2AWGA

Structure of the ppiase domain of the human fk506-binding protein 8
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
GSPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 38 kDa FK-506 binding protein
publication title Structure of the human FK-506 binding protein 8
rcsb
source organism Homo sapiens
molecule tags Signaling protein inhibitor
total genus 30
structure length 118
sequence length 118
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2awgA00
4DT4A 4JFJA 4DH0A 3O5RA 2JZVA 1L1PA 2ZQTA 3RGCA 1JVWA 2F21A 2KE0A 1FKIA 4U85A 4IQCA 1HXVA 2M1IA 1D7IA 2L2SA 2ZR4A 3O5JA 2KO7A 3I6CA 4JFIA 1NSGA 3KABA 4IPXA 2LKNA 4LAXA 1ROUA 3UQIA 1F8AB 1TCOC 3IKDA 2DG3A 1Q6UA 2DG4A 2ZR5A 4DROA 2FAPA 5HT1A 4DRPA 2ITKA 1YATA 1D7JA 5HW8A 1BL4A 1N1AA 4FAPA 2RURA 2XPBA 4DZ2A 5J6EA 2VN1A 2XP4A 3O5QA 5HW7A 2XPAA 2AWGA 4JFKA 3TC5A 2XP3A 1W26A 3O5GA 2MNTA 1QPFA 2FKEA 2Q5AA 2RUQA 4ODPA 4ODNA 4TW8A 5HWCA 2XP9A 2LJ4A 5B8IC 3PRBA 2VCDA 1ROTA 3KAGA 4W9OA 1ZK6A 2KI3A 5DITA 4LAVA 1U79A 2MPHA 2KFWA 1FKRA 3O5KA 1A7XA 1EYMA 1FKKA 3IHZA 1FKBA 4DRKA 4IQ2A 2ZQUA 2PV1A 4DRMA 4GIVA 1P5QA 2RQSA 4DRQA 2XP5A 1C9HA 4FN2A 2PV2A 1J4HA 4JFLA 3UI6A 5HW6A 1R9HA 4JYSA 4ODOA 3WH0A 4MSPA 2N87A 3UQBA 1J6YA 4G50A 3B7XA 2PPOA 4QT3A 2Y78A 3UF8A 3UI5A 3MDYB 3O5DA 1BKFA 4R0XA 3TCZA 4TW6A 1D7HA 2XP6A 2K8IA 2MLZA 1PINA 2ZQSA 2ZQVA 3CGMA 3LUOA 3KAIA 4ODKA 5DIUA 3VAWA 2MF9A 1FJDA 3CGNA 3O5FA 3KACA 2XP8A 3IKGA 2XP7A 1NMVA 2LPVA 1FKLA 1JNTA 4C02B 4DRJA 5HUAA 5HWBA 1FKTA 2PV3A 4NNRA 2MLYA 4LAWA 3UI4A 1Q6HA 5D75A 2F4EA 3O5PA 2MLXA 4TW7A 5HTGA 1Y0OA 4DRIA 1KT0A 1ZCNA 4N19A 4ITZA 3KAHA 4MGVA 2F2DA 2PPNA 5GPGA 5HKGA 3JXVA 2M2AA 2RUDA 1JNSA 2LGOA 4DRNA 3NI6A 3O5OA 4TYOA 3PA7A 2RUCA 1D6OA 3O5EA 2RSEA 1FKSA 3UQAA 4J4NA 2PBCA 3H9RB 3O5LA 1QZ2A 1EQ3A 4ODQA 2IF4A 4ODMA 4BF8A 1T11A 1J4IA 3O5IA 4GGQA 3ODKA 4JFMA 4QT2A 4LAYA 1J4RA 4G2PA 4U84A 1FKHA 3KAFA 4DZ3A 4J4OA 1F40A 4W9QA 1Q1CA 5DIVA 3JYJA 4ODRA 1FKJA 3RFWA 2DG9A 4DRHA 2ZR6A 4W9PA 4U86A 3FAPA 1YW5A 3JYMA 3NRKA 1FKGA 1KT1A 3KZ7A 4QIBA 1FKDA 1QPLA 3NTPA 3KADA 3TDBA 1FD9A 3GPKA 5I98A 3O5MA 4ODLA 2D9FA 1FKFA 1PBKA 2M08A 3KCEA 4TX0A 3EY6A 4O2TA 2PPPA 3IK8A 1FAPA 1NMWA 2KGJA 2KR7A 4TNSA 5BXJA 4DIPA 1Q6IA 3OOBA 3PRDA 1B6CA 2OFNA 2UZ5A 1M5YA
chains in the Genus database with same CATH superfamily
3O5RA 2WLYA 4P8UA 1K9TA 4U85A 4IQCA 1HXVA 1D7IA 2ZR4A 2KO7A 4DWSD 4IPXA 4LAXA 1ZL1A 4DWSC 1TCOC 4S3KA 3FXYA 3AS2A 1YATA 1D7JA 1N1AA 4DZ2A 4HBEA 2XPAA 2XP3A 3ALFA 5HWCA 1D2KA 3PRBA 1ROTA 2WK2A 1FKRA 4DWSB 1ZU8A 4WJXA 1FKBA 2ZQUA 1P5QA 2RQSA 2A3EA 4DRQA 3RMEA 3UI6A 2P4VA 1J4HA 4ODOA 3WH0A 1NH6A 1E6PA 2PPOA 2Y78A 3MDYB 1E9LA 3O5DA 3TCZA 1XHGA 1KFWA 2ZQSA 3VAWA 3LUOA 5DIUA 3KACA 1NMVA 1FKLA 4DRJA 1ZBWA 1JCHB 2A3AA 4DRIA 4Z2JA 5GPGA 3WQVA 2M2AA 2LGOA 4DRNA 2DT0A 3WL0A 3PA7A 3O5EA 2RSEA 3UQAA 2PBCA 4ML4A 2DSZA 1HKKA 2DT1A 5DF0A 1EQ3A 3ARTA 1HKMA 1J4IA 4MNMA 2DSWA 1X6LA 3QOKA 4U84A 1LG1A 2QF8A 4DZ3A 1GUVA 1E6RA 3JYJA 4Z2HA 3NRKA 1FKGA 1GOIA 5JH8A 3KADA 3WD0A 1FD9A 2D9FA 1FKFA 4TX0A 1LL7A 4IT6A 1Q6IA 2A3BA 1B6CA 3KAGA 1ZBVA 2FDMA 2ESCA 1TFVA 4DT4A 5GQBA 1L1PA 1WNOA 2F21A 1E6NA 3O5JA 4JFIA 1FFRA 1ROUA 3RM9A 1ZB5A 1F8AB 3IKDA 2DG4A 2ZR5A 4DROA 4MNJA 5HT1A 4DRPA 1WAWA 1BL4A 3EIPA 2RURA 2VN1A 4P8VA 2AWGA 2MNTA 1QPFA 2RUQA 2Q5AA 2XP9A 5HBFA 4L3NA 1ZK6A 5DITA 1XRVA 2KFWA 3WQWA 1EYMA 3IHZA 4DRKA 3AROA 1OGGA 2PV1A 4ZPTR 4DRMA 2XP5A 4QZVB 1R9HA 1W1VA 4MSPA 2N87A 3CZ8A 4G50A 1E6ZA 3B7XA 1EIBA 1W1TA 4LGXA 2K8IA 3B8SA 3CGMA 3ARUA 4ODKA 2MF9A 4P8WA 3O5FA 3IKGA 3CHDA 1FKTA 5DEZA 5D75A 2F4EA 4TW7A 3CH9A 1ZCNA 1UR8A 3KAHA 3WKZA 1EDQA 4WKFA 2F2DA 3O5OA 2RUCA 2DT3A 1NWUA 1QZ2A 1LL6A 4ODQA 2IF4A 4XAKA 1SR0A 3O5IA 4GGQA 4LAYA 4DWSA 3CHEA 4G2PA 4P8XA 3ARRA 4W9QA 2G41A 4ODRA 2DG9A 2OLHA 2WLZA 4W9PA 4AY1A 3FAPA 3GPKA 3EY6A 2KGJA 4TNSA 1W1PA 4PTMA 1JNDA 4DIPA 4Z2KA 3PRDA 2DT2A 3OA5A 4JFJA 2JZVA 1H0GA 3RGCA 1FKIA 2DSUA 3B9DA 2L2SA 3ARYA 3I6CA 2YBUA 2LKNA 2B31A 2O92A 4KR0B 5J6EA 2XP4A 3O5QA 5HW7A 4JFKA 4FAPA 1E44A 3CHFA 4MNLA 1HJXA 4ODPA 2G8ZA 2LJ4A 5B8IC 2VCDA 3AS1A 4W9OA 3WD4A 4ZS6A 4NSBA 1U79A 2MPHA 1FKKA 1JNEA 5HW6A 2PV2A 2B5UB 3UQBA 1J6YA 4QT3A 3UI5A 4Z2IA 4R0XA 4TW6A 1SYTA 1LG2A 2ZQVA 3RM8A 1HKIA 3CGNA 4HBOA 2XP7A 1JNTA 5HUAA 5HWBA 2MLYA 3UI4A 3O5PA 3ARZA 2YBTA 3G6MA 3WL1A 1KT0A 4NZCA 1H0IA 2PPNA 5HKGA 3JXVA 1EHNA 1JNSA 3NI6A 1FKSA 4J4NA 3ARWA 1HJVA 3O5LA 3ARPA 4ODMA 3CHCA 1LJYA 1T11A 1IX5A 3ODKA 1J4RA 2DSVA 3KAFA 4KQZA 2DPEA 1F40A 5DIVA 1FKJA 2A3CA 3RFWA 4DRHA 2ZR6A 1ZBKA 3GU0A 4MPKA 1E15A 1KT1A 3KZ7A 1FKDA 3FY1A 1QPLA 3NTPA 1HJWA 3TDBA 1PBKA 4Z2LA 3IK8A 1FAPA 1NMWA 2KR7A 3G6LA 3B9AA 2OFNA 5I98A 4L72B 4UDMA 4ZPVR 4DH0A 2ZQTA 3ARVA 1JVWA 2KE0A 1CTNA 2M1IA 2O9OA 1NSGA 3KABA 3UQIA 1FFQA 1LL4A 1Q6UA 2DG3A 1W1YA 2FAPA 5HW8A 2ITKA 2EULA 2XPBA 1VF8A 5DO2A 3TC5A 3O5GA 1W26A 2WM0A 2FKEA 4ODNA 4TW8A 3ARSA 1NWRA 1LQ0A 2KI3A 4LAVA 3O5KA 3AQUA 1A7XA 2AOSA 1GRJA 4IQ2A 4GIVA 3RM4A 1ITXA 1C9HA 4FN2A 4JFLA 4JYSA 2F23A 1UR9A 2PI6A 4WKAA 3WD2A 3WD1A 3UF8A 1BKFA 4R5EA 5GPRA 1WB0A 1ZBCA 1OGBA 1D7HA 2XP6A 4S3JA 4ZPWR 2MLZA 3WD3A 1PINA 1FJDA 3ALGA 3KAIA 3PR9A 4Q22A 2XP8A 2LPVA 4C02B 4Q7NA 1X6NA 2PV3A 4NNRA 4LAWA 4Z2GA 1Q6HA 2MLXA 4W5UA 5HTGA 4MTVA 1Y0OA 4N19A 4ITZA 4MGVA 1NWSA 2RUDA 1GPFA 3BXWA 4TYOA 3WIJA 3AS3A 1D6OA 3H9RB 4IT4A 2ETNA 3GTYX 1W9UA 3BMBA 1NWTA 3ARQA 4BF8A 4QT2A 1HKJA 2PN0A 4JFMA 2IUZA 4URIA 1FKHA 1O6IA 4HARA 4J4OA 1Q1CA 4WK9A 1RD6A 3ARXA 4U86A 1YW5A 3JYMA 1W9VA 4QIBA 1OWQA 1W9PA 3O5MA 4WKHA 4MAVA 4MNKA 4ODLA 3KCEA 2M08A 3AS0A 4WIWA 4O2TA 2PPPA 3PRAA 5BXJA 3OOBA 3B9EA 3W4RA 2UZ5A 1M5YA
chains in the Genus database with same CATH topology
3O5RA 2WLYA 4P8UA 1K9TA 4U85A 4IQCA 1HXVA 1D7IA 2ZR4A 2KO7A 4DWSD 4IPXA 4LAXA 1ZL1A 4DWSC 1TCOC 4S3KA 3FXYA 3AS2A 1YATA 1D7JA 1N1AA 4DZ2A 4HBEA 2XPAA 2XP3A 3ALFA 5HWCA 1D2KA 3PRBA 1ROTA 2WK2A 1FKRA 4DWSB 1ZU8A 4WJXA 1FKBA 2ZQUA 1P5QA 2RQSA 2A3EA 4DRQA 3RMEA 3UI6A 1J4HA 4ODOA 3WH0A 1NH6A 1E6PA 2PPOA 2Y78A 3MDYB 1E9LA 3O5DA 3TCZA 1XHGA 1KFWA 2ZQSA 3VAWA 3LUOA 5DIUA 3KACA 1NMVA 1FKLA 4DRJA 1ZBWA 2A3AA 4DRIA 4Z2JA 5GPGA 3WQVA 2M2AA 2LGOA 4DRNA 2DT0A 3WL0A 3PA7A 3O5EA 2RSEA 3UQAA 2PBCA 4ML4A 2DSZA 1HKKA 2DT1A 5DF0A 1EQ3A 3ARTA 1HKMA 1J4IA 4MNMA 2DSWA 1X6LA 3QOKA 4U84A 1LG1A 2QF8A 4DZ3A 1GUVA 1E6RA 3JYJA 4Z2HA 3NRKA 1FKGA 1GOIA 5JH8A 3KADA 3WD0A 1FD9A 2D9FA 1FKFA 4TX0A 1LL7A 4IT6A 1Q6IA 2A3BA 1B6CA 3KAGA 1ZBVA 2FDMA 2ESCA 1TFVA 4DT4A 5GQBA 1L1PA 1WNOA 2F21A 1E6NA 3O5JA 4JFIA 1FFRA 1ROUA 3RM9A 1ZB5A 1F8AB 3IKDA 2DG4A 2ZR5A 4DROA 4MNJA 5HT1A 4DRPA 1WAWA 1BL4A 2RURA 2VN1A 4P8VA 2AWGA 2MNTA 1QPFA 2RUQA 2Q5AA 2XP9A 5HBFA 4L3NA 1ZK6A 5DITA 1XRVA 2KFWA 3WQWA 1EYMA 3IHZA 4DRKA 3AROA 1OGGA 2PV1A 4ZPTR 4DRMA 2XP5A 4QZVB 1R9HA 1W1VA 4MSPA 2N87A 3CZ8A 4G50A 1E6ZA 3B7XA 1EIBA 1W1TA 4LGXA 2K8IA 3B8SA 3CGMA 3ARUA 4ODKA 2MF9A 4P8WA 3O5FA 3IKGA 3CHDA 1FKTA 5DEZA 5D75A 2F4EA 4TW7A 3CH9A 1ZCNA 1UR8A 3KAHA 3WKZA 1EDQA 4WKFA 2F2DA 3O5OA 2RUCA 2DT3A 1NWUA 1QZ2A 1LL6A 4ODQA 2IF4A 4XAKA 1SR0A 3O5IA 4GGQA 4LAYA 4DWSA 3CHEA 4G2PA 4P8XA 3ARRA 4W9QA 2G41A 4ODRA 2DG9A 2OLHA 2WLZA 4W9PA 4AY1A 3FAPA 3GPKA 3EY6A 2KGJA 4TNSA 1W1PA 4PTMA 1JNDA 4DIPA 4Z2KA 3PRDA 2DT2A 3OA5A 4JFJA 2JZVA 1H0GA 3RGCA 1FKIA 2DSUA 3B9DA 2L2SA 3ARYA 3I6CA 2YBUA 2LKNA 2B31A 2O92A 4KR0B 5J6EA 2XP4A 3O5QA 5HW7A 4JFKA 4FAPA 3CHFA 4MNLA 1HJXA 4ODPA 2G8ZA 2LJ4A 5B8IC 2VCDA 3AS1A 4W9OA 3WD4A 4ZS6A 4NSBA 1U79A 2MPHA 1FKKA 1JNEA 5HW6A 2PV2A 3UQBA 1J6YA 4QT3A 3UI5A 4Z2IA 4R0XA 4TW6A 1SYTA 1LG2A 2ZQVA 3RM8A 1HKIA 3CGNA 4HBOA 2XP7A 1JNTA 5HUAA 5HWBA 2MLYA 3UI4A 3O5PA 3ARZA 2YBTA 3G6MA 3WL1A 1KT0A 4NZCA 1H0IA 2PPNA 5HKGA 3JXVA 1EHNA 1JNSA 3NI6A 1FKSA 4J4NA 3ARWA 1HJVA 3O5LA 3ARPA 4ODMA 3CHCA 1LJYA 1T11A 1IX5A 3ODKA 1J4RA 2DSVA 3KAFA 4KQZA 2DPEA 1F40A 5DIVA 1FKJA 2A3CA 3RFWA 4DRHA 2ZR6A 1ZBKA 4MPKA 1E15A 1KT1A 3KZ7A 1FKDA 3FY1A 1QPLA 3NTPA 1HJWA 3TDBA 1PBKA 4Z2LA 3IK8A 1FAPA 1NMWA 2KR7A 3G6LA 3B9AA 2OFNA 5I98A 4L72B 4ZPVR 4DH0A 2ZQTA 3ARVA 1JVWA 2KE0A 1CTNA 2M1IA 2O9OA 1NSGA 3KABA 3UQIA 1FFQA 1LL4A 1Q6UA 2DG3A 1W1YA 2FAPA 5HW8A 2ITKA 2XPBA 1VF8A 5DO2A 3TC5A 3O5GA 1W26A 2WM0A 2FKEA 4ODNA 4TW8A 3ARSA 1NWRA 1LQ0A 2KI3A 4LAVA 3O5KA 3AQUA 1A7XA 2AOSA 4IQ2A 4GIVA 3RM4A 1ITXA 1C9HA 4FN2A 4JFLA 4JYSA 1UR9A 2PI6A 4WKAA 3WD2A 3WD1A 3UF8A 1BKFA 4R5EA 5GPRA 1WB0A 1ZBCA 1OGBA 1D7HA 2XP6A 4S3JA 4ZPWR 2MLZA 3WD3A 1PINA 1FJDA 3ALGA 3KAIA 3PR9A 4Q22A 2XP8A 2LPVA 4C02B 4Q7NA 1X6NA 2PV3A 4NNRA 4LAWA 4Z2GA 1Q6HA 2MLXA 4W5UA 5HTGA 4MTVA 1Y0OA 4N19A 4ITZA 4MGVA 1NWSA 2RUDA 1GPFA 3BXWA 4TYOA 3WIJA 3AS3A 1D6OA 3H9RB 4IT4A 1W9UA 1NWTA 3ARQA 4BF8A 4QT2A 1HKJA 4JFMA 2IUZA 4URIA 1FKHA 1O6IA 4HARA 4J4OA 1Q1CA 4WK9A 1RD6A 3ARXA 4U86A 1YW5A 3JYMA 1W9VA 4QIBA 1OWQA 1W9PA 3O5MA 4WKHA 4MAVA 4MNKA 4ODLA 3KCEA 2M08A 3AS0A 4WIWA 4O2TA 2PPPA 3PRAA 5BXJA 3OOBA 3B9EA 3W4RA 2UZ5A 1M5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DT4 A;  4JFJ A;  4DH0 A;  3O5R A;  2JZV A;  1L1P A;  2ZQT A;  3RGC A;  1JVW A;  2F21 A;  2KE0 A;  1FKI A;  4U85 A;  4IQC A;  1HXV A;  2M1I A;  1D7I A;  2L2S A;  2ZR4 A;  3O5J A;  2KO7 A;  3I6C A;  4JFI A;  1NSG A;  3KAB A;  4IPX A;  2LKN A;  4LAX A;  1ROU A;  3UQI A;  1F8A B;  1TCO C;  3IKD A;  2DG3 A;  1Q6U A;  2DG4 A;  2ZR5 A;  4DRO A;  2FAP A;  5HT1 A;  4DRP A;  2ITK A;  1YAT A;  1D7J A;  5HW8 A;  1BL4 A;  1N1A A;  4FAP A;  2RUR A;  2XPB A;  4DZ2 A;  5J6E A;  2VN1 A;  2XP4 A;  3O5Q A;  5HW7 A;  2XPA A;  2AWG A;  4JFK A;  3TC5 A;  2XP3 A;  1W26 A;  3O5G A;  2MNT A;  1QPF A;  2FKE A;  2Q5A A;  2RUQ A;  4ODP A;  4ODN A;  4TW8 A;  5HWC A;  2XP9 A;  2LJ4 A;  5B8I C;  3PRB A;  2VCD A;  1ROT A;  3KAG A;  4W9O A;  1ZK6 A;  2KI3 A;  5DIT A;  4LAV A;  1U79 A;  2MPH A;  2KFW A;  1FKR A;  3O5K A;  1A7X A;  1EYM A;  1FKK A;  3IHZ A;  1FKB A;  4DRK A;  4IQ2 A;  2ZQU A;  2PV1 A;  4DRM A;  4GIV A;  1P5Q A;  2RQS A;  4DRQ A;  2XP5 A;  1C9H A;  4FN2 A;  2PV2 A;  1J4H A;  4JFL A;  3UI6 A;  5HW6 A;  1R9H A;  4JYS A;  4ODO A;  3WH0 A;  4MSP A;  2N87 A;  3UQB A;  1J6Y A;  4G50 A;  3B7X A;  2PPO A;  4QT3 A;  2Y78 A;  3UF8 A;  3UI5 A;  3MDY B;  3O5D A;  1BKF A;  4R0X A;  3TCZ A;  4TW6 A;  1D7H A;  2XP6 A;  2K8I A;  2MLZ A;  1PIN A;  2ZQS A;  2ZQV A;  3CGM A;  3LUO A;  3KAI A;  4ODK A;  5DIU A;  3VAW A;  2MF9 A;  1FJD A;  3CGN A;  3O5F A;  3KAC A;  2XP8 A;  3IKG A;  2XP7 A;  1NMV A;  2LPV A;  1FKL A;  1JNT A;  4C02 B;  4DRJ A;  5HUA A;  5HWB A;  1FKT A;  2PV3 A;  4NNR A;  2MLY A;  4LAW A;  3UI4 A;  1Q6H A;  5D75 A;  2F4E A;  3O5P A;  2MLX A;  4TW7 A;  5HTG A;  1Y0O A;  4DRI A;  1KT0 A;  1ZCN A;  4N19 A;  4ITZ A;  3KAH A;  4MGV A;  2F2D A;  2PPN A;  5GPG A;  5HKG A;  3JXV A;  2M2A A;  2RUD A;  1JNS A;  2LGO A;  4DRN A;  3NI6 A;  3O5O A;  4TYO A;  3PA7 A;  2RUC A;  1D6O A;  3O5E A;  2RSE A;  1FKS A;  3UQA A;  4J4N A;  2PBC A;  3H9R B;  3O5L A;  1QZ2 A;  1EQ3 A;  4ODQ A;  2IF4 A;  4ODM A;  4BF8 A;  1T11 A;  1J4I A;  3O5I A;  4GGQ A;  3ODK A;  4JFM A;  4QT2 A;  4LAY A;  1J4R A;  4G2P A;  4U84 A;  1FKH A;  3KAF A;  4DZ3 A;  4J4O A;  1F40 A;  4W9Q A;  1Q1C A;  5DIV A;  3JYJ A;  4ODR A;  1FKJ A;  3RFW A;  2DG9 A;  4DRH A;  2ZR6 A;  4W9P A;  4U86 A;  3FAP A;  1YW5 A;  3JYM A;  3NRK A;  1FKG A;  1KT1 A;  3KZ7 A;  4QIB A;  1FKD A;  1QPL A;  3NTP A;  3KAD A;  3TDB A;  1FD9 A;  3GPK A;  5I98 A;  3O5M A;  4ODL A;  2D9F A;  1FKF A;  1PBK A;  2M08 A;  3KCE A;  4TX0 A;  3EY6 A;  4O2T A;  2PPP A;  3IK8 A;  1FAP A;  1NMW A;  2KGJ A;  2KR7 A;  4TNS A;  5BXJ A;  4DIP A;  1Q6I A;  3OOB A;  3PRD A;  1B6C A;  2OFN A;  2UZ5 A;  1M5Y A; 
#chains in the Genus database with same CATH topology
 3O5R A;  2WLY A;  4P8U A;  1K9T A;  4U85 A;  4IQC A;  1HXV A;  1D7I A;  2ZR4 A;  2KO7 A;  4DWS D;  4IPX A;  4LAX A;  1ZL1 A;  4DWS C;  1TCO C;  4S3K A;  3FXY A;  3AS2 A;  1YAT A;  1D7J A;  1N1A A;  4DZ2 A;  4HBE A;  2XPA A;  2XP3 A;  3ALF A;  5HWC A;  1D2K A;  3PRB A;  1ROT A;  2WK2 A;  1FKR A;  4DWS B;  1ZU8 A;  4WJX A;  1FKB A;  2ZQU A;  1P5Q A;  2RQS A;  2A3E A;  4DRQ A;  3RME A;  3UI6 A;  2P4V A;  1J4H A;  4ODO A;  3WH0 A;  1NH6 A;  1E6P A;  2PPO A;  2Y78 A;  3MDY B;  1E9L A;  3O5D A;  3TCZ A;  1XHG A;  1KFW A;  2ZQS A;  3VAW A;  3LUO A;  5DIU A;  3KAC A;  1NMV A;  1FKL A;  4DRJ A;  1ZBW A;  1JCH B;  2A3A A;  4DRI A;  4Z2J A;  5GPG A;  3WQV A;  2M2A A;  2LGO A;  4DRN A;  2DT0 A;  3WL0 A;  3PA7 A;  3O5E A;  2RSE A;  3UQA A;  2PBC A;  4ML4 A;  2DSZ A;  1HKK A;  2DT1 A;  5DF0 A;  1EQ3 A;  3ART A;  1HKM A;  1J4I A;  4MNM A;  2DSW A;  1X6L A;  3QOK A;  4U84 A;  1LG1 A;  2QF8 A;  4DZ3 A;  1GUV A;  1E6R A;  3JYJ A;  4Z2H A;  3NRK A;  1FKG A;  1GOI A;  5JH8 A;  3KAD A;  3WD0 A;  1FD9 A;  2D9F A;  1FKF A;  4TX0 A;  1LL7 A;  4IT6 A;  1Q6I A;  2A3B A;  1B6C A;  3KAG A;  1ZBV A;  2FDM A;  2ESC A;  1TFV A;  4DT4 A;  5GQB A;  1L1P A;  1WNO A;  2F21 A;  1E6N A;  3O5J A;  4JFI A;  1FFR A;  1ROU A;  3RM9 A;  1ZB5 A;  1F8A B;  3IKD A;  2DG4 A;  2ZR5 A;  4DRO A;  4MNJ A;  5HT1 A;  4DRP A;  1WAW A;  1BL4 A;  3EIP A;  2RUR A;  2VN1 A;  4P8V A;  2AWG A;  2MNT A;  1QPF A;  2RUQ A;  2Q5A A;  2XP9 A;  5HBF A;  4L3N A;  1ZK6 A;  5DIT A;  1XRV A;  2KFW A;  3WQW A;  1EYM A;  3IHZ A;  4DRK A;  3ARO A;  1OGG A;  2PV1 A;  4ZPT R;  4DRM A;  2XP5 A;  4QZV B;  1R9H A;  1W1V A;  4MSP A;  2N87 A;  3CZ8 A;  4G50 A;  1E6Z A;  3B7X A;  1EIB A;  1W1T A;  4LGX A;  2K8I A;  3B8S A;  3CGM A;  3ARU A;  4ODK A;  2MF9 A;  4P8W A;  3O5F A;  3IKG A;  3CHD A;  1FKT A;  5DEZ A;  5D75 A;  2F4E A;  4TW7 A;  3CH9 A;  1ZCN A;  1UR8 A;  3KAH A;  3WKZ A;  1EDQ A;  4WKF A;  2F2D A;  3O5O A;  2RUC A;  2DT3 A;  1NWU A;  1QZ2 A;  1LL6 A;  4ODQ A;  2IF4 A;  4XAK A;  1SR0 A;  3O5I A;  4GGQ A;  4LAY A;  4DWS A;  3CHE A;  4G2P A;  4P8X A;  3ARR A;  4W9Q A;  2G41 A;  4ODR A;  2DG9 A;  2OLH A;  2WLZ A;  4W9P A;  4AY1 A;  3FAP A;  3GPK A;  3EY6 A;  2KGJ A;  4TNS A;  1W1P A;  4PTM A;  1JND A;  4DIP A;  4Z2K A;  3PRD A;  2DT2 A;  3OA5 A;  4JFJ A;  2JZV A;  1H0G A;  3RGC A;  1FKI A;  2DSU A;  3B9D A;  2L2S A;  3ARY A;  3I6C A;  2YBU A;  2LKN A;  2B31 A;  2O92 A;  4KR0 B;  5J6E A;  2XP4 A;  3O5Q A;  5HW7 A;  4JFK A;  4FAP A;  1E44 A;  3CHF A;  4MNL A;  1HJX A;  4ODP A;  2G8Z A;  2LJ4 A;  5B8I C;  2VCD A;  3AS1 A;  4W9O A;  3WD4 A;  4ZS6 A;  4NSB A;  1U79 A;  2MPH A;  1FKK A;  1JNE A;  5HW6 A;  2PV2 A;  2B5U B;  3UQB A;  1J6Y A;  4QT3 A;  3UI5 A;  4Z2I A;  4R0X A;  4TW6 A;  1SYT A;  1LG2 A;  2ZQV A;  3RM8 A;  1HKI A;  3CGN A;  4HBO A;  2XP7 A;  1JNT A;  5HUA A;  5HWB A;  2MLY A;  3UI4 A;  3O5P A;  3ARZ A;  2YBT A;  3G6M A;  3WL1 A;  1KT0 A;  4NZC A;  1H0I A;  2PPN A;  5HKG A;  3JXV A;  1EHN A;  1JNS A;  3NI6 A;  1FKS A;  4J4N A;  3ARW A;  1HJV A;  3O5L A;  3ARP A;  4ODM A;  3CHC A;  1LJY A;  1T11 A;  1IX5 A;  3ODK A;  1J4R A;  2DSV A;  3KAF A;  4KQZ A;  2DPE A;  1F40 A;  5DIV A;  1FKJ A;  2A3C A;  3RFW A;  4DRH A;  2ZR6 A;  1ZBK A;  3GU0 A;  4MPK A;  1E15 A;  1KT1 A;  3KZ7 A;  1FKD A;  3FY1 A;  1QPL A;  3NTP A;  1HJW A;  3TDB A;  1PBK A;  4Z2L A;  3IK8 A;  1FAP A;  1NMW A;  2KR7 A;  3G6L A;  3B9A A;  2OFN A;  5I98 A;  4L72 B;  4UDM A;  4ZPV R;  4DH0 A;  2ZQT A;  3ARV A;  1JVW A;  2KE0 A;  1CTN A;  2M1I A;  2O9O A;  1NSG A;  3KAB A;  3UQI A;  1FFQ A;  1LL4 A;  1Q6U A;  2DG3 A;  1W1Y A;  2FAP A;  5HW8 A;  2ITK A;  2EUL A;  2XPB A;  1VF8 A;  5DO2 A;  3TC5 A;  3O5G A;  1W26 A;  2WM0 A;  2FKE A;  4ODN A;  4TW8 A;  3ARS A;  1NWR A;  1LQ0 A;  2KI3 A;  4LAV A;  3O5K A;  3AQU A;  1A7X A;  2AOS A;  1GRJ A;  4IQ2 A;  4GIV A;  3RM4 A;  1ITX A;  1C9H A;  4FN2 A;  4JFL A;  4JYS A;  2F23 A;  1UR9 A;  2PI6 A;  4WKA A;  3WD2 A;  3WD1 A;  3UF8 A;  1BKF A;  4R5E A;  5GPR A;  1WB0 A;  1ZBC A;  1OGB A;  1D7H A;  2XP6 A;  4S3J A;  4ZPW R;  2MLZ A;  3WD3 A;  1PIN A;  1FJD A;  3ALG A;  3KAI A;  3PR9 A;  4Q22 A;  2XP8 A;  2LPV A;  4C02 B;  4Q7N A;  1X6N A;  2PV3 A;  4NNR A;  4LAW A;  4Z2G A;  1Q6H A;  2MLX A;  4W5U A;  5HTG A;  4MTV A;  1Y0O A;  4N19 A;  4ITZ A;  4MGV A;  1NWS A;  2RUD A;  1GPF A;  3BXW A;  4TYO A;  3WIJ A;  3AS3 A;  1D6O A;  3H9R B;  4IT4 A;  2ETN A;  3GTY X;  1W9U A;  3BMB A;  1NWT A;  3ARQ A;  4BF8 A;  4QT2 A;  1HKJ A;  2PN0 A;  4JFM A;  2IUZ A;  4URI A;  1FKH A;  1O6I A;  4HAR A;  4J4O A;  1Q1C A;  4WK9 A;  1RD6 A;  3ARX A;  4U86 A;  1YW5 A;  3JYM A;  1W9V A;  4QIB A;  1OWQ A;  1W9P A;  3O5M A;  4WKH A;  4MAV A;  4MNK A;  4ODL A;  3KCE A;  2M08 A;  3AS0 A;  4WIW A;  4O2T A;  2PPP A;  3PRA A;  5BXJ A;  3OOB A;  3B9E A;  3W4R A;  2UZ5 A;  1M5Y A; 
#chains in the Genus database with same CATH homology
 3O5R A;  2WLY A;  4P8U A;  1K9T A;  4U85 A;  4IQC A;  1HXV A;  1D7I A;  2ZR4 A;  2KO7 A;  4DWS D;  4IPX A;  4LAX A;  1ZL1 A;  4DWS C;  1TCO C;  4S3K A;  3FXY A;  3AS2 A;  1YAT A;  1D7J A;  1N1A A;  4DZ2 A;  4HBE A;  2XPA A;  2XP3 A;  3ALF A;  5HWC A;  1D2K A;  3PRB A;  1ROT A;  2WK2 A;  1FKR A;  4DWS B;  1ZU8 A;  4WJX A;  1FKB A;  2ZQU A;  1P5Q A;  2RQS A;  2A3E A;  4DRQ A;  3RME A;  3UI6 A;  1J4H A;  4ODO A;  3WH0 A;  1NH6 A;  1E6P A;  2PPO A;  2Y78 A;  3MDY B;  1E9L A;  3O5D A;  3TCZ A;  1XHG A;  1KFW A;  2ZQS A;  3VAW A;  3LUO A;  5DIU A;  3KAC A;  1NMV A;  1FKL A;  4DRJ A;  1ZBW A;  2A3A A;  4DRI A;  4Z2J A;  5GPG A;  3WQV A;  2M2A A;  2LGO A;  4DRN A;  2DT0 A;  3WL0 A;  3PA7 A;  3O5E A;  2RSE A;  3UQA A;  2PBC A;  4ML4 A;  2DSZ A;  1HKK A;  2DT1 A;  5DF0 A;  1EQ3 A;  3ART A;  1HKM A;  1J4I A;  4MNM A;  2DSW A;  1X6L A;  3QOK A;  4U84 A;  1LG1 A;  2QF8 A;  4DZ3 A;  1GUV A;  1E6R A;  3JYJ A;  4Z2H A;  3NRK A;  1FKG A;  1GOI A;  5JH8 A;  3KAD A;  3WD0 A;  1FD9 A;  2D9F A;  1FKF A;  4TX0 A;  1LL7 A;  4IT6 A;  1Q6I A;  2A3B A;  1B6C A;  3KAG A;  1ZBV A;  2FDM A;  2ESC A;  1TFV A;  4DT4 A;  5GQB A;  1L1P A;  1WNO A;  2F21 A;  1E6N A;  3O5J A;  4JFI A;  1FFR A;  1ROU A;  3RM9 A;  1ZB5 A;  1F8A B;  3IKD A;  2DG4 A;  2ZR5 A;  4DRO A;  4MNJ A;  5HT1 A;  4DRP A;  1WAW A;  1BL4 A;  2RUR A;  2VN1 A;  4P8V A;  2AWG A;  2MNT A;  1QPF A;  2RUQ A;  2Q5A A;  2XP9 A;  5HBF A;  4L3N A;  1ZK6 A;  5DIT A;  1XRV A;  2KFW A;  3WQW A;  1EYM A;  3IHZ A;  4DRK A;  3ARO A;  1OGG A;  2PV1 A;  4ZPT R;  4DRM A;  2XP5 A;  4QZV B;  1R9H A;  1W1V A;  4MSP A;  2N87 A;  3CZ8 A;  4G50 A;  1E6Z A;  3B7X A;  1EIB A;  1W1T A;  4LGX A;  2K8I A;  3B8S A;  3CGM A;  3ARU A;  4ODK A;  2MF9 A;  4P8W A;  3O5F A;  3IKG A;  3CHD A;  1FKT A;  5DEZ A;  5D75 A;  2F4E A;  4TW7 A;  3CH9 A;  1ZCN A;  1UR8 A;  3KAH A;  3WKZ A;  1EDQ A;  4WKF A;  2F2D A;  3O5O A;  2RUC A;  2DT3 A;  1NWU A;  1QZ2 A;  1LL6 A;  4ODQ A;  2IF4 A;  4XAK A;  1SR0 A;  3O5I A;  4GGQ A;  4LAY A;  4DWS A;  3CHE A;  4G2P A;  4P8X A;  3ARR A;  4W9Q A;  2G41 A;  4ODR A;  2DG9 A;  2OLH A;  2WLZ A;  4W9P A;  4AY1 A;  3FAP A;  3GPK A;  3EY6 A;  2KGJ A;  4TNS A;  1W1P A;  4PTM A;  1JND A;  4DIP A;  4Z2K A;  3PRD A;  2DT2 A;  3OA5 A;  4JFJ A;  2JZV A;  1H0G A;  3RGC A;  1FKI A;  2DSU A;  3B9D A;  2L2S A;  3ARY A;  3I6C A;  2YBU A;  2LKN A;  2B31 A;  2O92 A;  4KR0 B;  5J6E A;  2XP4 A;  3O5Q A;  5HW7 A;  4JFK A;  4FAP A;  3CHF A;  4MNL A;  1HJX A;  4ODP A;  2G8Z A;  2LJ4 A;  5B8I C;  2VCD A;  3AS1 A;  4W9O A;  3WD4 A;  4ZS6 A;  4NSB A;  1U79 A;  2MPH A;  1FKK A;  1JNE A;  5HW6 A;  2PV2 A;  3UQB A;  1J6Y A;  4QT3 A;  3UI5 A;  4Z2I A;  4R0X A;  4TW6 A;  1SYT A;  1LG2 A;  2ZQV A;  3RM8 A;  1HKI A;  3CGN A;  4HBO A;  2XP7 A;  1JNT A;  5HUA A;  5HWB A;  2MLY A;  3UI4 A;  3O5P A;  3ARZ A;  2YBT A;  3G6M A;  3WL1 A;  1KT0 A;  4NZC A;  1H0I A;  2PPN A;  5HKG A;  3JXV A;  1EHN A;  1JNS A;  3NI6 A;  1FKS A;  4J4N A;  3ARW A;  1HJV A;  3O5L A;  3ARP A;  4ODM A;  3CHC A;  1LJY A;  1T11 A;  1IX5 A;  3ODK A;  1J4R A;  2DSV A;  3KAF A;  4KQZ A;  2DPE A;  1F40 A;  5DIV A;  1FKJ A;  2A3C A;  3RFW A;  4DRH A;  2ZR6 A;  1ZBK A;  4MPK A;  1E15 A;  1KT1 A;  3KZ7 A;  1FKD A;  3FY1 A;  1QPL A;  3NTP A;  1HJW A;  3TDB A;  1PBK A;  4Z2L A;  3IK8 A;  1FAP A;  1NMW A;  2KR7 A;  3G6L A;  3B9A A;  2OFN A;  5I98 A;  4L72 B;  4ZPV R;  4DH0 A;  2ZQT A;  3ARV A;  1JVW A;  2KE0 A;  1CTN A;  2M1I A;  2O9O A;  1NSG A;  3KAB A;  3UQI A;  1FFQ A;  1LL4 A;  1Q6U A;  2DG3 A;  1W1Y A;  2FAP A;  5HW8 A;  2ITK A;  2XPB A;  1VF8 A;  5DO2 A;  3TC5 A;  3O5G A;  1W26 A;  2WM0 A;  2FKE A;  4ODN A;  4TW8 A;  3ARS A;  1NWR A;  1LQ0 A;  2KI3 A;  4LAV A;  3O5K A;  3AQU A;  1A7X A;  2AOS A;  4IQ2 A;  4GIV A;  3RM4 A;  1ITX A;  1C9H A;  4FN2 A;  4JFL A;  4JYS A;  1UR9 A;  2PI6 A;  4WKA A;  3WD2 A;  3WD1 A;  3UF8 A;  1BKF A;  4R5E A;  5GPR A;  1WB0 A;  1ZBC A;  1OGB A;  1D7H A;  2XP6 A;  4S3J A;  4ZPW R;  2MLZ A;  3WD3 A;  1PIN A;  1FJD A;  3ALG A;  3KAI A;  3PR9 A;  4Q22 A;  2XP8 A;  2LPV A;  4C02 B;  4Q7N A;  1X6N A;  2PV3 A;  4NNR A;  4LAW A;  4Z2G A;  1Q6H A;  2MLX A;  4W5U A;  5HTG A;  4MTV A;  1Y0O A;  4N19 A;  4ITZ A;  4MGV A;  1NWS A;  2RUD A;  1GPF A;  3BXW A;  4TYO A;  3WIJ A;  3AS3 A;  1D6O A;  3H9R B;  4IT4 A;  1W9U A;  1NWT A;  3ARQ A;  4BF8 A;  4QT2 A;  1HKJ A;  4JFM A;  2IUZ A;  4URI A;  1FKH A;  1O6I A;  4HAR A;  4J4O A;  1Q1C A;  4WK9 A;  1RD6 A;  3ARX A;  4U86 A;  1YW5 A;  3JYM A;  1W9V A;  4QIB A;  1OWQ A;  1W9P A;  3O5M A;  4WKH A;  4MAV A;  4MNK A;  4ODL A;  3KCE A;  2M08 A;  3AS0 A;  4WIW A;  4O2T A;  2PPP A;  3PRA A;  5BXJ A;  3OOB A;  3B9E A;  3W4R A;  2UZ5 A;  1M5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...