4N19A

Structural basis of conformational transitions in the active site and 80 s loop in the fk506 binding protein fkbp12
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTVVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPPIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of conformational transitions in the active site and 80's loop in the FK506-binding protein FKBP12.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1A
total genus 27
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4n19A00
3O5IA 3CGMA 4G2PA 2PV2A 3O5FA 4ODPA 4TX0A 4ODQA 2M1IA 1BL4A 1BKFA 1QZ2A 2RSEA 2ZQVA 2PV3A 5D75A 2KI3A 3WH0A 5DITA 2KO7A 3O5KA 5HT1A 1ROTA 1ZK6A 2XP8A 4DRNA 5HWBA 1T11A 1QPLA 1KT0A 4ODNA 4BF8A 3UQAA 2RUDA 2K8IA 4TW7A 4U85A 1J4RA 1FKBA 4IQ2A 2ZQUA 3UQIA 2LPVA 1PINA 2D9FA 4U84A 2KFWA 2Y78A 4TYOA 3TDBA 3UI6A 4DRIA 4NNRA 5HTGA 1FKGA 5B8IC 4ODOA 2AWGA 2L2SA 3EY6A 1FKRA 2MNTA 3MDYB 2F2DA 3B7XA 3KACA 1YATA 4C02B 3CGNA 2XP5A 1Y0OA 3I6CA 3KZ7A 2LGOA 4DRKA 4ITZA 2ZR4A 4N19A 3JXVA 4QIBA 4DZ3A 4DZ2A 1F8AB 2IF4A 2MLXA 1B6CA 2XP7A 2ZQTA 4ODLA 1Q1CA 4TW8A 3O5MA 5HWCA 2PV1A 2M08A 2FKEA 3FAPA 4DRPA 3UQBA 2ZR6A 4GIVA 4ODKA 4J4OA 2LKNA 3NRKA 1KT1A 3H9RB 3PRDA 4MGVA 3TC5A 4JFLA 4FN2A 1HXVA 3NTPA 2N87A 1FKDA 2XP3A 2DG9A 3O5LA 4JFIA 1F40A 4DIPA 3LUOA 4JFKA 3O5EA 1FKTA 4QT2A 3RGCA 2RUQA 3PA7A 3ODKA 3IKGA 1NMVA 2ZR5A 3KABA 1P5QA 4W9QA 3KADA 1U79A 3KAIA 2JZVA 1R9HA 4LAVA 4DROA 4G50A 1EQ3A 1W26A 2PPPA 1TCOC 2VN1A 3O5GA 2XP4A 4JFJA 4W9OA 3PRBA 1J6YA 1FJDA 4ODRA 5HUAA 2RURA 3UI4A 4DRMA 5I98A 5J6EA 4DT4A 1FKIA 1J4HA 4IQCA 1PBKA 2KE0A 4DRQA 5HW7A 3JYJA 3KAFA 5GPGA 4IPXA 1FKSA 3GPKA 1D6OA 1Q6IA 2MF9A 1NMWA 2XPAA 2ZQSA 4LAWA 2PPNA 3RFWA 4DH0A 2KR7A 4LAYA 4QT3A 5BXJA 5DIVA 4U86A 2PBCA 1ZCNA 1FKFA 3UI5A 2OFNA 3KAHA 3KCEA 1N1AA 1M5YA 4R0XA 4TNSA 5HW6A 1FKHA 2LJ4A 2RQSA 1A7XA 2ITKA 3O5PA 4FAPA 1JNSA 1JVWA 2XPBA 1D7IA 1Q6HA 2VCDA 2MLYA 2XP9A 2XP6A 4ODMA 4DRHA 1FAPA 4LAXA 2UZ5A 1FKLA 1L1PA 1EYMA 3O5JA 3IHZA 1FKJA 3IKDA 2PPOA 3TCZA 2RUCA 1D7HA 4O2TA 3UF8A 2Q5AA 1NSGA 2F21A 3O5QA 4JFMA 1D7JA 4MSPA 1J4IA 3IK8A 3VAWA 1ROUA 4GGQA 2F4EA 4TW6A 2KGJA 5HW8A 2DG4A 1C9HA 1JNTA 3O5RA 5DIUA 3KAGA 2DG3A 1FD9A 3JYMA 3OOBA 3O5OA 1FKKA 5HKGA 1Q6UA 3NI6A 3O5DA 1QPFA 2M2AA 2MLZA 4W9PA 1YW5A 4DRJA 2FAPA 2MPHA 4JYSA 4J4NA
chains in the Genus database with same CATH superfamily
3O5IA 2PV2A 1SYTA 1BL4A 1D2KA 1EHNA 3AS2A 3WH0A 3RM4A 1JNDA 1ROTA 5GPRA 5HT1A 5HWBA 3B9AA 1KT0A 4ODNA 4WKFA 2IUZA 3ARTA 3UQIA 4IQ2A 2LPVA 4P8XA 3WL0A 3UI6A 1W1YA 2L2SA 4P8VA 3KACA 4C02B 4ITZA 1OGGA 4DZ2A 4DZ3A 2IF4A 2MLXA 2FDMA 2ESCA 3FAPA 1LG1A 1O6IA 4MGVA 4NSBA 1ZBVA 2O92A 4ZS6A 1FKDA 2DG9A 3O5LA 3WD3A 2O9OA 1GUVA 1FKTA 4Z2JA 3G6LA 1NH6A 3PA7A 3CHEA 3ODKA 3IKGA 4WKAA 1NMVA 1LJYA 2A3BA 1U79A 1R9HA 1TCOC 1OWQA 2DT3A 4W9OA 4JFJA 4ODRA 3ARXA 5J6EA 4Z2GA 4DT4A 1FKIA 4IQCA 1D6OA 2XPAA 5I98A 1WAWA 2KR7A 4QT3A 5DIVA 1SR0A 1N1AA 5HW6A 1FKHA 3PR9A 4P8UA 2DSUA 2XP9A 4L72B 2MLYA 2XP6A 3CZ8A 4DRHA 1E9LA 4DWSD 1ZBKA 4Z2LA 3IHZA 2PPOA 2RUCA 3RMEA 3O5QA 4MSPA 3IK8A 3FXYA 1GOIA 4GGQA 1LL4A 2F4EA 2KGJA 5HW8A 1NWTA 1JNEA 3O5RA 1TFVA 1W9UA 2DG3A 2DSZA 3OOBA 5DEZA 1Q6UA 2QF8A 3O5DA 4HARA 3G6MA 1GRJA 4WKHA 4Q22A 5JH8A 4ODQA 1H0GA 5D75A 1ZK6A 1T11A 3UQAA 1VF8A 4TW7A 4U85A 1PINA 4U84A 2KFWA 2Y78A 4TYOA 4Z2IA 5HTGA 4NNRA 1FKGA 4ODOA 3MDYB 1HJXA 4UDMA 3B7XA 1YATA 1ZB5A 3KZ7A 2LGOA 4DRKA 4MNMA 4QIBA 2YBTA 1B6CA 4ODLA 4WJXA 1XRVA 3O5MA 3UQBA 4ODKA 3TC5A 3PRDA 2N87A 1E44A 2PN0A 4JFKA 3OA5A 2RUQA 1P5QA 4WIWA 2DT2A 3KADA 2JZVA 4G50A 1W26A 2XP4A 3ARZA 3PRBA 1FJDA 3UI4A 4L3NA 1EIBA 5GQBA 1J4HA 1PBKA 4DRQA 1ITXA 4MPKA 4IPXA 3RFWA 1NMWA 4LAWA 3B9EA 3ARVA 3KAHA 1M5YA 4FAPA 2LJ4A 2DSVA 4NZCA 1Q6HA 2DSWA 4ODMA 2EULA 4MTVA 1EYMA 3ARQA 4S3KA 3O5JA 3UF8A 4O2TA 4JFMA 3CHCA 1KFWA 1D7JA 1J4IA 3VAWA 1ROUA 3WQWA 1HKJA 1C9HA 1JNTA 3ARSA 4URIA 3O5OA 1QPFA 2M2AA 2A3AA 4W9PA 4R5EA 4JYSA 4J4NA 1E6NA 3WD4A 4ODPA 4TX0A 1BKFA 2OLHA 1QZ2A 2RSEA 4IT4A 2PV3A 5DO2A 5DITA 2KO7A 3O5KA 4DRNA 1FFRA 1QPLA 2WLYA 3FY1A 2RUDA 1FKBA 2ZQUA 3TDBA 3ARRA 2AWGA 1FKRA 2MNTA 1E6RA 1Y0OA 3I6CA 4WK9A 1EDQA 2WK2A 3ARWA 2A3EA 2P4VA 3WKZA 1GPFA 2ZR4A 4MNLA 4XAKA 2XP7A 5HWCA 4TW8A 2PV1A 2M08A 4S3JA 2ZR6A 2LKNA 1KT1A 3H9RB 3ARPA 4JFLA 1HXVA 1K9TA 5HBFA 3NTPA 3AROA 1XHGA 3AQUA 4QZVB 2XP3A 1NWUA 1LL7A 2F23A 1UR9A 4JFIA 1F40A 4DIPA 3RGCA 3GTYX 3CHDA 2ZR5A 1NWRA 3KAIA 1JCHB 4LAVA 4DROA 2VN1A 3O5GA 4MNJA 3PRAA 4DRMA 1E6PA 3B9DA 3WQVA 4PTMA 2KE0A 4KQZA 4ML4A 3JYJA 3KAFA 1FKSA 1ZBWA 2MF9A 2PPNA 5BXJA 1LG2A 1X6NA 2PBCA 1HKKA 3WD1A 2OFNA 3KCEA 2ITKA 2YBUA 1JNSA 2AOSA 3ARYA 1JVWA 2XPBA 3WL1A 2VCDA 2UZ5A 1FKLA 1UR8A 4ZPWR 4ZPVR 1L1PA 3IKDA 3TCZA 1D7HA 4AY1A 2Q5AA 1NSGA 2F21A 1W9PA 4DWSB 2DT1A 2DG4A 3QOKA 4DWSA 3JYMA 2DT0A 3NI6A 1YW5A 2FAPA 1LQ0A 4MNKA 3CGMA 4G2PA 4KR0B 1H0IA 3O5FA 4W5UA 2M1IA 2ZQVA 2KI3A 2B31A 2G8ZA 2XP8A 3CH9A 2G41A 4Z2HA 4BF8A 1NWSA 4IT6A 1X6LA 2K8IA 3ALGA 1J4RA 3B8SA 2D9FA 3BXWA 1IX5A 3EIPA 4DRIA 1HJVA 5B8IC 3EY6A 2F2DA 4MAVA 3CGNA 2XP5A 1W1VA 5DF0A 1CTNA 2PI6A 4N19A 2ETNA 3JXVA 1F8AB 2ZQTA 1Q1CA 2FKEA 4DRPA 4GIVA 1HKIA 4J4OA 3NRKA 4FN2A 3WD2A 1HKMA 3W4RA 3BMBA 4HBEA 3LUOA 3O5EA 1E6ZA 4QT2A 4LGXA 3RM9A 1W1PA 3KABA 1OGBA 4W9QA 1WNOA 1RD6A 3AS3A 1EQ3A 2PPPA 1J6YA 1FFQA 3WIJA 4HBOA 4Z2KA 5HUAA 1WB0A 2RURA 3WD0A 2B5UB 3RM8A 3AS0A 4Q7NA 1E15A 4ZPTR 5GPGA 5HW7A 3GPKA 3ARUA 1Q6IA 1LL6A 2ZQSA 4DH0A 4LAYA 3ALFA 4U86A 1ZCNA 1FKFA 3UI5A 4TNSA 4R0XA 2RQSA 1W1TA 1A7XA 3O5PA 3CHFA 1D7IA 1HJWA 4DWSC 1FAPA 3GU0A 4LAXA 1ZU8A 1FKJA 2DPEA 1ZL1A 4P8WA 2WM0A 1ZBCA 2A3CA 4TW6A 1W9VA 5DIUA 3KAGA 2WLZA 1FD9A 3AS1A 1FKKA 5HKGA 2MLZA 4DRJA 2MPHA
chains in the Genus database with same CATH topology
3O5IA 2PV2A 1SYTA 1BL4A 1D2KA 1EHNA 3AS2A 3WH0A 3RM4A 1JNDA 1ROTA 5GPRA 5HT1A 5HWBA 3B9AA 1KT0A 4ODNA 4WKFA 2IUZA 3ARTA 3UQIA 4IQ2A 2LPVA 4P8XA 3WL0A 3UI6A 1W1YA 2L2SA 4P8VA 3KACA 4C02B 4ITZA 1OGGA 4DZ2A 4DZ3A 2IF4A 2MLXA 2FDMA 2ESCA 3FAPA 1LG1A 1O6IA 4MGVA 4NSBA 1ZBVA 2O92A 4ZS6A 1FKDA 2DG9A 3O5LA 3WD3A 2O9OA 1GUVA 1FKTA 4Z2JA 3G6LA 1NH6A 3PA7A 3CHEA 3ODKA 3IKGA 4WKAA 1NMVA 1LJYA 2A3BA 1U79A 1R9HA 1TCOC 1OWQA 2DT3A 4W9OA 4JFJA 4ODRA 3ARXA 5J6EA 4Z2GA 4DT4A 1FKIA 4IQCA 1D6OA 2XPAA 5I98A 1WAWA 2KR7A 4QT3A 5DIVA 1SR0A 1N1AA 5HW6A 1FKHA 3PR9A 4P8UA 2DSUA 2XP9A 4L72B 2MLYA 2XP6A 3CZ8A 4DRHA 1E9LA 4DWSD 1ZBKA 4Z2LA 3IHZA 2PPOA 2RUCA 3RMEA 3O5QA 4MSPA 3IK8A 3FXYA 1GOIA 4GGQA 1LL4A 2F4EA 2KGJA 5HW8A 1NWTA 1JNEA 3O5RA 1TFVA 1W9UA 2DG3A 2DSZA 3OOBA 5DEZA 1Q6UA 2QF8A 3O5DA 4HARA 3G6MA 4WKHA 4Q22A 5JH8A 4ODQA 1H0GA 5D75A 1ZK6A 1T11A 3UQAA 1VF8A 4TW7A 4U85A 1PINA 4U84A 2KFWA 2Y78A 4TYOA 4Z2IA 5HTGA 4NNRA 1FKGA 4ODOA 3MDYB 1HJXA 3B7XA 1YATA 1ZB5A 3KZ7A 2LGOA 4DRKA 4MNMA 4QIBA 2YBTA 1B6CA 4ODLA 4WJXA 1XRVA 3O5MA 3UQBA 4ODKA 3TC5A 3PRDA 2N87A 4JFKA 3OA5A 2RUQA 1P5QA 4WIWA 2DT2A 3KADA 2JZVA 4G50A 1W26A 2XP4A 3ARZA 3PRBA 1FJDA 3UI4A 4L3NA 1EIBA 5GQBA 1J4HA 1PBKA 4DRQA 1ITXA 4MPKA 4IPXA 3RFWA 1NMWA 4LAWA 3B9EA 3ARVA 3KAHA 1M5YA 4FAPA 2LJ4A 2DSVA 4NZCA 1Q6HA 2DSWA 4ODMA 4MTVA 1EYMA 3ARQA 4S3KA 3O5JA 3UF8A 4O2TA 4JFMA 3CHCA 1KFWA 1D7JA 1J4IA 3VAWA 1ROUA 3WQWA 1HKJA 1C9HA 1JNTA 3ARSA 4URIA 3O5OA 1QPFA 2M2AA 2A3AA 4W9PA 4R5EA 4JYSA 4J4NA 1E6NA 3WD4A 4ODPA 4TX0A 1BKFA 2OLHA 1QZ2A 2RSEA 4IT4A 2PV3A 5DO2A 5DITA 2KO7A 3O5KA 4DRNA 1FFRA 1QPLA 2WLYA 3FY1A 2RUDA 1FKBA 2ZQUA 3TDBA 3ARRA 2AWGA 1FKRA 2MNTA 1E6RA 1Y0OA 3I6CA 4WK9A 1EDQA 2WK2A 3ARWA 2A3EA 3WKZA 1GPFA 2ZR4A 4MNLA 4XAKA 2XP7A 5HWCA 4TW8A 2PV1A 2M08A 4S3JA 2ZR6A 2LKNA 1KT1A 3H9RB 3ARPA 4JFLA 1HXVA 1K9TA 5HBFA 3NTPA 3AROA 1XHGA 3AQUA 4QZVB 2XP3A 1NWUA 1LL7A 1UR9A 4JFIA 1F40A 4DIPA 3RGCA 3CHDA 2ZR5A 1NWRA 3KAIA 4LAVA 4DROA 2VN1A 3O5GA 4MNJA 3PRAA 4DRMA 1E6PA 3B9DA 3WQVA 4PTMA 2KE0A 4KQZA 4ML4A 3JYJA 3KAFA 1FKSA 1ZBWA 2MF9A 2PPNA 5BXJA 1LG2A 1X6NA 2PBCA 1HKKA 3WD1A 2OFNA 3KCEA 2ITKA 2YBUA 1JNSA 2AOSA 3ARYA 1JVWA 2XPBA 3WL1A 2VCDA 2UZ5A 1FKLA 1UR8A 4ZPWR 4ZPVR 1L1PA 3IKDA 3TCZA 1D7HA 4AY1A 2Q5AA 1NSGA 2F21A 1W9PA 4DWSB 2DT1A 2DG4A 3QOKA 4DWSA 3JYMA 2DT0A 3NI6A 1YW5A 2FAPA 1LQ0A 4MNKA 3CGMA 4G2PA 4KR0B 1H0IA 3O5FA 4W5UA 2M1IA 2ZQVA 2KI3A 2B31A 2G8ZA 2XP8A 3CH9A 2G41A 4Z2HA 4BF8A 1NWSA 4IT6A 1X6LA 2K8IA 3ALGA 1J4RA 3B8SA 2D9FA 3BXWA 1IX5A 4DRIA 1HJVA 5B8IC 3EY6A 2F2DA 4MAVA 3CGNA 2XP5A 1W1VA 5DF0A 1CTNA 2PI6A 4N19A 3JXVA 1F8AB 2ZQTA 1Q1CA 2FKEA 4DRPA 4GIVA 1HKIA 4J4OA 3NRKA 4FN2A 3WD2A 1HKMA 3W4RA 4HBEA 3LUOA 3O5EA 1E6ZA 4QT2A 4LGXA 3RM9A 1W1PA 3KABA 1OGBA 4W9QA 1WNOA 1RD6A 3AS3A 1EQ3A 2PPPA 1J6YA 1FFQA 3WIJA 4HBOA 4Z2KA 5HUAA 1WB0A 2RURA 3WD0A 3RM8A 3AS0A 4Q7NA 1E15A 4ZPTR 5GPGA 5HW7A 3GPKA 3ARUA 1Q6IA 1LL6A 2ZQSA 4DH0A 4LAYA 3ALFA 4U86A 1ZCNA 1FKFA 3UI5A 4TNSA 4R0XA 2RQSA 1W1TA 1A7XA 3O5PA 3CHFA 1D7IA 1HJWA 4DWSC 1FAPA 4LAXA 1ZU8A 1FKJA 2DPEA 1ZL1A 4P8WA 2WM0A 1ZBCA 2A3CA 4TW6A 1W9VA 5DIUA 3KAGA 2WLZA 1FD9A 3AS1A 1FKKA 5HKGA 2MLZA 4DRJA 2MPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5I A;  3CGM A;  4G2P A;  2PV2 A;  3O5F A;  4ODP A;  4TX0 A;  4ODQ A;  2M1I A;  1BL4 A;  1BKF A;  1QZ2 A;  2RSE A;  2ZQV A;  2PV3 A;  5D75 A;  2KI3 A;  3WH0 A;  5DIT A;  2KO7 A;  3O5K A;  5HT1 A;  1ROT A;  1ZK6 A;  2XP8 A;  4DRN A;  5HWB A;  1T11 A;  1QPL A;  1KT0 A;  4ODN A;  4BF8 A;  3UQA A;  2RUD A;  2K8I A;  4TW7 A;  4U85 A;  1J4R A;  1FKB A;  4IQ2 A;  2ZQU A;  3UQI A;  2LPV A;  1PIN A;  2D9F A;  4U84 A;  2KFW A;  2Y78 A;  4TYO A;  3TDB A;  3UI6 A;  4DRI A;  4NNR A;  5HTG A;  1FKG A;  5B8I C;  4ODO A;  2AWG A;  2L2S A;  3EY6 A;  1FKR A;  2MNT A;  3MDY B;  2F2D A;  3B7X A;  3KAC A;  1YAT A;  4C02 B;  3CGN A;  2XP5 A;  1Y0O A;  3I6C A;  3KZ7 A;  2LGO A;  4DRK A;  4ITZ A;  2ZR4 A;  4N19 A;  3JXV A;  4QIB A;  4DZ3 A;  4DZ2 A;  1F8A B;  2IF4 A;  2MLX A;  1B6C A;  2XP7 A;  2ZQT A;  4ODL A;  1Q1C A;  4TW8 A;  3O5M A;  5HWC A;  2PV1 A;  2M08 A;  2FKE A;  3FAP A;  4DRP A;  3UQB A;  2ZR6 A;  4GIV A;  4ODK A;  4J4O A;  2LKN A;  3NRK A;  1KT1 A;  3H9R B;  3PRD A;  4MGV A;  3TC5 A;  4JFL A;  4FN2 A;  1HXV A;  3NTP A;  2N87 A;  1FKD A;  2XP3 A;  2DG9 A;  3O5L A;  4JFI A;  1F40 A;  4DIP A;  3LUO A;  4JFK A;  3O5E A;  1FKT A;  4QT2 A;  3RGC A;  2RUQ A;  3PA7 A;  3ODK A;  3IKG A;  1NMV A;  2ZR5 A;  3KAB A;  1P5Q A;  4W9Q A;  3KAD A;  1U79 A;  3KAI A;  2JZV A;  1R9H A;  4LAV A;  4DRO A;  4G50 A;  1EQ3 A;  1W26 A;  2PPP A;  1TCO C;  2VN1 A;  3O5G A;  2XP4 A;  4JFJ A;  4W9O A;  3PRB A;  1J6Y A;  1FJD A;  4ODR A;  5HUA A;  2RUR A;  3UI4 A;  4DRM A;  5I98 A;  5J6E A;  4DT4 A;  1FKI A;  1J4H A;  4IQC A;  1PBK A;  2KE0 A;  4DRQ A;  5HW7 A;  3JYJ A;  3KAF A;  5GPG A;  4IPX A;  1FKS A;  3GPK A;  1D6O A;  1Q6I A;  2MF9 A;  1NMW A;  2XPA A;  2ZQS A;  4LAW A;  2PPN A;  3RFW A;  4DH0 A;  2KR7 A;  4LAY A;  4QT3 A;  5BXJ A;  5DIV A;  4U86 A;  2PBC A;  1ZCN A;  1FKF A;  3UI5 A;  2OFN A;  3KAH A;  3KCE A;  1N1A A;  1M5Y A;  4R0X A;  4TNS A;  5HW6 A;  1FKH A;  2LJ4 A;  2RQS A;  1A7X A;  2ITK A;  3O5P A;  4FAP A;  1JNS A;  1JVW A;  2XPB A;  1D7I A;  1Q6H A;  2VCD A;  2MLY A;  2XP9 A;  2XP6 A;  4ODM A;  4DRH A;  1FAP A;  4LAX A;  2UZ5 A;  1FKL A;  1L1P A;  1EYM A;  3O5J A;  3IHZ A;  1FKJ A;  3IKD A;  2PPO A;  3TCZ A;  2RUC A;  1D7H A;  4O2T A;  3UF8 A;  2Q5A A;  1NSG A;  2F21 A;  3O5Q A;  4JFM A;  1D7J A;  4MSP A;  1J4I A;  3IK8 A;  3VAW A;  1ROU A;  4GGQ A;  2F4E A;  4TW6 A;  2KGJ A;  5HW8 A;  2DG4 A;  1C9H A;  1JNT A;  3O5R A;  5DIU A;  3KAG A;  2DG3 A;  1FD9 A;  3JYM A;  3OOB A;  3O5O A;  1FKK A;  5HKG A;  1Q6U A;  3NI6 A;  3O5D A;  1QPF A;  2M2A A;  2MLZ A;  4W9P A;  1YW5 A;  4DRJ A;  2FAP A;  2MPH A;  4JYS A;  4J4N A; 
#chains in the Genus database with same CATH topology
 3O5I A;  2PV2 A;  1SYT A;  1BL4 A;  1D2K A;  1EHN A;  3AS2 A;  3WH0 A;  3RM4 A;  1JND A;  1ROT A;  5GPR A;  5HT1 A;  5HWB A;  3B9A A;  1KT0 A;  4ODN A;  4WKF A;  2IUZ A;  3ART A;  3UQI A;  4IQ2 A;  2LPV A;  4P8X A;  3WL0 A;  3UI6 A;  1W1Y A;  2L2S A;  4P8V A;  3KAC A;  4C02 B;  4ITZ A;  1OGG A;  4DZ2 A;  4DZ3 A;  2IF4 A;  2MLX A;  2FDM A;  2ESC A;  3FAP A;  1LG1 A;  1O6I A;  4MGV A;  4NSB A;  1ZBV A;  2O92 A;  4ZS6 A;  1FKD A;  2DG9 A;  3O5L A;  3WD3 A;  2O9O A;  1GUV A;  1FKT A;  4Z2J A;  3G6L A;  1NH6 A;  3PA7 A;  3CHE A;  3ODK A;  3IKG A;  4WKA A;  1NMV A;  1LJY A;  2A3B A;  1U79 A;  1R9H A;  1TCO C;  1OWQ A;  2DT3 A;  4W9O A;  4JFJ A;  4ODR A;  3ARX A;  5J6E A;  4Z2G A;  4DT4 A;  1FKI A;  4IQC A;  1D6O A;  2XPA A;  5I98 A;  1WAW A;  2KR7 A;  4QT3 A;  5DIV A;  1SR0 A;  1N1A A;  5HW6 A;  1FKH A;  3PR9 A;  4P8U A;  2DSU A;  2XP9 A;  4L72 B;  2MLY A;  2XP6 A;  3CZ8 A;  4DRH A;  1E9L A;  4DWS D;  1ZBK A;  4Z2L A;  3IHZ A;  2PPO A;  2RUC A;  3RME A;  3O5Q A;  4MSP A;  3IK8 A;  3FXY A;  1GOI A;  4GGQ A;  1LL4 A;  2F4E A;  2KGJ A;  5HW8 A;  1NWT A;  1JNE A;  3O5R A;  1TFV A;  1W9U A;  2DG3 A;  2DSZ A;  3OOB A;  5DEZ A;  1Q6U A;  2QF8 A;  3O5D A;  4HAR A;  3G6M A;  1GRJ A;  4WKH A;  4Q22 A;  5JH8 A;  4ODQ A;  1H0G A;  5D75 A;  1ZK6 A;  1T11 A;  3UQA A;  1VF8 A;  4TW7 A;  4U85 A;  1PIN A;  4U84 A;  2KFW A;  2Y78 A;  4TYO A;  4Z2I A;  5HTG A;  4NNR A;  1FKG A;  4ODO A;  3MDY B;  1HJX A;  4UDM A;  3B7X A;  1YAT A;  1ZB5 A;  3KZ7 A;  2LGO A;  4DRK A;  4MNM A;  4QIB A;  2YBT A;  1B6C A;  4ODL A;  4WJX A;  1XRV A;  3O5M A;  3UQB A;  4ODK A;  3TC5 A;  3PRD A;  2N87 A;  1E44 A;  2PN0 A;  4JFK A;  3OA5 A;  2RUQ A;  1P5Q A;  4WIW A;  2DT2 A;  3KAD A;  2JZV A;  4G50 A;  1W26 A;  2XP4 A;  3ARZ A;  3PRB A;  1FJD A;  3UI4 A;  4L3N A;  1EIB A;  5GQB A;  1J4H A;  1PBK A;  4DRQ A;  1ITX A;  4MPK A;  4IPX A;  3RFW A;  1NMW A;  4LAW A;  3B9E A;  3ARV A;  3KAH A;  1M5Y A;  4FAP A;  2LJ4 A;  2DSV A;  4NZC A;  1Q6H A;  2DSW A;  4ODM A;  2EUL A;  4MTV A;  1EYM A;  3ARQ A;  4S3K A;  3O5J A;  3UF8 A;  4O2T A;  4JFM A;  3CHC A;  1KFW A;  1D7J A;  1J4I A;  3VAW A;  1ROU A;  3WQW A;  1HKJ A;  1C9H A;  1JNT A;  3ARS A;  4URI A;  3O5O A;  1QPF A;  2M2A A;  2A3A A;  4W9P A;  4R5E A;  4JYS A;  4J4N A;  1E6N A;  3WD4 A;  4ODP A;  4TX0 A;  1BKF A;  2OLH A;  1QZ2 A;  2RSE A;  4IT4 A;  2PV3 A;  5DO2 A;  5DIT A;  2KO7 A;  3O5K A;  4DRN A;  1FFR A;  1QPL A;  2WLY A;  3FY1 A;  2RUD A;  1FKB A;  2ZQU A;  3TDB A;  3ARR A;  2AWG A;  1FKR A;  2MNT A;  1E6R A;  1Y0O A;  3I6C A;  4WK9 A;  1EDQ A;  2WK2 A;  3ARW A;  2A3E A;  2P4V A;  3WKZ A;  1GPF A;  2ZR4 A;  4MNL A;  4XAK A;  2XP7 A;  5HWC A;  4TW8 A;  2PV1 A;  2M08 A;  4S3J A;  2ZR6 A;  2LKN A;  1KT1 A;  3H9R B;  3ARP A;  4JFL A;  1HXV A;  1K9T A;  5HBF A;  3NTP A;  3ARO A;  1XHG A;  3AQU A;  4QZV B;  2XP3 A;  1NWU A;  1LL7 A;  2F23 A;  1UR9 A;  4JFI A;  1F40 A;  4DIP A;  3RGC A;  3GTY X;  3CHD A;  2ZR5 A;  1NWR A;  3KAI A;  1JCH B;  4LAV A;  4DRO A;  2VN1 A;  3O5G A;  4MNJ A;  3PRA A;  4DRM A;  1E6P A;  3B9D A;  3WQV A;  4PTM A;  2KE0 A;  4KQZ A;  4ML4 A;  3JYJ A;  3KAF A;  1FKS A;  1ZBW A;  2MF9 A;  2PPN A;  5BXJ A;  1LG2 A;  1X6N A;  2PBC A;  1HKK A;  3WD1 A;  2OFN A;  3KCE A;  2ITK A;  2YBU A;  1JNS A;  2AOS A;  3ARY A;  1JVW A;  2XPB A;  3WL1 A;  2VCD A;  2UZ5 A;  1FKL A;  1UR8 A;  4ZPW R;  4ZPV R;  1L1P A;  3IKD A;  3TCZ A;  1D7H A;  4AY1 A;  2Q5A A;  1NSG A;  2F21 A;  1W9P A;  4DWS B;  2DT1 A;  2DG4 A;  3QOK A;  4DWS A;  3JYM A;  2DT0 A;  3NI6 A;  1YW5 A;  2FAP A;  1LQ0 A;  4MNK A;  3CGM A;  4G2P A;  4KR0 B;  1H0I A;  3O5F A;  4W5U A;  2M1I A;  2ZQV A;  2KI3 A;  2B31 A;  2G8Z A;  2XP8 A;  3CH9 A;  2G41 A;  4Z2H A;  4BF8 A;  1NWS A;  4IT6 A;  1X6L A;  2K8I A;  3ALG A;  1J4R A;  3B8S A;  2D9F A;  3BXW A;  1IX5 A;  3EIP A;  4DRI A;  1HJV A;  5B8I C;  3EY6 A;  2F2D A;  4MAV A;  3CGN A;  2XP5 A;  1W1V A;  5DF0 A;  1CTN A;  2PI6 A;  4N19 A;  2ETN A;  3JXV A;  1F8A B;  2ZQT A;  1Q1C A;  2FKE A;  4DRP A;  4GIV A;  1HKI A;  4J4O A;  3NRK A;  4FN2 A;  3WD2 A;  1HKM A;  3W4R A;  3BMB A;  4HBE A;  3LUO A;  3O5E A;  1E6Z A;  4QT2 A;  4LGX A;  3RM9 A;  1W1P A;  3KAB A;  1OGB A;  4W9Q A;  1WNO A;  1RD6 A;  3AS3 A;  1EQ3 A;  2PPP A;  1J6Y A;  1FFQ A;  3WIJ A;  4HBO A;  4Z2K A;  5HUA A;  1WB0 A;  2RUR A;  3WD0 A;  2B5U B;  3RM8 A;  3AS0 A;  4Q7N A;  1E15 A;  4ZPT R;  5GPG A;  5HW7 A;  3GPK A;  3ARU A;  1Q6I A;  1LL6 A;  2ZQS A;  4DH0 A;  4LAY A;  3ALF A;  4U86 A;  1ZCN A;  1FKF A;  3UI5 A;  4TNS A;  4R0X A;  2RQS A;  1W1T A;  1A7X A;  3O5P A;  3CHF A;  1D7I A;  1HJW A;  4DWS C;  1FAP A;  3GU0 A;  4LAX A;  1ZU8 A;  1FKJ A;  2DPE A;  1ZL1 A;  4P8W A;  2WM0 A;  1ZBC A;  2A3C A;  4TW6 A;  1W9V A;  5DIU A;  3KAG A;  2WLZ A;  1FD9 A;  3AS1 A;  1FKK A;  5HKG A;  2MLZ A;  4DRJ A;  2MPH A; 
#chains in the Genus database with same CATH homology
 3O5I A;  2PV2 A;  1SYT A;  1BL4 A;  1D2K A;  1EHN A;  3AS2 A;  3WH0 A;  3RM4 A;  1JND A;  1ROT A;  5GPR A;  5HT1 A;  5HWB A;  3B9A A;  1KT0 A;  4ODN A;  4WKF A;  2IUZ A;  3ART A;  3UQI A;  4IQ2 A;  2LPV A;  4P8X A;  3WL0 A;  3UI6 A;  1W1Y A;  2L2S A;  4P8V A;  3KAC A;  4C02 B;  4ITZ A;  1OGG A;  4DZ2 A;  4DZ3 A;  2IF4 A;  2MLX A;  2FDM A;  2ESC A;  3FAP A;  1LG1 A;  1O6I A;  4MGV A;  4NSB A;  1ZBV A;  2O92 A;  4ZS6 A;  1FKD A;  2DG9 A;  3O5L A;  3WD3 A;  2O9O A;  1GUV A;  1FKT A;  4Z2J A;  3G6L A;  1NH6 A;  3PA7 A;  3CHE A;  3ODK A;  3IKG A;  4WKA A;  1NMV A;  1LJY A;  2A3B A;  1U79 A;  1R9H A;  1TCO C;  1OWQ A;  2DT3 A;  4W9O A;  4JFJ A;  4ODR A;  3ARX A;  5J6E A;  4Z2G A;  4DT4 A;  1FKI A;  4IQC A;  1D6O A;  2XPA A;  5I98 A;  1WAW A;  2KR7 A;  4QT3 A;  5DIV A;  1SR0 A;  1N1A A;  5HW6 A;  1FKH A;  3PR9 A;  4P8U A;  2DSU A;  2XP9 A;  4L72 B;  2MLY A;  2XP6 A;  3CZ8 A;  4DRH A;  1E9L A;  4DWS D;  1ZBK A;  4Z2L A;  3IHZ A;  2PPO A;  2RUC A;  3RME A;  3O5Q A;  4MSP A;  3IK8 A;  3FXY A;  1GOI A;  4GGQ A;  1LL4 A;  2F4E A;  2KGJ A;  5HW8 A;  1NWT A;  1JNE A;  3O5R A;  1TFV A;  1W9U A;  2DG3 A;  2DSZ A;  3OOB A;  5DEZ A;  1Q6U A;  2QF8 A;  3O5D A;  4HAR A;  3G6M A;  4WKH A;  4Q22 A;  5JH8 A;  4ODQ A;  1H0G A;  5D75 A;  1ZK6 A;  1T11 A;  3UQA A;  1VF8 A;  4TW7 A;  4U85 A;  1PIN A;  4U84 A;  2KFW A;  2Y78 A;  4TYO A;  4Z2I A;  5HTG A;  4NNR A;  1FKG A;  4ODO A;  3MDY B;  1HJX A;  3B7X A;  1YAT A;  1ZB5 A;  3KZ7 A;  2LGO A;  4DRK A;  4MNM A;  4QIB A;  2YBT A;  1B6C A;  4ODL A;  4WJX A;  1XRV A;  3O5M A;  3UQB A;  4ODK A;  3TC5 A;  3PRD A;  2N87 A;  4JFK A;  3OA5 A;  2RUQ A;  1P5Q A;  4WIW A;  2DT2 A;  3KAD A;  2JZV A;  4G50 A;  1W26 A;  2XP4 A;  3ARZ A;  3PRB A;  1FJD A;  3UI4 A;  4L3N A;  1EIB A;  5GQB A;  1J4H A;  1PBK A;  4DRQ A;  1ITX A;  4MPK A;  4IPX A;  3RFW A;  1NMW A;  4LAW A;  3B9E A;  3ARV A;  3KAH A;  1M5Y A;  4FAP A;  2LJ4 A;  2DSV A;  4NZC A;  1Q6H A;  2DSW A;  4ODM A;  4MTV A;  1EYM A;  3ARQ A;  4S3K A;  3O5J A;  3UF8 A;  4O2T A;  4JFM A;  3CHC A;  1KFW A;  1D7J A;  1J4I A;  3VAW A;  1ROU A;  3WQW A;  1HKJ A;  1C9H A;  1JNT A;  3ARS A;  4URI A;  3O5O A;  1QPF A;  2M2A A;  2A3A A;  4W9P A;  4R5E A;  4JYS A;  4J4N A;  1E6N A;  3WD4 A;  4ODP A;  4TX0 A;  1BKF A;  2OLH A;  1QZ2 A;  2RSE A;  4IT4 A;  2PV3 A;  5DO2 A;  5DIT A;  2KO7 A;  3O5K A;  4DRN A;  1FFR A;  1QPL A;  2WLY A;  3FY1 A;  2RUD A;  1FKB A;  2ZQU A;  3TDB A;  3ARR A;  2AWG A;  1FKR A;  2MNT A;  1E6R A;  1Y0O A;  3I6C A;  4WK9 A;  1EDQ A;  2WK2 A;  3ARW A;  2A3E A;  3WKZ A;  1GPF A;  2ZR4 A;  4MNL A;  4XAK A;  2XP7 A;  5HWC A;  4TW8 A;  2PV1 A;  2M08 A;  4S3J A;  2ZR6 A;  2LKN A;  1KT1 A;  3H9R B;  3ARP A;  4JFL A;  1HXV A;  1K9T A;  5HBF A;  3NTP A;  3ARO A;  1XHG A;  3AQU A;  4QZV B;  2XP3 A;  1NWU A;  1LL7 A;  1UR9 A;  4JFI A;  1F40 A;  4DIP A;  3RGC A;  3CHD A;  2ZR5 A;  1NWR A;  3KAI A;  4LAV A;  4DRO A;  2VN1 A;  3O5G A;  4MNJ A;  3PRA A;  4DRM A;  1E6P A;  3B9D A;  3WQV A;  4PTM A;  2KE0 A;  4KQZ A;  4ML4 A;  3JYJ A;  3KAF A;  1FKS A;  1ZBW A;  2MF9 A;  2PPN A;  5BXJ A;  1LG2 A;  1X6N A;  2PBC A;  1HKK A;  3WD1 A;  2OFN A;  3KCE A;  2ITK A;  2YBU A;  1JNS A;  2AOS A;  3ARY A;  1JVW A;  2XPB A;  3WL1 A;  2VCD A;  2UZ5 A;  1FKL A;  1UR8 A;  4ZPW R;  4ZPV R;  1L1P A;  3IKD A;  3TCZ A;  1D7H A;  4AY1 A;  2Q5A A;  1NSG A;  2F21 A;  1W9P A;  4DWS B;  2DT1 A;  2DG4 A;  3QOK A;  4DWS A;  3JYM A;  2DT0 A;  3NI6 A;  1YW5 A;  2FAP A;  1LQ0 A;  4MNK A;  3CGM A;  4G2P A;  4KR0 B;  1H0I A;  3O5F A;  4W5U A;  2M1I A;  2ZQV A;  2KI3 A;  2B31 A;  2G8Z A;  2XP8 A;  3CH9 A;  2G41 A;  4Z2H A;  4BF8 A;  1NWS A;  4IT6 A;  1X6L A;  2K8I A;  3ALG A;  1J4R A;  3B8S A;  2D9F A;  3BXW A;  1IX5 A;  4DRI A;  1HJV A;  5B8I C;  3EY6 A;  2F2D A;  4MAV A;  3CGN A;  2XP5 A;  1W1V A;  5DF0 A;  1CTN A;  2PI6 A;  4N19 A;  3JXV A;  1F8A B;  2ZQT A;  1Q1C A;  2FKE A;  4DRP A;  4GIV A;  1HKI A;  4J4O A;  3NRK A;  4FN2 A;  3WD2 A;  1HKM A;  3W4R A;  4HBE A;  3LUO A;  3O5E A;  1E6Z A;  4QT2 A;  4LGX A;  3RM9 A;  1W1P A;  3KAB A;  1OGB A;  4W9Q A;  1WNO A;  1RD6 A;  3AS3 A;  1EQ3 A;  2PPP A;  1J6Y A;  1FFQ A;  3WIJ A;  4HBO A;  4Z2K A;  5HUA A;  1WB0 A;  2RUR A;  3WD0 A;  3RM8 A;  3AS0 A;  4Q7N A;  1E15 A;  4ZPT R;  5GPG A;  5HW7 A;  3GPK A;  3ARU A;  1Q6I A;  1LL6 A;  2ZQS A;  4DH0 A;  4LAY A;  3ALF A;  4U86 A;  1ZCN A;  1FKF A;  3UI5 A;  4TNS A;  4R0X A;  2RQS A;  1W1T A;  1A7X A;  3O5P A;  3CHF A;  1D7I A;  1HJW A;  4DWS C;  1FAP A;  4LAX A;  1ZU8 A;  1FKJ A;  2DPE A;  1ZL1 A;  4P8W A;  2WM0 A;  1ZBC A;  2A3C A;  4TW6 A;  1W9V A;  5DIU A;  3KAG A;  2WLZ A;  1FD9 A;  3AS1 A;  1FKK A;  5HKG A;  2MLZ A;  4DRJ A;  2MPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...