4N19A

Structural basis of conformational transitions in the active site and 80 s loop in the fk506 binding protein fkbp12
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTVVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPPIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1A
publication title Structural basis of conformational transitions in the active site and 80's loop in the FK506-binding protein FKBP12.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 27
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4n19A00
2PV2A 3GPKA 2RUQA 1FKHA 3O5GA 4QT2A 3LUOA 3O5KA 3IKDA 4DRHA 2XP5A 2N87A 2FKEA 3I6CA 1D7IA 5B8IC 1A7XA 1FJDA 2LKNA 5HW6A 1P5QA 1FKGA 3KACA 4DRIA 2PBCA 2PPPA 3O5PA 4G50A 5I98A 1FKFA 1Q6HA 4ODQA 4U86A 3O5DA 5BXJA 2ZR5A 4QT3A 1F8AB 5HUAA 1KT1A 3O5FA 1U79A 1B6CA 4DRQA 4TX0A 1FKBA 1N1AA 5HTGA 5DIVA 2RQSA 1M5YA 2AWGA 4DZ2A 4MGVA 3O5LA 5HW7A 1NMWA 2M2AA 2ZQSA 4DRNA 1FKDA 1R9HA 3PRDA 4DZ3A 1J6YA 2LPVA 2ITKA 2DG9A 1NSGA 4QIBA 5J6EA 2KR7A 1FKSA 2F2DA 4TW7A 4ODNA 2ZR6A 1PBKA 2RUCA 4DRMA 1EQ3A 2VCDA 1QPFA 2Q5AA 2MF9A 1FKJA 3KAFA 1FKTA 4W9PA 3UQAA 2JZVA 4LAVA 2XP8A 2KE0A 2KO7A 1ZCNA 4NNRA 3TDBA 3VAWA 4IQ2A 4TW6A 2ZR4A 3UI4A 4DRJA 1D7HA 3CGMA 1W26A 2PPNA 4MSPA 2L2SA 4GIVA 4LAYA 3RFWA 2PPOA 4ITZA 4W9QA 2PV1A 3EY6A 3FAPA 4FAPA 2MLXA 4ODOA 1D6OA 1FKLA 2M1IA 3O5IA 1NMVA 4LAXA 1J4HA 4LAWA 3UI6A 1D7JA 4DROA 4DRPA 2XPAA 2XP9A 1JNSA 1Q1CA 1JVWA 3WH0A 1BL4A 3JXVA 3NTPA 4O2TA 3TC5A 4JFLA 3JYMA 4ODKA 1L1PA 4TYOA 4IQCA 5D75A 4JFKA 4DIPA 2D9FA 5GPGA 1J4RA 1ROUA 2F4EA 5DIUA 4JFIA 1FKRA 1FD9A 1T11A 1Y0OA 3KAHA 4JFMA 2M08A 3NI6A 1JNTA 2DG3A 4FN2A 1Q6IA 1Q6UA 3O5MA 5HKGA 4JYSA 1TCOC 3KAIA 4ODLA 5HWCA 3KCEA 3O5QA 2FAPA 5HT1A 2VN1A 4W9OA 2Y78A 1YATA 4R0XA 4DH0A 3CGNA 1QPLA 1QZ2A 3NRKA 4G2PA 4GGQA 3UF8A 4C02B 4DRKA 2XP7A 2XPBA 2KFWA 1J4IA 2MLZA 3H9RB 2RUDA 4J4NA 3MDYB 3TCZA 2MNTA 1BKFA 1FKKA 3OOBA 3KZ7A 3RGCA 2KI3A 1ROTA 1F40A 3O5JA 3O5EA 4ODMA 1FKIA 2F21A 2LGOA 3IKGA 4ODRA 3KABA 2UZ5A 1FAPA 2RURA 1YW5A 2DG4A 2OFNA 2XP6A 1HXVA 1KT0A 3UQIA 2ZQUA 4DT4A 3KADA 4J4OA 4TNSA 4U85A 4ODPA 3KAGA 4U84A 2PV3A 3JYJA 2ZQTA 5HWBA 1ZK6A 2IF4A 3IK8A 5DITA 2MLYA 2K8IA 4TW8A 1EYMA 3UQBA 3ODKA 3O5OA 1PINA 4N19A 2KGJA 3PRBA 2LJ4A 2RSEA 2MPHA 2XP4A 3B7XA 3IHZA 3O5RA 3UI5A 2XP3A 4BF8A 4IPXA 4JFJA 5HW8A 3PA7A 1C9HA 2ZQVA
chains in the Genus database with same CATH superfamily
1FKHA 3OA5A 1E6PA 1FFRA 3IKDA 4W5UA 4Q22A 3BMBA 1A7XA 1P5QA 1FKGA 3O5PA 5I98A 2DT0A 1FKFA 4MNLA 3O5FA 1U79A 3B8SA 4Z2HA 1X6LA 1W9UA 5HTGA 5DO2A 4DWSD 4L72B 3EIPA 1W1VA 4DZ2A 2DT1A 3O5LA 3PRDA 4P8WA 2DG9A 2KR7A 2F2DA 3ARPA 1LJYA 3RMEA 3KAFA 3CH9A 4LAVA 2KE0A 2KO7A 1ZCNA 4WIWA 4AY1A 4DRJA 4MSPA 1E6NA 2B31A 1GOIA 3FAPA 1ZBWA 2M1IA 1NMVA 1J4HA 4DRPA 2XP9A 3WH0A 3NTPA 3TC5A 3GU0A 3WKZA 1CTNA 1SYTA 1E44A 2F4EA 2IUZA 1T11A 1Y0OA 4JFMA 4P8XA 4FN2A 1Q6UA 4Z2GA 5HKGA 1NWRA 1GPFA 3KAIA 3WL1A 2VN1A 4W9OA 3GTYX 4ZPWR 4DH0A 1QPLA 1QZ2A 2PI6A 2XP7A 2XPBA 4WJXA 3TCZA 3ARQA 3RGCA 3G6LA 3KZ7A 1FKIA 4MAVA 1WB0A 4MPKA 3WD2A 2G8ZA 2RURA 1YW5A 2ETNA 4WKFA 2OFNA 3UQIA 3KADA 4TNSA 4XAKA 1LL6A 1W1YA 1EHNA 3ARSA 1JNEA 5HWBA 1HJVA 2O9OA 3IK8A 2MLYA 3AS2A 4DWSA 3B9DA 1JNDA 4HBEA 3WIJA 3B7XA 3UI5A 3O5RA 2XP3A 5GQBA 4PTMA 1LG1A 1C9HA 2RUQA 3O5KA 4DRHA 1XRVA 2N87A 3FY1A 5B8IC 1E6RA 3RM9A 2PPPA 4G50A 3CHEA 4ZPVR 3PR9A 1HJWA 1F8AB 1OWQA 2F23A 4TX0A 4DRQA 1X6NA 4DWSC 4MTVA 1E9LA 1WAWA 4MGVA 4DZ3A 1FKSA 4TW7A 4ODNA 2ZR6A 4DRMA 4Q7NA 4LGXA 1FKJA 1FKTA 2JZVA 1ITXA 1HKJA 2FDMA 4IQ2A 1W26A 2L2SA 4GIVA 4ML4A 2DSWA 4LAXA 1H0GA 4LAWA 1JNSA 2XPAA 4ZS6A 1Q1CA 4O2TA 3JXVA 4S3JA 1L1PA 4TYOA 4IQCA 4DIPA 4JFKA 2D9FA 5GPGA 1OGBA 1J4RA 4JFIA 3NI6A 1JNTA 2DG3A 2A3EA 1TCOC 4ODLA 1WNOA 2DT2A 4KR0B 3WD4A 2Y78A 3AS1A 3UF8A 4DRKA 3H9RB 2MLZA 1HKIA 3MDYB 2PN0A 1BKFA 3OOBA 2KI3A 3O5EA 4ODMA 2F21A 2LGOA 3AROA 4ODRA 1ZU8A 1HKMA 1HXVA 1OGGA 2ZQUA 3ARZA 1XHGA 3KAGA 3AS0A 1W1TA 3G6MA 3WD0A 1W9PA 2K8IA 4TW8A 1EYMA 3UQBA 3FXYA 3O5OA 1PINA 1JCHB 3PRBA 2MPHA 3IHZA 4R5EA 4IPXA 3QOKA 3PA7A 1EIBA 2PV2A 1TFVA 4QT2A 2WLZA 4P8VA 2XP5A 2FKEA 3I6CA 1D7IA 3ARWA 1FJDA 3WD3A 4MNKA 1HJXA 1Q6HA 4ODQA 3O5DA 4QT3A 1HKKA 1KFWA 1KT1A 2DT3A 1B6CA 3WD1A 1FKBA 5DIVA 2RQSA 4Z2KA 3ARYA 5HW7A 1R9HA 2LPVA 2ITKA 4NSBA 4QIBA 5J6EA 3ARXA 1PBKA 2RUCA 2VCDA 1ZL1A 4W9PA 2MF9A 3UQAA 4S3KA 2XP8A 4NNRA 3TDBA 1NWTA 4DWSB 4IT6A 3ARTA 2ZR4A 4TW6A 1D7HA 3AQUA 4LAYA 1LL7A 2PPOA 3EY6A 4FAPA 2MLXA 2WM0A 4ODOA 1D6OA 2DPEA 1FKLA 3UI6A 4DROA 1RD6A 1JVWA 2DSZA 1BL4A 3JYMA 1K9TA 3B9AA 1ROUA 5DIUA 1FKRA 1O6IA 4DRNA 3KAHA 1D2KA 2M08A 4URIA 1Q6IA 3O5MA 2DSVA 4JYSA 4NZCA 1ZBKA 2FAPA 3O5QA 3ALGA 3WQVA 4Z2IA 3CZ8A 4KQZA 1IX5A 4HBOA 3NRKA 4G2PA 4GGQA 2WLYA 1J4IA 4J4NA 2RUDA 1E6ZA 1FKKA 1F40A 1VF8A 3CHFA 2A3CA 3IKGA 3KABA 2UZ5A 1FAPA 2DG4A 1W1PA 3CHDA 2A3AA 4DT4A 3ALFA 3W4RA 1ZB5A 2YBUA 4U85A 4U84A 3JYJA 2ZQTA 1ZK6A 4HARA 2IF4A 5DITA 2QF8A 3ODKA 4WKAA 4N19A 2KGJA 3PRAA 2LJ4A 2RSEA 4JFJA 2B5UB 4ODPA 3GPKA 3O5GA 1NWSA 3LUOA 4QZVB 1UR9A 2LKNA 5HW6A 4UDMA 3KACA 5DF0A 4DRIA 2PBCA 1FFQA 5HBFA 3WL0A 4U86A 5BXJA 2ZR5A 5HUAA 1EDQA 3AS3A 3RM8A 1ZBVA 1N1AA 1W9VA 1M5YA 5DEZA 2AWGA 1NMWA 2M2AA 2ZQSA 1FKDA 3B9EA 2P4VA 1J6YA 3ARRA 1NSGA 1EQ3A 1QPFA 2Q5AA 1LG2A 3VAWA 3UI4A 3CGMA 2G41A 2PPNA 3RFWA 4ITZA 4W9QA 2PV1A 4Z2JA 3O5IA 5JH8A 1D7JA 1ZBCA 3ARVA 4L3NA 3BXWA 4JFLA 4WKHA 4ODKA 5D75A 4P8UA 1UR8A 1FD9A 5HWCA 3KCEA 1SR0A 1NH6A 5HT1A 1LQ0A 1NWUA 1YATA 4R0XA 2O92A 1LL4A 3CGNA 4IT4A 4C02B 3ARUA 2KFWA 4ZPTR 2MNTA 1GUVA 1ROTA 3O5JA 1E15A 5GPRA 2YBTA 2XP6A 1KT0A 1GRJA 4Z2LA 2A3BA 4J4OA 2DSUA 1H0IA 2AOSA 2PV3A 3RM4A 2OLHA 2EULA 4MNJA 2ESCA 2XP4A 3CHCA 5HW8A 4MNMA 4BF8A 3WQWA 2WK2A 4WK9A 2ZQVA
chains in the Genus database with same CATH topology
1FKHA 3OA5A 1E6PA 1FFRA 3IKDA 4W5UA 4Q22A 1A7XA 1P5QA 1FKGA 3O5PA 5I98A 2DT0A 1FKFA 4MNLA 3O5FA 1U79A 3B8SA 4Z2HA 1X6LA 1W9UA 5HTGA 5DO2A 4DWSD 4L72B 1W1VA 4DZ2A 2DT1A 3O5LA 3PRDA 4P8WA 2DG9A 2KR7A 2F2DA 3ARPA 1LJYA 3RMEA 3KAFA 3CH9A 4LAVA 2KE0A 2KO7A 1ZCNA 4WIWA 4AY1A 4DRJA 4MSPA 1E6NA 2B31A 1GOIA 3FAPA 1ZBWA 2M1IA 1NMVA 1J4HA 4DRPA 2XP9A 3WH0A 3NTPA 3TC5A 3WKZA 1CTNA 1SYTA 2F4EA 2IUZA 1T11A 1Y0OA 4JFMA 4P8XA 4FN2A 1Q6UA 4Z2GA 5HKGA 1NWRA 1GPFA 3KAIA 3WL1A 2VN1A 4W9OA 4ZPWR 4DH0A 1QPLA 1QZ2A 2PI6A 2XP7A 2XPBA 4WJXA 3TCZA 3ARQA 3RGCA 3G6LA 3KZ7A 1FKIA 4MAVA 1WB0A 4MPKA 3WD2A 2G8ZA 2RURA 1YW5A 4WKFA 2OFNA 3UQIA 3KADA 4TNSA 4XAKA 1LL6A 1W1YA 1EHNA 3ARSA 1JNEA 5HWBA 1HJVA 2O9OA 3IK8A 2MLYA 3AS2A 4DWSA 3B9DA 1JNDA 4HBEA 3WIJA 3B7XA 3UI5A 3O5RA 2XP3A 5GQBA 4PTMA 1LG1A 1C9HA 2RUQA 3O5KA 4DRHA 1XRVA 2N87A 3FY1A 5B8IC 1E6RA 3RM9A 2PPPA 4G50A 3CHEA 4ZPVR 3PR9A 1HJWA 1F8AB 1OWQA 4DRQA 4TX0A 1X6NA 4DWSC 4MTVA 1E9LA 1WAWA 4MGVA 4DZ3A 1FKSA 4TW7A 4ODNA 2ZR6A 4DRMA 4Q7NA 4LGXA 1FKJA 1FKTA 2JZVA 1ITXA 1HKJA 2FDMA 4IQ2A 1W26A 2L2SA 4GIVA 4ML4A 2DSWA 4LAXA 1H0GA 4LAWA 1JNSA 2XPAA 4ZS6A 1Q1CA 4O2TA 3JXVA 4S3JA 1L1PA 4TYOA 4IQCA 4DIPA 4JFKA 2D9FA 5GPGA 1OGBA 1J4RA 4JFIA 3NI6A 1JNTA 2DG3A 2A3EA 1TCOC 4ODLA 1WNOA 2DT2A 4KR0B 3WD4A 2Y78A 3AS1A 3UF8A 4DRKA 3H9RB 2MLZA 1HKIA 3MDYB 1BKFA 3OOBA 2KI3A 3O5EA 4ODMA 2F21A 2LGOA 3AROA 4ODRA 1ZU8A 1HKMA 1HXVA 1OGGA 2ZQUA 3ARZA 1XHGA 3KAGA 3AS0A 1W1TA 3G6MA 3WD0A 1W9PA 2K8IA 4TW8A 1EYMA 3UQBA 3FXYA 3O5OA 1PINA 3PRBA 2MPHA 3IHZA 4R5EA 4IPXA 3QOKA 3PA7A 1EIBA 2PV2A 1TFVA 4QT2A 2WLZA 4P8VA 2XP5A 2FKEA 3I6CA 1D7IA 3ARWA 1FJDA 3WD3A 4MNKA 1HJXA 1Q6HA 4ODQA 3O5DA 4QT3A 1HKKA 1KFWA 1KT1A 2DT3A 1B6CA 3WD1A 1FKBA 5DIVA 2RQSA 4Z2KA 3ARYA 5HW7A 1R9HA 2LPVA 2ITKA 4NSBA 4QIBA 5J6EA 3ARXA 1PBKA 2RUCA 2VCDA 1ZL1A 4W9PA 2MF9A 3UQAA 4S3KA 2XP8A 4NNRA 3TDBA 1NWTA 4DWSB 4IT6A 3ARTA 2ZR4A 4TW6A 1D7HA 3AQUA 4LAYA 1LL7A 2PPOA 3EY6A 4FAPA 2MLXA 2WM0A 4ODOA 1D6OA 2DPEA 1FKLA 3UI6A 4DROA 1RD6A 1JVWA 2DSZA 1BL4A 3JYMA 1K9TA 3B9AA 1ROUA 5DIUA 1FKRA 1O6IA 4DRNA 3KAHA 1D2KA 2M08A 4URIA 1Q6IA 3O5MA 2DSVA 4JYSA 4NZCA 1ZBKA 2FAPA 3O5QA 3ALGA 3WQVA 4Z2IA 3CZ8A 4KQZA 1IX5A 4HBOA 3NRKA 4G2PA 4GGQA 2WLYA 1J4IA 4J4NA 2RUDA 1E6ZA 1FKKA 1F40A 1VF8A 3CHFA 2A3CA 3IKGA 3KABA 2UZ5A 1FAPA 2DG4A 1W1PA 3CHDA 2A3AA 4DT4A 3ALFA 3W4RA 1ZB5A 2YBUA 4U85A 4U84A 3JYJA 2ZQTA 1ZK6A 4HARA 2IF4A 5DITA 2QF8A 3ODKA 4WKAA 4N19A 2KGJA 3PRAA 2LJ4A 2RSEA 4JFJA 4ODPA 3GPKA 3O5GA 1NWSA 3LUOA 4QZVB 1UR9A 2LKNA 5HW6A 3KACA 5DF0A 4DRIA 2PBCA 1FFQA 5HBFA 3WL0A 4U86A 5BXJA 2ZR5A 5HUAA 1EDQA 3AS3A 3RM8A 1ZBVA 1N1AA 1W9VA 1M5YA 5DEZA 2AWGA 1NMWA 2M2AA 2ZQSA 1FKDA 3B9EA 1J6YA 3ARRA 1NSGA 1EQ3A 1QPFA 2Q5AA 1LG2A 3VAWA 3UI4A 3CGMA 2G41A 2PPNA 3RFWA 4ITZA 4W9QA 2PV1A 4Z2JA 3O5IA 5JH8A 1D7JA 1ZBCA 3ARVA 4L3NA 3BXWA 4JFLA 4WKHA 4ODKA 5D75A 4P8UA 1UR8A 1FD9A 5HWCA 3KCEA 1SR0A 1NH6A 5HT1A 1LQ0A 1NWUA 1YATA 4R0XA 2O92A 1LL4A 3CGNA 4IT4A 4C02B 3ARUA 2KFWA 4ZPTR 2MNTA 1GUVA 1ROTA 3O5JA 1E15A 5GPRA 2YBTA 2XP6A 1KT0A 4Z2LA 2A3BA 4J4OA 2DSUA 1H0IA 2AOSA 2PV3A 3RM4A 2OLHA 4MNJA 2ESCA 2XP4A 3CHCA 5HW8A 4MNMA 4BF8A 3WQWA 2WK2A 4WK9A 2ZQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PV2 A;  3GPK A;  2RUQ A;  1FKH A;  3O5G A;  4QT2 A;  3LUO A;  3O5K A;  3IKD A;  4DRH A;  2XP5 A;  2N87 A;  2FKE A;  3I6C A;  1D7I A;  5B8I C;  1A7X A;  1FJD A;  2LKN A;  5HW6 A;  1P5Q A;  1FKG A;  3KAC A;  4DRI A;  2PBC A;  2PPP A;  3O5P A;  4G50 A;  5I98 A;  1FKF A;  1Q6H A;  4ODQ A;  4U86 A;  3O5D A;  5BXJ A;  2ZR5 A;  4QT3 A;  1F8A B;  5HUA A;  1KT1 A;  3O5F A;  1U79 A;  1B6C A;  4DRQ A;  4TX0 A;  1FKB A;  1N1A A;  5HTG A;  5DIV A;  2RQS A;  1M5Y A;  2AWG A;  4DZ2 A;  4MGV A;  3O5L A;  5HW7 A;  1NMW A;  2M2A A;  2ZQS A;  4DRN A;  1FKD A;  1R9H A;  3PRD A;  4DZ3 A;  1J6Y A;  2LPV A;  2ITK A;  2DG9 A;  1NSG A;  4QIB A;  5J6E A;  2KR7 A;  1FKS A;  2F2D A;  4TW7 A;  4ODN A;  2ZR6 A;  1PBK A;  2RUC A;  4DRM A;  1EQ3 A;  2VCD A;  1QPF A;  2Q5A A;  2MF9 A;  1FKJ A;  3KAF A;  1FKT A;  4W9P A;  3UQA A;  2JZV A;  4LAV A;  2XP8 A;  2KE0 A;  2KO7 A;  1ZCN A;  4NNR A;  3TDB A;  3VAW A;  4IQ2 A;  4TW6 A;  2ZR4 A;  3UI4 A;  4DRJ A;  1D7H A;  3CGM A;  1W26 A;  2PPN A;  4MSP A;  2L2S A;  4GIV A;  4LAY A;  3RFW A;  2PPO A;  4ITZ A;  4W9Q A;  2PV1 A;  3EY6 A;  3FAP A;  4FAP A;  2MLX A;  4ODO A;  1D6O A;  1FKL A;  2M1I A;  3O5I A;  1NMV A;  4LAX A;  1J4H A;  4LAW A;  3UI6 A;  1D7J A;  4DRO A;  4DRP A;  2XPA A;  2XP9 A;  1JNS A;  1Q1C A;  1JVW A;  3WH0 A;  1BL4 A;  3JXV A;  3NTP A;  4O2T A;  3TC5 A;  4JFL A;  3JYM A;  4ODK A;  1L1P A;  4TYO A;  4IQC A;  5D75 A;  4JFK A;  4DIP A;  2D9F A;  5GPG A;  1J4R A;  1ROU A;  2F4E A;  5DIU A;  4JFI A;  1FKR A;  1FD9 A;  1T11 A;  1Y0O A;  3KAH A;  4JFM A;  2M08 A;  3NI6 A;  1JNT A;  2DG3 A;  4FN2 A;  1Q6I A;  1Q6U A;  3O5M A;  5HKG A;  4JYS A;  1TCO C;  3KAI A;  4ODL A;  5HWC A;  3KCE A;  3O5Q A;  2FAP A;  5HT1 A;  2VN1 A;  4W9O A;  2Y78 A;  1YAT A;  4R0X A;  4DH0 A;  3CGN A;  1QPL A;  1QZ2 A;  3NRK A;  4G2P A;  4GGQ A;  3UF8 A;  4C02 B;  4DRK A;  2XP7 A;  2XPB A;  2KFW A;  1J4I A;  2MLZ A;  3H9R B;  2RUD A;  4J4N A;  3MDY B;  3TCZ A;  2MNT A;  1BKF A;  1FKK A;  3OOB A;  3KZ7 A;  3RGC A;  2KI3 A;  1ROT A;  1F40 A;  3O5J A;  3O5E A;  4ODM A;  1FKI A;  2F21 A;  2LGO A;  3IKG A;  4ODR A;  3KAB A;  2UZ5 A;  1FAP A;  2RUR A;  1YW5 A;  2DG4 A;  2OFN A;  2XP6 A;  1HXV A;  1KT0 A;  3UQI A;  2ZQU A;  4DT4 A;  3KAD A;  4J4O A;  4TNS A;  4U85 A;  4ODP A;  3KAG A;  4U84 A;  2PV3 A;  3JYJ A;  2ZQT A;  5HWB A;  1ZK6 A;  2IF4 A;  3IK8 A;  5DIT A;  2MLY A;  2K8I A;  4TW8 A;  1EYM A;  3UQB A;  3ODK A;  3O5O A;  1PIN A;  4N19 A;  2KGJ A;  3PRB A;  2LJ4 A;  2RSE A;  2MPH A;  2XP4 A;  3B7X A;  3IHZ A;  3O5R A;  3UI5 A;  2XP3 A;  4BF8 A;  4IPX A;  4JFJ A;  5HW8 A;  3PA7 A;  1C9H A;  2ZQV A; 
#chains in the Genus database with same CATH topology
 1FKH A;  3OA5 A;  1E6P A;  1FFR A;  3IKD A;  4W5U A;  4Q22 A;  3BMB A;  1A7X A;  1P5Q A;  1FKG A;  3O5P A;  5I98 A;  2DT0 A;  1FKF A;  4MNL A;  3O5F A;  1U79 A;  3B8S A;  4Z2H A;  1X6L A;  1W9U A;  5HTG A;  5DO2 A;  4DWS D;  4L72 B;  3EIP A;  1W1V A;  4DZ2 A;  2DT1 A;  3O5L A;  3PRD A;  4P8W A;  2DG9 A;  2KR7 A;  2F2D A;  3ARP A;  1LJY A;  3RME A;  3KAF A;  3CH9 A;  4LAV A;  2KE0 A;  2KO7 A;  1ZCN A;  4WIW A;  4AY1 A;  4DRJ A;  4MSP A;  1E6N A;  2B31 A;  1GOI A;  3FAP A;  1ZBW A;  2M1I A;  1NMV A;  1J4H A;  4DRP A;  2XP9 A;  3WH0 A;  3NTP A;  3TC5 A;  3GU0 A;  3WKZ A;  1CTN A;  1SYT A;  1E44 A;  2F4E A;  2IUZ A;  1T11 A;  1Y0O A;  4JFM A;  4P8X A;  4FN2 A;  1Q6U A;  4Z2G A;  5HKG A;  1NWR A;  1GPF A;  3KAI A;  3WL1 A;  2VN1 A;  4W9O A;  3GTY X;  4ZPW R;  4DH0 A;  1QPL A;  1QZ2 A;  2PI6 A;  2XP7 A;  2XPB A;  4WJX A;  3TCZ A;  3ARQ A;  3RGC A;  3G6L A;  3KZ7 A;  1FKI A;  4MAV A;  1WB0 A;  4MPK A;  3WD2 A;  2G8Z A;  2RUR A;  1YW5 A;  2ETN A;  4WKF A;  2OFN A;  3UQI A;  3KAD A;  4TNS A;  4XAK A;  1LL6 A;  1W1Y A;  1EHN A;  3ARS A;  1JNE A;  5HWB A;  1HJV A;  2O9O A;  3IK8 A;  2MLY A;  3AS2 A;  4DWS A;  3B9D A;  1JND A;  4HBE A;  3WIJ A;  3B7X A;  3UI5 A;  3O5R A;  2XP3 A;  5GQB A;  4PTM A;  1LG1 A;  1C9H A;  2RUQ A;  3O5K A;  4DRH A;  1XRV A;  2N87 A;  3FY1 A;  5B8I C;  1E6R A;  3RM9 A;  2PPP A;  4G50 A;  3CHE A;  4ZPV R;  3PR9 A;  1HJW A;  1F8A B;  1OWQ A;  2F23 A;  4TX0 A;  4DRQ A;  1X6N A;  4DWS C;  4MTV A;  1E9L A;  1WAW A;  4MGV A;  4DZ3 A;  1FKS A;  4TW7 A;  4ODN A;  2ZR6 A;  4DRM A;  4Q7N A;  4LGX A;  1FKJ A;  1FKT A;  2JZV A;  1ITX A;  1HKJ A;  2FDM A;  4IQ2 A;  1W26 A;  2L2S A;  4GIV A;  4ML4 A;  2DSW A;  4LAX A;  1H0G A;  4LAW A;  1JNS A;  2XPA A;  4ZS6 A;  1Q1C A;  4O2T A;  3JXV A;  4S3J A;  1L1P A;  4TYO A;  4IQC A;  4DIP A;  4JFK A;  2D9F A;  5GPG A;  1OGB A;  1J4R A;  4JFI A;  3NI6 A;  1JNT A;  2DG3 A;  2A3E A;  1TCO C;  4ODL A;  1WNO A;  2DT2 A;  4KR0 B;  3WD4 A;  2Y78 A;  3AS1 A;  3UF8 A;  4DRK A;  3H9R B;  2MLZ A;  1HKI A;  3MDY B;  2PN0 A;  1BKF A;  3OOB A;  2KI3 A;  3O5E A;  4ODM A;  2F21 A;  2LGO A;  3ARO A;  4ODR A;  1ZU8 A;  1HKM A;  1HXV A;  1OGG A;  2ZQU A;  3ARZ A;  1XHG A;  3KAG A;  3AS0 A;  1W1T A;  3G6M A;  3WD0 A;  1W9P A;  2K8I A;  4TW8 A;  1EYM A;  3UQB A;  3FXY A;  3O5O A;  1PIN A;  1JCH B;  3PRB A;  2MPH A;  3IHZ A;  4R5E A;  4IPX A;  3QOK A;  3PA7 A;  1EIB A;  2PV2 A;  1TFV A;  4QT2 A;  2WLZ A;  4P8V A;  2XP5 A;  2FKE A;  3I6C A;  1D7I A;  3ARW A;  1FJD A;  3WD3 A;  4MNK A;  1HJX A;  1Q6H A;  4ODQ A;  3O5D A;  4QT3 A;  1HKK A;  1KFW A;  1KT1 A;  2DT3 A;  1B6C A;  3WD1 A;  1FKB A;  5DIV A;  2RQS A;  4Z2K A;  3ARY A;  5HW7 A;  1R9H A;  2LPV A;  2ITK A;  4NSB A;  4QIB A;  5J6E A;  3ARX A;  1PBK A;  2RUC A;  2VCD A;  1ZL1 A;  4W9P A;  2MF9 A;  3UQA A;  4S3K A;  2XP8 A;  4NNR A;  3TDB A;  1NWT A;  4DWS B;  4IT6 A;  3ART A;  2ZR4 A;  4TW6 A;  1D7H A;  3AQU A;  4LAY A;  1LL7 A;  2PPO A;  3EY6 A;  4FAP A;  2MLX A;  2WM0 A;  4ODO A;  1D6O A;  2DPE A;  1FKL A;  3UI6 A;  4DRO A;  1RD6 A;  1JVW A;  2DSZ A;  1BL4 A;  3JYM A;  1K9T A;  3B9A A;  1ROU A;  5DIU A;  1FKR A;  1O6I A;  4DRN A;  3KAH A;  1D2K A;  2M08 A;  4URI A;  1Q6I A;  3O5M A;  2DSV A;  4JYS A;  4NZC A;  1ZBK A;  2FAP A;  3O5Q A;  3ALG A;  3WQV A;  4Z2I A;  3CZ8 A;  4KQZ A;  1IX5 A;  4HBO A;  3NRK A;  4G2P A;  4GGQ A;  2WLY A;  1J4I A;  4J4N A;  2RUD A;  1E6Z A;  1FKK A;  1F40 A;  1VF8 A;  3CHF A;  2A3C A;  3IKG A;  3KAB A;  2UZ5 A;  1FAP A;  2DG4 A;  1W1P A;  3CHD A;  2A3A A;  4DT4 A;  3ALF A;  3W4R A;  1ZB5 A;  2YBU A;  4U85 A;  4U84 A;  3JYJ A;  2ZQT A;  1ZK6 A;  4HAR A;  2IF4 A;  5DIT A;  2QF8 A;  3ODK A;  4WKA A;  4N19 A;  2KGJ A;  3PRA A;  2LJ4 A;  2RSE A;  4JFJ A;  2B5U B;  4ODP A;  3GPK A;  3O5G A;  1NWS A;  3LUO A;  4QZV B;  1UR9 A;  2LKN A;  5HW6 A;  4UDM A;  3KAC A;  5DF0 A;  4DRI A;  2PBC A;  1FFQ A;  5HBF A;  3WL0 A;  4U86 A;  5BXJ A;  2ZR5 A;  5HUA A;  1EDQ A;  3AS3 A;  3RM8 A;  1ZBV A;  1N1A A;  1W9V A;  1M5Y A;  5DEZ A;  2AWG A;  1NMW A;  2M2A A;  2ZQS A;  1FKD A;  3B9E A;  2P4V A;  1J6Y A;  3ARR A;  1NSG A;  1EQ3 A;  1QPF A;  2Q5A A;  1LG2 A;  3VAW A;  3UI4 A;  3CGM A;  2G41 A;  2PPN A;  3RFW A;  4ITZ A;  4W9Q A;  2PV1 A;  4Z2J A;  3O5I A;  5JH8 A;  1D7J A;  1ZBC A;  3ARV A;  4L3N A;  3BXW A;  4JFL A;  4WKH A;  4ODK A;  5D75 A;  4P8U A;  1UR8 A;  1FD9 A;  5HWC A;  3KCE A;  1SR0 A;  1NH6 A;  5HT1 A;  1LQ0 A;  1NWU A;  1YAT A;  4R0X A;  2O92 A;  1LL4 A;  3CGN A;  4IT4 A;  4C02 B;  3ARU A;  2KFW A;  4ZPT R;  2MNT A;  1GUV A;  1ROT A;  3O5J A;  1E15 A;  5GPR A;  2YBT A;  2XP6 A;  1KT0 A;  1GRJ A;  4Z2L A;  2A3B A;  4J4O A;  2DSU A;  1H0I A;  2AOS A;  2PV3 A;  3RM4 A;  2OLH A;  2EUL A;  4MNJ A;  2ESC A;  2XP4 A;  3CHC A;  5HW8 A;  4MNM A;  4BF8 A;  3WQW A;  2WK2 A;  4WK9 A;  2ZQV A; 
#chains in the Genus database with same CATH homology
 1FKH A;  3OA5 A;  1E6P A;  1FFR A;  3IKD A;  4W5U A;  4Q22 A;  1A7X A;  1P5Q A;  1FKG A;  3O5P A;  5I98 A;  2DT0 A;  1FKF A;  4MNL A;  3O5F A;  1U79 A;  3B8S A;  4Z2H A;  1X6L A;  1W9U A;  5HTG A;  5DO2 A;  4DWS D;  4L72 B;  1W1V A;  4DZ2 A;  2DT1 A;  3O5L A;  3PRD A;  4P8W A;  2DG9 A;  2KR7 A;  2F2D A;  3ARP A;  1LJY A;  3RME A;  3KAF A;  3CH9 A;  4LAV A;  2KE0 A;  2KO7 A;  1ZCN A;  4WIW A;  4AY1 A;  4DRJ A;  4MSP A;  1E6N A;  2B31 A;  1GOI A;  3FAP A;  1ZBW A;  2M1I A;  1NMV A;  1J4H A;  4DRP A;  2XP9 A;  3WH0 A;  3NTP A;  3TC5 A;  3WKZ A;  1CTN A;  1SYT A;  2F4E A;  2IUZ A;  1T11 A;  1Y0O A;  4JFM A;  4P8X A;  4FN2 A;  1Q6U A;  4Z2G A;  5HKG A;  1NWR A;  1GPF A;  3KAI A;  3WL1 A;  2VN1 A;  4W9O A;  4ZPW R;  4DH0 A;  1QPL A;  1QZ2 A;  2PI6 A;  2XP7 A;  2XPB A;  4WJX A;  3TCZ A;  3ARQ A;  3RGC A;  3G6L A;  3KZ7 A;  1FKI A;  4MAV A;  1WB0 A;  4MPK A;  3WD2 A;  2G8Z A;  2RUR A;  1YW5 A;  4WKF A;  2OFN A;  3UQI A;  3KAD A;  4TNS A;  4XAK A;  1LL6 A;  1W1Y A;  1EHN A;  3ARS A;  1JNE A;  5HWB A;  1HJV A;  2O9O A;  3IK8 A;  2MLY A;  3AS2 A;  4DWS A;  3B9D A;  1JND A;  4HBE A;  3WIJ A;  3B7X A;  3UI5 A;  3O5R A;  2XP3 A;  5GQB A;  4PTM A;  1LG1 A;  1C9H A;  2RUQ A;  3O5K A;  4DRH A;  1XRV A;  2N87 A;  3FY1 A;  5B8I C;  1E6R A;  3RM9 A;  2PPP A;  4G50 A;  3CHE A;  4ZPV R;  3PR9 A;  1HJW A;  1F8A B;  1OWQ A;  4DRQ A;  4TX0 A;  1X6N A;  4DWS C;  4MTV A;  1E9L A;  1WAW A;  4MGV A;  4DZ3 A;  1FKS A;  4TW7 A;  4ODN A;  2ZR6 A;  4DRM A;  4Q7N A;  4LGX A;  1FKJ A;  1FKT A;  2JZV A;  1ITX A;  1HKJ A;  2FDM A;  4IQ2 A;  1W26 A;  2L2S A;  4GIV A;  4ML4 A;  2DSW A;  4LAX A;  1H0G A;  4LAW A;  1JNS A;  2XPA A;  4ZS6 A;  1Q1C A;  4O2T A;  3JXV A;  4S3J A;  1L1P A;  4TYO A;  4IQC A;  4DIP A;  4JFK A;  2D9F A;  5GPG A;  1OGB A;  1J4R A;  4JFI A;  3NI6 A;  1JNT A;  2DG3 A;  2A3E A;  1TCO C;  4ODL A;  1WNO A;  2DT2 A;  4KR0 B;  3WD4 A;  2Y78 A;  3AS1 A;  3UF8 A;  4DRK A;  3H9R B;  2MLZ A;  1HKI A;  3MDY B;  1BKF A;  3OOB A;  2KI3 A;  3O5E A;  4ODM A;  2F21 A;  2LGO A;  3ARO A;  4ODR A;  1ZU8 A;  1HKM A;  1HXV A;  1OGG A;  2ZQU A;  3ARZ A;  1XHG A;  3KAG A;  3AS0 A;  1W1T A;  3G6M A;  3WD0 A;  1W9P A;  2K8I A;  4TW8 A;  1EYM A;  3UQB A;  3FXY A;  3O5O A;  1PIN A;  3PRB A;  2MPH A;  3IHZ A;  4R5E A;  4IPX A;  3QOK A;  3PA7 A;  1EIB A;  2PV2 A;  1TFV A;  4QT2 A;  2WLZ A;  4P8V A;  2XP5 A;  2FKE A;  3I6C A;  1D7I A;  3ARW A;  1FJD A;  3WD3 A;  4MNK A;  1HJX A;  1Q6H A;  4ODQ A;  3O5D A;  4QT3 A;  1HKK A;  1KFW A;  1KT1 A;  2DT3 A;  1B6C A;  3WD1 A;  1FKB A;  5DIV A;  2RQS A;  4Z2K A;  3ARY A;  5HW7 A;  1R9H A;  2LPV A;  2ITK A;  4NSB A;  4QIB A;  5J6E A;  3ARX A;  1PBK A;  2RUC A;  2VCD A;  1ZL1 A;  4W9P A;  2MF9 A;  3UQA A;  4S3K A;  2XP8 A;  4NNR A;  3TDB A;  1NWT A;  4DWS B;  4IT6 A;  3ART A;  2ZR4 A;  4TW6 A;  1D7H A;  3AQU A;  4LAY A;  1LL7 A;  2PPO A;  3EY6 A;  4FAP A;  2MLX A;  2WM0 A;  4ODO A;  1D6O A;  2DPE A;  1FKL A;  3UI6 A;  4DRO A;  1RD6 A;  1JVW A;  2DSZ A;  1BL4 A;  3JYM A;  1K9T A;  3B9A A;  1ROU A;  5DIU A;  1FKR A;  1O6I A;  4DRN A;  3KAH A;  1D2K A;  2M08 A;  4URI A;  1Q6I A;  3O5M A;  2DSV A;  4JYS A;  4NZC A;  1ZBK A;  2FAP A;  3O5Q A;  3ALG A;  3WQV A;  4Z2I A;  3CZ8 A;  4KQZ A;  1IX5 A;  4HBO A;  3NRK A;  4G2P A;  4GGQ A;  2WLY A;  1J4I A;  4J4N A;  2RUD A;  1E6Z A;  1FKK A;  1F40 A;  1VF8 A;  3CHF A;  2A3C A;  3IKG A;  3KAB A;  2UZ5 A;  1FAP A;  2DG4 A;  1W1P A;  3CHD A;  2A3A A;  4DT4 A;  3ALF A;  3W4R A;  1ZB5 A;  2YBU A;  4U85 A;  4U84 A;  3JYJ A;  2ZQT A;  1ZK6 A;  4HAR A;  2IF4 A;  5DIT A;  2QF8 A;  3ODK A;  4WKA A;  4N19 A;  2KGJ A;  3PRA A;  2LJ4 A;  2RSE A;  4JFJ A;  4ODP A;  3GPK A;  3O5G A;  1NWS A;  3LUO A;  4QZV B;  1UR9 A;  2LKN A;  5HW6 A;  3KAC A;  5DF0 A;  4DRI A;  2PBC A;  1FFQ A;  5HBF A;  3WL0 A;  4U86 A;  5BXJ A;  2ZR5 A;  5HUA A;  1EDQ A;  3AS3 A;  3RM8 A;  1ZBV A;  1N1A A;  1W9V A;  1M5Y A;  5DEZ A;  2AWG A;  1NMW A;  2M2A A;  2ZQS A;  1FKD A;  3B9E A;  1J6Y A;  3ARR A;  1NSG A;  1EQ3 A;  1QPF A;  2Q5A A;  1LG2 A;  3VAW A;  3UI4 A;  3CGM A;  2G41 A;  2PPN A;  3RFW A;  4ITZ A;  4W9Q A;  2PV1 A;  4Z2J A;  3O5I A;  5JH8 A;  1D7J A;  1ZBC A;  3ARV A;  4L3N A;  3BXW A;  4JFL A;  4WKH A;  4ODK A;  5D75 A;  4P8U A;  1UR8 A;  1FD9 A;  5HWC A;  3KCE A;  1SR0 A;  1NH6 A;  5HT1 A;  1LQ0 A;  1NWU A;  1YAT A;  4R0X A;  2O92 A;  1LL4 A;  3CGN A;  4IT4 A;  4C02 B;  3ARU A;  2KFW A;  4ZPT R;  2MNT A;  1GUV A;  1ROT A;  3O5J A;  1E15 A;  5GPR A;  2YBT A;  2XP6 A;  1KT0 A;  4Z2L A;  2A3B A;  4J4O A;  2DSU A;  1H0I A;  2AOS A;  2PV3 A;  3RM4 A;  2OLH A;  4MNJ A;  2ESC A;  2XP4 A;  3CHC A;  5HW8 A;  4MNM A;  4BF8 A;  3WQW A;  2WK2 A;  4WK9 A;  2ZQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...