4N19A

Structural basis of conformational transitions in the active site and 80 s loop in the fk506 binding protein fkbp12
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTVVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPPIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1A
publication title Structural basis of conformational transitions in the active site and 80's loop in the FK506-binding protein FKBP12.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4n19A00
2MLYA 5HWCA 4O2TA 1N1AA 1FD9A 1JNSA 2XPBA 2ZQVA 4JFIA 3VAWA 4DZ2A 2RURA 1W26A 3KZ7A 4GGQA 4TW8A 1FKFA 1J4RA 2KE0A 3I6CA 2LKNA 1C9HA 1FKLA 4J4NA 3PRBA 4DZ3A 4GIVA 3UQIA 2VCDA 4DT4A 5D75A 5HW8A 2PBCA 4DRHA 4ODKA 3RGCA 1EYMA 4TYOA 3O5IA 4ITZA 5DITA 5GPGA 3TC5A 3O5GA 4G50A 2KI3A 2XP3A 4NNRA 2XP7A 1J4HA 2ZR4A 1QZ2A 2MLXA 4C02B 1JNTA 3KAHA 2PV3A 3NRKA 4ODQA 3CGNA 4DRQA 2PV2A 1T11A 1TCOC 4TNSA 1PINA 2DG3A 2M08A 4QT2A 1A7XA 4MSPA 1FKTA 1ROTA 4JFMA 2AWGA 1EQ3A 1Q6IA 3UI4A 5HTGA 3JYJA 3JYMA 1FKRA 1M5YA 2LGOA 1FKSA 2XPAA 2KFWA 4ODOA 1D7IA 5DIVA 3UQAA 3FAPA 2UZ5A 3KABA 1QPFA 3WH0A 3O5RA 4DRKA 4TW7A 2F2DA 3UI5A 2MLZA 3LUOA 4QIBA 3KAGA 4TX0A 2M2AA 4LAWA 1YW5A 3KCEA 3O5OA 4LAVA 4N19A 3IKDA 1NMWA 2DG4A 1FKHA 2KR7A 2RUQA 1Q6HA 3JXVA 1D6OA 1BL4A 4JFKA 3O5LA 1FKKA 1R9HA 2Q5AA 4ODMA 3PRDA 4FN2A 4TW6A 5DIUA 4U86A 2F4EA 3UF8A 5HKGA 2MPHA 1J4IA 2RUDA 2RUCA 4MGVA 4DRIA 5BXJA 1ROUA 1HXVA 3NTPA 3O5PA 3O5MA 4DH0A 2MF9A 1Q1CA 2Y78A 1FKGA 1QPLA 2KGJA 1L1PA 1FKDA 2DG9A 1P5QA 3IKGA 4DRJA 3UQBA 2OFNA 3KADA 5HWBA 1KT1A 2L2SA 4JFJA 1ZCNA 4U84A 3RFWA 3ODKA 5HW6A 2XP6A 2VN1A 2ZR5A 4ODRA 1J6YA 4W9QA 1KT0A 3KAFA 2PPOA 1F8AB 1ZK6A 2ZR6A 3OOBA 4QT3A 1D7HA 4DRNA 2PPPA 3O5QA 4ODPA 4U85A 3TDBA 2XP5A 4ODLA 3GPKA 4IPXA 5I98A 3O5DA 1U79A 4J4OA 5J6EA 2PPNA 2FKEA 3O5JA 2RSEA 1BKFA 2FAPA 1FKIA 1FKJA 4LAXA 4W9PA 2K8IA 3MDYB 1FKBA 2PV1A 2MNTA 4JFLA 1Y0OA 2ZQTA 5HT1A 2F21A 2KO7A 2IF4A 1B6CA 1Q6UA 2LJ4A 3IHZA 1JVWA 4R0XA 3PA7A 4DRMA 1NSGA 2ZQUA 3TCZA 2D9FA 2ITKA 2N87A 2XP8A 1PBKA 3H9RB 4JYSA 5HW7A 3O5EA 4FAPA 4DROA 2XP4A 3O5FA 4LAYA 3IK8A 2XP9A 2JZVA 2ZQSA 3O5KA 3KAIA 3KACA 2M1IA 4BF8A 3NI6A 2LPVA 5B8IC 4G2PA 4ODNA 4IQ2A 4IQCA 1YATA 1FJDA 1NMVA 3EY6A 5HUAA 3UI6A 4W9OA 1F40A 4DRPA 3B7XA 3CGMA 1D7JA 1FAPA 4DIPA 2RQSA
chains in the Genus database with same CATH superfamily
1JNSA 1W9PA 5HWCA 1E6PA 1HKJA 3WD4A 3VAWA 2RURA 3KZ7A 2DPEA 1FKFA 4MPKA 4PTMA 1C9HA 1FKLA 3PRBA 3ARQA 4DT4A 5D75A 4ODKA 3WQWA 1EYMA 1GUVA 3AQUA 3ARUA 5DF0A 5GPGA 3ARYA 3O5GA 2KI3A 2XP7A 1J4HA 1JNTA 3KAHA 3NRKA 3CGNA 1T11A 1TCOC 2A3AA 4MSPA 1FKTA 1JNEA 2LGOA 1LG2A 2UZ5A 1NWUA 3O5RA 4DRKA 4TW7A 3WD3A 3KAGA 3CHCA 1WNOA 3CH9A 3B8SA 3IKDA 2KR7A 3KAFA 2YBTA 1Q6HA 3BMBA 1NWSA 1X6NA 3B9DA 4FN2A 4U86A 2F4EA 4DWSA 1XRVA 3ARPA 2G8ZA 3NTPA 4DH0A 2DT0A 1HKMA 1FKDA 3ALFA 4MAVA 4DRJA 4Z2IA 3BXWA 4Z2KA 1KT1A 3QOKA 2EULA 1LL4A 4WJXA 4P8WA 4DWSB 1KT0A 2PPOA 2WK2A 1ZK6A 1SR0A 1O6IA 3G6LA 4MNJA 1D7HA 4NZCA 1W9UA 2PPPA 4DRNA 4U85A 3CZ8A 1LL6A 5I98A 1U79A 3B9AA 4W9PA 3MDYB 2ZQTA 1W1TA 1B6CA 3EIPA 3B9EA 3TCZA 5HW7A 2XP8A 3O5EA 4DROA 2QF8A 3IK8A 2G41A 3O5KA 4ZPWR 3KAIA 3KACA 2WM0A 2LPVA 2A3BA 4G2PA 3AS2A 2AOSA 4IQCA 3WL1A 3UI6A 3WQVA 3B7XA 2ZQVA 4JFIA 4MNLA 4Z2GA 1W26A 4J4NA 3RM8A 1TFVA 4L3NA 3ARWA 4DRHA 1D2KA 3O5IA 4ITZA 1OGBA 3CHDA 3FY1A 4WKFA 3ALGA 3AS3A 4URIA 3GTYX 1UR9A 1JCHB 2A3CA 3ARZA 4W5UA 4DRQA 2PV2A 2DG3A 1A7XA 4KR0B 2O9OA 3UI4A 3JYMA 3WD0A 4ODOA 1D7IA 3UQAA 5DO2A 3KABA 4KQZA 3WH0A 2MLZA 3LUOA 2M2AA 1YW5A 2PI6A 3O5OA 2DSZA 4ODMA 1BL4A 1LJYA 2Q5AA 4MGVA 5BXJA 4DRIA 1ROUA 1HXVA 3AROA 3O5MA 4QZVB 1FKGA 1QPLA 4ZPVR 1P5QA 4S3JA 1FFQA 3UQBA 1KFWA 2ETNA 4JFJA 3RFWA 3ODKA 2XP6A 2ZR5A 4AY1A 1XHGA 2DSWA 1F8AB 4ODPA 1H0GA 3TDBA 2XP5A 1ZU8A 3O5DA 4J4OA 2PPNA 2FKEA 1BKFA 2FAPA 5HT1A 2F21A 2KO7A 2IF4A 1GRJA 4JYSA 1PBKA 4FAPA 2XP4A 4LAYA 1ZBVA 2JZVA 2ZQSA 4P8VA 2YBUA 3ARRA 3FXYA 4S3KA 4IQ2A 2DSUA 1LQ0A 4W9OA 4DRPA 4Q22A 1FAPA 2RQSA 2MLYA 1E6RA 1WB0A 4O2TA 1FD9A 4HARA 1E9LA 4TW8A 1J4RA 5GQBA 5JH8A 2LKNA 1HKIA 4UDMA 3UQIA 2VCDA 1GOIA 1JNDA 1VF8A 3RGCA 1ZBKA 4TYOA 2DT3A 5DITA 1LL7A 1EIBA 1E6ZA 4G50A 2ZR4A 1E44A 3GU0A 4NSBA 2PV3A 4WK9A 1RD6A 4TNSA 4P8XA 3WD1A 1PINA 1UR8A 1Q6IA 1W1YA 1M5YA 4MNKA 1FKSA 2KFWA 4MTVA 4DWSD 2F2DA 4TX0A 1EHNA 4LAWA 3KCEA 2A3EA 1E15A 4LAVA 4Z2HA 3JXVA 1D6OA 1R9HA 3PRDA 5HKGA 4WKHA 2RUDA 1EDQA 1E6NA 2MF9A 2Y78A 1W9VA 3AS0A 2KGJA 2IUZA 3PRAA 2DG9A 1HJXA 3PR9A 1NH6A 5HW6A 2VN1A 4ODRA 1W1VA 2P4VA 4QT3A 4Z2JA 1ZB5A 5J6EA 3O5JA 4LAXA 2DT1A 3W4RA 2K8IA 2OLHA 3WL0A 3IHZA 2B31A 1Q6UA 4XAKA 3PA7A 3RM4A 1NSGA 2ZQUA 5HUAA 2D9FA 2ITKA 2N87A 4IT4A 3H9RB 3O5FA 2DSVA 2M1IA 3ARVA 4BF8A 1WAWA 4ODNA 1HJWA 1FJDA 1NMVA 3EY6A 3WD2A 1F40A 3CGMA 4U84A 1N1AA 3CHFA 2XPBA 1IX5A 4DZ2A 4GGQA 1CTNA 4DZ3A 2KE0A 3I6CA 4GIVA 4HBEA 2ESCA 5HW8A 3OA5A 2PBCA 4LGXA 3WIJA 1NWRA 2DT2A 4R5EA 4P8UA 3TC5A 2XP3A 4NNRA 3ARSA 1QZ2A 2MLXA 4C02B 4ODQA 1ZL1A 2M08A 4QT2A 1ROTA 4JFMA 2AWGA 1EQ3A 1OWQA 1SYTA 2WLZA 5HTGA 4HBOA 3JYJA 1FKRA 2XPAA 4L72B 5DIVA 3FAPA 1QPFA 1OGGA 3UI5A 4DWSC 4QIBA 4ML4A 3AS1A 4WIWA 4WKAA 3RM9A 4N19A 1NMWA 2DG4A 1FKHA 2RUQA 3CHEA 5GPRA 4JFKA 5DIUA 2FDMA 3O5LA 1FKKA 3UF8A 4TW6A 4Z2LA 1X6LA 2MPHA 1J4IA 2RUCA 1FFRA 3G6MA 3O5PA 1Q1CA 4ZPTR 5DEZA 1L1PA 4ZS6A 1LG1A 1ITXA 3IKGA 2OFNA 3KADA 5HWBA 2L2SA 1ZCNA 3ARTA 4IT6A 1HKKA 1ZBCA 1J6YA 4W9QA 1K9TA 5HBFA 2B5UB 2ZR6A 3OOBA 4MNMA 3O5QA 4ODLA 1H0IA 3GPKA 4IPXA 2RSEA 1FKIA 1FKJA 4Q7NA 1FKBA 2PV1A 2MNTA 4JFLA 1Y0OA 1W1PA 2O92A 2LJ4A 3ARXA 4DRMA 4R0XA 1JVWA 2F23A 1ZBWA 1NWTA 1GPFA 3WKZA 2WLYA 2XP9A 3NI6A 1HJVA 3RMEA 5B8IC 1YATA 2PN0A 1D7JA 4DIPA
chains in the Genus database with same CATH topology
1JNSA 1W9PA 5HWCA 1E6PA 1HKJA 3WD4A 3VAWA 2RURA 3KZ7A 2DPEA 1FKFA 4MPKA 4PTMA 1C9HA 1FKLA 3PRBA 3ARQA 4DT4A 5D75A 4ODKA 3WQWA 1EYMA 1GUVA 3AQUA 3ARUA 5DF0A 5GPGA 3ARYA 3O5GA 2KI3A 2XP7A 1J4HA 1JNTA 3KAHA 3NRKA 3CGNA 1T11A 1TCOC 2A3AA 4MSPA 1FKTA 1JNEA 2LGOA 1LG2A 2UZ5A 1NWUA 3O5RA 4DRKA 4TW7A 3WD3A 3KAGA 3CHCA 1WNOA 3CH9A 3B8SA 3IKDA 2KR7A 3KAFA 2YBTA 1Q6HA 1NWSA 1X6NA 3B9DA 4FN2A 4U86A 2F4EA 4DWSA 1XRVA 3ARPA 2G8ZA 3NTPA 4DH0A 2DT0A 1HKMA 1FKDA 3ALFA 4MAVA 4DRJA 4Z2IA 3BXWA 4Z2KA 1KT1A 3QOKA 1LL4A 4WJXA 4P8WA 4DWSB 1KT0A 2PPOA 2WK2A 1ZK6A 1SR0A 1O6IA 3G6LA 4MNJA 1D7HA 4NZCA 1W9UA 2PPPA 4DRNA 4U85A 3CZ8A 1LL6A 5I98A 1U79A 3B9AA 4W9PA 3MDYB 2ZQTA 1W1TA 1B6CA 3B9EA 3TCZA 5HW7A 2XP8A 3O5EA 4DROA 2QF8A 3IK8A 2G41A 3O5KA 4ZPWR 3KAIA 3KACA 2WM0A 2LPVA 2A3BA 4G2PA 3AS2A 2AOSA 4IQCA 3WL1A 3UI6A 3WQVA 3B7XA 2ZQVA 4JFIA 4MNLA 4Z2GA 1W26A 4J4NA 3RM8A 1TFVA 4L3NA 3ARWA 4DRHA 1D2KA 3O5IA 4ITZA 1OGBA 3CHDA 3FY1A 4WKFA 3ALGA 3AS3A 4URIA 1UR9A 2A3CA 3ARZA 4W5UA 4DRQA 2PV2A 2DG3A 1A7XA 4KR0B 2O9OA 3UI4A 3JYMA 3WD0A 4ODOA 1D7IA 3UQAA 5DO2A 3KABA 4KQZA 3WH0A 2MLZA 3LUOA 2M2AA 1YW5A 2PI6A 3O5OA 2DSZA 4ODMA 1BL4A 1LJYA 2Q5AA 4MGVA 5BXJA 4DRIA 1ROUA 1HXVA 3AROA 3O5MA 4QZVB 1FKGA 1QPLA 4ZPVR 1P5QA 4S3JA 1FFQA 3UQBA 1KFWA 4JFJA 3RFWA 3ODKA 2XP6A 2ZR5A 4AY1A 1XHGA 2DSWA 1F8AB 4ODPA 1H0GA 3TDBA 2XP5A 1ZU8A 3O5DA 4J4OA 2PPNA 2FKEA 1BKFA 2FAPA 5HT1A 2F21A 2KO7A 2IF4A 4JYSA 1PBKA 4FAPA 2XP4A 4LAYA 1ZBVA 2JZVA 2ZQSA 4P8VA 2YBUA 3ARRA 3FXYA 4S3KA 4IQ2A 2DSUA 1LQ0A 4W9OA 4DRPA 4Q22A 1FAPA 2RQSA 2MLYA 1E6RA 1WB0A 4O2TA 1FD9A 4HARA 1E9LA 4TW8A 1J4RA 5GQBA 5JH8A 2LKNA 1HKIA 3UQIA 2VCDA 1GOIA 1JNDA 1VF8A 3RGCA 1ZBKA 4TYOA 2DT3A 5DITA 1LL7A 1EIBA 1E6ZA 4G50A 2ZR4A 4NSBA 2PV3A 4WK9A 1RD6A 4TNSA 4P8XA 3WD1A 1PINA 1UR8A 1Q6IA 1W1YA 1M5YA 4MNKA 1FKSA 2KFWA 4MTVA 4DWSD 2F2DA 4TX0A 1EHNA 4LAWA 3KCEA 2A3EA 1E15A 4LAVA 4Z2HA 3JXVA 1D6OA 1R9HA 3PRDA 5HKGA 4WKHA 2RUDA 1EDQA 1E6NA 2MF9A 2Y78A 1W9VA 3AS0A 2KGJA 2IUZA 3PRAA 2DG9A 1HJXA 3PR9A 1NH6A 5HW6A 2VN1A 4ODRA 1W1VA 4QT3A 4Z2JA 1ZB5A 5J6EA 3O5JA 4LAXA 2DT1A 3W4RA 2K8IA 2OLHA 3WL0A 3IHZA 2B31A 1Q6UA 4XAKA 3PA7A 3RM4A 1NSGA 2ZQUA 5HUAA 2D9FA 2ITKA 2N87A 4IT4A 3H9RB 3O5FA 2DSVA 2M1IA 3ARVA 4BF8A 1WAWA 4ODNA 1HJWA 1FJDA 1NMVA 3EY6A 3WD2A 1F40A 3CGMA 4U84A 1N1AA 3CHFA 2XPBA 1IX5A 4DZ2A 4GGQA 1CTNA 4DZ3A 2KE0A 3I6CA 4GIVA 4HBEA 2ESCA 5HW8A 3OA5A 2PBCA 4LGXA 3WIJA 1NWRA 2DT2A 4R5EA 4P8UA 3TC5A 2XP3A 4NNRA 3ARSA 1QZ2A 2MLXA 4C02B 4ODQA 1ZL1A 2M08A 4QT2A 1ROTA 4JFMA 2AWGA 1EQ3A 1OWQA 1SYTA 2WLZA 5HTGA 4HBOA 3JYJA 1FKRA 2XPAA 4L72B 5DIVA 3FAPA 1QPFA 1OGGA 3UI5A 4DWSC 4QIBA 4ML4A 3AS1A 4WIWA 4WKAA 3RM9A 4N19A 1NMWA 2DG4A 1FKHA 2RUQA 3CHEA 5GPRA 4JFKA 5DIUA 2FDMA 3O5LA 1FKKA 3UF8A 4TW6A 4Z2LA 1X6LA 2MPHA 1J4IA 2RUCA 1FFRA 3G6MA 3O5PA 1Q1CA 4ZPTR 5DEZA 1L1PA 4ZS6A 1LG1A 1ITXA 3IKGA 2OFNA 3KADA 5HWBA 2L2SA 1ZCNA 3ARTA 4IT6A 1HKKA 1ZBCA 1J6YA 4W9QA 1K9TA 5HBFA 2ZR6A 3OOBA 4MNMA 3O5QA 4ODLA 1H0IA 3GPKA 4IPXA 2RSEA 1FKIA 1FKJA 4Q7NA 1FKBA 2PV1A 2MNTA 4JFLA 1Y0OA 1W1PA 2O92A 2LJ4A 3ARXA 4DRMA 4R0XA 1JVWA 1ZBWA 1NWTA 1GPFA 3WKZA 2WLYA 2XP9A 3NI6A 1HJVA 3RMEA 5B8IC 1YATA 1D7JA 4DIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MLY A;  5HWC A;  4O2T A;  1N1A A;  1FD9 A;  1JNS A;  2XPB A;  2ZQV A;  4JFI A;  3VAW A;  4DZ2 A;  2RUR A;  1W26 A;  3KZ7 A;  4GGQ A;  4TW8 A;  1FKF A;  1J4R A;  2KE0 A;  3I6C A;  2LKN A;  1C9H A;  1FKL A;  4J4N A;  3PRB A;  4DZ3 A;  4GIV A;  3UQI A;  2VCD A;  4DT4 A;  5D75 A;  5HW8 A;  2PBC A;  4DRH A;  4ODK A;  3RGC A;  1EYM A;  4TYO A;  3O5I A;  4ITZ A;  5DIT A;  5GPG A;  3TC5 A;  3O5G A;  4G50 A;  2KI3 A;  2XP3 A;  4NNR A;  2XP7 A;  1J4H A;  2ZR4 A;  1QZ2 A;  2MLX A;  4C02 B;  1JNT A;  3KAH A;  2PV3 A;  3NRK A;  4ODQ A;  3CGN A;  4DRQ A;  2PV2 A;  1T11 A;  1TCO C;  4TNS A;  1PIN A;  2DG3 A;  2M08 A;  4QT2 A;  1A7X A;  4MSP A;  1FKT A;  1ROT A;  4JFM A;  2AWG A;  1EQ3 A;  1Q6I A;  3UI4 A;  5HTG A;  3JYJ A;  3JYM A;  1FKR A;  1M5Y A;  2LGO A;  1FKS A;  2XPA A;  2KFW A;  4ODO A;  1D7I A;  5DIV A;  3UQA A;  3FAP A;  2UZ5 A;  3KAB A;  1QPF A;  3WH0 A;  3O5R A;  4DRK A;  4TW7 A;  2F2D A;  3UI5 A;  2MLZ A;  3LUO A;  4QIB A;  3KAG A;  4TX0 A;  2M2A A;  4LAW A;  1YW5 A;  3KCE A;  3O5O A;  4LAV A;  4N19 A;  3IKD A;  1NMW A;  2DG4 A;  1FKH A;  2KR7 A;  2RUQ A;  1Q6H A;  3JXV A;  1D6O A;  1BL4 A;  4JFK A;  3O5L A;  1FKK A;  1R9H A;  2Q5A A;  4ODM A;  3PRD A;  4FN2 A;  4TW6 A;  5DIU A;  4U86 A;  2F4E A;  3UF8 A;  5HKG A;  2MPH A;  1J4I A;  2RUD A;  2RUC A;  4MGV A;  4DRI A;  5BXJ A;  1ROU A;  1HXV A;  3NTP A;  3O5P A;  3O5M A;  4DH0 A;  2MF9 A;  1Q1C A;  2Y78 A;  1FKG A;  1QPL A;  2KGJ A;  1L1P A;  1FKD A;  2DG9 A;  1P5Q A;  3IKG A;  4DRJ A;  3UQB A;  2OFN A;  3KAD A;  5HWB A;  1KT1 A;  2L2S A;  4JFJ A;  1ZCN A;  4U84 A;  3RFW A;  3ODK A;  5HW6 A;  2XP6 A;  2VN1 A;  2ZR5 A;  4ODR A;  1J6Y A;  4W9Q A;  1KT0 A;  3KAF A;  2PPO A;  1F8A B;  1ZK6 A;  2ZR6 A;  3OOB A;  4QT3 A;  1D7H A;  4DRN A;  2PPP A;  3O5Q A;  4ODP A;  4U85 A;  3TDB A;  2XP5 A;  4ODL A;  3GPK A;  4IPX A;  5I98 A;  3O5D A;  1U79 A;  4J4O A;  5J6E A;  2PPN A;  2FKE A;  3O5J A;  2RSE A;  1BKF A;  2FAP A;  1FKI A;  1FKJ A;  4LAX A;  4W9P A;  2K8I A;  3MDY B;  1FKB A;  2PV1 A;  2MNT A;  4JFL A;  1Y0O A;  2ZQT A;  5HT1 A;  2F21 A;  2KO7 A;  2IF4 A;  1B6C A;  1Q6U A;  2LJ4 A;  3IHZ A;  1JVW A;  4R0X A;  3PA7 A;  4DRM A;  1NSG A;  2ZQU A;  3TCZ A;  2D9F A;  2ITK A;  2N87 A;  2XP8 A;  1PBK A;  3H9R B;  4JYS A;  5HW7 A;  3O5E A;  4FAP A;  4DRO A;  2XP4 A;  3O5F A;  4LAY A;  3IK8 A;  2XP9 A;  2JZV A;  2ZQS A;  3O5K A;  3KAI A;  3KAC A;  2M1I A;  4BF8 A;  3NI6 A;  2LPV A;  5B8I C;  4G2P A;  4ODN A;  4IQ2 A;  4IQC A;  1YAT A;  1FJD A;  1NMV A;  3EY6 A;  5HUA A;  3UI6 A;  4W9O A;  1F40 A;  4DRP A;  3B7X A;  3CGM A;  1D7J A;  1FAP A;  4DIP A;  2RQS A; 
#chains in the Genus database with same CATH topology
 1JNS A;  1W9P A;  5HWC A;  1E6P A;  1HKJ A;  3WD4 A;  3VAW A;  2RUR A;  3KZ7 A;  2DPE A;  1FKF A;  4MPK A;  4PTM A;  1C9H A;  1FKL A;  3PRB A;  3ARQ A;  4DT4 A;  5D75 A;  4ODK A;  3WQW A;  1EYM A;  1GUV A;  3AQU A;  3ARU A;  5DF0 A;  5GPG A;  3ARY A;  3O5G A;  2KI3 A;  2XP7 A;  1J4H A;  1JNT A;  3KAH A;  3NRK A;  3CGN A;  1T11 A;  1TCO C;  2A3A A;  4MSP A;  1FKT A;  1JNE A;  2LGO A;  1LG2 A;  2UZ5 A;  1NWU A;  3O5R A;  4DRK A;  4TW7 A;  3WD3 A;  3KAG A;  3CHC A;  1WNO A;  3CH9 A;  3B8S A;  3IKD A;  2KR7 A;  3KAF A;  2YBT A;  1Q6H A;  3BMB A;  1NWS A;  1X6N A;  3B9D A;  4FN2 A;  4U86 A;  2F4E A;  4DWS A;  1XRV A;  3ARP A;  2G8Z A;  3NTP A;  4DH0 A;  2DT0 A;  1HKM A;  1FKD A;  3ALF A;  4MAV A;  4DRJ A;  4Z2I A;  3BXW A;  4Z2K A;  1KT1 A;  3QOK A;  2EUL A;  1LL4 A;  4WJX A;  4P8W A;  4DWS B;  1KT0 A;  2PPO A;  2WK2 A;  1ZK6 A;  1SR0 A;  1O6I A;  3G6L A;  4MNJ A;  1D7H A;  4NZC A;  1W9U A;  2PPP A;  4DRN A;  4U85 A;  3CZ8 A;  1LL6 A;  5I98 A;  1U79 A;  3B9A A;  4W9P A;  3MDY B;  2ZQT A;  1W1T A;  1B6C A;  3EIP A;  3B9E A;  3TCZ A;  5HW7 A;  2XP8 A;  3O5E A;  4DRO A;  2QF8 A;  3IK8 A;  2G41 A;  3O5K A;  4ZPW R;  3KAI A;  3KAC A;  2WM0 A;  2LPV A;  2A3B A;  4G2P A;  3AS2 A;  2AOS A;  4IQC A;  3WL1 A;  3UI6 A;  3WQV A;  3B7X A;  2ZQV A;  4JFI A;  4MNL A;  4Z2G A;  1W26 A;  4J4N A;  3RM8 A;  1TFV A;  4L3N A;  3ARW A;  4DRH A;  1D2K A;  3O5I A;  4ITZ A;  1OGB A;  3CHD A;  3FY1 A;  4WKF A;  3ALG A;  3AS3 A;  4URI A;  3GTY X;  1UR9 A;  1JCH B;  2A3C A;  3ARZ A;  4W5U A;  4DRQ A;  2PV2 A;  2DG3 A;  1A7X A;  4KR0 B;  2O9O A;  3UI4 A;  3JYM A;  3WD0 A;  4ODO A;  1D7I A;  3UQA A;  5DO2 A;  3KAB A;  4KQZ A;  3WH0 A;  2MLZ A;  3LUO A;  2M2A A;  1YW5 A;  2PI6 A;  3O5O A;  2DSZ A;  4ODM A;  1BL4 A;  1LJY A;  2Q5A A;  4MGV A;  5BXJ A;  4DRI A;  1ROU A;  1HXV A;  3ARO A;  3O5M A;  4QZV B;  1FKG A;  1QPL A;  4ZPV R;  1P5Q A;  4S3J A;  1FFQ A;  3UQB A;  1KFW A;  2ETN A;  4JFJ A;  3RFW A;  3ODK A;  2XP6 A;  2ZR5 A;  4AY1 A;  1XHG A;  2DSW A;  1F8A B;  4ODP A;  1H0G A;  3TDB A;  2XP5 A;  1ZU8 A;  3O5D A;  4J4O A;  2PPN A;  2FKE A;  1BKF A;  2FAP A;  5HT1 A;  2F21 A;  2KO7 A;  2IF4 A;  1GRJ A;  4JYS A;  1PBK A;  4FAP A;  2XP4 A;  4LAY A;  1ZBV A;  2JZV A;  2ZQS A;  4P8V A;  2YBU A;  3ARR A;  3FXY A;  4S3K A;  4IQ2 A;  2DSU A;  1LQ0 A;  4W9O A;  4DRP A;  4Q22 A;  1FAP A;  2RQS A;  2MLY A;  1E6R A;  1WB0 A;  4O2T A;  1FD9 A;  4HAR A;  1E9L A;  4TW8 A;  1J4R A;  5GQB A;  5JH8 A;  2LKN A;  1HKI A;  4UDM A;  3UQI A;  2VCD A;  1GOI A;  1JND A;  1VF8 A;  3RGC A;  1ZBK A;  4TYO A;  2DT3 A;  5DIT A;  1LL7 A;  1EIB A;  1E6Z A;  4G50 A;  2ZR4 A;  1E44 A;  3GU0 A;  4NSB A;  2PV3 A;  4WK9 A;  1RD6 A;  4TNS A;  4P8X A;  3WD1 A;  1PIN A;  1UR8 A;  1Q6I A;  1W1Y A;  1M5Y A;  4MNK A;  1FKS A;  2KFW A;  4MTV A;  4DWS D;  2F2D A;  4TX0 A;  1EHN A;  4LAW A;  3KCE A;  2A3E A;  1E15 A;  4LAV A;  4Z2H A;  3JXV A;  1D6O A;  1R9H A;  3PRD A;  5HKG A;  4WKH A;  2RUD A;  1EDQ A;  1E6N A;  2MF9 A;  2Y78 A;  1W9V A;  3AS0 A;  2KGJ A;  2IUZ A;  3PRA A;  2DG9 A;  1HJX A;  3PR9 A;  1NH6 A;  5HW6 A;  2VN1 A;  4ODR A;  1W1V A;  2P4V A;  4QT3 A;  4Z2J A;  1ZB5 A;  5J6E A;  3O5J A;  4LAX A;  2DT1 A;  3W4R A;  2K8I A;  2OLH A;  3WL0 A;  3IHZ A;  2B31 A;  1Q6U A;  4XAK A;  3PA7 A;  3RM4 A;  1NSG A;  2ZQU A;  5HUA A;  2D9F A;  2ITK A;  2N87 A;  4IT4 A;  3H9R B;  3O5F A;  2DSV A;  2M1I A;  3ARV A;  4BF8 A;  1WAW A;  4ODN A;  1HJW A;  1FJD A;  1NMV A;  3EY6 A;  3WD2 A;  1F40 A;  3CGM A;  4U84 A;  1N1A A;  3CHF A;  2XPB A;  1IX5 A;  4DZ2 A;  4GGQ A;  1CTN A;  4DZ3 A;  2KE0 A;  3I6C A;  4GIV A;  4HBE A;  2ESC A;  5HW8 A;  3OA5 A;  2PBC A;  4LGX A;  3WIJ A;  1NWR A;  2DT2 A;  4R5E A;  4P8U A;  3TC5 A;  2XP3 A;  4NNR A;  3ARS A;  1QZ2 A;  2MLX A;  4C02 B;  4ODQ A;  1ZL1 A;  2M08 A;  4QT2 A;  1ROT A;  4JFM A;  2AWG A;  1EQ3 A;  1OWQ A;  1SYT A;  2WLZ A;  5HTG A;  4HBO A;  3JYJ A;  1FKR A;  2XPA A;  4L72 B;  5DIV A;  3FAP A;  1QPF A;  1OGG A;  3UI5 A;  4DWS C;  4QIB A;  4ML4 A;  3AS1 A;  4WIW A;  4WKA A;  3RM9 A;  4N19 A;  1NMW A;  2DG4 A;  1FKH A;  2RUQ A;  3CHE A;  5GPR A;  4JFK A;  5DIU A;  2FDM A;  3O5L A;  1FKK A;  3UF8 A;  4TW6 A;  4Z2L A;  1X6L A;  2MPH A;  1J4I A;  2RUC A;  1FFR A;  3G6M A;  3O5P A;  1Q1C A;  4ZPT R;  5DEZ A;  1L1P A;  4ZS6 A;  1LG1 A;  1ITX A;  3IKG A;  2OFN A;  3KAD A;  5HWB A;  2L2S A;  1ZCN A;  3ART A;  4IT6 A;  1HKK A;  1ZBC A;  1J6Y A;  4W9Q A;  1K9T A;  5HBF A;  2B5U B;  2ZR6 A;  3OOB A;  4MNM A;  3O5Q A;  4ODL A;  1H0I A;  3GPK A;  4IPX A;  2RSE A;  1FKI A;  1FKJ A;  4Q7N A;  1FKB A;  2PV1 A;  2MNT A;  4JFL A;  1Y0O A;  1W1P A;  2O92 A;  2LJ4 A;  3ARX A;  4DRM A;  4R0X A;  1JVW A;  2F23 A;  1ZBW A;  1NWT A;  1GPF A;  3WKZ A;  2WLY A;  2XP9 A;  3NI6 A;  1HJV A;  3RME A;  5B8I C;  1YAT A;  2PN0 A;  1D7J A;  4DIP A; 
#chains in the Genus database with same CATH homology
 1JNS A;  1W9P A;  5HWC A;  1E6P A;  1HKJ A;  3WD4 A;  3VAW A;  2RUR A;  3KZ7 A;  2DPE A;  1FKF A;  4MPK A;  4PTM A;  1C9H A;  1FKL A;  3PRB A;  3ARQ A;  4DT4 A;  5D75 A;  4ODK A;  3WQW A;  1EYM A;  1GUV A;  3AQU A;  3ARU A;  5DF0 A;  5GPG A;  3ARY A;  3O5G A;  2KI3 A;  2XP7 A;  1J4H A;  1JNT A;  3KAH A;  3NRK A;  3CGN A;  1T11 A;  1TCO C;  2A3A A;  4MSP A;  1FKT A;  1JNE A;  2LGO A;  1LG2 A;  2UZ5 A;  1NWU A;  3O5R A;  4DRK A;  4TW7 A;  3WD3 A;  3KAG A;  3CHC A;  1WNO A;  3CH9 A;  3B8S A;  3IKD A;  2KR7 A;  3KAF A;  2YBT A;  1Q6H A;  1NWS A;  1X6N A;  3B9D A;  4FN2 A;  4U86 A;  2F4E A;  4DWS A;  1XRV A;  3ARP A;  2G8Z A;  3NTP A;  4DH0 A;  2DT0 A;  1HKM A;  1FKD A;  3ALF A;  4MAV A;  4DRJ A;  4Z2I A;  3BXW A;  4Z2K A;  1KT1 A;  3QOK A;  1LL4 A;  4WJX A;  4P8W A;  4DWS B;  1KT0 A;  2PPO A;  2WK2 A;  1ZK6 A;  1SR0 A;  1O6I A;  3G6L A;  4MNJ A;  1D7H A;  4NZC A;  1W9U A;  2PPP A;  4DRN A;  4U85 A;  3CZ8 A;  1LL6 A;  5I98 A;  1U79 A;  3B9A A;  4W9P A;  3MDY B;  2ZQT A;  1W1T A;  1B6C A;  3B9E A;  3TCZ A;  5HW7 A;  2XP8 A;  3O5E A;  4DRO A;  2QF8 A;  3IK8 A;  2G41 A;  3O5K A;  4ZPW R;  3KAI A;  3KAC A;  2WM0 A;  2LPV A;  2A3B A;  4G2P A;  3AS2 A;  2AOS A;  4IQC A;  3WL1 A;  3UI6 A;  3WQV A;  3B7X A;  2ZQV A;  4JFI A;  4MNL A;  4Z2G A;  1W26 A;  4J4N A;  3RM8 A;  1TFV A;  4L3N A;  3ARW A;  4DRH A;  1D2K A;  3O5I A;  4ITZ A;  1OGB A;  3CHD A;  3FY1 A;  4WKF A;  3ALG A;  3AS3 A;  4URI A;  1UR9 A;  2A3C A;  3ARZ A;  4W5U A;  4DRQ A;  2PV2 A;  2DG3 A;  1A7X A;  4KR0 B;  2O9O A;  3UI4 A;  3JYM A;  3WD0 A;  4ODO A;  1D7I A;  3UQA A;  5DO2 A;  3KAB A;  4KQZ A;  3WH0 A;  2MLZ A;  3LUO A;  2M2A A;  1YW5 A;  2PI6 A;  3O5O A;  2DSZ A;  4ODM A;  1BL4 A;  1LJY A;  2Q5A A;  4MGV A;  5BXJ A;  4DRI A;  1ROU A;  1HXV A;  3ARO A;  3O5M A;  4QZV B;  1FKG A;  1QPL A;  4ZPV R;  1P5Q A;  4S3J A;  1FFQ A;  3UQB A;  1KFW A;  4JFJ A;  3RFW A;  3ODK A;  2XP6 A;  2ZR5 A;  4AY1 A;  1XHG A;  2DSW A;  1F8A B;  4ODP A;  1H0G A;  3TDB A;  2XP5 A;  1ZU8 A;  3O5D A;  4J4O A;  2PPN A;  2FKE A;  1BKF A;  2FAP A;  5HT1 A;  2F21 A;  2KO7 A;  2IF4 A;  4JYS A;  1PBK A;  4FAP A;  2XP4 A;  4LAY A;  1ZBV A;  2JZV A;  2ZQS A;  4P8V A;  2YBU A;  3ARR A;  3FXY A;  4S3K A;  4IQ2 A;  2DSU A;  1LQ0 A;  4W9O A;  4DRP A;  4Q22 A;  1FAP A;  2RQS A;  2MLY A;  1E6R A;  1WB0 A;  4O2T A;  1FD9 A;  4HAR A;  1E9L A;  4TW8 A;  1J4R A;  5GQB A;  5JH8 A;  2LKN A;  1HKI A;  3UQI A;  2VCD A;  1GOI A;  1JND A;  1VF8 A;  3RGC A;  1ZBK A;  4TYO A;  2DT3 A;  5DIT A;  1LL7 A;  1EIB A;  1E6Z A;  4G50 A;  2ZR4 A;  4NSB A;  2PV3 A;  4WK9 A;  1RD6 A;  4TNS A;  4P8X A;  3WD1 A;  1PIN A;  1UR8 A;  1Q6I A;  1W1Y A;  1M5Y A;  4MNK A;  1FKS A;  2KFW A;  4MTV A;  4DWS D;  2F2D A;  4TX0 A;  1EHN A;  4LAW A;  3KCE A;  2A3E A;  1E15 A;  4LAV A;  4Z2H A;  3JXV A;  1D6O A;  1R9H A;  3PRD A;  5HKG A;  4WKH A;  2RUD A;  1EDQ A;  1E6N A;  2MF9 A;  2Y78 A;  1W9V A;  3AS0 A;  2KGJ A;  2IUZ A;  3PRA A;  2DG9 A;  1HJX A;  3PR9 A;  1NH6 A;  5HW6 A;  2VN1 A;  4ODR A;  1W1V A;  4QT3 A;  4Z2J A;  1ZB5 A;  5J6E A;  3O5J A;  4LAX A;  2DT1 A;  3W4R A;  2K8I A;  2OLH A;  3WL0 A;  3IHZ A;  2B31 A;  1Q6U A;  4XAK A;  3PA7 A;  3RM4 A;  1NSG A;  2ZQU A;  5HUA A;  2D9F A;  2ITK A;  2N87 A;  4IT4 A;  3H9R B;  3O5F A;  2DSV A;  2M1I A;  3ARV A;  4BF8 A;  1WAW A;  4ODN A;  1HJW A;  1FJD A;  1NMV A;  3EY6 A;  3WD2 A;  1F40 A;  3CGM A;  4U84 A;  1N1A A;  3CHF A;  2XPB A;  1IX5 A;  4DZ2 A;  4GGQ A;  1CTN A;  4DZ3 A;  2KE0 A;  3I6C A;  4GIV A;  4HBE A;  2ESC A;  5HW8 A;  3OA5 A;  2PBC A;  4LGX A;  3WIJ A;  1NWR A;  2DT2 A;  4R5E A;  4P8U A;  3TC5 A;  2XP3 A;  4NNR A;  3ARS A;  1QZ2 A;  2MLX A;  4C02 B;  4ODQ A;  1ZL1 A;  2M08 A;  4QT2 A;  1ROT A;  4JFM A;  2AWG A;  1EQ3 A;  1OWQ A;  1SYT A;  2WLZ A;  5HTG A;  4HBO A;  3JYJ A;  1FKR A;  2XPA A;  4L72 B;  5DIV A;  3FAP A;  1QPF A;  1OGG A;  3UI5 A;  4DWS C;  4QIB A;  4ML4 A;  3AS1 A;  4WIW A;  4WKA A;  3RM9 A;  4N19 A;  1NMW A;  2DG4 A;  1FKH A;  2RUQ A;  3CHE A;  5GPR A;  4JFK A;  5DIU A;  2FDM A;  3O5L A;  1FKK A;  3UF8 A;  4TW6 A;  4Z2L A;  1X6L A;  2MPH A;  1J4I A;  2RUC A;  1FFR A;  3G6M A;  3O5P A;  1Q1C A;  4ZPT R;  5DEZ A;  1L1P A;  4ZS6 A;  1LG1 A;  1ITX A;  3IKG A;  2OFN A;  3KAD A;  5HWB A;  2L2S A;  1ZCN A;  3ART A;  4IT6 A;  1HKK A;  1ZBC A;  1J6Y A;  4W9Q A;  1K9T A;  5HBF A;  2ZR6 A;  3OOB A;  4MNM A;  3O5Q A;  4ODL A;  1H0I A;  3GPK A;  4IPX A;  2RSE A;  1FKI A;  1FKJ A;  4Q7N A;  1FKB A;  2PV1 A;  2MNT A;  4JFL A;  1Y0O A;  1W1P A;  2O92 A;  2LJ4 A;  3ARX A;  4DRM A;  4R0X A;  1JVW A;  1ZBW A;  1NWT A;  1GPF A;  3WKZ A;  2WLY A;  2XP9 A;  3NI6 A;  1HJV A;  3RME A;  5B8I C;  1YAT A;  1D7J A;  4DIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...