3G6MA

Crystal structure of a chitinase crchi1 from the nematophagous fungus clonostachys rosea in complex with a potent inhibitor caffeine
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
388
structure length
388
Chain Sequence
TGSINAVYFTNWGIYGRNFQPADLQASKILHVLYSFMNLRVDGTVYSGDTYADLEKHYSDDSWNDIGTNAYGCVKQLYKLKKANRSLKIMLSIGGWTWSTNFPAAASTEATRATFAKTAVEFMKDWGFDGIDVDWEYPASETDANNMVLLLQRVRQELDSYSATYANGYHFQLSIAAPAGPSHYNVLKLAQLGSVLDNINLMAYDYAGSWDSVSGHQTNLYPSTSNPSSTPFSTKAAVDAYIAAGVPASKIILGMPIYGRAFVGTDGPGKPYSTIGEGSWESGIWDYKVLPKAGATVITDSAAGATYSYDSSSRTMISYDTPDMVRTKVSYAKGLGLGGSMFWEASADKTGSDSLIGTALSSMGSHDSTQNCLSYPNSKFDNIKNSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase
publication title Crystal structure and mutagenesis analysis of chitinase CrChi1 from the nematophagous fungus Clonostachys rosea in complex with the inhibitor caffeine
pubmed doi rcsb
source organism Bionectria ochroleuca
molecule tags Hydrolase/hydrolase inhibitor
total genus 144
structure length 388
sequence length 388
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2009-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3g6mA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3g6mA01
2CBIA 1CXEA 4LXFA 4NZCA 1TMQA 4U2YA 1OGGA 2MANA 1DWIM 2XVGA 4MDOA 3AMDA 4BQ4A 2VX5A 5BRQA 5EFDA 3CZ8A 4Z2JA 4AEEA 3HJEA 1UKSA 3DECA 3IJ8A 1CXLA 4HOZA 4UOQA 1C7SA 5E09A 1OINA 3PTKA 2EO7A 3QHNA 4W5ZA 3DYOA 5M17A 4IPLA 4ZFMA 3WEZA 3AISA 2CIPA 4AZ5A 1GOQA 3ZSTA 3ARUA 3GNRA 4AZIA 1U33A 3WUFA 1GQLA 4D6GA 1UWTA 4P7RA 2D24A 2YA2A 1UWUA 4JFVA 4WF7A 1W9UA 3CHDA 1B3VA 3W38A 4WKAA 2EJ1A 3WELA 3J7HA 3MMWA 4LQ1A 4WSKA 3T09A 1ZBKA 4AC1X 2O9RA 1HKJA 4QLLA 1G1YA 1EOKA 1R85A 3W81A 2G3IA 3FAXA 4MADA 1E6RA 3GNPA 1V0MA 1MQRA 3NYDA 3ARXA 1V0KA 1CYGA 4C7GA 5FL1A 4PCTA 3VMPA 1E4NA 2DEPA 3MUAA 3AHYA 4BA0A 4OUEA 4W7UA 1HNYA 3BAKA 3THCA 2Y24A 4YHGA 2OYKA 3FNDA 4J7RA 4W88A 3VD5A 1E43A 3MSGA 5D9MA 2YIHA 2UY4A 1UOKA 4KRUA 1W9DM 3GDBA 3ARTA 1NP2A 3ARPA 1PZ2A 2OLHA 1BFNA 5A6JA 5CPQA 1DWFM 4UFMA 2DSWA 3AHZA 1LL4A 2E9LA 3PZVA 4B15A 1DEDA 2WVVA 3N17A 5CLWA 3OA5A 2VVSA 3DYPA 1K6AA 1BG4A 4M24A 1C3FA 1KXTA 4WSJA 3I3BA 3GNOA 3G6MA 1B1YA 2X1IA 2W66A 1QI2A 1E4IA 3A4XA 3VM5A 1HJVA 2X09A 1M01A 1KCLA 1QW9A 3I3EA 1BYCA 1E6QM 3VNZA 1E0VA 1BLIA 2E4TA 5CPSA 1H0IA 5LYRA 3PZ9A 4Z2GA 4FLRA 5C8BB 2UY3A 1WCGA 2X0YA 3GH4A 1WE5A 3VIIA 1QPKA 4BCEA 1JAEA 1CENA 1WDQA 4AZ6A 1VRXA 1BYAA 2Y2WA 3SUVA 3UG4A 3ZT6A 3A6OA 1UWIA 1JZ7A 4MDPA 3AZTA 1RP9A 5EMYA 1VFMA 1BTCA 1JIBA 1V3IA 1XH2A 2BFGA 3WNNA 1V0NA 2BHUA 2BVTA 2CCRA 2J7GA 5A2BA 1K9TA 2O9TA 4JAWA 1BF2A 3OG2A 3OLGA 2WMFA 3VMNA 1NWUA 1SR0A 2OSWA 5DT5A 4D6JA 5A2AA 1Y7VA 4CVUA 1PZ3A 3WD4A 3N9KA 2JIWA 2TAAA 4XZBA 2Q8XA 3WF1A 4BQ5A 4NRRA 3QR3A 3WUEA 3CUFA 1W3KA 3RO8A 4DWSA 1BSIA 2ZX5A 5E6ZA 1UD8A 2X8RA 3AYRA 4ZENA 3FAWA 4A4AA 2XWEA 1HP5A 1O6IA 2XJ7A 4TTGA 3WH8A 1HJXA 1EDGA 3BLPX 3BLKA 5A8MA 2G3JA 4U33A 3WUBA 1J18A 3AMGA 1ZBCA 1OSEA 5D8ZA 1RD6A 1UH4A 3VDBA 1OGSA 3T0BA 4UFJA 2YDSA 3AIEA 5HDRA 1QNRA 1VIWA 1WDSA 1QOXA 2VRQA 4MB3A 3BXWA 3WDQA 3BCDA 1FA2A 2CPUA 5A8NA 5AC5A 2V3DA 3L4WA 2RGLA 2WMHA 2EEXA 2VCBA 4V28A 4ATLA 4J28A 3WN6A 1Q6FA 1KBBA 1E4MM 4PMNA 3A3HA 1G9HA 4CU8A 4GKLA 1M7XA 1JDCA 5A69A 1NM9A 3CZJA 1BHGA 4BQ3A 4PMDA 3OGSA 1GOMA 5CGTA 1CGUA 4V2XA 1B90A 1JYNA 2BVDA 2W61A 1XH1A 4AYSA 3WENA 4QCEA 4RE4A 1JNDA 4OOUA 1R7AA 5JBDA 2XGIA 3NUKA 1UD3A 1J0YA 3U5YA 1OD0A 2EPMX 2D0GA 4CCDA 1KCKA 3ARQA 1UUQA 1FP9A 1PX4A 3UEQA 4B16A 3NDZA 3TOPA 1E55A 1JGIA 2BHZA 1PIFA 4GZEA 3VTRA 4HZ7A 4E4PA 5JIWA 3RM9A 2VVNA 3K1DA 2ZXAA 2VQUA 4P7LA 5CG0A 1KWKA 3WL1A 4GIAA 2YJQA 3W82A 1HX0A 1HKMA 5AC4A 2W91A 3BH4A 1TA3A 4AD4A 3LPGA 3OZOA 3CGTA 2JFEX 4FLOA 2HVMA 2WM0A 4NF7A 3VKKA 2ZUSA 2A3HA 1UYQA 1QNPA 1IZKA 3WDIA 2ZXBA 5I3DA 2VZOA 1B3XA 1JZ3A 1P6WA 1GOWA 4WJXA 5E6YA 4RE3A 3WY1A 2BXYA 3SCQA 4TVDA 4JKMA 4UFHA 1GQKA 3A47A 4GXPA 1J12A 3PZGA 3LMYA 3AXHA 1VEOA 2CNCA 2WMJA 5FKYA 4H8HA 4GO9A 3MANA 1E72M 1QI4A 1HVXA 2WCGA 2GFTA 1JZ2A 7CGTA 3M6DA 3VILA 4AZCA 3BAIA 3KEHA 3ARWA 2F8QA 1E1EA 5CZKA 4QCFA 1ITXA 4U3AA 3OBAA 5A6MA 4YHEA 3SCSA 2YDRA 1XV8A 4EK7A 4HA4A 4BF7A 3ARZA 5I6SA 1HVQA 3VGFA 2YBTA 2DIJA 2ZX9A 1W9VA 1E5NA 1E73M 3ZMRA 2YL5A 3SURA 1BQCA 2ZOXA 1OWQA 1E4LA 4D1JA 2XUCA 5HXMA 4ZEPA 1HL8A 3LPPA 2XFRA 1G5AA 4PMUA 2NSXA 2XSBA 5JUVA 1ZJAA 4U2ZA 1GHSA 3EMZA 1J0HA 3SUTA 5D9NA 1FHLA 4GO8A 3GH5A 3GXFA 5EB8A 1LL6A 3D5HA 3OLEA 1C90A 2ZUMA 4D72A 1W3HA 3TTOA 4M56A 5FL0A 1UWQA 3TONA 3VIJA 3SCRA 1I1XA 4DUVA 2CHOA 3AMLA 4IM4A 3MS8A 1HXJA 2ZX7A 3PBGA 1CBGA 2BV9A 1UR9A 5M3WA 3N12A 3VIKA 3WEOA 4UTFA 2W67A 2J74A 3PZMA 1UKQA 2ZUUA 1UWRA 1MW1A 3BC9A 5A6BA 1HJUA 2PWEA 2VUYA 4IPNB 1VEMA 1KR1A 4CD7A 1KB3A 1M53A 4UQEA 2QHAA 3VO0A 3T0DA 1W32A 1QI3A 2JEQA 1MQQA 4J3XA 3CZKA 3BSHA 5CLTA 2WSPA 3CZLA 1W1TA 5IXEA 1XD1A 5C71A 3AZSA 5LA0A 1NP0A 3N04A 4JL2A 1KGXA 3IJ7A 1DHKA 1LWJA 1H09A 4BS0A 1LQ0A 3AIWA 1E5JA 1J0JA 1ISXA 3VGEA 3WMBA 4FK9A 3G6LA 1KR0A 5GNZA 1JD9A 2YLLA 2OSXA 4AMCA 3WH9A 4PSRA 5A2CA 1IV8A 1NWSA 3AS0A 1W91A 4PSPA 4C7DA 3WH6A 3ZR6A 2Z1SA 2F2HA 4MTVA 1TR1A 2QLYA 5I5RA 3SUWA 2V5CA 3A4WA 4PCSA 5JH8A 2UY2A 3MV01 5I23A 3AS3A 4CD5A 1W1VA 1UD2A 3SCPA 4TOQA 1OBAA 2WZEA 2PB1A 2W63A 2W62A 2GJPA 4D6FA 4D6IA 2VNCA 3L4XA 2WBKA 1PJ9A 3EDEA 4WKFA 4IUGA 3HU7A 4F79A 1EGZA 2PWHA 2WHMA 4DWSC 5F7UA 3L4ZA 4CUCA 1OT2A 4HOWA 3FY1A 2YA1A 1LWHA 1NWRA 5D9OA 2E0PA 1M04A 2DH3A 1ODUA 2WMKA 3MUZ1 5CSYA 2AOSA 1SMAA 2BY3A 2QF8A 1V6YA 1QHOA 2Y8KA 4M80A 3ZJKA 2F61A 3QGVA 1XYFA 2ZXQA 3WMCA 2WLYA 1Q6EA 2YDQA 1CGYA 4CCEA 3PZQA 4OZOA 2WSKA 4W93A 1XCXA 3ALGA 2GJXA 2J4GA 3UR8A 3ZO9A 1UZ4A 2QPUA 1B31A 1J9YA 1GVIA 4JHZA 1KGWA 1CXFA 4P7OA 1BYDA 3MUIA 1V3HA 1MXGA 2ZX8A 1DP0A 3GXIA 1BYBA 1CPUA 4UFLA 3RJYA 2BS9A 3CZGA 3VD9A 5BXRA 1PPIA 4UOZA 3WF2A 5ABFB 2BNJA 4E8CA 3B9DA 3APGA 2W92A 2D2OA 3AS1A 2YBUA 3WBEA 3CUJA 4PUEA 2DGAA 4J27A 3VD3A 4X0VA 1CDGA 1UR2A 2YLAA 5FD0A 2XVPA 5DEZA 2J7EA 3BCFA 4PRWA 1GVYA 3PZTA 4WKHA 4ACZB 2WC3A 2PC8A 3HMCA 5CGMA 4UNIA 2FDMA 4NSBA 3VGHA 4D6EA 4Z2IA 1V3JA 1EXPA 3CZEA 2E8YA 1E0WA 4W8LA 3M46A 2J7DA 1EQCA 2ESCA 2BY0A 3RJXA 2VZVA 1CZ1A 4JFTA 2DT3A 5D8WA 4H7VA 2D3NA 3L4TA 1V6UA 4P8VA 2X2YA 1EDQA 2CKRA 4W7WA 1UD6A 5D9PA 1UD4A 3PZNA 4PMXA 1AQMA 2VZTA 1C8YA 1WDPA 4U5KA 1B0IA 1CNVA 2FH8A 4ZE5A 5FOOA 3KL3A 3FHQA 2V5DA 3MSDA 1VAHA 3EMCA 2VO5A 5BCAA 3ARYA 2UWFA 5IHRA 5HPOA 4ATWA 4HU0A 3BSGA 4TUFA 3WDRA 1HIZA 4LYQA 4AIUA 1C8XA 4Z2HA 1BGAA 3AJ7A 3TTYA 1TZ7A 2WB5A 4PMQA 3EYPA 1QI0A 4AD2A 3W24A 1QBAA 1JYXA 4LYPA 3POHA 4MB4A 4UZUA 1HJQA 4TTUA 4EANA 2V3FA 1FFRA 2FHBA 1MFUA 4AD0A 4XB3A 4CN6A 3SUSA 5I24A 1TVPA 3TTQA 2YL9A 2WVVB 3LPOA 3O9NA 2Y4SA 2IXVA 3MMUA 4X0NA 3F5KA 1HN1A 5EBAA 1R87A 1E6PA 5HBFA 3W28A 1FHDA 5CQ1A 1WNOA 3PZUA 1VEPA 3N11A 4GI6A 2FGZA 1OCQA 1BGGA 3VIPA 3U7BA 2YL6A 6A3HA 2WW5A 4JFSA 4J3TA 2G3MA 3DYMA 4UR9A 4ACYA 2WWCA 3T2QA 1CLXA 1W9BM 1JI2A 3AFBA 4HZ6A 3NSNA 2FGLA 2VX4A 1J0IA 3OGVA 5ABEA 2VT0A 3A4AA 3U57A 4W85A 5CJ5A 1E6ZA 3AMKA 3ZIZA 3U7VA 4NI3A 4F66A 4D6HA 3T2OA 3L4UA 2OSYA 3IANA 1JXJA 5FIPA 4YPJA 2EPLX 1XD0A 3SEPA 1EA9C 5E0CA 1RH9A 4MNJA 3FN9A 3U5UA 2VZSA 2O9OA 1GPFA 5BWFA 3SCWA 4IISA 3RDKA 4F8XA 3EDFA 1D7FA 3B8SA 3CHFA 2GJRA 4JHOA 2IUZA 2D22A 4AISA 4X9YA 2UY5A 2D23A 4PYSA 1QHZA 4QLKA 1ZL1A 2WZIA 4MNKA 2XIBA 1PBGA 3EMQA 3WNLA 4DWSB 1MW0A 1VF8A 2G4FA 3F4VA 2WWDA 1UQYA 3S6TA 3WUGA 3GBDA 3N18A 1QNOA 1AMYA 2EQDA 2E8ZA 2EPNA 3VPLA 4HZ8A 3WDJA 1V03A 5DFAA 1OGBA 1QI5A 1KXVA 4CU7A 2VQTA 2J79A 2ZUWA 3AXIA 5HOSA 3WDPP 3CIVA 3RPMA 4QP0A 5I0DA 4UQAA 3ZQ9A 1WP6A 1UKPA 4AD3A 3T2PA 1JF6A 3GBEA 3WQ6A 1V6VA 1PAMA 1TG7A 1BVZA 4BQ2A 1GOKA 2WKGA 3KE0A 4CGTA 4W7VA 2ZUVA 2XFFA 2W4XA 4PTVA 1DWAM 1SMDA 5D4YA 4ZE4A 5I79A 4QLJA 2J7BA 5ABHA 2EPOA 3DHUA 3N15A 2WCAA 1WPCA 4DUXA 1NARA 5GQBA 4AZGA 1XSKA 1F4HA 5IHSA 3MKKA 1JG9A 2GUYA 3ALFA 2XIIA 6CGTA 1LF1A 4Y7EA 1R86A 1NQ6A 2WYSA 1GZJA 1Q6GA 4M29A 3ZR5A 4AZ7A 1UG6A 4OBRA 4NRSA 2CYGA 3UR7A 2AMGA 2VURA 2ZWYA 1E3XA 3W53A 3WD1A 4J3SA 1UH2A 3GM8A 3KL5A 1L0PA 3AMCA 5FCZA 1XSIA 1UZ1A 5TD4A 2Z1KA 5A1AA 4HMEA 2WBGA 4TX6A 1JDDA 3ZM8A 3ZOAA 3AIQA 1VJZA 3AROA 5JBFA 4H8UA 1GOOA 2VR5A 5KZ6A 1UH3A 1DWHM 3DC0A 4XX6A 4EAMA 2CHNA 1F4AA 1GOIA 4HP5A 1UKOA 1K9EA 2DPEA 1CEOA 1ZS2A 2CBUA 3AHXA 4D71A 5HNNA 1TA3B 4KH2A 1J11A 2FHCA 2YKKA 1V0LA 1ODZA 1MVYA 2WXDM 3MU7A 3RCNA 4XUYA 1HKIA 4BZYA 3N1AA 4OKDA 2OWXA 3ARSA 5BRPA 2XM2A 4QAWA 2CXGA 1TUXA 1B30A 5GNXA 4JL1A 1AVAA 4KRTA 3SCTA 5A6AA 1XH0A 1KQYA 2G8ZA 3BMVA 1FOBA 1D3CA 4HMCA 2J7FA 3EDJA 4A3YA 2A3CA 3VM7A 3WDHA 2A3AA 3THDA 4CD4A 3MUY1 4AZCB 3OGRA 4UFIA 4H2CA 4V27A 3W25A 3ARVA 4MB5A 4E2OA 4PTWA 1R7OA 1UR0A 4M81A 5ECUA 1V6WA 1C7TA 1DTUA 1VBRA 3DHPA 3VINA 6TAAA 5ABGA 4EE9A 5I78A 2DSUA 2PWGA 1ISYA 1C8QA 4JCMA 4HPHA 1B2YA 4ZXOA 3VIHA 4JIEA 2WNWA 4FMVA 2J62A 2J75A 5E70A 4AWEA 3O6AA 5DMYA 1UKTA 3WF3A 4W8AA 2X05A 2JE8A 1JAKA 1CGVA 4MJ4A 3CUIA 2V3GA 1EQPA 5IFTA 3NIYA 2VTFA 4PMYA 1HL9A 4L4PA 4Q22A 1VBUA 1MFVA 1G0CA 1KFWA 2OWWA 4Q7NA 2E40A 3QHMA 1JFHA 2JIEA 5CXPA 1W9PA 5A6KA 5E9AA 4MJ2A 4AIOA 1J0ZA 1X6NA 1UWSA 4KWUA 2CBVA 5CPTA 2BHYA 3OIHA 2IXUA 1WB0A 4LPCA 3IAQA 2O92A 2JALA 5BYWA 3GXDA 1NWTA 2VX7A 1J10A 4Z2KA 3NSXA 3OLIA 3UETA 1BG9A 4KMQA 3GZAA 1MW3A 4P7NA 2XHYA 1VENA 3UCQA 4GQRA 3VNYA 4P7QA 2PI6A 1S46A 3TTSA 4HMDA 3SCOA 4B9YA 2V38A 3CO4A 1PEZA 2YL8A 4J3UA 9CGTA 2ZWZA 1ISZA 1W3JA 1LJYA 2VRJA 7A3HA 4U3CA 4M1RA 1XHGA 1PX3A 3OLDA 2DT1A 3PZOA 3WQWA 3UG5A 4FLQA 2GK1A 3AXXA 3SCUA 4S3JA 4DM2A 4F9JA 1G94A 1Z32X 1C93A 1H11A 2CERA 2VOTA 1H41A 1PX8A 2PWDA 3EDDA 1IZJA 1WZLA 3IK2A 3VIFA 3L4YA 3OB8A 3BGAA 4GZIA 1MQPA 4B3LA 1UR8A 4AD1A 4GZJA 1H5VA 2NT1A 5I2UA 1B3WA 4MAVA 1CECA 4MPKA 4F9DA 1UA7A 4OJYA 2GVYA 2PWFA 1ECEA 3GXMA 5A6BD 4U31A 7TAAA 3VVGA 4D6CA 1GQJA 1ZB5A 2G3NA 4W84A 3ZSSA 2WANA 1EOMA 3ZJ8A 3IJ9A 3E1F1 1KBKA 2CKSA 4HTYA 5CSUA 3CHCA 5A8QA 2V3EA 4J3WA 2PBOA 2PBGA 1GW1A 2XTKA 1XRVA 1EH9A 3T08A 1WDRA 3BAYA 3L2MA 3M07A 3W0KA 3RILA 1ISWA 2JF6A 2E9BA 4CD6A 2E9MA 1CXKA 1N82A 3PTQA 4MNLA 3WFLA 4AZHA 3WF4A 2Y5EA 2J47A 1UR1A 4AY1A 2XGBA 1I1WA 1GNXA 1X6LA 1TE1A 2QPSA 5DT7A 1JDAA 3KL0A 3AIBA 1BVNP 4H41A 4AIEA 3FXYA 3MMDA 3VUPA 2GK1B 1OIMA 3K8MA 1VFOA 4CN1A 3CPUA 1WO2A 1J0KA 4FF5A 4B3KA 3WD0A 1HT6A 4AZBA 2J8GA 5AYBA 2GJXB 1QBBA 3S2CA 2ZIDA 1E40A 1XGZA 1HKKA 3TA9A 4QFUA 3WMSA 5JBEA 1LG2A 2D0HA 4N0RA 3WQVA 3MO4A 1CLVA 1NH6A 3CUGA 1WKYA 4PMVA 2AAAA 1H0GA 1NOWA 3L2LA 1RPKA 1MWOA 2GSJA 1JNEA 1L8NA 2D0FA 2VJXA 3WKZA 2A3BA 1W2VA 4UQ9A 3ZT5A 5DO8A 3VIMA 4MB1A 3UESA 1AQHA 5M03A 1GQIA 1CGTA 3AICA 5A95A 8A3HA 4CU6A 4TX8A 4WK9A 3CBWA 1KWGA 3GTNA 4DUWA 1W2PA 3NDYA 3ZT7A 1Q4NX 4OBSA 4PBGA 3AI0A 4UQDA 4HOXA 1E3ZA 3WNOA 3OZPA 3VDCA 1XYZA 1JF5A 3K8KA 1BPLB 5AY7A 3ECQA 3CHEA 3ZJ7A 4D1IA 1JI1A 3M7SA 3K4DA 3VMOA 1GUVA 2J8FA 5A94A 4PN2A 1KXHA 4MAZA 2VC9A 4P8XA 3B9EA 2BXZA 2QMKA 3NCOA 1VJSA 2DIEA 3AHTA 4TXEA 4JKKA 1FH7A 4Z2LA 2XVKA 5LA2A 1US3A 1JZ6A 2VMFA 4RE2A 2Y8VA 3WQ8A 1DWJM 2GDVA 2WMGA 3PZIA 2ZXDA 3O2LA 2XVLA 2YOCA 3VDHA 3UERA 2C0HA 3W26A 1EHNA 4RL3A 1NOFA 2WKLA 1A3HA 2DDXA 5IFPA 4GPNA 2DSZA 2J7HA 2WZHA 1VFUA 3VIGA 4FLSA 1EO5A 3BAWA 4AW7A 1ISVA 4GINA 1J01A 2WAGA 5BXSA 3W6LA 3AZRA 4CN4A 4R5EA 1B3ZA 5I77A 2DQXA 1JYVA 2OWCA 2CBJA 1UR4A 4UCFA 2HISA 1US2A 2VR4A 2XWDA 4UQBA 3SUUA 5LA1A 1OM0A 4W87A 1E70M 1VFFA 2EPKX 1CGXA 1W1PA 1U30A 3W27A 4TVCA 3WNKA 4W5UA 1BAGA 1E71M 2WVTA 2W5FA 3WH7A 5A3HA 4JZ5A 1LL7A 1V3MA 1JXKA 3POCA 2ZUTA 2D20A 1LLOA 1XC6A 1B9ZA 3W6MA 3MV11 4HA1A 5BROA 4URIA 1TVNA 2CEQA 1CIUA 2VZUA 4PUDA 2VCAA 3D3AA 2DT0A 2J77A 2X0HA 3WH5A 1RP8A 3CTTA 1MW2A 2DH2A 2D1ZA 1YQ2A 4DM1A 3AIVA 4LGXA 4W89A 3VD4A 1ZJBA 1JZ5A 3KZSA 1GORA 1OT1A 4HPGA 1YHTA 1FH9A 4WIWA 2QMJA 1A47A 2VCCA 3K8LA 2WCSA 2WVSA 3VX0A 2VI0A 4PMOA 1EIBA 2BVYA 1Q6DA 4CCCA 5A6SA 3LPFA 2DSKA 2E3ZA 1GJUA 3PTMA 4B9ZA 1E1FA 1JZ4A 1Q6CA 2WHLA 4PMZA 3PN8A 2XYLA 3CMGA 1GJWA 3VGDA 1OD8A 2OYLA 2JF7A 2D3LA 1I75A 3WQ5A 3AIRA 3RMEA 2RGMA 1MYRA 1JZ8A 4UQCA 2BY2A 1WZAA 5A6LA 5A8OA 4DWSD 3WFZA 1KGUA 1MXDA 2WMIA 5EFFA 3AQUA 4ML4A 3WF0A 2WC4A 4E8DA 4EKJA 3WD3A 3PHAA 1E0XA 3I3DA 2J7CA 1V3KA 4PEEA 5DF0A 4P8WA 1V02A 1V08A 1ZBVA 4OOZA 1DWGM 2J25A 3B9AA 1H49A 1W9XA 3VGBA 1TCMA 1QVBA 4M8UA 4JFUA 3VOCA 5E0FA 3CUHA 3N13A 1QNSA 4GI9A 4CVWA 3K4AA 1QNQA 4P8UA 1ESWA 1WZMA 2YA0A 3CLWA 4J3VA 3WBAA 2XSAA 1KXQA 4JCLA 2C8NA 4H8VA 3ZJ6A 3EDKA 1QHPA 1UD5A 2C7FA 2WC7A 5KEZA 1K9FA 4PMRA 1E6NA 1UQZA 3AYSA 4M82A 5BXPA 5JIPA 4PTMA 1XCWA 4S3KA 3W29A 1H4PA 3QOMA 2OYMA 3F5JA 4GQQA 2VRKA 1HJWA 3W4RA 2NT0A 3W37A 3WQ4A 5BXTA 1CWYA 2QV4A 2DSVA 2FHFA 1NOUA 1FP8A 2J78A 1C92A 4YN5A 3GH7A 3FW6A 1E9LA 3CH9A 1X1NA 2VL4A 2ZE0A 5M5DA 4A3HA 4C7FA 2GDUA 1OB0A 4JFWA 1AQ0A 4N42A 8CGTA 5C70A 2EBNA 3RM8A 3AOFA 2WMIB 1CXHA 1JD7A 3VD7A 1EDTA 4UFKA 3SCVA 1E15A 1K9DA 3VU2A 2WK2A 3WNPA 3WL0A 4HU8A 1ITCA 4JKLA 1WAWA 4L4OA 1E6SM 3FHAA 2BY1A 1D2KA 4LYRA 4H04A 1GONA 2B31A 1R8LA 1M03A 3IAPA 1UA3A 1E6XM 1SFSA 4XZWA 2WHKA 3BMWA 3NSMA 3WNMA 2A3EA 1V3LA 3JUGA 1W3LA 4CKQA 4R27A 3VX1A 5GPRA 1EO7A 1W1YA 1U2YA 2JEPA 2WLZA 4ZXLA 1JFXA 2CITA 4ATDA 4AXNA 1JYWA 3AS2A 2EXOA 1ZU8A 4W8BA 1H1NA 2ZUNA 1H3GA 3GYCA 1V6XA 4K68A 2FH6A 5A8PA 1PIGA 1TFVA 1VB9A 2ZX6A 1LG1A 3L4VA 3WSUA 3VGGA 1GHRA 4LX4A 4W86A 5IDIA 3BAXA 1FH8A 4QDMA 2XM1A 1O7AA 4KGJA 4U5IA 2CETA 1V02E 4D6DA 1ZBWA 1XSJA 2ZICA 2WVUA 3SCNA 3RM4A 2DT2A 3CMJA 3WD2A 5HPCA 1H2JA 3AIUA 3VIOA 3EBVA 1B3YA 3AHVA 3WEMA 5AYIA 4OIFA 2XG9A 1G01A 3SIMA 4TVUA 1QW8A 2VX6A 1FFQA 2XFYA 4MNMA 1HP4A 2G41A 1OIFA 1UHVA 3KWXA 4UOJA 4AEFA 2XVNA 2CESA 1CXIA 1KQZA 5ABFA 3BAJA 3QOKA 1EHAA 3QHOA 1CTNA 3T0AA 1CGWA 4PTXA 4HA3A 1JL8A 1E56A 1HF6A 2NW0A 3F5LA 3UG3A 1C91A 3ARRA 3HN3A 2WPGA 1HJSA 1WZKA 5GNYA 4KGLA 2WHJA 3RIKA 3II1A 1IT0A 4ACZA 4AD5A 2O9PA 3WIJA 1GCYA 1SYTA 3NJ3A 3K46A 4UZSA 3VDAA 4GI8A 4CD8A 2XPKA 4WLCA 2PF0A 4XV0A 3TP4A
chains in the Genus database with same CATH superfamily
2CBIA 1OYCA 2ZRWA 4OE7A 1F5ZA 4I9AA 4J2PA 4DXKA 1DWIM 2XVGA 3JU2A 2VX5A 3TZFA 4EIVA 4AEEA 2WJEA 3P2VA 1C7SA 2EO7A 1UBSA 3QHNA 1A80A 5FF0A 3SJ3A 4ASTA 4DJEA 3OQ8A 1EGVA 4HYWA 3W7CA 2CIPA 5DX7A 1DBTA 3ARUA 4XZ9A 4LS0A 1U5JA 2R1LA 1LP6A 1P0EA 3PPHA 4QE5A 3B4UA 4P7RA 4FXFA 1W9UA 1B3VA 4TW8A 3W38A 2EJ1A 3WELA 4WSKA 5LIWX 1EC9A 1HKJA 4QLLA 1J2WA 3P61A 3UGRA 1DJXA 5LKYA 2R8WA 3H53A 3UWYA 3GNPA 1PS9A 1YEYA 4O4VA 4C7GA 5FL1A 4NJHA 3E5PA 3TNBA 4W7UA 4YHGA 1L6SA 1POJA 3TCSA 2RDWA 2Y88A 3MSGA 2HBVA 2GVLA 1P7TA 1HXVA 2GOKA 3VFCA 2GWGA 4R34A 2PDKA 1PZ2A 1FHVA 2OLHA 4H9VA 3WYZA 3SFWA 3KBNA 4GQGA 3PZVA 1PE1A 2OGJA 1NDVA 2WVVA 3OA5A 2VC5A 2E1DA 1K6AA 2PUZA 1FWGC 2F23A 1DOSA 4JTSA 3PY2A 1RSCA 1A5UA 1BYCA 3BDKA 4HARA 3BOFA 4FR6A 5HNRA 5CPSA 1RVGA 4MF4A 3ITTA 2UY3A 2X0YA 4PB4A 3VIIA 3UGVA 1JAEA 1SU5A 3TSBA 1RVKA 1VRXA 3OO2A 2V30A 3AXMA 1UWIA 2PZNA 2Z25A 1AUSL 1SO6A 3TFCA 1DQUA 2REQA 3KRSA 3KHJA 3HZ3A 3LLFA 4I9TA 3C52A 1JIBA 3U4AA 3NZPA 3I7SA 2X7WA 2ZFAA 2J7GA 5A2BA 1K9TA 1ONWA 3LCHA 4O17A 1JVNA 2AAMA 3I7RA 3OG2A 5GJPA 1A7XA 3EA2A 3VMNA 3S3GA 1A5AA 4AMAA 4DYKA 2RQSA 2XN0A 1VS1A 4FNUA 2CZVA 1PZ3A 1TPC1 4ZPTR 4NJGA 3PSVA 4AIBA 3KTXA 4K7YA 2Z28A 2YCEA 5FEWA 4XZBA 3EZ4A 4H3DA 2QIWA 1TV4A 4NRRA 5LXEA 3L9CA 1W3KA 1FCQA 1BSIA 3LXBA 1S2UA 2X8RA 3AYRA 1KBJA 1QO2A 1HP5A 3BGGA 1Q1CA 5G5IA 4TTGA 3WH8A 5IM51 1EDGA 3DHFA 2ZYFA 5CBBA 2GGIA 3W1XA 4J40A 1RD6A 1QWGA 4ODQA 3SW6A 4LAUA 2ABAA 4HSNA 2YDSA 4K39A 5AVHA 1ZAJA 1ENUA 5DY3A 3UXLA 4Q32A 3W1PA 4DI9A 2CPUA 5AC5A 1OZQA 3L4WA 3ZR4A 2WMHA 2EEXA 2VCBA 4JDYA 1TV8A 3PFRA 3W84A 4FPSA 2DUXA 1PKNA 3DFQA 3VKJA 4Z17A 2YYUA 5MF5A 1YE4A 2Q02A 1OX6A 2V9DA 2ZQUA 3ZWSA 1F61A 1BHGA 1L6GA 3U0HA 4JS3A 1KFCA 2Y5SA 1CGUA 4V2XA 1B90A 1JYNA 3FJ4A 3WMLA 2BVDA 3IACA 2PDNA 2PA6A 4LW7A 4OOUA 5JBDA 3QEZA 4JHMA 3HFYA 2M08A 1TZ9A 1J0YA 3R1ZA 3QV7A 1KRMA 3W1LA 2EPMX 3R94A 3U2EA 2D0GA 4CCDA 1XDMA 4S1FA 1UUQA 4LU0A 5D2VA 1TV5A 3UEQA 1EYEA 4GGQA 3H2OA 1JGIA 1XQLA 2BHZA 3G3DA 1OX5A 4E4PA 3K1DA 3JYMA 4MKSA 2ZVIA 4LNCA 4P7LA 3R2GA 1KWKA 4GIAA 1PIIA 3FSUA 1HKMA 4LUYA 2PF8A 2W91A 1Y65A 1Y5XA 1R46A 4X60A 2DZUA 3ONCA 1ZFJA 3S6DA 2HVMA 1FXPA 3VKKA 1UYQA 4GXWA 1XBYA 2P4VA 3GY1A 2XP7A 1GOWA 3SCQA 3L68A 4TVDA 2NQHA 4JKMA 2J9YA 4GXPA 3AXHA 2WMJA 1LRTA 1SR9A 2AL2B 4H8HA 5MKGA 3MANA 1OJXA 3CEUA 4ZCWA 2WCGA 2GFTA 1XPYA 3FKRA 7CGTA 4JTIA 1E1EA 1CW2A 4JNMA 4US5A 1T6MA 4NJJA 2EG8A 4FALA 4QCFA 1BXBA 3TAOA 1XV8A 2QVHA 4HA4A 4BF7A 3B9OA 3ARZA 1ICQA 3NZGA 5K3VA 2YBTA 2ZX9A 4N9EA 1YW1A 3TVAA 1E73M 4JTUA 3AJXA 2YL5A 4XK2A 1FWSA 4MY9A 1LBFA 1E4LA 4FNSA 3PS7A 8XIAA 2NSXA 3E5BA 1PHWA 5HA7A 4IIBA 5D9NA 3PTDA 5EB8A 3B40A 1MDRA 3FAPA 3GC4A 3UG8A 4G7EB 2IKJA 2UZ9A 4R9OA 4D72A 1FJDA 4M56A 4QNEA 1EUNA 4O52A 3VIJA 2ZADA 4GYKA 3UCCA 4C02B 2ZQTA 4NZ3A 3QTGA 1CBGA 2FTYA 1VC4A 5M3WA 2Q71A 2BTMA 2J74A 4HNLA 5DXXA 1K03A 1FDYA 4AVFA 1UKQA 1L1PA 4NZFA 1EJVC 1UWRA 3BC9A 5I3FA 3DDMA 1HJUA 3NQ7A 4IPNB 1W5QA 3KOZA 3T6CA 2P88A 4AWSA 5L9FA 3B0XA 3TYAA 3W2JA 3Q45A 4MWAD 3A23A 2KAUC 3U4FA 5CLTA 3BSHA 3UW6A 2WSPA 1H63A 3QVQA 4U28A 5IXEA 1K4HA 4KIRA 3AZSA 4LH8A 3N29A 2FB2A 1P1MA 3IJ7A 5I3KA 2B81A 2GYIA 4Q4PA 2X41A 1ISXA 3VOGA 3WMBA 2V5JA 3G6LA 2I7GA 1PTDA 3SM0A 3N2CA 1OVDA 1JD9A 1JRCA 2WQDA 2YLLA 1L2UA 3OU8A 2UBPC 4PSRA 1MSSA 4DO7A 2QCFA 4K8EA 4PSPA 4C7DA 1V4YA 3ABXA 1XF0A 4O11A 4CNOA 1VYRA 5I5RA 3SUWA 2V5CA 4LUTB 3A4WA 4DO6A 4L4MA 5JH8A 3MV01 4JQ2A 5KTLA 5I23A 1DTNA 3LOTA 4LC6A 4GACA 5HMFA 2RUCA 3H2MA 4TOQA 1E0TA 1OX4B 3LV6A 2W62A 2D69A 2XH4A 4DAFA 1FKFA 1F8MA 1PJ9A 4DF1A 3EDEA 4IUGA 1KLZA 5BWAA 2WHMA 3A24A 4CUCA 3TROA 4L6HA 3LD5A 4HOWA 3NL6A 2W0UA 1A3WA 3CLMA 2DH3A 2BY3A 2RKXA 1ONXA 1D7HA 1XFCA 3MI2A 3ZJKA 1XYFA 1VZWA 5CC7A 5BMXA 3WMCA 2GQAA 2WLYA 1Q6EA 4DNMA 4E6MA 2YDQA 2PDFA 1UB3A 1ZCCA 4NG3A 3F7JA 2YB4A 3UR8A 1QU4A 2HV5A 4DI8A 1LCOA 4IGHA 3K13A 1FCUA 4POCA 1J9YA 1GVIA 1VKFA 3I65A 3ID7A 4MGVA 3C56A 4Y9NA 1MXGA 4ICNA 5JMUA 3GXIA 4Z1YA 1BYBA 3GIPA 2WSQA 4O1EA 4L1GA 3IRDA 3APTA 2BWGA 3APGA 5D33A 1H7OA 3WBEA 3CUJA 3TXVA 3N3TA 4J27A 3QGKC 1MEIA 1CDGA 1BVWA 1BEUA 5DEZA 3EPOA 3NQCA 2PEVA 3E2SA 2VENA 3G1AA 4NNBA 2FTWA 3DFYA 4Q4OA 5CGMA 4Z08A 2ACSA 3MYPA 4MHBA 1V5XA 4HBKA 4ZGYA 8TIMA 1EXPA 2FZ9A 2QV5A 3W7DA 4W8LA 3M46A 5CZTA 2JQXA 5FJIA 1JUKA 2BY0A 3OYZA 2ABBA 4KF1A 4JFTA 3C0JA 2P0IA 4DIPA 3MCMA 1KT0A 2PDHA 4GVGA 3KRZA 3W7KA 3GNNA 3CIWA 1OCNA 2X2YA 1F6KA 2CKRA 1O5RA 2HNEA 5C9XA 4UC5A 2VD8A 1TRDA 1FCBA 2OZ8A 1B0IA 4CCZA 1TSIA 3EKGA 3JYJA 3W1AA 2PWVA 2Y78A 4L9XA 3UPWA 3LTPA 3SGGA 3W85A 4HNUA 4TU1A 1DQXA 2HXUA 1V8EA 2FVLA 5IHRA 5HPOA 1VBGA 4O50A 4HU0A 4GBUA 4LYQA 4AIUA 4P5UA 1NF0A 1XLCA 1BGAA 3BSMA 3AJ7A 2V5KA 2A79A 3EYPA 4JNZA 4X63A 1ZHAA 4DROA 1RQBA 3TMQA 1QBAA 3MW7A 4LYPA 3K30A 2CZEA 4MB4A 1EZ2A 2NVCA 4TTUA 4HQVA 1Y5WA 3GHSA 4DWDA 3A3XA 3RCYA 4XB3A 4O54A 2C18A 3HPAA 1S3TC 3L66A 4Z0SA 3LPOA 4FX7A 4E5TA 3DN5A 1UZDA 3F5KA 5EBAA 4ICCX 3SN0A 4O1BA 2QGHA 3SGUA 3W28A 4F0KA 3P82A 3GG1A 2OFJA 4KCWA 1M7JA 2CLEA 1JCNA 1A0EA 1DIOA 1THFD 2DW6A 3U7BA 4KPLA 1C9WA 6A3HA 4J3TA 3R58A 4WY0F 5CEWA 5C9UA 1KKRA 3T2QA 3AFBA 2VX4A 4KIEA 4AVNA 3A4AA 3E0WA 1N8FA 4CNNA 4IIGA 1E6ZA 3QSRA 2R1MA 3L4UA 4YPJA 1U5VA 4I5RA 1EA9C 5E0CA 3GKFA 2PLMA 2XN2A 4ODOA 5BWFA 3W7HA 2J6XA 3RDKA 3RX3A 2GJRA 3B8SA 3CHFA 3CUZA 3P3BA 3C8NA 4JHOA 2D22A 3P84A 3DZ1A 3LN3A 2R24A 2PDYA 3DG3A 4UTTC 4B91A 4J5NA 1Z3NA 3DX5A 1H62A 1XGDA 3R4IA 4H6QA 4DWSB 3F4VA 3KRUA 3VNMA 2EQDA 1CT5A 1NU5A 2E8ZA 4HZ8A 4UTWA 3VOIA 5DFAA 5FESA 1GRJA 1OGBA 3HG2A 4PL1A 3I4EA 3FDKA 5EKYA 2ETNA 3V75A 3OVGA 2BASA 3GWQA 5I0DA 3ZQ9A 3T2PA 1JF6A 1PAMA 3BMBA 2R14A 3RF9A 1GOKA 3MJMA 3KE0A 3VNDA 3LRLA 3WQPA 2XFFA 1WAUA 5REQB 1DWAM 2QYGA 4JY9A 5ABHA 2TMDA 1EJRC 1BF6A 2WCAA 1IWBA 4N6EA 4DUXA 4GH1A 2LKNA 5GQBA 3DFPA 2MUCA 1E1CA 1F4HA 3N4EA 4OBTA 3GVWA 1LF1A 1IXOA 1TMHA 1KCXA 2R1PA 5K9XA 4W9OA 4AX6A 2WYSA 1GZJA 2H3BA 1Q6GA 3SQMA 5XIAA 5AC7A 3GW0A 2CLFA 4NRSA 2OKTA 2ZWYA 3W53A 4ZOEA 4ZB2A 3SQSA 4J3SA 3KL5A 3PAJA 3W83A 1JGMA 5I3HA 3VE9A 5TD4A 2OQYA 4HMEA 3CQIA 2WJZA 4IT6A 3AIQA 3GTFA 3RRXA 4H8UA 1GOOA 2VR5A 5AHMA 4GX8A 2P1FA 2INZA 3QPEA 4XX6A 2CHNA 1GOIA 1IGSA 2DPEA 1CEOA 1DJHA 1OK4A 3PSWA 2NSOA 3UY8A 4XD6A 1RALA 5HR7A 3KOYA 4D71A 1A5CA 3JZUA 2FHCA 2FDSA 2PDWA 1T41A 4B5VA 3LZ5A 2F21A 4H9TA 4LCRA 4D9PA 4DBSA 5IBXC 3IGUA 1GK8A 1BKHA 4XUYA 4GXMA 1KO0A 2ZC8A 2WNZA 4JFJA 2A4AA 4KFNA 4JFLA 1MZRA 2CXGA 1B30A 3V18A 1XLIA 1A5MC 2VFGA 3E0IA 3BJFA 2G8ZA 4XZHA 4DBUA 4IFKB 5D09A 4HMCA 2EG7A 2J7FA 4IIFA 5HWNA 1H1ZA 4A3YA 3M44A 3VM7A 3HPXA 4HBOA 1FKXA 3MPGA 2OT1A 4NZ1A 2FLIA 1P6CA 5EL1A 2KE0A 3V5CA 3ARVA 1Y0EA 3LUTA 2QUNA 3CEPA 1V6WA 2WPBA 1NFGA 4Q3MA 1DTUA 4J2MA 6TAAA 5ABGA 2LGOA 3QQ0A 2PDCA 4QJ3B 4N7QA 4MWAE 2A0NA 3GFZA 1C8QA 1VBJA 4QXIA 4HPHA 3ZWTA 1NTHA 4UDMA 2J62A 5E70A 4KQZA 4K2SA 3O6AA 3ERPA 4W8AA 1XP3A 1G7UA 3MVTA 4FX6M 1TV2A 1TR9A 4IMEA 4C65A 2G4JA 5IFTA 5XIMA 1HL9A 2V2CA 4L4PA 3WBXA 4GYPC 1VBUA 2OWWA 3N6QA 2JIEA 2QCHA 3GYEA 1W9PA 3EKLA 4LB3A 1KM5A 5A6KA 5HINA 3R43A 4MJ2A 1BWKA 1UWSA 1OFEA 5CPTA 3JXVA 1R3WA 2NUWA 3OIHA 3GD6A 2YFOA 3HPSA 3NPUA 1PWMA 3GXDA 2WV8A 4O1AA 4KESA 3UETA 2AMXA 4RZ4A 2DZBA 2TYSA 3EWZA 1BG9A 1IXNA 3NZ1A 3UJSA 2QCCA 1KM0A 3IV8A 5CCZA 3UCQA 4DJFC 2VGIA 3M0VA 1VP5A 4ERGA 4XAKA 2PI6A 1S46A 4A8LA 3N2OA 3HQ1A 1O4UA 3G1RA 1JEZA 3ES8A 1FKKA 3EA3A 3GQYA 1LJYA 7A3HA 4B2DA 1XHGA 3W70A 3OLDA 4QEHA 2O4QA 3UG5A 2XP5A 2NQ5A 3VNKA 4FLQA 2HE5A 2A7NA 3AXXA 4XZMX 4S3JA 4PR4A 1GEHA 3K2GA 1H11A 3NEVA 4JN7A 5U4NA 2CERA 3MUXA 5LZLA 2VOTA 2FKPA 2PWDA 3EDDA 1GVQA 4PMJA 1VIZA 1VHCA 4GZJA 1H5VA 3DERA 2NT1A 1B3WA 4MAVA 1S5VA 1QCWA 3LEPA 2TODA 3MBDA 1PUDA 1QO5A 3NL2A 2GVYA 4X2PA 2PWFA 3GXMA 1JPMA 2ZZ7A 1YE6A 4PBEA 4U31A 1RCXB 2X42A 4LYKA 4ADUA 3ZSSA 1R3QA 3E1F1 4BF8A 1KBKA 2Q3RA 5A8QA 3EA1A 1XINA 4KW2A 4DZ2A 4HJWA 5FF7A 4S39A 4C90A 3L2MA 1XLFA 2OVLA 3R10A 2CZDA 3RILA 2E9BA 5DRCA 1YDOA 1N82A 4H9ZA 3WFLA 3FGCB 4AZHA 3KUMA 4RZBA 2J47A 5BOFA 3VZXA 5HUAA 1R2SA 4E3VA 4NHVA 1GNXA 1X6LA 1DV7A 1TE1A 3CQKA 5FAJA 1BVNP 1FKWA 4MJMA 4AIEA 1FKHA 2GK1B 4B4HA 1VFOA 4CN1A 2E09A 5FSDC 4B3KA 1PSCA 4AF0B 1J2BA 4P2VA 1ZJIA 4GNVA 2GJXB 2QXWA 3GDMA 3S2CA 3HO8A 4E4UA 5H1WA 4JTRA 2Z00A 5F2LA 1LG2A 4PULA 4AVOA 1KD0A 3MO4A 3LY0A 1WKYA 2ZKMX 3XISA 1L8NA 2V0TA 3HG3A 3S46A 5EMKA 1NELA 2X2GA 2A3BA 1W2VA 3V5OA 4MB1A 1OHLA 5EMUA 5IDZA 2CLLA 4DXXA 8A3HA 4ZFCA 3CBWA 5AB3A 1W2PA 1A5NC 4XVEA 4OBSA 4DZ5A 3EX2A 1FWEC 4US6A 4G7FA 3A5VA 4DUOA 4FR1A 1JF5A 4MOZA 1GVFA 4N19A 2NXGA 3OQEA 4ROQA 2C13A 6REQB 5C0QA 3M7SA 3VMOA 1P6BA 1GUVA 4DJED 5A94A 3M1ZA 3W22A 3G8RA 1G4TA 2VC9A 1TWWA 4YXGA 2YPIA 3BICA 1IR2A 3AHTA 4TXEA 5AZ1A 4CNSA 1ONRA 1G4PA 3UR5A 3UWZA 1FH7A 4DJDA 4N6FA 1REQB 3VOHA 1IEXA 2EKCA 2Y8VA 5CG7A 5EBUA 4RUBA 3PK7A 2XVLA 4DHGA 4M6PA 1NOFA 3U2ZA 4B3ZA 2J7HA 5D75A 1TWIA 2XIOA 4HCLA 2PPGA 3D47A 2AWGA 3BAWA 3W76A 4WOQA 1VYPX 2RAGA 3GX9A 4AW7A 4C6IA 4GINA 3R6IA 3AZRA 3MA8A 4C1KA 4L1WA 4CN4A 5LNVA 4R5EA 1XIBA 1MNZA 4WDXA 3NAVA 4H9YA 2OWCA 4UTKA 3LGGA 1X8FA 1EC8A 1ROUA 4Y6GA 2V5BA 3O63A 3W1TA 4UQBA 3SUUA 5LA1A 2OXNA 1S1RA 1T0OA 3B05A 2LJ4A 4IQ2A 3H12A 4TVCA 2GGEA 1AZ2A 1GKQA 3BOLA 1E71M 2POZA 5A3HA 4GYFA 2PTXA 1JXKA 1KKOA 4RNFA 1LLOA 1UWAA 2XZ9A 2FFCA 3W9ZA 4G1KA 4HA1A 4EP8C 1A0CA 1KNWA 3I7QA 4KT2A 2ISDA 2DT0A 2MPHA 2VP8A 3O1NA 1QPNA 4OUIA 2VD9A 3B8WA 3A21A 3SN1A 3MHUA 3AIVA 3H55A 3DC8A 4MZ8A 4IPXA 1SZGA 3KZSA 4HPGA 1FH9A 2C1GA 1A47A 4LBRA 3QQ1A 3N3MA 2NQZA 2ZZ5A 4MIMA 3CT7A 2RUSA 4PMOA 3LLXA 3AC0A 4CCCA 5A6SA 3LPFA 4MSSA 1FUYA 1W0MA 3RG6A 4DVOA 4U85A 3PAOA 4GUJA 5DCDA 1OG6A 3VGDA 3ME3A 2NVAA 4GC3A 3EB4A 4RPPA 3WLIA 1Z44A 2EGZA 4EF9A 4ZOBA 3WQ5A 1D6OA 2NXIA 3RMEA 3SECA 4HPNA 5TAOA 3IJLA 1JZ8A 4BFAA 2BY2A 1J5SA 2Q6ZA 1FKDA 3T4CA 4DLMA 3IRSA 2DUZA 4W4QA 2WC4A 4RNJA 2I5GA 4E8DA 2KZHA 4HPJA 3WD3A 3PHAA 3T4WA 4GNKB 4D8ZA 2E6AA 4IPPA 4BF5A 3M0XA 1V3KA 4PEEA 4UWMA 3LCXA 4N2YA 4FNRA 3LNPA 1V7AA 3VGBA 3OOBA 4H01A 1U5HA 8RUCA 3VOCA 3NQ6A 2VEMA 4DRSA 4ZSUA 4Z0JA 4GI9A 3T40A 3M41A 4P8UA 1ESWA 4J3VA 4R33A 4AG0A 3LCIA 1AH4A 1KXQA 4WVXA 3STPA 4H8VA 3B03A 1UD5A 2HQAA 2ZZ2A 1H5YA 5KEZA 3PM6A 4NNRA 1ZZMA 4UXDA 1IHIA 3W29A 1H4PA 3QOMA 1GWJA 4R3UA 1AFSA 3W88A 4RK8A 2D9FA 3E9AA 4LS1A 1RA0A 4M6QA 2DSVA 3GTHA 4HZMA 4I7VA 3STCA 1E9IA 4JX5A 4QGCA 2BOFX 3T8LA 4NKCA 2C1HA 1X1NA 3CH9A 5M5DA 5AYYA 1NY1A 4JEQA 2GDUA 1MNSA 4C7FA 3LV5A 2E68A 4GZ7A 1AQ0A 5B7ZA 1RAKA 2OO0A 1R9XA 2EBNA 3KP0A 3VXGA 4PUWA 2G0WA 2Q5AA 4UFKA 2L2SA 3SCVA 1QUMA 2GQ9A 2WK2A 3WL0A 2AGTA 2NX1A 3AXKA 1OZMA 1WAWA 4L4OA 3EY6A 2WSRA 3NGJA 3TR2A 1A4LA 4I7UA 2QKFA 5FI8A 4GY7A 1GG1A 3UI4A 2PV1A 1R8LA 2QUMA 1HQTA 1CI1A 4XZWA 5EGRA 2WHKA 2VOMA 1FRBA 1W3LA 4QISA 3V1HA 3PR9A 1RD5A 4FO4A 1EO7A 1W1YA 4LY8A 4MFDA 4YWIA 1UCWA 1W1A1 3EOSA 1Z41A 1NF7A 1ZU8A 1QMLA 4W8BA 5HR6A 1P5QA 1H1NA 2ZUNA 3GYCA 1V6XA 3NXLA 2FH6A 5A8PA 1TFVA 1VB9A 2ZX6A 1KRAC 1TPH1 2VDGA 2R82A 3WSUA 3S1WA 3VGGA 3PULA 3ANYA 2ODOA 3UXIA 4O13A 3BAXA 1EPXA 1O7AA 2CETA 4O0KA 2MNTA 3DEQA 1ZBWA 1XSJA 2YW4A 2QZRA 4US5D 5CZJA 3GTIA 1RPXA 1XG4A 1B3YA 4GCAA 3EOUA 5AYIA 3SFKA 4TVUA 1FFQA 4JQ3A 5DMNA 4NJKA 2XVNA 4KWOA 5XINA 3R0KA 3UJRA 1EJ7L 3EWWA 1QPQA 2DVUA 3F5LA 1DVJA 3UG3A 1C91A 3HN3A 5DMMA 3H4WA 5GNYA 1EGMA 1I45A 1OK6A 1M41A 2XH2A 3TNOA 1GCYA 3BTNA 4UZSA 3FX4A 3LSCA 2VUNA 3IWPA 6ALDA 4UMAA 2CZ5A 3O5KA 3GR8A 3AYTA 2PF0A 3TP4A 1YADA 1F76A 3S6OA 2FFIA 2IKHA 1CXEA 4E2BA 4NZCA 1TMQA 4U2YA 4ZB0A 1VPQA 5DBUA 1OGGA 3MKCA 3IGXA 2CWXA 1IXQA 5M2FX 1XI3A 1KV5A 1R5YA 2JGQA 3DECA 1IR1A 1IIHA 2ZRYA 1OINA 3UJEA 4W5ZA 3O5QA 4ZFMA 5BU6A 1W5MA 3BQ6A 4AZ5A 3QMSA 5AZ0A 3ZSTA 5LGXA 2WSYA 2AQVA 3W1MA 4DRKA 3WUFA 1GQLA 4D6GA 4GUHA 3TYCA 2YA2A 4A6GA 1UWUA 4WF7A 3CPRA 3CHDA 2CXEA 3EWXA 3TWBA 3PJXA 3MMWA 4OVXA 4AC1X 3UYCA 2BG5A 2O9RA 3HJZA 1G1YA 4MADA 3KBVA 3WLNA 1R2TA 1V0MA 1MQRA 2OKOA 2R1NA 4PCTA 1E4NA 3MUAA 3RAOA 4BA0A 4OUEA 3THCA 2OYKA 3FNDA 4ZMGA 4J7RA 4W88A 4PFMA 1SJBA 3VCNA 3VD5A 1E43A 3C8FA 5D9MA 1UOKA 1W9DM 5JXQA 1BFNA 4GUIA 2ZQSA 4L6OA 3V0SA 1QASA 3IJIA 4HVXA 3LK6A 1LL4A 2E9LA 5G2WA 5CLWA 1H61A 1DHPA 4O8RA 4NXKA 4M7SA 3H70A 4LAMA 3H2NA 1VGAA 2CHRA 4NXSA 4ZPVR 4KCUA 4LAOA 1DIKA 1BG4A 3NOEA 4WSJA 1E4IA 2ZTJA 3A4XA 4LEQA 3VM5A 1HJVA 3BZGA 1K8YA 1E6QM 4HJFA 2HK1A 2Z0IA 2E4TA 4FLRA 5C8BB 1XC4A 3Q2DA 1WE5A 1FKLA 4F0SA 1CENA 1WDQA 4IMAA 2Y2WA 3RFWA 4ERIA 5HQMA 4MDPA 3TU9A 4EPDC 1Q45A 1V3IA 1S2WA 1XYCA 1RK6A 2IQ0A 5CPMA 1JDEA 2CCRA 3TZNA 1BF2A 2C91A 3U3HA 4IGMA 4QM1A 3SB0A 3EPNA 5DCBA 3T42A 5DT5A 1SW0A 1ZJHA 2XN1A 1Z6KA 4ZO8A 1W31A 2QDHA 3WF1A 4BQ5A 3S42A 2BMBA 3SRHA 3QR3A 3S1VA 4LUSB 3RO8A 4CQ8A 1N7KA 5E6ZA 4RJEA 3NA8A 3LHVA 4HB7A 4I3GA 4A4AA 3LXCA 1J4EA 1FWIC 3RPDA 4GABA 2BVWA 4GJIA 3BLPX 3W1QA 2SFPA 3ATZA 1DIEA 3NURA 5A8MA 4WHBA 1XQKA 5I98A 3HQNA 1J18A 3KOFA 2PP0A 1OSEA 3RR4A 3KZ7A 3LDVA 3IUIA 3CS2A 1VQTA 4JTQA 1BRLB 4Q33A 4ZQRA 4LNYA 4UFJA 2WZMA 4XUGA 1VIWA 5J5RA 1TPFA 3KACA 5CC5A 4MB3A 1Y8BA 3FJNA 1WXYA 5A8NA 3KAHA 3WK3A 2J24A 4V28A 5AC6A 3G24A 1E4MM 3S1UA 1VFTA 3A3HA 1Q63A 4FI4A 4CU8A 1M7XA 4WRHA 4O18A 5KETA 3JW7A 4BQ3A 4E3TA 3KM8A 4C1LA 3OGSA 3KBJA 4IGSA 4XSLA 2AL2A 1WV2A 3FV9A 4UNLA 2VCDA 3M0YA 4LRSA 4AYSA 2GSEA 2VFDA 3N2MA 4XIAA 4QDWA 1JNDA 3PUOA 2CLKA 4RXFA 1M68A 4JY8A 4Z42C 2E6DA 2DV0A 1FP9A 4B16A 1E55A 4EX4A 3E74A 1PIFA 3VTRA 4HZ7A 5JIWA 2HDJA 2VQUA 4IMDA 4CQDA 4DO5A 1HX0A 3GLCA 1JPDX 3DAQA 5AC4A 4FIQA 1E9ZB 1YNPA 5DRIA 4G7EA 2GSHA 3OZOA 4FLOA 5I07A 1PO9A 1UP2A 4C6EA 3GVRA 4I90A 1YATA 4J35A 1JZ3A 4OHQA 1Q6IA 1JUBA 1P6WA 5HMEA 4GGHA 2C14A 3VOFA 5E6YA 3WY1A 2BXYA 3O06A 3LRKA 4C6BA 2FZNA 3NXFA 3A47A 1VEOA 3S5YA 1LBMA 3LBOA 3W1NA 4FF7A 3W2MA 2PMQA 1QT1A 3N6HA 2D2GA 4LF2A 3W07A 3PJTA 2NQ9A 1HO1A 5I3GA 4TYOA 3BAIA 4QTGA 3ARWA 1DJGA 5CZKA 1N55A 4XISA 4E2VA 1ITXA 4Y8FA 5D05A 3KS5A 2XP8A 3KX6A 2RH9A 3FYYA 2DIJA 2PBCA 3MHGA 4MGGA 1W9VA 1E5NA 3OIXA 3ZMRA 2ZOXA 1OWQA 4GVIA 2XUCA 5EPDA 4ZEPA 3QJAA 3TV8A 2B4GA 2YYTA 1ZJAA 4U2ZA 3EMZA 5HT1A 1GPWA 1FHLA 3LERA 4U4MA 3GH5A 3GXFA 1O95A 1LUCB 3OLEA 1OFDA 3WJZA 1HZYA 1VR6A 3ITLA 4XO7A 1UWQA 3ABQA 3ITCA 1D9EA 2CHOA 5BU9A 3AMLA 3DG7A 4L80A 3PBGA 4WGXA 2RFGA 3DG6A 3N12A 3VIKA 4C6JA 2XPAA 4UTFA 2VEFA 3KW3A 5C9WA 1OX4A 3AWOA 4IGNA 3TX9A 2GQ8A 1QR7A 1MUWA 3BURA 3AWNA 1MW1A 5A6BA 4XBSA 2PDLA 2VUYA 2PWEA 4XTDA 2PU1A 1VEMA 3IKDA 3B3DA 2Q3OA 4ORIA 2QHAA 3M5ZA 1WX0A 4YTTA 1MQQA 3SN4A 3T78A 4GX9A 3CZLA 3NYZA 3BLOA 4NYUA 3TK7A 1NMVA 3NVTA 4JL2A 5HWCA 4BKNA 1LWJA 3VZZA 4ZS6A 2NV9A 1YPFA 3AIWA 3KVJA 4UTTA 4YTRA 4QG9A 3LHUA 5K9DA 2Z2AA 3MT1A 1L2QA 5GNZA 1FWJC 2X0SA 2GDQA 3WH9A 1YNQA 5A2CA 5HJLA 3T81A 4PB5A 5CC3A 3BV7A 3JRKA 3QBUA 1NWSA 2Y7GA 1PYMA 3I4KA 1XLKA 3ZR6A 3SJNA 3EXSA 2PLKA 3NQDA 1JPKA 1TB3A 1XBVA 2UY2A 4S2CA 1BL4A 2E6YA 1XGEA 1W1VA 2FJUB 5DIVA 3KZPA 3SCPA 1OBAA 4KETA 3RX2A 4C6KA 2W63A 1BKFA 4D6FA 4D6IA 2VNCA 2WBKA 1KBLA 1J79A 3A3WA 2I5QA 5A6TC 1WOAA 1ZP4A 4RZ6A 1A50A 1AJZA 2YCJA 2PWHA 3UZXA 3CTLA 4DZIA 1EFZA 2ZDSA 1GYNA 3UWEA 2YA1A 2YR1A 3IGSA 1FWRA 5D9OA 2E0PA 2QIIA 1ODUA 1J4IA 5CSYA 2AOSA 1P4CA 1SMAA 4JX6A 3I6RA 4H7ZA 3KAOA 3R25A 3H23A 1QHOA 4M80A 2F61A 1X97A 4PCPA 5C2XA 1Q2RA 2WNQA 3TJIA 2HROA 3PZQA 4OZOA 2WSKA 1GG0A 5C7VA 3EOEA 1XCXA 2PD9A 4A3UA 4YIWA 4TO8A 3XIMA 4AHOA 3BUVA 4GIVA 3UR2A 4JXCA 1UZ4A 4GQBA 3GTYX 2QPUA 1W3IA 1K70A 2QJHA 3CC1A 2CLMA 4S38A 3L23A 4INFA 1X96A 1ZSXA 1E44A 1B57A 1IQ8A 5F4XA 3WJSA 2V8ZA 1A5OC 1A5KC 2BGSA 4G2PA 2QCEA 3VD9A 3CZGA 5BXRA 2V63A 1KM4A 3WF2A 5FEZA 3WLHA 1Q6HA 2ATSA 2BNJA 3ATYA 5KZDA 1Q8AA 2PE4A 2W92A 4RNHA 2QCDA 3GDKA 5DLCA 5HQEA 4UIOA 1QPFA 2YCLA 3VD3A 4X0VA 1FHUA 1UR2A 5FD0A 2J7EA 4PRWA 4H9XA 3PZTA 2M2AA 1YNYA 4ACZB 2PC8A 4WZHA 4JX4A 1K4GA 3PBUA 4D8LA 1GQNA 3V36A 3M43A 3ITOA 4Z2IA 2I16A 2ESCA 2VZVA 3NNTA 1CZ1A 1AK5A 2DT3A 1HUVA 4K7VA 1V6UA 1DJZA 2PZ0A 1EDQA 3PZNA 4Q4MA 3QPYA 4HU4A 3P5YA 2FH8A 1OC5A 5FOOA 3KL3A 3FHQA 3I6EA 2V5DA 3MSDA 1VAHA 4XO6A 3G0XA 3EMCA 3L5LA 1QJWA 1LBLA 1IEWA 4GCXA 4CEXC 4LSBA 2WM1A 2NX9A 1A5BA 2Y63A 4TUFA 4B2DD 3MJYA 2B5UB 3FJLA 1C8XA 4RX0A 4GYPA 4NZ5A 2I9UA 1YTKA 1A4MA 4JPGA 1K8ZA 4PMQA 2CFFA 3C6CA 4ZO6A 4N9CA 2ITKA 1UMLA 1MMFA 5HUPA 3POHA 1ICPA 1QZ2A 4UZUA 1P7TB 2GUUA 1EB3A 2V3FA 2E5CA 5TF0A 1FFRA 2FHBA 1MFUA 5GPGA 2B7QA 3DFOA 2FYMA 3SUSA 1Y0OA 2PP3A 2WVVB 3O9NA 2W6RA 2IXVA 3MMUA 4YVVA 3M0LA 2IKGA 3QLLA 3LQLA 2QDDA 1E6PA 5HBFA 2O55A 1SGJA 2J88A 3LLDA 4FP1A 5E1QA 1VEPA 2AQWA 4GI6A 3VABA 1FKTA 3NO1A 2FGZA 4FXSA 1OCQA 2BDQA 4X22A 4C6QA 4MFEA 3GG0A 1UJQA 3DYMA 4QJ4B 2PRMA 1W9BM 3UXAA 1JI2A 1S2TA 2FGLA 4DX3A 5ABEA 5LGZA 3KTCA 4TW7A 5CJ5A 2ZCGA 1OY0A 3GO2A 2REQB 3AMKA 5HATA 3ZIZA 2IKIA 2P50A 4UTMA 3CM4A 4XZIA 1SW7A 3BGJA 1FXQA 1I8JA 1YMYA 3R8HA 1RH9A 2WJFA 5AHNA 2VZSA 2Y0FA 4YTUA 1G69A 4O16A 3L5AA 3M4HA 3MB9A 3O6YX 1D7FA 3TAKA 3QMTA 1KTNA 4AISA 3NM1A 3A64A 4PYSA 4QLKA 3HA1A 2WZIA 2HK0A 3NQMA 4DYJA 5HW8A 3ZZ1A 4MNKA 1NSGA 4QR6A 4IP5A 4GGBA 1PBGA 3EMQA 1MW0A 2F4EA 3DESA 4F0LA 1VF8A 3FJ6A 2WWDA 4OECA 1Z7AA 1LYXA 3WUGA 1NDWA 1QNOA 1K8CA 2Z2BA 3BG9A 3CU2A 2EPNA 1V03A 3LI1A 1KXVA 4L72B 2VWSA 2VQTA 1ZCOA 4UTUA 3O6CA 1EF3A 1OCBA 4M7TA 4QIBA 3WDPP 1BSLA 3CIVA 4UR8A 2YXXA 3RPMA 4UR7A 1XLEA 1WP6A 3KVLA 1V6VA 5G2IA 4MYXA 1XLLA 4V33A 1TG7A 5DXYA 4BQ2A 3B8IA 4CGTA 4GI4A 4LUJA 1AW2A 4W7VA 1SZNA 4PTVA 5D4YA 4ZE4A 3DHUA 4HK5A 4DJDD 4LY4A 2AL1A 2FIQA 4XG1A 3HPZA 2QQ6A 4EXAA 1NARA 3KABA 3LG3A 4V15A 1XSKA 4B5UA 5IHSA 4DNHA 1JG9A 1F3EA 1V93A 4HPXA 3TLLA 5KZEA 4Y7EA 2HS8A 2BP1A 1R86A 4IFKA 3H21A 3DU0A 3A5FA 2OB3A 3ZR5A 4CNPA 4MY8A 4AZ7A 1VCFA 1UG6A 4OBRA 2CYGA 3GVVA 1UH2A 5F1VA 3CUXA 2KFWA 3H2AA 4DB7A 3LS9A 1AQFA 1JDDA 2DORA 1SM9A 3FA5A 1KLYA 4REQA 1AW1A 1XLAA 4NJIA 4JGDA 4Y2WA 3FOKA 3BVJA 4KFOA 1HGWA 1JULA 4IX0A 3UZJA 3N9RA 1UH3A 1D7KA 1FWHC 3DI1A 1K02A 4EAMA 1F4AA 4KBXA 2R6OA 3GU0A 4HP5A 1GYLA 3B06A 1XRTA 3OW1A 2CBUA 2VDIA 3FSTA 4KH2A 3MP4A 2C0AA 3UYIA 3E02A 3CHVA 4RLIA 5KMYA 2WO5A 2X1RA 5M1TA 5KSWA 1HKIA 2GGGA 4DRQA 3IKGA 4OKDA 5JH2A 3B7XA 1RBLA 2FB3A 5CZ0A 2ACUA 4JL1A 4KRTA 4HNNA 2NV2A 4IX2A 5I06A 1KM3A 3BMVA 3TMLA 1QNVA 3KCOA 3RXZA 1F9CA 5MKGB 4ZPWR 1IE7C 1MRQA 4ROPA 4NILA 2A3AA 2VELA 4H6EA 3HF3A 3MUY1 2GPTA 3OGRA 4U86A 4UFIA 4E38A 3L21A 4JQAA 4V27A 3W25A 3DFNA 4MB5A 4IJCA 4A29A 4PUUA 5CBIA 1GEQA 1OF8A 1N8WA 4M81A 5IOBA 1BKSA 4FNPA 4L4LA 2Z1WA 3WBYA 3PBYA 3LRMA 2Z7GA 1VBRA 3GG7A 2JBMA 3EX3A 2I57A 3N4AA 4EE9A 4PUMA 3LXAA 5I78A 4JYSA 2Z26A 2DSUA 2PWGA 1B2YA 4ZXOA 3ZLGA 3VIHA 4JIEA 2DU2A 4QE4A 1PKMA 4PFHA 1D7IA 2WNWA 3G1DA 2J75A 4AWEA 1T99A 3IARA 5DMYA 1QPOA 1IIGA 4PODA 3WF3A 4MJ4A 5K7JA 1XBZA 3CUIA 3NIYA 3BANA 4PUNA 3KADA 4GISA 4LVGA 2CLOA 4YL2A 1KFWA 1VPXA 2ZZ4A 3QHMA 1JNSA 1JFHA 3Q67A 2E28A 2PV2A 1GYMA 3LENA 2BHYA 3E0FA 3LHYA 4FNTA 1Z9AA 2IXUA 4PTNA 1WB0A 3IAQA 4GK8A 2O92A 2JALA 2UV8G 5ENLA 1S2CA 4I5XA 1J10A 4Z2KA 1UC5A 4S3FA 3DOPA 1XYBA 1TIWA 1QFEA 4KMQA 3GZAA 4FZIA 1MW3A 5CBJA 1UPMB 5I00A 1G67A 2PWUA 4ZR8A 1VENA 2VR2A 3NPXA 4QQ3A 1VHNA 4LEFA 3IJQA 1O1ZA 4IQCA 3TUUA 3E6EA 2A1YA 2D2JA 3MHFA 2G96A 2P3ZA 4J3UA 1PINA 1Q8JA 1ISZA 1YIXA 3OJGA 4U3CA 4QE1A 2X16A 2DT1A 3B8TA 3UP8A 2GK1A 9RUBA 3SCUA 3PA7A 4ODRA 2Y8UA 3R8GA 3SY1A 1EWDA 2AGKA 2ON3A 1B4EA 1WZLA 3IK2A 3VIFA 3BMXA 4KEMA 1ME7A 4B3LA 2ZBTA 1UR8A 4K36A 3LTSA 4QG8A 4IH3A 1ECQA 2DZXA 5I2UA 3RCMA 4MPKA 4F9DA 3ORWA 3UVIA 4OJYA 3ABZA 3I10A 1ZAIA 1W8GA 1GVEA 4D6CA 4IWWA 5LNRA 3O5OA 1ZB5A 1ITUA 4W84A 3QY6A 1F40A 1LRNA 3L0KA 1HKWA 3G18A 3S47A 3L67A 5CSUA 2PBOA 2PBGA 1GW1A 3GUGA 2XTKA 3T08A 4EVZA 2ZA2A 5HANA 2DUAA 3W72A 4GMEA 2VC7A 4JFIA 1UR3M 3TW9A 4CD6A 1KT1A 1CXKA 3PTQA 3PC0A 3P0WA 3M7WA 2NUXA 4AY1A 1RJRA 3YPIA 4R53A 1F8IA 1JDAA 2V2HA 1HL2A 3AIBA 4DF0A 4H41A 3H9RB 1TPB1 3VUPA 3UQNA 1OIMA 3K8MA 4Z1AA 1HO4A 1KRCC 4L9ZA 1Q6OA 1BD0A 4B5TA 3CPUA 1WO2A 3T44A 1TREA 1REQA 3WD0A 4H1ZA 1GTEA 2J8GA 3W74A 1E40A 1J96A 7ENLA 1XYMA 2NWSA 1XGZA 2HVNA 1HKKA 1I2NA 4QFUA 3WQVA 3R7MA 3W2UA 1TV3A 1AH0A 3GVQA 3IIOA 4GLEA 2PODA 1NOWA 2X30A 1RPKA 3MO7A 1N8IA 1MWOA 4QIUA 2YGYA 5AHEA 2VJXA 3WKZA 1R2RA 4UQ9A 3N19B 5DO8A 4W9PA 3BE7A 3FA4A 3UESA 3O0FA 5M03A 3NDOA 2KR7A 1GQIA 1CGTA 2QCNA 3K5XA 1KWGA 4DUWA 3NDYA 3QW4B 4PBGA 4UQDA 1OC6A 3WNOA 5AN7A 1T7LA 3VCCA 1FKGA 3S9IA 1R3SA 1NEYA 1BPLB 1XXXA 2J9ZA 3CHEA 4D1IA 9XIAA 3F4WA 4QHRA 2J6VA 3P8JA 4BEQA 3E0VA 1XM3A 4KCTA 4P8XA 4LANA 4KRZA 3TR9A 1WKDA 3TA6A 1VJSA 2DIEA 4O15A 3EWDA 4JKKA 4M0XA 5FA5A 4Z2LA 4WCJA 2PPOA 3GW3A 1US3A 2VMFA 4ZODA 3BK0A 1V79A 3KWSA 3LCGA 4GIRA 4E4FA 2ZXDA 3CGNA 1ELSA 3VDHA 2C0HA 4LCSA 2WKLA 5LIYX 3C2EA 5IFPA 3W2LA 4Z1BA 4NQ1A 4GHRA 1VFUA 1W1B1 3W86A 1EIXA 2DW7A 3NQGA 4PZVA 1ZY9A 4G6CA 2HE8A 2WAGA 4WDTA 4G9PA 3PUEA 4XQ6A 4HYRA 2CBJA 3ISIX 1UR4A 5F2IA 4UCFA 1US2A 2YZ5A 2QJJA 2VR4A 1LT8A 1ADDA 1JPIA 1E70M 1VFFA 3KBMA 2EPKX 4WD0A 3W27A 3PJUA 1BAGA 3W2NA 1DXFA 5FJTA 2QJGA 1Q6RA 4IQLA 1V3MA 2FZMA 1XYAA 3IVSA 2D20A 1S5NA 4AWUA 3CASA 3KP1A 4IQEA 1VBHA 2KO7A 5BROA 1TVNA 1CIUA 2PGWA 2ZRXA 2C79A 2I5IA 2VCAA 3C2YA 3NL3A 2J77A 2YW3A 1RP8A 1MW2A 1F6YA 2DH2A 3N2XA 4HSOA 3C2RA 5AECA 3LX9A 4W89A 3CWOX 4IF2A 4MG4A 3L5MA 3W87A 1GORA 4HNTA 1ML1A 5BXJA 3R8RA 2QMJA 1G4SA 4Q8NA 1UPPA 2VI0A 4X3ZA 4LT9A 4LUIA 1EIBA 1SPQA 3TN3A 2EJAA 4YCPA 3RU8X 2E3ZA 1GJUA 4B9ZA 4B92A 4WDUA 1JZ4A 1Q6CA 2WHLA 1PBKA 4PMZA 2PV3A 3PN8A 2XYLA 2A5HA 4DELA 4IG2B 1OD8A 8XIMA 4FXJA 4H6KA 2D3LA 3HBLA 3UF8A 3AIRA 4NT0A 5DMLA 1MYRA 4UQCA 4XBJA 5ABTA 3H2CA 1EA0A 3UT0A 3O07A 2LPVA 2FGBA 1PCWA 3EIPA 4ML4A 3CL7A 4L64A 3WF0A 3R12A 4WOZA 2DIKA 4FEZA 3DBNA 1E0XA 1KM6A 2HCVA 3I3DA 3QRHA 5DF0A 4P8WA 1ZBVA 3C2FA 3B9AA 1H49A 3CYVA 1QVBA 5RUBA 1KW1A 5I7GA 2JKPA 1LZOA 3JS3A 4JFUA 4BI6A 5E0FA 2A7PA 3CUHA 3N13A 1QNSA 4LVAA 5F1UA 1POKA 3ELFA 3CLWA 3WBAA 1AJ2A 3E3HA 3I6TA 2C8NA 3THQA 4C6NA 2FKEA 1QHPA 2C7FA 1K9FA 3PNZA 3UJ2A 4YU1A 3AYSA 1S5WA 5BXPA 5JIPA 2NUYA 3P67A 4S3KA 3ZLHA 3NO5A 3QSTA 4BF9A 3F5JA 4GQQA 2NT0A 3W4RA 1SQ7A 3W37A 4LCQA 1QPLA 4MZYA 1GTHA 5BXTA 2QV4A 4Z1CA 1GKRA 3NVDA 2J78A 1DYSA 4LAYA 4MVAA 4YN5A 3GH7A 4HN8A 2VL4A 2ZE0A 3B04A 1OB0A 5BOEA 2PDUA 2HRWA 1SFTA 5C70A 1XLMA 5LNUA 3V7PA 1H7WA 2WMIB 3M0MA 3VD7A 2HMCA 3JZEA 3ENLA 1E15A 1K9DA 4IUOA 3VU2A 3WNPA 4HT3A 4HU8A 4GQ0A 4BHYA 2QR6A 3VI2A 4N4PA 3NOYA 4HHPA 3IS4A 3FHAA 3URAA 2GJLA 4XWUA 4DPPA 4R7JA 4LYRA 4ZO9A 1ZNNA 1Q2SA 1W26A 2Z27A 1GONA 1S5MA 1DE6A 1M03A 4IFOA 3T0CA 1K8XA 2A3EA 1LOLA 1V3LA 3C0SA 4CKQA 5GPRA 2JEPA 3PNUA 1IEVA 5C9ZA 2I14A 2P8CA 3WLLA 4ZXLA 4ZBCA 2CITA 1NFBA 2NVDA 5B8IC 2EXOA 3IPWA 1K7FA 5C2GA 2V6AA 3OYXA 4GJJA 4WSHA 1LG1A 3BW4A 3GR7A 5F4SA 4ODKA 5H91A 4W86A 3NQBA 5T9BG 4NX5A 2E7FA 5EMLA 1EQ3A 1FH8A 4QDMA 1B3OA 5CAKA 4D6DA 3HIJA 4FX8A 3RGTA 1DXIA 3BJTA 2WVUA 3CMJA 3WD2A 1H2JA 3R0DA 3ZVHA 3AIUA 5D38A 3TYDA 3EBVA 3AHVA 4XIMA 4XAFA 1TVLA 3SIMA 4M6UA 1SVDA 1QW8A 1KCZA 2XFYA 4MNMA 3G0UA 3VCRA 4HNCA 4I6KA 4O10A 2FZBA 2CESA 4B5NA 1CXIA 2J8TA 5ABFA 4HA3A 2RHGA 1E56A 1J6YA 2NW0A 3ARRA 1KRBC 2PU0A 1ME8A 4ODLA 3O3RA 2WHJA 3RIKA 1FWTA 3QZ6A 4KWSA 2O9PA 4JTGA 4F4RA 1SYTA 3S4TA 3C0LA 3TXZA 3NR0A 4CD8A 2RURA 3GFXA 1P1XA 2X40A 3ONBA 4LXFA 1XLHA 4BQ4A 1YDYA 1MUMA 5BRQA 5EFDA 3CZ8A 4ILSA 4Z2JA 4R85A 3HJEA 3IJ8A 1CXLA 1RR2A 5JVLA 2OU4A 2XIQA 3SRDA 5I3JA 3NQ8A 2KI3A 5M17A 1S39A 3H7UA 4JD4A 4IHCA 5C55A 1W8SA 2XZ7A 3GNRA 4Y9AA 1UWTA 2HEJA 4JFVA 3VYLA 1SO5A 4AYGA 4WKAA 3ZS4A 2W9MA 3J7HA 4OV4A 4FXRA 3T09A 4GE8A 1ZBKA 1EWEA 3H7VA 1EYWA 2QUVA 2G3IA 3FAXA 4RZ5A 4D2JA 3CWNA 5D2YA 1OABA 2PDGA 3UPMA 3O5IA 3ARXA 3RUBL 3VMPA 4M5PA 2Y6ZA 3BAKA 3DKLA 4IP4A 5EU9A 3MTWA 3USZA 5G1TA 2YCIX 3C61A 4FS9A 4DF2A 1DJIA 3TDBA 3ARTA 1NP2A 4DRNA 3R79A 1U1HA 3ES7A 4FOUA 3G0SA 1EKOA 2Z1XA 1W5OA 1XUUA 1DWFM 1LT7A 2NV1A 3AHZA 4UFMA 4LUSA 2PPPA 1DEDA 4P61A 3N17A 4DRHA 1FWDC 3KVMA 4GD0A 4M24A 4EXBA 3LYEA 3O15A 1L6FA 1B1YA 2X1IA 3NFUA 2W66A 4JQ1A 1QI2A 1VH7A 4HHMA 1KCLA 1QW9A 4I9JA 3VNZA 1BLIA 3CB8A 4Z2GA 3CJPA 3HGSA 4NASA 1QOPA 1WCGA 2G97A 3DI0A 4BCEA 3SUVA 1BYAA 2PD5A 3UG4A 4DIAA 6XIAA 5HNUA 3UWQA 1JZ7A 5FJRA 1YX1A 3KDOA 2OR2A 2V68A 2OEKA 5EMYA 5HUOA 3SSJA 1BXCA 1GZGA 4IICA 3WK0A 1XH2A 2BFGA 2XISA 2BHUA 4AY7A 3BPWA 1Q85A 2O9TA 2PDBA 5A8GA 2E67A 4JAWA 3OLGA 2WMFA 1QATA 1NWUA 3CNYA 2OSWA 2NLIA 2RDTA 4D6JA 1Y7VA 3EB2A 5AHIA 4DT4A 3WD4A 3FA3A 1LROA 3SZ8A 3PWAA 2JIWA 2FVKA 4HTBA 1YW5A 3DGRA 2Q8XA 3P80A 3CUFA 4GUGA 4RCXA 5E9XA 3QV8A 5G4WA 2ZX5A 2OELA 4ZENA 1IGWA 2XWEA 1O6IA 2XJ7A 2B7NA 4EWJA 3Q4DA 4V1XA 1R38A 3RR1A 3BLKA 3LBMA 4U33A 3TE9A 4IL2A 3ODKA 3AMGA 1ZBCA 1QWKA 1UH4A 1FTXA 4Q8MA 1Z89A 4NL1A 5J5DA 3T0BA 4IT1A 2BZNA 3T0TA 2XP3A 4A35A 1WDSA 3BXWA 1MZHA 1W3TA 1W17A 2EG6A 2OQLA 1I0BA 1FA2A 4JIIX 1M1BA 2IMRA 2V3DA 4JYFA 3TJ4A 4J28A 3GDRA 4AY8A 1KBBA 1T11A 1XJBA 4A05A 2DZAA 4RDYA 2GOUA 1G9HA 3QGAC 1JDCA 1AL7A 4JYEA 3CZJA 3DHDA 2E1WA 3GNXA 4K8HA 4KCVA 3CV6A 2MLZA 2OFNA 1OFBA 1B54A 2W61A 3WENA 1YBQA 1XDJA 4RE4A 1R7AA 1TYGA 3WLKX 4QX4A 3NUKA 1DL3A 3EWYA 3UWVA 1A53A 2FMOA 1KCKA 3ARQA 4Q6XA 1PX4A 3IJ6A 1F3XA 3TOPA 2VVNA 3B8DA 4YS1A 4K37A 5F2GA 5CG0A 3W7IA 4H9MA 3C3NA 1PZ1A 1DXEA 1TA3A 1YXCA 4WGHA 4AD4A 1JCYA 3KBWA 3CGTA 2XH7A 2JFEX 7REQB 4XVDA 2WM0A 3VE7A 4DJFD 4NF7A 2ZUSA 2A3HA 1QNPA 3AU6A 2B7OA 2WZTA 3MBFA 2VZOA 1B3XA 4Y9PA 4WJXA 4HN4A 4RE3A 1J12A 3PZGA 5LIUX 3LMYA 2CNCA 3M9YA 4E8GA 5FKYA 4GO9A 4LBUA 3EPMA 1HVXA 4BEUA 1JZ2A 4RKAA 3VC6A 3VKDA 3M6DA 2MLYA 3T05A 3VILA 3UZ5A 4AEOA 4AZCA 4IFRA 3KEHA 1K7XA 4YHEA 3SCSA 4YVXA 1GKPA 4F48A 2XP4A 3OP2A 1FKBA 2OT0A 1ZALA 2OEJA 3UZZA 3VNIA 4IMGA 5A5WA 5I6SA 5TNVA 5LHFA 2PTZA 2VM8A 3QFWA 5GJNA 2TRSA 3BWWA 1TWSA 1W37A 2VGGA 4KERA 2ATMA 3TYBA 4D1JA 5HXMA 1KFJA 3TDFA 1HL8A 3BW3A 3LPPA 4GY0A 4H19A 4PMUA 2Y70A 1TJRA 3STGA 1NFPA 1GHSA 1R3YA 1J0HA 4GO8A 1LL6A 1UZHA 3D5HA 2XPBA 1TELA 3OODA 1C90A 3W7JA 5HULA 3S2JA 1W3HA 3TTOA 5FL0A 3C0QA 3CAWA 1I1XA 5CGQA 4L6DA 3WQEA 4DUVA 4PUKA 1HXJA 3QYQA 1VPYA 2ZX7A 4RW5A 1UR9A 2FPVA 1ZCNA 1UBPC 3KCJA 3B0PA 3WEOA 2W67A 2FTPA 4BJHA 1KFBA 1XLGA 5FEXA 2ZUUA 2BX7A 1J5TA 3WBWA 4FN2A 3VAWA 2F84A 5CZSA 3BLDA 5DCEA 1KR1A 4BI5A 1EJTC 4GJ1A 1KB3A 1EEPA 4UQEA 1RCQA 3VO0A 3T0DA 1A0DA 1W32A 4QNWA 5IRPA 2JEQA 3M0HA 4J3XA 4OTKA 4KR0B 4HCHA 3MKVA 4IP7A 5C71A 1NP0A 4A22A 5D37A 3N04A 1DHKA 3FFSA 4BS0A 1LQ0A 1PHQA 3BL3A 4FK9A 5CPNA 2DZPA 1KR0A 3DFSA 4UNKA 3EGJA 2OSXA 3CGMA 4FOJA 1IV8A 5KINA 2ZA3A 2G50A 2QAFA 3WH6A 2Z1SA 4DY1A 3RK8A 4A8NA 4C6CA 2F2HA 4MMWA 3EOLA 4MTVA 2QLYA 1DJWA 3H22A 4PCSA 3AS3A 3TC5A 4KEVA 1UIPA 3WLRA 4ZTXA 1S5TA 2XDFA 4JFKA 2WZEA 1MI3A 5J04A 1XCFA 1M5YA 6TIMA 3L4XA 1D3HA 4WKFA 3O5JA 3F1QA 3KRBA 1BWVA 2DVXA 1LOQA 4DWSC 1OCJA 2O7SA 3L4ZA 5D02A 3BZJA 5CAHA 1LWHA 3GR4A 3RN6A 1NWRA 4I8YA 5FJPA 3W00A 6XIMA 1GVRA 1M04A 3MUZ1 3O8AA 4EAYA 3CMFA 3O7UA 2ICSA 3LMZA 1V6YA 2Y8KA 1FWCC 3QGVA 2NLYA 2RSEA 2ZXQA 2EPHA 1TX2A 3GC2A 4CCEA 2WNNA 1Q6UA 4GOAA 1K1DA 1S2VA 4W93A 3VAVA 3ALGA 1CB7B 4X9SA 4NAEB 1JQXA 4ZQPA 2A6NA 2GVEA 3IHZA 1TTQA 4JHZA 1KGWA 3MWCA 3SIZA 1YXYA 4P7OA 1V3HA 1DJYA 1DP0A 2INEA 2BS9A 4O14A 4UOZA 1F7BA 4I5UA 5HK4A 4LJ3A 3U9IA 3H2FA 4E8CA 5AHLA 3FVMA 3AS1A 2YBUA 1Q4WA 2YDAA 1TTPA 2A85A 4AC7C 2YLAA 1I0DA 3AU2A 2ANUA 3BCFA 4ZSTA 1GVYA 1J8VA 1SFLA 2GLKA 4LS2A 3LCWA 2WC3A 1AMKA 1VLIA 2QGYA 3G3MA 1O68A 1EBHA 3P7YA 5GVJA 2FDMA 1XUZA 3BOXA 3VGHA 2CLHA 4D6EA 1V3JA 2E8YA 3MCNA 1E0WA 2J7DA 1EQCA 2Q8ZA 1W54A 3TN5A 1TTJA 4TIMA 3V16A 4A8IA 4AQLA 3STFA 1JUEA 1X7FA 3EXTA 5D8WA 4UMCA 2E6FA 4C6DA 4LV4A 4H7VA 1Z48A 2D3NA 3L4TA 4B5XA 3V1PA 4C5ZA 4MZ1A 4W7WA 3H4GA 1UD4A 5D9PA 3DH7A 1AQMA 2VZTA 1CCWB 1CNVA 4AX7A 4ZE5A 4Q8TA 3O5GA 1J93A 4AXKA 5J8LA 3W7QA 4ES4A 1VFSA 1ZUAX 4FAMA 3W6YA 3A9IA 2VO5A 2AKMA 3ARYA 2DZTA 4IPJA 4ZTYA 4ATWA 1TJ2A 3UD6A 4M3PA 4J4OA 1M7OA 4JR5A 2PAJA 4GYJA 2QCMA 3TTYA 2WB5A 4O4WA 1HW6A 4EWND 4ZVJA 1OFOA 4L5ZA 2OJPA 2X1UA 3MP3A 3MZNA