3G6MA

Crystal structure of a chitinase crchi1 from the nematophagous fungus clonostachys rosea in complex with a potent inhibitor caffeine
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
388
structure length
388
Chain Sequence
b'TGSINAVYFTNWGIYGRNFQPADLQASKILHVLYSFMNLRVDGTVYSGDTYADLEKHYSDDSWNDIGTNAYGCVKQLYKLKKANRSLKIMLSIGGWTWSTNFPAAASTEATRATFAKTAVEFMKDWGFDGIDVDWEYPASETDANNMVLLLQRVRQELDSYSATYANGYHFQLSIAAPAGPSHYNVLKLAQLGSVLDNINLMAYDYAGSWDSVSGHQTNLYPSTSNPSSTPFSTKAAVDAYIAAGVPASKIILGMPIYGRAFVGTDGPGKPYSTIGEGSWESGIWDYKVLPKAGATVITDSAAGATYSYDSSSRTMISYDTPDMVRTKVSYAKGLGLGGSMFWEASADKTGSDSLIGTALSSMGSHDSTQNCLSYPNSKFDNIKNSLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase
publication title Crystal structure and mutagenesis analysis of chitinase CrChi1 from the nematophagous fungus Clonostachys rosea in complex with the inhibitor caffeine
pubmed doi rcsb
source organism Bionectria ochroleuca
molecule tags Hydrolase/hydrolase inhibitor
total genus 144
structure length 388
sequence length 388
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2009-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3g6mA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3g6mA01
1GORA 3ALFA 3AHYA 5E09A 3WUGA 4PMQA 4AZIA 1JNEA 2W62A 1DHKA 3VDHA 2OLHA 4UOQA 4UFJA 1KXTA 2ZXAA 2WCSA 4AIOA 2JEQA 1JYVA 2W91A 5BWFA 1E56A 4P7NA 5EBAA 1BYCA 5BRPA 2ZX7A 4L4PA 3A4AA 1ISZA 4GZIA 3AOFA 1UWQA 2QHAA 1LL6A 5A6JA 3WF0A 3AS3A 4Z2KA 3SURA 3RO8A 4AZGA 3WDHA 3TTOA 2VZVA 1XH0A 1QNQA 4B3KA 1MFUA 3GZAA 3WDIA 3RJYA 1G94A 4TTUA 5D8WA 3FXYA 1FH9A 1GOQA 3W6LA 1TR1A 4AC1X 1Q4NX 3L4ZA 2E40A 4WIWA 4CD4A 3AIVA 4J3SA 1HVXA 4LQ1A 4Z2JA 1HJVA 1RH9A 1G5AA 5FCZA 2A3HA 4CVWA 2X2YA 2D0GA 2IUZA 1W3KA 4U5IA 1P6WA 2D2OA 3WDJA 1CYGA 3B9EA 4H2CA 1GVIA 4KRUA 3MSGA 2GK1A 4E2OA 2BVDA 3CUHA 3WBAA 1CGWA 5D9PA 4AD0A 3FAXA 4PMZA 3N04A 2WHMA 4X0NA 2JIWA 4M80A 4Z2GA 1TA3B 4PTXA 2ZUTA 1IT0A 4MAVA 2VX4A 3EDEA 3W29A 4CN6A 1HL8A 1AVAA 1EO7A 1QI4A 2YA1A 4DUVA 1B0IA 5DO8A 1S46A 2J7GA 2J75A 3UR8A 4GI9A 3F5KA 4QP0A 2W5FA 1KQYA 2OYLA 4ACZA 3NYDA 1OBAA 1VBUA 3UETA 1JYXA 3AIBA 3WQVA 3HU7A 1UZ4A 2J78A 5GNZA 1ZJBA 3FNDA 1QNPA 4B16A 5HPCA 1H5VA 1W9PA 1VIWA 2G3MA 2AMGA 3AS2A 4ZXOA 1BLIA 4PMUA 1IZKA 2WXDM 3IJ9A 4MB3A 2E9BA 1UR8A 4PTWA 3A4WA 4YPJA 1E6SM 3I3BA 1CXHA 1U2YA 1MW3A 2VVNA 2BY0A 1ISXA 2YA0A 5CGTA 1JZ4A 5I78A 2HISA 2X8RA 3AFBA 1HKJA 2OWXA 1EQCA 1WZKA 2A3AA 3DYPA 1JD9A 2A3CA 2VQUA 3O2LA 4QLJA 4UFKA 3VIHA 3L4VA 1EO5A 1H0GA 3WBEA 3CUJA 1G0CA 2E8YA 4P7OA 1PX8A 5BXSA 3PZ9A 4MAZA 4CN4A 1H1NA 3ZO9A 3VD4A 2YDQA 3B9DA 2F2HA 5A2AA 3WNOA 2GDUA 4Z2HA 4UZSA 7TAAA 4F79A 2B31A 1J0ZA 4OKDA 2CEQA 2ZE0A 1XHGA 4QLLA 4PUEA 4WLCA 4W8AA 2PBOA 3M46A 3VIGA 1W2VA 2WKLA 3CIVA 4TVUA 5CZKA 5LYRA 5IHRA 4MB1A 3N9KA 1LWHA 1BGAA 4EKJA 4UFIA 3E1F1 1C92A 3AS1A 2UWFA 4GIAA 2D0FA 1XYFA 5DT7A 5CJ5A 3WY1A 4JL2A 1QHZA 1KGUA 2XSBA 1LG1A 3EDJA 3FHAA 1PBGA 1IZJA 2XGBA 3BC9A 4UTFA 4HOZA 3CTTA 3VUPA 2V5DA 3SUSA 3CH9A 1E5JA 3OIHA 2GVYA 4OJYA 2UY4A 8CGTA 4PBGA 5AC4A 1H3GA 3AMGA 3OA5A 2WLZA 3RM9A 1W3HA 1OGGA 5BXRA 1JZ8A 5A69A 3AROA 3PHAA 2CCRA 3MUAA 3PZVA 3AZSA 1XSIA 1HJQA 4HU8A 3VX1A 2WMGA 3TONA 1CENA 3MANA 3T2QA 1XC6A 4Z2LA 4DM1A 1CXFA 5GQBA 1NQ6A 4CCEA 2ZIDA 3T09A 3BAIA 5EFFA 4KRTA 3TP4A 2E8ZA 1X1NA 2CYGA 3N18A 4H8VA 2PWFA 8A3HA 3AXHA 1W9VA 2PF0A 2J7DA 3WSUA 5A1AA 4OBSA 1O6IA 1E9LA 3UEQA 2D0HA 5F7UA 2BVYA 1JI2A 4AW7A 1JZ6A 2PC8A 3MUZ1 1E3XA 1WB0A 1V6WA 5CG0A 2EXOA 3A47A 4U2YA 1J0JA 1HX0A 4H8UA 3DHUA 2BY2A 3IAQA 3SUVA 1QVBA 3WELA 3VDCA 1J0HA 3BMWA 4OOUA 1QHPA 4QDMA 4XB3A 4P8WA 3RILA 3KE0A 3WH9A 1CECA 4IPNB 2WSKA 5D4YA 2OSWA 5A8QA 1KFWA 5DF0A 1E1FA 1D2KA 2VR5A 2OYKA 2YOCA 1E6RA 2ZX8A 4J3TA 4XZWA 1Q6EA 3U57A 6TAAA 1V0NA 2XFYA 2J25A 1OWQA 1E4LA 1LLOA 1GOOA 5A8NA 3GTNA 1ESWA 1SR0A 4JHOA 3RIKA 1Q6FA 4AXNA 1LJYA 3VTRA 4UQBA 3OGVA 2X0HA 1VEMA 3WQWA 3QGVA 4ATDA 1BVNP 4S3KA 1XSKA 1MQRA 3LPOA 4KWUA 4GO9A 2W66A 1EOKA 2J7EA 1J12A 1LF1A 5M5DA 2E0PA 1W1TA 2ZUSA 1WDQA 4D6IA 3CUFA 4GQQA 1NP0A 4AIUA 4TUFA 1QW9A 1HJUA 3WFZA 5D9OA 2JALA 1OCQA 3WD2A 1UWUA 4NZCA 3PTQA 4ATWA 2BVTA 1R87A 4M82A 2HVMA 3AXIA 1EOMA 3W4RA 3L4TA 4AD2A 3RJXA 1GOKA 1HXJA 1K6AA 3ZOAA 2DH3A 3SCUA 4TVCA 3AJ7A 1V0LA 1VAHA 3ARQA 4V27A 2FGLA 5A2BA 1OGSA 1XD0A 2BFGA 1PX3A 2EPMX 2E9MA 1PIFA 4UCFA 2Z1KA 1XD1A 1MYRA 3BAYA 1VBRA 3N13A 3UG5A 1MXGA 1WZLA 3B9AA 3ZMRA 2G41A 1YQ2A 1CGTA 3VM7A 5A6BD 1CEOA 1MWOA 3CO4A 4AZCA 2WC3A 1VFFA 3CZLA 2DSWA 1H4PA 3VIIA 3W38A 1NM9A 4TVDA 3AIRA 1RPKA 2DSZA 3ZT5A 3I3EA 3BMVA 1H0IA 1J0KA 1O7AA 2D23A 3QOKA 1OIMA 3BAXA 3VNYA 3T0AA 5C70A 2EPLX 1R7OA 1JF6A 1JAEA 2X0YA 4D6CA 2Y4SA 4UQEA 5JIWA 2EPNA 3G6LA 1ITCA 1G01A 3VO0A 2VVSA 3U7VA 1I1WA 3IAPA 2XTKA 2ZX5A 2BHUA 2ESCA 1W3JA 3VIMA 1GHSA 3BGAA 1GJWA 2G8ZA 3VGHA 3DYMA 5EFDA 1C7TA 2J74A 3RM8A 5I79A 1CTNA 4BZYA 1JZ5A 4QCEA 1MFVA 1HJSA 3POCA 3WIJA 4HA1A 4LXFA 5JUVA 1NOFA 1V02A 3WEOA 4WSKA 1ITXA 3K4DA 1H09A 3T2PA 2VOTA 1R8LA 1OT2A 2QV4A 1DTUA 5E9AA 4DUXA 2JFEX 4ACYA 1W2PA 2PB1A 1FOBA 1DWFM 4J28A 1JDAA 1Z32X 1EDTA 4HMDA 3SUWA 2IXVA 2QMKA 1NP2A 3G6MA 5EB8A 1E6XM 4RE3A 1AQMA 1TVNA 3HMCA 4M29A 3FHQA 3SCVA 3GXDA 4OOZA 1B3XA 2X05A 1W1YA 3NSMA 2YL6A 3FW6A 2Q8XA 1OGBA 4JHZA 4XUYA 3GH5A 1US2A 3WD4A 3WF2A 2DGAA 2WBKA 4JKKA 5E6YA 4MNKA 5CSYA 1XV8A 1EH9A 3BH4A 3VPLA 5ECUA 2MANA 4XZBA 2CBUA 4NI3A 5A94A 3VGEA 4HZ7A 3GNPA 1R7AA 3AMLA 3VMOA 4HTYA 1TCMA 2VCCA 4W8BA 4AWEA 2J47A 2OWCA 3OZPA 4N42A 3W37A 3PZGA 1NH6A 3BAWA 1JFHA 4M1RA 4M8UA 1B31A 4URIA 4R5EA 2CIPA 3L4UA 1V3JA 3PTKA 4H04A 5EMYA 2PWGA 2WHLA 3CHCA 2WCAA 4YHGA 4LX4A 4DWSD 1E43A 4U2ZA 3CZKA 1E6NA 1ZL1A 1OT1A 2FHCA 4E4PA 2C0HA 3D5HA 2CETA 1ZJAA 4JKLA 2J8FA 2VRJA 1VEOA 1MW0A 3M7SA 1KXVA 1OD0A 1UOKA 3RMEA 3TOPA 1J11A 2VMFA 3AHZA 1XGZA 1E3ZA 4WKHA 1V6XA 3UESA 2WVVA 5A6LA 1J10A 1CGYA 4PTMA 1SMDA 1ISVA 1ZS2A 2J7CA 1QNRA 4DWSA 1NWRA 1DWIM 2VJXA 3AIQA 1KGXA 3WMBA 1WDRA 1BFNA 6CGTA 2D22A 2VZUA 1V3IA 2FGZA 4MTVA 2YDRA 3WKZA 4FLOA 1UHVA 1NOUA 2CHOA 3EDKA 5DFAA 1RD6A 3GH4A 3KEHA 3UCQA 1K9EA 5BRQA 4KGJA 4PCSA 3L2MA 2BV9A 4ZENA 1AQ0A 3CUIA 4JAWA 3O6AA 3U7BA 4JCMA 1L8NA 4P7LA 4Y7EA 3GBDA 1UR1A 2J4GA 1DP0A 3MUY1 3CUGA 3WMCA 5I2UA 2RGLA 3BXWA 3VIKA 3VMNA 4AEFA 5FL1A 4HA4A 4AY1A 1E55A 1W3LA 1MQPA 1E15A 3NIYA 1PIGA 4GI6A 4J7RA 3TA9A 3A3HA 1JF5A 2E3ZA 3OLDA 3RDKA 3SCRA 2O92A 1PZ2A 3NCOA 2WSPA 2Z1SA 1FFQA 1AQHA 1CLVA 3GBEA 2V38A 1W32A 3QHOA 2WMKA 5BCAA 4AIEA 3PTMA 4ML4A 3VKKA 4GZEA 2EEXA 1FH8A 3A6OA 5LA1A 3ZR6A 1C7SA 3OB8A 3F4VA 1G9HA 1QHOA 2XIIA 4YN5A 3WUFA 1E0WA 5GNYA 3MMWA 4D6JA 1CZ1A 1HN1A 3D3AA 2OSYA 2AAAA 4KMQA 1GONA 1WDSA 2JE8A 2PWEA 5DMYA 4D1IA 4LGXA 2DT1A 1VF8A 2GUYA 2WCGA 2WW5A 3GDBA 4AISA 5FOOA 1UWTA 2F8QA 4S3JA 1V0KA 4UQCA 3VIOA 1K9TA 1KGWA 1UWSA 1DWAM 1PZ3A 1FP8A 4CKQA 5JIPA 5E6ZA 4MJ2A 4H41A 3LPGA 3W0KA 3ZJ6A 2OWWA 1UH4A 5BXPA 1BAGA 1HJXA 3AIWA 1W9XA 1LQ0A 1UKOA 1Q6GA 4ATLA 1ZBKA 4UQAA 1OIFA 3T2OA 3JUGA 2XSAA 3ZT6A 1GPFA 3AXXA 5DEZA 4PUDA 5A8OA 2DT2A 4J3VA 2V3DA 4UR9A 4W88A 2OSXA 3RM4A 2WMJA 2C8NA 1V6YA 1C8QA 1UD2A 3GYCA 3CZGA 7A3HA 1CXLA 4Z2IA 2DIJA 2YBUA 2E9LA 4IUGA 5LA2A 1KBKA 3W27A 2VL4A 2WVVB 1TG7A 4D6EA 4B3LA 3HJEA 1J9YA 4A3YA 3VD9A 1QI2A 1GQIA 1M01A 3VIFA 1FHDA 3ZM8A 1FP9A 1M7XA 1BG9A 4FLQA 4BA0A 2GSJA 2GK1B 2JF6A 3WQ5A 2EBNA 2WZIA 2QMJA 3DECA 4AD3A 1F4HA 3THCA 3ARTA 1KWGA 3W24A 3FY1A 1A3HA 3VGBA 1EGZA 1JZ3A 3ZR5A 2WHJA 3EDDA 1F4AA 3WH7A 2WHKA 2VC9A 4BQ3A 3WDQA 3ARYA 5CQ1A 4ZE5A 3OLEA 5D8ZA 4HA3A 1DEDA 1LG2A 5C8BB 4IM4A 5JBFA 1RP9A 4MDOA 3VX0A 2YLLA 4PMVA 1E4NA 4CD6A 1WP6A 3SUUA 3BSGA 4ACZB 1ZU8A 3CHDA 5HNNA 3N11A 3AHVA 1EHAA 1JNDA 3SCPA 2J79A 3VMPA 1ZB5A 1UUQA 4D1JA 5D9NA 2BY3A 2W61A 2ZUVA 2Y2WA 1Q6DA 3MKKA 1GUVA 1W1PA 1UD4A 4LYQA 1B30A 5BROA 4MB5A 2VZSA 4D71A 4AD1A 2CPUA 2TAAA 5JBEA 4FLSA 1KCKA 3WUEA 4PTVA 2NSXA 4WKAA 1HVQA 3AQUA 4E8CA 3POHA 2XVKA 3PZNA 1PX4A 3IK2A 3NJ3A 4MNJA 3KL3A 4CU7A 3WEZA 3PZUA 1V3HA 1MW1A 4TX8A 4JZ5A 5A3HA 3BSHA 3LPPA 2VNCA 4CVUA 2QLYA 3SCQA 1CGXA 1BHGA 1BYDA 4PMDA 4W86A 4GINA 1V3KA 1GQJA 3NSXA 2WVTA 2BNJA 4P7RA 1NWUA 3ZJ8A 4HZ6A 1UZ1A 3CPUA 1I1XA 5CPQA 5ABFA 3IJ7A 5BXTA 1E6ZA 5I5RA 2EPOA 3WF3A 4W7VA 1EIBA 3CLWA 3GH7A 3EMZA 3WQ6A 3VGGA 1QI3A 2QPSA 4JFUA 1J0IA 3AZTA 5GNXA 1SMAA 1E40A 1J18A 3AYSA 2YA2A 2QF8A 4WK9A 3MSDA 1WCGA 4PRWA 2YDSA 3ARWA 2VCBA 3AISA 5IFPA 5A6SA 3VD3A 1BSIA 5HXMA 1XRVA 2G4FA 5CLTA 4UZUA 3W6MA 3CMGA 1XYZA 1KXHA 1WDPA 4U3CA 3VINA 1E72M 3II1A 1PJ9A 4JKMA 3VVGA 1CIUA 1C8XA 3PZIA 1W9DM 3ARZA 1UH3A 4PN2A 5A8PA 1GW1A 5A6AA 2VTFA 2CBIA 2WB5A 4X9YA 5TD4A 4NRRA 3VGDA 4ZE4A 5M17A 1HP5A 3OGRA 1UR2A 2CESA 4NSBA 1YHTA 2ZXQA 1E4IA 5IXEA 5I3DA 2FHFA 4MADA 1VFUA 4JIEA 2E4TA 1WKYA 1E73M 3AIUA 5LA0A 5I0DA 5FL0A 2DIEA 1LL7A 4V28A 4MNMA 3WN6A 5A6KA 1CGVA 2G3NA 3MU7A 4MDPA 3CHFA 3T0BA 5A6BA 2BY1A 2ZWZA 3QOMA 2WBGA 4KH2A 2J7FA 2NT1A 3GXFA 2D1ZA 3WH8A 4PCTA 5JH8A 3AI0A 1U30A 4W93A 2JF7A 4P8UA 1JFXA 2A3BA 5CGMA 2WWCA 1JZ7A 5E70A 2WMFA 3T08A 2O9RA 1E71M 4EK7A 1WNOA 3TTQA 5CPTA 2VUYA 1TMQA 1BG4A 2QPUA 4J3WA 3N17A 2J7BA 1ISWA 3TTYA 1VJZA 1KWKA 2ZOXA 2PWHA 2XWDA 1HL9A 3GXMA 4U31A 5KEZA 1UR9A 2Y8KA 3KZSA 4OBRA 2WZEA 3AMCA 2PI6A 4JFSA 3SCOA 1MVYA 1WZMA 1I75A 1EHNA 2RGMA 4W8LA 1JYNA 1EXPA 2VQTA 4PYSA 4AMCA 2V3GA 2CBVA 1XCWA 4PSPA 1ODUA 3WF4A 3WD1A 3L2LA 5M03A 3WNMA 1SYTA 5JBDA 1TE1A 5CSUA 2Y24A 3BCFA 4UOZA 1CPUA 1E6PA 2J62A 3AYRA 4WF7A 4ZEPA 1WPCA 2ZWYA 1VJSA 1KXQA 3ZQ9A 1GJUA 1UD6A 2ZUUA 2VZOA 4W87A 5ABFB 2D20A 4JCLA 2J77A 1V3LA 2WMHA 2XJ7A 2J7HA 2YL8A 2C7FA 3ARPA 2BS9A 3S2CA 2X09A 4GO8A 2WMIA 1FFRA 4WSJA 4UNIA 3BAKA 1GZJA 5FD0A 3WD0A 4HOXA 1E1EA 1V02E 3UR7A 3KL5A 1E6QM 3ZSSA 3K8MA 1JXJA 1X6NA 2CBJA 4B9ZA 3PBGA 1QBBA 1CXEA 1KCLA 3MMDA 2VURA 4W7UA 2D3NA 1B1YA 4P7QA 2FH6A 3VNZA 4YHEA 3HN3A 5ABEA 2OYMA 5AYIA 4W7WA 1Y7VA 4K68A 1LWJA 4FK9A 4AYSA 4ZXLA 5KZ6A 2NW0A 1DWJM 4A4AA 2VT0A 5I24A 4B15A 3K4AA 4PMOA 1M03A 2WK2A 5E0FA 3WF1A 3EMCA 3L4YA 4OUEA 3ZSTA 5I6SA 1Q6CA 1CXKA 2W63A 4AZCB 3UG3A 5A2CA 3F5LA 4GZJA 4CGTA 4GI8A 1C3FA 2XM1A 4JFTA 1EDGA 3S6TA 3CZJA 3LPFA 5E0CA 4J27A 1ZBWA 1UR4A 3AICA 3BLPX 3K8KA 4HPGA 4D6GA 2WM0A 2DT0A 2XFRA 3NDYA 1UKSA 2DH2A 2WC7A 1E0VA 4AEEA 2DPEA 3ZIZA 1M53A 3ZT7A 3CMJA 3ARRA 1ECEA 4MB4A 4E8DA 1C91A 1HKIA 5A8MA 2YIHA 3W25A 4D6HA 1JDDA 1EQPA 4TOQA 1XSJA 1XCXA 4C7DA 1JGIA 2EQDA 4BQ2A 3RPMA 4PEEA 1QNOA 2BXZA 3GNRA 3T0DA 5I77A 1NWSA 1ZBCA 1JL8A 5GPRA 1K9DA 4TTGA 3WNPA 1VENA 2O9TA 1XH1A 3GXIA 3QR3A 4RE4A 4U33A 4BF7A 3MMUA 3N15A 2YLAA 4Q7NA 4AZBA 5HPOA 2GJXA 4NF7A 2XVGA 3WQ4A 4UFHA 1VRXA 1BYBA 4J3UA 1UKTA 3WDPP 1IV8A 2G3IA 2GDVA 1BQCA 2VZTA 2XIBA 3WMSA 5C71A 4R27A 3WD3A 1QNSA 1JD7A 3WEMA 1JI1A 2VR4A 1FH7A 4F9JA 2XFFA 4QLKA 3AIEA 3SCWA 4JL1A 4PMYA 2DSKA 2XUCA 2J8GA 2IXUA 3VM5A 4UFMA 4FF5A 1WO2A 1GOMA 1H49A 2CITA 4GKLA 3MV01 2ZXDA 2XM2A 4M24A 1QPKA 1CDGA 1EDQA 3EBVA 3IJ8A 3ARUA 4BQ4A 2CNCA 3VOCA 4N0RA 4BQ5A 2PWDA 3PN8A 2WMIB 3WNNA 4MJ4A 3EMQA 4X0VA 2XPKA 4CCDA 5BYWA 4HU0A 1RP8A 2A3EA 1V08A 4UOJA 2EJ1A 1V03A 4CCCA 4TX6A 2VX6A 3SCTA 2ZUWA 4C7GA 1OB0A 2GJRA 3A4XA 3WL1A 1WE5A 3M07A 4UQDA 4LYRA 3PZOA 3EYPA 4WJXA 1VEPA 3SEPA 4MPKA 2ZUMA 2VI0A 3M6DA 3WENA 3VIJA 3MS8A 3OZOA 3AMDA 4GQRA 1V3MA 1UD5A 5FKYA 1CNVA 1M04A 1CXIA 4HOWA 1G1YA 4XV0A 1D7FA 1HIZA 3I3DA 1R85A 1TVPA 2EO7A 1UD3A 4BS0A 3NUKA 1A47A 4GXPA 1H2JA 1JAKA 1GCYA 4F9DA 2WYSA 3AHXA 1UYQA 1PEZA 2XWEA 3ARVA 3PZTA 2V5CA 1K9FA 1UQZA 1GQKA 1UKPA 4U3AA 1E5NA 4DWSB 2DEPA 1JG9A 2UY5A 3OG2A 4QAWA 4FLRA 1JIBA 1L0PA 3CGTA 3ALGA 3ECQA 1HJWA 1N82A 2O9OA 3MO4A 1QI0A 4CUCA 5A6MA 1QOXA 5IDIA 1B3ZA 2WNWA 3L4XA 2DQXA 2WPGA 2WKGA 1W9UA 4EANA 1GQLA 3BAJA 4UQ9A 2WVUA 1SFSA 4XX6A 3DYOA 3CBWA 4HMCA 1B9ZA 1NOWA 1BVZA 2X1IA 3AZRA 3SCNA 2WAGA 2XGIA 3AHTA 4CN1A 3VIPA 3K46A 4A3HA 4HPHA 2VCAA 5HOSA 4B9YA 1BYAA 2FHBA 2GJXB 4JFVA 3WUBA 2XHYA 2BHZA 1GVYA 4PSRA 2CKRA 2GJPA 5CLWA 5AC5A 3N12A 3WNLA 1E4MM 1MW2A 4TXEA 1W91A 1CBGA 4RL3A 1BTCA 3SCSA 4HMEA 3WL0A 2WLYA 4EE9A 2BXYA 4DWSC 4J3XA 4JFWA 4DUWA 1HNYA 4L4OA 3SUTA 1TUXA 1V0MA 4CD7A 1OSEA 1WAWA 1CWYA 1GOIA 1NARA 2WVSA 3NSNA 4GPNA 6A3HA 3GM8A 3F5JA 1NWTA 1KR0A 3KWXA 3APGA 2FDMA 1B90A 5I23A 4QFUA 1OM0A 3THDA 3W53A 4LYPA 4IISA 4NRSA 5ABGA 2DDXA 1UH2A 3WQ8A 2XYLA 1MQQA 2BHYA 3VDBA 3WFLA 2W4XA 1UR0A 3VGFA 3BLKA 1C90A 4F66A 4D72A 3DHPA 1DWGM 4CD8A 5A95A 2WWDA 3OBAA 2WC4A 4UFLA 1AMYA 1BPLB 3UERA 4W5UA 4H7VA 2CERA 3EDFA 3NDZA 1US3A 3VD7A 1UKQA 2ZX6A 2ZXBA 1BGGA 2Y5EA 1UA3A 4M56A 3L4WA 1KBBA 1J01A 4PMNA 1CLXA 3CZEA 1PAMA 2ZICA 1PPIA 4BCEA 3QHMA 5CPSA 5D9MA 2AOSA 1JXKA 2YKKA 3RCNA 3U5YA 3OLIA 4D6FA 2UY3A 3VU2A 4FMVA 1DWHM 3B8SA 4AD4A 2D3LA 3SIMA 1FHLA 2F61A 3ZJ7A 1E70M 2FH8A 4AZ5A 4CU6A 1W1VA 1JDCA 3GNOA 2EPKX 5HDRA 5FIPA 3U5UA 4HZ8A 1HP4A 3O9NA 1OD8A 4P8XA 5AY7A 3WNKA 1KQZA 1B3VA 1V6UA 4RE2A 1CGUA 1B2YA 2YL9A 2O9PA 2CXGA 2CHNA 4F8XA 4D6DA 3OLGA 5CXPA 2VRQA 4U5KA 4QCFA 1QI5A 9CGTA 2XVPA 1KR1A 1HKKA 2JEPA 2Y8VA 3VILA 1H11A 1E0XA 2V3FA 5HBFA 1ODZA 1KB3A 1V6VA 1D3CA 1HF6A 1BF2A 5AYBA 4W84A 3ARXA 2D24A 1HT6A 1GOWA 2CKSA 2JIEA 2V3EA 3BCDA 4AZHA 3KL0A 3MV11 4KGLA 3CZ8A 2DSVA 4PMXA 3W28A 3AMKA 3MUIA 5DT5A 3VD5A 4W85A 1VB9A 3LMYA 2VX5A 1TA3A 1X6LA 3VDAA 4Q22A 4M81A 2WANA 3N1AA 7CGTA 2UY2A 2XG9A 1J0YA 3PZMA 4PMRA 4AZ7A 2WZHA 4W89A 4HP5A 2G3JA 1B3WA 3UG4A 1U33A 1VFMA 2W67A 1FA2A 1QBAA 1WZAA 1UD8A 4W5ZA 1JYWA 2VO5A 2ZUNA 1UG6A 1QW8A 2DSUA 4IPLA 4LPCA 3WH6A 2W92A 3TTSA 4MNLA 1B3YA 5IFTA 2ZX9A 1VFOA 2XVNA 3WDRA 3FN9A 3K1DA 1W9BM 4ZFMA 2YL5A 4P8VA 3PZQA 3J7HA 1TFVA 2GFTA 4AD5A 3ARSA 3CHEA 3K8LA 2NT0A 5M3WA 1GNXA 3AS0A 3IANA 4OZOA 4WKFA 1HKMA 2YJQA 3QHNA 5IHSA 3W81A 4C7FA 2XVLA 1C8YA 1JZ2A 1H41A 1OINA 2DT3A 2PBGA 1TZ7A 3WH5A 4EAMA 1LL4A 1C93A 3W82A 1GHRA 1UWRA 4OIFA 3DC0A 3FAWA 3W26A 4AZ6A 5ABHA 2VX7A 2VRKA 1EA9C 4CU8A 4H8HA 1ISYA 1MXDA 1ZBVA 3ZJKA 4DM2A 1UWIA 1XH2A 1UQYA 4V2XA 3OGSA 1UA7A 4CD5A 1R86A 2YBTA
chains in the Genus database with same CATH superfamily
3S2MA 4AZIA 2W62A 4W9QA 1K6WA 2IQTA 1V4YA 5CEWA 1KXTA 2CZEA 3WQGA 2WCSA 1JYVA 1IX5A 4M3PA 5BWFA 1E56A 3TH6A 2VP8A 1BYCA 3W02A 1OHLA 4DI9A 4HNCA 4GZIA 4V15A 5A6JA 3UZWA 4Z2KA 5C9UA 3UI5A 1W56A 1W17A 1MFUA 3GZAA 3WDIA 4C6MA 2A7NA 2I7GA 1G94A 2OOFA 5HWMA 4PUNA 2CLPA 3W6LA 1Q4NX 4C90A 3V4BA 1P7TA 3WG6A 2QCEA 4QROA 1LRQA 2IQDA 1RVKA 1MXSA 1G5AA 5FCZA 2A3HA 4CVWA 2X2YA 3NZ1A 4PB3A 1JCTA 1TRIA 3OEXA 2BVDA 3ME3A 3G8EA 1I0BA 1CGWA 1UBPC 4IMGA 4UTLA 3VOGA 2WHMA 3S46A 4FS9A 3F7JA 1RV8A 3GHUA 3O6DA 4MY1A 2V5KA 1KFCA 2VX4A 4CN6A 4HNTA 1K4HA 6XIAA 3SW6A 1LORA 1JRCA 4UR7A 3N73A 4XZNX 4DUVA 5MKGA 3B8UA 5DO8A 4F4RA 4XSLA 3UR8A 4GI9A 3F5KA 1UPPA 1H63A 2BB0A 3ONCA 4B2DA 3BICA 1RA0A 3KLLA 4JTEA 4WD0A 3GVVA 1JYXA 3PAJA 1Z69A 3PG9A 4H9UA 1E9IA 3FNDA 3LCLA 1QNPA 3U2ZA 1A5SA 4B16A 1F3XA 1EX1A 1W9PA 2AMGA 1LTDA 4RNFA 2GGGA 3LNMA 2FMOA 2W79A 1FWIC 2E9BA 3OZYA 1ZSXA 3A4WA 2G96A 1A5UA 4LBUA 5FEZA 4Z1BA 3QR1A 2PDFA 3E2QA 5I78A 2ZYFA 3UJSA 1EGMA 1HKJA 4UNLA 1OFOA 1B3OA 4A22A 3ZLFA 1DJNA 3L68A 4QDPA 1Y8BA 3OODA 1D9EA 3R43A 2PPPA 4AC7C 3WBEA 1H0GA 1G0CA 1SFJA 5B8IC 1S39A 4LAKA 5AVHA 3WBYA 4IIBA 3EA3A 2Q3OA 4MSPA 4GI4A 4MAZA 4CN4A 5LIWX 4RJEA 1W5MA 2F2HA 2ZRXA 2ZTKA 4UZSA 3NA8A 2XIJA 4F79A 3WFAA 3A9BA 4JYEA 2ZE0A 4GHRA 2PBOA 2R8WA 1O1ZA 3CIVA 3M16A 1US0A 2VD8A 4KCTA 5A6TC 3E1F1 1C92A 2UWFA 4G50A 1V51A 4GIAA 2FGBA 1Q1CA 2CXEA 2XSBA 3N25A 3EDJA 3FHAA 4F0HA 3CTTA 3IWPA 3DKJA 4LY4A 3CH9A 1O5QA 2GVYA 4ZOBA 3WX7A 3BLLA 4GJIA 4K3ZA 3EWYA 2V5BA 3OA5A 2WLZA 3RM9A 1X39A 5BXRA 4XO7A 5A69A 2PDQA 2PRHA 3AROA 2GLKA 3DG3A 3SRHA 3PRAA 1HJQA 1EWDA 4HU8A 4RNIA 2WMGA 5EKYA 2EJAA 1R2TA 1JCHB 4Z2LA 3AUJA 4XAGA 2LKNA 1KM2A 2ZIDA 4MWAE 5M1TA 4GVFA 3TP4A 3GRIA 3N18A 4J1OA 3EA2A 4GMEA 5HWBA 2HPIA 3AXHA 4PL2A 3TWAA 2J7DA 3SGZA 5TF0A 5BXJA 1E9LA 4QEEA 2D0HA 1JZ6A 2H3DA 1E3XA 3QVQA 1WB0A 5FEWA 3V36A 1XLMA 3SDOA 5DITA 3PB2A 2I9EA 5DY2A 3PBYA 4YTRA 2UZ5A 3M0MA 4QDMA 1MEWA 4P8WA 3RILA 3MYOA 3C0SA 1W1A1 2WSKA 5D4YA 3ERPA 4JTQA 3UQBA 3RU8X 5A8QA 2P3EA 1KFBA 1PB0A 1E1FA 2YOCA 3APTA 3U57A 2J25A 1OWQA 3G5EA 1OC6A 1GOOA 3ITYA 5A8NA 4A3QA 4JHOA 4GYJA 3RIKA 1IWBA 1LJYA 4IZGA 4EWJA 1BVNP 1UC5A 3S6OA 1P0NA 4XKYB 3LCGA 3FV9A 3LPOA 3F4NA 4R34A 1RHCA 1T8QA 4YL2A 2J7EA 1LF1A 1SO6A 3HGSA 1POKA 1W1TA 5DCEA 3H55A 1AJZA 3R0KA 2ZBTA 4GQQA 1HJUA 4A8RA 1H51A 3WFZA 1NF0A 1TWZA 5DN1A 3W7MA 3SRDA 3W4RA 1QPOA 4AD2A 2Z1XA 3UVIA 5D2YA 1RQBA 3ZOAA 4PUJA 4HK6A 2DH3A 3P14A 3AJ7A 5I09A 2X42A 3C2EA 3PUDA 4ML9A 5FF0A 1VAHA 4V27A 4GZ7A 2FGLA 4IMEA 5A2BA 1PKMA 1PX3A 2E9MA 3IARA 1EJWC 4JDBA 1XD1A 1XG4A 3DG7A 3W7QA 1MXGA 3HQOA 1UUMA 3QSTA 3B9AA 3LTPA 3ZMRA 1OG6A 2R6OA 5G1MA 5CJMA 1CGTA 2PZNA 1CEOA 4DRMA 3CO4A 1KM6A 4PE8A 1VFFA 3BOLA 1H4PA 4GOAA 3VIIA 3AIRA 4JX5A 3N34A 1J0KA 2ZZ1A 1O7AA 3LXAA 3QOKA 2P3ZA 1J5SA 4B5UA 2I16A 3QSRA 2EPLX 2E67A 1X8FA 1ME8A 3VKCA 4D6CA 5JIWA 2AL1A 2EPNA 1ITCA 2NXHA 3VO0A 1CX9A 4IGNA 2ZX5A 3LRLA 2BHUA 4IQJA 1RALA 1VQTA 4AQLA 1UWAA 2RJHA 4EPKA 1PWMA 5HWNA 3LD5A 3VNLA 4UIOA 3CC1A 2SFPA 1C7TA 3G24A 5I79A 1CTNA 4BZYA 1C9DA 3U9IA 1HJSA 4HA1A 5JUVA 5C2XA 3W7OA 4HN8A 4XZHA 3WEOA 4KWVA 3FVDA 3H54A 3K4DA 4HNOA 4L4LA 3W88A 3HGOA 4N2YA 2QDEA 5E5CA 2QUTA 4UWMA 4DUXA 2JFEX 4ZO6A 2FLIA 3MPGA 1HO1A 4NZ5A 1TV5A 1DWFM 1LBMA 2ZQVA 4HMDA 3U48A 2IXVA 3G6MA 3KBJA 2CLKA 4GUJA 3O5JA 2NQLA 3FKRA 1AQMA 4M29A 1P1MA 1CB2A 3SCVA 3PG8A 1J5TA 1VGAA 3TUUA 1B3XA 1RY0A 1TZ9A 1OGBA 3LB0A 3LQGA 4XUYA 3GH5A 2HROA 2DGAA 4JKKA 5E6YA 3W7IA 2X1RA 1EF3A 5CSYA 4DF1A 4JTLA 3C8NA 4GUHA 1DXEA 5ECUA 1NSJA 2MANA 1NAL1 3GNPA 1R7AA 4HZ7A 1WOAA 4CQCA 3VMOA 5XINA 5HNTA 4HTYA 4XK2A 2E09A 5EA9A 2OLSA 3XIMA 3OZPA 2QCHA 5D38A 4C6QA 3BCJA 3BAWA 4ODPA 4MZ8A 5D75A 5E9XA 4ADUA 2BGQA 3L4UA 4I5XA 1V7AA 4YCPA 1XFCA 3KCLA 2WCAA 4GACA 4ONVA 3YPIA 1E43A 1E6NA 2FVLA 4S3BA 2J8FA 1VEOA 3TEVA 8XIMA 4TV5A 3P5YA 3WO8A 1QU4A 1UOKA 1D8CA 3OG3A 1E1CA 5A6LA 4IIDA 1J10A 2VFDA 2L2SA 1ZS2A 3SY5A 2X40A 1QNRA 3C2FA 4C5ZA 3AIQA 1K77A 1V3IA 2CZVA 3GU0A 2FPYA 3EB3A 2NQJA 2RQSA 4FLOA 1QO5A 4FI4A 5DFAA 3NQ8A 3GH4A 1OADA 3NZGA 3TYZA 5BRQA 3PC0A 2PDBA 1TJ2A 4A35A 4YYCA 3W2UA 4Z0JA 5AHNA 4LB3A 4ZENA 3MBDA 3CUIA 1TQJA 1QWGA 2TMDA 3U7BA 2HZGA 2VEFA 3CWNA 1GG0A 1DP0A 1P6BA 1PKYA 1RR2A 2CZDA 4NIRA 3CUGA 2QDHA 4HSHA 4GLEA 3UZZA 5I2UA 3L5MA 3VIKA 4AEFA 4WJEA 5FL1A 3FCPA 4AY1A 1MQPA 4HKPA 4GI6A 3TA9A 3RDKA 2E3ZA 1PZ2A 1XJBA 4BWLC 5CSRA 1FFQA 5C9RA 1Q7ZA 7REQA 3GBEA 4ZOCA 3GHTA 3KCJA 1W32A 5BCAA 3PTMA 3G2GA 3TWBA 4NNAA 1V79A 1BRLA 4GGHA 3LCXA 4FAPA 1FH8A 1BXCA 4GIEA 3F4VA 4YN5A 3EWZA 3RRAA 2ISDA 1E0WA 4D6JA 3D3AA 2OSYA 3QQ0A 2RHGA 4MFDA 5HINA 4GVGA 4KMQA 1GONA 1SFTA 1CLKA 2JE8A 2PWEA 2OELA 2X0SA 4O13A 2WO5A 5FACA 1Q7MA 1GYLA 3GDBA 4EP8C 3S9YA 1G69A 1EC8A 2IKHA 3LHYA 4LUYA 2F8QA 3B4YA 3LV5A 4O50A 3VIOA 1WXYA 3VNKA 2ZZ7A 1PZ3A 1FP8A 1C8VA 4MJ2A 4QG9A 1ZP3A 3KCEA 2NQ9A 4H41A 3URBA 4D8LA 2AQOA 1A4LA 3CB8A 3CV6A 3ZJ6A 2HRWA 1LQ0A 1Q6GA 3MBFA 3JUGA 3ZT6A 4LB4A 2BASA 1JQXA 3P2VA 5LNSA 3TKFA 3NQ7A 2V3DA 1VPXA 1UJPA 2ISVA 4W88A 3RM4A 1ZY9A 4QG8A 1NIUA 2WMJA 1BSLA 3HZ3A 2C8NA 1QPNA 1V6YA 2Y61A 3TDBA 1LWIA 4JNZA 2DIJA 2E9LA 4IUGA 3TR9A 1KBKA 3W27A 2PDJA 4DLFA 1TG7A 3ZVHB 3VD9A 1J9YA 4XAYA 5PTDA 4EOUA 2E25A 2VXNA 1GYMA 4R3UA 1VCFA 3IGUA 1M7XA 3BANA 3LY0A 1BG9A 2GK1B 1O66A 1GG1A 1Z48A 2JF6A 4HN4A 2EKGA 4NX5A 4GX8A 2REQB 3NO3A 4G2PA 3DECA 1VP5A 3FIGA 3LK6A 3URNA 3O63A 3HGRA 1KWGA 1P5QA 3W24A 4UTTA 1VFLA 1JZ3A 1EGZA 3L12A 1MO0A 2RDXA 1OCBA 1WKDA 2WHJA 1F4AA 2WHKA 2K8IA 4BQ3A 4J40A 5T26A 1RCOB 4HA3A 1XWYA 1LG2A 4IM4A 1SZGA 4ZO8A 3VX0A 3HG4A 1E4NA 3BSGA 1ZU8A 3CHDA 4J9JA 2ADAA 2X1SA 3SGGA 3BOXA 1ZB5A 3WLKX 5DCBA 5F4WA 3U6WA 2Y62A 5D9NA 3VYLA 3MKKA 2YCJA 3AXKA 3W1AA 3NQVA 1SJAA 4GC3A 3N9SA 1R46A 5JBEA 4FLSA 1KCKA 4EAYA 3WUEA 1MEIA 2NSXA 1HVQA 4ZOEA 1ME7A 1S1RA 3G8RA 1K8YA 2V2DA 2XVKA 5J04A 4UTIA 1O5XA 1D3GA 3BJTA 3NJ3A 2C0AA 1MW1A 5A3HA 2Y89A 3BSHA 1GZGA 3ABZA 5F2IA 3DKLA 3SCQA 5HWCA 1BYDA 4TQTA 4OECA 1YMYA 4PMDA 4W86A 3D46A 3BLIA 2WVTA 4P7RA 2X30A 4HZ6A 3CPUA 2PPNA 1I1XA 4GH3A 1IGSA 1UZHA 4XAZA 5DXXA 5BXTA 4KCVA 3CLWA 1PXGA 2OB3A 2TPSA 2QPSA 3VGGA 3BE7A 5HJLA 3AZTA 4AG0A 1E40A 1OZMA 1GZ1A 1PHQA 3AYSA 5HKGA 4DYJA 3MSDA 2VCBA 5AYYA 2FTWA 1GWJA 5CGQA 1XRVA 1IR2A 4UZUA 2ZC8A 1SW3A 4K1WA 2RUCA 1XYZA 4QQ3A 1KXHA 1WDPA 4PL1A 4C6PA 1TTQA 2FTPA 3KDNA 1OABA 1PJ9A 3VVGA 3BV7A 1CIUA 1XLCA 4CQDA 1TJ1A 4AXKA 3ARZA 2QUMA 1UH3A 1N8IA 1TPFA 1SFLA 5A6AA 2VTFA 1LLZA 2WB5A 2P1FA 3C2VA 4X9YA 1RK5A 3LGEA 4K38A 4NRRA 3UQAA 3GTFA 2WZMA 3GTIA 1YHTA 1M7PA 5EL1A 1E4IA 3B05A 1OC5A 2FHFA 4MADA 4JIEA 2Y6ZA 3W70A 1TMLA 1ZJIA 5FL0A 3NM3A 4ZQMA 3QV7A 1XX1A 1CGVA 4XD4A 2V67A 3MU7A 3CHFA 5A6BA 3KADA 2Q8LA 4KH2A 4F3HA 3GXFA 4MYXA 4JIQA 3WH8A 4PCTA 3UWWA 1VRDA 1NEYA 4W93A 4AWUA 2HVOA 1JFXA 2WWCA 3MHUA 2QULA 4OTKA 5GJMA 1XICA 3CK5A 2ZR5A 5I06A 2O9RA 4RPQA 4GISA 3NPXA 2FKEA 3KRBA 3QJAA 1OG0A 3KWSA 5D32A 4PCNA 1ISWA 4JN8A 3WQFA 1VJZA 1WXJA 3LM7A 3FDGA 1UR9A 3KZSA 4JY9A 2WZEA 3RCYA 3UA4A 3Q67A 4FIQA 4JOMA 2O55A 1MVYA 1QK0A 1WZMA 4MKVA 2CFFA 3WQCA 1AL8A 3GG0A 3WF4A 2CBVA 4PSPA 3O5OA 5KITA 5M03A 5JBDA 3BCFA 3G77A 3EB4A 5GJPA 4JQ2A 1WPCA 1VJSA 1X7FA 1KFLA 5ABFB 2VZOA 1H7PA 2J77A 3C0LA 1V3LA 2WMHA 3LNPA 3GR8A 4JBRA 5DBUA 2C7FA 4WOQA 2GYIA 4XISA 4LAZA 4PUMA 4UNIA 2NUYA 2P8CA 5FD0A 3S1UA 4Z1YA 3WD0A 3SB0A 3I68A 3B9OA 1N8FA 3ZSSA 1FKFA 2PV1A 1S2AA 3E49A 2CBJA 1X6NA 3BARA 3MMDA 2VURA 2QF7A 2BLEA 3BWWA 1Q8JA 4HU4A 5AYIA 3L67A 3EX3A 2GUUA 1XLFA 4AYSA 2VT0A 4KWWA 2ODOA 1PDYA 4PMOA 4WHBA 5HATA 3EZ4A 4OUEA 2HPMA 1Q6CA 3TXZA 1CXKA 2VC7A 3HG5A 3TCEA 4CQAA 3CQKA 3M0KA 3OW1A 3RUBL 3T1GA 2R1LA 3NM1A 3TJLA 4HJFA 4XIMA 1I2PA 2J8TA 5E0CA 4LF2A 1IEIA 2DT0A 1UKSA 3NGFA 2DPEA 2XP4A 3ZIZA 3GTXA 3T4WA 4NJKA 1K70A 3UCCA 3KXQA 3GIPA 2Z25A 1ZJHA 2Z7KA 1FJDA 2R94A 3GD6A 4E8DA 1C91A 3W25A 4ECLA 4LVGA 4N9BA 4RZ5A 4EXBA 4N02A 3ANVA 3IACA 3S4TA 3T4CA 3LSBA 5G2HA 3T0DA 1ZBCA 3ITLA 3KBNA 4EF9A 3GHRA 3W01A 4YXGA 2E1DA 4IT1A 2PWUA 3WNPA 4WEVX 1QPFA 1IR1A 2O9TA 2O7QA 4RE4A 3NQ6A 3MC5A 4WDWA 3MMUA 1N2VA 3H53A 2YLAA 3C61A 3E0FA 3BW4A 3UWVA 3AJXA 4C1LA 3CAQA 3DFOA 2DJLA 1J2WA 3CPGA 1QNSA 4C6BA 4XVDA 3P60A 4JQ4A 2VR4A 5F4SA 4NZ1A 2GSHA 3SCWA 3GUWA 4JL1A 5KSWA 1O5KA 2BOFX 2J8GA 1A7XA 4RX0A 3IEBA 2IXUA 2ATMA 4ZBCA 3W1NA 4F0KA 1PV8A 2P50A 2H90A 1JGMA 1QPKA 1YTDA 5HWJA 2VFIA 3LU2A 4XZIA 2ZRWA 2VEKA 1Z3NA 2XPKA 3GWQA 4CCDA 1F3EA 1V08A 5D2VA 4UOJA 1V03A 1XKJA 3TZFA 3M0ZA 3PBUA 3C4UA 3LOTA 1D7IA 4LYRA 2QCFA 1ICSA 3FEQA 2GJNA 2ZUMA 2VI0A 3M6DA 1QFEA 3WENA 3VIJA 3OZOA 4YCOA 4H9YA 1YRRA 3TAOA 1UD5A 1KBIA 1CXIA 2ANUA 1G1YA 2PODA 1D7FA 4MWAA 5HMSA 3DBPA 4BS0A 1A47A 4UTJA 1H2JA 4YVVA 4F9DA 3WQDA 2WYSA 3AHXA 1TVLA 2MNTA 3QBUA 1VYRA 4K7VA 4DN1A 4FNUA 2PDGA 1ZCNA 1K9FA 4X2PA 1UQZA 4O53A 4U3AA 1ONXA 3ANUA 3HB9A 2GQAA 3UYIA 4KWOA 1XM3A 3KZ7A 3OG2A 3GNDA 1JIBA 4JFMA 2DZTA 4MZ1A 2I5IA 1HJWA 5FJTA 1N82A 3MO4A 1QI0A 3EA1A 4ROPA 4TU1A 2E77A 5FF2A 1AQFA 4G56A 2NQ5A 4DBDA 4UQ9A 1F5ZA 2WVUA 4MHBA 3DYOA 5FJPA 3W72A 4PUKA 1B9ZA 3MSYA 1BVZA 2G37A 4H6EA 4X63A 3SCNA 1P1XA 2WAGA 3B9NA 3AHTA 5T9BG 4A3HA 1L9WA 4C6EA 1UZDA 4GGQA 5HOSA 4B9YA 3N4EA 4H00A 2X7VA 4WY0B 3WUBA 5BOFA 4GH1A 5H8UA 1TKKA 4U4MA 5CLWA 3R4IA 2GSEA 4I5RA 3IJLA 3PANA 1BTCA 5LIKX 3SCSA 2A7PA 1EP2A 3G0UA 1RLDA 1YDVA 4PBFA 1X1ZA 3LI0A 3OQ8A 1HNYA 4L4OA 3F4DA 1EF2A 3QYQA 2F7FA 3SUTA 1OSEA 1WAWA 1CWYA 1NARA 4IMAA 1NFPA 2DZVA 2Q3RA 1B90A 5K9XA 4M7SA 3U4AA 3THDA 2PTDA 4NRSA 4XAFA 3TYEA 2D69A 4X22A 1UH2A 2XYLA 3BLOA 1MQQA 2BHYA 2VYOA 2W4XA 2NX3A 1UR0A 3PPFA 3F2CA 4AB4A 3R25A 2P53A 4D72A 3DHPA 3NYZA 4CD8A 2Z2UA 3MVIA 4Q6XA 7PTDA 1AW2A 4O17A 3NDZA 2F9RA 3OHMB 2ZX6A 3M47A 4ZFCA 4XWUA 2OVLA 2Y5EA 1EP1A 1T96A 4GXWA 1CLXA 4JFLA 2FZ8A 2GGJA 1GEQA 4GQ0A 3TJ4A 2G5WA 3A3XA 4YWSA 2YKKA 3B8WA 3A13A 1SGJA 5J5DA 2I14A 3E96A 4IMCA 4HTBA 2YZ5A 3TJIA 3E9AA 1DWHM 3B8SA 4AD4A 2D3LA 4PULA 6REQB 2F61A 4UMCA 3ZJ7A 3SRFA 3S1GA 5LNWA 1UB3A 1W1VA 5I7GA 1PUDA 2JKAA 5FIPA 5IM51 1YBQB 5AY7A 3PJTA 1WBJA 1B3VA 2C71A 4RE2A 5HJXA 1AW1A 1CGUA 2NQHA 4DZ2A 2O9PA 2CXGA 5JH2A 4F8XA 4LH8A 1KRAC 3G1AA 3W9ZA 1Y0OA 4M1BA 1XFBA 3EEGA 2XGZA 2D2GA 3CAKA 3G3DA 5C55A 3CEPA 1ODZA 2GVLA 3HPSA 5AYBA 2FKPA 1KC7A 1YX1A 1GOWA 1FD9A 1DXFA 3V35A 2V3EA 1W6TA 4FEZA 3CZ8A 4PMXA 3W28A 3AMKA 3SY8A 5L9FA 1VB9A 1TPH1 1XLJA 3GU1A 1N55A 5LNVA 1RY8A 3O1NA 2UY2A 1J0YA 1LOLA 4PMRA 3APYA 2G3JA 2F84A 2W67A 1JUBA 3W7LA 2VO5A 2QIWA 3V18A 1B4EA 2DSUA 4EPBC 4LPCA 2NX9A 2W27A 1LT8A 3QY8A 5IFTA 2YXGA 4Y8EA 3WDRA 3K1DA 1W9BM 4ZFMA 1DXIA 1TFVA 1QWKA 2GFTA 3CHEA 3M0IA 3FS2A 5M3WA 1SUXA 1FXPA 3T6CA 2QEZA 3P81A 1UP0A 4AF0B 1RCXB 3N4FA 3QHNA 3W81A 3CB3A 3NZRA 2XVLA 1TWDA 2PD5A 3VKJA 1JZ2A 1OINA 4AX6A 4US5D 3N6QA 3UP8A 1LL4A 1A5MC 3W82A 4DY1A 3BG3A 3W26A 5ABHA 2VX7A 1EA9C 4IFRA 4O1DA 5TAOA 1MXDA 4ZODA 3PSWA 1BL4A 4V2XA 1EGVA 3OGSA 4DX3A 4CD5A 3R58A 4EX4A 3L21A 3QTGA 2QVHA 5DQPA 1JNEA 5HK4A 2PRLA 3VDHA 3W7JA 2IKIA 4UOQA 1PCKA 1IEVA 3CLMA 1IQ8A 6PTDA 2JEQA 3WJYA 3T42A 3PPCA 3IK4A 3NL3A 2W91A 1XXXA 4PC8A 2QJHA 3H23A 5EBAA 4QGCA 4E4UA 2ZX7A 4DRHA 3H4XA 1ISZA 5KETA 4IQCA 2ATSA 3WF0A 1GPWA 3SURA 1BXNA 3C8FA 3WDHA 3CL8A 1XH0A 1QNQA 3EPNA 1XBZA 1OC7A 2ZRUA 1RJRA 4QHRA 4MVAA 3JR2A 3B0PA 4NASA 4LFYA 4WIWA 3AIVA 4J3SA 1HVXA 4CLMA 4LQ1A 3T40A 3EIPA 1RH9A 1TJ0A 2PD9A 3GFYA 2ACSA 2D0GA 4IL2A 2IUZA 1W3KA 2D2OA 1XF0A 4H2CA 5C9WA 1FCQA 4AU0A 3OOQA 1Z6KA 2GK1A 1F6YA 4GIYA 3TQKA 3QPEA 3F2DA 2EKCA 3WBAA 2PRMA 5D9PA 4AD0A 3FAXA 2REQA 1T8XA 4QQUA 4G9PA 1LOSA 3AU6A 4U85A 4GYPC 3JYMA 4M80A 1TA3B 4AUBA 2QVNA 1JPKA 1X98A 3EDEA 3W29A 1CCWB 5SWUA 3S5YA 3UGVA 2WJZA 1AVAA 1QI4A 2CLLA 2CZ5A 3G1XA 1S46A 3NURA 3OZMA 2V0TA 2W5FA 4FR6A 4C91A 3NQ2A 3BV4A 4NKCA 3UXIA 3NYDA 1OBAA 1F3TA 3HF3A 3AIBA 3HU7A 1HGWA 1XLLA 3DH7A 4JX6A 4C5YA 3GAKA 4W9PA 5HPCA 3P84A 1VIWA 3UPWA 3ANYA 1VYPX 2ACUA 1RK6A 4WDTA 4I7VA 2Q02A 3IJDA 4HMNA 4PTWA 4QISA 1QZ2A 4MSSA 2R1NA 2ZCGA 3TIMA 3I6TA 2DVTA 1MW3A 1A0DA 3RAOA 2YA0A 1JZ4A 1K02A 1VBJA 2HE8A 2HISA 2OOGA 4F2TA 4K8GA 4E2DA 1THFD 1G7VA 4UXDA 3PBWA 5FJUA 1J6OA 1A3XA 5ABTA 2A3AA 3UWYA 1KKOA 4G2DA 1U1HA 2A3CA 2IKGA 4QLJA 1DQUA 4UFKA 1NFBA 3L4VA 3JRKA 3LYEA 3CUJA 2D2JA 1QTWA 1FKGA 3ZO9A 1PTDA 1POJA 3JYJA 3QKZA 1UP3A 4B5TA 5HMFA 4Z2HA 1JDFA 4TNSA 7TAAA 2B31A 1J0ZA 3M6YA 4IF2A 2ZQTA 3W6YA 4DB7A 3ES7A 1XHGA 4PUEA 4WLCA 5K4ZA 3VIGA 4HNLA 5IHRA 4MB1A 3N9KA 4UTWA 4EKJA 3I6RA 3H24A 5CZTA 5DT7A 3WY1A 1NTHA 1KGUA 1VLWA 1XQLA 3T0CA 4C6KA 3DFQA 4NJJA 2XGBA 3KDOA 3CIWA 4XZMX 1P7TB 4ASTA 3SUSA 3OIHA 3B8DA 1RJQA 1DHPA 2FQIA 1DJZA 4DJFA 2DW7A 3NL6A 5AYXA 5CCZA 5AC4A 1F8AB 3ABXA 4S3FA 1HTIA 3SN0A 5K4XA 1G4SA 3BPWA 1Q4WA 3KTCA 2Z28A 2F38A 1Q13A 1LOQA 4DJEA 3TONA 3VZZA 3MANA 3WJWA 1XC6A 4JTRA 4DM1A 1CB7B 3BAIA 5EFFA 1MNZA 4H8VA 2HWGA 2VEPA 8A3HA 2ON3A 4A2RA 2HK0A 5MKGB 2PF0A 4ITZA 3JZUA 5A1AA 4OBSA 1O6IA 2WSQA 4GVHA 2Y85A 3F4CA 2A6NA 1XLHA 1JI2A 4E3VA 1GTEA 1V6WA 5CG0A 1J0JA 1HX0A 3DHUA 1VFTA 4IPIA 3VNMA 4XB3A 3O5EA 3H2CA 3NQGA 3T55A 4QBXA 3LI1A 1ZFJA 2RAGA 2OSWA 3PUGA 4CNNA 5I07A 1IXNA 1QW7A 3KAOA 4I5UA 5HULA 1R9ZA 2PLJA 3KBMA 3FA5A 1E6RA 4IX2A 1SJBA 1Q6EA 4IJRA 3B3DA 1P43A 2PDNA 3HPZA 1LLWA 4G7EA 5AZ0A 5HUAA 1OY0A 1Q6FA 4AXNA 5C7VA 1YNYA 1UROA 3VTRA 2MF9A 4UQBA 4HD5A 2W0UA 4Q7IA 3IPWA 4UDMA 4Z0SA 3V0TA 3GKAA 4KWUA 5KZEA 2QXWA 4LC6A 2Q71A 1AK5A 1J12A 1FKXA 5H6HA 2FZ9A 2Y78A 4NZFA 1Q7QA 4C6JA 1WDQA 1QASA 1A5BA 1S2CA 2JALA 4QIBA 1OCQA 1UWUA 1R30A 3S5SA 2BVTA 4GIVA 3AWNA 3SQMA 3VNIA 3KAHA 1OFQA 4WGXA 3IUDA 4Q8MA 3L4TA 3KRSA 3RJXA 1GOKA 4TVCA 3DC8A 4ODLA 1AJ0A 3LN3A 1V0LA 3ARQA 3LZ3A 4FR1A 1OGSA 2GUBA 2BFGA 4RUBA 2EPMX 2C18A 2NZLA 4GNVA 2Z1KA 1MYRA 2QJIA 3BAYA 1GVOA 1VBHA 3IV3A 1S3HA 1WZLA 4PRTA 4YTUA 2G41A 1L6FA 2PAJA 4L1XA 1W37A 3GDTA 3KHDA 2QT3A 5A6BD 3R0UA 3KOZA 1MWOA 2WC3A 3I7SA 3MWCA 4FOKA 4N6FA 1G4EA 4TMBA 3I3EA 3BMVA 4O1CA 4O57A 2D23A 4WSHA 4WDXA 1MUWA 3VNYA 5B7YA 4H9ZA 3CWHA 4H7CA 4B5XA 3MKCA 2XH0A 2NWRA 1X96A 3G6LA 4O2TA 1JR1A 2QCCA 4ICNA 3U7VA 4OV4A 3IAPA 1UMLA 2F6XA 1YYAA 2JKEA 3BGAA 1GJWA 3N19B 2G8ZA 2G97A 3VGHA 5EFDA 2G0WA 1FWWA 4ZCWA 5H1WA 3PPHA 4YTQA 3TLLA 1FWBC 1JZ5A 3KOYA 1MFVA 1Y0EA 3WIJA 1NOFA 5DIVA 2BMBA 4WSKA 3K5XA 2P8BA 1OF8A 2GVGA 3CAWA 3H21A 5LXXA 1H09A 3CO8A 1Z44A 1R8LA 4LCRA 1XLIA 3LBMA 4N9DA 5AZ1A 3W1TA 4LAYA 1W2PA 2PB1A 4J28A 3RCMA 1XINA 5EPDA 1EDTA 3N2MA 2QMKA 3GXTA 2PN0A 1R3YA 2PP1A 2A0NA 3C6CA 5K7JA 5BNKA 6TIMA 1NDVA 3LZ5A 3GXDA 1R9HA 3NSMA 3O5PA 2IPWA 2YL6A 3FW6A 3P0WA 3XINA 5HQEA 2WSRA 2HEJA 5I3JA 1US2A 3WD4A 3AAMA 4RR4A 3VE9A 3PR9A 4MNKA 5FAGA 3HGJA 1EH9A 3NWRA 1M3UA 3VPLA 4J5NA 3W7PA 4U84A 5C9ZA 2UV8G 3UY7A 5A94A 2VD9A 2VGGA 2YW4A 3NZPA 3AMLA 5D05A 3E0WA 2VCCA 4QIUA 4AWEA 1EWEA 4FZIA 2Y70A 1E51A 5LNRA 2VDGA 4OE7A 3W37A 2DZPA 1NH6A 1U79A 4AYGA 2DZSA 2CIPA 5AHLA 4D8ZA 5LGXA 1V3JA 2PWGA 2LLEA 2WHLA 4A2SA 3P7YA 3WLPA 3DXIA 1IIGA 4LX4A 4YHGA 3S1XA 1FKDA 4U2ZA 1ZL1A 1EC9A 3L2IA 4EVZA 1ZJAA 1KFJA 3W23A 2NXGA 1KXVA 4XBKA 3AHZA 1HGYA 2QCNA 4LANA 2WKJA 4LW7A 4L9YA 3CL6A 2EAWA 1BD0A 3QMTA 4P5UA 1B6CA 5E1QA 1SMDA 1ISVA 2YBVA 4S38A 1DWIM 3VZYA 2PCEA 2VJXA 2F6KA 2W3ZA 3WMBA 1WDRA 3LSCA 2VZUA 3C2OA 5AB3A 3I10A 4MTVA 1E9ZB 3A5VA 3AO0A 4O19A 2AWGA 1UHVA 2CHOA 1RD6A 4OVXA 3KEHA 3UCQA 3UR5A 1K9EA 4KGJA 1L6SA 1X6UA 4PCSA 3KS6A 1J79A 1SZEA 4JAWA 4JCMA 4DIPA 1EA0A 4HHHA 4GFSA 1UCWA 4LAOA 3MUY1 3GC4A 1A5OC 5DXYA 2O4QA 4LUIA 1QPLA 1Z9AA 3GY1A 1TREA 2P10A 1EYEA 1E15A 4J7RA 5B7ZA 3KX6A 3EOLA 4B4FA 3G1RA 3U8GA 2H6RA 2EG6A 1PHWA 1R38A 1XL9A 3FSUA 1I9CB 3QHOA 4GE8A 1RD5A 2YCEA 1L6GA 2PTXA 4ZQOA 4QNEA 3TX9A 4AWSA 4GZEA 3EPMA 4K37A 5LA1A 3OB8A 2FPVA 3WLSA 4Q4SA 1Y5WA 5GNYA 1CZ1A 4HVXA 3RFWA 1XW8A 3DCPA 1TQXA 2POTA 1WDSA 5AVNA 3PK7A 3TYAA 4K1GA 5DMYA 4D1IA 4LGXA 1M5WA 4BF5A 1VF8A 3R89A 2A79A 4E0CA 9XIAA 2HV5A 4AISA 3U4FA 3B0XA 3WBXA 3EWXA 4S3JA 1OEPA 2PE4A 3NPVA 1FKKA 1PYFA 2H9AA 1DWAM 3ABOA 3UF9A 5E6ZA 8TIMA 4ZQPA 2J6VA 2XPBA 3LPGA 4MWAD 3W0KA 1JNTA 3AIWA 4J4KA 4X3ZA 4NJHA 4ENLA 1OIFA 1PIIA 1U83A 4KIEA 1XR2A 1GPFA 1YPIA 5H8MA 4IOTA 4Q7BA 3AXXA 1EKOA 3MO7A 4PUDA 4J3VA 1Q5MA 2FDSA 3ZFHA 3GX9A 3KBWA 2OSXA 3UWQA 3VCCA 4DPPA 3LDVA 4L4MA 3MDUA 1C8QA 2ZE3A 3KOXA 3GYCA 3UZJA 3CZGA 7A3HA 4H9MA 3FYOA 3NO1A 1EUNA 5HW8A 1H61A 4GUGA 4B5WA 1E1CB 1VR6A 3M5YA 4A3YA 1N8WA 1QCWA 2BWGA 3TROA 1LZOA 3MJMA 3STPA 6REQA 5EMJA 3VIFA 1FHDA 4LRSA 3CJPA 2R14A 5EMKA 4BA0A 2Y7GA 2GSJA 3M0HA 4O4VA 1YBQA 3E74A 1I0DA 2PURA 2PV2A 1EFZA 5DCDA 4AD3A 3T44A 1KV8A 5BMWA 1IEQA 1M1BA 3MI3A 1F4HA 3ARTA 2QIIA 3DHFA 3VGBA 3BJSA 3ZR5A 2OEMA 4S3EA 3PULA 3WH7A 2VC9A 4LBSA 3ARYA 1G67A 2P88A 5CQ1A 4ZE5A 3OLEA 1TTPA 3NEHA 5AC7A 2YCIX 1B4KA 5DBTA 1EXBA 2Z27A 1RP9A 3FX4A 1WDWA 4PMVA 1WP6A 1M7JA 3ZYZA 5HNNA 4NQ1A 3PM6A 1EHAA 1JNDA 2BXVA 3SCPA 3GG1A 2A3LA 2QCLA 1E0UA 7REQB 1UW9A 3QPZA 1AG1O 2XPAA 4GJJA 1GVFA 2BY3A 2W61A 1LBFA 2Y2WA 1BRLB 1UD4A 1EX5A 1XYBA 4MB5A 2FTYA 1LQAA 2PLCA 5BW6A 4R53A 2TAAA 4Y9PA 1Q63A 1LDCA 1TPWA 3WLMA 1S5TA 4R88A 3AQUA 4E8CA 2KGJA 1ICPA 2PWVA 2ONEA 4O12A 4B4HA 4AY8A 4ES4A 4DIAA 2PSNA 1F07A 2M08A 4MNJA 1FWDC 4CU7A 3WEZA 4GBDA 4TX8A 3TC6A 3LPPA 2VNCA 4TO8A 4CVUA 2QLYA 3Q2DA 1TYGA 1CGXA 5DRCA 2RDUA 4U86A 3IRSA 4DXKA 3NSXA 3GDLA 3ZJ8A 2DVXA 4GUIA 4RKAA 1PKNA 1JNSA 3UGRA 3IJ7A 3M7WA 4NG3A 1FWEC 1E6ZA 3PUOA 3WF3A 1ROUA 4LV9A 4DO7A 4W7VA 1EIBA 1KTCA 1EB3A 2XFWA 4LAWA 4RNJA 4DAFA 1QI3A 3W1XA 4JFUA 3G22A 3N4AA 4C02B 1SMAA 1BF6A 2QF8A 4WK9A 1L6WA 2YDSA 1L6YA 1QXLA 2Y1HA 5IFPA 3VD3A 2G4FA 2E6FA 1KCXA 3CMGA 1IF2A 2ZFAA 4U3CA 3KM8A 1BWLA 3U2CA 3VXGA 3RGCA 3PZIA 4R33A 4ZA0A 2YZRA 4PN2A 3H2EA 2Z1WA 3PBVA 2VCDA 1VFSA 5TD4A 3R79A 2EPHA 5M17A 3DAQA 2VN1A 1UR2A 4HGXA 1SJDA 4NSBA 5HA7A 3LHUA 5IXEA 4O15A 1XIHA 3D47A 2E4TA 2H8XA 1SSDA 2BOEX 5I3IA 3N9RA 3PWGA 4JEJA 1AODA 5LA0A 2AGKA 2E5DA 3W7HA 3PFRA 3WN6A 2G3NA 4MDPA 3T0BA 5CSSA 4JNMA 3MDWA 4JICA 2TRSA 5A5WA 2D1ZA 4AMAA 1KM0A 4UTWC 2QGYA 4H83A 1W31A 2GDQA 3QN3A 4NAFB 2EG8A 3KBSA 1GQNA 2A3BA 1SQ7A 5HTGA 5MHBA 1J6PA 4Y90A 5IBXA 1E71M 2HS8A 4ROQA 4H9XA 1WNOA 5CPTA 4YJ5A 5LIUX 2YCKX 1TMQA 2XP6A 1BG4A 1FBAA 3HFTA 3U0HA 2QPUA 1KLZA 4J3WA 3LMZA 3UR2A 3CL7A 5C9XA 2NQZA 2PWHA 1OX5A 1O68A 4LUJA 2DZUA 4GY1A 2Y8KA 4UR8A 4WJ8A 4XAKA 3BW2A 3LLFA 3AMCA 3SCOA 1LUCA 4DEFA 3LM3A 5D04C 3WMLA 4PYSA 4WR3A 1QT1A 2V3GA 3DEQA 1ODUA 3WD1A 4DF0A 2C3ZA 4KS0A 3G1SA 2OEKA 3QZAA 1RCQA 1NVMA 3H2NA 3HPFA 4UOZA 4RZ4A 2J62A 4KRZA 1SVDA 5U4NA 2C6QA 1EJSC 3NQCA 4BY3A 1KXQA 2WNZA 3QLLA 1FVPA 4TX9A 3ZQ9A 4NAEA 3RYSA 1DPMA 4W87A 4JCLA 2ZZ4A 1XPGA 2R82A 2I5QA 3IVUA 4M7TA 2YL8A 3V16A 4ZR8A 3S2CA 4K8HA 1S3TC 1P0EA 1FFRA 5KTLA 4F40A 3BAKA 3TA6A 2HK1A 3LRKA 2VDHA 1V02E 3PVFA 2BZNA 1YADA 3CH0A 2DZXA 2VEMA 4FA3A 2GWGA 2RFGA 3KL5A 4R7OA 4PGLA 3H8AA 3HBLA 3TFCA 1UASA 2IS7A 3PBGA 3W83A 2RUSA 3RLHA 1DQXA 3CIXA 2Y63A 4W7UA 4P7QA 1B1YA 2FH6A 2XP5A 4E6MA 2FIQA 4YHEA 1Q6QA 2OYMA 3FOKA 1K8ZA 5LIXX 3DGBA 1LWJA 3E2VA 4PH6A 5FF4A 3O5FA 4ZXLA 2GQ9A 4GNKB 1KT0A 2NW0A 1DWJM 4A4AA 3H70A 3KW3A 2WNQA 5I24A 1JJKA 3E2SA 4B15A 4QJ1A 1F8IA 1M03A 2WK2A 3WF1A 3L4YA 3DERA 2W63A 5CAHA 4AZCB 3UG3A 2AL2A 3KRZA 4IFKA 5A2CA 4GY0A 3F5LA 4GZJA 2I17A 4GI8A 1C3FA 3QMSA 4JFTA 1EDGA 5D02A 3ELFA 1ZBWA 1UR4A 4IGHA 4O14A 3M44A 5C6MA 5I3HA 2XFRA 2WC7A 4B5NA 1M53A 5FEPA 4F0RA 4ZPVR 3QZEA 1EEXA 4D6HA 1JDDA 2DFAA 4LF1A 3TAKA 5KMYA 3IKGA 3REQB 2Z24A 1XSJA 1XCXA 4C7DA 3EWWA 1F74A 4I8DA 2PS2A 1BWVA 2RKXA 4BQ2A 4PEEA 2BXZA 4UUIA 1NWSA 1TUFA 3UVAA 4TW6A 1YDNA 1SW7A 4QS6A 1GGOA 1XH1A 3BURA 3N15A 1OF6A 3EEZA 5HPOA 1VPYA 1GRJA 1VRXA 5KZMA 1BYBA 2QJMA 1UKTA 3WDPP 4WUIA 1IV8A 4JIRA 2C1HA 2GDVA 2VZTA 3T9PA 3W1MA 2XIBA 1TPDA 3T07A 3TN6A 3QRHA 3SRKA 3P8JA 4O1BA 4YU1A 1K7FA 3G0SA 3AIEA 1YXDA 4ODQA 4F48A 4JPGA 3N6JA 4DZ3A 5F2MA 2CITA 4LCSA 1CDGA 3B40A 1PE1A 3OVRA 1YDYA 3I7RA 4HQVA 1XIJA 3EMQA 4X0VA 3QQ1A 2EJ1A 4CCCA 3IKDA 1IT7A 1XIMA 4JIPA 1I45A 3PJXA 3SCTA 4HZMA 4C7GA 2G4JA 2GJRA 3A4XA 3WL1A 3UYCA 3EYPA 4WJXA 1VEPA 3GC5A 3U2OA 5LNUA 1TSIA 1UJQA 4M6QA 4AH7A 5AHIA 1ZENA 1GEHA 4GIRA 3V0SA 3TZNA 4HOWA 1O12A 3BOFA 4XV0A 4XO6A 1U5JA 2EO7A 1AUSL 3OU8A 3WLNA 3NUKA 4LY8A 3RITA 4GXPA 2INEA 3HQNA 3PR2A 3TYUA 4WX2A 3DFYA 4DJFD 2EULA 4XVEA 1PEZA 2ABBA 4NILA 3UFYA 4BI5A 3ZZ1A 3PZTA 2UBPC 5E93A 1G7UA 4LAVA 3UCDA 1GQKA 1E5NA 2WQDA 1JG9A 3H9RB 3RK8A 4KCUA 3LA4A 1XKYA 4DJED 3IIPA 1Z42A 3PBMA 1Z8AA 3DX5A 4KF1A 4MY8A 2XN0A 3MKVA 1CT5A 2V5JA 2O9OA 1F9CA 4CUCA 5A6MA 1QOXA 4UTHA 2OO6A 2DQXA 2KI3A 1W9UA 4EANA 4FNSA 1GQLA 1MRQA 2OODA 2Y5JA 4JXCA 1SSGA 4HMCA 2VENA 1EYWA 3GR4A 2X1IA 1C29A 3AZRA 4GFIA 3UWUA 1WA3A 4IT6A 3A21A 5DMNA 1OFBA 4HHPA 3TXVA 3NQAA 3ZLGA 1FWHC 5CC6A 4C6DA 2BHZA 2FZNA 1GVYA 2GJPA 3WLOA 4L65A 2V6AA 4ICMA 3WNLA 3LTYA 3FK4A 3EWBX 1W91A 3C2RA 1CBGA 2Z26A 4RL3A 2CLFA 2BXYA 3ID7A 1RBOB 3DIPA 4WZHA 1LBLA 3F03K 1QMLA 3PJWA 4KT2A 2CLHA 3TYDA 4IIEA 2CWNA 4B92A 1TUXA 1V0MA 3MUXA 3SAZA 3WYZA 4FSAA 6A3HA 2VEIA 2QUVA 4M19A 3GM8A 3OVPA 2XIQA 3B06A 4AX7A 1NWTA 4ZGYA 5H2ZA 4ODRA 2YFOA 2NVDA 1FKSA 3R10A 5I23A 4HSNA 3K30A 3VA8A 2DDXA 4MGVA 4GBUA 3WFLA 3NFUA 3HPXA 3GDKA 1FKTA 1OFEA 4I8YA 1H5YA 4Q33A 5F2LA 3OBAA 4UFLA 1BPLB 3UERA 1GOXA 3IGSA 1US3A 4LCQA 4MIMA 4OBTA 1R9XA 2DVUA 1BGGA 5FAJA 1P0KA 3W00A 4M56A 4MWAB 1J01A 3SR7A 1A50A 1U1UA 2V30A 1PAMA 3PPGA 4Z1AA 5CC3A 1PPIA 4BCEA 3IIXA 4XD6A 3E5PA 3RCNA 3OLIA 4GD0A 4OV9A 2AKMA 4FMVA 4N7QA 4JEQA 4Z1DA 1FHLA 1TPEA 2FH8A 4L56A 1JDCA 1HO4A 4V1XA 3G1VA 3WLLA 3GNOA 2B7PA 4FB7A 3URAA 3WNKA 3OO2A 2Y7FA 1V6UA 1B2YA 2YL9A 4UMBA 2DZWA 1S2UA 1L1PA 4QNWA 4B91A 1JUEA 3DUGA 1R2RA 4GJ1A 2WZTA 4NNBA 2XN2A 4HU3A 2E28A 1JCNA 3KUMA 2Y8VA 4PCFA 2DUAA 5HBFA 1V6VA 1KB3A 4XBSA 3LENA 4HHMA 1M41A 2PDIA 1BF2A 2QUNA 2I5GA 4EXQA 3ZVIA 2CKSA 4DNMA 4XTIA 2A6LA 3OJGA 3P67A 1I2RA 4KGLA 3MV11 3O5RA 2DU2A 2DSVA 1K03A 1WUEA 3MUIA 3GTHA 5DT5A 2CWXA 3B0YA 1KO0A 3LMYA 1X6LA 1ME9A 4Q22A 4K36A 3OBKA 2ZVRA 4AHQA 5B80A 2Y5SA 4AZ7A 2WZHA 4HP5A 3V0UA 1B3WA 4ZB0A 3GNXA 1FA2A 1QBAA 5TQLA 4W5ZA 2I9UA 4M6VA 2XINA 3WH6A 2PDPA 3TTSA 3WK2A 1J2BA 4MNLA 3ZWSA 3RLUA 3BGGA 4H4IA 5EMLA 4FXJA 3R8HA 2C1GA 3L7RA 2XP7A 2YL5A 4P8VA 4JTKA 1IXOA 4AD5A 3ARSA 3K8LA 2ETNA 3UNTA 1W26A 3E0LA 2RUDA 4D8AA 2EHHA 4EPDC 3C3UA 4DI8A 1Y5VA 1JVWA 4OUIA 5IHSA 3SSZA 4C7FA 2OU4A 4NT0A 4ZB2A 1H41A 2V2HA 3BO9A 2DT3A 4HJWA 3TN4A 3O16A 4OHQA 2OZ3A 4F0SA 4EAMA 4XZ9A 4YYFA 2ZR4A 1UWRA 4OIFA 3VAWA 5HJYA 8RUCA 4H8HA 3KVJA 2C15A 4RW3A 4AWTA 4DM2A 1UWIA 1XH2A 3IUIA 4US5A 4PA8A 5FJOA 1HUVA 1GORA 3NG3A 3AHYA 4F0LA 5E09A 3WUGA 2VELA 3S6DA 4E38A 1DHKA 2NV9A 3S1WA 2H8ZA 1YW1A 2ZXAA 3M0LA 4AIOA 2XDFA 3RMJA 1VFHA 3MZNA 3MZ2A 2Z6IA 4P7NA 5BRPA 3A4AA 2JGQA 2N87A 3L5LA 1RQEA 2PP3A 3S9ZA 4HPJA 1UWQA 3FYPA 3AS3A 3RO8A 3SY1A 4AZGA 1W1IE 2JK2A 4ZVJA 2C91A 3WJSA 4NNCA 3FXYA 2PDXA 2J6XA 1GW9A 2F4EA 4H9VA 5EMUA 3AUOA 1XCFA 2E40A 4CD4A 1TIMA 1S38A 3T7VA 1V6TA 4Z2JA 1HJVA 1DIKA 1XYMA 3O6CA 1EC7A 2OGYA 2VHLA 2WQPA 3KACA 3CUXA 3B9EA 4QG6A 3O5KA 1Z7AA 4KRUA 3MSGA 4UNKA 4Y9AA 4E2OA 3CUHA 2DZAA 5G4EA 1AH3A 4M0XA 4PMZA 2JIWA 2XU2A 2P5NA 4PTXA 2ZUTA 1IT0A 4MAVA 4O16A 4OGZA 2YA1A 1S5VA 5IRPA 5JXQA 3MI2A 4R0XA 4H19A 4QP0A 1TV2A 1M6JA 1KQYA 3TOYA 2BBFA 4NYYA 4DJDD 3UETA 2PPOA 4ICCX 4Z1CA 1FDZA 2J78A 3SECA 5GNZA 1DJXA 1VHCA 5TNVA 2HS6A 2FB2A 3N2BA 2OPJA 5BMXA 2DG4A 1XBVA 3EXRA 3H7UA 3L65A 1P6CA 1H5VA 3S5NA 2G3MA 4ZXOA 2PC4A 2WXDM 3NZQA 4GK8A 3TFXA 4I9AA 1UR8A 4ODOA 3M5XA 4DVOA 4YPJA 3FJ6A 1E6SM 4UTMA 5I03A 3L23A 3USBA 1DOSA 4DT4A 3FA4A 1CXHA 4RDWA 2PGEA 3TQPA 1ISXA 5CGTA 3UJRA 1B9BA 5FF3A 3MDYB 5EMMA 1D3HA 4QJ3B 2TYSA 1R9YA 1MEHA 3AFBA 1VCGA 3BMBA 2OWXA 5C5YA 1EQCA 1Q6LA 5IBXC 4OT7A 3EX2A 4JTTA 3DYPA 1JD9A 2VQUA 4LSBA 1OVDA 2E8YA 4P7OA 1TMHA 4LS0A 1PX8A 2NSOA 2GGIA 3FDKA 1PDZA 2DUZA 2MLXA 1FXQA 2YDQA 3Q45A 3NOEA 4OFCA 2J66A 3JW7A 3NPUA 4OKDA 3TTEA 2CEQA 5FESA 3GS6A 1DE6A 4QLLA 1AW5A 2E5CA 2WKLA 5LYRA 1XYLA 4I9JA 2R1PA 3AS1A 1UIOA 2D0FA 1XYFA 1KBJA 4C6IA 5CJ5A 4JL2A 4LVBA 3UXAA 1QHZA 4Q4KA 4H8NA 1W3NA 4BFAA 1DJYA 5CPMA 2NLYA 2GZXA 3BC9A 4EWND 4UTFA 4HOZA 2V5DA 1XI3A 4UB9A 4MLRA 3NQDA 3H4GA 4ZPWR 3W7EA 3QC0A 4OJYA 2UY4A 3RR4A 3UJFA 5ENLA 4ZL1A 1J96A 3BUVA 3THQA 4W4QA 4IHCA 1NMWA 4X9SA 2QCMA 3PHAA 2CCRA 4JGDA 2KO7A 3MUAA 2CLEA 3LCFA 2CHRA 2QAFA 3M41A 1XSIA 2MNRA 2P4VA 3T2QA 4BEUA 1BXBA 5GQBA 2GPTA 1N1AA 4DZHA 4CCEA 3T09A 3A12A 2XSXA 4X2RA 1P5BA 2J9ZA 1M5YA 4A3RA 1OK6A 3GR7A 2PF8A 1Q2SA 3NVTA 4MM1A 4IJBA 4A05A 3A64A 5DLCA 1JCXA 1X97A 1PCWA 3LV6A 3NO5A 4NAFA 6ALDA 5LHEA 2CC0A 2EXOA 1PVNA 4U2YA 3QFWA 1EP3A 1IXQA 4ZOAA 2Z6JA 1QVBA 3VOJA 3WELA 5AC6A 3BMWA 4H6RA 1FKIA 1QHPA 2F2DA 1FKLA 4C65A 3KE0A 3KCOA 4KERA 1CECA 1I2OA 3UWZA 4QZVB 3HG2A 3E6EA 3NQMA 2VR5A 1X8CA 2EF9A 1EZWA 3P74A 1V0NA 2A2IA 2DY3A 5I98A 2VFHA 1E4LA 5FJRA 1ESWA 2LPVA 1SR0A 2X2GA 1DBTA 4BK9A 2ZQSA 2XP9A 3R7MA 3K1GA 1VEMA 2A85A 3QGVA 4ATDA 4S3KA 4O18A 4QJ4B 2ZZ6A 1DIDA 2ZVIA 1GTHA 1R3WA 3A22A 4GO9A 2OMAA 1F40A 1I6NA 2ZADA 5M5DA 3HTWA 2E0PA 2MLZA 2IMRA 3CV2A 3K13A 4JR5A 4TUFA 1J8VA 3ZLHA 1WXZA 3UNDA 3WD2A 4Q3MA 1D7HA 3PTQA 4ATWA 4L9ZA 1R87A 3UI4A 4OWGA 3P62A 2KAUC 4M82A 3TYBA 3AXIA 1EOMA 3UBPC 2F21A 2WM1A 3M1ZA 3QW3A 1JUKA 4BI7A 4PUWA 5CC7A 3BLFA 3MB9A 1NFGA 4QE1A 4FOUA 4NXSA 4YNGA 1XRTA 1JEZA 1PIFA 4UCFA 3C0JA 3N13A 3UG5A 1XDJA 2NXIA 2RDTA 4HCDA 2CLOA 4IX0A 3VCRA 4N9EA 2NV2A 3WK1A 1YQ2A 3B0UX 3ICJA 3VM7A 3GXNA 2VWTA 2HTMA 4AZCA 3T05A 1FWCC 4MG4A 2YSWA 4TVDA 4DUOA 2DSZA 3ZT5A 2J88A 2ACRA 3TN5A 1HG3A 1K8XA 2POZA 1OIMA 3WLTA 3BAXA 1IZCA 3GTYX 1R7OA 4LTSA 2Y88A 3EOSA 2HSAA 2X0YA 1G01A 2CU0A 2VVSA 1SJCA 4IQDA 1OCNA 1FHVA 1XLGA 1W3JA 1ZALA 3VIMA 4JFJA 3N14A 3REQA 3DYMA 2HCVA 2GVEA 5FI8A 4DO4A 2PP0A 4IICA 3B03A 2HNHA 4KIRA 3AYTA 3P80A 1JCMP 4I90A 4IIHA 1J4IA 4FAMA 3GU2A 1KM3A 4LXFA 4WQ6A 4LRTA 4I7WA 2Z2AA 1H7RA 1V02A 4IPPA 2DIKA 3N29A 5JQ9A 1AZ2A 3BQ5A 4S23A 2NLIA 3T2PA 3V5FA 1DTUA 1TJPA 1FWGC 5AN7A 1FX6A 2PGWA 4ACYA 3L66A 2ZQ0A 1JDAA 4G7EB 2OT0A 5M2FX 3BQ6A 4DBWA 3MYPA 4E8GA 3WK3A 5CH9A 3R11A 4RE3A 1TVNA 1UC4A 3FFSA 3FHQA 5EU9A 3UF8A 1EBGA 4OOZA 5HQMA 4IJCA 2X05A 1W1YA 2Q8XA 3PSVA 2DQWA 1OYBA 1WX0A 4JHZA 4L6OA 3WF2A 2PDKA 2WBKA 4RDVA 3KBVA 3BH4A 3KTSA 1TPUA 2RH9A 3W85A 3SJ3A 4XZBA 2CBUA 4NI3A 2QV5A 5REQA 1TCMA 3EOEA 4J3ZA 2YDAA 1FHUA 2J47A 2OWCA 2FYMA 4CCZA 1T40A 3PZGA 2W9MA 3KTXA 1ADSA 1JFHA 4M1RA 4URIA 3H22A 2PZ0A 3PTKA 4I3GA 3CHCA 4ZTYA 5GJNA 4IP7A 4DWSD 1E9YB 1OT1A 3GDRA 3S1VA 1UMYA 4JKLA 4F2BA 4QM1A 3IJQA 2VRJA 1D7KA 4IUOA 1MW0A 2ZTJA 3M7SA 4NP7A 2RUQA 3QEZA 4HPNA 1OD0A 1RA5A 4I6KA 3TOPA 1J11A 1T11A 2VMFA 3IUHA 2WVVA 3I4EA 4DBUA 1T6MA 3BZJA 1OK4A 4EF8A 1CGYA 4PTMA 4ZSUA 2J7CA 3FXGA 1REQA 3CYJA 1NWRA 2A4AA 4YVXA 3R0DA 4N4QA 1BFNA 1YPXA 3CQ0A 2D22A 4NZ3A 3WKZA 3ORWA 4DO5A 4I9MA 1NOUA 3EDKA 1IHIA 4ILSA 4N6EA 2QAPA 3GZ3A 2XH7A 3KZPA 1KV5A 1ECQA 3L2MA 1ICQA 3W7KA 1VC4A 3O6AA 4P7LA 1FAPA 4Y7EA 3V75A 3GBDA 4PB5A 3LERA 1UR1A 2J4GA 1L8PA 3WMCA 1H7OA 5K3VA 2RGLA 2QW5A 4JTCA 3BXWA 3VMNA 3KOFA 4HA4A 2PDYA 3LS9A 1IEWA 4LVAA 3VKAA 1E55A 2RJGA 1W3LA 2FZBA 3NIYA 4C1KA 2ACQA 3RXZA 3A3HA 3H7RA 1JF5A 2GOKA 2KZHA 1VCVA 2QUUA 3SCRA 2GL5A 3KP0A 2Z1SA 2XH2A 5LKYA 1CLVA 4Q4OA 1KT1A 2V38A 4AIEA 3LRMA 4O11A 5TIMA 2G95A 5FEXA 1HW6A 4QE5A 2EG7A 3VKKA 1LCOA 3ZR6A 4IQ2A 1C7SA 1G9HA 3THUA 2XIIA 4O1AA 4LUTB 3WUFA 5G4WA 3MMWA 1MDRA 2J9XA 3Q37A 2HJPA 2AAAA 3C52A 3EXTA 3UWEA 1BVWA 4CNPA 3VUSA 4HSOA 1TELA 4UMAA 2DT1A 2OGJA 3CEUA 1FUYA 3ES8A 2GUYA 3N2TA 2WCGA 4NX0A 3OBEA 2NWSA 5FOOA 1R3TA 1PBKA 4Q8PA 1FTXA 2PLKA 1IYXA 1SZFA 1V0KA 4UQCA 5IOBA 2XP8A 5XIAA 1KGWA 1K9TA 4CKQA 1EBHA 4J2PA 5XIMA 3M9YA 2JGYA 1BAGA 4DH0A 2NX1A 3TDFA 1W9XA 1UKOA 3LG3A 4ATLA 3O3RA 2OLAA 4UQAA 3VDGA 2XSAA 4C6LA 1BEUA 3S5ZA 5E0KA 5DEZA 3WH0A 5A8OA 1PYMA 1SU5A 4UR9A 5BZAA 1KTBA 3TK7A 2BGSA 3H2MA 1P4CA