3G6MA

Crystal structure of a chitinase crchi1 from the nematophagous fungus clonostachys rosea in complex with a potent inhibitor caffeine
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
388
structure length
388
Chain Sequence
TGSINAVYFTNWGIYGRNFQPADLQASKILHVLYSFMNLRVDGTVYSGDTYADLEKHYSDDSWNDIGTNAYGCVKQLYKLKKANRSLKIMLSIGGWTWSTNFPAAASTEATRATFAKTAVEFMKDWGFDGIDVDWEYPASETDANNMVLLLQRVRQELDSYSATYANGYHFQLSIAAPAGPSHYNVLKLAQLGSVLDNINLMAYDYAGSWDSVSGHQTNLYPSTSNPSSTPFSTKAAVDAYIAAGVPASKIILGMPIYGRAFVGTDGPGKPYSTIGEGSWESGIWDYKVLPKAGATVITDSAAGATYSYDSSSRTMISYDTPDMVRTKVSYAKGLGLGGSMFWEASADKTGSDSLIGTALSSMGSHDSTQNCLSYPNSKFDNIKNSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and mutagenesis analysis of chitinase CrChi1 from the nematophagous fungus Clonostachys rosea in complex with the inhibitor caffeine
pubmed doi rcsb
source organism Bionectria ochroleuca
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Chitinase
total genus 144
structure length 388
sequence length 388
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2009-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3g6mA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3g6mA01
4AZBA 3VGHA 1UR1A 1V3JA 3IAQA 4ACZB 3N17A 3IANA 2J8FA 5GNYA 2C8NA 1N82A 3WD4A 3VD5A 8CGTA 2VZOA 2VMFA 4PMZA 3UEQA 1C3FA 1G1YA 2X05A 3SCUA 2QPSA 3ARUA 2A3BA 3A6OA 5D9MA 1HP4A 2CBVA 4MDPA 3K46A 2WB5A 3T0BA 3U7BA 1W9BM 1UZ4A 1BAGA 3RM8A 3ZQ9A 1C8XA 3EDDA 3N15A 1UR8A 3CGTA 3GDBA 3GH7A 3VGEA 4NF7A 4L4PA 1R7OA 2YBUA 3K4AA 5A8NA 3GH5A 5A2BA 1WO2A 1VRXA 1VB9A 1CXFA 1W3KA 2C7FA 1WB0A 4UOZA 3VGBA 1CGVA 3ZJKA 1RD6A 1XD0A 4GZJA 3VIIA 1JZ5A 2EXOA 1J10A 3FW6A 4GQQA 5AY7A 3E1F1 2V3EA 5ABEA 4JFVA 4MJ2A 4QFUA 3NSXA 3ZMRA 3UESA 3AHVA 2J8GA 3W24A 1WAWA 5GPRA 1GW1A 2XVLA 3EMZA 3BMWA 5HBFA 3T08A 1DWHM 4L4OA 1UD4A 4CD8A 1HXJA 5DMYA 1NH6A 2WM0A 1LF1A 4AMCA 4CU8A 1G01A 3UCQA 4BS0A 2G4FA 1VAHA 2X0HA 4M24A 3NDYA 4FLOA 1H0IA 3MSDA 2QHAA 4JHZA 1TMQA 1V6WA 1NWUA 1UH4A 1HKJA 2X8RA 2DT1A 1BGAA 4MB5A 4A3HA 3I3DA 4ATLA 2YLLA 1BYAA 1GOOA 4PSPA 4W5UA 3GXFA 4PCTA 1GOKA 3S2CA 4NI3A 6CGTA 2DIEA 2WHLA 1EOKA 4CGTA 4AZ6A 1WKYA 3CZKA 4ATWA 1V6UA 1VFFA 4P7LA 2A3EA 4CVWA 3CUIA 1E71M 2CYGA 3VTRA 3VIHA 1R87A 2VZUA 3MU7A 2YBTA 1H5VA 3UETA 4JZ5A 4QDMA 4CVUA 1TA3B 1ZBWA 3PTQA 2WMGA 3M7SA 3PZMA 3WF3A 3AHZA 1W91A 3FXYA 4JFSA 2EEXA 4MB1A 5CZKA 4W84A 3VO0A 4U5KA 1V6XA 1K9TA 4AD3A 4GI6A 3GBDA 3K8MA 4AD0A 5ABFB 3HMCA 2PF0A 2XVPA 4B9YA 2E8ZA 2PBGA 3G6MA 4S3KA 1M01A 1MXDA 2PWFA 5CGTA 3AOFA 1JZ4A 3AHXA 2E9MA 2WC7A 2ZUUA 1I1WA 3SCQA 4LX4A 2DSZA 2GK1A 3SUUA 3VMPA 3SUVA 4HZ6A 4Q7NA 3WUEA 3QHNA 1H2JA 2VR5A 3BAWA 2XTKA 5I2UA 4AC1X 1EO7A 4WK9A 1EHAA 1AQMA 4HOXA 1GQLA 3BGAA 1J9YA 2ZX8A 1ZB5A 5JBDA 4W5ZA 2BV9A 5GNXA 2ZWZA 3VGDA 5A1AA 5JIWA 4FK9A 2YDSA 4J3WA 3ZT5A 4EAMA 3WQVA 4W86A 2ZXQA 1W32A 3L2LA 1CGXA 4JKLA 1YQ2A 3W4RA 1J18A 5ABFA 4AY1A 4PMYA 2OYMA 4BQ4A 1EGZA 5DFAA 4H2CA 1E56A 1W9VA 1R8LA 2ZX6A 3WH7A 1H09A 3L4TA 4GO9A 1JDDA 5KZ6A 4U3CA 1EO5A 2QMKA 3TA9A 3VNYA 1KXQA 3CUJA 4U2ZA 4DM2A 2XVGA 3AFBA 1ZBVA 4U5IA 1FA2A 5HDRA 2FH6A 1CENA 3L4ZA 5HXMA 1UQYA 4PTXA 1AVAA 1JYWA 3AZSA 1DWFM 1KXVA 3HN3A 3OLIA 3BLPX 1DP0A 4OKDA 4M29A 4PMNA 1ZJBA 3WL0A 3VM7A 3VDCA 1OD0A 1RP8A 4GI9A 1PJ9A 4HOZA 4XUYA 1ODZA 1UHVA 1NP0A 3EDFA 5C71A 3U5UA 5D4YA 5A8PA 2WMKA 2D20A 5D9PA 3ALGA 1PAMA 1VBRA 2ZXDA 1KBKA 3WDQA 1A3HA 4MJ4A 2FGLA 4D6FA 2VX6A 4FLRA 3VX1A 1W2PA 2XWEA 4AXNA 3QR3A 1KCLA 1QI4A 2WBKA 3QHMA 2WKGA 4UZUA 2GVYA 1JZ7A 2CERA 4WLCA 2J7BA 1TR1A 2XFRA 1WZKA 4M80A 5LA2A 3W37A 4MNLA 1LJYA 2VRKA 1WDSA 3THCA 1OGGA 4D6HA 3U57A 1NARA 3B8SA 1C8QA 3VIKA 4PYSA 1WZLA 1E5NA 1EOMA 1GPFA 1MVYA 2XWDA 1Q4NX 1FFRA 2VVNA 3K8LA 3BXWA 2E8YA 3WD3A 3WF1A 3O2LA 4CU7A 1KQYA 1C93A 1MW0A 2EPNA 4MB3A 3VU2A 4CD6A 1K9EA 4NSBA 4QLJA 1JZ2A 1VENA 3WL1A 1QW9A 2JF7A 1WDPA 3D5HA 4B15A 1VF8A 3FAWA 2UWFA 2XYLA 4UQCA 1E0VA 4QP0A 1PPIA 4DWSC 2TAAA 3F5KA 3VD4A 1UWUA 4PMXA 5BXTA 5FL1A 4AD4A 1OBAA 3DYMA 1TFVA 2YOCA 3VIMA 2PB1A 3K8KA 3SUWA 2ZUWA 1OIMA 4PRWA 1ZJAA 4U3AA 1GNXA 5HPCA 1HJUA 3QHOA 4GKLA 7A3HA 2GK1B 5D9OA 2VTFA 1DTUA 2VC9A 3SCWA 4XV0A 1GOIA 4D71A 4OOZA 3ECQA 1GUVA 2IXVA 1XH2A 3DC0A 5JH8A 4RL3A 4P8WA 1H4PA 5I3DA 4W93A 3WELA 3II1A 2UY4A 4KRUA 4BA0A 1JL8A 1K9DA 2NT1A 4AZ5A 4AIOA 3BAJA 4D6EA 2BY3A 3W25A 3AICA 4F8XA 1AQ0A 2ZUTA 4WKHA 1W3HA 4H8VA 3AS1A 2A3AA 4ACYA 2UY5A 3VINA 3ARXA 1E4LA 4GIAA 3O6AA 5E9AA 1UH2A 5E6YA 1HNYA 2ZE0A 1JAEA 2BXZA 3KEHA 1O6IA 1B3WA 4YPJA 1XH1A 3WENA 1CDGA 1E72M 3VD3A 1OSEA 3CUHA 3OLGA 4GINA 2CNCA 5DO8A 5CJ5A 2WNWA 1HN1A 3WD0A 1FHLA 3WQ6A 2PC8A 1LWHA 3W81A 2C0HA 4HA1A 3KWXA 4AD1A 4PEEA 4PSRA 1AQHA 3TTOA 5ECUA 4AYSA 1E4IA 1US3A 2XVKA 1CYGA 3ZM8A 2WHMA 2V5CA 1US2A 2CKSA 2FHBA 1CLVA 1E3ZA 2J78A 1S46A 2CITA 2WSPA 5I77A 1FH9A 3MANA 2GJPA 1UD6A 3M46A 5IFPA 3IAPA 1UUQA 2XGBA 1QVBA 4LGXA 5FCZA 1E4MM 5IFTA 5IHSA 2BY0A 3WDJA 3EMQA 3AMGA 2CHNA 2BHUA 4A3YA 5BWFA 2YIHA 3WEMA 1XC6A 3EYPA 4A4AA 2W62A 2PBOA 2G8ZA 2EBNA 1XCWA 4ZXLA 3WH5A 1PZ2A 3WFZA 4D6IA 1IV8A 1FHDA 2FDMA 3AMDA 3GXIA 3WMCA 3VUPA 4AD2A 2BVDA 2G3JA 3A3HA 3AMCA 3SCNA 3M6DA 2OYKA 1WZAA 4M8UA 1JD7A 3W29A 1CGWA 3BMVA 2DT2A 4WJXA 1UD3A 3AIWA 2QLYA 3L4WA 3NJ3A 1XSJA 5IXEA 1W9DM 4D1IA 2XJ7A 1NQ6A 3OZPA 2AAAA 5AC5A 1GOMA 1V3LA 2Z1KA 3LPPA 3BAXA 4PN2A 3M07A 5HOSA 3AYSA 1BYCA 1QNQA 5EFDA 5GQBA 1QI3A 5CGMA 1JNDA 2J7GA 1OCQA 4N42A 1TCMA 3IJ9A 3GNPA 1HL8A 4CU6A 1E6PA 1HJQA 4TVUA 3BSHA 4AISA 4W7VA 4HA4A 4FLSA 2WVUA 1UKSA 1CTNA 5E0CA 3HU7A 1QNOA 1JI2A 1L8NA 5A3HA 3TOPA 1F4HA 3W27A 3SCVA 1HKIA 4BQ2A 3AMLA 4PMVA 2VQUA 4DWSA 4WIWA 3GNRA 3T0DA 4HZ8A 3MV11 3WEZA 4U31A 5CLWA 6TAAA 1QW8A 3N9KA 4H41A 1UR4A 1QHZA 1XYZA 4P8VA 1ZBKA 3ARRA 4K68A 1C7TA 3D3AA 4JKMA 1WNOA 1RP9A 1V6VA 2VL4A 4PMDA 3EDJA 4AZGA 2ZOXA 2VURA 4KWUA 1V0MA 5FIPA 1VJZA 5E0FA 3AZTA 2FHCA 5LA1A 1XRVA 1VFUA 2D1ZA 5F7UA 1QI2A 3PZIA 3WQWA 5A2AA 4ACZA 1B3YA 2WLZA 2GJXB 5JUVA 2CXGA 4J3TA 4MADA 4MDOA 3CMJA 1KGWA 4AZCB 1UKQA 4C7FA 4E2OA 3OB8A 4E4PA 1JXKA 3NCOA 4M56A 2UY3A 3GBEA 3ARQA 2XM1A 3NDZA 4UFHA 3F5LA 3WNLA 3PZTA 4DUWA 4ZXOA 4MNKA 3MKKA 3CBWA 2ZUMA 1UKTA 2WZIA 3B9AA 1MFVA 1LG2A 4LXFA 2CIPA 5AC4A 2UY2A 2Y4SA 2ZIDA 1EHNA 5A6BD 4CCCA 3WD2A 1M7XA 2Y8VA 5D8WA 5BRQA 1UZ1A 3VGGA 4UFMA 2J62A 4W7UA 2WHJA 5BXRA 4JFUA 1LLOA 2V3DA 1G0CA 1PX3A 3I3BA 4IUGA 3VPLA 1W3JA 2OSWA 2PWGA 4PUDA 1KQZA 2XGIA 3MUY1 3WF0A 1UD5A 5A69A 1UOKA 1R86A 3SCOA 4JKKA 4W7WA 1GORA 1HJWA 1B1YA 2YL8A 3CPUA 3KZSA 1W1VA 4OIFA 1OINA 4TX6A 2YLAA 3W6MA 1JZ6A 4FMVA 1QPKA 2V3FA 3ARYA 3CIVA 2WXDM 3SUSA 1WDRA 4MAZA 3BCDA 3VDAA 3PZNA 2WZHA 3A4XA 1CXHA 2J79A 3L4YA 1MWOA 1BFNA 3ZJ6A 1VJSA 1KGXA 4W87A 1B90A 4URIA 2DH3A 1UKPA 4LYQA 1UH3A 2W4XA 3EDKA 3MSGA 4E8CA 1CXIA 1ITCA 5CSUA 3WEOA 4JCMA 2CBIA 1J01A 4AZCA 1J0IA 1I1XA 1MQRA 3THDA 3TP4A 1QBBA 2PWHA 3W0KA 1MFUA 4WKFA 1HL9A 3WH9A 4UFIA 4WSKA 1EQCA 4B3LA 2A3CA 4QCEA 4GZIA 1E3XA 3MMWA 2BS9A 1V6YA 3N04A 4Z2LA 1VEOA 2WMHA 1V03A 3UG5A 1XH0A 1E6NA 1ECEA 1GVYA 4GO8A 2J7DA 1KWKA 3B9DA 1V0KA 2GUYA 4EE9A 4P7OA 4Q22A 1UWIA 4W89A 1V08A 1P6WA 2DEPA 4ZE5A 4C7DA 1GJUA 5JBEA 3OBAA 3WF4A 3T09A 3UR7A 3AXHA 4HOWA 2OSXA 1NOUA 2PWDA 4GZEA 3NIYA 4UR9A 4XZBA 1C90A 2J7HA 1EH9A 1PIGA 4ZFMA 2ZX7A 4BF7A 1AMYA 5C70A 5ABHA 1UD8A 3UERA 2DSVA 4Z2IA 3MUIA 4NZCA 3AIBA 1CWYA 2VX4A 4GXPA 1U30A 1G94A 4M82A 4MB4A 2F61A 2XFYA 3PHAA 3WQ4A 4J7RA 1B9ZA 1E1FA 2GJRA 4N0RA 3WSUA 1EQPA 1JG9A 1OWQA 5HNNA 4HPHA 5EB8A 1UWTA 3L4UA 2WW5A 1DWJM 4HTYA 4B9ZA 1H3GA 1KGUA 1MW1A 2ZWYA 3WNKA 2XPKA 2D3LA 3VD7A 3AISA 3FHQA 2GDVA 3PTMA 3BLKA 1ISVA 3ARPA 2WCAA 3AHTA 4D6JA 4CKQA 5D9NA 3ZR5A 5JBFA 2Y24A 3CH9A 4AIEA 4JIEA 3NSNA 4DUXA 2F2HA 2OYLA 1W3LA 4MAVA 1QI5A 4IPNB 1E6XM 3N13A 4KH2A 2DSKA 1OD8A 3ARSA 2DIJA 1B3VA 7CGTA 3ZT6A 1C7SA 1SR0A 5EBAA 1JZ8A 1GQJA 1TVNA 4EANA 1B0IA 1E55A 5A94A 3AJ7A 1X6LA 4PTMA 2XSBA 5BXPA 1HIZA 2JIWA 1W1TA 1JF5A 2WMIB 4ATDA 1ISXA 4P8UA 4CN4A 1TE1A 4HMDA 3CMGA 3WUBA 1BYDA 2ZUNA 2BVTA 3AIUA 2X1IA 4HP5A 3AI0A 1PX8A 2CETA 3WY1A 3CTTA 5CXPA 3BH4A 3FAXA 3OLEA 5A8OA 4RE2A 3VIGA 1C8YA 4MNMA 2XFFA 4BZYA 4PBGA 4LYRA 4OBSA 3BC9A 3PZ9A 2DPEA 1MQQA 2V38A 2OLHA 3VKKA 1H41A 4ML4A 3WQ5A 2A3HA 1IT0A 3DYPA 1WDQA 5DF0A 1W1YA 4LPCA 1SFSA 2Q8XA 2OWWA 1Q6GA 3BAYA 1FH8A 4XZWA 3CHCA 1UA3A 2EJ1A 4NRSA 3AS2A 1E6QM 3W53A 1CEOA 1J0ZA 2J7FA 4JCLA 2WMIA 5I6SA 4X0VA 5A8QA 2EPOA 2YA0A 3A47A 2D0GA 1W9XA 3RCNA 5CPTA 1TG7A 4HA3A 2VJXA 1JXJA 2G3MA 5C8BB 5EFFA 5DT5A 1W9UA 2D23A 5I23A 3ARWA 4GQRA 1WPCA 1G5AA 1CZ1A 4Z2HA 5JIPA 1M53A 9CGTA 4GI8A 3AXIA 2VT0A 3SURA 1SYTA 3BSGA 5BXSA 3DHPA 4LQ1A 2W66A 2O9RA 2VO5A 3WDPP 4TUFA 3OG2A 3VIFA 4AEEA 5I79A 2VR4A 1KR0A 4UFKA 1JD9A 3MMDA 1HJSA 1XYFA 3QGVA 1KBBA 1K6AA 4UQAA 4OZOA 1UA7A 3ZSSA 1VIWA 3CUFA 1PBGA 3GZAA 3OZOA 3I3EA 2WWDA 3VIPA 4TXEA 1WP6A 3UG4A 1F4AA 4D72A 2WAGA 3BCFA 3ZR6A 3DECA 1OT2A 2ZX5A 1CGTA 3NUKA 4BQ3A 3AHYA 1BPLB 2JF6A 1GHSA 1JNEA 1L0PA 4AWEA 1SMDA 3EMCA 5IDIA 1J12A 1HX0A 4CN1A 3IJ8A 4PCSA 2CBUA 3IK2A 3PZQA 2ZUSA 5TD4A 2CCRA 1EDGA 1V02E 1NWRA 4MNJA 1E6SM 1JI1A 1I75A 4DM1A 2E4TA 3ALFA 3CO4A 4DWSD 5I24A 1XGZA 1Y7VA 4JFTA 1W2VA 5CPSA 4TVDA 1MXGA 1JYXA 1JFHA 4MTVA 3W6LA 1ZL1A 2YL5A 4UNIA 1CNVA 4HU0A 2D22A 3F4VA 3L2MA 1DWGM 1GZJA 4MPKA 4Z2KA 3NYDA 3AQUA 3CLWA 3WUGA 3RPMA 4W8AA 3WFLA 3WF2A 1Z32X 4V28A 1UWSA 1ESWA 2FGZA 4H8UA 4AEFA 5M5DA 1X6NA 2YL6A 1UYQA 4V27A 3POCA 2DT3A 2F8QA 4OUEA 1M03A 1VBUA 3A4WA 2X09A 2WBGA 1LL7A 1CXEA 1BLIA 1UKOA 2VI0A 2VCCA 3ZSTA 1KFWA 4WKAA 1H0GA 3APGA 4CCDA 2QPUA 4B16A 3RDKA 3WBEA 4CCEA 2BHYA 4AW7A 1HF6A 2CESA 2VCBA 2YDRA 4J3SA 4R5EA 4W88A 4CD4A 3GNOA 1Q6DA 5ABGA 4UFJA 2W61A 3AIEA 1OM0A 4WSJA 1OGBA 1BTCA 4HPGA 1UG6A 2W67A 3UG3A 4AZIA 2E3ZA 4XX6A 4UCFA 4NRRA 5HPOA 5EMYA 2EPMX 4JHOA 1PEZA 2QMJA 5BROA 3EBVA 2JEPA 2W5FA 3QOKA 2WMFA 5A6AA 3VVGA 2Z1SA 3WDIA 4HMCA 1QNRA 5M3WA 4PTVA 2VRJA 1H11A 1PIFA 5DT7A 2E9BA 1TVPA 4W85A 2WC3A 4U2YA 1JYVA 1UR2A 1LWJA 4V2XA 1V3KA 1CXKA 3VIJA 1Q6FA 2JFEX 2DDXA 4FLQA 3BAIA 4AZ7A 5E09A 4YN5A 1RPKA 1BYBA 4YHEA 2J7CA 4WF7A 1BSIA 2OWXA 1JFXA 1CBGA 1UQZA 2V5DA 3SCTA 1EIBA 2BFGA 4M81A 4TVCA 1XHGA 3KE0A 1CGUA 1BVNP 1EDQA 3GYCA 2WZEA 3LPOA 1E9LA 4S3JA 1MQPA 5E6ZA 2JALA 1KXTA 3N18A 4J3XA 3VMOA 2V3GA 2ZXBA 3GXDA 2WCGA 3GTNA 5M17A 3MS8A 4PMOA 3OGSA 4UQBA 1QHOA 3SCSA 2GFTA 2O92A 4J3VA 1XD1A 5CG0A 1VEMA 2ZICA 1B3ZA 2VZTA 3SCRA 4ZE4A 5FL0A 4PMRA 1MYRA 2D3NA 1FOBA 3VMNA 1GONA 2J77A 3AS3A 6A3HA 2FHFA 2D2OA 4H8HA 1J0YA 1QNPA 4RE3A 1U2YA 2XVNA 1XSKA 2DSWA 5LA0A 1E0WA 1QNSA 1E5JA 2Y2WA 2CPUA 4DUVA 3OGVA 2YA1A 1OIFA 1FH7A 3WMBA 1E70M 4PMUA 2VCAA 1V3HA 2AMGA 2XM2A 4RE4A 2J47A 3WH6A 1UD2A 2E0PA 3ARZA 3FNDA 1GJWA 1DHKA 4TX8A 2DT0A 1JIBA 2VOTA 1EA9C 3WH8A 2WMJA 1GHRA 2J75A 3ZIZA 3N12A 4J27A 4EKJA 3CHFA 2AOSA 2E9LA 2WHKA 8A3HA 3KL3A 2VX7A 3ARVA 4HZ7A 2ZXAA 3ZJ8A 4IISA 1V3MA 4TOQA 1QHPA 5A6SA 5DEZA 5I5RA 1E0XA 2IUZA 2BHZA 4DWSB 4KRTA 3POHA 5FOOA 2VX5A 2G41A 1LL6A 1BG4A 4EK7A 3TTQA 1WZMA 3DYOA 1UWRA 3O9NA 2JIEA 3WIJA 3VIOA 2VNCA 1GVIA 4C7GA 3GM8A 5FD0A 3PZOA 1ODUA 1DEDA 4XB3A 1ZU8A 1ISWA 2WLYA 3T2PA 7TAAA 3GH4A 5A95A 1LQ0A 1B2YA 1UR0A 1BHGA 1X1NA 1YHTA 4HU8A 2YKKA 3VNZA 2CKRA 4JFWA 5D8ZA 4Z2GA 3ZO9A 3L4VA 5CLTA 1WCGA 3CHEA 2BNJA 1OT1A 3IJ7A 5AYIA 4P7QA 1E4NA 3MUAA 1KR1A 2WANA 2EO7A 3N1AA 3W82A 3WDHA 3CHDA 3WQ8A 1OGSA 1VFOA 1BVZA 1GOWA 2W63A 5KEZA 2D0HA 2WSKA 1TUXA 3N11A 4UQEA 4PUEA 4D1JA 3WD1A 4X9YA 2WVVB 4F9DA 5A6BA 2QF8A 1LG1A 4X0NA 3AZRA 4P7RA 2VRQA 3CUGA 3PBGA 3T2OA 3ZJ7A 4D6DA 3DHUA 3PZVA 1VEPA 3KL0A 4ZEPA 2WCSA 3K1DA 3MO4A 1V0LA 1XV8A 2DQXA 3CZEA 2G3IA 2O9OA 1MW2A 1CPUA 1OB0A 1E6ZA 1R85A 1CXLA 3AS0A 2ZX9A 2HISA 3KL5A 4QLKA 5E70A 3WDRA 2FH8A 1VFMA 4AIUA 3GXMA 1IZKA 2BVYA 4J28A 3SUTA 3VGFA 2WVSA 3T2QA 5A8MA 3LMYA 2Y8KA 2RGMA 5IHRA 4U33A 4AD5A 2CBJA 3WNOA 2WYSA 2Y5EA 4W8LA 3SCPA 2O9TA 3WMSA 2PI6A 5BRPA 3VDHA 4UQ9A 3OIHA 3AROA 1U33A 2ZUVA 4JL2A 3ARTA 4FF5A 3RMEA 3W28A 3JUGA 3PZGA 1KWGA 3SEPA 1JYNA 3CZJA 1E40A 2MANA 3BAKA 2GDUA 1H49A 3L4XA 1IZJA 1HVXA 3T0AA 1ISZA 2E40A 3MV01 3VD9A 2OSYA 2VQTA 3CZLA 1KXHA 4UQDA 1ITXA 3OGRA 1W1PA 3S6TA 5A6KA 3VDBA 1J0HA 3ZT7A 2NT0A 5CSYA 1ZBCA 4KGJA 3RO8A 3WNPA 4CN6A 1QBAA 2D24A 3LPFA 3VOCA 2YA2A 3VM5A 2CEQA 1J0JA 1HKKA 4QLLA 1FP8A 4F9JA 4Z2JA 3UR8A 3SIMA 3AIQA 4OJYA 4R27A 1JF6A 2WVTA 4KGLA 1KB3A 3TONA 4BQ5A 1B30A 1BGGA 2BXYA 1GQKA 5FKYA 3OLDA 3F5JA 1C92A 1W9PA 4OOUA 3WKZA 1ISYA 3PZUA 2XHYA 4JL1A 1WE5A 1FFQA 3J7HA 5I78A 5I0DA 1K9FA 2G3NA 1PZ3A 3FHAA 3A4AA 1BQCA 4F79A 3RM9A 4BCEA 1E15A 1Q6CA 3MUZ1 1D2KA 1BG9A 3HJEA 3K4DA 1E1EA 1MW3A 5A6JA 3U5YA 5A6MA 2XUCA 3NSMA 3TTSA 2WC4A 1KCKA 4AZHA 5M03A 4IM4A 1CECA 1QOXA 3VILA 1NM9A 1D7FA 1B3XA 5A6LA 1JGIA 1GQIA 1GCYA 1JDCA 4YHGA 5BCAA 2J25A 1HJXA 2PWEA 2W92A 1BF2A 3CZGA 4LYPA 3WBAA 4F66A 1JDAA 2XG9A 5A2CA 1CGYA 1B31A 3RILA 2DGAA 1UR9A 3W26A 1O7AA 1C91A 2WVVA 5CQ1A 1EXPA 2RGLA 4P8XA 4H7VA 1D3CA 1SMAA 2EQDA 2W91A 4JAWA 2DH2A 3B9EA 5BYWA 1J11A 4PMQA 1LL4A 1UWQA 1Q6EA 2D0FA 2VVSA 4H04A 4IPLA 3RJYA 1DWIM 1QI0A 4UTFA 2HVMA 2YJQA 2X0YA 3AMKA 3FY1A 1NP2A 2XIIA 3VX0A 3WNNA 4QCFA 2OWCA 4TTGA 3CZ8A 1PX4A 4QAWA 1G9HA 3WUFA 4Y7EA 3AYRA 3FN9A 4CUCA 4P7NA 2B31A 1E73M 2WK2A 2J74A 4B3KA 1V0NA 3MMUA 1HT6A 3U7VA 1V02A 2QV4A 4D6GA 3TTYA 1RH9A 3LPGA 1NOFA 3AIVA 1H1NA 2GSJA 1FP9A 3W38A 4UFLA 2ESCA 4E8DA 2XSAA 1R7AA 1V3IA 4UZSA 3WN6A 3EDEA 5GNZA 1A47A 2J7EA 4J3UA 1ZS2A 1GOQA 4KMQA 4OBRA 4CD5A 1CIUA 1HVQA 3RJXA 1E43A 2YDQA 1HP5A 2X2YA 2EPLX 1JZ3A 4D6CA 1DWAM 3WNMA 1J0KA 5CPQA 3RM4A 2VUYA 3AXXA 2DSUA 2YL9A 2GJXA 3PN8A 3QOMA 2IXUA 3OA5A 2BY1A 2WWCA 2J4GA 3PTKA 3AIRA 1NWTA 2XIBA 1HJVA 1E6RA 4M1RA 1EDTA 3G6LA 2JE8A 2O9PA 1TA3A 4HMEA 4UOQA 3ZOAA 1JAKA 1M04A 4UOJA 1CLXA 3RIKA 1HKMA 2VZVA 2NW0A 4ZENA 2BY2A 1TZ7A 4GPNA 5LYRA 5AYBA 1NOWA 4W8BA 1XCXA 2WKLA 4PTWA 2VZSA 4CD7A 1XSIA 2WPGA 2JEQA 2CHOA 2EPKX 4TTUA 2NSXA 1NWSA
chains in the Genus database with same CATH superfamily
3VGHA 4IF2A 4I8YA 2ETNA 3N17A 3MUXA 5GNYA 2RDTA 4IQEA 2C8NA 1GVQA 2EG8A 3VD5A 3B03A 2VMFA 2ACQA 3UEQA 2MLZA 4HPJA 1G1YA 4ROQA 4DPQA 3PPCA 5D9MA 1HP4A 5AC6A 1XIBA 1AK5A 1FTXA 5DMNA 3U7BA 2G4JA 1VZWA 3ZQ9A 3NPXA 3O5DA 4JEQA 1OEPA 1ONRA 2Z2BA 4J4OA 3VGEA 1A3WA 1R7OA 3K4AA 3IUHA 2FAPA 1WO2A 1TJ0A 3LCFA 1W3KA 2C7FA 1WB0A 3GIPA 4FS9A 1CGVA 2ZDRA 3NDOA 3SQLA 2VP8A 4GFIA 5FAJA 3M0MA 1XD0A 3VIIA 4YTTA 1JZ5A 4DYEA 2EXOA 3M1ZA 4GQQA 4XD5A 1Y8BA 3E1F1 5ABEA 1TYGA 4JFVA 4QG9A 1UIPA 4QFUA 2ZRXA 3ZMRA 3S0CA 1WQ5A 4US6A 4XKYA 3TAOA 2R94A 4DRQA 3HG4A 5GPRA 2W0UA 5CH9A 5HBFA 5FI8A 4CD8A 1YADA 1HXJA 3VC6A 2VXNA 2WM0A 1LF1A 5FF3A 4AMCA 2ZZ7A 2GQAA 1UWAA 1JCTA 3NVDA 3L67A 3S6DA 4LVGA 3TNOA 4HNUA 4OUIA 3EKZA 4GX8A 3MSDA 2J13A 1AZ2A 1BL4A 3THAA 3JU2A 2X8RA 1SZNA 4GZ7A 3F4CA 4ODLA 1NSJA 2DT1A 4KCVA 1SO4A 4MB5A 3USZA 4A3HA 4ATLA 4E38A 1GOOA 4LUTA 4PSPA 1JQXA 3HPXA 1EX5A 2BODX 4UB9A 5G2HA 3VCRA 6CGTA 2WHLA 3DERA 3SGGA 5C7HA 4NAFA 1WKYA 5K2ZA 3PP7A 4IQCA 1D8CA 1VFFA 2V69A 4LAXA 1EJUC 1RSCA 3L2IA 2V9DA 4O11A 1Q66A 3E74A 2FZ8A 3H4GA 1S5WA 1M1BA 2RH9A 3DHFA 5C2CA 4YVVA 1H5VA 4MPQA 4X60A 2WMGA 2X1UA 3C86A 3QKEA 1R3TA 4S3EA 2EEXA 2OGJA 2REQB 1T11A 5DIVA 2CLMA 4ZGYA 4W84A 1SZRA 4U5KA 3LSCA 1K9TA 1GG0A 3IUDA 3HOJA 4LYKA 9RUBA 3DG6A 3H4XA 1ITQA 5ABFB 4LH8A 2QYGA 3OQ8A 3VOIA 2Y5SA 2PWFA 2VOMA 1F3EA 4EWND 5CGTA 2PD5A 3KLKA 2E9MA 3USBA 1IR1A 3LENA 1CW2A 3SUVA 3WUEA 1V79A 4JQAA 2WO5A 1V77A 1VFTA 3BICA 2FFIA 2OMAA 1ADSA 1WV2A 4HOXA 2NZLA 4EXAA 5G5IA 4O17A 4KQNA 2GQ3A 1TIWA 3VKAA 5JBDA 1TE6A 2ACSA 3CWHA 3I7QA 4XZNX 3VOFA 3KHDA 3ZT5A 4GVIA 4ZQRA 3WQVA 4W86A 5C2GA 3W7PA 1LQ2A 4OU1A 1CGXA 5B7ZA 5C9ZA 1YQ2A 3LBOA 4Y9OA 1UJPA 3W4RA 1J18A 1XR2A 1FKDA 3Q94A 1IXPA 2R6OA 4H2CA 1A5KC 1EJWC 2FTPA 3L65A 4UTKA 5BOEA 5D05A 3F7JA 2PUZA 1TIMA 4GO9A 1QXLA 4HN8A 4DO5A 3VCNA 3VNYA 4U2ZA 4DM2A 2XVGA 3M43A 1F9CA 3C5QA 4IMFA 1ZBVA 2XZ7A 3GS6A 2KE0A 4MG4A 1PBKA 1FWRA 1UQYA 3AZSA 1DWFM 4AHOA 2Z28A 4QE4A 3WG6A 4AEOA 4B91A 1KXVA 3HN3A 3LA4A 3BLPX 3N6HA 1KCZA 3E3HA 2CHRA 3WL0A 3VM7A 3VDCA 4C6MA 1RP8A 4B5VA 3S1WA 5T9CE 1RXOB 5TF0A 3VZYA 4OGZA 3W76A 1J93A 5HJLA 2XP3A 5C7VA 5KMYA 1QW7A 1DIOA 1BKFA 3ALGA 4LCQA 2ZXDA 3IKDA 3WDQA 3WQOA 1TVLA 1A3HA 1VCGA 2GWNA 4Y96A 4C6PA 1QR7A 3LHZA 4QSFA 2VX6A 5HUOA 3VX1A 1W2PA 2WSYA 2PLKA 2H3BA 3G77A 1QI4A 2WBKA 3QHMA 5J6EA 1JZ7A 2J7BA 4JFIA 4H9YA 4WDUA 4H6EA 4M80A 3WK3A 3N3TA 1SJDA 2Z7GA 1FDYA 4D6HA 3P7YA 1FKKA 3CV2A 3MI6A 1W5MA 2PRHA 3KS6A 1C8QA 3H7RA 1EC7A 2CLLA 1GPFA 2XWDA 2PZ0A 1FFRA 2VVNA 2XDFA 4N6FA 3WF1A 3PRDA 4CU7A 2EPNA 3P82A 4QLJA 1VENA 2JGQA 3G3MA 3WL1A 1QW9A 4L6HA 2JF7A 1WDPA 4K7VA 3D5HA 1AD1A 3EA1A 3GNXA 1FCVA 1JRBA 2IKIA 3I6EA 5C9UA 3UQBA 4MIMA 2I16A 2VD8A 3SGUA 3CK5A 4PTDA 2NWRA 1K7EA 4PMXA 1JDEA 2Q3RA 5FL1A 4NAEA 4QEHA 4AD4A 1OBAA 4HN4A 2R24A 1A0DA 3K8KA 1EXBA 2QJIA 4PRWA 1ZJHA 2GGJA 1GNXA 5HPCA 7A3HA 5CJNA 3BCJA 5D9OA 3B7XA 1DTUA 1PVNA 3EKGA 4XV0A 3ECQA 1G7UA 2PWUA 4FA3A 1H4PA 2A85A 4W93A 1M9HA 5EMLA 4BA0A 1JL8A 2NT1A 4D6EA 4F8XA 1AQ0A 3GUWA 2A1YA 3PJWA 3MVIA 4H8VA 4JTDA 4AB4A 4ACYA 2I17A 1ZTVA 2G50A 4GIAA 3G1RA 4AVOA 3KEHA 3A21A 3F1QA 3HPZA 4YPJA 3WENA 1MEIA 3CUHA 1XIMA 2CNCA 3OZYA 5HW6A 3AUJA 2RDUA 3EOUA 5CAKA 3P8IA 4MZYA 3PF3A 3W81A 5AHEA 4HA1A 1IEVA 1SGJA 2P76A 3B0YA 4O0QA 5ECUA 3TTOA 4AYSA 2Z0IA 4TW7A 4UMAA 2XVKA 2WHMA 1GOXA 4GH3A 1US2A 2CKSA 3HIJA 4LY4A 4F0RA 2J78A 3U0HA 4YTUA 2D2JA 1L6SA 1S46A 5F1UA 5HJYA 1FH9A 3S6OA 5MKGB 3NQMA 3MANA 4PMJA 4U84A 1OX4A 3QR1A 3EWZA 1LCOA 5IFTA 5IHSA 2Y89A 1Q2SA 2OJPA 4LC8A 4LJ3A 3AMGA 4RNFA 2P50A 1XC6A 5HULA 4A4AA 2CC0A 3FIGA 3LCIA 3S3GA 2GVEA 2O4MA 3AC0A 1M5YA 2C16A 4XBJA 3ABQA 1OFOA 1R9ZA 4D6IA 1B4KA 1IV8A 4O1FA 1DHPA 1E51A 2H8ZA 3B06A 5AYZA 3A3HA 2DG3A 1OYBA 2Z1XA 1I45A 4A8RA 3AMCA 3PJTA 2Y61A 4O1EA 1ZLPA 2PBCA 3VOHA 2F84A 1W3NA 4MY8A 1TCOC 1CGWA 4G2DA 2DT2A 3W1MA 5HT1A 3NJ3A 1OF8A 5IXEA 3TW7A 1W9DM 2XJ7A 3QPZA 2Y6ZA 3AYSA 3RFAA 5GQBA 1QI3A 1EEXA 3BE7A 3KW3A 1TCMA 1HGYA 1QWKA 3MB9A 1HL8A 3ISIX 3BV7A 3T0TA 1AQFA 5DBUA 3VE9A 2IKHA 4W7VA 2E1DA 3TIMA 1UKSA 1CTNA 4HJFA 1JI2A 1Z3NA 3TOPA 3B9NA 3W27A 4H6QA 4HB7A 4ZQPA 3AMLA 1UBPC 5EYWA 3H4WA 3O0KA 1ADOA 3W88A 1I0DA 3TX9A 4HZ8A 1RK6A 3W1PA 4KKXA 5I3JA 3KOYA 4FSAA 3V4BA 3WEZA 4U31A 1CX9A 3RX3A 1FWHC 3N9KA 3W7NA 1M6JA 4DI8A 4A3RA 2O7SA 4ML9A 2FZDA 3PBMA 4JKMA 3NQEA 1RP9A 1V6VA 1BRLA 4AZGA 3KACA 2XIMA 1XPYA 5E0FA 5I09A 1VC4A 4DNMA 1VIZA 4DRSA 4ZR8A 4LS2A 3IJDA 3NQVA 3W85A 4MADA 4ZFCA 2PCEA 1Z8AA 1KGWA 4AZCB 3I6TA 3PFRA 3WK0A 1A0EA 1AH3A 1YW5A 3NCOA 4PUMA 4M56A 1WOBA 3IWPA 2Z4GA 1TZZA 4C6EA 3GY1A 2Z2AA 4DUWA 2DIKA 4ZXOA 2BZNA 3M0IA 5REQB 4RJEA 1FKSA 4GVHA 1UKTA 2WZIA 1VR6A 5HUAA 1UBSA 5AC4A 5KZMA 2Y4SA 2ZIDA 1EHNA 1PKNA 4CCCA 2Y8VA 4C65A 4UFMA 3KRSA 2WHJA 1Q6QA 3SRFA 1ZFJA 3PULA 3S5YA 3NWRA 4JFUA 1PX3A 1SZEA 1W3JA 1AUSL 4JYFA 4ADUA 4NASA 5FF4A 2VFHA 3MUY1 1T0OA 1QJWA 3CAVA 3WF0A 1UP3A 5A69A 4KWWA 1R86A 4GYFA 1ONXA 2FTYA 1HJWA 3KZSA 1W1VA 4GKTA 4OIFA 1FWDC 3UNTA 3GO2A 3W6MA 2P5NA 4RW5A 4GGHA 4JYDA 3ARYA 2WXDM 4AY7A 3LG3A 1U5JA 2Q8LA 4AU0A 3BOXA 4EF8A 3B4YA 2VFDA 4US5A 3LLDA 3P14A 1MEHA 3SW6A 1VJSA 4UR8A 3H26A 3HZ3A 4XKYB 4URIA 5DCBA 1YPXA 2DH3A 3RNDA 2VN1A 2W4XA 1Y5VA 1CXIA 3DFOA 1ITCA 4QSHA 2H6RA 2ONEA 1QPLA 1GEQA 4AZCA 3VKCA 4DBUA 3V75A 2PD9A 2PWHA 3W0KA 4WKFA 3WH9A 4NYUA 1DTNA 1XLGA 3LZ3A 2CU0A 3DAQA 4GZIA 1E3XA 4HHMA 4HA0A 4Z0SA 4Z2LA 1VEOA 4N4PA 3NM3A 3WQGA 1ME7A 1ECEA 3IS4A 4K36A 4FOJA 1GVYA 4Q4RA 5B7YA 5DY2A 4B4HA 1KWKA 1AW1A 5KITA 4EE9A 2FZ9A 3UI4A 4Q22A 2OCZA 1EGMA 1P6WA 3AAMA 4ZE5A 3W7LA 4PB5A 4QT3A 2BMBA 2GSEA 1X38A 2TRSA 2OSXA 3C2FA 3TSDA 3LI0A 1NOUA 2F21A 2PWDA 4KWVA 4PUNA 1TQJA 1C90A 4HNVA 4ZFMA 4ZQOA 5FJJA 5ABHA 2HCVA 3VZZA 1Q13A 4Z2IA 4GXWA 3TLQA 4NZCA 3KVKA 4NT0A 4MJMA 4GXPA 2XFYA 3WQ4A 1JR1A 3N2TA 4N2YA 1B9ZA 1PTAA 1IX5A 4N0RA 1XLMA 4A21A 3PWAA 3LEPA 3GVVA 3LGDA 4QDPA 1KGUA 1MW1A 1GYLA 4L5ZA 4QNWA 1TWZA 2D3LA 1FKJA 4C5ZA 3BLKA 4GG9A 3ARPA 1LORA 3ZR5A 5JBFA 2QUUA 2Y24A 3CH9A 1TREA 3NA8A 2RFGA 1EWEA 1XISA 1OD8A 2Q5AA 3WK1A 1B3VA 1H63A 3QPEA 2ITKA 1Q45A 3ZT6A 2E6AA 1LBMA 3NZRA 1GQJA 2F23A 3MI2A 1XBVA 4XAPA 3C8FA 3B8VA 1B0IA 1E55A 4PTMA 5C55A 2XSBA 1UPPA 1ISXA 4LOCA 3WJZA 2J6VA 3MSRA 4P8UA 1W5OA 5HINA 2ZUNA 4IICA 4O16A 3M16A 5HTGA 5DIUA 3AI0A 4GXMA 1DVJA 4C6QA 1LUCA 3KLLA 4F4RA 3BH4A 3KDOA 3OLEA 1R6WA 3P61A 4PBGA 5CZTA 4LYRA 3BC9A 1UJQA 3JYMA 2QDEA 3G22A 3GSMA 2DPEA 3GTFA 3MDUA 2A3HA 4L9XA 1LT7A 1FKFA 2V30A 1W1YA 4LPCA 4KEZA 2INZA 2Q8XA 1Q6GA 3BAYA 1P7TB 2JZVA 3EIPA 3N4AA 4IIGA 4NRSA 3AS2A 4UR7A 1SQ7A 1CB7B 3O15A 3ITGA 2J7FA 3T0CA 2IKGA 3A47A 1JVNA 1PL9A 1X7FA 3RCNA 1V6TA 1TG7A 1XQKA 5DT5A 1W9UA 4Y6GA 2UZ5A 2AGTA 2NV2A 1WPCA 1CZ1A 1KTBA 2PA6A 1EF3A 2XH2A 3AXIA 3EPNA 3PBUA 2A3LA 1SYTA 3SFKA 3DHPA 3CM4A 4PFMA 1BXCA 3TEVA 2PWVA 4YCOA 4NNCA 1SO3A 1JD9A 2P88A 1XYFA 4GNJA 2XN2A 4U10A 3RX2A 3W7KA 1O5QA 4KWSA 3ZFHA 1PBGA 2OZ0A 1R46A 3IVSA 1YDOA 2DJLA 3EEGA 2WWDA 1PYMA 3KTCA 4LSBA 4D9PA 1XBZA 3UG4A 3S1UA 3LGGA 1HUVA 3LHWA 1REQA 4D72A 5J8LA 3BCFA 2KAUC 3ZR6A 4Z0JA 2XP9A 4U28A 3STCA 1F3XA 4BQ3A 2GJLA 2PEVA 1D9EA 1RZMA 3SQSA 3HURA 3CWOX 5IDIA 1J12A 1HX0A 4CN1A 5J04A 2OKOA 5I3FA 4PCSA 2NQHA 2ZUSA 2V8ZA 2JK2A 1R3WA 1V02E 1JULA 3CQHA 2QCEA 1E6SM 1JI1A 1XF0A 2QAFA 4Y9AA 4GGQA 5EMMA 1A5NC 5GVJA 1BXNA 1Y7VA 3L66A 2PU1A 5AYYA 3S2JA 2YBVA 4TVDA 1QUMA 1GT8A 1JUKA 3LBMA 3W6LA 1WXZA 1ZL1A 4UNIA 3KBNA 4GY0A 4HU0A 2MLXA 3O6CA 1VHCA 1DWGM 1XIDA 1GZJA 2ISWA 4Z2KA 3QV9A 3QM3A 4W8AA 4ALDA 2GOKA 3C0LA 2OR2A 1Z44A 3W71A 1ESWA 5D2VA 2ZR6A 1Z7AA 1YIXA 3ITXA 3LRMA 4V1XA 4D8ZA 1E0UA 5M5DA 3LZ5A 1DXFA 5DRIA 2DT3A 1H61A 1VBUA 1XPGA 1BLIA 3DI1A 1L8PA 3KM8A 3IRSA 4CCDA 3RDKA 4E0CA 1J5TA 1JCJA 4FZIA 3C0SA 1Q7ZA 3IKGA 2DV0A 3O63A 4BF8A 3NOYA 3B8WA 4GJ1A 3W1TA 2DJXA 4UFJA 1F3TA 3QW4B 3TYZA 4WSJA 4O50A 1SR9A 2Y70A 4QJ4B 5HA7A 6TIMA 1RHCA 3BGGA 3PPFA 3NGFA 4UCFA 4NRRA 1DJGA 4IG2A 3WLKX 3CYVA 4DYKA 2QS8A 2BSLA 4M0XA 4FIRA 4KPLA 2WV8A 4UTHA 4I5UA 5AECA 2VRJA 3NPWA 3G1DA 1EP1A 5DT7A 2E9BA 1TVPA 2PDGA 1JYVA 1LWJA 4V2XA 1V3KA 3O5IA 3FYYA 4AC7C 2DQWA 2JFEX 2DDXA 3CC1A 4G5DA 1OZQA 4PFHA 1EYEA 2G97A 3URAA 6XIMA 1BSIA 2OWXA 3UCDA 2AKMA 1CBGA 3SCTA 4M81A 4TVCA 2R1MA 3KE0A 1XLCA 3KTSA 3NQAA 1EDQA 4KRZA 2NX1A 1GWJA 3TN5A 1F5ZA 1NDWA 3N18A 4ODOA 2V3GA 4JYSA 2WCGA 3GTNA 1U5HA 3KOWA 3MS8A 4A8LA 4FP1A 3WBXA 1JUBA 4KFPA 3N2BA 3EWBX 2GFTA 4J3VA 5CG0A 3U3HA 1VEMA 2ABAA 2OX1A 4MYAA 5AOUA 4XD3A 2HXTA 2P4VA 4QHRA 3VMNA 1GONA 4UCGA 2RDXA 1K77A 4GWEA 4H8HA 5LHEA 1A5SA 4XISA 2ZRYA 3UVIA 4RE3A 3RF9A 3DGBA 4K1GA 3FAPA 2K8IA 3VDGA 3MWCA 2UV8G 4DUVA 5A6TC 3P84A 2I7GA 1OCBA 2DUXA 1AJ0A 2AMGA 3NL3A 1I2NA 3O5KA 1NFBA 4LVFA 3T8QA 2DZUA 3UBPC 2WM1A 1XLJA 4KEVA 4UC5A 1KM6A 2V67A 4JYEA 1TELA 2FPYA 5C9XA 4MY1A 2VOTA 2V2DA 4K37A 4LAKA 1RY0A 6REQA 4L6DA 4J27A 3R58A 3CHFA 3QKZA 8A3HA 4M6QA 3KL3A 3D0CA 5EL1A 4HZ7A 1IEXA 2ZXAA 3TQKA 3IIXA 1XP3A 1M7OA 5A6SA 5DEZA 3DCPA 2ZADA 1ZGDA 3C2EA 4M7SA 4KRTA 5FOOA 5D33A 2G41A 4GLEA 1TPB1 2ISVA 2M08A 3WQDA 1WZMA 4L1GA 5LIYX 5I3IA 3WIJA 2VNCA 1ZCNA 3PZOA 2QQ6A 4YTQA 4PCNA 1ZU8A 1ISWA 4LF1A 5H91A 2WLYA 4Z08A 2W3ZA 3GH4A 2Y7DA 5LNUA 2KGJA 1B2YA 4HYWA 1UP0A 1UZHA 4GCAA 1VGAA 4GJJA 3HV8A 3E0VA 5D2YA 2IF4A 4RNIA 4IMEA 4LBSA 3MUAA 1KR1A 1VBHA 1OK4A 3RUBL 5HATA 2NV9A 1SO5A 4OV4A 3W1XA 3GXNA 3HQ1A 1KTNA 3GWQA 4QR6A 5C0QA 3TMLA 3O5PA 3S5SA 4KEMA 4KWOA 3WD1A 4Q6JA 2WVVB 4F9DA 2QF8A 5KTLA 3GAYA 4X0NA 3O8AA 3WLRA 3HA1A 2V81A 3BMXA 4D6DA 4IFKB 3P80A 3DHUA 4B4FA 3FX4A 1VEPA 4HTBA 4ZEPA 3MO4A 3PC0A 4DY1A 3N4EA 3TNBA 2DQXA 4JIQA 3CZEA 2G3IA 1AW5A 4R9XA 2ZX9A 5E70A 4MKNA 3WJSA 1LP6A 2Y7GA 4AIUA 3C2OA 3FGCA 4J28A 3CH0A 3SUTA 3H9RB 3NM1A 4JBRA 2HV5A 3KRBA 3LMYA 2HSAA 2V82A 5IHRA 4LAOA 3W22A 4IJRA 3VDHA 4GRSA 2ZUVA 4H01A 4JL2A 4FF5A 1UP2A 3TC3A 3W28A 3JUGA 2EULA 4R7WA 2OEMA 1R5YA 2J24A 4G9PA 1E40A 3G8EA 4ERGA 3GU1A 3TVAA 2GDUA 3S5OA 1ISZA 2VEPA 2VQTA 4O57A 3W7GA 5BU9A 3UI5A 4TU1A 3PUEA 3OGRA 3W7HA 5A6KA 3ZT7A 3V5FA 1KFJA 4MGVA 3W74A 1ZBCA 4JFKA 1QBAA 3ELFA 1GKPA 4XK2A 4X63A 1IR2A 3ABRA 3UR8A 3GIYA 4IT1A 2B4GA 3EPOA 3IVUA 5FKYA 2C15A 3F5JA 2Y0FA 2HE5A 1C92A 1W9PA 4OOUA 2OKTA 2XHYA 1WE5A 1FFQA 2G3NA 3A4AA 2O55A 3OTRA 1FKXA 3EAUA 4O4VA 2XP5A 1NJJA 1E15A 3MUZ1 2Y85A 3EXRA 2GJNA 2WJDA 4NX0A 4KESA 4IH3A 1Q6IA 3ITLA 4AZHA 5M03A 3VK5A 1B3XA 3HTWA 1GCYA 1QCWA 5IRPA 2BVWA 2J25A 1HJXA 1CB2A 3RN6A 3N2OA 3G2GA 3B9OA 4CQDA 1JDAA 2XG9A 5A2CA 1CGYA 1B31A 1A4MA 4NZ1A 2OQHA 1V4YA 1TZ9A 5BZAA 4LVDA 2RGLA 4P8XA 1IIHA 1S38A 1JNSA 1PKMA 3FA3A 2DH2A 5F2MA 3DZ1A 3AYVA 5U7SA 4FOUA 1LLZA 4H04A 3OP2A 3FYPA 7XIMA 1VBGA 2HVMA 2YJQA 1X8CA 1YXCA 5AYXA 4BY3A 1BQGA 3OU8A 2RDWA 1IT7A 3LLXA 1MO0A 5FEZA 2YW4A 3LHTA 4TTGA 4GVGA 3CZ8A 1PX4A 5K9DA 5LNRA 4DJEA 1G9HA 3HGOA 3S9ZA 4Y7EA 4CUCA 4XZ9A 3VNDA 3STGA 3WJWA 2ZZ3A 2E7FA 3U7VA 3P3BA 4KR0B 1LRTA 2ANUA 3TTYA 3G5EA 4QT2A 3AIVA 2HZGA 1XQLA 2ZVRA 3PSVA 2ZZ2A 4GK8A 4UFLA 1HKWA 3RFWA 1NU5A 2ESCA 4E8DA 4LCRA 3BLFA 3M47A 1KM3A 5CBJA 3ANYA 1A47A 4J3UA 2GUUA 3UQNA 4KMQA 3V16A 4OBRA 5IBXC 3RJXA 4JNZA 4H4IA 1HP5A 3VOJA 1VYPX 3FOKA 2NXGA 4GIVA 4HYRA 2DZBA 3MSYA 4DXXA 3QOMA 3TLLA 3OA5A 1UC5A 2YXGA 3DI0A 4MZ8A 1TJRA 4GISA 2J4GA 3PTKA 3UT0A 4O15A 5CAHA 1K8XA 4OWGA 1YNQA 3Q58A 3ZOAA 2FVKA 3RIKA 1HKMA 4LB4A 1OFQA 2YX0A 4NZ3A 4ZENA 2C71A 5JXQA 2EHHA 1TZ7A 1EKOA 5LYRA 1LT8A 1NOWA 2MNRA 1XCXA 2GQ9A 1XSIA 4S3CA 1AJ2A 2F7FA 2D69A 1KRAC 3CEPA 1AMKA 2A2IA 2J8FA 4L9ZA 1C3FA 1DQWA 2A3BA 3UA3A 5AVHA 3IV8A 5DMLA 1XDJA 1W9BM 2YGYA 4FX8A 1VPQA 5HAOA 3RM8A 4ITZA 1GVSA 3DFPA 5LHFA 4FX6M 3GDBA 4MVAA 1JRCA 4NF7A 4L4PA 2YBUA 1QAPA 5A2BA 1VRXA 1VB9A 4GYKA 4UOZA 3KCJA 3VGBA 2V6AA 3RHGA 1XCFA 1Q6HA 4S38A 3LHYA 3GKFA 4IHCA 3WLPA 1T5AA 3O07A 1XWYA 3NSXA 4XO7A 3ITVA 3UESA 3PJXA 3QMRA 4EX4A 3TV8A 1NDYA 3AHVA 3GLCA 3W24A 4J5NA 3BMWA 3T08A 1IF2A 2ZRVA 3BW3A 4NIRA 1NH6A 3O6DA 4ZPTR 4TX9A 1G01A 2RUQA 4BS0A 2G0WA 1XBYA 3EB4A 4JIHA 2X0HA 2QW5A 4M24A 4DJFA 3TJ4A 1YXYA 3JS3A 2VGGA 3S5NA 1UH4A 1HKJA 1OF6A 1PE1A 1XLFA 1XGEA 5BRBA 3NI6A 3M5YA 3KZ7A 2QPXA 4F0KA 2YLLA 1BYAA 2QJJA 4GA8A 4ADTA 4B5TA 4AH7A 3UZJA 3KAIA 3KHJA 3TJXA 3I4EA 3W1QA 4AZ6A 5BW6A 3CZKA 3NR0A 4A3UA 4ATWA 3SZ8A 1HQTA 4ZSTA 1QWGA 4P7LA 3CUZA 3TXVA 1RQBA 5CBBA 4Q8QA 1XDMA 1FWNA 3T44A 1A5UA 1ZRQA 3VTRA 2VZUA 1AH4A 4DIAA 3W23A 4ZCWA 1LLWA 4QDMA 1TA3B 3BZJA 4NKCA 3URNA 1FUYA 1VFSA 3M7SA 3PZMA 4O1BA 4L80A 5M2FX 2QGYA 4OTKA 2PDPA 4Y9PA 1IGSA 2UZ9A 3TXZA 4NXKA 5CZKA 4AD3A 4JTFA 3GBDA 1GPWA 2KI3A 3L0GA 4UMCA 4C6DA 4B9YA 2E8ZA 4LC6A 4G8TA 3G6MA 4S3KA 3AHXA 2QDDA 1Q6OA 2ZUUA 1FQ0A 4G2PA 4LX4A 1LOLA 3VMPA 4C90A 4HZ6A 3THUA 4Q7NA 3QHNA 1H2JA 2VR5A 1SSGA 3KVMA 3BAWA 3P60A 3UW6A 3RG6A 5I2UA 4AC1X 4KETA 1OADA 3W84A 1AQMA 4L7ZA 2ZX8A 1ZB5A 3WH0A 3VNIA 4HK7A 2HBVA 1BXBA 1FXPA 1YX1A 3ZVIA 1L6GA 2BV9A 4ZQCA 5A1AA 3CPRA 4JTQA 4O10A 1R2TA 1XYBA 3M9YA 3ZWTA 3TROA 1W32A 2E67A 1O66A 2ON3A 2RHGA 2ISFA 4MUZA 3B97A 1WXYA 3W01A 5ABFA 4IX0A 4GIYA 4DEFA 1OCJA 5EMUA 1EGZA 5DFAA 2AQWA 4ZB0A 2AQVA 1VLWA 2ZX6A 3QPYA 3WH7A 1H09A 3KBJA 4JIIX 3L4TA 1ZHAA 5KZ6A 5CPMA 3GNDA 1Q6UA 1DQUA 3OBEA 1K02A 1S2CA 3GVRA 3VNMA 2PCQA 5HDRA 4GUFA 3TR9A 3L4ZA 2PGRA 3PWIA 1RD5A 4PTXA 4UTMA 1EPXA 4XVEA 3TYDA 3OLIA 4C6FA 1PSCA 4PMNA 4NJGA 5A8GA 3MI3A 1YNPA 1OD0A 2GLKA 4XUYA 2F2DA 3EDFA 3D47A 3W73A 3U5UA 2WMKA 4Q7IA 5FEWA 4DLMA 4WOZA 4O1AA 1KBKA 3M64A 3UFYA 2OFJA 6ALDA 2RKXA 3V1HA 5K3VA 1F40A 3H55A 4U4MA 3LHVA 2VEIA 4JFJA 2XIQA 3ITTA 4JTKA 4UZUA 4FR6A 3WBWA 3WK2A 5RUBA 1X1OA 1GK8A 2CERA 3MP3A 4WLCA 4LAWA 1BSLA 1ZAIA 2B7NA 4MNLA 1ZENA 1JNTA 2DP3A 3V5OA 2E1WA 4DRPA 5HQLA 3S9IA 4ICMA 3B8SA 4WHBA 3VIKA 4PYSA 3U2CA 4C91A 1E5NA 2F2KA 4GGBA 1BWVA 4IX2A 3VKJA 1ME8A 1OVDA 3NPVA 2WZMA 2ZQTA 3BXWA 4UIOA 2E8YA 3SRHA 3TQ0A 1T99A 3O2LA 1I8JA 3DKJA 1BWLA 4MGGA 4PZVA 1WKEA 2CZVA 4I8DA 4NNRA 2OT1A 1W3TA 3P93A 4QP0A 1PPIA 4DWSC 4NJJA 3F5KA 4DRIA 3MQTA 3VD4A 2WPBA 3TC5A 2EAWA 4PUKA 3DYMA 2PPNA 1MI3A 3E0IA 2Z2UA 1WAUA 2PB1A 5CJMA 4HVXA 4U3AA 2A6NA 4LNCA 3GG0A 4UDMA 2OU4A 2VTFA 2VC9A 3SCWA 1H7NA 1GOIA 4D71A 1FDZA 1XH2A 3DC0A 5JH8A 4P8WA 5LIKX 4E8GA 2VC6A 4RPQA 1A5BA 1F8AB 1G4PA 2PLCA 4GY7A 4AZ5A 4AIOA 4HCHA 1Y0OA 2YYUA 4GCXA 3FSTA 4FAMA 2DY3A 3AS1A 2A3AA 2VHLA 1EJVC 2UY5A 4I7UA 1E4LA 5E9AA 3W7OA 5JMUA 1HNYA 1JAEA 1PHQA 2BXZA 3SJNA 1B3WA 1U5VA 2YSWA 1Z42A 1KT1A 3QGKC 4JQ4A 5DO8A 5CJ5A 3EEZA 5TNVA 3DESA 1FHLA 1L6FA 3W2JA 3I7SA 2VENA 4AD1A 4PEEA 4JHMA 4PSRA 1TSIA 4MMWA 4IL0A 4X2RA 1WDWA 3E9AA 1CYGA 1XRSA 2V5CA 3RR4A 2PDJA 1HO4A 1JDFA 1EP3A 2CITA 4LRTA 2VFGA 4RZ6A 1UD6A 3SECA 3I65A 5IFPA 3UXIA 1UUQA 4FEZA 3CB8A 2XGBA 4CQBA 4LGXA 2QUTA 3LCXA 5FCZA 3Q4DA 2E6YA 2ISSA 1PINA 2VM8A 1TR9A 4HD5A 1R9YA 3EMQA 3B0VC 4IJCA 2ZQUA 5BWFA 3WEMA 1QPOA 3PUGA 5HNTA 3EXSA 3ZZ1A 3KVJA 5GJMA 1I2PA 2W62A 3STFA 2EBNA 4ZSUA 1U22A 4GQGA 4XZHA 3WH5A 1PZ2A 1H7PA 3WFZA 1E1CB 2MUCA 2NV1A 4DJDC 3SSZA 4EVZA 3KBSA 2BVDA 2G3JA 5DMMA 4KCTA 4IWWA 3WLLA 3RGTA 2ZTJA 3IIZA 4H6KA 2OYKA 3NTYA 1WZAA 1A80A 3MP5A 3AIWA 8XIAA 3WLJA 4HBOA 3GTXA 4LY8A 4QE5A 1NQ6A 1OFDA 1GOMA 4KIEA 5HOSA 2WJZA 5EFDA 4H9MA 3DFNA 4ZODA 1JNDA 3N2CA 1DJZA 7ENLA 2ZZ5A 1YDVA 3IK4A 1OCQA 6PTDA 3M5ZA 4N42A 4A05A 1W1ZA 4IT6A 2R82A 1HJQA 4L9YA 5IOBA 6REQB 4AISA 1FWIC 1X96A 4HA4A 2NXHA 2JKEA 3HV9A 3IACA 5B80A 2WVUA 3M44A 5E0CA 4O14A 3JR2A 1YMYA 2PE4A 1HKIA 2NVAA 1WKDA 2VQUA 4ICCX 4WIWA 3GHRA 3GNRA 4RW3A 3MV11 1SZGA 5C6MA 1QW8A 4ODPA 2YDAA 4H41A 1UR4A 1I2QA 1QHZA 4AWUA 1AW2A 3NVTA 4K68A 1TMHA 1DJIA 4PMDA 4HIBA 3ORWA 2RAGA 4YYFA 1IXNA 1MDLA 4KWUA 1V0MA 5FIPA 3IVTA 3AZTA 3LB0A 4QG8A 1OHLA 3PZIA 2ZQ0A 2NQ5A 1F2JA 2WLZA 2GJXB 2VEFA 4C6OA 3KVLA 3N4FA 4MDOA 3CMJA 1ZNNA 4C7FA 4GH1A 1HL2A 4E2OA 3UZXA 1ZQ5A 5CGQA 1TV8A 5D2TA 2UY3A 4Q4SA 3NO5A 2OZTA 1M65A 3GBEA 1FHUA 3NDZA 4UFHA 2L2SA 3F5LA 2QVHA 1RK5A 4G7FA 5E93A 2NWSA 3FEMA 1KFBA 1UCWA 5GJNA 4WJ8A 1MFVA 1LG2A 4LXFA 3W70A 2CIPA 2UY2A 3DHDA 3WD2A 5HR7A 2PDMA 1M7XA 4US5D 4WX2A 1UZ1A 3S42A 1O94A 5IBXA 2PDBA 3K1GA 5FESA 3KAOA 3W75A 3G1FA 3QQ0A 2CZ5A 2OT0A 3W83A 1PDYA 4Q8VA 2OSWA 3CYJA 5EGRA 1KQZA 1UD5A 1UOKA 4PUUA 3T4WA 4W7WA 4KERA 2G3FA 3CPUA 3WLSA 1OINA 3V1PA 3G1AA 2OELA 3BLIA 2W27A 3H12A 2QJNA 4BJHA 2QF7A 1QPKA 3CIVA 3SUSA 2P8CA 3WO8A 4I9TA 2Y8UA 3BCDA 4JTGA 3H2CA 1CXHA 3BQ5A 3W6YA 3CQKA 5JQ9A 2J79A 1G69A 5T91A 1J6YA 1ICPA 1MWOA 4B5WA 1MSSA 4M5PA 1KC7A 3R12A 2AL2B 4P2VA 1UKPA 1UH3A 1IEWA 3EDKA 4JN8A 3CIXA 3V7PA 4E8CA 3GVWA 3WEOA 3T07A 2CBIA 3TP4A 1QBBA 1GVOA 3F2DA 5ECVA 1G4SA 3N04A 1EUAA 3L21A 1V03A 3UG5A 1XIEA 1XH0A 4GNKB 1OY0A 3NGJA 4LVBA 4GO8A 1OC6A 3WLTA 3B9DA 3HFYA 1THFD 2EG6A 4P7OA 1UWIA 4W89A 1V08A 4C7DA 4HPXA 3OBAA 4TV5A 3LHUA 3WF4A 3EOOA 3NIYA 1YLVA 3UJ2A 1GVFA 4XZBA 2PDFA 4WGXA 1XS2A 4WQ6A 3ZR4A 3IJQA 5C70A 1UD8A 4IIHA 3UERA 1KRMA 3C52A 1IWBA 4MWAE 1CWYA 1P5BA 3KS5A 4MOZA 4EPDC 2R14A 2C1HA 4W9PA 1FWFC 3KABA 1L6WA 1OJXA 1T40A 2GJRA 4GFSA 4O12A 1EQPA 5CCZA 4LFYA 5HNNA 4HPHA 2ZVIA 3L4UA 4HTYA 2P3EA 3MUCA 2XFWA 2HNHA 1W6TA 3TN4A 1A5MC 3AXKA 3GR8A 2PPPA 2ZBTA 2XPKA 3GDLA 3AISA 2GDVA 4HNLA 4WY0A 4YVXA 2WCAA 4AIEA 3P6LA 9XIAA 4X3ZA 3IIOA 1FKIA 4MAVA 3LXAA 4LF2A 4KH2A 2DSKA 4ZO6A 4IPJA 2DIJA 5DLCA 4EWJA 1H1ZA 4MSSA 5EBAA 3A4JA 2FJUB 1U1JA 2J66A 5XIAA 2FLIA 5A94A 1KLZA 3AJ7A 3GFZA 4C6LA 5BXPA 1HIZA 1N2VA 4MWAB 4O19A 1FCQA 2WMIB 4I3GA 3VNKA 4H9XA 4HMDA 3W7MA 2NQJA 1BYDA 1YEYA 4LAUA 3R8HA 3UR5A 3YPIA 4DROA 4R9OA 2CETA 3FGCB 3ITCA 1EJXC 3DFHA 3QMTA 3XISA 3CTTA 5D38A 5FAGA 1EJSC 3FAXA 1PS9A 1M7PA 3W2MA 5A8OA 4BEQA 1ME9A 1C8YA 4MNMA 1EC9A 4F3HA 3T7VA 4OBSA 1KLYA 3ES7A 5BOOA 1RBLA 4S3GA 1PYFA 3IJ6A 4HCDA 3DYPA 3TYBA 1S2TA 5DF0A 1RCOB 4UTUA 2BTMA 1FH8A 2F38A 2E5BA 4N7QA 2VEGA 4MFDA 2EKCA 1OCNA 3QV7A 2EJ1A 3QZAA 1ZAHA 1OC7A 3L0NA 4UXDA 3E2QA 5JH2A 2FMOA 4C6BA 4R88A 1X98A 2YA0A 1D6OA 2X7WA 2D0GA 3TOYA 1W9XA 2ACUA 3ZYZA 1O1HA 1T41A 1J5SA 1WA3A 4HA3A 3D46A 1JXJA 2QCFA 5LSMA 3UPBA 4YLWA 5AHMA 4GI8A 3MZ2A 4EIVA 5F4WA 4DH0A 2VT0A 3SURA 4GC4A 4LQ1A 2W66A 2VO5A 4DELA 1NMWA 4DZIA 1K8CA 3LNPA 3VIFA 2G96A 1KV5A 3JYJA 4JY9A 5I79A 3O5EA 4UFKA 4ENLA 3MMDA 3QGVA 1K6AA 2DZSA 4UQAA 3ZSSA 2RURA 2O4QA 1VIWA 1XUZA 3GZAA 5AZ0A 4V1YA 3OZOA 2Y63A 1MDRA 3VIPA 5LGZA 3R5EA 2D9FA 2RUSA 2WAGA 5D2WA 1B9BA 3DECA 1OT2A 1AL7A 2ZX5A 1Y5WA 4GQBA 2V68A 2X0SA 3RMJA 2CBUA 4NZ4A 3E12A 5TD4A 1L2QA 5FA5A 2V5KA 5BOFA 1NWRA 3HPFA 3N34A 2NQ9A 1F8MA 1I75A 4DM1A 3ALFA 3CO4A 3PJUA 4YWSA 4W9TA 2YFNA 5CG7A 4INFA 1XLLA 3ITOA 3FK4A 2DZWA 1JYXA 4MTVA 4ZTYA 1XRFA 3BUVA 4TIMA 3L2MA 1TWWA 1HO1A 2P10A 5AB3A 4XIMA 5CSRA 4MPKA 3AQUA 3WUGA 4O13A 3RPMA 4XVDA 1TPFA 1Z32X 4V28A 4DJDA 5HR6A 2FGZA 4DO7A 2XPBA 4H8UA 4AEFA 3N2XA 1UROA 4XD4A 3OPSA 1VKFA 2RJGA 1M03A 4H9TA 2PTZA 3WLIA 1DYSA 2WBGA 4PC8A 1QPRA 2GSHA 1LL7A 3DBNA 3NL2A 2MLYA 4J4NA 3ZSTA 3TC7A 2A7PA 3APGA 4S3BA 4B16A 3WBEA 4ODMA 2OO6A 1PUDA 3V35A 2QCMA 3EWYA 3S5ZA 1FWEC 4RKAA 3TE9A 4JDYA 2Q09A 1JPMA 3W7EA 4AAJA 3R0UA 4AQLA 4QGCA 2Y7EA 5D75A 1F8IA 4XX6A 3U6WA 5J5DA 5HPOA 1KFCA 5EMYA 3ZLGA 1PEZA 4Q4PA 4EACA 2JEPA 1FVPA 4L61A 1GTHA 2WMFA 2PU0A 3KOZA 3I6RA 4DRMA 1QNRA 5M3WA 1H7RA 2WC3A 4U2YA 4N9BA 2BOGX 3VIJA 1I2RA 3FA5A 4DI9A 2V2HA 4AZ7A 4HNOA 4YN5A 1BYBA 2H8XA 4YHEA 5DRCA 4S3AA 2HS6A 2WSQA 4HSHA 1XHGA 1FD9A 5DN1A 3LPOA 1UZDA 4N19A 3FLUA 3JZEA 4BI6A 1PIIA 4KT2A 2Q3OA 1VYRA 4QXIA 1W5PA 1P6CA 2QULA 1E9YB 4KF1A 4ORIA 5HNUA 4DVOA 4UTWC 4UQBA 1KA9F 3KCLA 3ERPA 4Q4MA 3W00A 5LKYA 3GKAA 1XLDA 3LXBA 2VZTA 5HMSA 4CNPA 2ZE3A 4PMRA 1MYRA 3OVGA 4XZMX 3R2GA 1Z41A 3P81A 3AS3A 3UWZA 6A3HA 4E4FA 2D2OA 2DZVA 4ADSA 1QZ2A 3H2EA 2ACRA 4S2CA 4YS1A 3TDBA 3EB3A 1R9XA 3M41A 1XSKA 3IK8A 4IFRA 1VFLA 1E5JA 4GBUA 2Y2WA 1OG0A 3O5QA 1OIFA 3WMBA 3R7MA 1UASA 3ANVA 1FRBA 2NQLA 1FKRA 4CNSA 2PGWA 1R9HA 2XM2A 1TTIA 4PB3A 5AHNA 1QOPA 5HWJA 2FKPA 4B2DD 5H8MA 1EA9C 3TJIA 2QT3A 1TV7A 1M7JA 3WH8A 4CQ8A 2WMJA 3I6CA 1K3UA 1NY1A 2X40A 3V0UA 3ZIZA 4EKJA 4GYJA 3PANA 4TMCA 2E9LA 3H2OA 5I07A 1F3WA 3KBVA 4H8NA 4HSOA 3ZJ8A 4IISA 1I4NA 1V3MA 3UWVA 4I7VA 5HWBA 1SPQA 2BHZA 4C1KA 5FEPA 4DWSB 1SVDA 1LL6A 3MJYA 4HSNA 4EK7A 1JCMP 1C8VA 2JIEA 4HNCA 4IL2A 1WKFA 1GVIA 4ECLA 4C7GA 3UJRA 1ODUA 1DEDA 3QV8A 1JPDX 2XPAA 5MKGA 1FKBA 3PAOA 5AN7A 3T2PA 4AWSA 5DCDA 5A95A 4JICA 1LQ0A 1N8FA 3MYOA 3NZQA 1UR0A 1BHGA 3CV1A 4ONVA 5T26A 4HU8A 2YKKA 3VNZA 1OFPA 2CKRA 1JUEA 2ZCGA 4ZB2A 5AFDA 1POKA 1XLAA 4PBFA 4Z1BA 2IPJA 2PZNA 3L4VA 3CHEA 4UTTA 1OT1A 4DN1A 3RLGA 2ALDA 2WANA 1G4TA 3T78A 1OGSA 3FCPA 4CNNA 2A79A 3UQAA 5L9FA 1GOWA 4L64A 2BGNE 5KEZA 3LQLA 1QPNA 1B3OA 1FCUA 1H7OA 3LX9A 1PKYA 1A5LC 4GMEA 4D1JA 1YATA 1HFBA 5A6BA 4CNUA 1LG1A 3NOEA 5D02A 1V7YA 2DZTA 5D03A 3UR2A 1W1B1 2VRQA 4FPSA 2V5LA 2R9RA 3T2OA 3CS2A 2BX7A 3OOQA 3PZVA 3VZXA 4GY1A 4XTDA 3KL0A 3MHFA 3I68A 3P0WA 3LRLA 2Z27A 1V0LA 2IPWA 3PS7A 2O9OA 1MW2A 1R85A 3DG3A 3N6JA 4K8HA 3O5FA 1CXLA 4DZAA 2HISA 2FH8A 1F07A 3HO8A 5G1TA 3GXMA 2BVYA 5FSEC 4LAMA 1LROA 3TTEA 1H5YA 4ODRA 1XLKA 3VXGA 2WVSA 5A8MA 2C91A 2A6LA 4DBSA 3ODKA 1R38A 2QDHA 4U33A 4AD5A 3SCPA 3C61A 3WMSA 1UB3A 4XZLX 2MF9A 1Q4WA 4UQ9A 3AROA 3GXTA 5T9BG 3RMEA 1Q63A 5LGXA 3PZGA 1N55A 3CZJA 4CQAA 4Y90A 1IGWA 2OEJA 3BAKA 4HHLA 1IZJA 3KBMA 1HVXA 3T0AA 2XN0A 3VD9A 2OSYA 3QMSA 3GQYA 2FJKA 2VKZG 4Q8UA 3ONCA 1J0HA 3TW9A 1S39A 1B6CA 5CSYA 3WNPA 3VUSA 2F6UA 4M51A 2G5WA 4R7JA 3VOCA 4F0LA 2BG5A 8XIMA 2BGQA 1GZGA 3NZPA 4DF2A 1JF6A 2WVTA 2QV5A 3AO0A 1KB3A 3OEXA 3TONA 4ZO8A 1BGGA 2BXYA 3OLDA 3PM6A 3WKZA 2G95A 2ZC1A 4JL1A 3T42A 5I0DA 1ZAJA 1YPIA 4LANA 3W7QA 1TQXA 2REQA 4HHPA 3RM9A 1K1DA 4BCEA 4DYJA 4K6AA 3UF8A 1KFLA 5TIMA 5G1MA 3K4DA 1MW3A 5A6JA 2G37A 1T8QA 4YXGA 1WUFA 5A6MA 3OOBA 3ATYA 2XUCA 5M1TA 3NSMA 1YW1A 1PCKA 1NSGA 3R8RA 1J4HA 1P0DA 5D32A 1KCKA 5LIXX 3QBUA 1CECA 2PP1A 1QOXA 3QYSA 3VILA 1JGIA 4JNYA 3KOXA 1JDCA 4LEQA 5HJXA 4XAZA 3O16A 4GUJA 3UVAA 4F66A 5G2IA 3BVJA 3T55A 1O60A 2DGAA 1UR9A 1G7VA 2WVVA 4AVFA 5FJTA 4BKNA 1SMAA 4DLFA 3BJTA 4PMQA 1LL4A 2D0FA 3WFAA 2GDQA 2E6DA 3A9BA 1DWIM 1YTEA 2MNTA 3DFSA 4UTLA 3R1ZA 2AGKA 2VUNA 3E2VA 2NX3A 1AG1O 3AMKA 5CZJA 5HNRA 4IZGA 4B5XA 4GIEA 3DGRA 3SR7A 2XIIA 3HB9A 3VX0A 3WNNA 1VCVA 2VDHA 2Y62A 4QAWA 3WUFA 3O1NA 3AYRA 2F6KA 2XH0A 4P7NA 4B2DA 4GYPC 2XU2A 2NUXA 4K8GA 4LB3A 4WD0A 1EBHA 3Q45A 3U2OA 4EPBC 1U1UA 1HT6A 3TSBA 5AHLA 1RH9A 5FJPA 1NOFA 4Z1YA 1XKJA 2ZYFA 7ODCA 1H1NA 2GSJA 2R8WA 5MF5A 2ALRA 2QCDA 3O5RA 4DBDA 4DZHA 3SM0A 1QTWA 5D04C 3W72A 3RPDA 1BEUA 4HKPA 4UZSA 3WN6A 1XIHA 5G1YA 5H6HA 4NY2A 1GOQA 1CIUA 1HVQA 3S8HA 5JH1A 1E43A 3GTYX 2YDQA 3EZ4A 3GFXA 3S47A 1J0KA 2W9MA 4OFCA 5CPQA 1FX6A 4RDWA 3AXXA 2PDUA 4ZMGA 2PLMA 3L0KA 4DRJA 3MKVA 3N9SA 4Z17A 1OFBA 4K8EA 3AIRA 1WX0A 1E6RA 4IOTA 5HMFA 4UOQA 4HMEA 1CLXA 1A7XA 2VZVA 4KS0A 2NW0A 1TB3A 3U48A 3T8LA 5I7GA 4GPNA 3C2VA 1DJXA 2I9EA 3MMTA 3UGRA 2WKLA 1EL3A 3LDVA 2CHOA 1DQXA 4TTUA 4ES4A 2NSXA 1TV4A 1NWSA 1EP2A 1XYLA 1V3JA 3IAQA 3NRKA 3PBWA 2BWGA 5CZSA 3O5GA 8CGTA 2VZOA 3MCNA 5GPGA 2A7RA 4PMZA 2OG9A 2X05A 3SCUA 2QPSA 1QT1A 3VFCA 3C56A 4QRNA 4Q8OA 3K46A 2WB5A 4FOKA 2B81A 3T0BA 4UBPC 1C8XA 1UR8A 3EGJA 3EX2A 4LAVA 2ZTKA 3ZLHA 3STEA 4IFKA 4YYCA 2M2AA 3VFLA 4GVFA 3NQDA 1CXFA 4JTAA 1I0BA 5I3GA 1RD6A 1KO0A 4NYYA 3RLVA 3FW6A 1S5MA 3COTA 1KBIA 1O95A 5AY7A 2V3EA 4GHRA 5HANA 2HBXA 1IIGA 3B8IA 4J40A 3BW2A 2J8GA 1R47A 4L4OA 1UW9A 1IQ8A 1UD4A 5DMYA 3W7CA 2FB3A 3OJGA 4CU8A 3UCQA 3AJXA 1W37A 2QUNA 3I4KA 2WNQA 3NDYA 4WDXA 2A4AA 3DN5A 4FLOA 1H0IA 1IWPA 2QHAA 1MUCA 4OV9A 1NWUA 3W07A 2KX9A 2QCDB 4F48A 3APYA 1BGAA 4MZ1A 3XIMA 3KFTA 3I3DA 4Z1CA 4NXSA 2R91A 3UWQA 4ZVJA 4I9MA 3FJNA 3GG8A 2HJPA 3OHMB 4W5UA 3GXFA 4NI3A 1RQEA 1DL3A 2SFPA 4LU0A 4NU7A 5EA9A 3HMJG 1V6UA 2QDGA 2A3EA 1TPDA 3UXKA 3TCSA 2PC4A 3CEUA 3H53A 3SI9A 2DVTA 2GUBA 1E71M 2CYGA 3VIHA 3TFCA 1R87A 4G7EB 3MU7A 4AG0A 5E1QA 1TPH1 2YBTA 3UETA 3UG8A 3HF3A 2PDXA 2LPVA 3R94A 3DBPA 1ZBWA 3FJ4A 3PTQA 3E02A 1W91A 4HU4A 1FWAC 3GDTA 5HW8A 1QK0A 3GK0A 4N9CA 4NZFA 3VO0A 3C2YA 4ZO9A 4P61A 1J8VA 5CKSA 4YMZA 2QCCA 3A5VA 2Z1WA 3GVGA 3LLFA 1FCBA 3SAZA 2Z1BA 1LOSA 2FDSA 2VEKA 3CAKA 3AOFA 2WC7A 1I1WA 1FKWA 2GK1A 2PP0A 2FZMA 4NP7A 3H7VA 1X8FA 4KCUA 2YR1A 1EO7A 1GQLA 3BGAA 2C14A 5XINA 3IRDA 3V0TA 1TMLA 2IQTA 4W5ZA 2ZWZA 5JIWA 4FK9A 4V15A 3TJLA 4J3WA 4MKVA 3KRUA 2ZXQA 1NF0A 4REQB 3K13A 4JKLA 2NLIA 2QVNA 4AY1A 1Z9AA 2OYMA 4FXFA 1E56A 2PFHA 1W9VA 1R8LA 4H83A 3RITA 1TJ2A 4O4WA 1KM1A 4ODKA 3SN4A 1TV3A 4X22A 4CQCA 1LRQA 4LT9A 1GRJA 1L2UA 1E9ZB 4U3CA 3FEQA 3FFSA 3TA9A 4FXJA 1SW7A 4DJFD 5CC5A 4AHQA 3AFBA 1WYIA 4NAEB 1RVGA 5CC6A 3ATZA 1DBTA 4K38A 5K4XA 2FH6A 1CENA 4C60A 4TV6A 2PGEA 3LERA 1JYWA 4JTRA 1P0KA 1FKHA 1DP0A 1YBQA 4M29A 4PL1A 1ZJBA 4MSPA 3REQA 2EJAA 2VC7A 3OZMA 1PJ9A 4HOZA 1NP0A 4B3ZA 3H70A 1PAMA 3TC6A 4MJ4A 4RK8A 1OX4B 3RLUA 5HQMA 2FGLA 4RE0A 3C6CA 4I6KA 4O28A 2XWEA 4AXNA 4DRNA 1KCLA 1OC5A 1X1ZA 5CC7A 4LBUA 3LRKA 1TR1A 1VS1A 1WZKA 1OX5A 1LJYA 3LXCA 2X1SA 2C19A 5FJOA 1WDSA 3THCA 1OGGA 4NUWA 1ONWA 1XYAA 2OOGA 1NARA 2HTMA 2X1RA 1WZLA 4TMBA 2AMXA 1L1PA 5H1WA 1MVYA 4H00A 1Q4NX 4QJ5B 3K8LA 3QTPA 1KQYA 1MW0A 4JX4A 4MB3A 3VU2A 2XGZA 3G1XA 4XQ6A 3RLHA 4CD6A 1SJCA 2AL1A 2IQ0A 4B15A 3CU2A 4OBTA 3KOFA 3EA2A 4WJEA 2QKFA 2UWFA 1S2VA 1QU4A 2XYLA 4UQCA 5DXYA 2TAAA 2B0MA 2YCKX 4LV9A 1AL8A 5I06A 1JCXA 5CZ0A 4DF1A 1F6YA 2YOCA 3LNMA 1HGWA 3QSTA 3VIMA 4IGMA 2I5QA 1OIMA 4R85A 3GB6A 1ZJAA 4BI7A 1HJUA 2F6XA 5A5WA 4GC3A 2DZAA 1W5QA 3TQPA 3M0LA 4DNHA 4XSLA 2IXVA 3HGRA 3WELA 3II1A 2UY4A 2FZBA 3C3NA 2VC5A 1K9DA 3KZPA 3W25A 4B5SA 3AICA 2ZUTA 3L5LA 1P6BA 1P43A 4QBXA 4L56A 2LKNA 4H1ZA 3S1VA 4OQVA 5E6YA 4HK5A 3CV6A 1WBJA 2ZE0A 3IHZA 1O6IA 4JNMA 1KNWA 1WDDA 2V5BA 1XH1A 4WEVX 3DG7A 3UZ5A 1CDGA 2OZ3A 4UTJA 3IJLA 3TWAA 1OSEA 2YZRA 3OLGA 3M0VA 3UXLA 1J2BA 1I2OA 2WNWA 5EMKA 1ONEA 1SJAA 4JIPA 4ZA0A 4GD0A 4A3QA 3WX7A 3WQ6A 4DO6A 2PC8A 1LWHA 2C0HA 1AJZA 3B8TA 2YPIA 3BJSA 4WDTA 4YIWA 3KWXA 4AVNA 3WLNA 3BV4A 4GACA 1T96A 3ZXWA 5SWUA 2ZKMX 1VRDA 4L3NA 1E4IA 1KT0A 3H6OA 8RUCA 3ZM8A 3W1NA 1LTDA 2YFOA 1RY8A 2WSPA 5I77A 5TAOA 3PFMA 2QCGA 5F2GA 3TYEA 4IGNA 1Q7MA 2QJHA 1OFEA 3C2RA 4FI4A 1V93A 4A2RA 4N9EA 3E6EA 3WDJA 2CHNA 5DY3A 1PHWA 4A3YA 4H7ZA 2YIHA 3SSJA 1H60A 2G8ZA 4YJ5A 3OBKA 3MDYB 2JKPA 3GG7A 3UY8A 1M41A 3HPAA 1O68A 3GVQA 4YTRA 1FHDA 3AMDA 3W2LA 5D37A 3OYXA 3GXIA 1ZCCA 2P53A 3LGEA 2PTWA 4R53A 2FMNA 4U86A 3SCNA 3V5CA 3KCEA 3PG9A 3VAWA 3ME3A 1JD7A 3W29A 1I6NA 4RXGA 4BWLC 4NVTA 3NEHA 1UD3A 4JEJA 5K9CA 1Q8JA 2WJEA 3GTHA 3GHUA 3L4WA 1VLIA 5FF7A 1V3LA 4ZOAA 3BAXA 1BYCA 1QNQA 5CGMA 2J7GA 4R0XA 4OVXA 3T4CA 3UJFA 3WJYA 3H7UA 3SQMA 4W9QA 4CU6A 1E6PA 4TVUA 1DIDA 3BSHA 1ZY9A 1FDJA 3HQPA 4FLSA 5HWMA 1R2SA 3HU7A 1EA0A 1QNOA 1OYCA 1Z69A 4AX6A 5A3HA 1F4HA 2PGFA 4BQ2A 4NHVA 3M0HA 4DO4A 4PMVA 1H1YA 3ID7A 1RCXB 3KRZA 3T0DA 3LY0A 3CLMA 1DORA 5CLWA 2QJGA 4NZJA 3I7RA 1XFCA 4IQ2A 2WOQA 1M5WA 1ZK6A 1XYZA 3RGCA 3LYEA 4IIDA 1ZBKA 3MPGA 3ARRA 4ZOCA 4OECA 2Z26A 2VL4A 3LTYA 1X39A 3EDJA 2QEZA 1UOZA 3GFYA 2XIJA 2X41A 2ZOXA 2VURA 3ABZA 4RUBA 3K4WA 4UTIA 4WCJA 2BOEX 3R6IA 5F7UA 2QNEA 1CT5A 1W3IA 1HG3A 4CQ9A 4J3TA 2VGBA 1B4EA 3OB8A 1QK2A 4E4PA 4Y9MA 2WQDA 2YCLB 5G4HC 1VPXA 2PDHA 3WNLA 5F2IA 2NVDA 3MKKA 3CBWA 1P5QA 4DB7A 3REQB 1O5RA 1VD6A 3S2NA 1XLBA 4RZ5A 3B9AA 5DXXA 3B4UA 5A6BD 1N7KA 1E1CA 2Q71A 1SJBA 2PLJA 3VGGA 2J62A 1LRNA 4QQUA 4QS5A 3MCMA 2QUVA 3BQ6A 2V3DA 4IUGA 3FKRA 3RRAA 1VCFA 3TCZA 4DWDA 3CHVA 1DPMA 2PWGA 2B7PA 4XSMA 2Y5JA 5E5CA 1P0EA 3S9YA 4P5UA 1GKRA 3VE7A 2B7OA 3GDMA 4NJKA 4JTJA 2PODA 4CEUC 2PV2A 4IJBA 1KRBC 3AALA 2HVOA 1XKYA 4FMVA 4FF7A 2V3FA 2M1IA 1WDRA 4MAZA 4QISA 3N25A 1FXQA 1VYSX 5EMJA 1IXQA 3VDAA 4NQ1A 1VHNA 2ZDSA 3PZNA 3A4XA 4K1WA 5I98A 3UD6A 3RU6A 3L4YA 3H2MA 2H90A 3NURA 1D7JA 3HGJA 3S46A 4W87A 5HK4A 1B90A 3BTNA 5F4XA 2GVJA 4LYQA 4H6RA 5D09A 3MSGA 1B57A 3O6YX 4R3UA 1J01A 1J0IA 1I1XA