4N19A

Structural basis of conformational transitions in the active site and 80 s loop in the fk506 binding protein fkbp12
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTVVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPPIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of conformational transitions in the active site and 80's loop in the FK506-binding protein FKBP12.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1A
total genus 27
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4n19A00
3I6CA 2XPBA 1YATA 2DG4A 1P5QA 2PPNA 3KADA 1Q1CA 3FAPA 4U85A 4DRHA 2KI3A 2RURA 2UZ5A 1KT1A 3OOBA 3IK8A 2PV2A 1KT0A 4DZ2A 1FKLA 2MLXA 2RUQA 2RQSA 3KAHA 2ZQSA 2ZQUA 1FKSA 4ODMA 2VCDA 3UQAA 1BL4A 3MDYB 2K8IA 4IQCA 3B7XA 1QZ2A 1JNSA 2KFWA 1J6YA 1D7JA 3NI6A 3TCZA 4ITZA 4DRKA 4ODQA 3JYMA 5I98A 5B8IC 3NTPA 3EY6A 4LAXA 1PINA 2Y78A 2N87A 4DZ3A 3UI5A 3H9RB 1T11A 4IPXA 1FKKA 3UF8A 5HW8A 4FAPA 2FKEA 4U84A 3O5LA 4U86A 4MSPA 4R0XA 1PBKA 4DRPA 2XP4A 3ODKA 1FKBA 2FAPA 1FKTA 4LAYA 1L1PA 3O5IA 3PRDA 2PV1A 4BF8A 2VN1A 1Q6HA 1YW5A 2KE0A 3KAFA 2PBCA 2LKNA 3IKGA 3NRKA 3O5RA 3O5GA 3VAWA 5HWCA 4NNRA 1FKFA 1Y0OA 2LGOA 2RSEA 4TW7A 3IKDA 1D7HA 2AWGA 4JYSA 2M08A 4LAVA 4W9PA 2RUDA 2M1IA 5DIVA 1TCOC 1FKRA 1BKFA 1QPFA 2ZR4A 1FAPA 1J4RA 1FKIA 2F4EA 2XP6A 5HTGA 5J6EA 2JZVA 3O5OA 5HW6A 3UI6A 1FKHA 2F21A 4MGVA 4ODLA 1EQ3A 1JNTA 2PPPA 3O5DA 4JFLA 4QT2A 1F40A 1C9HA 1FKJA 4C02B 3O5KA 1JVWA 2PV3A 4ODOA 3UQBA 2KGJA 1D6OA 2KR7A 4N19A 3CGNA 4QT3A 3KABA 4DIPA 2DG9A 5HKGA 1FJDA 2ZR6A 3O5FA 4G50A 4JFKA 4DRQA 1U79A 4TX0A 1A7XA 3O5PA 5DIUA 1EYMA 3UI4A 1FD9A 1J4HA 4O2TA 5HUAA 2MPHA 2XP7A 4J4OA 4DROA 3KZ7A 3PA7A 2XP5A 5HT1A 1ZK6A 4QIBA 1Q6IA 3WH0A 4DH0A 1NSGA 3LUOA 4LAWA 4TYOA 2MNTA 3KAIA 2ZQTA 3CGMA 2XP8A 4J4NA 4ODNA 1NMVA 1FKDA 1NMWA 1FKGA 1QPLA 5DITA 1J4IA 2F2DA 2ZR5A 4DRIA 4ODPA 4TNSA 5GPGA 2XPAA 4DRNA 2DG3A 1D7IA 4G2PA 2M2AA 1W26A 4TW8A 2IF4A 2Q5AA 5HWBA 1HXVA 4JFIA 4TW6A 3RGCA 3O5EA 4JFMA 3O5QA 1ROUA 4FN2A 4GIVA 5D75A 2MF9A 2MLYA 3TC5A 1F8AB 2L2SA 4JFJA 2XP3A 4ODRA 3TDBA 1M5YA 3JXVA 3GPKA 4DRMA 4W9QA 3KACA 5BXJA 2MLZA 2OFNA 3RFWA 1Q6UA 3PRBA 4W9OA 1ZCNA 2LJ4A 3IHZA 3UQIA 3JYJA 2D9FA 1R9HA 1B6CA 2XP9A 2RUCA 4IQ2A 3O5MA 4ODKA 3KCEA 3KAGA 4DRJA 2KO7A 4DT4A 5HW7A 2ZQVA 2PPOA 3O5JA 2LPVA 1ROTA 1N1AA 4GGQA 2ITKA
chains in the Genus database with same CATH superfamily
1YATA 2DG4A 1P5QA 3KADA 1Q1CA 4U85A 4DRHA 2KI3A 2G41A 2IUZA 2UZ5A 2RUQA 3WD3A 2ZQSA 2ZQUA 1FKSA 1CTNA 5JH8A 1ZU8A 4WIWA 2K8IA 2FDMA 1JNSA 2KFWA 4NSBA 3NI6A 4MNMA 2AOSA 4LAXA 2DSUA 1HJWA 3B9AA 4DZ3A 3UI5A 2DPEA 1FKKA 4MSPA 4R0XA 1PBKA 2A3EA 3ARZA 1FKBA 4MPKA 4WKFA 1W1PA 1FKTA 3AS3A 1W1TA 1Q6HA 3KAFA 1O6IA 4NNRA 1UR8A 2LGOA 2AWGA 4JYSA 1ZBWA 2M08A 1NWRA 1TCOC 1GOIA 2XP6A 5HTGA 5J6EA 2JZVA 4PTMA 4ODLA 1HJXA 1JNTA 2PPPA 1ZB5A 1FKJA 1SYTA 1IX5A 4C02B 3UQBA 2PV3A 2KR7A 3B8SA 2WK2A 4NZCA 3O5FA 4JFKA 4DRQA 1U79A 1A7XA 3RM4A 3UI4A 3B9DA 1SR0A 4DWSA 3GTYX 2XP5A 1E44A 1Q6IA 1JNEA 4LAWA 3KAIA 3WQVA 1NMVA 1FKDA 1FKGA 2F2DA 2ZR5A 4DRIA 2WM0A 4XAKA 1W26A 4Z2LA 4ML4A 5GPRA 5D75A 3ARQA 1F8AB 2PN0A 1W1VA 3WQWA 2O9OA 1VF8A 2WLZA 3FXYA 3PRBA 3RFWA 4Z2JA 3ALGA 1OGBA 3WD2A 2XP9A 2DSVA 3KCEA 1OWQA 4DT4A 3WD0A 1WB0A 2ZQVA 4ODNA 4GGQA 2XPBA 1WNOA 2ESCA 3OA5A 3OOBA 1KT1A 4ZPVR 3IK8A 4DZ2A 1FKLA 3KAHA 3WKZA 3UQAA 1BL4A 3PR9A 3B7XA 3AQUA 1J6YA 1D7JA 3TCZA 4DRKA 3AROA 3JYMA 5I98A 3G6LA 1XHGA 3BMBA 1D2KA 2O92A 3UF8A 5HW8A 4U84A 4U86A 3CHCA 4DRPA 2XP4A 1FFQA 3ODKA 1L1PA 4BF8A 2VN1A 1YW5A 1LJYA 1RD6A 2LKNA 3NRKA 3O5RA 3VAWA 2RSEA 3WL1A 3RMEA 3ARTA 4W9PA 3CHFA 5DIVA 2ZR4A 1GUVA 1FAPA 1J4RA 3FY1A 5DO2A 4MTVA 1FKHA 1LL7A 4JFLA 1E6NA 1HKIA 3CH9A 3WL0A 1ZBVA 2KGJA 3KABA 2DG9A 2ZR6A 3B9EA 2DSZA 2YBUA 2DT1A 3ARRA 4J4OA 2XP7A 4DROA 5HT1A 3RM9A 4QIBA 4DH0A 4TYOA 3RM8A 2B5UB 3CGMA 4J4NA 1QPLA 1EIBA 1UR9A 4DRNA 4TNSA 2XPAA 2DG3A 1HXVA 3BXWA 4JFIA 4TW6A 3ARYA 3O5EA 4JFMA 3RGCA 1ROUA 4Z2KA 4FN2A 2F23A 4GIVA 3TC5A 2L2SA 3TDBA 1E15A 3JXVA 3GPKA 1K9TA 4W9QA 3WIJA 5BXJA 2MLZA 1Q6UA 3ARUA 1X6NA 4DWSD 1HKMA 1H0IA 4Z2HA 3O5MA 3ARWA 3EIPA 1NWUA 1GRJA 1ROTA 2RURA 3KZ7A 3I6CA 2PPNA 1H0GA 4WK9A 4DWSC 2B31A 1X6LA 2PV2A 2RQSA 4S3JA 4ODMA 2VCDA 4S3KA 3MDYB 3QOKA 4IQCA 3CHDA 4ITZA 5B8IC 3CZ8A 2Y78A 3H9RB 4IPXA 3AS0A 1W9UA 2WLYA 3O5LA 1LL4A 3ARSA 3O5IA 2PV1A 5DEZA 4WKHA 2A3AA 1NWTA 2PBCA 3IKGA 4R5EA 5HWCA 4TW7A 4MNLA 4ZPWR 3IKDA 1D7HA 5HBFA 4WKAA 1LQ0A 1EHNA 1FKRA 1FKIA 2F4EA 4AY1A 1FFRA 4Z2IA 3O5OA 3UI6A 2F21A 2DT2A 1WAWA 1JNDA 4ODOA 1XRVA 1ZBCA 4N19A 2A3CA 4DIPA 2A3BA 3G6MA 4G50A 1GPFA 2OLHA 4TX0A 3O5PA 1ZBKA 2QF8A 1OGGA 1FD9A 4O2TA 2MPHA 1NH6A 2PI6A 4L3NA 3WH0A 1NSGA 4HBEA 2ZQTA 2XP8A 2EULA 4KQZA 1E6PA 4Q22A 5GPGA 4TW8A 2MF9A 2MLYA 3ALFA 4WJXA 4ODRA 2XP3A 1M5YA 4DRMA 3CHEA 2LJ4A 3UQIA 4MNKA 2YBTA 2D9FA 1R9HA 2RUCA 4IT6A 4ODKA 4DRJA 3KAGA 1LG1A 2PPOA 4URIA 1N1AA 3FAPA 4MNJA 1KT0A 4HBOA 2MLXA 1HKJA 4Q7NA 3PRAA 1EDQA 1JCHB 1QZ2A 4L72B 4Z2GA 4ODQA 3NTPA 3EY6A 4LGXA 1PINA 1NWSA 2N87A 1T11A 3GU0A 4FAPA 2FKEA 4UDMA 2DSWA 2DT3A 4P8VA 1HKKA 2FAPA 4IT4A 4LAYA 3PRDA 3AS1A 2DT0A 2KE0A 1E9LA 2G8ZA 1ITXA 3O5GA 1KFWA 1FKFA 1Y0OA 3WD1A 4DWSB 4LAVA 4ZS6A 2RUDA 2M1IA 1BKFA 1QPFA 1W9VA 4P8XA 5HW6A 1HJVA 1TFVA 4MGVA 4MAVA 1W1YA 1EQ3A 4QT2A 3O5DA 1F40A 1C9HA 1W9PA 3O5KA 1JVWA 1D6OA 1LG2A 4KR0B 4ZPTR 3CGNA 4QT3A 5HKGA 3WD4A 3AS2A 5DIUA 4W5UA 1ZL1A 1EYMA 2ETNA 1J4HA 5HUAA 3PA7A 3ARXA 1ZK6A 3LUOA 3W4RA 2MNTA 1E6ZA 1LL6A 1NMWA 5DITA 1J4IA 4ODPA 1D7IA 4G2PA 2M2AA 2IF4A 2Q5AA 5HWBA 3O5QA 4P8WA 4QZVB 4JFJA 2P4VA 3KACA 2OFNA 4W9OA 1E6RA 1ZCNA 5DF0A 3IHZA 3ARPA 3ARVA 3JYJA 4HARA 1B6CA 4IQ2A 2KO7A 5HW7A 4P8UA 5GQBA 3O5JA 2LPVA 1FJDA 2ITKA
chains in the Genus database with same CATH topology
1YATA 2DG4A 1P5QA 3KADA 1Q1CA 4U85A 4DRHA 2KI3A 2G41A 2IUZA 2UZ5A 2RUQA 3WD3A 2ZQSA 2ZQUA 1FKSA 1CTNA 5JH8A 1ZU8A 4WIWA 2K8IA 2FDMA 1JNSA 2KFWA 4NSBA 3NI6A 4MNMA 2AOSA 4LAXA 2DSUA 1HJWA 3B9AA 4DZ3A 3UI5A 2DPEA 1FKKA 4MSPA 4R0XA 1PBKA 2A3EA 3ARZA 1FKBA 4MPKA 4WKFA 1W1PA 1FKTA 3AS3A 1W1TA 1Q6HA 3KAFA 1O6IA 4NNRA 1UR8A 2LGOA 2AWGA 4JYSA 1ZBWA 2M08A 1NWRA 1TCOC 1GOIA 2XP6A 5HTGA 5J6EA 2JZVA 4PTMA 4ODLA 1HJXA 1JNTA 2PPPA 1ZB5A 1FKJA 1SYTA 1IX5A 4C02B 3UQBA 2PV3A 2KR7A 3B8SA 2WK2A 4NZCA 3O5FA 4JFKA 4DRQA 1U79A 1A7XA 3RM4A 3UI4A 3B9DA 1SR0A 4DWSA 2XP5A 1Q6IA 1JNEA 4LAWA 3KAIA 3WQVA 1NMVA 1FKDA 1FKGA 2F2DA 2ZR5A 4DRIA 2WM0A 4XAKA 1W26A 4Z2LA 4ML4A 5GPRA 5D75A 3ARQA 1F8AB 1W1VA 3WQWA 2O9OA 1VF8A 2WLZA 3FXYA 3PRBA 3RFWA 4Z2JA 3ALGA 1OGBA 3WD2A 2XP9A 2DSVA 3KCEA 1OWQA 4DT4A 3WD0A 1WB0A 2ZQVA 4ODNA 4GGQA 2XPBA 1WNOA 2ESCA 3OA5A 3OOBA 1KT1A 4ZPVR 3IK8A 4DZ2A 1FKLA 3KAHA 3WKZA 3UQAA 1BL4A 3PR9A 3B7XA 3AQUA 1J6YA 1D7JA 3TCZA 4DRKA 3AROA 3JYMA 5I98A 3G6LA 1XHGA 1D2KA 2O92A 3UF8A 5HW8A 4U84A 4U86A 3CHCA 4DRPA 2XP4A 1FFQA 3ODKA 1L1PA 4BF8A 2VN1A 1YW5A 1LJYA 1RD6A 2LKNA 3NRKA 3O5RA 3VAWA 2RSEA 3WL1A 3RMEA 3ARTA 4W9PA 3CHFA 5DIVA 2ZR4A 1GUVA 1FAPA 1J4RA 3FY1A 5DO2A 4MTVA 1FKHA 4JFLA 1LL7A 1E6NA 1HKIA 3CH9A 3WL0A 1ZBVA 2KGJA 3KABA 2DG9A 2ZR6A 3B9EA 2DSZA 2YBUA 2DT1A 3ARRA 4J4OA 2XP7A 4DROA 5HT1A 3RM9A 4QIBA 4DH0A 4TYOA 3RM8A 3CGMA 4J4NA 1QPLA 1EIBA 1UR9A 4DRNA 4TNSA 2XPAA 2DG3A 1HXVA 3BXWA 4JFIA 4TW6A 3ARYA 3O5EA 4JFMA 3RGCA 1ROUA 4Z2KA 4FN2A 4GIVA 3TC5A 2L2SA 3TDBA 1E15A 3JXVA 3GPKA 1K9TA 4W9QA 3WIJA 5BXJA 2MLZA 1Q6UA 3ARUA 1X6NA 4DWSD 1HKMA 1H0IA 4Z2HA 3O5MA 3ARWA 1NWUA 1ROTA 2RURA 3KZ7A 3I6CA 2PPNA 1H0GA 4WK9A 4DWSC 2B31A 1X6LA 2PV2A 2RQSA 4S3JA 4ODMA 2VCDA 4S3KA 3MDYB 3QOKA 4IQCA 3CHDA 4ITZA 5B8IC 3CZ8A 2Y78A 3H9RB 4IPXA 3AS0A 1W9UA 2WLYA 3O5LA 1LL4A 3ARSA 3O5IA 2PV1A 5DEZA 4WKHA 2A3AA 1NWTA 2PBCA 3IKGA 4R5EA 5HWCA 4TW7A 4MNLA 4ZPWR 3IKDA 1D7HA 5HBFA 4WKAA 1LQ0A 1EHNA 1FKRA 1FKIA 2F4EA 4AY1A 1FFRA 4Z2IA 3O5OA 3UI6A 2F21A 2DT2A 1WAWA 1JNDA 4ODOA 1XRVA 1ZBCA 4N19A 2A3CA 4DIPA 2A3BA 3G6MA 4G50A 1GPFA 2OLHA 4TX0A 3O5PA 1ZBKA 2QF8A 1OGGA 1FD9A 4O2TA 2MPHA 1NH6A 2PI6A 4L3NA 3WH0A 1NSGA 4HBEA 2ZQTA 2XP8A 4KQZA 1E6PA 4Q22A 5GPGA 4TW8A 2MF9A 2MLYA 3ALFA 4WJXA 4ODRA 2XP3A 1M5YA 4DRMA 3CHEA 2LJ4A 3UQIA 4MNKA 2YBTA 2D9FA 1R9HA 2RUCA 4IT6A 4ODKA 4DRJA 3KAGA 1LG1A 2PPOA 4URIA 1N1AA 3FAPA 4MNJA 1KT0A 4HBOA 2MLXA 1HKJA 4Q7NA 3PRAA 1EDQA 1QZ2A 4L72B 4Z2GA 4ODQA 3NTPA 3EY6A 4LGXA 1PINA 1NWSA 2N87A 1T11A 4FAPA 2FKEA 2DSWA 2DT3A 4P8VA 1HKKA 2FAPA 4IT4A 4LAYA 3PRDA 3AS1A 2DT0A 2KE0A 1E9LA 2G8ZA 1ITXA 3O5GA 1KFWA 1FKFA 1Y0OA 3WD1A 4DWSB 4LAVA 4ZS6A 2RUDA 2M1IA 1BKFA 1QPFA 1W9VA 4P8XA 5HW6A 1HJVA 1TFVA 4MGVA 4MAVA 1W1YA 1EQ3A 4QT2A 3O5DA 1F40A 1C9HA 1W9PA 3O5KA 1JVWA 1D6OA 1LG2A 4KR0B 4ZPTR 3CGNA 4QT3A 5HKGA 3WD4A 3AS2A 5DIUA 4W5UA 1ZL1A 1EYMA 1J4HA 5HUAA 3PA7A 3ARXA 1ZK6A 3LUOA 3W4RA 2MNTA 1E6ZA 1LL6A 1NMWA 5DITA 1J4IA 4ODPA 1D7IA 4G2PA 2M2AA 2IF4A 2Q5AA 5HWBA 3O5QA 4P8WA 4QZVB 4JFJA 3KACA 2OFNA 4W9OA 1E6RA 1ZCNA 5DF0A 3IHZA 3ARPA 3ARVA 3JYJA 4HARA 1B6CA 4IQ2A 2KO7A 5HW7A 4P8UA 5GQBA 3O5JA 2LPVA 1FJDA 2ITKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I6C A;  2XPB A;  1YAT A;  2DG4 A;  1P5Q A;  2PPN A;  3KAD A;  1Q1C A;  3FAP A;  4U85 A;  4DRH A;  2KI3 A;  2RUR A;  2UZ5 A;  1KT1 A;  3OOB A;  3IK8 A;  2PV2 A;  1KT0 A;  4DZ2 A;  1FKL A;  2MLX A;  2RUQ A;  2RQS A;  3KAH A;  2ZQS A;  2ZQU A;  1FKS A;  4ODM A;  2VCD A;  3UQA A;  1BL4 A;  3MDY B;  2K8I A;  4IQC A;  3B7X A;  1QZ2 A;  1JNS A;  2KFW A;  1J6Y A;  1D7J A;  3NI6 A;  3TCZ A;  4ITZ A;  4DRK A;  4ODQ A;  3JYM A;  5I98 A;  5B8I C;  3NTP A;  3EY6 A;  4LAX A;  1PIN A;  2Y78 A;  2N87 A;  4DZ3 A;  3UI5 A;  3H9R B;  1T11 A;  4IPX A;  1FKK A;  3UF8 A;  5HW8 A;  4FAP A;  2FKE A;  4U84 A;  3O5L A;  4U86 A;  4MSP A;  4R0X A;  1PBK A;  4DRP A;  2XP4 A;  3ODK A;  1FKB A;  2FAP A;  1FKT A;  4LAY A;  1L1P A;  3O5I A;  3PRD A;  2PV1 A;  4BF8 A;  2VN1 A;  1Q6H A;  1YW5 A;  2KE0 A;  3KAF A;  2PBC A;  2LKN A;  3IKG A;  3NRK A;  3O5R A;  3O5G A;  3VAW A;  5HWC A;  4NNR A;  1FKF A;  1Y0O A;  2LGO A;  2RSE A;  4TW7 A;  3IKD A;  1D7H A;  2AWG A;  4JYS A;  2M08 A;  4LAV A;  4W9P A;  2RUD A;  2M1I A;  5DIV A;  1TCO C;  1FKR A;  1BKF A;  1QPF A;  2ZR4 A;  1FAP A;  1J4R A;  1FKI A;  2F4E A;  2XP6 A;  5HTG A;  5J6E A;  2JZV A;  3O5O A;  5HW6 A;  3UI6 A;  1FKH A;  2F21 A;  4MGV A;  4ODL A;  1EQ3 A;  1JNT A;  2PPP A;  3O5D A;  4JFL A;  4QT2 A;  1F40 A;  1C9H A;  1FKJ A;  4C02 B;  3O5K A;  1JVW A;  2PV3 A;  4ODO A;  3UQB A;  2KGJ A;  1D6O A;  2KR7 A;  4N19 A;  3CGN A;  4QT3 A;  3KAB A;  4DIP A;  2DG9 A;  5HKG A;  1FJD A;  2ZR6 A;  3O5F A;  4G50 A;  4JFK A;  4DRQ A;  1U79 A;  4TX0 A;  1A7X A;  3O5P A;  5DIU A;  1EYM A;  3UI4 A;  1FD9 A;  1J4H A;  4O2T A;  5HUA A;  2MPH A;  2XP7 A;  4J4O A;  4DRO A;  3KZ7 A;  3PA7 A;  2XP5 A;  5HT1 A;  1ZK6 A;  4QIB A;  1Q6I A;  3WH0 A;  4DH0 A;  1NSG A;  3LUO A;  4LAW A;  4TYO A;  2MNT A;  3KAI A;  2ZQT A;  3CGM A;  2XP8 A;  4J4N A;  4ODN A;  1NMV A;  1FKD A;  1NMW A;  1FKG A;  1QPL A;  5DIT A;  1J4I A;  2F2D A;  2ZR5 A;  4DRI A;  4ODP A;  4TNS A;  5GPG A;  2XPA A;  4DRN A;  2DG3 A;  1D7I A;  4G2P A;  2M2A A;  1W26 A;  4TW8 A;  2IF4 A;  2Q5A A;  5HWB A;  1HXV A;  4JFI A;  4TW6 A;  3RGC A;  3O5E A;  4JFM A;  3O5Q A;  1ROU A;  4FN2 A;  4GIV A;  5D75 A;  2MF9 A;  2MLY A;  3TC5 A;  1F8A B;  2L2S A;  4JFJ A;  2XP3 A;  4ODR A;  3TDB A;  1M5Y A;  3JXV A;  3GPK A;  4DRM A;  4W9Q A;  3KAC A;  5BXJ A;  2MLZ A;  2OFN A;  3RFW A;  1Q6U A;  3PRB A;  4W9O A;  1ZCN A;  2LJ4 A;  3IHZ A;  3UQI A;  3JYJ A;  2D9F A;  1R9H A;  1B6C A;  2XP9 A;  2RUC A;  4IQ2 A;  3O5M A;  4ODK A;  3KCE A;  3KAG A;  4DRJ A;  2KO7 A;  4DT4 A;  5HW7 A;  2ZQV A;  2PPO A;  3O5J A;  2LPV A;  1ROT A;  1N1A A;  4GGQ A;  2ITK A; 
#chains in the Genus database with same CATH topology
 1YAT A;  2DG4 A;  1P5Q A;  3KAD A;  1Q1C A;  4U85 A;  4DRH A;  2KI3 A;  2G41 A;  2IUZ A;  2UZ5 A;  2RUQ A;  3WD3 A;  2ZQS A;  2ZQU A;  1FKS A;  1CTN A;  5JH8 A;  1ZU8 A;  4WIW A;  2K8I A;  2FDM A;  1JNS A;  2KFW A;  4NSB A;  3NI6 A;  4MNM A;  2AOS A;  4LAX A;  2DSU A;  1HJW A;  3B9A A;  4DZ3 A;  3UI5 A;  2DPE A;  1FKK A;  4MSP A;  4R0X A;  1PBK A;  2A3E A;  3ARZ A;  1FKB A;  4MPK A;  4WKF A;  1W1P A;  1FKT A;  3AS3 A;  1W1T A;  1Q6H A;  3KAF A;  1O6I A;  4NNR A;  1UR8 A;  2LGO A;  2AWG A;  4JYS A;  1ZBW A;  2M08 A;  1NWR A;  1TCO C;  1GOI A;  2XP6 A;  5HTG A;  5J6E A;  2JZV A;  4PTM A;  4ODL A;  1HJX A;  1JNT A;  2PPP A;  1ZB5 A;  1FKJ A;  1SYT A;  1IX5 A;  4C02 B;  3UQB A;  2PV3 A;  2KR7 A;  3B8S A;  2WK2 A;  4NZC A;  3O5F A;  4JFK A;  4DRQ A;  1U79 A;  1A7X A;  3RM4 A;  3UI4 A;  3B9D A;  1SR0 A;  4DWS A;  3GTY X;  2XP5 A;  1E44 A;  1Q6I A;  1JNE A;  4LAW A;  3KAI A;  3WQV A;  1NMV A;  1FKD A;  1FKG A;  2F2D A;  2ZR5 A;  4DRI A;  2WM0 A;  4XAK A;  1W26 A;  4Z2L A;  4ML4 A;  5GPR A;  5D75 A;  3ARQ A;  1F8A B;  2PN0 A;  1W1V A;  3WQW A;  2O9O A;  1VF8 A;  2WLZ A;  3FXY A;  3PRB A;  3RFW A;  4Z2J A;  3ALG A;  1OGB A;  3WD2 A;  2XP9 A;  2DSV A;  3KCE A;  1OWQ A;  4DT4 A;  3WD0 A;  1WB0 A;  2ZQV A;  4ODN A;  4GGQ A;  2XPB A;  1WNO A;  2ESC A;  3OA5 A;  3OOB A;  1KT1 A;  4ZPV R;  3IK8 A;  4DZ2 A;  1FKL A;  3KAH A;  3WKZ A;  3UQA A;  1BL4 A;  3PR9 A;  3B7X A;  3AQU A;  1J6Y A;  1D7J A;  3TCZ A;  4DRK A;  3ARO A;  3JYM A;  5I98 A;  3G6L A;  1XHG A;  3BMB A;  1D2K A;  2O92 A;  3UF8 A;  5HW8 A;  4U84 A;  4U86 A;  3CHC A;  4DRP A;  2XP4 A;  1FFQ A;  3ODK A;  1L1P A;  4BF8 A;  2VN1 A;  1YW5 A;  1LJY A;  1RD6 A;  2LKN A;  3NRK A;  3O5R A;  3VAW A;  2RSE A;  3WL1 A;  3RME A;  3ART A;  4W9P A;  3CHF A;  5DIV A;  2ZR4 A;  1GUV A;  1FAP A;  1J4R A;  3FY1 A;  5DO2 A;  4MTV A;  1FKH A;  1LL7 A;  4JFL A;  1E6N A;  1HKI A;  3CH9 A;  3WL0 A;  1ZBV A;  2KGJ A;  3KAB A;  2DG9 A;  2ZR6 A;  3B9E A;  2DSZ A;  2YBU A;  2DT1 A;  3ARR A;  4J4O A;  2XP7 A;  4DRO A;  5HT1 A;  3RM9 A;  4QIB A;  4DH0 A;  4TYO A;  3RM8 A;  2B5U B;  3CGM A;  4J4N A;  1QPL A;  1EIB A;  1UR9 A;  4DRN A;  4TNS A;  2XPA A;  2DG3 A;  1HXV A;  3BXW A;  4JFI A;  4TW6 A;  3ARY A;  3O5E A;  4JFM A;  3RGC A;  1ROU A;  4Z2K A;  4FN2 A;  2F23 A;  4GIV A;  3TC5 A;  2L2S A;  3TDB A;  1E15 A;  3JXV A;  3GPK A;  1K9T A;  4W9Q A;  3WIJ A;  5BXJ A;  2MLZ A;  1Q6U A;  3ARU A;  1X6N A;  4DWS D;  1HKM A;  1H0I A;  4Z2H A;  3O5M A;  3ARW A;  3EIP A;  1NWU A;  1GRJ A;  1ROT A;  2RUR A;  3KZ7 A;  3I6C A;  2PPN A;  1H0G A;  4WK9 A;  4DWS C;  2B31 A;  1X6L A;  2PV2 A;  2RQS A;  4S3J A;  4ODM A;  2VCD A;  4S3K A;  3MDY B;  3QOK A;  4IQC A;  3CHD A;  4ITZ A;  5B8I C;  3CZ8 A;  2Y78 A;  3H9R B;  4IPX A;  3AS0 A;  1W9U A;  2WLY A;  3O5L A;  1LL4 A;  3ARS A;  3O5I A;  2PV1 A;  5DEZ A;  4WKH A;  2A3A A;  1NWT A;  2PBC A;  3IKG A;  4R5E A;  5HWC A;  4TW7 A;  4MNL A;  4ZPW R;  3IKD A;  1D7H A;  5HBF A;  4WKA A;  1LQ0 A;  1EHN A;  1FKR A;  1FKI A;  2F4E A;  4AY1 A;  1FFR A;  4Z2I A;  3O5O A;  3UI6 A;  2F21 A;  2DT2 A;  1WAW A;  1JND A;  4ODO A;  1XRV A;  1ZBC A;  4N19 A;  2A3C A;  4DIP A;  2A3B A;  3G6M A;  4G50 A;  1GPF A;  2OLH A;  4TX0 A;  3O5P A;  1ZBK A;  2QF8 A;  1OGG A;  1FD9 A;  4O2T A;  2MPH A;  1NH6 A;  2PI6 A;  4L3N A;  3WH0 A;  1NSG A;  4HBE A;  2ZQT A;  2XP8 A;  2EUL A;  4KQZ A;  1E6P A;  4Q22 A;  5GPG A;  4TW8 A;  2MF9 A;  2MLY A;  3ALF A;  4WJX A;  4ODR A;  2XP3 A;  1M5Y A;  4DRM A;  3CHE A;  2LJ4 A;  3UQI A;  4MNK A;  2YBT A;  2D9F A;  1R9H A;  2RUC A;  4IT6 A;  4ODK A;  4DRJ A;  3KAG A;  1LG1 A;  2PPO A;  4URI A;  1N1A A;  3FAP A;  4MNJ A;  1KT0 A;  4HBO A;  2MLX A;  1HKJ A;  4Q7N A;  3PRA A;  1EDQ A;  1JCH B;  1QZ2 A;  4L72 B;  4Z2G A;  4ODQ A;  3NTP A;  3EY6 A;  4LGX A;  1PIN A;  1NWS A;  2N87 A;  1T11 A;  3GU0 A;  4FAP A;  2FKE A;  4UDM A;  2DSW A;  2DT3 A;  4P8V A;  1HKK A;  2FAP A;  4IT4 A;  4LAY A;  3PRD A;  3AS1 A;  2DT0 A;  2KE0 A;  1E9L A;  2G8Z A;  1ITX A;  3O5G A;  1KFW A;  1FKF A;  1Y0O A;  3WD1 A;  4DWS B;  4LAV A;  4ZS6 A;  2RUD A;  2M1I A;  1BKF A;  1QPF A;  1W9V A;  4P8X A;  5HW6 A;  1HJV A;  1TFV A;  4MGV A;  4MAV A;  1W1Y A;  1EQ3 A;  4QT2 A;  3O5D A;  1F40 A;  1C9H A;  1W9P A;  3O5K A;  1JVW A;  1D6O A;  1LG2 A;  4KR0 B;  4ZPT R;  3CGN A;  4QT3 A;  5HKG A;  3WD4 A;  3AS2 A;  5DIU A;  4W5U A;  1ZL1 A;  1EYM A;  2ETN A;  1J4H A;  5HUA A;  3PA7 A;  3ARX A;  1ZK6 A;  3LUO A;  3W4R A;  2MNT A;  1E6Z A;  1LL6 A;  1NMW A;  5DIT A;  1J4I A;  4ODP A;  1D7I A;  4G2P A;  2M2A A;  2IF4 A;  2Q5A A;  5HWB A;  3O5Q A;  4P8W A;  4QZV B;  4JFJ A;  2P4V A;  3KAC A;  2OFN A;  4W9O A;  1E6R A;  1ZCN A;  5DF0 A;  3IHZ A;  3ARP A;  3ARV A;  3JYJ A;  4HAR A;  1B6C A;  4IQ2 A;  2KO7 A;  5HW7 A;  4P8U A;  5GQB A;  3O5J A;  2LPV A;  1FJD A;  2ITK A; 
#chains in the Genus database with same CATH homology
 1YAT A;  2DG4 A;  1P5Q A;  3KAD A;  1Q1C A;  4U85 A;  4DRH A;  2KI3 A;  2G41 A;  2IUZ A;  2UZ5 A;  2RUQ A;  3WD3 A;  2ZQS A;  2ZQU A;  1FKS A;  1CTN A;  5JH8 A;  1ZU8 A;  4WIW A;  2K8I A;  2FDM A;  1JNS A;  2KFW A;  4NSB A;  3NI6 A;  4MNM A;  2AOS A;  4LAX A;  2DSU A;  1HJW A;  3B9A A;  4DZ3 A;  3UI5 A;  2DPE A;  1FKK A;  4MSP A;  4R0X A;  1PBK A;  2A3E A;  3ARZ A;  1FKB A;  4MPK A;  4WKF A;  1W1P A;  1FKT A;  3AS3 A;  1W1T A;  1Q6H A;  3KAF A;  1O6I A;  4NNR A;  1UR8 A;  2LGO A;  2AWG A;  4JYS A;  1ZBW A;  2M08 A;  1NWR A;  1TCO C;  1GOI A;  2XP6 A;  5HTG A;  5J6E A;  2JZV A;  4PTM A;  4ODL A;  1HJX A;  1JNT A;  2PPP A;  1ZB5 A;  1FKJ A;  1SYT A;  1IX5 A;  4C02 B;  3UQB A;  2PV3 A;  2KR7 A;  3B8S A;  2WK2 A;  4NZC A;  3O5F A;  4JFK A;  4DRQ A;  1U79 A;  1A7X A;  3RM4 A;  3UI4 A;  3B9D A;  1SR0 A;  4DWS A;  2XP5 A;  1Q6I A;  1JNE A;  4LAW A;  3KAI A;  3WQV A;  1NMV A;  1FKD A;  1FKG A;  2F2D A;  2ZR5 A;  4DRI A;  2WM0 A;  4XAK A;  1W26 A;  4Z2L A;  4ML4 A;  5GPR A;  5D75 A;  3ARQ A;  1F8A B;  1W1V A;  3WQW A;  2O9O A;  1VF8 A;  2WLZ A;  3FXY A;  3PRB A;  3RFW A;  4Z2J A;  3ALG A;  1OGB A;  3WD2 A;  2XP9 A;  2DSV A;  3KCE A;  1OWQ A;  4DT4 A;  3WD0 A;  1WB0 A;  2ZQV A;  4ODN A;  4GGQ A;  2XPB A;  1WNO A;  2ESC A;  3OA5 A;  3OOB A;  1KT1 A;  4ZPV R;  3IK8 A;  4DZ2 A;  1FKL A;  3KAH A;  3WKZ A;  3UQA A;  1BL4 A;  3PR9 A;  3B7X A;  3AQU A;  1J6Y A;  1D7J A;  3TCZ A;  4DRK A;  3ARO A;  3JYM A;  5I98 A;  3G6L A;  1XHG A;  1D2K A;  2O92 A;  3UF8 A;  5HW8 A;  4U84 A;  4U86 A;  3CHC A;  4DRP A;  2XP4 A;  1FFQ A;  3ODK A;  1L1P A;  4BF8 A;  2VN1 A;  1YW5 A;  1LJY A;  1RD6 A;  2LKN A;  3NRK A;  3O5R A;  3VAW A;  2RSE A;  3WL1 A;  3RME A;  3ART A;  4W9P A;  3CHF A;  5DIV A;  2ZR4 A;  1GUV A;  1FAP A;  1J4R A;  3FY1 A;  5DO2 A;  4MTV A;  1FKH A;  4JFL A;  1LL7 A;  1E6N A;  1HKI A;  3CH9 A;  3WL0 A;  1ZBV A;  2KGJ A;  3KAB A;  2DG9 A;  2ZR6 A;  3B9E A;  2DSZ A;  2YBU A;  2DT1 A;  3ARR A;  4J4O A;  2XP7 A;  4DRO A;  5HT1 A;  3RM9 A;  4QIB A;  4DH0 A;  4TYO A;  3RM8 A;  3CGM A;  4J4N A;  1QPL A;  1EIB A;  1UR9 A;  4DRN A;  4TNS A;  2XPA A;  2DG3 A;  1HXV A;  3BXW A;  4JFI A;  4TW6 A;  3ARY A;  3O5E A;  4JFM A;  3RGC A;  1ROU A;  4Z2K A;  4FN2 A;  4GIV A;  3TC5 A;  2L2S A;  3TDB A;  1E15 A;  3JXV A;  3GPK A;  1K9T A;  4W9Q A;  3WIJ A;  5BXJ A;  2MLZ A;  1Q6U A;  3ARU A;  1X6N A;  4DWS D;  1HKM A;  1H0I A;  4Z2H A;  3O5M A;  3ARW A;  1NWU A;  1ROT A;  2RUR A;  3KZ7 A;  3I6C A;  2PPN A;  1H0G A;  4WK9 A;  4DWS C;  2B31 A;  1X6L A;  2PV2 A;  2RQS A;  4S3J A;  4ODM A;  2VCD A;  4S3K A;  3MDY B;  3QOK A;  4IQC A;  3CHD A;  4ITZ A;  5B8I C;  3CZ8 A;  2Y78 A;  3H9R B;  4IPX A;  3AS0 A;  1W9U A;  2WLY A;  3O5L A;  1LL4 A;  3ARS A;  3O5I A;  2PV1 A;  5DEZ A;  4WKH A;  2A3A A;  1NWT A;  2PBC A;  3IKG A;  4R5E A;  5HWC A;  4TW7 A;  4MNL A;  4ZPW R;  3IKD A;  1D7H A;  5HBF A;  4WKA A;  1LQ0 A;  1EHN A;  1FKR A;  1FKI A;  2F4E A;  4AY1 A;  1FFR A;  4Z2I A;  3O5O A;  3UI6 A;  2F21 A;  2DT2 A;  1WAW A;  1JND A;  4ODO A;  1XRV A;  1ZBC A;  4N19 A;  2A3C A;  4DIP A;  2A3B A;  3G6M A;  4G50 A;  1GPF A;  2OLH A;  4TX0 A;  3O5P A;  1ZBK A;  2QF8 A;  1OGG A;  1FD9 A;  4O2T A;  2MPH A;  1NH6 A;  2PI6 A;  4L3N A;  3WH0 A;  1NSG A;  4HBE A;  2ZQT A;  2XP8 A;  4KQZ A;  1E6P A;  4Q22 A;  5GPG A;  4TW8 A;  2MF9 A;  2MLY A;  3ALF A;  4WJX A;  4ODR A;  2XP3 A;  1M5Y A;  4DRM A;  3CHE A;  2LJ4 A;  3UQI A;  4MNK A;  2YBT A;  2D9F A;  1R9H A;  2RUC A;  4IT6 A;  4ODK A;  4DRJ A;  3KAG A;  1LG1 A;  2PPO A;  4URI A;  1N1A A;  3FAP A;  4MNJ A;  1KT0 A;  4HBO A;  2MLX A;  1HKJ A;  4Q7N A;  3PRA A;  1EDQ A;  1QZ2 A;  4L72 B;  4Z2G A;  4ODQ A;  3NTP A;  3EY6 A;  4LGX A;  1PIN A;  1NWS A;  2N87 A;  1T11 A;  4FAP A;  2FKE A;  2DSW A;  2DT3 A;  4P8V A;  1HKK A;  2FAP A;  4IT4 A;  4LAY A;  3PRD A;  3AS1 A;  2DT0 A;  2KE0 A;  1E9L A;  2G8Z A;  1ITX A;  3O5G A;  1KFW A;  1FKF A;  1Y0O A;  3WD1 A;  4DWS B;  4LAV A;  4ZS6 A;  2RUD A;  2M1I A;  1BKF A;  1QPF A;  1W9V A;  4P8X A;  5HW6 A;  1HJV A;  1TFV A;  4MGV A;  4MAV A;  1W1Y A;  1EQ3 A;  4QT2 A;  3O5D A;  1F40 A;  1C9H A;  1W9P A;  3O5K A;  1JVW A;  1D6O A;  1LG2 A;  4KR0 B;  4ZPT R;  3CGN A;  4QT3 A;  5HKG A;  3WD4 A;  3AS2 A;  5DIU A;  4W5U A;  1ZL1 A;  1EYM A;  1J4H A;  5HUA A;  3PA7 A;  3ARX A;  1ZK6 A;  3LUO A;  3W4R A;  2MNT A;  1E6Z A;  1LL6 A;  1NMW A;  5DIT A;  1J4I A;  4ODP A;  1D7I A;  4G2P A;  2M2A A;  2IF4 A;  2Q5A A;  5HWB A;  3O5Q A;  4P8W A;  4QZV B;  4JFJ A;  3KAC A;  2OFN A;  4W9O A;  1E6R A;  1ZCN A;  5DF0 A;  3IHZ A;  3ARP A;  3ARV A;  3JYJ A;  4HAR A;  1B6C A;  4IQ2 A;  2KO7 A;  5HW7 A;  4P8U A;  5GQB A;  3O5J A;  2LPV A;  1FJD A;  2ITK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...