3G6MA

Crystal structure of a chitinase crchi1 from the nematophagous fungus clonostachys rosea in complex with a potent inhibitor caffeine
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
388
structure length
388
Chain Sequence
TGSINAVYFTNWGIYGRNFQPADLQASKILHVLYSFMNLRVDGTVYSGDTYADLEKHYSDDSWNDIGTNAYGCVKQLYKLKKANRSLKIMLSIGGWTWSTNFPAAASTEATRATFAKTAVEFMKDWGFDGIDVDWEYPASETDANNMVLLLQRVRQELDSYSATYANGYHFQLSIAAPAGPSHYNVLKLAQLGSVLDNINLMAYDYAGSWDSVSGHQTNLYPSTSNPSSTPFSTKAAVDAYIAAGVPASKIILGMPIYGRAFVGTDGPGKPYSTIGEGSWESGIWDYKVLPKAGATVITDSAAGATYSYDSSSRTMISYDTPDMVRTKVSYAKGLGLGGSMFWEASADKTGSDSLIGTALSSMGSHDSTQNCLSYPNSKFDNIKNSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and mutagenesis analysis of chitinase CrChi1 from the nematophagous fungus Clonostachys rosea in complex with the inhibitor caffeine
pubmed doi rcsb
source organism Bionectria ochroleuca
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Chitinase
total genus 144
structure length 388
sequence length 388
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2009-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3g6mA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3g6mA01
1IV8A 4OKDA 3BC9A 2G3MA 5CSUA 2XFRA 1BSIA 2V3FA 4PCTA 1JI1A 1MYRA 1UR9A 3WNNA 2XM2A 4KGJA 2W63A 2XYLA 2WLYA 1UR1A 4MNLA 1FP9A 4YN5A 1GHRA 3IK2A 1E55A 4KRUA 3ARRA 1G1YA 3VIIA 2VZUA 2VZSA 4F8XA 1CGYA 1PX3A 3CGTA 3VGDA 4Q22A 1W1VA 2YOCA 4GI8A 2XFYA 5BCAA 3RM8A 3WUEA 4D6HA 5A6AA 4A4AA 3CUHA 4UQAA 3CZLA 2ZXQA 3L4XA 4JL2A 1V03A 4CU6A 5BXTA 1XD1A 2VCBA 1W3KA 1OGGA 1LLOA 3AXXA 3OLIA 3VO0A 4QDMA 2E9BA 4W87A 3RDKA 3MSDA 4J3WA 3WQ8A 1C8QA 2Y8KA 3L4UA 2WZIA 2BVYA 5D8WA 1IZKA 1V6VA 3WQVA 5A2CA 3BGAA 2ESCA 4LQ1A 4GKLA 4U5KA 2VC9A 1CTNA 3SCSA 3WF1A 2A3EA 5I0DA 3HN3A 3NDZA 2NT1A 3MMWA 3UG4A 3WEMA 3L4ZA 2X1IA 3OLEA 1V0KA 1ITCA 1E6ZA 1JNDA 4AW7A 1WP6A 3WQWA 1J0IA 2VZOA 3PN8A 4MPKA 2YA2A 2FGLA 3N11A 2WHLA 2C0HA 3TP4A 4JKLA 3VKKA 3FHQA 1W9DM 3MSGA 2A3BA 3UR7A 1PX4A 1NWUA 4JKMA 3F5KA 4WKHA 1JZ3A 2GDVA 1B30A 2J4GA 1OCQA 3CIVA 4PRWA 1E4NA 3PZ9A 3BH4A 3VINA 2YLAA 4JCMA 4CCDA 3KL5A 4J3TA 3TTQA 2WVVB 2BXZA 4XX6A 1UR0A 2PBGA 4H7VA 1GPFA 3SUSA 4HP5A 2NSXA 3AIEA 1CGTA 2WSPA 2J7FA 2VR4A 2VX6A 1XYZA 1ZU8A 4QLJA 2WCGA 1AMYA 3S6TA 3L4YA 5A8OA 3TA9A 1JNEA 1B31A 4CUCA 4PMYA 1KB3A 1BF2A 4CD4A 3FXYA 5GNZA 2CEQA 1US2A 2ZOXA 2VRQA 1WDQA 3TTYA 1FH9A 3VX0A 4HU0A 1TVNA 4PMVA 5ECUA 1EOMA 2GJXA 4JAWA 1HJXA 2GJRA 3EDEA 3GXFA 1JDCA 4U3CA 4UFJA 2V3DA 2IUZA 3K8LA 1QHZA 2DH2A 5DFAA 4UR9A 3GNPA 4H8UA 1KR1A 3ZSTA 3PTQA 1KGXA 3GM8A 2DSVA 2XHYA 2QHAA 4D6EA 1HT6A 5AC5A 1KXHA 2XSAA 1VENA 4WKAA 1H0IA 4BQ5A 1LQ0A 1OM0A 2ZUTA 1E71M 3NSMA 3SUTA 3WMBA 4MJ2A 1GQKA 2WHKA 1BG4A 1WZKA 1JAEA 3GH5A 3GH4A 2CHOA 4UFLA 1OT1A 1W1YA 2XVLA 1W9XA 4EE9A 2VZVA 3N04A 4QCEA 3VIGA 3ARYA 2BV9A 5D9OA 2ZUVA 1D7FA 3SIMA 1G01A 3F5JA 3KZSA 3OB8A 5A8NA 2X0YA 1CDGA 5A3HA 1BFNA 2PI6A 4AY1A 4J27A 5E0CA 4MNMA 4PTMA 2OSYA 2WMGA 5BYWA 4Z2LA 3ARTA 1MQPA 3GDBA 4FLOA 1B0IA 3OZPA 1BHGA 1XGZA 3KL3A 4M1RA 3WF2A 4AIUA 4XV0A 5M17A 3SURA 3AIRA 4GZJA 1K9EA 5DO8A 4D72A 1W3LA 2JF7A 5JIPA 4JFTA 4N0RA 3U5UA 5E9AA 2BY1A 2E4TA 1QVBA 4FLRA 1ISVA 3PTKA 3AIQA 1YQ2A 1E1FA 2J7DA 5A6MA 3AIBA 1KCKA 1QHPA 4D6GA 1RD6A 3ARXA 1UD4A 3CZKA 3LPGA 5HBFA 5CZKA 1ZL1A 4W84A 4Z2IA 2WMKA 3N18A 3AIVA 5ABFB 2CETA 1KWKA 4W5UA 5BXSA 1HJWA 1V3JA 2V5DA 2OSWA 1E6PA 4HPHA 3N12A 1UG6A 2Y2WA 2YLLA 4LYQA 4U31A 5I5RA 3RCNA 2VOTA 1JYVA 4TTGA 1VJZA 3ZJ8A 1VAHA 4UQBA 2XVNA 3TOPA 1HNYA 1QOXA 4U2ZA 2W4XA 1JYNA 5E0FA 4AEEA 1JDDA 3SUUA 3AHXA 3UEQA 3U57A 3SCUA 1GOQA 1WCGA 1AQMA 1WO2A 2JIEA 2ZX7A 2DSKA 3MUY1 3RO8A 2PC8A 5CJ5A 1GCYA 2O9TA 4ACZA 2XG9A 3AHYA 3T0DA 2DSWA 4MADA 1CECA 4HA4A 6CGTA 1VF8A 1FOBA 1BYAA 5JBFA 3T08A 1E6SM 1S46A 3L4TA 2XVKA 5DF0A 1XCXA 1AQHA 4HA1A 2ZX6A 1CWYA 1ESWA 1XSJA 2G41A 3SEPA 4YHGA 5LYRA 1NP0A 2V5CA 4UFKA 5C71A 3TONA 1WZAA 1EHAA 4MJ4A 3UCQA 1MWOA 2OWWA 5IHRA 3N1AA 1HL8A 1X6NA 2WWDA 2Z1KA 4CVWA 3VNYA 2WXDM 1UWIA 1V0MA 4TXEA 2WAGA 3POCA 2X8RA 3WKZA 2WCSA 5JBEA 1BTCA 1NOWA 1EGZA 1VFOA 2XVGA 3O9NA 3QHOA 1VB9A 4ZFMA 4D6IA 1QI3A 1FH7A 2XIIA 3MUIA 4R27A 1GONA 5GNYA 4D71A 1QPKA 4ZEPA 1Z32X 1JZ8A 5M5DA 3WNPA 5HPCA 1SYTA 1E3ZA 3AICA 4IUGA 3ZJ6A 1CYGA 2J79A 1FA2A 2BXYA 3VILA 4AZBA 2GSJA 3K46A 4D6CA 1A3HA 1PJ9A 3BAWA 2EPLX 2E3ZA 4JCLA 3SCVA 4WLCA 1BVZA 3CZGA 4UQDA 4MTVA 4W7WA 3CZJA 3WBEA 3A47A 2J25A 1XH1A 1B3WA 3NIYA 1HN1A 1PX8A 1W32A 2CPUA 1NARA 5EMYA 2CCRA 1H1NA 4BF7A 3I3BA 1CGUA 4TOQA 2C7FA 2J7HA 2FH6A 2A3AA 4B9YA 3MV11 1CBGA 2WMIA 1QI4A 5FCZA 3PZNA 2OWXA 2UY2A 5A8PA 2GJPA 4JHOA 1CIUA 1CXHA 2VMFA 5IHSA 3BSHA 1VEPA 4DWSC 1CXEA 3IJ9A 3SUVA 4B3LA 1V6YA 1WDSA 2X05A 2YL6A 3WDQA 1HP5A 5D9MA 1QNSA 4AISA 4LYPA 3VGFA 1M7XA 1W1PA 1V0NA 3WF0A 3WELA 3MUAA 1E6NA 3WD2A 1CXKA 3WFLA 1JYXA 1TCMA 3VPLA 3ZR6A 3CMJA 1PZ2A 1WZMA 3AYRA 2YL5A 1NWTA 3W82A 4CCCA 1Q6FA 3VGBA 1I75A 4EAMA 2PF0A 1E1EA 4BCEA 2VR5A 1E70M 1E72M 2OWCA 2WZEA 2OYMA 5C70A 1NOUA 4UCFA 3RM4A 1MW1A 2W91A 4AIOA 3OZOA 5E6YA 4DUVA 1B90A 1ZJBA 2ZE0A 3DC0A 2O9OA 2XFFA 3VX1A 1H09A 2QMJA 3WNLA 2WVVA 1V3MA 4ZXOA 1JGIA 2WANA 4B15A 4MAVA 1Q6DA 3ZOAA 2VI0A 3PZIA 1LL4A 2GVYA 1H4PA 1B1YA 1B3XA 3WQ4A 4FLSA 1UD8A 1BG9A 4GQRA 5TD4A 1EA9C 3VIKA 2ZX5A 1CGWA 2UY3A 2FHFA 1B2YA 2VUYA 1VBRA 1KXVA 3MANA 3UETA 2VVNA 3CMGA 1RH9A 2PB1A 1FHLA 1W9PA 4UZSA 5M03A 3M46A 4AD3A 2J7GA 4C7FA 4DM2A 2DSUA 1R7OA 5A6BA 4W8LA 2W66A 4J3XA 1B3ZA 1KBBA 1WZLA 5JIWA 2HVMA 2XVPA 1VFUA 3MS8A 2ZUSA 2NW0A 3ZIZA 2XJ7A 1J11A 1WPCA 4GZIA 3QGVA 1LL6A 1E4MM 3FHAA 5BROA 5I6SA 4AYSA 1US3A 3D3AA 2WBKA 3CUIA 3PZTA 4PEEA 3CUGA 4CD6A 1UD5A 1OIFA 3K1DA 4CN4A 2VTFA 3SCRA 1W9VA 1JFXA 4AD5A 3CHCA 2VO5A 2HISA 1TE1A 1CXLA 3ARUA 2D0FA 4PTXA 3BLPX 4HOWA 2QPUA 1JG9A 2MANA 5FL1A 1E5JA 1UA7A 3SCNA 2J74A 4OUEA 4FF5A 1E4IA 4JFUA 5A6BD 3U5YA 1BYBA 5A8MA 3WH8A 3WSUA 3WF4A 3WDIA 2DQXA 3KE0A 2WVTA 5A8QA 3OLDA 1HIZA 2BNJA 1OIMA 3ARZA 3KL0A 1TVPA 4AXNA 3ECQA 3T2OA 3ZT5A 4W86A 3W24A 1C8XA 3PZUA 1MW0A 4DWSB 3AS1A 4Q7NA 2VCCA 1JZ6A 3VTRA 2FDMA 2CXGA 4S3JA 1OGSA 1L8NA 4W7VA 4QCFA 2BY0A 1JD9A 4NI3A 2GFTA 1FP8A 5CXPA 2E8YA 1HKKA 1HX0A 1J9YA 5IFPA 5GQBA 3PZMA 2E0PA 5A2AA 1QNRA 4B9ZA 2W5FA 3EMQA 4AIEA 1QI5A 1XHGA 4U2YA 2BHYA 4P7LA 4TVUA 4AZCA 2JFEX 3AOFA 1UWUA 1SMAA 4H41A 4LXFA 4PMOA 2XGIA 3NSNA 1BYDA 1DWHM 2RGMA 4PMZA 3QOKA 2DT0A 1CLVA 1GZJA 4GI6A 2YKKA 3NJ3A 3W0KA 2WSKA 4IISA 5LA1A 1EXPA 1ODZA 3RIKA 2V3GA 4W8AA 3ZT7A 4H04A 2AMGA 5FOOA 1TUXA 2OLHA 2WZHA 4UFHA 4CU7A 3WL0A 3NYDA 5A6KA 1JYWA 2OYKA 3FY1A 3RILA 2ZX9A 1ZBKA 2VRKA 5I79A 1ZB5A 2G8ZA 2JEPA 5JH8A 4W85A 4ACZB 4PTWA 1WDPA 1E6XM 3MMDA 4PSPA 2DGAA 1ZBVA 2F61A 2ZWZA 4BA0A 3AQUA 3POHA 4J3UA 4PSRA 1UUQA 3AS0A 4PMNA 1C7SA 1EQCA 3ZMRA 5AC4A 2PWDA 2WNWA 2UWFA 2EPKX 1XCWA 2D2OA 1TMQA 3RMEA 4YHEA 3WDRA 1LJYA 1W2PA 3L2LA 2WK2A 4B3KA 5JBDA 1UQZA 2GK1A 5I77A 1F4HA 1UQYA 1J01A 5HXMA 1KQZA 4N42A 3WNOA 2G3NA 2J62A 1GOIA 4AD0A 2QMKA 3K4DA 1KR0A 2WCAA 3APGA 3RJYA 2ZX8A 1QI0A 4RE3A 1H2JA 4M82A 2XPKA 2C8NA 1QNOA 3UG3A 4KWUA 3ZR5A 1V6WA 5LA0A 2Y5EA 1F4AA 2YA1A 5A94A 3THDA 1M01A 1EO7A 3FN9A 5A2BA 4HZ6A 1HF6A 4WF7A 3VIJA 3ARVA 2BY3A 4P7NA 1MQRA 1UWSA 1G5AA 2QPSA 2J8GA 1XH0A 5A69A 3DHUA 3W25A 2J77A 2UY4A 1ZBWA 1W91A 2XWDA 3CBWA 3GBEA 4URIA 1KWGA 3PZQA 2FHBA 2CKRA 1GHSA 3FW6A 2GJXB 4M56A 2WC7A 2J7EA 3CHDA 3M6DA 3MV01 3NDYA 4UOJA 2WMJA 3ARSA 3TTSA 3HMCA 5BXRA 4LGXA 1NQ6A 2J75A 4AZIA 1K6AA 3VDBA 3A6OA 4NRSA 3VD4A 4F9JA 4JFWA 4JFSA 4PUDA 3VMOA 3VDAA 2BVTA 3N17A 1V6XA 3WENA 4GINA 1TR1A 3WN6A 3W6LA 3WUBA 1YHTA 1AVAA 5HDRA 4V28A 4K68A 5A6JA 4UTFA 4TX6A 5DEZA 3O6AA 4NF7A 4OBRA 3SUWA 2EO7A 3CHEA 2ZUMA 4F79A 3AISA 5CLTA 1UR2A 3A4WA 3AIWA 4CD8A 3WEOA 2WKGA 3VVGA 2ZICA 4D1JA 3L2MA 4OJYA 4GQQA 1IZJA 1GOKA 3VUPA 2W61A 2VVSA 2FHCA 1MFVA 2YA0A 2ZWYA 3VIHA 3VIPA 4AZ6A 3GZAA 1U2YA 2F2HA 2G3IA 5JUVA 3W4RA 4GO9A 3VD9A 1XYFA 3QHNA 5A6SA 4LPCA 1C91A 1HJSA 1TG7A 4HZ7A 3BAIA 3WQ5A 1GUVA 2Q8XA 4S3KA 7TAAA 1E9LA 2PWFA 4XUYA 3VD3A 3OGVA 5ABEA 3W26A 1LF1A 1O7AA 1HXJA 1QW8A 2YDSA 1CXFA 1B9ZA 1E56A 2XM1A 1CEOA 3VOCA 4AEFA 4ATDA 4EKJA 8A3HA 3OGSA 1VIWA 3RPMA 3WD0A 1PPIA 1HKIA 2WYSA 1XH2A 4P8VA 2OYLA 3ZM8A 2EPOA 2D23A 4UNIA 4OIFA 4A3HA 3GH7A 1C93A 2G3JA 2DIEA 2J78A 2YJQA 5FD0A 5HNNA 3VNZA 4GI9A 3VM5A 1LL7A 4KH2A 2WPGA 4WK9A 1L0PA 2VCAA 4PUEA 4CD5A 1JXJA 3VMPA 2EXOA 3M7SA 3WIJA 1B3VA 1V3HA 3N13A 3WY1A 3ZJ7A 1PIFA 4CCEA 1UWQA 3FAXA 4V27A 1GW1A 4J3VA 3B9DA 1NOFA 1CPUA 1KXQA 3EMZA 5CG0A 1E0WA 1WE5A 5CQ1A 1NP2A 4D1IA 3B8SA 5I3DA 1X1NA 1JZ2A 2YBUA 4H8VA 5AYIA 3AI0A 1R87A 1UKOA 7A3HA 3CZ8A 3S2CA 1VFFA 5HPOA 5AY7A 2WVSA 3RJXA 4X9YA 3GNRA 4OZOA 4TTUA 2PWGA 3BCDA 2D24A 3WD1A 1GJUA 4QAWA 1R7AA 3PZGA 1EQPA 1UKPA 1BLIA 4OOUA 4AWEA 5EFFA 1GQLA 4Y7EA 2DIJA 1XV8A 4Z2JA 3AIUA 3WDPP 1KQYA 2D3NA 2WVUA 3BCFA 2X0HA 4PYSA 3II1A 3WQ6A 1Q6CA 4U33A 2OSXA 3CZEA 3SCOA 3UESA 1JZ7A 3AMGA 9CGTA 2PBOA 4RL3A 3VDCA 2CITA 1OBAA 3W29A 1JF6A 4M24A 1FH8A 1XRVA 1BYCA 4D6FA 5BWFA 1CLXA 4HOZA 1C8YA 2PWHA 4GPNA 4RE2A 2V3EA 4LX4A 1RP8A 3J7HA 1GVYA 4B16A 3VIMA 1GOMA 4JKKA 2EBNA 3AZSA 4QLLA 4MNKA 4W7UA 1W9UA 1JZ5A 4AD2A 4ZXLA 3ALGA 2D0HA 3BLKA 5FIPA 1V3IA 4GZEA 5DT5A 4UQCA 4W93A 1E15A 4AZCB 4R5EA 4PMDA 4XZWA 5A1AA 3N15A 1I1XA 4P7QA 1FHDA 3VU2A 2WC3A 4HZ8A 4J3SA 5BXPA 3WH7A 4Z2HA 2UY5A 2QV4A 4HU8A 1M03A 5I23A 3IAPA 2WMHA 2Z1SA 3QR3A 1PIGA 4E2OA 1UZ4A 3OGRA 2A3HA 3VGGA 3BAXA 1VRXA 3EBVA 2WHJA 3O2LA 1U33A 4HOXA 1XC6A 2WMIB 1UH2A 1W3JA 5I2UA 4P8XA 2W62A 2JEQA 5LA2A 3EMCA 4MB1A 3GBDA 1OSEA 2IXVA 2WW5A 3WDHA 2ZUUA 3EDDA 1MFUA 2WWCA 1EH9A 1H5VA 1D3CA 1ZBCA 1VEMA 4PMXA 2CYGA 2DEPA 1JAKA 4PMQA 4UZUA 1QI2A 3EDJA 4E4PA 3CO4A 1P6WA 3F5LA 4ATWA 1WB0A 2DDXA 2Y8VA 1E43A 4PBGA 3BMWA 4X0NA 2VQTA 1E73M 4AD1A 2WHMA 5BRQA 4BQ2A 4AZGA 3MMUA 1VJSA 3WUFA 1O6IA 2X2YA 4W5ZA 5E6ZA 1LWHA 1PBGA 3AXIA 1EIBA 4L4OA 4D6JA 2EEXA 1ISYA 3VD7A 2BHZA 2W92A 3IAQA 2O92A 1JIBA 2DT1A 3OBAA 5EB8A 5EFDA 2BHUA 2Y4SA 4U5IA 5C8BB 3KEHA 3BXWA 1HJUA 5E70A 3W27A 3DECA 4D6DA 2YBTA 4P8UA 1XD0A 4UQ9A 3SCQA 4BS0A 1TA3B 1ZS2A 2EJ1A 4DWSD 1NM9A 4W8BA 1KFWA 1W1TA 2VQUA 2D20A 1G94A 1GQIA 1VEOA 2CBUA 1DWAM 4XB3A 1C90A 3WNMA 1Q6EA 1CXIA 1ISWA 1FFQA 3BSGA 4HTYA 5CGTA 2CERA 1LG2A 1ITXA 1W3HA 4MNJA 1GJWA 1ZJAA 1J18A 1QHOA 5KEZA 1WDRA 1OT2A 3ZJKA 1QW9A 4YPJA 2VJXA 2J8FA 1HL9A 2EPNA 2G4FA 3VIFA 4NZCA 1JD7A 5M3WA 1JFHA 2WB5A 2XGBA 4CD7A 1K9FA 4BZYA 3VDHA 1UYQA 5F7UA 2BS9A 4Z2KA 1PAMA 3QOMA 1DHKA 3LPOA 1HVQA 3MUZ1 4M8UA 3PHAA 1HP4A 1J0YA 4JL1A 2VZTA 3AHVA 5A95A 4DUXA 1UKTA 1V3LA 1E40A 1R86A 2ZXBA 1TFVA 4NRRA 4WSKA 4GO8A 2XUCA 2O9RA 3WH9A 3WD3A 1OD0A 4UOQA 3CHFA 1UH4A 1V02E 5D9NA 4KMQA 3THCA 5DMYA 2RGLA 3RM9A 1E0XA 2QLYA 3U7VA 3AJ7A 1UWTA 5FKYA 3ARQA 4TVCA 4P7OA 2J7CA 1BQCA 3UG5A 1H11A 2YL8A 2D22A 1E4LA 5AYBA 1GOWA 1TZ7A 4E8CA 1M04A 4IM4A 3AYSA 2V38A 2CKSA 3VGHA 1EO5A 3WH5A 4PMUA 5I24A 3PTMA 3PBGA 2ZUNA 1QNPA 3IJ7A 1UR8A 2ZXAA 4QLKA 5CGMA 4PMRA 1Y7VA 3AHTA 4JZ5A 2E8ZA 3VIOA 1NWSA 4DM1A 2BY2A 4WJXA 1MXDA 3EDFA 1C3FA 4IPLA 3CLWA 3WBAA 3CTTA 2XIBA 4LYRA 1UH3A 3E1F1 1NWRA 1QBAA 1BGGA 2IXUA 4U3AA 4CVUA 2VX4A 5GNXA 5KZ6A 1DWFM 1VBUA 4TUFA 1J0HA 4P7RA 2D3LA 1CGXA 1CGVA 3T2QA 1ISZA 2JALA 1UZ1A 3DYOA 1GQJA 1EDGA 2E40A 3HJEA 4MB3A 3VMNA 2CNCA 4RE4A 4AMCA 4HA3A 3FNDA 1BGAA 2NT0A 2JIWA 3WFZA 3CUJA 1HKMA 2ZXDA 2XWEA 3I3EA 2YL9A 1KGWA 1OD8A 1ODUA 1CENA 1UKSA 2XSBA 4IPNB 1CNVA 1V3KA 4H8HA 2ZIDA 3IANA 3WH6A 3VM7A 1EDTA 4QP0A 1JZ4A 3W81A 5D8ZA 3DYPA 4MB5A 1AQ0A 4GIAA 3AZTA 3ALFA 2GUYA 3ZO9A 1W9BM 4MAZA 2GK1B 1GOOA 3DYMA 1N82A 3OA5A 3OLGA 1J0KA 3T2PA 2CHNA 1GORA 3GXIA 1NH6A 4E8DA 1G0CA 1WAWA 1MW2A 3GXDA 4BQ3A 2EPMX 2JE8A 3K4AA 2BFGA 4CU8A 2CESA 4L4PA 5CLWA 2A3CA 5FL0A 3K8KA 4HMEA 3BAYA 5GPRA 1Q4NX 1JI2A 3GNOA 3CUFA 4JHZA 2WLZA 1XSKA 1UOKA 4EANA 3AZRA 3VGEA 1KXTA 4P8WA 4M80A 3B9EA 4X0VA 2FGZA 1V08A 1SMDA 3SCPA 4ATLA 2ZUWA 4ZE5A 4V2XA 2O9PA 6TAAA 1C7TA 3LPPA 1EDQA 3ZQ9A 3A4AA 4ZENA 1UD6A 4EK7A 2DT2A 3NUKA 4AZHA 4J28A 4AZ5A 2CBIA 3PZVA 4FK9A 3W37A 2VT0A 5DT7A 1KCLA 3AHZA 5HOSA 4CN6A 4UFIA 1OB0A 1SFSA 1JL8A 2VNCA 3A4XA 3ZT6A 3L4WA 1DEDA 3D5HA 5CPQA 2YDQA 1DTUA 1E6QM 1V6UA 3UR8A 4TX8A 3SCWA 3OIHA 3MO4A 3N9KA 3G6MA 3AMKA 1DWGM 3MU7A 1XSIA 4UFMA 1HJVA 1UA3A 1V0LA 2CIPA 2Y24A 2J47A 3CPUA 3W28A 1Q6GA 1UD2A 3B9AA 2XTKA 4FLQA 1GNXA 3T0AA 1DP0A 5ABHA 5A6LA 1EOKA 1KBKA 3W6MA 3HU7A 3JUGA 3AMCA 1LG1A 1UWRA 1KGUA 6A3HA 4JIEA 4GXPA 4CN1A 3WEZA 4QFUA 1JXKA 2WKLA 2VX5A 5EBAA 4W89A 3LMYA 3ZSSA 4FMVA 5ABGA 5E09A 1DWJM 4UQEA 1MW3A 4AZ7A 4PCSA 8CGTA 3AS3A 2AOSA 1MQQA 1J0JA 4WKFA 4NSBA 3WDJA 2VRJA 4PN2A 1MXGA 3M07A 3I3DA 3BMVA 3OG2A 1OGBA 3GTNA 4MB4A 1B3YA 3AMLA 2QF8A 3ARWA 4PTVA 4AD4A 1E3XA 2WM0A 4M81A 3CH9A 1V02A 5IFTA 2WC4A 2WMFA 4WIWA 4A3YA 1W2VA 4WSJA 1RP9A 1FFRA 5I78A 3WMSA 1A47A 3GYCA 4MDPA 3VD5A 1LWJA 2FH8A 1H3GA 1EHNA 1C92A 1ECEA 1E6RA 3TTOA 4DUWA 3KWXA 3WL1A 3UERA 3WNKA 1E0VA 2DT3A 4M29A 1BAGA 4F9DA 4W88A 1M53A 1TA3A 1J12A 1WNOA 1QNQA 3WUGA 3IJ8A 4F66A 3AS2A 4OOZA 1JF5A 2VL4A 1QBBA 1VFMA 1HVXA 1UR4A 3K8MA 2DH3A 2D0GA 1PZ3A 2E9LA 3SCTA 1J10A 5ABFA 3AXHA 1UKQA 5IDIA 3WD4A 2DSZA 4AC1X 3T09A 3MKKA 4MDOA 3W53A 4UOZA 2GDUA 4ACYA 2F8QA 2TAAA 3WF3A 1UHVA 1K9TA 3GXMA 2CBJA 4H2CA 2B31A 4BQ4A 5CPTA 1X6LA 1G9HA 5D4YA 2W67A 1WKYA 4KGLA 3NCOA 5CSYA 4OBSA 3BAJA 1IT0A 1ISXA 2VURA 4ZE4A 1HKJA 3ARPA 2PWEA 2VX7A 1PEZA 2BVDA 3T0BA 2AAAA 4CKQA 4J7RA 1E5NA 2EQDA 4HMCA 1UD3A 5IXEA 2WBGA 2CBVA 5BRPA 4Z2GA 3BAKA 7CGTA 3QHMA 1J0ZA 3U7BA 2E9MA 1OINA 1R8LA 1D2KA 4XZBA 3PZOA 1OWQA 1BPLB 1GVIA 2YDRA 3A3HA 4TVDA 1H41A 2YIHA 3WMCA 4ML4A 4HPGA 4JFVA 1I1WA 1R85A 1HJQA 2DPEA 3W38A 1SR0A 3AROA 3FAWA 2D1ZA 2JF6A 3AMDA 5D9PA 3F4VA 3EDKA 1H49A 3EYPA 1CZ1A 3LPFA 1JDAA 4C7DA 1K9DA 3G6LA 3L4VA 2X09A 2J7BA 3AFBA 4CGTA 4C7GA 1DWIM 3DHPA 5CPSA 1MVYA 1H0GA 4KRTA 1RPKA 1U30A 3NSXA 4HMDA 1BVNP 4DWSA
chains in the Genus database with same CATH superfamily
1IV8A 3BJSA 1POJA 3S1XA 4GK8A 1BSIA 1IXOA 1GTEA 4NNAA 2J66A 1J4HA 3WQCA 1JI1A 5C55A 1UR9A 2XYLA 1YNPA 4WY0A 2I5IA 1GHRA 2HEJA 2HE5A 4KRUA 3IHZA 3ELFA 3ARRA 3PSVA 3VDGA 1CGYA 5FF7A 7REQA 2YSWA 3JZUA 2YOCA 4Y96A 2OPJA 4ZQRA 3GUWA 3RM8A 4XAFA 4P2VA 4MG4A 3WUEA 4JDBA 3KTSA 4A4AA 2VGFA 4WGXA 3W02A 2YCIX 3W22A 3UT0A 1W3KA 3RXZA 5C0QA 3OLIA 5HUOA 4QR6A 4QDMA 1MNSA 2E9BA 2TYSA 3DUGA 3RRXA 5DCDA 3KWSA 1C8QA 3L4UA 5D8WA 2BVYA 3RG6A 1PB0A 1V6VA 2H9AB 4MFDA 2O4MA 2PTXA 1ADSA 3LLXA 4JTAA 3ICJA 3N3TA 2AMXA 4Y9AA 3UF9A 3L12A 3MMWA 1TJ0A 4PEKA 4WXZA 1F76A 4BI6A 5HQLA 4V1YA 1XLEA 4Q8WA 4JKLA 4R9XA 4D8LA 3BVJA 3MSGA 5I3IA 4O52A 3CJPA 1TMLA 2UV8G 4FX8A 2DUZA 3F5KA 2KI3A 3TQ0A 3PUEA 1B30A 2J4GA 4GACA 3S1GA 1OCQA 5LIKX 2PDMA 1YEYA 2FDSA 4JCMA 3KL5A 4J3TA 3TTQA 2WVVB 3LXAA 2PBGA 1XIBA 4O53A 3GR4A 4OVXA 1XYZA 3UNTA 3IEBA 3FSUA 2YXOA 3P81A 3L4YA 2MPHA 4H01A 1AODA 4ERAA 4PMYA 1KB3A 3E96A 1BF2A 1S5WA 1DPMA 3W76A 2CEQA 1US2A 1ZY9A 4Q4MA 4H9VA 1TVNA 1EOMA 2GJXA 3EDEA 2P5NA 3GKAA 1TWDA 4DBEA 3GUGA 4YTQA 4JTRA 2V3DA 4F2TA 4QEHA 1GEHA 1LLWA 2ACSA 4RV8A 5DFAA 3L5MA 4UR9A 4H9TA 4MJZA 4F48A 5C9RA 3T40A 3RMJA 4AWSA 3BLFA 1VYRA 2WJFA 4D6EA 3TW9A 4WKAA 1H0IA 1GYMA 3SAZA 2ALDA 3NSMA 3SUTA 4MJ2A 1SFTA 4UTLA 3CT2A 4LEFA 3GH4A 4HBOA 4QDPA 5HJXA 1IF2A 1KNWA 2XPBA 4ODNA 4ZSTA 3URAA 1OT1A 2X42A 3RFAA 4AYGA 1W1YA 4ODPA 4CNNA 4EE9A 5GVJA 4QCEA 3VOIA 3STPA 4GH1A 3EKLA 1UC4A 3VI2A 4B4FA 3KBWA 3O8AA 2GPTA 4GIRA 4HNUA 3FYOA 3RU6A 2ZUVA 5JU6A 1VBJA 4X63A 3O05A 1XYAA 1Z89A 3OB8A 3UZYA 4ZOAA 3ORWA 4KF1A 4J27A 4DIAA 1RHCA 3LXBA 4NG3A 4AY8A 1PHWA 5BYWA 4GGHA 3ARTA 1MQPA 1RQEA 1BHGA 1XGZA 3KL3A 1LTDA 4XV0A 4F0RA 3MUCA 3D0CA 1EUNA 2RFGA 2CLMA 3T6CA 4ZTXA 3ZXWA 4JFTA 4N0RA 1S3HA 4XZNX 2VFGA 4FLRA 4RNJA 3PTKA 3PWIA 1YXYA 4UTJA 2WOQA 4UMCA 1KCKA 2AKZA 4HIBA 4D6GA 2WO5A 2PCQA 3CZKA 1WXZA 2BOEX 3PG9A 3LENA 4FS9A 4NJHA 3N18A 2OFNA 1RXOB 3LCIA 4MKSA 4EPKA 1ZALA 4ZODA 3H8AA 3IGHX 4MOZA 4OHQA 3KOWA 1G4EA 5TBOA 4C6LA 3DHFA 4LYQA 4NIRA 4HNLA 2VOTA 3NQ6A 4FNQA 4BY3A 3ZJ8A 5L6UA 4UQBA 2XVNA 2VR2A 3N2TA 4WY0F 1TV3A 2CW6A 4PMJA 3B05A 2ZVIA 1GOQA 2XH0A 1O1HA 5FJTA 2DSKA 2PC8A 1GCYA 2PN0A 2DSWA 4MADA 1CECA 4XAGA 3R0UA 5F4WA 4I7VA 5CJMA 4KCUA 2VENA 4HA1A 1SFJA 3LNPA 2V5CA 3GZ3A 5C2GA 4UFKA 3QW4B 1WZAA 1EHAA 3B4UA 3UCQA 1FWEC 3TN4A 2Z1KA 3CAVA 4G5DA 1A5BA 1UWIA 1OFRA 2NQZA 2VEGA 4FPSA 4PE8A 4ZQNA 2WCSA 1R5YA 1NOWA 1YATA 4HGXA 1VFOA 5FJPA 1VB9A 1KRCC 5DBUA 5G4WA 1QI3A 3BOXA 2XIQA 1FDZA 1PKMA 4R27A 1OFQA 1GONA 4JTQA 1E44A 4GA8A 1IXNA 4DJEC 1SYTA 3HGOA 4XVEA 3AICA 1UIOA 1IT8A 2A7NA 4L4LA 3RCMA 4IUGA 3VYLA 1GVFA 3CGMA 3UR5A 1CYGA 1FA2A 1SSGA 3T44A 1XGEA 4QJ5B 3I6TA 4ZMGA 5BOEA 1PJ9A 3BAWA 2EPLX 4NX0A 3T78A 4UMBA 4PUMA 4WLCA 4MTVA 4YYCA 3V0SA 3A47A 1XH1A 1B3WA 3NIYA 4L64A 1QRQA 4DB7A 3V16A 3E2QA 1W32A 1RLDA 3NXLA 5EMYA 1MZRA 2CCRA 4PC8A 4GY1A 4TOQA 2C7FA 4G1KA 5U4NA 3EWXA 4B9YA 3O5OA 2VM8A 4GQGA 2WMIA 5FCZA 1O12A 5I3JA 5K2ZA 4E5TA 2GJPA 2AAMA 3U48A 4HNTA 3CTLA 1VEPA 4E2VA 3P62A 4DWSC 3SUVA 1ONWA 4KCTA 4R7JA 4AAJA 1T8QA 4O18A 1HP5A 4WUIA 1OFBA 4AISA 3SY8A 1A5LC 4HPXA 4C6QA 1M7XA 4DYEA 4RDYA 3EKZA 4I6KA 3MUAA 1JJKA 4MYAA 3M64A 1XGDA 2PSNA 3CV2A 2DW6A 2ZBTA 2XPAA 5D2VA 3W82A 4CCCA 1Q6FA 3VGBA 2I56A 3HG4A 1I75A 4BCEA 1LORA 3GK0A 4UC5A 1P0EA 1VPQA 1E72M 2WZEA 4IIHA 4BR1A 2OYMA 1ME8A 4C6FA 2E1WA 3G8EA 3NFUA 5C70A 2F2DA 2BOGX 4KQZA 1MW1A 4IGSA 5C9WA 4TW7A 1QXLA 4PZVA 2OZ3A 1TZZA 4YU1A 1IEWA 2O9OA 2HDJA 2QMJA 3K30A 1JGIA 2PWUA 2WANA 4DZ3A 1U5JA 2VI0A 1XIJA 2C91A 4GKTA 3PZIA 1R46A 5BXJA 3GIPA 4MFEA 2EJAA 3SIZA 5BOFA 5TD4A 4BWLA 2QCFA 2B7QA 3OTRA 2J6VA 4O19A 2BGSA 3NZGA 3EX6A 2VUYA 5EY5A 3QQ1A 3MDWA 1NMWA 1Q8AA 2PB1A 1W9PA 4UZSA 4PUWA 5M2FX 2J7GA 3CYJA 4BEQA 1A5SA 2ETNA 4W8LA 3DFYA 1S38A 4GIYA 1KBBA 1VFUA 2ZUSA 4KIEA 4IT6A 1LWIA 1J11A 1FWJC 4GJJA 2I57A 3QGVA 2GZXA 3UPBA 4PCFA 3QV9A 3TA6A 3CM4A 1EJ7L 3PZTA 4N9BA 3CUGA 4BWLC 1UD5A 1UUMA 5G4EA 4AVFA 1YRRA 3SCRA 1JFXA 1P1MA 5AHLA 1OYBA 4A2SA 2PRLA 1JVWA 1CXLA 4A6GA 1F07A 4HOWA 2HRWA 3ONCA 3W1MA 1E5JA 1UA7A 4FF5A 3GU0A 1BYBA 4O17A 3WF4A 3WQGA 2NQJA 2DQXA 2CLHA 4DRHA 1QAPA 4MKNA 3HGSA 3TW6A 3IV3A 3H21A 1W3NA 1TVPA 3ECQA 2JZVA 2CZVA 4W86A 1JCYA 2TSYA 3I7SA 3E0FA 4DWSB 1X1OA 4Q7NA 2ZRYA 5HQEA 5ABTA 4PTNA 4FX6M 2FDMA 4S3JA 1OGSA 3DEQA 4W7VA 3KCLA 1KM2A 4NI3A 3HPFA 3NQ2A 3I6EA 5CXPA 2KO7A 3JZEA 1EX1A 2XP8A 3T7VA 1QNRA 2W5FA 1XHGA 4U2YA 3UCCA 2BHYA 4LS2A 3L21A 5CSRA 4TVUA 3AOFA 4LXFA 2XGIA 3NSNA 2BTMA 3KTXA 3USBA 3QOKA 3P0XA 4KPLA 1RBOB 1ICQA 3G24A 2D2JA 3W73A 2WSKA 1YBQB 4WDUA 1J79A 4LH8A 1KO0A 2NV9A 1MMFA 3ZT7A 2AMGA 2Z25A 2OLHA 3H2MA 1ZP4A 4AHPA 2R8WA 3NYDA 3DFHA 4MY1A 3KOYA 4EWND 3RO6A 3WQPA 3RILA 2ZX9A 4H00A 1BF6A 2F23A 3PBYA 5JH8A 4DELA 3VOJA 3MMDA 2WZTA 3HO8A 2ZWZA 5C54A 3POHA 5FF4A 4J3UA 1B4EA 3CS2A 3OPSA 4Z1CA 1C7SA 1EQCA 2VC7A 3CAWA 3MY9A 1DXIA 5K4XA 2EPKX 1XCWA 1BKFA 2D2OA 1TMQA 5HW6A 1YIXA 1RK6A 3L2LA 4MY9A 1LT8A 4EF8A 3BJTA 7ENLA 3NQFA 1EF2A 2F2KA 5JMUA 1J01A 5HXMA 1KQZA 3WNOA 1F8IA 2E67A 4AD0A 3RJYA 1QI0A 2FZNA 2KAUC 3KAFA 2XH7A 3B3DA 4MVAA 2GJNA 4ZOCA 1M65A 4FOKA 5A94A 1BEUA 3U3HA 2Y61A 3UXLA 4WF7A 2BY3A 4P7NA 2QULA 1MQRA 4GG9A 1OFEA 1UMYA 2OGYA 3N2BA 4CNSA 4EOUA 2J77A 1YW5A 2AQVA 4IPJA 3ITVA 1A5CA 4LY4A 2PCEA 5DXXA 1HG3A 2HWGA 4X2PA 3HMCA 5BXRA 1R3WA 1IEIA 1Q6OA 4LNYA 5CPOA 3NI6A 3AXMA 3VDBA 3M5VA 4JTLA 3A6OA 4NRSA 4F9JA 4FEZA 3VDAA 2C71A 1V6XA 1JPHA 6REQA 1DOSA 4EVZA 1ML1A 1TR1A 3CQIA 3C6CA 2A7PA 1ZFJA 5CC7A 1AVAA 4RNIA 3SBFA 4TMCA 4V28A 4K68A 4UTFA 4TX6A 2F4EA 5DEZA 2QCNA 3MUXA 3NRKA 1Y8BA 4S3AA 4NF7A 4CQ9A 4F79A 4A3QA 4NT0A 5C2CA 2HS6A 4G56A 4MWAB 3VXGA 2WKGA 1OYCA 1M41A 2ZICA 1T41A 1YDYA 1QJWA 3VUPA 3G3MA 2W61A 2FHCA 1G7VA 4B5WA 3VIPA 3MP4A 4NAFB 2F2HA 3FJLA 1Q7ZA 1R38A 1XYFA 3QHNA 1AH0A 1K3UA 3ZVIA 4Q6JA 2DVUA 2DJXA 2J13A 1E9LA 1V5XA 3OGVA 5ABEA 4JX4A 4JIPA 4L9XA 3T4WA 2FTYA 5E1QA 2X7WA 4QE1A 1H5YA 3LHTA 3ERPA 3RPMA 3SDOA 3WD0A 4L9YA 4DBDA 2WYSA 4ZQPA 2OLSA 2UZ5A 4OIFA 1GVQA 2E77A 2YJQA 2DORA 3K5XA 1KC7A 2WPBA 4L65A 1KT1A 4JDYA 3UP8A 1LL7A 1PINA 4WK9A 1L0PA 4QGCA 3GVVA 1AA1B 3VMPA 4LAMA 2QIIA 1V3HA 3N13A 3MHGA 4M0XA 4IIEA 5FJOA 3FAXA 4D9PA 5DITA 5TNVA 3BSMA 1V93A 3EMZA 3FJ6A 3PULA 5D09A 5CQ1A 1NP2A 4JQ2A 2OEKA 3CO8A 1X1NA 5I3DA 3GHTA 4JTIA 3QYQA 5AYIA 3E2SA 1E9YB 2PWVA 4HTBA 3CZ8A 4XKYA 3S2CA 1AD1A 5DMLA 5AY7A 5AFDA 3RJXA 2O0TA 2NQ9A 3RAOA 3RLUA 3UZXA 3BCDA 1LBMA 1FAPA 2IQTA 5AYZA 5J5DA 1ZAJA 4QAWA 1XRFA 1UKPA 3RGCA 2IQDA 1TWSA 4OOUA 4DF2A 3TIMA 5AC8A 3LHYA 1VHCA 1J6OA 2GQ8A 3S1UA 1TJRA 1XFCA 4GX8A 4Z2JA 5HNTA 3FYYA 4LBUA 2WVUA 1XJBA 2X0HA 3VKAA 1GT8A 1NTHA 4U33A 4DN1A 3V35A 4DYKA 3LHUA 4QS6A 3LSBA 3AMGA 3NQDA 4RL3A 2CITA 5D2XA 1NSJA 4M24A 4D6FA 5E5CA 1CLXA 3INPA 2PWHA 2V3EA 3PAOA 3J7HA 3GDRA 4IHCA 4U10A 1GOMA 2ZR6A 2G37A 3QFEA 5MKGB 2IKGA 4AD2A 1F2JA 4W9TA 2BGNE 5CGQA 1XLFA 5DT5A 4UQCA 5TAOA 3H22A 4XZWA 5A1AA 3N15A 1ZHAA 3KAOA 5FEPA 5XIAA 5CCZA 3CH0A 1I1XA 4DPPA 1ELSA 4J3SA 2HZGA 3AUOA 2UY5A 1JQVA 1M03A 3IAPA 1FHUA 1PIGA 3F2CA 3VGGA 2A3HA 1EZ2A 2NQLA 4QM1A 1OY0A 2VGIA 4DRMA 1JRBA 1U33A 3OU8A 4ZO9A 1XC6A 1UH2A 3NZPA 4XKMA 1W3JA 3GU2A 1GZ1A 1YPIA 1ENUA 4B3ZA 3GC5A 4Y9PA 5D30A 4MB1A 4C1LA 4RNFA 4GI4A 1S39A 4S3DA 3WDHA 4WVXA 3C86A 4WRHA 3TQVA 1H5VA 4DX3A 1D3CA 1ZBCA 3PSWA 1XLBA 3UXAA 4UZUA 4IP4A 2PODA 3VZXA 5C9XA 3W2KA 3EDJA 3W23A 1R3QA 3Q45A 4UTTC 4XUGA 4GC3A 2GDQA 3LGDA 1NFBA 3KBMA 3PC0A 1A50A 4X0NA 2ZADA 1E73M 1KLZA 2L2SA 3P5YA 4F4RA 3MMUA 3C2OA 1TSIA 3UW6A 2X2YA 5E6ZA 4K38A 5CKSA 4DO7A 2J8TA 3NURA 4MKVA 4UNKA 3VD7A 4EIVA 1F3EA 2W92A 2O92A 4KFOA 4LBRA 4ML9A 3OBAA 5EB8A 4AVNA 3NEHA 1FKLA 1TVLA 4U5IA 3KEHA 3KOZA 3WO8A 2BB0A 5E70A 1TV8A 3FDKA 2YBTA 2BWGA 4UQ9A 3W2JA 2JKPA 4AWTA 4E38A 5HMFA 3V36A 3DFNA 1TA3B 1ZS2A 1NM9A 1W1TA 4NY2A 1ITUA 1QO2A 2VQUA 3RX3A 2VEPA 4HSHA 2PFHA 3S8HA 4ROPA 2MLZA 3WNMA 2ZA3A 1CXIA 3MI3A 4JY8A 5REQB 3REQB 1EYWA 1JGMA 3K4WA 1L9WA 4IPIA 4D8AA 1D7JA 5I98A 2OB3A 3ITGA 3E5PA 1ZTVA 1N8FA 3GTHA 1GW9A 5LNRA 3KBJA 4NZCA 3VUSA 1JFHA 1K4HA 2EKGA 3VDHA 5C2XA 4XBKA 3W3OA 5F7UA 2BS9A 3OO2A 3RN6A 4LCQA 4A8RA 2ADAA 4TMBA 1A3WA 5KINA 1EBGA 1HVQA 4RR4A 1HP4A 4JL1A 1J0YA 3R2GA 3P67A 3S2JA 1RJPA 4N9EA 1UKTA 2BBFA 4B91A 4L7ZA 1W5NA 1M7JA 3AUJA 1E40A 1R86A 4NRRA 4DEFA 4CQAA 2O9RA 3WH9A 3IIVA 1UW9A 3CHFA 1TELA 3PS7A 2RGLA 3HIJA 3RM9A 1OCNA 2QLYA 1IYXA 1UWTA 2V30A 1IT7A 3BOLA 2I1OA 2ZZ3A 1CT5A 1P4CA 3UG5A 3LQGA 2VEFA 1BKHA 4S2CA 3RFWA 4FNUA 4E8CA 1I2NA 2DU2A 2F84A 1OFAA 3AYSA 2OX1A 3WH5A 3P82A 1XIGA 3PBGA 3MI6A 2TODA 3ONBA 1UR8A 3DIPA 5CGMA 3CUXA 3IGXA 2PUZA 3AHTA 3FA5A 4Z0SA 2JBMA 3TXVA 2E8ZA 1I60A 2C1IA 2BY2A 4WJXA 4LCSA 4DQWA 3WBAA 2JK2A 2XIBA 4LYRA 4NZ4A 4ZPVR 1X97A 1EP1A 1ICPA 4U3AA 2QVNA 1W56A 2NSOA 4KQNA 1J0HA 2PA6A 3NEVA 5JQ9A 3HPSA 4EXQA 4LALA 1O66A 1UZ1A 3QZAA 1EYEA 1RJRA 3FVDA 4RE4A 4AMCA 3TZNA 1BGAA 4XVDA 2JIWA 3WFZA 4LAZA 1HKMA 8XIAA 4AX7A 4YNGA 3BV4A 4AVOA 3I3EA 2YL9A 2R1NA 1ODUA 4Z08A 5FJUA 3DGBA 1WBHA 4N6EA 5J04A 5DMNA 2XSBA 1XBVA 1YPFA 4H8HA 2PMQA 1EDTA 4GUIA 4LY8A 4QP0A 3BUVA 1IR2A 1DE5A 3GO2A 3GRIA 4S3EA 2DZPA 1VQTA 1T7LA 1FWRA 4OBTA 2DZWA 4ODLA 3OA5A 4O15A 1A4LA 4WOQA 1E9IA 2CHNA 2ACRA 3L67A 3GD6A 2JE8A 3ZLHA 4N4QA 4QHRA 3QRHA 4ZSUA 3GHRA 5CLWA 4OV9A 3MBFA 5I3HA 1VKFA 5FL0A 3BAYA 3SQLA 1Q4NX 4LAOA 3A3WA 4M3PA 5J5RA 4QQ3A 2GOUA 4DJFA 3EWWA 4M80A 4P8WA 1H1YA 1GRJA 4XZHA 1SW3A 1V08A 4IGNA 1SMDA 3N2MA 2ZZ4A 5G2WA 3LGGA 4Q33A 1K8CA 3WLRA 4E4UA 6TAAA 1JVNA 1C7TA 2JKAA 1EDQA 2PAJA 2DG9A 5I03A 1DJIA 1GEQA 1UASA 3GDMA 4AZ5A 3QF0A 3PY2A 5DT7A 1S5TA 3AHZA 3AU2A 1G67A 4M6VA 2GVEA 5F4XA 1OB0A 1SFSA 3O5FA 2VNCA 5LHFA 3A4XA 3ZT6A 3G2GA 1DEDA 2E09A 1VBGA 4GGBA 1J5SA 1V6UA 1UROA 2BG5A 3QSRA 1QMLA 1NSGA 4DIPA 3OIHA 3G6MA 4ASTA 3O16A 1TTJA 4UFMA 3LERA 1CX9A 1UA3A 2PTDA 2LGOA 1L2UA 1BD0A 5LSMA 1A5NC 4KETA 4NU7A 3VC5A 1H7OA 2FVKA 4GUFA 3SW6A 4KEMA 4ZQOA 1OK4A 1W0MA 3QKZA 3UWZA 4TYOA 3Q4DA 3LCWA 2ZQVA 3W6MA 2WQPA 1LG1A 2HTMA 4Q8QA 1JXKA 3EX4A 2I17A 2WKLA 5D2YA 1AFSA 3TC7A 1XUUA 3NZRA 3KAIA 3O7UA 4RXFA 4AF0B 4UQEA 3FLUA 1IIHA 1MW3A 4AZ7A 5DELA 4IT1A 1LRQA 2VWTA 2OEJA 2PGWA 3I3DA 3CPRA 4ITZA 1FRBA 3GHUA 3NOYA 1LBFA 3S0CA 4RNHA 1XG4A 3ARWA 3EWCA 1VGAA 2DZUA 4I7WA 5D38A 2E6FA 1PZ0A 5I07A 4H19A 1XXXA 1YDVA 2WC4A 3W2UA 3G77A 5I78A 3VD5A 3T9PA 1H3GA 4XD3A 1ECEA 3R13A 1E6RA 4DUWA 3KWXA 3WNKA 2DT3A 4F9DA 1J12A 2Y7GA 4Q32A 1K6WA 3IJ8A 1JF5A 1XYBA 1VFMA 2EHHA 2V69A 3N4FA 3TQKA 3BCJA 1X6UA 3WBYA 2DSZA 4AC1X 4GYPA 2GDUA 3OBKA 3E2RA 2TAAA 1UHVA 1K9TA 4H2CA 1RPXA 4MMWA 5CPTA 1G9HA 2W67A 1WKYA 3NCOA 5CSYA 1AW1A 1IT0A 3VCCA 2G97A 4I8YA 3L5AA 3LNMA 5K4ZA 2VX7A 5AVNA 1O68A 2GGJA 2QQ6A 2OXNA 3VC6A 4J7RA 3NDOA 1E5NA 4DROA 4FZIA 1RJQA 1UD3A 3C2RA 5BRPA 1IHIA 3BAKA 1J0ZA 3BG5A 1D2KA 3KUMA 3M1ZA 1H41A 4QTGA 4ML4A 4HPGA 4YS1A 3M0MA 1I1WA 2OU4A 3TYCA 2TRSA 3W38A 2ZZ7A 5ECVA 2JF6A 3AMDA 4IXXA 5F2GA 3F4VA 4HNVA 1DJQA 1H49A 1CZ1A 3ENLA 5M1TA 4C7DA 4N9DA 1XYMA 1XLMA 1W5OA 3L4VA 2J7BA 4CGTA 2C1GA 1VCGA 1DWIM 4IGMA 1S2VA 4Q8NA 4RW5A 1R9HA 5XIMA 1MVYA 2WM1A 3UBPC 3AYTA 4QNWA 3NSXA 3BMBA 3H7VA 4GCXA 2G3MA 2V3FA 3TYBA 1TPUA 1DIDA 1QATA 3SGZA 3URBA 4FA3A 4CQBA 4IFOA 4LNCA 3WNNA 2XM2A 1RD5A 1QPLA 2WLYA 1UR1A 5LKYA 3IK2A 2RHGA 4NJGA 1GK8A 2X1RA 4RDZA 2CC0A 5A6TC 4K1GA 3VIIA 3QLLA 1FWSA 4HB7A 3KHDA 3CGTA 1W54A 4DJED 1W1VA 5CBBA 3I65A 4IQ2A 2XFYA 2GVLA 3MYPA 1SR9A 3HQPA 5HQMA 4O1EA 3G8RA 1I2QA 1LYXA 5A6AA 3CUHA 4UQAA 4JL2A 3B0PA 5BXTA 1DQUA 2JQXA 3EX2A 4JFLA 5DANA 2EULA 4UCGA 1R9XA 2PZNA 3O5GA 3MDUA 4MHBA 1H7PA 3XINA 1IZCA 1MEHA 3WQ8A 3LTPA 3TYDA 2IS7A 3CU2A 3ABQA 4JYDA 3BGAA 4LQ1A 3MYOA 4U5KA 2R1KA 3S1WA 3IJLA 2INEA 2VEKA 4OV4A 5I0DA 3ITXA 1Q66A 2OZ8A 4O1DA 3GG8A 3S5SA 3L4ZA 3WEMA 2X1IA 2XH4A 1E6ZA 3W1XA 1P6BA 3AAMA 1RCXB 1J0IA 2NQHA 3V5OA 5HULA 5KSWA 4MPKA 3VKKA 3TOYA 1MUMA 3R12A 2FFIA 1PX4A 3DBPA 4XAYA 4AQLA 1ZRQA 3S83A 5HT1A 3CWHA 4IG2A 1QT1A 3N3MA 2Y7DA 3GLCA 4CCDA 4FAPA 3IJDA 3M0KA 1UR0A 1IGWA 3SUSA 2J7FA 5HW7A 4QLJA 3OBEA 2PGFA 3S6TA 5F2LA 1XQKA 1JNEA 3NWRA 4M7TA 4CD4A 3QY6A 1EQ3A 1PBKA 3O63A 4NP7A 1MSSA 4PMVA 3F2DA 3EXTA 2GJRA 3P2VA 1KFJA 3VOFA 2QUNA 2IUZA 4RDVA 2DH2A 2PRMA 3IS4A 3HB9A 3GW0A 1EC8A 4H8UA 1KR1A 3DCPA 3PTQA 5AHNA 5CJNA 4CLMA 2Z1WA 6REQB 1GWJA 2QHAA 2CLIA 3NNTA 1HT6A 5HAOA 5AC5A 1VENA 1OM0A 1K1DA 2ZUTA 1VLIA 1GQKA 1V8EA 3CC1A 4KR0B 1AW2A 8TIMA 3R79A 1JAEA 2CHOA 1JUKA 3S1VA 1G4SA 1Q6HA 1W9XA 2ISFA 1LRTA 5EA9A 4DJFC 1Y5XA 1QUMA 1L6YA 4I9TA 1ONXA 2BV9A 2C6QA 1H61A 1G01A 3KZSA 5A8NA 2XINA 1VIZA 2X0YA 1K7EA 4DXXA 1BFNA 3CQKA 2PI6A 3B0XA 3TSMA 4C65A 4DZ2A 5E0CA 5BRBA 3UXIA 4V33A 2OSYA 2QR6A 2TPSA 4Z2LA 1R3VA 1L6GA 2G96A 3E38A 3OA3A 3WF2A 4F0SA 5I06A 3QY8A 4Q8OA 3SURA 1RR2A 4IT4A 1K9EA 4UR7A 5F1UA 1NDVA 1W3LA 2MNRA 4QX4A 3C52A 1GKPA 4JFIA 3IUDA 2BY1A 3EOOA 3IIXA 4POCA 1ISVA 2Q09A 1DKWA 4TU1A 3HURA 3NAVA 5E0KA 1FY6A 3W7NA 4C5ZA 1WXYA 5HBFA 5DQPA 3TFCA 4TW8A 3AWOA 1ZL1A 3LTSA 3L65A 3PBUA 1F3WA 1N7KA 3AIVA 5ABFB 1C9DA 2CETA 5AYXA 1KWKA 1EIXA 3S46A 1HJWA 2WJDA 1UG6A 2YLLA 5I5RA 1B6CA 3GE7A 1JYVA 3DU0A 5EPDA 3TOPA 4U2ZA 3ABZA 2PTWA 2W4XA 4XO7A 4HN8A 4PBEA 3BQ6A 3SUUA 3AHXA 3TWAA 3UEQA 2P8CA 3USZA 1AQMA 4HD5A 1WO2A 1X38A 4GYKA 2D69A 4A2RA 5TQLA 3MUY1 1EJRC 2O9TA 4C6CA 3JYJA 3LTYA 2GQAA 1VF8A 4WD0A 3N6HA 1S46A 4H6QA 3L4TA 2M1IA 4NQ1A 2Y89A 2OR2A 1MEWA 3IKDA 5C9ZA 4JN6A 1ESWA 4GGQA 3SEPA 4YHGA 2Z2BA 5H8MA 5C71A 4HMNA 4MJ4A 1MWOA 1NQKA 5IHRA 1XICA 2WWDA 1Q6UA 4WQ6A 2WXDM 3ABSA 4IOTA 1S2CA 4Y90A 4ES4A 1V0MA 3R7MA 2OTDA 3GFYA 1N8WA 5JBEA 3A22A 4IH3A 3O9NA 3W9ZA 3A4JA 5HMSA 2XIIA 3QQWA 4D71A 2DW7A 4ODOA 3OYZA 2XN2A 2ITKA 1W1A1 5D32A 1X98A 3WNPA 2G50A 2VFFA 2ZC1A 1E3ZA 2V0TA 3EZ4A 4RZ6A 2HXUA 3KCJA 3ZJ6A 3BPWA 2J79A 2V2DA 3VILA 4PODA 2A3LA 1IQ8A 3TNBA 4C6NA 4IWWA 4D6CA 2GUUA 1XS2A 3P80A 1JPIA 4E2DA 3A5FA 1D7IA 3C56A 3CZGA 3MCMA 3CZJA 3WBEA 1KRAC 3TZFA 3EPNA 1HN1A 3BGJA 3W1UA 1A4MA 1NARA 3ES7A 3NM3A 3NQ8A 4DY1A 4BF7A 3I3BA 4AB4A 4QE4A 5I09A 4FX7A 3BK0A 3W71A 3PZNA 2OWXA 1R30A 3OVQA 5A8PA 3NQMA 4JHOA 4PUKA 2Y62A 1CXHA 1KFEA 3E6EA 3OQ8A 1SW0A 4O1CA 1CXEA 1EB3A 3IJ9A 1V6YA 1WDSA 4ADTA 4Y8EA 3QW3A 4HCHA 3HZ3A 3IK8A 4EACA 1VCVA 3ZR6A 3NG3A 3CMJA 3GXTA 3RF9A 4KWVA 4EP8C 1U5HA 1NWTA 4H9MA 4EPEC 4ODMA 5CPNA 3QV7A 2PF0A 3THUA 3TNOA 3VE9A 5FESA 1E1EA 2HVOA 4B5SA 2OWCA 1V7YA 2WJEA 1NOUA 3CXOA 3RM4A 3WQEA 2RDWA 1KTNA 4CEXC 4O2TA 1B90A 2AL1A 2XFFA 3VX1A 1H09A 3WNLA 1V3MA 4ZXOA 4B15A 1HXVA 4L9ZA 3IRDA 1Q6DA 4DRKA 3S2NA 3N9RA 3ZOAA 2J9ZA 5H1WA 3DFOA 1KM4A 2GVYA 3WQ4A 1B3XA 1FHVA 1EA9C 2ZZ6A 2V6AA 1C8VA 3COTA 3VIKA 2BODX 2ZX5A 3NOEA 4X22A 3ZVHA 2FHFA 1FUYA 3OYXA 4L3NA 1B2YA 1KXVA 3UETA 4P5UA 1ZNNA 3CMGA 3REQA 1U83A 2QGHA 1FHLA 2FPTA 3DZ1A 5M03A 1JCMP 4AD3A 3LM3A 2LJ4A 2Y1HA 5A6BA 2YBVA 2W66A 5DRCA 2ACUA 2HVMA 3QGKC 1TTPA 3MS8A 5K9CA 1M1BA 4KEVA 1NY1A 2O55A 3FXGA 3MZ2A 3FHAA 5BROA 5I6SA 3D3AA 2HSAA 2OZ0A 2YZRA 2WBKA 3CUIA 4WR3A 1ZCCA 4ONVA 4JTFA 4XAKA 3VKJA 3JVAA 5AHMA 1W1B1 3KBVA 3UZWA 1JPMA 3BLLA 1WYIA 4GOAA 2IPWA 4HKPA 4YIWA 5EGRA 2TMDA 4ZBCA 1JG9A 2MANA 3G1XA 3RCYA 2YXXA 3UWUA 1NEYA 3SCNA 2J74A 1UZHA 1O94A 4HHHA 4JTKA 3WSUA 3KE0A 2WVTA 2X0SA 3C2YA 2Z7GA 4IJRA 1FKTA 3W7DA 2BNJA 3BURA 4A05A 1U1UA 3KL0A 3THQA 4AXNA 3RPDA 3F1QA 4L1GA 1MW0A 4MPQA 4DRSA 3WLKX 2VCCA 2X1UA 3ID7A 4GABA 2NX1A 4L56A 3QPZA 1D8WA 4MGGA 5BMXA 3UU0A 3LSCA 2GOKA 4QCFA 3GWQA 4IIGA 3MT1A 1JD9A 4XZ9A 4JIHA 2GFTA 2A1YA 3S4TA 1EBHA 5K9DA 3DH7A 1KM1A 1J9YA 3PZMA 4LT9A 4WZHA 3MO7A 4B9ZA 1QI5A 2NXGA 2I5QA 1I2OA 1Q4WA 2XP7A 3B0VC 1W17A 2BSLA 4H41A 4PMOA 1DWHM 4PMZA 4Y9NA 4FF7A 2XSXA 2YKKA 4EWJA 3HA1A 3N6QA 3W0KA 4IISA 3P74A 3WJSA 4JN8A 3RIKA 2BXVA 2V3GA 4NAEB 4HN4A 1TUXA 1KBJA 4ENLA 3DKLA 4UFHA 3E02A 4YLWA 1QASA 2OYKA 4DRNA 2YR1A 4FAMA 4O0KA 1MUCA 3HFYA 2ISSA 1QK2A 2JEPA 2YZ5A 3TJIA 1UC5A 1QO5A 4W85A 3UJEA 2DV0A 3MP3A 4PTWA 1R2RA 1WDDA 1GOXA 3A24A 2DGAA 3AYVA 1P7TB 4UIOA 4XIAA 4X61A 1QK0A 5HUPA 4HSOA 5BW6A 4PSRA 1SJBA 1SUXA 1UUQA 3AS0A 2QEZA 3HFTA 4O1FA 1UUOA 1DQXA 3LA4A 2PWDA 2UWFA 5DX7A 3T0CA 2P50A 2ALRA 4OFCA 3W7QA 1P6CA 2OELA 4IGHA 4IFKB 1OADA 4GFIA 4B3KA 5JBDA 4UTWC 3H70A 2W3ZA 4QT3A 1F4HA 1UQYA 1DJWA 2ZRUA 3NPUA 4DT4A 1A0DA 4JICA 3KFTA 4FOJA 1GOIA 2FJKA 1FKBA 1KR0A 2WCAA 2ZX8A 4XSMA 1V6TA 1XBYA 3U6WA 3M6YA 4RE3A 1H2JA 2NXIA 2XPKA 3NQAA 1P0DA 1GGOA 1V6WA 2FMOA 5LA0A 3O6CA 5AVHA 5LHEA 1FKGA 3EOEA 4DI9A 1DIOA 4JOMA 2C79A 1SZFA 3KOFA 4HZ6A 4DNMA 5A2BA 4GISA 4K1WA 1G5AA 2QPSA 3B06A 3MB9A 1K8YA 2EG8A 4Q4QA 2UY4A 4JYEA 3CBWA 1VR6A 3B0UX 2OQLA 4YYFA 3PZQA 1Q2RA 3CPGA 3FW6A 3F03K 4QEEA 4M56A 2WC7A 4DZAA 4RV3A 3PAJA 3M6DA 2O56A 3MV01 3NDYA 4UOJA 3WLOA 4W4QA 1XIEA 3TTSA 3QR0A 3GG1A 2J75A 1RSCA 4Z42C 4AZIA 3R58A 4S38A 3VMOA 4L6DA 2BVTA 3N17A 2ZR5A 4GVIA 3WUBA 1YHTA 3O3RA 2Z2AA 3SSZA 3WYZA 4H3DA 4F2UA 1JULA 3QC3A 3LS9A 5A6JA 2Q6ZA 2PS2A 4OBRA 4ALDA 3T42A 4BHYA 3CHEA 1UR2A 3AIWA 1SJCA 4LRTA 4FI4A 1X39A 3QV8A 3S5OA 3W2NA 4LFYA 3L2MA 4OJYA 4GQQA 3U0HA 4KWSA 1IZJA 3I6CA 2VVSA 1MFVA 2YA0A 2ZWYA 4JQ1A 1QWGA 4AZ6A 1FVPA 3WK2A 4CNTA 4DXVA 1ZAHA 4MWAC 2FZMA 1XKYA 1G4PA 2E7FA 3RNDA 4LVDA 1TRDA 3T05A 3C4UA 1SZRA 1HJSA 3GY1A 3PNUA 1LLZA 4XG1A 2FJUB 3BAIA 4ZPWR 2Q8XA 4S3BA 4LC8A 1FKIA 4S3KA 3NGJA 7TAAA 2H90A 3U8GA 4XUYA 4UUIA 4BKNA 2AQWA 2WV8A 1O7AA 3TYZA 1Q6RA 1HXJA 2GL5A 1IEVA 5MF5A 2BMBA 1CXFA 3M0HA 4BJHA 3UF8A 4EKJA 3VOCA 3RU8X 4HHMA 8A3HA 4B90A 4LVFA 1IX5A 4XZLX 3UA4A 4G7EA 5AHIA 1IIGA 1XH2A 2OYLA 2CXEA 2QAFA 4A3HA 1C93A 3CWOX 2J78A 2V5JA 5FD0A 3E2VA 2Y7FA 2E1DA 2PU1A 1QCWA 3QKEA 3VM5A 4J5NA 5LGZA 4KH2A 5G1YA 2E5DA 3TW7A 4DWDA 1H62A 4H6RA 3UPMA 4IIFA 4OWGA 4TO8A 3CNYA 4PUEA 4CD5A 1JXJA 3VE7A 1TJ1A 3WY1A 3JXVA 4PCPA 3E3HA 4GYJA 4V27A 3CV1A 3B9DA 4R0XA 1NOFA 1CPUA 4LB4A 1KXQA 2R1MA 1WE5A 1W6TA 4JXCA 3KZPA 3SRDA 1FCUA 4D1IA 4YTRA 3QJAA 2A5HA 2YBUA 3SADA 1R87A 4J35A 1DYSA 2PDBA 1VFFA 3UJSA 3W7EA 3O1NA 3FGCB 4X9YA 4HNNA 4TTUA 2PDPA 2PWGA 2I7GA 1R7AA 3PZGA 1EQPA 4Q4SA 3PM6A 4FIRA 5H2ZA 3HOJA 2OQHA 1BTMA 3L2IA 4DZ5A 1FWIC 2O7QA 2DIJA 1XV8A 2QJMA 4NZ5A 1KQYA 4AX6A 2V8ZA 2XIJA 2D3NA 3BCFA 1X8FA 1X96A 1H7XA 1LDCA 1Q6CA 3QZEA 3CZEA 3SCOA 4JFJA 3L0KA 1JZ7A 1FWFC 1OBAA 1E1CA 3W29A 1JF6A 3B8DA 1F05A 1K8ZA 5BWFA 4CQDA 1W3TA 1I2PA 1WKEA 1J4EA 4HOZA 4GPNA 5EMLA 4LX4A 1AMKA 1RP8A 4FNTA 3KAHA 3UFYA 2PDLA 2Z7KA 1MEIA 4KWWA 4QLLA 3GW3A 3HJZA 3ALGA 1LQ2A 2X41A 1V3IA 2P8BA 1E15A 4MLRA 4AZCB 5T9CE 1P43A 4MUZA 4P7QA 1S3TC 2DFAA 2QV4A 2RKXA 4HU8A 4XAPA 1HKWA 2Z1SA 4L6OA 1P0BA 3D47A 3B8IA 4GFSA 4K7VA 4QJ3B 4QXIA 3EBVA 2WHJA 5G5IA 1AJZA 2NX3A 5I2UA 4HYVA 2JEQA 5LA2A 2QZRA 3IUHA 2OMAA 4I8DA 3UVIA 1HO4A 4Q8VA 1DJYA 2WW5A 2ONEA 1MFUA 2WWCA 4LAUA 3FCPA 2VKZG 1FBAA 3U4FA 3GVQA 1QI2A 4GJ1A 1RQHA 2YCJA 4E4PA 3UI4A 1P6WA 3F5LA 3T0TA 1E43A 4PBGA 3V1PA 4K8GA 4M6PA 2BDQA 1M3UA 3LU2A 2ZZ2A 2P88A 2WSYA 4J40A 4BQ2A 3UI5A 4R7OA 1P1XA 1O6IA 2FTWA 3GTXA 3WX7A 1BXBA 1Y5VA 3UJFA 1ITQA 2HPIA 3BGGA 4L4OA 3GVRA 3S5YA 3GNXA 2EEXA 1ZUAX 2P4VA 3IAQA 1JIBA 4LF2A 2P53A 1NFGA 5LNUA 4A35A 5EFDA 2GUBA 3BL3A 4Z1BA 3KRBA 1Z8AA 3H2AA 4RPPA 3FX4A 3BXWA 1HJUA 3W27A 4R7WA 5FEWA 1RV8A 4Z1DA 1LCOA 4GVHA 1EJUC 1XD0A 1ZSXA 1HQTA 2FZ8A 2VGBA 1GQIA 4LEQA 2PTYA 4B5XA 4N6FA 3W75A 1QPRA 3FJNA 1EKOA 1FCVA 1Q6EA 4ZB5A 4GY7A 2ZA1A 3A12A 4I9MA 2CERA 1LG2A 1ITXA 4MNJA 3IVUA 1J18A 5KEZA 1WDRA 4DVOA 3B97A 1JCHB 4IL2A 1BQGA 1A3XA 1YLVA 3N34A 4YVXA 1E51A 4E3TA 3O5EA 3DERA 3VIFA 3NYZA 5M3WA 2PDGA 4HYRA 2WB5A 4BI5A 3UY8A 4BZYA 5KTLA 4NXKA 3P6LA 3LXCA 1JUEA 4LAKA 4UWMA 3QOMA 1DHKA 1FCBA 2MF9A 3URQA 4M8UA 2R94A 2G5WA 4JIIX 4TX0A 3P14A 2CLEA 4OQVA 4YTUA 1O5RA 2VCDA 2NV2A 4M6QA 1T40A 4WSKA 3BW4A 3CQ0A 3W7RA 3BJFA 5FAJA 4HNOA 1R47A 3TVAA 3KCOA 4X2RA 2AWGA 4GZ7A 3THCA 1KW1A 2VC5A 1E0XA 3U7VA 3QZ6A 5FKYA 2A6NA 4K6AA 2Z1XA 1SO3A 1H60A 2WJZA 4P7OA 4JTTA 4NVTA 3VKCA 1EWEA 5I02A 3QV6A 3XIMA 1H11A 2YL8A 2D22A 1E4LA 1GOWA 1XLDA 3DKJA 1J5TA 3LRKA 1Q6QA 3SFWA 4UXDA 2V38A 1EO5A 3QTPA 3PTMA 1VS1A 5F2MA 2PU0A 4E3VA 2DVXA 1KD0A 4PMRA 2VGGA 1Y7VA 5LXEA 4GH3A 3QQ0A 1XYLA 3VIOA 4PBFA 1NWSA 4DM1A 1MXDA 1A0CA 1D6OA 2AGTA 2F7FA 1NWRA 2NLYA 1TZ9A 3MMTA 3G1SA 3F4NA 2I16A 2IXUA 3LLDA 4CVUA 4JEQA 2A85A 1EP2A 5KZ6A 4HZMA 5CZ0A 3W7PA 3EXSA 3TWBA 4RW3A 2D3LA 2HPMA 1CGVA 5HWJA 3T2QA 4LYKA 3T8QA 2V81A 5PTDA 1EDGA 2E40A 3HJEA 3LV5A 4MB3A 4LUJA 1SQ7A 4FR6A 4HA3A 4UTMA 1SSDA 2QF7A 3RLVA 3O5MA 3MHFA 2V9DA 3CUJA 4Q3MA 1R9YA 3L0GA 5IBXA 2XWEA 3R11A 5CG7A 1UKSA 2Y6ZA 2W0UA 2ZYFA 4DRIA 4B92A 3PFMA 3VM7A 2FKEA 3QH2A 3WQFA 1JZ4A 3W81A 1PDYA 2D73A 2RH9A 1J6PA 3V18A 2AKMA 1AQ0A 4GIAA 3AZTA 4MAZA 3NQ7A 4GUHA 1XW8A 2GK1B 1GOOA 2OJPA 1WBJA 2Y8UA 1N82A 2Q3OA 3W07A 4PUJA 3O0FA 4KEUA 3AU6A 3R0KA 3NGFA 3GXIA 3E74A 1MW2A 2EPMX 4TV6A 4QRNA 3K4AA 3MZNA 3EWBX 1E0UA 2CU0A 3AWNA 4F0KA 5I7GA 1UBSA 3WK1A 4H7ZA 5GPRA 4M5PA 1XLJA 4NUWA 3DXIA 5AZ1A 2GVJA 1JI2A 3CUFA 4LC6A 1UOKA 1PVNA 1KXTA 1W3IA 3ABOA 4ZO6A 3TDBA 1CB7B 2UBPC 1A53A 3SCPA 4GXWA 5DCBA 2IPFA 1DTNA 1XDMA 1RK5A 3ZQ9A 3A4AA 2DT2A 5F1VA 3NUKA 4EXBA 1VC4A 1HW6A 4QG6A 1YDNA 3PZVA 4H6KA 1Q2SA 5K9XA 1R6WA 1U22A 1V79A 4CN6A 4UFIA 2GQ3A 1JL8A 2ZRVA 2YCEA 1GVEA 3O0KA 4D8ZA 3WH0A 3CWNA 2YDQA 3EB4A 1DTUA 1K70A 1EA0A 4HBEA 1DWGM 4L80A 3MU7A 1V0LA 3TYAA 3RR1A 2J47A 3TC5A 4QIUA 3B9AA 5I3GA 5C5YA 2V5LA 3T0AA 5D75A 3HU7A 1VRDA 1KGUA 2QKFA 4CN1A 2GGHA 4H7CA 4R3UA 5MHBA 3TR9A 3EKGA 3YPIA 3M0YA 3H7RA 2ZQ0A 3M0VA 1BRLB 4FMVA 3H2OA 4LJ3A 1DWJM 5FF2A 1S2UA 4I90A 2AOSA 1J0JA 4WKFA 3LHZA 4AFYA 2OKTA 1MXGA 2LKNA 3BMVA 3OG2A 1OGBA 3WFAA 1O5QA 4MB4A 2FKPA 1KBLA 4REQB 4PTVA 3VOGA 2WM0A 3CH9A 1V02A 2CZ5A 4ZQMA 5IFTA 4WIWA 4GQBA 1K77A 3VNJA 1W2VA 1TV2A 2VDGA 3WMSA 1A47A 1MRQA 4U4MA 3PF3A 2W27A 2E5BA 2IMRA 3TTOA 3KOXA 1HFBA 1ZZMA 3UERA 1KFKA 1Y0OA 1F8AB 2E25A 1XLIA 2N87A 2ZVRA 1H1ZA 5BOOA 1TA3A 3PPCA 1FDYA 1US0A 3AS2A 4G7FA 5LNSA 2C1HA 3ES8A 3PPGA 3ZVHB 3K8MA 2E9LA 5REQA 1TV4A 4HCLA 1XQLA 4WHBA 4UOZA 2F8QA 2V82A 3WF3A 1UPPA 1IWPA 5FJRA 4QBXA 3PUGA 1X6LA 3BG3A 3WJZA 5D4YA 2IKJA 2Y78A 2J88A 1F9CA 1W31A 4JY9A 1JCJA 3BAJA 2OFJA 4RZ5A 3VNDA 1GZGA 1OG6A 4ZE4A 1XISA 3ARPA 4LV4A 2PWEA 1PKLA 1L6FA 3CL6A 3T0BA 4CKQA 4KCWA 4DHGA 4Z2GA 4RXGA 5H6HA 3FFSA 3OQEA 2E9MA 1R8LA 4G2DA 3PZOA 1BPLB 1GVIA 1SZGA 3WMCA 5IM51 3LN3A 4H9UA 4JFVA 4JTEA 1R85A 2DPEA 1SR0A 3AROA 1U79A 5D9PA 3GR8A 1LUCB 3LPFA 1AD4A 1JDAA 3EA2A 2X09A 1KTCA 4BF8A 2DZVA 1Z48A 4WXYA 3U2ZA 4G9PA 4G2PA 4DNHA 5KITA 1Z42A 2B5UB 1H0GA 1RPKA 1U30A 1OF6A 4HMDA 4DWSA 1XYCA 3BC9A 1UWAA 4K3ZA 5CSUA 2XFRA 4C02B 5B7YA 2V5KA 4PCTA 4NNCA 1MYRA 3OODA 2Y70A 2W63A 4K2SA 3N2XA 4MNLA 1FP9A 1E55A 4J9JA 3A5VA 3N9SA 4HYWA 1G1YA 1VHNA 1LT7A 3TN5A 3A13A 1PX3A 3B8VA 4PRRA 3VGDA 4Q22A 4GI8A 5I00A 5BCAA 1EWDA 2R24A 2RUSA 5AC7A 3V75A 2QCMA 4D6HA 5CH9A 2VELA 1S2WA 4GBUA 2XDFA 4NZFA 4CU6A 1V03A 1D9EA 4TW6A 2VCBA 4BEUA 1TMHA 3W7KA 1OGGA 1KFLA 4W9QA 3AXXA 3KVKA 3S2MA 4GY0A 1MUWA 4J3WA 3EY6A 2LPVA 1XX1A 1YDOA 2WZIA 4KCVA 2QIWA 1IZKA 3U2CA 4GKLA 3SRFA 2Q3RA 4ZCWA 2HK1A 2VC9A 3VZYA 2G4JA 1CTNA 3SCSA 1B9BA 1F7BA 1P7TA 3T4CA 4ZFCA 3E0IA 3D6NA 5XINA 3NDZA 3GSMA 3UG4A 3W88A 4HNCA 1F3XA 3URNA 3OLEA 1V0KA 1ITCA 2HBVA 1WP6A 3DAQA 3KCEA 3WQWA 3G18A 2VZOA 3LEPA 4D2JA 3PN8A 2YA2A 4LAWA 2FGLA 2WHLA 2C0HA 3TX9A 3FHQA 1TR9A 2BGQA 1YKWA 2A3BA 3M7WA 1IXPA 5DLCA 3W1AA 1JZ3A 3KVJA 2GDVA 3HGJA 1RY8A 1FKXA 3O5RA 3KDOA 2FGBA 4GYPC 3ZZ1A 1G6CA 4DI8A 1REQA 1M9HA 3T81A 3MQTA 3DOPA 3BH4A 5CC5A 4MYXA 2Z6IA 2BXZA 4XX6A 3SJ3A 1GPFA 3C61A 4HP5A 2PDWA 3AIEA 1CGTA 3W7GA 4GYFA 1ZU8A 1ZCNA 2WCGA 3S2LA 2OVLA 1VZWA 5A8OA 1OABA 3L66A 3TA9A 1Y65A 3W7HA 1F6YA 3NQBA 4XWUA 3FXYA 4L4MA 4ZB0A 4FOUA 4I3GA 2ZOXA 2VRQA 1WDQA 5RUBA 1H7NA 2FPVA 2RDUA 3VX0A 1DQWA 5ECUA 2QJGA 1HJXA 4JNMA 3B8WA 1NFPA 1JDCA 4U3CA 3B04A 3GDLA 4C6PA 3NTPA 1M7OA 3PTDA 2REQA 1QHZA 3QSTA 1FXPA 4Y8FA 2QXWA 3RLHA 1OG0A 4FNRA 3ZSTA 4ICNA 1KGXA 3GM8A 2DSVA 1OX5A 2IKHA 2R82A 2XSAA 1E71M 2FVMA 3H53A 1AG1O 4AXKA 1WZKA 3QMTA 4C6OA 3FA3A 3H6OA 3NPWA 3PUOA 2XVLA 1FKRA 1LM1A 3N04A 3OIXA 1TO3A 3VIGA 3IPWA 4JPGA 1QNVA 3A64A 3OHMB 1E9ZB 3F5JA 3SRKA 3PNZA 5A3HA 1CDGA 2VN1A 4AY1A 2ZFAA 4MNMA 2WMGA 2RSEA 2C14A 4FLOA 2OO6A 3KVLA 2VXNA 3OZPA 4Q8MA 4AIUA 1D3GA 5M17A 3AIRA 1LP6A 4JQ4A 5DO8A 4D72A 5JH1A 3LRMA 1LROA 2JF7A 1R9ZA 5JIPA 3U5UA 5EBUA 2E4TA 3P93A 4JR5A 1YQ2A 1E1FA 2J7DA 4QDWA 5A6MA 3MW7A 4PULA 3H4GA 2PLCA 2AL2B 3LBOA 4G7EB 3MSYA 1QHPA 2OX4A 1RD6A 3G1DA 3ARXA 1UD4A 4WJ8A 1ROTA 1V51A 3LZ3A 3O6YX 3MJYA 4UDMA 2RUCA 2UZ9A 4QJ1A 1OFPA 1OCJA 1EYMA 3DG6A 5BXSA 4XAZA 2V5DA 1XIHA 2OSWA 4LRSA 3H7UA 1L6WA 4FXSA 6ALDA 4HPHA 2RJGA 3N12A 1XPYA 1FWAC 2Y2WA 3VCNA 3DGRA 2O7SA 3RCNA 1VJZA 2QT3A 2GGIA 3E0LA 1OQFA 1NF0A 5H8UA 2ACQA 1QOXA 3EIPA 3C0QA 3DG3A 5EL1A 2PE4A 2YCLB 3BZJA 5E0FA 4AEEA 2NUYA 1JDDA 2KR7A 1KT0A 2IF4A 1J2BA 3GTYX 2WNNA 1KV5A 3SCUA 2JIEA 2ZX7A 2GWGA 3CLMA 3RO8A 1ADOA 5CJ5A 5HJYA 4ACZA 4Q4OA 1F6PA 3AHYA 3T0DA 3KRZA 6CGTA 1FOBA 1BYAA 2CWNA 2VUNA 2I9UA 1E6SM 2XVKA 5DRIA 5JVLA 3F2BA 3TE9A 1XSJA 2G41A 5LYRA 1XUZA 2CZDA 3PVFA 2ISDA 4LU0A 4QSFA 2F9RA 2J9XA 2FQIA 1HL8A 3N1AA 4H1ZA 1N2VA 3VNYA 3PB0A 5CPLA 2Z1VA 3I68A 3C2VA 3W7LA 3PBWA 5T9BG 2WAGA 3SN0A 3N2OA 4RE0A 3POCA 2F38A 4ORMA 3WKZA 3UGRA 8RUCA 3MKCA 1XIFA 4M19A 5SWUA 1EGZA 2PDNA 3QHOA 3GXPA 4PB4A 3CV7A 4D6IA 4AIBA 1FH7A 4NNRA 3W6YA 1R3YA 4M51A 3MUIA 4FO4A 1WKFA 2PDIA 4ZEPA 1Z32X 1B54A 4JTGA 1JZ8A 5M5DA 5BNKA 5HPCA 4HK7A 2FPYA 1ZQ5A 3P0WA 4WGHA 1PIIA 3VAWA 3N29A 2PPOA 2XP5A 1AK5A 2BXYA 4PGLA 3O5PA 2B0MA 2GSJA 4XD4A 1OEPA 2OCZA 3OZYA 1PKYA 1X7IA 3SCVA 1BVZA 4LUTA 2PRHA 1AH4A 3LYEA 1DJHA 3IJ6A 2YYUA 1DL3A 1PX8A 3G1YA 4WDWA 5AZ0A 4MZYA 4EPBC 3L68A 2E28A 4I5UA 2KE0A 4BFAA 3GR7A 9RUBA 1GVSA 2A3AA 1HGWA 5FEZA 2IKIA 3KBSA 1QI4A 4ICCX 4PL1A 4KRZA 4LOCA 4NZ3A 2QCDB 3SN1A 5G4HC 3ZR4A 1CIUA 2VMFA 3BSHA 1QWKA 1BXNA 5AECA 2VFDA 3IIPA 1W1IE 3FJ4A 2Q5AA 2X05A 3WDQA 3LUTA 5D9MA 1QNSA 4X60A 4FIQA 5D05A 2QCEA 3WF0A 3JU2A 1KKRA 1E6NA 1XF0A 3RITA 3GU1A 4ODRA 3ABXA 1TCMA 3S42A 4DBSA 1PZ2A 3QGAC 2QUMA 3AYRA 2YL5A 3WJXA 1FX6A 2WQDA 5AN7A 4NAFA 3NL2A 4EAMA 4LW7A 4CNPA 1PWLA 3ODKA 2PEVA 3STFA 2F21A 2YGYA 2Z1BA 4N7QA 2RJHA 4UCFA 4GVFA 3O15A 2PLKA 4H83A 5HA7A 2MNTA 3M44A 4DUVA 2ZE3A 3FA4A 4ZPTR 1ZJBA 3LOTA 4KESA 2ZE0A 1YXDA 4UB9A 1XLGA 3DX5A 3PG8A 2WVVA 4KEZA 4L1XA 1GTHA 2PDKA 3TJ4A 1GVRA 3IGSA 1YE6A 4S2BA 1H4PA 1OK6A 1B1YA 3FOKA 3GPKA 2FB3A 3KHJA 4FLSA 1UD8A 1BG9A 4HCDA 3PPFA 4RZBA 2Y63A 2ZTJA 3T8LA 3W2LA 3N4AA 1CGWA 4WJEA 1OVDA 2UY3A 3M0IA 1HUVA 5B80A 1EJVC 1Q8JA 3NL3A 3QMSA 3M9YA 3MANA 4Z1YA 4R88A 1FWDC 1RH9A 1ZCOA 3WLHA 2CHRA 4YMZA 1UP3A 5AC6A 4QE5A 1TPWA 1ZJIA 2CLOA 1A5OC 3KP1A 4J3XA 1B3ZA 4KKXA 1O1ZA 2NW0A 3ZIZA 4ZS6A 5I3KA 2YB1A 1I8JA 3LGEA 5FEXA 1DE6A 3CL7A 2DIKA 5A5WA 1LL6A 2WNZA 3UWEA 1VFTA 1L1PA 4U86A 4L5ZA 4PEEA 3W7JA 3BQ5A 2GVGA 1W9VA 3CHCA 1ALDA 3DENA 3BG9A 4PRTA 1G7UA 4NZ1A 3EWDA 2Y7EA 4I6VA 2B7OA 4OUEA 3EPMA 1E4IA 1WX0A 3ATZA 4JFUA 2H8ZA 3WH8A 2A7RA 1E0TA 3KRUA 3WDIA 2NVAA 3UG8A 2ASHA 5CC3A 4MY8A 5U7SA 3OLDA 4DAIA 4GE8A 1POKA 3OG3A 4S3CA 3OEXA 1XBZA 2X7VA 4HU3A 3ARZA 3TSDA 3QBUA 3ZT5A 3W7IA 1RA5A 3EPOA 2NZLA 1ME9A 1O4UA 5GPGA 3TCEA 4DRJA 2KFWA 2BY0A 3VFCA 4X9SA 4I9AA 1OC7A 1FP8A 1OZMA 1Q65A 1WKDA 5MKGA 2WNQA 5GQBA 2NUXA 3L5LA 5A2AA 3N6JA 1YADA 3FK4A 4PUNA 3NQVA 3TSBA 4IX0A 1G69A 2JFEX 3L23A 3QR1A 1UWUA 4JS3A 1XKJA 1SMAA 3UJ2A 1IR1A 4FB7A 1CLVA 5J8LA 3LQLA 1GZJA 3BE7A 1RLCL 1T11A 3KACA 3R0DA 4C90A 1W37A 1HO1A 1ODZA 1BVWA 3IVSA 1XC4A 2PDQA 4H04A 5KZMA 1W5MA 2E6YA 2PDJA 4TV5A 2VEMA 2WZHA 3S5ZA 4CU7A 1JYWA 1P5QA 2DJLA 4ZTYA 2R1PA 3M0LA 2B81A 4C60A 2QJNA 3FY1A 3SECA 3G1FA 3T1GA 4DJFD 1ZB5A 4WCJA 1W5PA 4XTDA 1WDPA 4H9XA 4PSPA 1WQ5A 4M6UA 3UZ5A 2F61A 3EWUA 1VFHA 2FB2A 4OECA 4PMNA 1UJQA 1RVGA 3ZMRA 3EGJA 3LI0A 3RR4A 4A29A 1LJYA 1Q5MA 2WK2A