2AWGA

Structure of the ppiase domain of the human fk506-binding protein 8
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
GSPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the human FK-506 binding protein 8
rcsb
source organism Homo sapiens
molecule tags Signaling protein inhibitor
molecule keywords 38 kDa FK-506 binding protein
total genus 30
structure length 118
sequence length 118
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2awgA00
2M2AA 1J4IA 1D7HA 2PV3A 1D7JA 1YATA 1NSGA 1PINA 2KFWA 5HKGA 1FKBA 4C02B 2JZVA 4DROA 1Q6UA 3RFWA 3UQAA 5HWBA 4LAVA 1Q6HA 3MDYB 4R0XA 2D9FA 4QT3A 1ZK6A 1L1PA 4ODRA 3KABA 1FKKA 4LAWA 3O5GA 1FJDA 3O5FA 2ITKA 3KZ7A 4IPXA 1EYMA 1F8AB 1FKHA 1W26A 1JNTA 1D6OA 2LPVA 5HUAA 1QZ2A 2KGJA 5GPGA 5HWCA 2LKNA 1Y0OA 2OFNA 3O5JA 1QPLA 1ROUA 3KAGA 5DIUA 4DRNA 2PPPA 2K8IA 3O5EA 4TYOA 2M1IA 3IHZA 1TCOC 4N19A 1NMVA 1YW5A 3IKGA 3NTPA 4O2TA 2VN1A 2Y78A 1J4RA 5HW7A 1KT1A 1HXVA 1T11A 3TC5A 4NNRA 3KAFA 4J4NA 5HTGA 1F40A 5D75A 4DZ3A 1C9HA 1N1AA 3FAPA 2MNTA 1JNSA 2N87A 2XP7A 2DG9A 3PRBA 2PV2A 3UI6A 4DT4A 4FN2A 4MGVA 1U79A 2XPBA 3UF8A 5B8IC 4MSPA 2MLZA 2F21A 4W9QA 3O5OA 1FD9A 1P5QA 3O5QA 2KE0A 4U84A 2XP8A 4DRHA 1BKFA 2XPAA 1JVWA 3KCEA 3NRKA 3LUOA 4ODOA 1Q1CA 1FKDA 3UI5A 5HW6A 2DG3A 3ODKA 4QT2A 4FAPA 1J6YA 2F2DA 4JFKA 4ODPA 1J4HA 1M5YA 3PA7A 5DITA 3OOBA 3O5DA 4ODQA 4TNSA 2KI3A 1PBKA 4IQCA 1QPFA 4ITZA 4TW7A 5HT1A 3IK8A 1FKIA 4W9PA 1Q6IA 3CGMA 3JYMA 1ROTA 4DRJA 4DRMA 2RQSA 4U85A 1ZCNA 1FKTA 3VAWA 4DIPA 2XP3A 4G2PA 3NI6A 4U86A 1FAPA 3H9RB 4JYSA 4TW6A 3JYJA 3O5MA 4JFLA 4QIBA 2XP5A 2DG4A 3RGCA 4BF8A 2MF9A 3KACA 2LJ4A 3TDBA 3EY6A 4LAXA 1NMWA 2F4EA 3O5PA 3IKDA 4IQ2A 1FKRA 2PV1A 4DRKA 3I6CA 4DRPA 5BXJA 2Q5AA 1FKGA 4W9OA 5J6EA 4DRQA 2ZQVA 4J4OA 3B7XA 2PBCA 2ZR5A 3CGNA 2FAPA 2FKEA 2IF4A 2RUDA 4GIVA 4ODNA 2XP6A 2PPOA 4LAYA 5DIVA 5I98A 1FKFA 4DH0A 2RUQA 3O5IA 2XP9A 2MLYA 2ZQSA 2LGOA 4TW8A 2MPHA 2VCDA 1BL4A 2KR7A 2ZQUA 2ZR6A 3O5RA 1B6CA 1FKJA 1FKLA 2KO7A 3O5KA 3UI4A 4G50A 1FKSA 1EQ3A 3JXVA 1KT0A 4DRIA 2XP4A 4JFMA 2L2SA 1R9HA 3KADA 4ODMA 1A7XA 3GPKA 2RSEA 1D7IA 3O5LA 4GGQA 2UZ5A 4JFIA 4ODLA 2RUCA 3TCZA 3UQIA 4DZ2A 2ZR4A 3PRDA 2AWGA 2M08A 2RURA 2ZQTA 3KAHA 4TX0A 5HW8A 3UQBA 2PPNA 4ODKA 3WH0A 2MLXA 4JFJA 3KAIA
chains in the Genus database with same CATH superfamily
1D7HA 1D7JA 4HARA 1FKBA 4DROA 3WD2A 3W4RA 3MDYB 4R0XA 3ARSA 5DF0A 1HKJA 3KZ7A 2A3CA 1FKHA 5HUAA 1UR8A 1D6OA 3CHCA 5GPGA 4WJXA 5DIUA 3B9DA 3ALGA 4O2TA 3RM8A 1J4RA 5HW7A 1T11A 3ARXA 2G8ZA 4DWSD 3PRBA 3RM9A 4DWSA 1U79A 2YBTA 2XPBA 1ZU8A 3O5QA 2XP8A 3NRKA 1FKDA 3AS1A 3ODKA 4QT2A 1J6YA 4P8WA 1UR9A 4W5UA 5DITA 2PI6A 4ODQA 2A3EA 4ITZA 4TW7A 1FKIA 3AS3A 1Q6IA 4MNLA 2ESCA 3VAWA 2XP3A 3CHEA 4TW6A 3JYJA 4Z2IA 5GQBA 4BF8A 2MF9A 3EY6A 3CZ8A 3BMBA 3WIJA 2PV1A 1ZBVA 2Q5AA 4W9OA 5J6EA 3FY1A 4L3NA 4J4OA 2FAPA 2DPEA 4ODNA 1FKFA 1HKIA 2DT3A 2WK2A 2ZQSA 1NWSA 1E15A 2IUZA 2ZR6A 1ZBWA 2ZQUA 1JNDA 2KO7A 1EQ3A 2XP4A 3KADA 4DZ2A 3AS0A 3AROA 1XHGA 2PN0A 3WD1A 1O6IA 4ODKA 4UDMA 3KAIA 2M2AA 1H0GA 1YATA 2A3BA 2KFWA 1Q6UA 3WL0A 4WKFA 4MTVA 4QT3A 1ZK6A 2DSZA 1L1PA 1FKKA 1FJDA 3O5FA 2ITKA 2DSVA 1WAWA 1LL4A 1GRJA 5HWCA 2LKNA 1LG1A 1NH6A 2OFNA 3O5JA 1QPLA 2DSUA 4DRNA 2EULA 4TYOA 3IHZA 1TCOC 1NWUA 1YW5A 3NTPA 1HJWA 1GOIA 2Y78A 1KT1A 3ARUA 5D75A 1RD6A 1SYTA 2MNTA 1JNSA 2N87A 2XP7A 2DG9A 3UI6A 1OGBA 4FN2A 1KFWA 1E9LA 1HJVA 4P8XA 1ZB5A 1FD9A 3CHFA 4U84A 1CTNA 1BKFA 5DEZA 3KCEA 3LUOA 1Q1CA 4DWSC 1M5YA 3EIPA 4TNSA 3O5DA 4IQCA 1QPFA 4P8UA 5HT1A 3CGMA 4Z2JA 4DRMA 2WLZA 4U85A 1ZCNA 1FKTA 4G2PA 3WD3A 1W9UA 4MNKA 2DG4A 4HBOA 1HKMA 2YBUA 3KACA 2LJ4A 4L72B 3BXWA 4DRKA 4DRPA 1LG2A 3AQUA 1D2KA 2IF4A 1ITXA 4Z2HA 1E6PA 2XP6A 4LAYA 5I98A 2RUQA 3O5IA 3B9AA 4TW8A 4S3KA 1BL4A 1E6RA 1FKJA 2G41A 1KT0A 1LQ0A 2L2SA 1FFQA 4IT6A 4ODMA 4JFIA 1GPFA 4GGQA 1D7IA 1GUVA 3ARVA 2RUCA 2ZR4A 3WD4A 3ARPA 3PRDA 4Z2GA 4TX0A 2ZQTA 4JFJA 2DSWA 3B9EA 4NSBA 4KR0B 2F23A 4C02B 3RM4A 2JZVA 4WKHA 4AY1A 3UQAA 4P8VA 5HWBA 2D9FA 3AS2A 4ODRA 3KABA 4ML4A 4LAWA 3O5GA 1IX5A 4IPXA 1EYMA 1F8AB 2LPVA 4WK9A 1QZ2A 2KGJA 1HJXA 4Z2LA 1NWRA 3KAGA 2K8IA 2M1IA 1LL6A 4N19A 1NMVA 2WM0A 3G6MA 1EHNA 2DT2A 1X6LA 1HXVA 3TC5A 1HKKA 3KAFA 4J4NA 4NNRA 3QOKA 4MNJA 1N1AA 1NWTA 4Q7NA 2PV2A 1SR0A 1EIBA 4MSPA 2MLZA 2F21A 3O5OA 1P5QA 2KE0A 3WL1A 1ZL1A 4IT4A 4ODOA 4URIA 3ARWA 2DG3A 1JCHB 4FAPA 2F2DA 3B8SA 4ODPA 1J4HA 1OGGA 3PA7A 3PR9A 2KI3A 3ARZA 4DRJA 3GU0A 3IK8A 3JYMA 1ROTA 2OLHA 2RQSA 4MPKA 3FXYA 1W1VA 3NI6A 3ALFA 4U86A 1FAPA 3H9RB 4JYSA 3RGCA 2XP5A 4MNMA 1NMWA 4IQ2A 1FKRA 3IKDA 4Q22A 3I6CA 5HBFA 2ZQVA 2ZR5A 3CGNA 2DT1A 4QZVB 4WIWA 2RUDA 4GIVA 4S3JA 2AOSA 2PPOA 5DIVA 3PRAA 2P4VA 1WNOA 2LGOA 2VCDA 4HBEA 1EDQA 2KR7A 1VF8A 1TFVA 3O5KA 3UI4A 2FDMA 4G50A 1FKSA 1LL7A 4DRIA 3GTYX 4DT4A 1K9TA 3UQIA 4ODLA 3TCZA 3ARQA 3CHDA 3RMEA 2AWGA 2M08A 3KAHA 2WLYA 5HW8A 1X6NA 2B5UB 3ARYA 1WB0A 1J4IA 2PV3A 1NSGA 1PINA 2B31A 5HKGA 4KQZA 4MAVA 3RFWA 4LAVA 1Q6HA 4LGXA 3WD0A 1ZBCA 4ZS6A 4DWSB 1W26A 1JNTA 1Y0OA 4ZPWR 1ROUA 2PPPA 3O5EA 1E44A 3IKGA 5GPRA 2VN1A 4Z2KA 1W9VA 3WKZA 5HTGA 1F40A 4DZ3A 1C9HA 3FAPA 1ZBKA 4MGVA 5JH8A 3UF8A 5B8IC 3CH9A 4XAKA 4W9QA 2QF8A 4DRHA 2XPAA 1JVWA 2DT0A 3WQVA 1W1TA 3UI5A 5HW6A 3OA5A 4ZPTR 4JFKA 3ARTA 3G6LA 3OOBA 1PBKA 1W1PA 4PTMA 4W9PA 1XRVA 4DIPA 4ZPVR 3O5MA 4JFLA 4QIBA 2A3AA 2ETNA 4WKAA 3TDBA 4LAXA 5DO2A 1H0IA 2F4EA 3O5PA 5BXJA 2O9OA 1E6NA 1FKGA 1FFRA 4DRQA 3B7XA 2PBCA 2FKEA 2O92A 4R5EA 4DH0A 2XP9A 2MLYA 3ARRA 2MPHA 4NZCA 1JNEA 3O5RA 1B6CA 1FKLA 1OWQA 3JXVA 4JFMA 1R9HA 1A7XA 3GPKA 1E6ZA 3O5LA 2RSEA 2UZ5A 1W9PA 1W1YA 3WQWA 2RURA 1LJYA 3UQBA 2PPNA 3WH0A 2MLXA
chains in the Genus database with same CATH topology
1D7HA 1D7JA 4HARA 1FKBA 4DROA 3WD2A 3W4RA 3MDYB 4R0XA 3ARSA 5DF0A 1HKJA 3KZ7A 2A3CA 1FKHA 5HUAA 1UR8A 1D6OA 3CHCA 5GPGA 4WJXA 5DIUA 3B9DA 3ALGA 4O2TA 3RM8A 1J4RA 5HW7A 1T11A 3ARXA 2G8ZA 4DWSD 3PRBA 3RM9A 4DWSA 1U79A 2YBTA 2XPBA 1ZU8A 3O5QA 2XP8A 3NRKA 1FKDA 3AS1A 3ODKA 4QT2A 1J6YA 4P8WA 1UR9A 4W5UA 5DITA 2PI6A 4ODQA 2A3EA 4ITZA 4TW7A 1FKIA 3AS3A 1Q6IA 4MNLA 2ESCA 3VAWA 2XP3A 3CHEA 4TW6A 3JYJA 4Z2IA 5GQBA 4BF8A 2MF9A 3EY6A 3CZ8A 3WIJA 2PV1A 1ZBVA 2Q5AA 4W9OA 5J6EA 3FY1A 4L3NA 4J4OA 2FAPA 2DPEA 4ODNA 1FKFA 1HKIA 2DT3A 2WK2A 2ZQSA 1NWSA 1E15A 2IUZA 2ZR6A 1ZBWA 2ZQUA 1JNDA 2KO7A 1EQ3A 2XP4A 3KADA 4DZ2A 3AS0A 3AROA 1XHGA 3WD1A 1O6IA 4ODKA 3KAIA 2M2AA 1H0GA 1YATA 2A3BA 2KFWA 1Q6UA 3WL0A 4WKFA 4MTVA 4QT3A 1ZK6A 2DSZA 1L1PA 1FKKA 1FJDA 3O5FA 2ITKA 2DSVA 1WAWA 1LL4A 5HWCA 2LKNA 1LG1A 1NH6A 2OFNA 3O5JA 1QPLA 2DSUA 4DRNA 4TYOA 3IHZA 1TCOC 1NWUA 1YW5A 3NTPA 1HJWA 1GOIA 2Y78A 1KT1A 3ARUA 5D75A 1RD6A 1SYTA 2MNTA 1JNSA 2N87A 2XP7A 2DG9A 3UI6A 1OGBA 4FN2A 1KFWA 1E9LA 1HJVA 4P8XA 1ZB5A 1FD9A 3CHFA 4U84A 1CTNA 1BKFA 5DEZA 3KCEA 3LUOA 1Q1CA 4DWSC 1M5YA 4TNSA 3O5DA 4IQCA 1QPFA 4P8UA 5HT1A 3CGMA 4Z2JA 4DRMA 2WLZA 4U85A 1ZCNA 1FKTA 4G2PA 3WD3A 1W9UA 4MNKA 2DG4A 4HBOA 1HKMA 2YBUA 3KACA 2LJ4A 4L72B 3BXWA 4DRKA 4DRPA 1LG2A 3AQUA 1D2KA 2IF4A 1ITXA 4Z2HA 1E6PA 2XP6A 4LAYA 5I98A 2RUQA 3O5IA 3B9AA 4TW8A 4S3KA 1BL4A 1E6RA 1FKJA 2G41A 1KT0A 1LQ0A 2L2SA 1FFQA 4IT6A 4ODMA 4JFIA 1GPFA 4GGQA 1D7IA 1GUVA 3ARVA 2RUCA 2ZR4A 3WD4A 3ARPA 3PRDA 4Z2GA 4TX0A 2ZQTA 4JFJA 2DSWA 3B9EA 4NSBA 4KR0B 4C02B 3RM4A 2JZVA 4WKHA 4AY1A 3UQAA 4P8VA 5HWBA 2D9FA 3AS2A 4ODRA 3KABA 4ML4A 4LAWA 3O5GA 1IX5A 4IPXA 1EYMA 1F8AB 2LPVA 4WK9A 1QZ2A 2KGJA 1HJXA 4Z2LA 1NWRA 3KAGA 2K8IA 2M1IA 1LL6A 4N19A 1NMVA 2WM0A 3G6MA 1EHNA 2DT2A 1X6LA 1HXVA 3TC5A 1HKKA 3KAFA 4J4NA 4NNRA 3QOKA 4MNJA 1N1AA 1NWTA 4Q7NA 2PV2A 1SR0A 1EIBA 4MSPA 2MLZA 2F21A 3O5OA 1P5QA 2KE0A 3WL1A 1ZL1A 4IT4A 4ODOA 4URIA 3ARWA 2DG3A 4FAPA 2F2DA 3B8SA 4ODPA 1J4HA 1OGGA 3PA7A 3PR9A 2KI3A 3ARZA 4DRJA 3IK8A 3JYMA 1ROTA 2OLHA 2RQSA 4MPKA 3FXYA 1W1VA 3NI6A 3ALFA 4U86A 1FAPA 3H9RB 4JYSA 3RGCA 2XP5A 4MNMA 1NMWA 4IQ2A 1FKRA 3IKDA 4Q22A 3I6CA 5HBFA 2ZQVA 2ZR5A 3CGNA 2DT1A 4QZVB 4WIWA 2RUDA 4GIVA 4S3JA 2AOSA 2PPOA 5DIVA 3PRAA 1WNOA 2LGOA 2VCDA 4HBEA 1EDQA 2KR7A 1VF8A 1TFVA 3O5KA 3UI4A 2FDMA 4G50A 1FKSA 1LL7A 4DRIA 4DT4A 1K9TA 3UQIA 4ODLA 3TCZA 3ARQA 3CHDA 3RMEA 2AWGA 2M08A 3KAHA 2WLYA 5HW8A 1X6NA 3ARYA 1WB0A 1J4IA 2PV3A 1NSGA 1PINA 2B31A 5HKGA 4KQZA 4MAVA 3RFWA 4LAVA 1Q6HA 4LGXA 3WD0A 1ZBCA 4ZS6A 4DWSB 1W26A 1JNTA 1Y0OA 4ZPWR 1ROUA 2PPPA 3O5EA 3IKGA 5GPRA 2VN1A 4Z2KA 1W9VA 3WKZA 5HTGA 1F40A 4DZ3A 1C9HA 3FAPA 1ZBKA 4MGVA 5JH8A 3UF8A 5B8IC 3CH9A 4XAKA 4W9QA 2QF8A 4DRHA 2XPAA 1JVWA 2DT0A 3WQVA 1W1TA 3UI5A 5HW6A 3OA5A 4ZPTR 4JFKA 3ARTA 3G6LA 3OOBA 1PBKA 1W1PA 4PTMA 4W9PA 1XRVA 4DIPA 4ZPVR 3O5MA 4JFLA 4QIBA 2A3AA 4WKAA 3TDBA 4LAXA 5DO2A 1H0IA 2F4EA 3O5PA 5BXJA 2O9OA 1E6NA 1FKGA 1FFRA 4DRQA 3B7XA 2PBCA 2FKEA 2O92A 4R5EA 4DH0A 2XP9A 2MLYA 3ARRA 2MPHA 4NZCA 1JNEA 3O5RA 1B6CA 1FKLA 1OWQA 3JXVA 4JFMA 1R9HA 1A7XA 3GPKA 1E6ZA 3O5LA 2RSEA 2UZ5A 1W9PA 1W1YA 3WQWA 2RURA 1LJYA 3UQBA 2PPNA 3WH0A 2MLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M2A A;  1J4I A;  1D7H A;  2PV3 A;  1D7J A;  1YAT A;  1NSG A;  1PIN A;  2KFW A;  5HKG A;  1FKB A;  4C02 B;  2JZV A;  4DRO A;  1Q6U A;  3RFW A;  3UQA A;  5HWB A;  4LAV A;  1Q6H A;  3MDY B;  4R0X A;  2D9F A;  4QT3 A;  1ZK6 A;  1L1P A;  4ODR A;  3KAB A;  1FKK A;  4LAW A;  3O5G A;  1FJD A;  3O5F A;  2ITK A;  3KZ7 A;  4IPX A;  1EYM A;  1F8A B;  1FKH A;  1W26 A;  1JNT A;  1D6O A;  2LPV A;  5HUA A;  1QZ2 A;  2KGJ A;  5GPG A;  5HWC A;  2LKN A;  1Y0O A;  2OFN A;  3O5J A;  1QPL A;  1ROU A;  3KAG A;  5DIU A;  4DRN A;  2PPP A;  2K8I A;  3O5E A;  4TYO A;  2M1I A;  3IHZ A;  1TCO C;  4N19 A;  1NMV A;  1YW5 A;  3IKG A;  3NTP A;  4O2T A;  2VN1 A;  2Y78 A;  1J4R A;  5HW7 A;  1KT1 A;  1HXV A;  1T11 A;  3TC5 A;  4NNR A;  3KAF A;  4J4N A;  5HTG A;  1F40 A;  5D75 A;  4DZ3 A;  1C9H A;  1N1A A;  3FAP A;  2MNT A;  1JNS A;  2N87 A;  2XP7 A;  2DG9 A;  3PRB A;  2PV2 A;  3UI6 A;  4DT4 A;  4FN2 A;  4MGV A;  1U79 A;  2XPB A;  3UF8 A;  5B8I C;  4MSP A;  2MLZ A;  2F21 A;  4W9Q A;  3O5O A;  1FD9 A;  1P5Q A;  3O5Q A;  2KE0 A;  4U84 A;  2XP8 A;  4DRH A;  1BKF A;  2XPA A;  1JVW A;  3KCE A;  3NRK A;  3LUO A;  4ODO A;  1Q1C A;  1FKD A;  3UI5 A;  5HW6 A;  2DG3 A;  3ODK A;  4QT2 A;  4FAP A;  1J6Y A;  2F2D A;  4JFK A;  4ODP A;  1J4H A;  1M5Y A;  3PA7 A;  5DIT A;  3OOB A;  3O5D A;  4ODQ A;  4TNS A;  2KI3 A;  1PBK A;  4IQC A;  1QPF A;  4ITZ A;  4TW7 A;  5HT1 A;  3IK8 A;  1FKI A;  4W9P A;  1Q6I A;  3CGM A;  3JYM A;  1ROT A;  4DRJ A;  4DRM A;  2RQS A;  4U85 A;  1ZCN A;  1FKT A;  3VAW A;  4DIP A;  2XP3 A;  4G2P A;  3NI6 A;  4U86 A;  1FAP A;  3H9R B;  4JYS A;  4TW6 A;  3JYJ A;  3O5M A;  4JFL A;  4QIB A;  2XP5 A;  2DG4 A;  3RGC A;  4BF8 A;  2MF9 A;  3KAC A;  2LJ4 A;  3TDB A;  3EY6 A;  4LAX A;  1NMW A;  2F4E A;  3O5P A;  3IKD A;  4IQ2 A;  1FKR A;  2PV1 A;  4DRK A;  3I6C A;  4DRP A;  5BXJ A;  2Q5A A;  1FKG A;  4W9O A;  5J6E A;  4DRQ A;  2ZQV A;  4J4O A;  3B7X A;  2PBC A;  2ZR5 A;  3CGN A;  2FAP A;  2FKE A;  2IF4 A;  2RUD A;  4GIV A;  4ODN A;  2XP6 A;  2PPO A;  4LAY A;  5DIV A;  5I98 A;  1FKF A;  4DH0 A;  2RUQ A;  3O5I A;  2XP9 A;  2MLY A;  2ZQS A;  2LGO A;  4TW8 A;  2MPH A;  2VCD A;  1BL4 A;  2KR7 A;  2ZQU A;  2ZR6 A;  3O5R A;  1B6C A;  1FKJ A;  1FKL A;  2KO7 A;  3O5K A;  3UI4 A;  4G50 A;  1FKS A;  1EQ3 A;  3JXV A;  1KT0 A;  4DRI A;  2XP4 A;  4JFM A;  2L2S A;  1R9H A;  3KAD A;  4ODM A;  1A7X A;  3GPK A;  2RSE A;  1D7I A;  3O5L A;  4GGQ A;  2UZ5 A;  4JFI A;  4ODL A;  2RUC A;  3TCZ A;  3UQI A;  4DZ2 A;  2ZR4 A;  3PRD A;  2AWG A;  2M08 A;  2RUR A;  2ZQT A;  3KAH A;  4TX0 A;  5HW8 A;  3UQB A;  2PPN A;  4ODK A;  3WH0 A;  2MLX A;  4JFJ A;  3KAI A; 
#chains in the Genus database with same CATH topology
 1D7H A;  1D7J A;  4HAR A;  1FKB A;  4DRO A;  3WD2 A;  3W4R A;  3MDY B;  4R0X A;  3ARS A;  5DF0 A;  1HKJ A;  3KZ7 A;  2A3C A;  1FKH A;  5HUA A;  1UR8 A;  1D6O A;  3CHC A;  5GPG A;  4WJX A;  5DIU A;  3B9D A;  3ALG A;  4O2T A;  3RM8 A;  1J4R A;  5HW7 A;  1T11 A;  3ARX A;  2G8Z A;  4DWS D;  3PRB A;  3RM9 A;  4DWS A;  1U79 A;  2YBT A;  2XPB A;  1ZU8 A;  3O5Q A;  2XP8 A;  3NRK A;  1FKD A;  3AS1 A;  3ODK A;  4QT2 A;  1J6Y A;  4P8W A;  1UR9 A;  4W5U A;  5DIT A;  2PI6 A;  4ODQ A;  2A3E A;  4ITZ A;  4TW7 A;  1FKI A;  3AS3 A;  1Q6I A;  4MNL A;  2ESC A;  3VAW A;  2XP3 A;  3CHE A;  4TW6 A;  3JYJ A;  4Z2I A;  5GQB A;  4BF8 A;  2MF9 A;  3EY6 A;  3CZ8 A;  3BMB A;  3WIJ A;  2PV1 A;  1ZBV A;  2Q5A A;  4W9O A;  5J6E A;  3FY1 A;  4L3N A;  4J4O A;  2FAP A;  2DPE A;  4ODN A;  1FKF A;  1HKI A;  2DT3 A;  2WK2 A;  2ZQS A;  1NWS A;  1E15 A;  2IUZ A;  2ZR6 A;  1ZBW A;  2ZQU A;  1JND A;  2KO7 A;  1EQ3 A;  2XP4 A;  3KAD A;  4DZ2 A;  3AS0 A;  3ARO A;  1XHG A;  2PN0 A;  3WD1 A;  1O6I A;  4ODK A;  4UDM A;  3KAI A;  2M2A A;  1H0G A;  1YAT A;  2A3B A;  2KFW A;  1Q6U A;  3WL0 A;  4WKF A;  4MTV A;  4QT3 A;  1ZK6 A;  2DSZ A;  1L1P A;  1FKK A;  1FJD A;  3O5F A;  2ITK A;  2DSV A;  1WAW A;  1LL4 A;  1GRJ A;  5HWC A;  2LKN A;  1LG1 A;  1NH6 A;  2OFN A;  3O5J A;  1QPL A;  2DSU A;  4DRN A;  2EUL A;  4TYO A;  3IHZ A;  1TCO C;  1NWU A;  1YW5 A;  3NTP A;  1HJW A;  1GOI A;  2Y78 A;  1KT1 A;  3ARU A;  5D75 A;  1RD6 A;  1SYT A;  2MNT A;  1JNS A;  2N87 A;  2XP7 A;  2DG9 A;  3UI6 A;  1OGB A;  4FN2 A;  1KFW A;  1E9L A;  1HJV A;  4P8X A;  1ZB5 A;  1FD9 A;  3CHF A;  4U84 A;  1CTN A;  1BKF A;  5DEZ A;  3KCE A;  3LUO A;  1Q1C A;  4DWS C;  1M5Y A;  3EIP A;  4TNS A;  3O5D A;  4IQC A;  1QPF A;  4P8U A;  5HT1 A;  3CGM A;  4Z2J A;  4DRM A;  2WLZ A;  4U85 A;  1ZCN A;  1FKT A;  4G2P A;  3WD3 A;  1W9U A;  4MNK A;  2DG4 A;  4HBO A;  1HKM A;  2YBU A;  3KAC A;  2LJ4 A;  4L72 B;  3BXW A;  4DRK A;  4DRP A;  1LG2 A;  3AQU A;  1D2K A;  2IF4 A;  1ITX A;  4Z2H A;  1E6P A;  2XP6 A;  4LAY A;  5I98 A;  2RUQ A;  3O5I A;  3B9A A;  4TW8 A;  4S3K A;  1BL4 A;  1E6R A;  1FKJ A;  2G41 A;  1KT0 A;  1LQ0 A;  2L2S A;  1FFQ A;  4IT6 A;  4ODM A;  4JFI A;  1GPF A;  4GGQ A;  1D7I A;  1GUV A;  3ARV A;  2RUC A;  2ZR4 A;  3WD4 A;  3ARP A;  3PRD A;  4Z2G A;  4TX0 A;  2ZQT A;  4JFJ A;  2DSW A;  3B9E A;  4NSB A;  4KR0 B;  2F23 A;  4C02 B;  3RM4 A;  2JZV A;  4WKH A;  4AY1 A;  3UQA A;  4P8V A;  5HWB A;  2D9F A;  3AS2 A;  4ODR A;  3KAB A;  4ML4 A;  4LAW A;  3O5G A;  1IX5 A;  4IPX A;  1EYM A;  1F8A B;  2LPV A;  4WK9 A;  1QZ2 A;  2KGJ A;  1HJX A;  4Z2L A;  1NWR A;  3KAG A;  2K8I A;  2M1I A;  1LL6 A;  4N19 A;  1NMV A;  2WM0 A;  3G6M A;  1EHN A;  2DT2 A;  1X6L A;  1HXV A;  3TC5 A;  1HKK A;  3KAF A;  4J4N A;  4NNR A;  3QOK A;  4MNJ A;  1N1A A;  1NWT A;  4Q7N A;  2PV2 A;  1SR0 A;  1EIB A;  4MSP A;  2MLZ A;  2F21 A;  3O5O A;  1P5Q A;  2KE0 A;  3WL1 A;  1ZL1 A;  4IT4 A;  4ODO A;  4URI A;  3ARW A;  2DG3 A;  1JCH B;  4FAP A;  2F2D A;  3B8S A;  4ODP A;  1J4H A;  1OGG A;  3PA7 A;  3PR9 A;  2KI3 A;  3ARZ A;  4DRJ A;  3GU0 A;  3IK8 A;  3JYM A;  1ROT A;  2OLH A;  2RQS A;  4MPK A;  3FXY A;  1W1V A;  3NI6 A;  3ALF A;  4U86 A;  1FAP A;  3H9R B;  4JYS A;  3RGC A;  2XP5 A;  4MNM A;  1NMW A;  4IQ2 A;  1FKR A;  3IKD A;  4Q22 A;  3I6C A;  5HBF A;  2ZQV A;  2ZR5 A;  3CGN A;  2DT1 A;  4QZV B;  4WIW A;  2RUD A;  4GIV A;  4S3J A;  2AOS A;  2PPO A;  5DIV A;  3PRA A;  2P4V A;  1WNO A;  2LGO A;  2VCD A;  4HBE A;  1EDQ A;  2KR7 A;  1VF8 A;  1TFV A;  3O5K A;  3UI4 A;  2FDM A;  4G50 A;  1FKS A;  1LL7 A;  4DRI A;  3GTY X;  4DT4 A;  1K9T A;  3UQI A;  4ODL A;  3TCZ A;  3ARQ A;  3CHD A;  3RME A;  2AWG A;  2M08 A;  3KAH A;  2WLY A;  5HW8 A;  1X6N A;  2B5U B;  3ARY A;  1WB0 A;  1J4I A;  2PV3 A;  1NSG A;  1PIN A;  2B31 A;  5HKG A;  4KQZ A;  4MAV A;  3RFW A;  4LAV A;  1Q6H A;  4LGX A;  3WD0 A;  1ZBC A;  4ZS6 A;  4DWS B;  1W26 A;  1JNT A;  1Y0O A;  4ZPW R;  1ROU A;  2PPP A;  3O5E A;  1E44 A;  3IKG A;  5GPR A;  2VN1 A;  4Z2K A;  1W9V A;  3WKZ A;  5HTG A;  1F40 A;  4DZ3 A;  1C9H A;  3FAP A;  1ZBK A;  4MGV A;  5JH8 A;  3UF8 A;  5B8I C;  3CH9 A;  4XAK A;  4W9Q A;  2QF8 A;  4DRH A;  2XPA A;  1JVW A;  2DT0 A;  3WQV A;  1W1T A;  3UI5 A;  5HW6 A;  3OA5 A;  4ZPT R;  4JFK A;  3ART A;  3G6L A;  3OOB A;  1PBK A;  1W1P A;  4PTM A;  4W9P A;  1XRV A;  4DIP A;  4ZPV R;  3O5M A;  4JFL A;  4QIB A;  2A3A A;  2ETN A;  4WKA A;  3TDB A;  4LAX A;  5DO2 A;  1H0I A;  2F4E A;  3O5P A;  5BXJ A;  2O9O A;  1E6N A;  1FKG A;  1FFR A;  4DRQ A;  3B7X A;  2PBC A;  2FKE A;  2O92 A;  4R5E A;  4DH0 A;  2XP9 A;  2MLY A;  3ARR A;  2MPH A;  4NZC A;  1JNE A;  3O5R A;  1B6C A;  1FKL A;  1OWQ A;  3JXV A;  4JFM A;  1R9H A;  1A7X A;  3GPK A;  1E6Z A;  3O5L A;  2RSE A;  2UZ5 A;  1W9P A;  1W1Y A;  3WQW A;  2RUR A;  1LJY A;  3UQB A;  2PPN A;  3WH0 A;  2MLX A; 
#chains in the Genus database with same CATH homology
 1D7H A;  1D7J A;  4HAR A;  1FKB A;  4DRO A;  3WD2 A;  3W4R A;  3MDY B;  4R0X A;  3ARS A;  5DF0 A;  1HKJ A;  3KZ7 A;  2A3C A;  1FKH A;  5HUA A;  1UR8 A;  1D6O A;  3CHC A;  5GPG A;  4WJX A;  5DIU A;  3B9D A;  3ALG A;  4O2T A;  3RM8 A;  1J4R A;  5HW7 A;  1T11 A;  3ARX A;  2G8Z A;  4DWS D;  3PRB A;  3RM9 A;  4DWS A;  1U79 A;  2YBT A;  2XPB A;  1ZU8 A;  3O5Q A;  2XP8 A;  3NRK A;  1FKD A;  3AS1 A;  3ODK A;  4QT2 A;  1J6Y A;  4P8W A;  1UR9 A;  4W5U A;  5DIT A;  2PI6 A;  4ODQ A;  2A3E A;  4ITZ A;  4TW7 A;  1FKI A;  3AS3 A;  1Q6I A;  4MNL A;  2ESC A;  3VAW A;  2XP3 A;  3CHE A;  4TW6 A;  3JYJ A;  4Z2I A;  5GQB A;  4BF8 A;  2MF9 A;  3EY6 A;  3CZ8 A;  3WIJ A;  2PV1 A;  1ZBV A;  2Q5A A;  4W9O A;  5J6E A;  3FY1 A;  4L3N A;  4J4O A;  2FAP A;  2DPE A;  4ODN A;  1FKF A;  1HKI A;  2DT3 A;  2WK2 A;  2ZQS A;  1NWS A;  1E15 A;  2IUZ A;  2ZR6 A;  1ZBW A;  2ZQU A;  1JND A;  2KO7 A;  1EQ3 A;  2XP4 A;  3KAD A;  4DZ2 A;  3AS0 A;  3ARO A;  1XHG A;  3WD1 A;  1O6I A;  4ODK A;  3KAI A;  2M2A A;  1H0G A;  1YAT A;  2A3B A;  2KFW A;  1Q6U A;  3WL0 A;  4WKF A;  4MTV A;  4QT3 A;  1ZK6 A;  2DSZ A;  1L1P A;  1FKK A;  1FJD A;  3O5F A;  2ITK A;  2DSV A;  1WAW A;  1LL4 A;  5HWC A;  2LKN A;  1LG1 A;  1NH6 A;  2OFN A;  3O5J A;  1QPL A;  2DSU A;  4DRN A;  4TYO A;  3IHZ A;  1TCO C;  1NWU A;  1YW5 A;  3NTP A;  1HJW A;  1GOI A;  2Y78 A;  1KT1 A;  3ARU A;  5D75 A;  1RD6 A;  1SYT A;  2MNT A;  1JNS A;  2N87 A;  2XP7 A;  2DG9 A;  3UI6 A;  1OGB A;  4FN2 A;  1KFW A;  1E9L A;  1HJV A;  4P8X A;  1ZB5 A;  1FD9 A;  3CHF A;  4U84 A;  1CTN A;  1BKF A;  5DEZ A;  3KCE A;  3LUO A;  1Q1C A;  4DWS C;  1M5Y A;  4TNS A;  3O5D A;  4IQC A;  1QPF A;  4P8U A;  5HT1 A;  3CGM A;  4Z2J A;  4DRM A;  2WLZ A;  4U85 A;  1ZCN A;  1FKT A;  4G2P A;  3WD3 A;  1W9U A;  4MNK A;  2DG4 A;  4HBO A;  1HKM A;  2YBU A;  3KAC A;  2LJ4 A;  4L72 B;  3BXW A;  4DRK A;  4DRP A;  1LG2 A;  3AQU A;  1D2K A;  2IF4 A;  1ITX A;  4Z2H A;  1E6P A;  2XP6 A;  4LAY A;  5I98 A;  2RUQ A;  3O5I A;  3B9A A;  4TW8 A;  4S3K A;  1BL4 A;  1E6R A;  1FKJ A;  2G41 A;  1KT0 A;  1LQ0 A;  2L2S A;  1FFQ A;  4IT6 A;  4ODM A;  4JFI A;  1GPF A;  4GGQ A;  1D7I A;  1GUV A;  3ARV A;  2RUC A;  2ZR4 A;  3WD4 A;  3ARP A;  3PRD A;  4Z2G A;  4TX0 A;  2ZQT A;  4JFJ A;  2DSW A;  3B9E A;  4NSB A;  4KR0 B;  4C02 B;  3RM4 A;  2JZV A;  4WKH A;  4AY1 A;  3UQA A;  4P8V A;  5HWB A;  2D9F A;  3AS2 A;  4ODR A;  3KAB A;  4ML4 A;  4LAW A;  3O5G A;  1IX5 A;  4IPX A;  1EYM A;  1F8A B;  2LPV A;  4WK9 A;  1QZ2 A;  2KGJ A;  1HJX A;  4Z2L A;  1NWR A;  3KAG A;  2K8I A;  2M1I A;  1LL6 A;  4N19 A;  1NMV A;  2WM0 A;  3G6M A;  1EHN A;  2DT2 A;  1X6L A;  1HXV A;  3TC5 A;  1HKK A;  3KAF A;  4J4N A;  4NNR A;  3QOK A;  4MNJ A;  1N1A A;  1NWT A;  4Q7N A;  2PV2 A;  1SR0 A;  1EIB A;  4MSP A;  2MLZ A;  2F21 A;  3O5O A;  1P5Q A;  2KE0 A;  3WL1 A;  1ZL1 A;  4IT4 A;  4ODO A;  4URI A;  3ARW A;  2DG3 A;  4FAP A;  2F2D A;  3B8S A;  4ODP A;  1J4H A;  1OGG A;  3PA7 A;  3PR9 A;  2KI3 A;  3ARZ A;  4DRJ A;  3IK8 A;  3JYM A;  1ROT A;  2OLH A;  2RQS A;  4MPK A;  3FXY A;  1W1V A;  3NI6 A;  3ALF A;  4U86 A;  1FAP A;  3H9R B;  4JYS A;  3RGC A;  2XP5 A;  4MNM A;  1NMW A;  4IQ2 A;  1FKR A;  3IKD A;  4Q22 A;  3I6C A;  5HBF A;  2ZQV A;  2ZR5 A;  3CGN A;  2DT1 A;  4QZV B;  4WIW A;  2RUD A;  4GIV A;  4S3J A;  2AOS A;  2PPO A;  5DIV A;  3PRA A;  1WNO A;  2LGO A;  2VCD A;  4HBE A;  1EDQ A;  2KR7 A;  1VF8 A;  1TFV A;  3O5K A;  3UI4 A;  2FDM A;  4G50 A;  1FKS A;  1LL7 A;  4DRI A;  4DT4 A;  1K9T A;  3UQI A;  4ODL A;  3TCZ A;  3ARQ A;  3CHD A;  3RME A;  2AWG A;  2M08 A;  3KAH A;  2WLY A;  5HW8 A;  1X6N A;  3ARY A;  1WB0 A;  1J4I A;  2PV3 A;  1NSG A;  1PIN A;  2B31 A;  5HKG A;  4KQZ A;  4MAV A;  3RFW A;  4LAV A;  1Q6H A;  4LGX A;  3WD0 A;  1ZBC A;  4ZS6 A;  4DWS B;  1W26 A;  1JNT A;  1Y0O A;  4ZPW R;  1ROU A;  2PPP A;  3O5E A;  3IKG A;  5GPR A;  2VN1 A;  4Z2K A;  1W9V A;  3WKZ A;  5HTG A;  1F40 A;  4DZ3 A;  1C9H A;  3FAP A;  1ZBK A;  4MGV A;  5JH8 A;  3UF8 A;  5B8I C;  3CH9 A;  4XAK A;  4W9Q A;  2QF8 A;  4DRH A;  2XPA A;  1JVW A;  2DT0 A;  3WQV A;  1W1T A;  3UI5 A;  5HW6 A;  3OA5 A;  4ZPT R;  4JFK A;  3ART A;  3G6L A;  3OOB A;  1PBK A;  1W1P A;  4PTM A;  4W9P A;  1XRV A;  4DIP A;  4ZPV R;  3O5M A;  4JFL A;  4QIB A;  2A3A A;  4WKA A;  3TDB A;  4LAX A;  5DO2 A;  1H0I A;  2F4E A;  3O5P A;  5BXJ A;  2O9O A;  1E6N A;  1FKG A;  1FFR A;  4DRQ A;  3B7X A;  2PBC A;  2FKE A;  2O92 A;  4R5E A;  4DH0 A;  2XP9 A;  2MLY A;  3ARR A;  2MPH A;  4NZC A;  1JNE A;  3O5R A;  1B6C A;  1FKL A;  1OWQ A;  3JXV A;  4JFM A;  1R9H A;  1A7X A;  3GPK A;  1E6Z A;  3O5L A;  2RSE A;  2UZ5 A;  1W9P A;  1W1Y A;  3WQW A;  2RUR A;  1LJY A;  3UQB A;  2PPN A;  3WH0 A;  2MLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...