4N19A

Structural basis of conformational transitions in the active site and 80 s loop in the fk506 binding protein fkbp12
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTVVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPPIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1A
publication title Structural basis of conformational transitions in the active site and 80's loop in the FK506-binding protein FKBP12.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 27
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4n19A00
4ODKA 2Q5AA 4G2PA 2UZ5A 1A7XA 1FKTA 2IF4A 3WH0A 1D7JA 3IKGA 4W9PA 4TW7A 1R9HA 1Y0OA 2VN1A 3RGCA 2KE0A 2XP4A 3O5OA 4TNSA 4DZ2A 3KACA 2L2SA 3PRDA 3VAWA 4JFLA 3CGMA 5HWCA 1KT0A 4ODNA 3JYMA 4MGVA 1ZCNA 2DG4A 2MLXA 1QPFA 2F4EA 3O5IA 2PPNA 2MF9A 4J4NA 4JFIA 3UI6A 3UI4A 3GPKA 4QT3A 2KR7A 4TW6A 2LGOA 4LAXA 1EYMA 1FKBA 2FKEA 3ODKA 2PPOA 4ODOA 3EY6A 3JXVA 3OOBA 1ROUA 2KO7A 4QT2A 4DRMA 4JFMA 1P5QA 3KAIA 3RFWA 2VCDA 2XP9A 4DZ3A 3IKDA 2DG9A 2XP6A 4G50A 1PINA 1FAPA 2MPHA 4DRPA 5I98A 3IHZA 4DRHA 5J6EA 4FAPA 1U79A 1JVWA 1FKLA 2LKNA 4DRQA 1EQ3A 4ITZA 1ROTA 1Q6HA 3JYJA 1F40A 3KAGA 1FKRA 1QZ2A 2ITKA 3B7XA 4ODLA 5HTGA 1NSGA 4W9OA 4U85A 2LJ4A 4FN2A 1Q6UA 1FJDA 1QPLA 4ODQA 4NNRA 1BL4A 1FKIA 2MLYA 4LAWA 1FKJA 4QIBA 3TC5A 2RSEA 2XP5A 1FKHA 1JNTA 2XP3A 1J4HA 2LPVA 3O5JA 2PPPA 1F8AB 3NI6A 4LAVA 2OFNA 4N19A 5HW7A 1N1AA 1JNSA 1NMVA 4MSPA 4TX0A 3UI5A 2KGJA 4IQ2A 3UQAA 1HXVA 3MDYB 4DRIA 3O5RA 1FKDA 4J4OA 1KT1A 4DH0A 1B6CA 3TCZA 2PBCA 2ZQSA 2ZQTA 2M1IA 2KFWA 3KCEA 3KAFA 4LAYA 1J4RA 2PV1A 2ZR4A 2XP8A 2RQSA 4GIVA 1C9HA 2DG3A 3O5LA 4DRJA 5B8IC 4O2TA 2PV3A 4JFJA 2XP7A 5HW8A 5DITA 2F2DA 4DRKA 1L1PA 1D7HA 2FAPA 1M5YA 3NTPA 3O5QA 3PRBA 1PBKA 2RUQA 4DIPA 5HUAA 2K8IA 3KAHA 1YATA 2Y78A 5DIVA 4GGQA 1Q6IA 1T11A 3LUOA 2ZR6A 3O5GA 1YW5A 3O5DA 1Q1CA 5HWBA 4DRNA 2PV2A 1D7IA 2JZVA 2XPBA 5DIUA 1D6OA 3O5KA 5HW6A 4ODPA 1FKFA 1ZK6A 4C02B 4DT4A 5BXJA 1BKFA 4TYOA 2M2AA 1TCOC 3O5MA 3UF8A 5GPGA 1J6YA 4JYSA 2KI3A 1W26A 4IQCA 4R0XA 4DROA 3I6CA 2N87A 2AWGA 2RUCA 2F21A 2XPAA 2ZQVA 1FKGA 3NRKA 3FAPA 4W9QA 3O5PA 4ODMA 5D75A 3PA7A 4U84A 3O5FA 1FD9A 4BF8A 4IPXA 4JFKA 4TW8A 3UQIA 2ZR5A 3CGNA 2RUDA 3IK8A 3H9RB 3KABA 3KZ7A 2D9FA 2RURA 4ODRA 3TDBA 3UQBA 1NMWA 3O5EA 1J4IA 2M08A 1FKKA 3KADA 5HT1A 1FKSA 5HKGA 4U86A 2MNTA 2MLZA 2ZQUA
chains in the Genus database with same CATH superfamily
1E6RA 2Q5AA 1H0IA 1A7XA 1FKTA 3B9EA 3CHCA 3AROA 2A3BA 3BMBA 4W5UA 1R9HA 3AS1A 3WL1A 4TNSA 2L2SA 3PRDA 3VAWA 4JFLA 3CGMA 2WK2A 4WJXA 3JYMA 3ARPA 2MF9A 3UI6A 2FKEA 2PPOA 3ARRA 1P5QA 1EHNA 2VCDA 1XRVA 3QOKA 2DG9A 1PINA 2QF8A 1JCHB 4DRHA 1IX5A 2DT3A 5J6EA 2WLZA 1OGBA 1FKLA 1EQ3A 1ROTA 1NWSA 1GUVA 1UR9A 1QZ2A 3B7XA 3B9DA 4W9OA 2LJ4A 1HJXA 3WD3A 2RSEA 1X6LA 1JNTA 2PPPA 1ZBWA 4N19A 1NMVA 4TX0A 1NWUA 3UQAA 1TFVA 4Z2IA 1FKDA 1B6CA 2PBCA 2ZQSA 4S3KA 2ESCA 2A3EA 1XHGA 4LAYA 3WD0A 1EDQA 1C9HA 2DSWA 4MNMA 2XP7A 2DSVA 2F2DA 1PBKA 2RUQA 5HUAA 2EULA 2K8IA 3KAHA 1WAWA 1LL4A 3RM8A 3O5GA 4S3JA 1LL7A 2P4VA 1FFQA 1FKFA 4XAKA 3O5MA 3WIJA 4QZVB 3GU0A 4DROA 4IQCA 4R0XA 3I6CA 2RUCA 1SYTA 4Z2JA 2F21A 2XPAA 3NRKA 3FAPA 2YBUA 3WKZA 4BF8A 4JFKA 1W9PA 4IT4A 4ODRA 2RUDA 3IK8A 3H9RB 3KABA 3UQBA 5DF0A 1HJVA 1FKKA 4DRPA 1HKIA 1LL6A 2ZQUA 1W9VA 3BXWA 1W1VA 3W4RA 1NWTA 1NH6A 2VN1A 3RGCA 2KE0A 2XP4A 1E6ZA 3CHEA 1KT0A 2MLXA 2F4EA 2WLYA 1FFRA 3GPKA 1EIBA 4Z2LA 4IT6A 1EYMA 1FKBA 3ODKA 2IUZA 1LG1A 4QT2A 4HBEA 2XP9A 1W1YA 2ETNA 1HKMA 1H0GA 4LGXA 1FAPA 3CHFA 3RM4A 1U79A 1GPFA 4DRQA 4ITZA 3JYJA 2ITKA 3ARSA 4ODLA 5HTGA 3G6LA 2B31A 4FN2A 1Q6UA 2MLYA 4QIBA 3O5JA 1J4HA 2LPVA 3WD1A 2O92A 5HW7A 4MSPA 1GRJA 3FY1A 1ITXA 1WB0A 3ARYA 3O5RA 1ZB5A 3TCZA 2M1IA 4MAVA 4DWSA 3KAFA 3ARVA 4WK9A 2ZR4A 4GIVA 2XP8A 2DG3A 4DRJA 4O2TA 1UR8A 3WQWA 5DITA 5HW8A 4DRKA 1L1PA 1D7HA 2FAPA 2G8ZA 5DO2A 3AS2A 3ALGA 1YATA 1GOIA 2Y78A 5DIVA 1Q6IA 2ZR6A 1YW5A 5HWBA 1Q1CA 5HW6A 1BKFA 1TCOC 1J6YA 5GPGA 4JYSA 2AWGA 3B8SA 1W1TA 4HBOA 4ODMA 2YBTA 3PA7A 4P8XA 4DWSD 4TW8A 2ZR5A 3CGNA 2RURA 4KR0B 1J4IA 2M08A 2WM0A 3KADA 4ZS6A 1FKSA 5HKGA 4U86A 3B9AA 4G2PA 1ZBKA 4WKFA 2IF4A 3G6MA 3WH0A 1D7JA 1SR0A 4W9PA 1Y0OA 1LG2A 4P8UA 3O5OA 4Q22A 3GTYX 3KACA 2PN0A 2F23A 5HWCA 4WIWA 1W9UA 4MGVA 2DG4A 3O5IA 2PPNA 2DPEA 4J4NA 3UI4A 1O6IA 4WKAA 2DSUA 3WD4A 1JNDA 2KR7A 4TW6A 4LAXA 3EY6A 4DRMA 4JFMA 3KAIA 3RFWA 2B5UB 3ARXA 4MNLA 2MPHA 5I98A 3CHDA 4FAPA 4Z2HA 1JVWA 1LQ0A 4KQZA 4AY1A 1Q6HA 3WL0A 1F40A 1FKRA 1NWRA 4U85A 4R5EA 1FJDA 4ODQA 4PTMA 4NNRA 1OWQA 1FKJA 3FXYA 4DWSC 3AQUA 1N1AA 4IQ2A 2PI6A 3MDYB 3PR9A 4DRIA 1HXVA 4J4OA 4DH0A 3AS3A 1K9TA 1HKJA 2ZQTA 3ARZA 3KCEA 1E9LA 5GPRA 1J4RA 4MPKA 2RQSA 3O5LA 4JFJA 1E44A 3NTPA 1M5YA 3CZ8A 3EIPA 4DIPA 4GGQA 1E15A 1T11A 5DIUA 2JZVA 2XPBA 1D6OA 3O5KA 2AOSA 4ODPA 1ZK6A 5BXJA 4TYOA 2M2AA 4L3NA 3UF8A 2KI3A 2N87A 1FKGA 3RM9A 4W9QA 5D75A 1FD9A 2DT0A 3WD2A 1X6NA 1HKKA 2FDMA 4Z2KA 1ZBCA 2MNTA 2MLZA 4ODKA 3AS0A 2UZ5A 3RMEA 4ZPVR 4DWSB 3IKGA 3ARWA 4TW7A 1LJYA 4DZ2A 3CH9A 1JNEA 1E6NA 4ODNA 1ZCNA 1QPFA 1ZL1A 2G41A 4JFIA 4QT3A 4L72B 2LGOA 2DSZA 4ODOA 1E6PA 3ARQA 2O9OA 3JXVA 1ROUA 2KO7A 3OOBA 1W1PA 4P8WA 4DZ3A 3IKDA 2XP6A 4G50A 1ZBVA 3IHZA 1RD6A 3ARUA 5JH8A 2LKNA 4WKHA 3OA5A 3KAGA 4Z2GA 1OGGA 1NSGA 2OLHA 4NSBA 1D2KA 2DT1A 4NZCA 1ZU8A 4Q7NA 4ZPTR 4MTVA 1QPLA 1BL4A 1FKIA 4LAWA 3TC5A 2XP5A 1FKHA 2XP3A 4LAVA 1F8AB 3NI6A 2OFNA 1JNSA 3UI5A 2KGJA 3WQVA 2A3CA 3PRAA 4MNKA 1KT1A 2KFWA 3ALFA 2PV1A 5GQBA 5B8IC 2PV3A 4ML4A 2DT2A 4HARA 3PRBA 1HJWA 3O5QA 3ARTA 1WNOA 3LUOA 3O5DA 4MNJA 1CTNA 1KFWA 4DRNA 2PV2A 1D7IA 4URIA 4ZPWR 2A3AA 4C02B 4DT4A 1W26A 5HBFA 1VF8A 2ZQVA 4UDMA 3O5PA 4U84A 3O5FA 4IPXA 3UQIA 4P8VA 3KZ7A 2D9FA 3TDBA 5DEZA 1NMWA 3O5EA 5HT1A
chains in the Genus database with same CATH topology
1E6RA 2Q5AA 1H0IA 1A7XA 1FKTA 3B9EA 3CHCA 3AROA 2A3BA 4W5UA 1R9HA 3AS1A 3WL1A 4TNSA 2L2SA 3PRDA 3VAWA 4JFLA 3CGMA 2WK2A 4WJXA 3JYMA 3ARPA 2MF9A 3UI6A 2FKEA 2PPOA 3ARRA 1P5QA 1EHNA 2VCDA 1XRVA 3QOKA 2DG9A 1PINA 2QF8A 4DRHA 1IX5A 2DT3A 5J6EA 2WLZA 1OGBA 1FKLA 1EQ3A 1ROTA 1NWSA 1GUVA 1UR9A 1QZ2A 3B7XA 3B9DA 4W9OA 2LJ4A 1HJXA 3WD3A 2RSEA 1X6LA 1JNTA 2PPPA 1ZBWA 4N19A 1NMVA 4TX0A 1NWUA 3UQAA 1TFVA 4Z2IA 1FKDA 1B6CA 2PBCA 2ZQSA 4S3KA 2ESCA 2A3EA 1XHGA 4LAYA 3WD0A 1EDQA 1C9HA 2DSWA 4MNMA 2XP7A 2DSVA 2F2DA 1PBKA 2RUQA 5HUAA 2K8IA 3KAHA 1WAWA 1LL4A 3RM8A 3O5GA 4S3JA 1LL7A 1FFQA 1FKFA 4XAKA 3O5MA 3WIJA 4QZVB 4DROA 4IQCA 4R0XA 3I6CA 2RUCA 1SYTA 4Z2JA 2F21A 2XPAA 3NRKA 3FAPA 2YBUA 3WKZA 4BF8A 4JFKA 1W9PA 4IT4A 4ODRA 2RUDA 3IK8A 3H9RB 3KABA 3UQBA 5DF0A 1HJVA 1FKKA 4DRPA 1HKIA 1LL6A 2ZQUA 1W9VA 3BXWA 1W1VA 3W4RA 1NWTA 1NH6A 2VN1A 3RGCA 2KE0A 2XP4A 1E6ZA 3CHEA 1KT0A 2MLXA 2F4EA 2WLYA 1FFRA 3GPKA 1EIBA 4Z2LA 4IT6A 1EYMA 1FKBA 3ODKA 2IUZA 1LG1A 4QT2A 4HBEA 2XP9A 1W1YA 1HKMA 1H0GA 4LGXA 1FAPA 3CHFA 3RM4A 1U79A 1GPFA 4DRQA 4ITZA 3JYJA 2ITKA 3ARSA 4ODLA 5HTGA 3G6LA 2B31A 4FN2A 1Q6UA 2MLYA 4QIBA 3O5JA 1J4HA 2LPVA 3WD1A 2O92A 5HW7A 4MSPA 3FY1A 1ITXA 1WB0A 3ARYA 3O5RA 1ZB5A 3TCZA 2M1IA 4MAVA 4DWSA 3KAFA 3ARVA 4WK9A 2ZR4A 4GIVA 2XP8A 2DG3A 4DRJA 4O2TA 1UR8A 3WQWA 5DITA 5HW8A 4DRKA 1L1PA 1D7HA 2FAPA 2G8ZA 5DO2A 3AS2A 3ALGA 1YATA 1GOIA 2Y78A 5DIVA 1Q6IA 2ZR6A 1YW5A 5HWBA 1Q1CA 5HW6A 1BKFA 1TCOC 1J6YA 5GPGA 4JYSA 2AWGA 3B8SA 1W1TA 4HBOA 4ODMA 2YBTA 3PA7A 4P8XA 4DWSD 4TW8A 2ZR5A 3CGNA 2RURA 4KR0B 1J4IA 2M08A 2WM0A 3KADA 4ZS6A 1FKSA 5HKGA 4U86A 3B9AA 4G2PA 1ZBKA 4WKFA 2IF4A 3G6MA 3WH0A 1D7JA 1SR0A 4W9PA 1Y0OA 1LG2A 4P8UA 3O5OA 4Q22A 3KACA 5HWCA 4WIWA 1W9UA 4MGVA 2DG4A 3O5IA 2PPNA 2DPEA 4J4NA 3UI4A 1O6IA 4WKAA 2DSUA 3WD4A 1JNDA 2KR7A 4TW6A 4LAXA 3EY6A 4DRMA 4JFMA 3KAIA 3RFWA 3ARXA 4MNLA 2MPHA 5I98A 3CHDA 4FAPA 4Z2HA 1JVWA 1LQ0A 4KQZA 4AY1A 1Q6HA 3WL0A 1F40A 1FKRA 1NWRA 4U85A 4R5EA 1FJDA 4ODQA 4PTMA 4NNRA 1OWQA 1FKJA 3FXYA 4DWSC 3AQUA 1N1AA 4IQ2A 2PI6A 3MDYB 3PR9A 4DRIA 1HXVA 4J4OA 4DH0A 3AS3A 1K9TA 1HKJA 2ZQTA 3ARZA 3KCEA 1E9LA 5GPRA 1J4RA 4MPKA 2RQSA 3O5LA 4JFJA 3NTPA 1M5YA 3CZ8A 4DIPA 4GGQA 1E15A 1T11A 5DIUA 2JZVA 2XPBA 1D6OA 3O5KA 2AOSA 4ODPA 1ZK6A 5BXJA 4TYOA 2M2AA 4L3NA 3UF8A 2KI3A 2N87A 1FKGA 3RM9A 4W9QA 5D75A 1FD9A 2DT0A 3WD2A 1X6NA 1HKKA 2FDMA 4Z2KA 1ZBCA 2MNTA 2MLZA 4ODKA 3AS0A 2UZ5A 3RMEA 4ZPVR 4DWSB 3IKGA 3ARWA 4TW7A 1LJYA 4DZ2A 3CH9A 1JNEA 1E6NA 4ODNA 1ZCNA 1QPFA 1ZL1A 2G41A 4JFIA 4QT3A 4L72B 2LGOA 2DSZA 4ODOA 1E6PA 3ARQA 2O9OA 3JXVA 1ROUA 2KO7A 3OOBA 1W1PA 4P8WA 4DZ3A 3IKDA 2XP6A 4G50A 1ZBVA 3IHZA 1RD6A 3ARUA 5JH8A 2LKNA 4WKHA 3OA5A 3KAGA 4Z2GA 1OGGA 1NSGA 2OLHA 4NSBA 1D2KA 2DT1A 4NZCA 1ZU8A 4Q7NA 4ZPTR 4MTVA 1QPLA 1BL4A 1FKIA 4LAWA 3TC5A 2XP5A 1FKHA 2XP3A 4LAVA 1F8AB 3NI6A 2OFNA 1JNSA 3UI5A 2KGJA 3WQVA 2A3CA 3PRAA 4MNKA 1KT1A 2KFWA 3ALFA 2PV1A 5GQBA 5B8IC 2PV3A 4ML4A 2DT2A 4HARA 3PRBA 1HJWA 3O5QA 3ARTA 1WNOA 3LUOA 3O5DA 4MNJA 1CTNA 1KFWA 4DRNA 2PV2A 1D7IA 4URIA 4ZPWR 2A3AA 4C02B 4DT4A 1W26A 5HBFA 1VF8A 2ZQVA 3O5PA 4U84A 3O5FA 4IPXA 3UQIA 4P8VA 3KZ7A 2D9FA 3TDBA 5DEZA 1NMWA 3O5EA 5HT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ODK A;  2Q5A A;  4G2P A;  2UZ5 A;  1A7X A;  1FKT A;  2IF4 A;  3WH0 A;  1D7J A;  3IKG A;  4W9P A;  4TW7 A;  1R9H A;  1Y0O A;  2VN1 A;  3RGC A;  2KE0 A;  2XP4 A;  3O5O A;  4TNS A;  4DZ2 A;  3KAC A;  2L2S A;  3PRD A;  3VAW A;  4JFL A;  3CGM A;  5HWC A;  1KT0 A;  4ODN A;  3JYM A;  4MGV A;  1ZCN A;  2DG4 A;  2MLX A;  1QPF A;  2F4E A;  3O5I A;  2PPN A;  2MF9 A;  4J4N A;  4JFI A;  3UI6 A;  3UI4 A;  3GPK A;  4QT3 A;  2KR7 A;  4TW6 A;  2LGO A;  4LAX A;  1EYM A;  1FKB A;  2FKE A;  3ODK A;  2PPO A;  4ODO A;  3EY6 A;  3JXV A;  3OOB A;  1ROU A;  2KO7 A;  4QT2 A;  4DRM A;  4JFM A;  1P5Q A;  3KAI A;  3RFW A;  2VCD A;  2XP9 A;  4DZ3 A;  3IKD A;  2DG9 A;  2XP6 A;  4G50 A;  1PIN A;  1FAP A;  2MPH A;  4DRP A;  5I98 A;  3IHZ A;  4DRH A;  5J6E A;  4FAP A;  1U79 A;  1JVW A;  1FKL A;  2LKN A;  4DRQ A;  1EQ3 A;  4ITZ A;  1ROT A;  1Q6H A;  3JYJ A;  1F40 A;  3KAG A;  1FKR A;  1QZ2 A;  2ITK A;  3B7X A;  4ODL A;  5HTG A;  1NSG A;  4W9O A;  4U85 A;  2LJ4 A;  4FN2 A;  1Q6U A;  1FJD A;  1QPL A;  4ODQ A;  4NNR A;  1BL4 A;  1FKI A;  2MLY A;  4LAW A;  1FKJ A;  4QIB A;  3TC5 A;  2RSE A;  2XP5 A;  1FKH A;  1JNT A;  2XP3 A;  1J4H A;  2LPV A;  3O5J A;  2PPP A;  1F8A B;  3NI6 A;  4LAV A;  2OFN A;  4N19 A;  5HW7 A;  1N1A A;  1JNS A;  1NMV A;  4MSP A;  4TX0 A;  3UI5 A;  2KGJ A;  4IQ2 A;  3UQA A;  1HXV A;  3MDY B;  4DRI A;  3O5R A;  1FKD A;  4J4O A;  1KT1 A;  4DH0 A;  1B6C A;  3TCZ A;  2PBC A;  2ZQS A;  2ZQT A;  2M1I A;  2KFW A;  3KCE A;  3KAF A;  4LAY A;  1J4R A;  2PV1 A;  2ZR4 A;  2XP8 A;  2RQS A;  4GIV A;  1C9H A;  2DG3 A;  3O5L A;  4DRJ A;  5B8I C;  4O2T A;  2PV3 A;  4JFJ A;  2XP7 A;  5HW8 A;  5DIT A;  2F2D A;  4DRK A;  1L1P A;  1D7H A;  2FAP A;  1M5Y A;  3NTP A;  3O5Q A;  3PRB A;  1PBK A;  2RUQ A;  4DIP A;  5HUA A;  2K8I A;  3KAH A;  1YAT A;  2Y78 A;  5DIV A;  4GGQ A;  1Q6I A;  1T11 A;  3LUO A;  2ZR6 A;  3O5G A;  1YW5 A;  3O5D A;  1Q1C A;  5HWB A;  4DRN A;  2PV2 A;  1D7I A;  2JZV A;  2XPB A;  5DIU A;  1D6O A;  3O5K A;  5HW6 A;  4ODP A;  1FKF A;  1ZK6 A;  4C02 B;  4DT4 A;  5BXJ A;  1BKF A;  4TYO A;  2M2A A;  1TCO C;  3O5M A;  3UF8 A;  5GPG A;  1J6Y A;  4JYS A;  2KI3 A;  1W26 A;  4IQC A;  4R0X A;  4DRO A;  3I6C A;  2N87 A;  2AWG A;  2RUC A;  2F21 A;  2XPA A;  2ZQV A;  1FKG A;  3NRK A;  3FAP A;  4W9Q A;  3O5P A;  4ODM A;  5D75 A;  3PA7 A;  4U84 A;  3O5F A;  1FD9 A;  4BF8 A;  4IPX A;  4JFK A;  4TW8 A;  3UQI A;  2ZR5 A;  3CGN A;  2RUD A;  3IK8 A;  3H9R B;  3KAB A;  3KZ7 A;  2D9F A;  2RUR A;  4ODR A;  3TDB A;  3UQB A;  1NMW A;  3O5E A;  1J4I A;  2M08 A;  1FKK A;  3KAD A;  5HT1 A;  1FKS A;  5HKG A;  4U86 A;  2MNT A;  2MLZ A;  2ZQU A; 
#chains in the Genus database with same CATH topology
 1E6R A;  2Q5A A;  1H0I A;  1A7X A;  1FKT A;  3B9E A;  3CHC A;  3ARO A;  2A3B A;  3BMB A;  4W5U A;  1R9H A;  3AS1 A;  3WL1 A;  4TNS A;  2L2S A;  3PRD A;  3VAW A;  4JFL A;  3CGM A;  2WK2 A;  4WJX A;  3JYM A;  3ARP A;  2MF9 A;  3UI6 A;  2FKE A;  2PPO A;  3ARR A;  1P5Q A;  1EHN A;  2VCD A;  1XRV A;  3QOK A;  2DG9 A;  1PIN A;  2QF8 A;  1JCH B;  4DRH A;  1IX5 A;  2DT3 A;  5J6E A;  2WLZ A;  1OGB A;  1FKL A;  1EQ3 A;  1ROT A;  1NWS A;  1GUV A;  1UR9 A;  1QZ2 A;  3B7X A;  3B9D A;  4W9O A;  2LJ4 A;  1HJX A;  3WD3 A;  2RSE A;  1X6L A;  1JNT A;  2PPP A;  1ZBW A;  4N19 A;  1NMV A;  4TX0 A;  1NWU A;  3UQA A;  1TFV A;  4Z2I A;  1FKD A;  1B6C A;  2PBC A;  2ZQS A;  4S3K A;  2ESC A;  2A3E A;  1XHG A;  4LAY A;  3WD0 A;  1EDQ A;  1C9H A;  2DSW A;  4MNM A;  2XP7 A;  2DSV A;  2F2D A;  1PBK A;  2RUQ A;  5HUA A;  2EUL A;  2K8I A;  3KAH A;  1WAW A;  1LL4 A;  3RM8 A;  3O5G A;  4S3J A;  1LL7 A;  2P4V A;  1FFQ A;  1FKF A;  4XAK A;  3O5M A;  3WIJ A;  4QZV B;  3GU0 A;  4DRO A;  4IQC A;  4R0X A;  3I6C A;  2RUC A;  1SYT A;  4Z2J A;  2F21 A;  2XPA A;  3NRK A;  3FAP A;  2YBU A;  3WKZ A;  4BF8 A;  4JFK A;  1W9P A;  4IT4 A;  4ODR A;  2RUD A;  3IK8 A;  3H9R B;  3KAB A;  3UQB A;  5DF0 A;  1HJV A;  1FKK A;  4DRP A;  1HKI A;  1LL6 A;  2ZQU A;  1W9V A;  3BXW A;  1W1V A;  3W4R A;  1NWT A;  1NH6 A;  2VN1 A;  3RGC A;  2KE0 A;  2XP4 A;  1E6Z A;  3CHE A;  1KT0 A;  2MLX A;  2F4E A;  2WLY A;  1FFR A;  3GPK A;  1EIB A;  4Z2L A;  4IT6 A;  1EYM A;  1FKB A;  3ODK A;  2IUZ A;  1LG1 A;  4QT2 A;  4HBE A;  2XP9 A;  1W1Y A;  2ETN A;  1HKM A;  1H0G A;  4LGX A;  1FAP A;  3CHF A;  3RM4 A;  1U79 A;  1GPF A;  4DRQ A;  4ITZ A;  3JYJ A;  2ITK A;  3ARS A;  4ODL A;  5HTG A;  3G6L A;  2B31 A;  4FN2 A;  1Q6U A;  2MLY A;  4QIB A;  3O5J A;  1J4H A;  2LPV A;  3WD1 A;  2O92 A;  5HW7 A;  4MSP A;  1GRJ A;  3FY1 A;  1ITX A;  1WB0 A;  3ARY A;  3O5R A;  1ZB5 A;  3TCZ A;  2M1I A;  4MAV A;  4DWS A;  3KAF A;  3ARV A;  4WK9 A;  2ZR4 A;  4GIV A;  2XP8 A;  2DG3 A;  4DRJ A;  4O2T A;  1UR8 A;  3WQW A;  5DIT A;  5HW8 A;  4DRK A;  1L1P A;  1D7H A;  2FAP A;  2G8Z A;  5DO2 A;  3AS2 A;  3ALG A;  1YAT A;  1GOI A;  2Y78 A;  5DIV A;  1Q6I A;  2ZR6 A;  1YW5 A;  5HWB A;  1Q1C A;  5HW6 A;  1BKF A;  1TCO C;  1J6Y A;  5GPG A;  4JYS A;  2AWG A;  3B8S A;  1W1T A;  4HBO A;  4ODM A;  2YBT A;  3PA7 A;  4P8X A;  4DWS D;  4TW8 A;  2ZR5 A;  3CGN A;  2RUR A;  4KR0 B;  1J4I A;  2M08 A;  2WM0 A;  3KAD A;  4ZS6 A;  1FKS A;  5HKG A;  4U86 A;  3B9A A;  4G2P A;  1ZBK A;  4WKF A;  2IF4 A;  3G6M A;  3WH0 A;  1D7J A;  1SR0 A;  4W9P A;  1Y0O A;  1LG2 A;  4P8U A;  3O5O A;  4Q22 A;  3GTY X;  3KAC A;  2PN0 A;  2F23 A;  5HWC A;  4WIW A;  1W9U A;  4MGV A;  2DG4 A;  3O5I A;  2PPN A;  2DPE A;  4J4N A;  3UI4 A;  1O6I A;  4WKA A;  2DSU A;  3WD4 A;  1JND A;  2KR7 A;  4TW6 A;  4LAX A;  3EY6 A;  4DRM A;  4JFM A;  3KAI A;  3RFW A;  2B5U B;  3ARX A;  4MNL A;  2MPH A;  5I98 A;  3CHD A;  4FAP A;  4Z2H A;  1JVW A;  1LQ0 A;  4KQZ A;  4AY1 A;  1Q6H A;  3WL0 A;  1F40 A;  1FKR A;  1NWR A;  4U85 A;  4R5E A;  1FJD A;  4ODQ A;  4PTM A;  4NNR A;  1OWQ A;  1FKJ A;  3FXY A;  4DWS C;  3AQU A;  1N1A A;  4IQ2 A;  2PI6 A;  3MDY B;  3PR9 A;  4DRI A;  1HXV A;  4J4O A;  4DH0 A;  3AS3 A;  1K9T A;  1HKJ A;  2ZQT A;  3ARZ A;  3KCE A;  1E9L A;  5GPR A;  1J4R A;  4MPK A;  2RQS A;  3O5L A;  4JFJ A;  1E44 A;  3NTP A;  1M5Y A;  3CZ8 A;  3EIP A;  4DIP A;  4GGQ A;  1E15 A;  1T11 A;  5DIU A;  2JZV A;  2XPB A;  1D6O A;  3O5K A;  2AOS A;  4ODP A;  1ZK6 A;  5BXJ A;  4TYO A;  2M2A A;  4L3N A;  3UF8 A;  2KI3 A;  2N87 A;  1FKG A;  3RM9 A;  4W9Q A;  5D75 A;  1FD9 A;  2DT0 A;  3WD2 A;  1X6N A;  1HKK A;  2FDM A;  4Z2K A;  1ZBC A;  2MNT A;  2MLZ A;  4ODK A;  3AS0 A;  2UZ5 A;  3RME A;  4ZPV R;  4DWS B;  3IKG A;  3ARW A;  4TW7 A;  1LJY A;  4DZ2 A;  3CH9 A;  1JNE A;  1E6N A;  4ODN A;  1ZCN A;  1QPF A;  1ZL1 A;  2G41 A;  4JFI A;  4QT3 A;  4L72 B;  2LGO A;  2DSZ A;  4ODO A;  1E6P A;  3ARQ A;  2O9O A;  3JXV A;  1ROU A;  2KO7 A;  3OOB A;  1W1P A;  4P8W A;  4DZ3 A;  3IKD A;  2XP6 A;  4G50 A;  1ZBV A;  3IHZ A;  1RD6 A;  3ARU A;  5JH8 A;  2LKN A;  4WKH A;  3OA5 A;  3KAG A;  4Z2G A;  1OGG A;  1NSG A;  2OLH A;  4NSB A;  1D2K A;  2DT1 A;  4NZC A;  1ZU8 A;  4Q7N A;  4ZPT R;  4MTV A;  1QPL A;  1BL4 A;  1FKI A;  4LAW A;  3TC5 A;  2XP5 A;  1FKH A;  2XP3 A;  4LAV A;  1F8A B;  3NI6 A;  2OFN A;  1JNS A;  3UI5 A;  2KGJ A;  3WQV A;  2A3C A;  3PRA A;  4MNK A;  1KT1 A;  2KFW A;  3ALF A;  2PV1 A;  5GQB A;  5B8I C;  2PV3 A;  4ML4 A;  2DT2 A;  4HAR A;  3PRB A;  1HJW A;  3O5Q A;  3ART A;  1WNO A;  3LUO A;  3O5D A;  4MNJ A;  1CTN A;  1KFW A;  4DRN A;  2PV2 A;  1D7I A;  4URI A;  4ZPW R;  2A3A A;  4C02 B;  4DT4 A;  1W26 A;  5HBF A;  1VF8 A;  2ZQV A;  4UDM A;  3O5P A;  4U84 A;  3O5F A;  4IPX A;  3UQI A;  4P8V A;  3KZ7 A;  2D9F A;  3TDB A;  5DEZ A;  1NMW A;  3O5E A;  5HT1 A; 
#chains in the Genus database with same CATH homology
 1E6R A;  2Q5A A;  1H0I A;  1A7X A;  1FKT A;  3B9E A;  3CHC A;  3ARO A;  2A3B A;  4W5U A;  1R9H A;  3AS1 A;  3WL1 A;  4TNS A;  2L2S A;  3PRD A;  3VAW A;  4JFL A;  3CGM A;  2WK2 A;  4WJX A;  3JYM A;  3ARP A;  2MF9 A;  3UI6 A;  2FKE A;  2PPO A;  3ARR A;  1P5Q A;  1EHN A;  2VCD A;  1XRV A;  3QOK A;  2DG9 A;  1PIN A;  2QF8 A;  4DRH A;  1IX5 A;  2DT3 A;  5J6E A;  2WLZ A;  1OGB A;  1FKL A;  1EQ3 A;  1ROT A;  1NWS A;  1GUV A;  1UR9 A;  1QZ2 A;  3B7X A;  3B9D A;  4W9O A;  2LJ4 A;  1HJX A;  3WD3 A;  2RSE A;  1X6L A;  1JNT A;  2PPP A;  1ZBW A;  4N19 A;  1NMV A;  4TX0 A;  1NWU A;  3UQA A;  1TFV A;  4Z2I A;  1FKD A;  1B6C A;  2PBC A;  2ZQS A;  4S3K A;  2ESC A;  2A3E A;  1XHG A;  4LAY A;  3WD0 A;  1EDQ A;  1C9H A;  2DSW A;  4MNM A;  2XP7 A;  2DSV A;  2F2D A;  1PBK A;  2RUQ A;  5HUA A;  2K8I A;  3KAH A;  1WAW A;  1LL4 A;  3RM8 A;  3O5G A;  4S3J A;  1LL7 A;  1FFQ A;  1FKF A;  4XAK A;  3O5M A;  3WIJ A;  4QZV B;  4DRO A;  4IQC A;  4R0X A;  3I6C A;  2RUC A;  1SYT A;  4Z2J A;  2F21 A;  2XPA A;  3NRK A;  3FAP A;  2YBU A;  3WKZ A;  4BF8 A;  4JFK A;  1W9P A;  4IT4 A;  4ODR A;  2RUD A;  3IK8 A;  3H9R B;  3KAB A;  3UQB A;  5DF0 A;  1HJV A;  1FKK A;  4DRP A;  1HKI A;  1LL6 A;  2ZQU A;  1W9V A;  3BXW A;  1W1V A;  3W4R A;  1NWT A;  1NH6 A;  2VN1 A;  3RGC A;  2KE0 A;  2XP4 A;  1E6Z A;  3CHE A;  1KT0 A;  2MLX A;  2F4E A;  2WLY A;  1FFR A;  3GPK A;  1EIB A;  4Z2L A;  4IT6 A;  1EYM A;  1FKB A;  3ODK A;  2IUZ A;  1LG1 A;  4QT2 A;  4HBE A;  2XP9 A;  1W1Y A;  1HKM A;  1H0G A;  4LGX A;  1FAP A;  3CHF A;  3RM4 A;  1U79 A;  1GPF A;  4DRQ A;  4ITZ A;  3JYJ A;  2ITK A;  3ARS A;  4ODL A;  5HTG A;  3G6L A;  2B31 A;  4FN2 A;  1Q6U A;  2MLY A;  4QIB A;  3O5J A;  1J4H A;  2LPV A;  3WD1 A;  2O92 A;  5HW7 A;  4MSP A;  3FY1 A;  1ITX A;  1WB0 A;  3ARY A;  3O5R A;  1ZB5 A;  3TCZ A;  2M1I A;  4MAV A;  4DWS A;  3KAF A;  3ARV A;  4WK9 A;  2ZR4 A;  4GIV A;  2XP8 A;  2DG3 A;  4DRJ A;  4O2T A;  1UR8 A;  3WQW A;  5DIT A;  5HW8 A;  4DRK A;  1L1P A;  1D7H A;  2FAP A;  2G8Z A;  5DO2 A;  3AS2 A;  3ALG A;  1YAT A;  1GOI A;  2Y78 A;  5DIV A;  1Q6I A;  2ZR6 A;  1YW5 A;  5HWB A;  1Q1C A;  5HW6 A;  1BKF A;  1TCO C;  1J6Y A;  5GPG A;  4JYS A;  2AWG A;  3B8S A;  1W1T A;  4HBO A;  4ODM A;  2YBT A;  3PA7 A;  4P8X A;  4DWS D;  4TW8 A;  2ZR5 A;  3CGN A;  2RUR A;  4KR0 B;  1J4I A;  2M08 A;  2WM0 A;  3KAD A;  4ZS6 A;  1FKS A;  5HKG A;  4U86 A;  3B9A A;  4G2P A;  1ZBK A;  4WKF A;  2IF4 A;  3G6M A;  3WH0 A;  1D7J A;  1SR0 A;  4W9P A;  1Y0O A;  1LG2 A;  4P8U A;  3O5O A;  4Q22 A;  3KAC A;  5HWC A;  4WIW A;  1W9U A;  4MGV A;  2DG4 A;  3O5I A;  2PPN A;  2DPE A;  4J4N A;  3UI4 A;  1O6I A;  4WKA A;  2DSU A;  3WD4 A;  1JND A;  2KR7 A;  4TW6 A;  4LAX A;  3EY6 A;  4DRM A;  4JFM A;  3KAI A;  3RFW A;  3ARX A;  4MNL A;  2MPH A;  5I98 A;  3CHD A;  4FAP A;  4Z2H A;  1JVW A;  1LQ0 A;  4KQZ A;  4AY1 A;  1Q6H A;  3WL0 A;  1F40 A;  1FKR A;  1NWR A;  4U85 A;  4R5E A;  1FJD A;  4ODQ A;  4PTM A;  4NNR A;  1OWQ A;  1FKJ A;  3FXY A;  4DWS C;  3AQU A;  1N1A A;  4IQ2 A;  2PI6 A;  3MDY B;  3PR9 A;  4DRI A;  1HXV A;  4J4O A;  4DH0 A;  3AS3 A;  1K9T A;  1HKJ A;  2ZQT A;  3ARZ A;  3KCE A;  1E9L A;  5GPR A;  1J4R A;  4MPK A;  2RQS A;  3O5L A;  4JFJ A;  3NTP A;  1M5Y A;  3CZ8 A;  4DIP A;  4GGQ A;  1E15 A;  1T11 A;  5DIU A;  2JZV A;  2XPB A;  1D6O A;  3O5K A;  2AOS A;  4ODP A;  1ZK6 A;  5BXJ A;  4TYO A;  2M2A A;  4L3N A;  3UF8 A;  2KI3 A;  2N87 A;  1FKG A;  3RM9 A;  4W9Q A;  5D75 A;  1FD9 A;  2DT0 A;  3WD2 A;  1X6N A;  1HKK A;  2FDM A;  4Z2K A;  1ZBC A;  2MNT A;  2MLZ A;  4ODK A;  3AS0 A;  2UZ5 A;  3RME A;  4ZPV R;  4DWS B;  3IKG A;  3ARW A;  4TW7 A;  1LJY A;  4DZ2 A;  3CH9 A;  1JNE A;  1E6N A;  4ODN A;  1ZCN A;  1QPF A;  1ZL1 A;  2G41 A;  4JFI A;  4QT3 A;  4L72 B;  2LGO A;  2DSZ A;  4ODO A;  1E6P A;  3ARQ A;  2O9O A;  3JXV A;  1ROU A;  2KO7 A;  3OOB A;  1W1P A;  4P8W A;  4DZ3 A;  3IKD A;  2XP6 A;  4G50 A;  1ZBV A;  3IHZ A;  1RD6 A;  3ARU A;  5JH8 A;  2LKN A;  4WKH A;  3OA5 A;  3KAG A;  4Z2G A;  1OGG A;  1NSG A;  2OLH A;  4NSB A;  1D2K A;  2DT1 A;  4NZC A;  1ZU8 A;  4Q7N A;  4ZPT R;  4MTV A;  1QPL A;  1BL4 A;  1FKI A;  4LAW A;  3TC5 A;  2XP5 A;  1FKH A;  2XP3 A;  4LAV A;  1F8A B;  3NI6 A;  2OFN A;  1JNS A;  3UI5 A;  2KGJ A;  3WQV A;  2A3C A;  3PRA A;  4MNK A;  1KT1 A;  2KFW A;  3ALF A;  2PV1 A;  5GQB A;  5B8I C;  2PV3 A;  4ML4 A;  2DT2 A;  4HAR A;  3PRB A;  1HJW A;  3O5Q A;  3ART A;  1WNO A;  3LUO A;  3O5D A;  4MNJ A;  1CTN A;  1KFW A;  4DRN A;  2PV2 A;  1D7I A;  4URI A;  4ZPW R;  2A3A A;  4C02 B;  4DT4 A;  1W26 A;  5HBF A;  1VF8 A;  2ZQV A;  3O5P A;  4U84 A;  3O5F A;  4IPX A;  3UQI A;  4P8V A;  3KZ7 A;  2D9F A;  3TDB A;  5DEZ A;  1NMW A;  3O5E A;  5HT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...