2AWGA

Structure of the ppiase domain of the human fk506-binding protein 8
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
GSPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein inhibitor
molecule keywords 38 kDa FK-506 binding protein
publication title Structure of the human FK-506 binding protein 8
rcsb
source organism Homo sapiens
total genus 30
structure length 118
sequence length 118
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2awgA00
4TW8A 1ZK6A 1FKGA 1FKLA 2XPBA 3UI4A 1FKIA 1Q6UA 2IF4A 2OFNA 4TNSA 2KR7A 4G2PA 2M08A 3MDYB 4W9PA 4C02B 4DRMA 1FKHA 2F2DA 2KFWA 2PV3A 2XP8A 4JFMA 4DRKA 1L1PA 2PBCA 3IKGA 3O5LA 4ITZA 5DIVA 1D7HA 2ZR6A 3KCEA 1NMWA 4FN2A 4TX0A 4JYSA 5J6EA 4N19A 5HW7A 2PV2A 4DIPA 4O2TA 4DRNA 3JYJA 5HTGA 1ZCNA 2KGJA 2XP6A 2PV1A 4IQCA 3WH0A 3O5FA 4ODPA 1FKDA 1EYMA 4LAXA 3KADA 2RUCA 4JFJA 1BKFA 4GGQA 2FKEA 3O5GA 4ODOA 1JNSA 1D7JA 4DZ2A 2RQSA 3KAFA 2LJ4A 3PA7A 3UI5A 4NNRA 3ODKA 3RGCA 2F21A 4DH0A 5I98A 3KZ7A 4W9QA 3JXVA 2ZQTA 1HXVA 2Q5AA 4ODQA 3UI6A 1FKTA 2VN1A 3O5JA 4QT3A 4J4OA 2LKNA 1QZ2A 3CGMA 4U86A 5DITA 4DRJA 3O5KA 5HW8A 4GIVA 1TCOC 2RURA 4ODNA 3NI6A 2AWGA 4R0XA 1J4IA 2DG3A 2PPPA 3KAHA 2F4EA 3O5QA 1ROUA 3O5OA 1PBKA 2L2SA 4QT2A 2KE0A 2KO7A 1J6YA 5HW6A 4DROA 2PPNA 3UQIA 2M1IA 3TC5A 5HUAA 1F8AB 1NMVA 1FJDA 2RUDA 2Y78A 4IQ2A 3OOBA 1R9HA 2FAPA 2K8IA 5GPGA 3UQAA 1FAPA 2M2AA 1J4RA 2XPAA 3KABA 3LUOA 1YW5A 4ODKA 1P5QA 2XP9A 4LAYA 3RFWA 1NSGA 4TW7A 1Y0OA 3PRBA 4DRIA 1QPLA 4W9OA 5DIUA 2XP7A 2XP4A 3IHZA 1W26A 1FD9A 1U79A 2ZR5A 2DG4A 3IKDA 5BXJA 4LAVA 2MF9A 3O5PA 5HT1A 5B8IC 3FAPA 2N87A 2JZVA 1ROTA 2ZQSA 1PINA 2ZR4A 3IK8A 4LAWA 4BF8A 4DT4A 3H9RB 3I6CA 4JFIA 4MGVA 3UQBA 1A7XA 1FKKA 3TCZA 3O5DA 1YATA 4FAPA 1JNTA 1FKJA 2VCDA 1KT1A 3NRKA 1C9HA 1D7IA 4JFKA 4DRQA 3GPKA 5HKGA 5HWCA 1B6CA 4ODMA 1Q6HA 2MNTA 2LGOA 2XP3A 3O5EA 4IPXA 3VAWA 2ZQUA 4DRPA 4QIBA 4ODLA 2MPHA 1KT0A 2DG9A 3KAGA 3PRDA 1D6OA 3O5RA 3EY6A 2MLZA 1Q6IA 3B7XA 4U84A 5D75A 2D9FA 3UF8A 4DZ3A 2MLXA 3CGNA 3TDBA 1QPFA 2MLYA 1EQ3A 3O5MA 4MSPA 1FKBA 1N1AA 2ZQVA 2ITKA 2RSEA 3KACA 1JVWA 5HWBA 1T11A 1J4HA 4U85A 1FKSA 2UZ5A 2XP5A 4ODRA 4JFLA 1F40A 3NTPA 2RUQA 4G50A 3KAIA 2LPVA 4TW6A 1FKRA 4DRHA 1BL4A 3JYMA 3O5IA 4J4NA 4TYOA 2PPOA 2KI3A 1M5YA 1FKFA 1Q1CA
chains in the Genus database with same CATH superfamily
1FKLA 1Q6UA 2DPEA 2M08A 4W9PA 4P8WA 4DRKA 4DWSA 3O5LA 3IKGA 4ITZA 1L1PA 1D7HA 1E9LA 1HKIA 2PV2A 4DIPA 2PI6A 4DRNA 5HTGA 4P8XA 1VF8A 2XP6A 1FFQA 2PV1A 4LAXA 1E6RA 3AROA 4GGQA 3O5GA 4KQZA 1GPFA 3AS1A 2ETNA 3WD2A 3RGCA 5I98A 2Q5AA 4ODQA 1FKTA 1OGGA 2ESCA 2O92A 4MTVA 3CGMA 3ARSA 4NSBA 1TCOC 4WIWA 4N19A 4ODOA 4DRJA 1TFVA 2F4EA 3ARUA 1RD6A 4QT2A 4DWSD 2KE0A 2KO7A 5HW6A 4DROA 2PPNA 4S3KA 2B5UB 4IQ2A 1R9HA 1J4RA 3KABA 1LQ0A 2XP9A 1Y0OA 3PR9A 1HJWA 1JNDA 2MF9A 3ARVA 5HT1A 3FAPA 1W9VA 2N87A 2ZR4A 4LAWA 3WL1A 1A7XA 4IT4A 3B8SA 3ARYA 4P8UA 1B6CA 1Q6HA 1WNOA 2XP3A 3O5EA 4IPXA 3VAWA 4DRPA 4QIBA 2DG9A 3KAGA 3PRDA 1W9PA 3ARQA 3CHDA 2AOSA 4DZ3A 3WD1A 3WD4A 3B9AA 1QPFA 3G6LA 4MSPA 4NZCA 4LGXA 3BMBA 5HWBA 1E6NA 1FKSA 2UZ5A 2IUZA 2A3AA 2LPVA 1BL4A 4Z2HA 5DF0A 4W9OA 4L3NA 1W1VA 3ARWA 1FKGA 2XPBA 3UI4A 4AY1A 2KR7A 1HKJA 1LL7A 2PV3A 1LL4A 3BXWA 1ZL1A 2PBCA 5DIVA 1NMWA 4JYSA 5HW7A 3CHFA 4O2TA 1JCHB 1ITXA 3O5FA 4HBOA 3ARZA 1EYMA 3KADA 4JFJA 1BKFA 2FKEA 3WKZA 3B9EA 1JNSA 4PTMA 2RQSA 3KAFA 1XHGA 5GPRA 1H0GA 4DH0A 1KFWA 1SYTA 1LL6A 4QT3A 3ARPA 2LKNA 1QZ2A 1OGBA 1E6PA 2O9OA 4MNKA 4R0XA 5GPGA 2PPPA 3O5QA 2YBTA 3O5OA 2L2SA 1J6YA 3CHEA 2WLZA 2M1IA 3PRAA 5HUAA 1NMVA 1FJDA 3CH9A 2FAPA 3AS2A 3WD0A 2DSWA 1FAPA 1K9TA 4WKFA 1P5QA 4LAYA 3RFWA 4TW7A 3AQUA 2XP7A 1GOIA 1U79A 2DG4A 3RM9A 5BXJA 2DT0A 4XAKA 1PINA 2DT3A 3I6CA 3UQBA 4Z2IA 2B31A 4ZS6A 1W9UA 3TCZA 3O5DA 4FAPA 1W1YA 1JNTA 3NRKA 1D7IA 1LG2A 5HKGA 3EIPA 4ODMA 1ZB5A 2LGOA 2A3CA 2DSVA 1HJXA 2MPHA 1KT0A 5D75A 1D6OA 4U84A 3UF8A 2MLZA 1Q6IA 1EQ3A 3O5MA 4Z2LA 2ZQVA 1N1AA 2RSEA 4U85A 2XP5A 2G41A 3KAIA 1CTNA 1W1TA 4J4NA 2PPOA 4QZVB 2DT1A 1LG1A 3CHCA 4TW8A 3QOKA 3RM4A 1ZK6A 4TNSA 4C02B 4DRMA 2KFWA 4JFMA 1E6ZA 3ARRA 1LJYA 2ZR6A 3AS0A 4FN2A 4TX0A 1EDQA 1GRJA 2QF8A 1ZCNA 2KGJA 2RUCA 4KR0B 4Q22A 2PN0A 2LJ4A 4L72B 4NNRA 3ODKA 2F21A 4W9QA 2ZQTA 1IX5A 1HXVA 3UI6A 5HBFA 4J4OA 4IT6A 5HW8A 1HJVA 4GIVA 2RURA 4ODNA 3NI6A 3W4RA 1X6NA 4S3JA 1HKKA 2DG3A 2OLHA 4ZPWR 3AS3A 3UQIA 2WLYA 3TC5A 2A3BA 2RUDA 3OOBA 4HARA 3RM8A 3UQAA 4Q7NA 4ODKA 1O6IA 3B9DA 1NSGA 4DRIA 3PRBA 4Z2JA 5DIUA 1NWTA 2XP4A 3IHZA 1W26A 2DSZA 2ZR5A 3IKDA 4LAVA 3O5PA 5B8IC 4Z2GA 4MPKA 4WKHA 1XRVA 3IK8A 3ALGA 4W5UA 4JFIA 4MGVA 1ZU8A 1FKKA 1YATA 2VCDA 3ARTA 1EHNA 1E15A 4JFKA 1ZBKA 3GPKA 5HWCA 2MNTA 2DSUA 4WK9A 5DEZA 5GQBA 2FDMA 1HKMA 1E44A 2A3EA 3O5RA 4MAVA 3B7XA 4HBEA 1WAWA 2MLXA 2MLYA 1FKBA 3KACA 4DWSC 1J4HA 4JFLA 3NTPA 4TW6A 1X6LA 1FKRA 4DRHA 4ML4A 3JYMA 3O5IA 1M5YA 1FKFA 1ZBCA 3OA5A 1UR8A 3FY1A 1FKIA 2IF4A 2OFNA 4G2PA 3MDYB 1FKHA 2F2DA 2XP8A 5JH8A 3KCEA 5J6EA 3JYJA 2EULA 4IQCA 1FFRA 3WH0A 4ODPA 1FKDA 4WKAA 3CZ8A 1D7JA 4DZ2A 3WQVA 1ZBVA 2P4VA 3PA7A 3FXYA 3UI5A 1NH6A 1GUVA 3KZ7A 3JXVA 1OWQA 2VN1A 4Z2KA 2F23A 1JNEA 4U86A 1EIBA 5DITA 3O5KA 3WD3A 2AWGA 1J4IA 3KAHA 1ROUA 1PBKA 3GTYX 4MNLA 1F8AB 4P8VA 4ZPVR 2Y78A 3WIJA 1UR9A 3ARXA 1ZBWA 2K8IA 1WB0A 2M2AA 2XPAA 3LUOA 1YW5A 4UDMA 1W1PA 3WQWA 4DWSB 1QPLA 2G8ZA 4URIA 2YBUA 1H0IA 1FD9A 4WJXA 3WL0A 4R5EA 2JZVA 1ROTA 1NWSA 2ZQSA 3ALFA 4BF8A 5DO2A 4DT4A 3H9RB 1FKJA 1SR0A 1KT1A 1C9HA 4DRQA 2WM0A 2DT2A 2ZQUA 4ODLA 3EY6A 4MNJA 2D9FA 3CGNA 3TDBA 1D2KA 2ITKA 1JVWA 3G6MA 2WK2A 4ZPTR 1T11A 1F40A 4ODRA 3GU0A 2RUQA 4G50A 1NWUA 1NWRA 3RMEA 4TYOA 2KI3A 3O5JA 4MNMA 1Q1CA
chains in the Genus database with same CATH topology
1FKLA 1Q6UA 2DPEA 2M08A 4W9PA 4P8WA 4DRKA 4DWSA 3O5LA 3IKGA 4ITZA 1L1PA 1D7HA 1E9LA 1HKIA 2PV2A 4DIPA 2PI6A 4DRNA 5HTGA 4P8XA 1VF8A 2XP6A 1FFQA 2PV1A 4LAXA 1E6RA 3AROA 4GGQA 3O5GA 4KQZA 1GPFA 3AS1A 3WD2A 3RGCA 5I98A 2Q5AA 4ODQA 1FKTA 1OGGA 2ESCA 2O92A 4MTVA 3CGMA 3ARSA 4NSBA 1TCOC 4WIWA 4N19A 4ODOA 4DRJA 1TFVA 2F4EA 3ARUA 1RD6A 4QT2A 4DWSD 2KE0A 2KO7A 5HW6A 4DROA 2PPNA 4S3KA 4IQ2A 1R9HA 1J4RA 3KABA 1LQ0A 2XP9A 1Y0OA 3PR9A 1HJWA 1JNDA 2MF9A 3ARVA 5HT1A 3FAPA 1W9VA 2N87A 2ZR4A 4LAWA 3WL1A 1A7XA 4IT4A 3B8SA 3ARYA 4P8UA 1B6CA 1Q6HA 1WNOA 2XP3A 3O5EA 4IPXA 3VAWA 4DRPA 4QIBA 2DG9A 3KAGA 3PRDA 1W9PA 3ARQA 3CHDA 2AOSA 4DZ3A 3WD1A 3WD4A 3B9AA 1QPFA 3G6LA 4MSPA 4NZCA 4LGXA 5HWBA 1E6NA 1FKSA 2UZ5A 2IUZA 2A3AA 2LPVA 1BL4A 4Z2HA 5DF0A 4W9OA 4L3NA 1W1VA 3ARWA 1FKGA 2XPBA 3UI4A 4AY1A 2KR7A 1HKJA 1LL7A 2PV3A 1LL4A 3BXWA 1ZL1A 2PBCA 5DIVA 1NMWA 4JYSA 5HW7A 3CHFA 4O2TA 1ITXA 3O5FA 4HBOA 3ARZA 1EYMA 3KADA 4JFJA 1BKFA 2FKEA 3WKZA 3B9EA 1JNSA 4PTMA 2RQSA 3KAFA 1XHGA 5GPRA 1H0GA 4DH0A 1KFWA 1SYTA 1LL6A 4QT3A 3ARPA 2LKNA 1QZ2A 1OGBA 1E6PA 2O9OA 4MNKA 4R0XA 5GPGA 2PPPA 3O5QA 2YBTA 3O5OA 2L2SA 1J6YA 3CHEA 2WLZA 2M1IA 3PRAA 5HUAA 1NMVA 1FJDA 3CH9A 2FAPA 3AS2A 3WD0A 2DSWA 1FAPA 1K9TA 4WKFA 1P5QA 4LAYA 3RFWA 4TW7A 3AQUA 2XP7A 1GOIA 1U79A 2DG4A 3RM9A 5BXJA 2DT0A 4XAKA 1PINA 2DT3A 3I6CA 3UQBA 4Z2IA 2B31A 4ZS6A 1W9UA 3TCZA 3O5DA 4FAPA 1W1YA 1JNTA 3NRKA 1D7IA 1LG2A 5HKGA 4ODMA 1ZB5A 2LGOA 2A3CA 2DSVA 1HJXA 2MPHA 1KT0A 5D75A 1D6OA 4U84A 3UF8A 2MLZA 1Q6IA 1EQ3A 3O5MA 4Z2LA 2ZQVA 1N1AA 2RSEA 4U85A 2XP5A 2G41A 3KAIA 1CTNA 1W1TA 4J4NA 2PPOA 4QZVB 2DT1A 1LG1A 3CHCA 4TW8A 3QOKA 3RM4A 1ZK6A 4TNSA 4C02B 4DRMA 2KFWA 4JFMA 1E6ZA 3ARRA 1LJYA 2ZR6A 3AS0A 4FN2A 4TX0A 1EDQA 2QF8A 1ZCNA 2KGJA 2RUCA 4KR0B 4Q22A 2LJ4A 4L72B 4NNRA 3ODKA 2F21A 4W9QA 2ZQTA 1IX5A 1HXVA 3UI6A 5HBFA 4J4OA 4IT6A 5HW8A 1HJVA 4GIVA 2RURA 4ODNA 3NI6A 3W4RA 1X6NA 4S3JA 1HKKA 2DG3A 2OLHA 4ZPWR 3AS3A 3UQIA 2WLYA 3TC5A 2A3BA 2RUDA 3OOBA 4HARA 3RM8A 3UQAA 4Q7NA 4ODKA 1O6IA 3B9DA 1NSGA 4DRIA 3PRBA 4Z2JA 5DIUA 1NWTA 2XP4A 3IHZA 1W26A 2DSZA 2ZR5A 3IKDA 4LAVA 3O5PA 5B8IC 4Z2GA 4MPKA 4WKHA 1XRVA 3IK8A 3ALGA 4W5UA 4JFIA 4MGVA 1ZU8A 1FKKA 1YATA 2VCDA 3ARTA 1EHNA 1E15A 4JFKA 1ZBKA 3GPKA 5HWCA 2MNTA 2DSUA 4WK9A 5DEZA 5GQBA 2FDMA 1HKMA 2A3EA 3O5RA 4MAVA 3B7XA 4HBEA 1WAWA 2MLXA 2MLYA 1FKBA 3KACA 4DWSC 1J4HA 4JFLA 3NTPA 4TW6A 1X6LA 1FKRA 4DRHA 4ML4A 3JYMA 3O5IA 1M5YA 1FKFA 1ZBCA 3OA5A 1UR8A 3FY1A 1FKIA 2IF4A 2OFNA 4G2PA 3MDYB 1FKHA 2F2DA 2XP8A 5JH8A 3KCEA 5J6EA 3JYJA 4IQCA 1FFRA 3WH0A 4ODPA 1FKDA 4WKAA 3CZ8A 1D7JA 4DZ2A 3WQVA 1ZBVA 3PA7A 3FXYA 3UI5A 1NH6A 1GUVA 3KZ7A 3JXVA 1OWQA 2VN1A 4Z2KA 1JNEA 4U86A 1EIBA 5DITA 3O5KA 3WD3A 2AWGA 1J4IA 3KAHA 1ROUA 1PBKA 4MNLA 1F8AB 4P8VA 4ZPVR 2Y78A 3WIJA 1UR9A 3ARXA 1ZBWA 2K8IA 1WB0A 2M2AA 2XPAA 3LUOA 1YW5A 1W1PA 3WQWA 4DWSB 1QPLA 2G8ZA 4URIA 2YBUA 1H0IA 1FD9A 4WJXA 3WL0A 4R5EA 2JZVA 1ROTA 1NWSA 2ZQSA 3ALFA 4BF8A 5DO2A 4DT4A 3H9RB 1FKJA 1SR0A 1KT1A 1C9HA 4DRQA 2WM0A 2DT2A 2ZQUA 4ODLA 3EY6A 4MNJA 2D9FA 3CGNA 3TDBA 1D2KA 2ITKA 1JVWA 3G6MA 2WK2A 4ZPTR 1T11A 1F40A 4ODRA 2RUQA 4G50A 1NWUA 1NWRA 3RMEA 4TYOA 2KI3A 3O5JA 4MNMA 1Q1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TW8 A;  1ZK6 A;  1FKG A;  1FKL A;  2XPB A;  3UI4 A;  1FKI A;  1Q6U A;  2IF4 A;  2OFN A;  4TNS A;  2KR7 A;  4G2P A;  2M08 A;  3MDY B;  4W9P A;  4C02 B;  4DRM A;  1FKH A;  2F2D A;  2KFW A;  2PV3 A;  2XP8 A;  4JFM A;  4DRK A;  1L1P A;  2PBC A;  3IKG A;  3O5L A;  4ITZ A;  5DIV A;  1D7H A;  2ZR6 A;  3KCE A;  1NMW A;  4FN2 A;  4TX0 A;  4JYS A;  5J6E A;  4N19 A;  5HW7 A;  2PV2 A;  4DIP A;  4O2T A;  4DRN A;  3JYJ A;  5HTG A;  1ZCN A;  2KGJ A;  2XP6 A;  2PV1 A;  4IQC A;  3WH0 A;  3O5F A;  4ODP A;  1FKD A;  1EYM A;  4LAX A;  3KAD A;  2RUC A;  4JFJ A;  1BKF A;  4GGQ A;  2FKE A;  3O5G A;  4ODO A;  1JNS A;  1D7J A;  4DZ2 A;  2RQS A;  3KAF A;  2LJ4 A;  3PA7 A;  3UI5 A;  4NNR A;  3ODK A;  3RGC A;  2F21 A;  4DH0 A;  5I98 A;  3KZ7 A;  4W9Q A;  3JXV A;  2ZQT A;  1HXV A;  2Q5A A;  4ODQ A;  3UI6 A;  1FKT A;  2VN1 A;  3O5J A;  4QT3 A;  4J4O A;  2LKN A;  1QZ2 A;  3CGM A;  4U86 A;  5DIT A;  4DRJ A;  3O5K A;  5HW8 A;  4GIV A;  1TCO C;  2RUR A;  4ODN A;  3NI6 A;  2AWG A;  4R0X A;  1J4I A;  2DG3 A;  2PPP A;  3KAH A;  2F4E A;  3O5Q A;  1ROU A;  3O5O A;  1PBK A;  2L2S A;  4QT2 A;  2KE0 A;  2KO7 A;  1J6Y A;  5HW6 A;  4DRO A;  2PPN A;  3UQI A;  2M1I A;  3TC5 A;  5HUA A;  1F8A B;  1NMV A;  1FJD A;  2RUD A;  2Y78 A;  4IQ2 A;  3OOB A;  1R9H A;  2FAP A;  2K8I A;  5GPG A;  3UQA A;  1FAP A;  2M2A A;  1J4R A;  2XPA A;  3KAB A;  3LUO A;  1YW5 A;  4ODK A;  1P5Q A;  2XP9 A;  4LAY A;  3RFW A;  1NSG A;  4TW7 A;  1Y0O A;  3PRB A;  4DRI A;  1QPL A;  4W9O A;  5DIU A;  2XP7 A;  2XP4 A;  3IHZ A;  1W26 A;  1FD9 A;  1U79 A;  2ZR5 A;  2DG4 A;  3IKD A;  5BXJ A;  4LAV A;  2MF9 A;  3O5P A;  5HT1 A;  5B8I C;  3FAP A;  2N87 A;  2JZV A;  1ROT A;  2ZQS A;  1PIN A;  2ZR4 A;  3IK8 A;  4LAW A;  4BF8 A;  4DT4 A;  3H9R B;  3I6C A;  4JFI A;  4MGV A;  3UQB A;  1A7X A;  1FKK A;  3TCZ A;  3O5D A;  1YAT A;  4FAP A;  1JNT A;  1FKJ A;  2VCD A;  1KT1 A;  3NRK A;  1C9H A;  1D7I A;  4JFK A;  4DRQ A;  3GPK A;  5HKG A;  5HWC A;  1B6C A;  4ODM A;  1Q6H A;  2MNT A;  2LGO A;  2XP3 A;  3O5E A;  4IPX A;  3VAW A;  2ZQU A;  4DRP A;  4QIB A;  4ODL A;  2MPH A;  1KT0 A;  2DG9 A;  3KAG A;  3PRD A;  1D6O A;  3O5R A;  3EY6 A;  2MLZ A;  1Q6I A;  3B7X A;  4U84 A;  5D75 A;  2D9F A;  3UF8 A;  4DZ3 A;  2MLX A;  3CGN A;  3TDB A;  1QPF A;  2MLY A;  1EQ3 A;  3O5M A;  4MSP A;  1FKB A;  1N1A A;  2ZQV A;  2ITK A;  2RSE A;  3KAC A;  1JVW A;  5HWB A;  1T11 A;  1J4H A;  4U85 A;  1FKS A;  2UZ5 A;  2XP5 A;  4ODR A;  4JFL A;  1F40 A;  3NTP A;  2RUQ A;  4G50 A;  3KAI A;  2LPV A;  4TW6 A;  1FKR A;  4DRH A;  1BL4 A;  3JYM A;  3O5I A;  4J4N A;  4TYO A;  2PPO A;  2KI3 A;  1M5Y A;  1FKF A;  1Q1C A; 
#chains in the Genus database with same CATH topology
 1FKL A;  1Q6U A;  2DPE A;  2M08 A;  4W9P A;  4P8W A;  4DRK A;  4DWS A;  3O5L A;  3IKG A;  4ITZ A;  1L1P A;  1D7H A;  1E9L A;  1HKI A;  2PV2 A;  4DIP A;  2PI6 A;  4DRN A;  5HTG A;  4P8X A;  1VF8 A;  2XP6 A;  1FFQ A;  2PV1 A;  4LAX A;  1E6R A;  3ARO A;  4GGQ A;  3O5G A;  4KQZ A;  1GPF A;  3AS1 A;  2ETN A;  3WD2 A;  3RGC A;  5I98 A;  2Q5A A;  4ODQ A;  1FKT A;  1OGG A;  2ESC A;  2O92 A;  4MTV A;  3CGM A;  3ARS A;  4NSB A;  1TCO C;  4WIW A;  4N19 A;  4ODO A;  4DRJ A;  1TFV A;  2F4E A;  3ARU A;  1RD6 A;  4QT2 A;  4DWS D;  2KE0 A;  2KO7 A;  5HW6 A;  4DRO A;  2PPN A;  4S3K A;  2B5U B;  4IQ2 A;  1R9H A;  1J4R A;  3KAB A;  1LQ0 A;  2XP9 A;  1Y0O A;  3PR9 A;  1HJW A;  1JND A;  2MF9 A;  3ARV A;  5HT1 A;  3FAP A;  1W9V A;  2N87 A;  2ZR4 A;  4LAW A;  3WL1 A;  1A7X A;  4IT4 A;  3B8S A;  3ARY A;  4P8U A;  1B6C A;  1Q6H A;  1WNO A;  2XP3 A;  3O5E A;  4IPX A;  3VAW A;  4DRP A;  4QIB A;  2DG9 A;  3KAG A;  3PRD A;  1W9P A;  3ARQ A;  3CHD A;  2AOS A;  4DZ3 A;  3WD1 A;  3WD4 A;  3B9A A;  1QPF A;  3G6L A;  4MSP A;  4NZC A;  4LGX A;  3BMB A;  5HWB A;  1E6N A;  1FKS A;  2UZ5 A;  2IUZ A;  2A3A A;  2LPV A;  1BL4 A;  4Z2H A;  5DF0 A;  4W9O A;  4L3N A;  1W1V A;  3ARW A;  1FKG A;  2XPB A;  3UI4 A;  4AY1 A;  2KR7 A;  1HKJ A;  1LL7 A;  2PV3 A;  1LL4 A;  3BXW A;  1ZL1 A;  2PBC A;  5DIV A;  1NMW A;  4JYS A;  5HW7 A;  3CHF A;  4O2T A;  1JCH B;  1ITX A;  3O5F A;  4HBO A;  3ARZ A;  1EYM A;  3KAD A;  4JFJ A;  1BKF A;  2FKE A;  3WKZ A;  3B9E A;  1JNS A;  4PTM A;  2RQS A;  3KAF A;  1XHG A;  5GPR A;  1H0G A;  4DH0 A;  1KFW A;  1SYT A;  1LL6 A;  4QT3 A;  3ARP A;  2LKN A;  1QZ2 A;  1OGB A;  1E6P A;  2O9O A;  4MNK A;  4R0X A;  5GPG A;  2PPP A;  3O5Q A;  2YBT A;  3O5O A;  2L2S A;  1J6Y A;  3CHE A;  2WLZ A;  2M1I A;  3PRA A;  5HUA A;  1NMV A;  1FJD A;  3CH9 A;  2FAP A;  3AS2 A;  3WD0 A;  2DSW A;  1FAP A;  1K9T A;  4WKF A;  1P5Q A;  4LAY A;  3RFW A;  4TW7 A;  3AQU A;  2XP7 A;  1GOI A;  1U79 A;  2DG4 A;  3RM9 A;  5BXJ A;  2DT0 A;  4XAK A;  1PIN A;  2DT3 A;  3I6C A;  3UQB A;  4Z2I A;  2B31 A;  4ZS6 A;  1W9U A;  3TCZ A;  3O5D A;  4FAP A;  1W1Y A;  1JNT A;  3NRK A;  1D7I A;  1LG2 A;  5HKG A;  3EIP A;  4ODM A;  1ZB5 A;  2LGO A;  2A3C A;  2DSV A;  1HJX A;  2MPH A;  1KT0 A;  5D75 A;  1D6O A;  4U84 A;  3UF8 A;  2MLZ A;  1Q6I A;  1EQ3 A;  3O5M A;  4Z2L A;  2ZQV A;  1N1A A;  2RSE A;  4U85 A;  2XP5 A;  2G41 A;  3KAI A;  1CTN A;  1W1T A;  4J4N A;  2PPO A;  4QZV B;  2DT1 A;  1LG1 A;  3CHC A;  4TW8 A;  3QOK A;  3RM4 A;  1ZK6 A;  4TNS A;  4C02 B;  4DRM A;  2KFW A;  4JFM A;  1E6Z A;  3ARR A;  1LJY A;  2ZR6 A;  3AS0 A;  4FN2 A;  4TX0 A;  1EDQ A;  1GRJ A;  2QF8 A;  1ZCN A;  2KGJ A;  2RUC A;  4KR0 B;  4Q22 A;  2PN0 A;  2LJ4 A;  4L72 B;  4NNR A;  3ODK A;  2F21 A;  4W9Q A;  2ZQT A;  1IX5 A;  1HXV A;  3UI6 A;  5HBF A;  4J4O A;  4IT6 A;  5HW8 A;  1HJV A;  4GIV A;  2RUR A;  4ODN A;  3NI6 A;  3W4R A;  1X6N A;  4S3J A;  1HKK A;  2DG3 A;  2OLH A;  4ZPW R;  3AS3 A;  3UQI A;  2WLY A;  3TC5 A;  2A3B A;  2RUD A;  3OOB A;  4HAR A;  3RM8 A;  3UQA A;  4Q7N A;  4ODK A;  1O6I A;  3B9D A;  1NSG A;  4DRI A;  3PRB A;  4Z2J A;  5DIU A;  1NWT A;  2XP4 A;  3IHZ A;  1W26 A;  2DSZ A;  2ZR5 A;  3IKD A;  4LAV A;  3O5P A;  5B8I C;  4Z2G A;  4MPK A;  4WKH A;  1XRV A;  3IK8 A;  3ALG A;  4W5U A;  4JFI A;  4MGV A;  1ZU8 A;  1FKK A;  1YAT A;  2VCD A;  3ART A;  1EHN A;  1E15 A;  4JFK A;  1ZBK A;  3GPK A;  5HWC A;  2MNT A;  2DSU A;  4WK9 A;  5DEZ A;  5GQB A;  2FDM A;  1HKM A;  1E44 A;  2A3E A;  3O5R A;  4MAV A;  3B7X A;  4HBE A;  1WAW A;  2MLX A;  2MLY A;  1FKB A;  3KAC A;  4DWS C;  1J4H A;  4JFL A;  3NTP A;  4TW6 A;  1X6L A;  1FKR A;  4DRH A;  4ML4 A;  3JYM A;  3O5I A;  1M5Y A;  1FKF A;  1ZBC A;  3OA5 A;  1UR8 A;  3FY1 A;  1FKI A;  2IF4 A;  2OFN A;  4G2P A;  3MDY B;  1FKH A;  2F2D A;  2XP8 A;  5JH8 A;  3KCE A;  5J6E A;  3JYJ A;  2EUL A;  4IQC A;  1FFR A;  3WH0 A;  4ODP A;  1FKD A;  4WKA A;  3CZ8 A;  1D7J A;  4DZ2 A;  3WQV A;  1ZBV A;  2P4V A;  3PA7 A;  3FXY A;  3UI5 A;  1NH6 A;  1GUV A;  3KZ7 A;  3JXV A;  1OWQ A;  2VN1 A;  4Z2K A;  2F23 A;  1JNE A;  4U86 A;  1EIB A;  5DIT A;  3O5K A;  3WD3 A;  2AWG A;  1J4I A;  3KAH A;  1ROU A;  1PBK A;  3GTY X;  4MNL A;  1F8A B;  4P8V A;  4ZPV R;  2Y78 A;  3WIJ A;  1UR9 A;  3ARX A;  1ZBW A;  2K8I A;  1WB0 A;  2M2A A;  2XPA A;  3LUO A;  1YW5 A;  4UDM A;  1W1P A;  3WQW A;  4DWS B;  1QPL A;  2G8Z A;  4URI A;  2YBU A;  1H0I A;  1FD9 A;  4WJX A;  3WL0 A;  4R5E A;  2JZV A;  1ROT A;  1NWS A;  2ZQS A;  3ALF A;  4BF8 A;  5DO2 A;  4DT4 A;  3H9R B;  1FKJ A;  1SR0 A;  1KT1 A;  1C9H A;  4DRQ A;  2WM0 A;  2DT2 A;  2ZQU A;  4ODL A;  3EY6 A;  4MNJ A;  2D9F A;  3CGN A;  3TDB A;  1D2K A;  2ITK A;  1JVW A;  3G6M A;  2WK2 A;  4ZPT R;  1T11 A;  1F40 A;  4ODR A;  3GU0 A;  2RUQ A;  4G50 A;  1NWU A;  1NWR A;  3RME A;  4TYO A;  2KI3 A;  3O5J A;  4MNM A;  1Q1C A; 
#chains in the Genus database with same CATH homology
 1FKL A;  1Q6U A;  2DPE A;  2M08 A;  4W9P A;  4P8W A;  4DRK A;  4DWS A;  3O5L A;  3IKG A;  4ITZ A;  1L1P A;  1D7H A;  1E9L A;  1HKI A;  2PV2 A;  4DIP A;  2PI6 A;  4DRN A;  5HTG A;  4P8X A;  1VF8 A;  2XP6 A;  1FFQ A;  2PV1 A;  4LAX A;  1E6R A;  3ARO A;  4GGQ A;  3O5G A;  4KQZ A;  1GPF A;  3AS1 A;  3WD2 A;  3RGC A;  5I98 A;  2Q5A A;  4ODQ A;  1FKT A;  1OGG A;  2ESC A;  2O92 A;  4MTV A;  3CGM A;  3ARS A;  4NSB A;  1TCO C;  4WIW A;  4N19 A;  4ODO A;  4DRJ A;  1TFV A;  2F4E A;  3ARU A;  1RD6 A;  4QT2 A;  4DWS D;  2KE0 A;  2KO7 A;  5HW6 A;  4DRO A;  2PPN A;  4S3K A;  4IQ2 A;  1R9H A;  1J4R A;  3KAB A;  1LQ0 A;  2XP9 A;  1Y0O A;  3PR9 A;  1HJW A;  1JND A;  2MF9 A;  3ARV A;  5HT1 A;  3FAP A;  1W9V A;  2N87 A;  2ZR4 A;  4LAW A;  3WL1 A;  1A7X A;  4IT4 A;  3B8S A;  3ARY A;  4P8U A;  1B6C A;  1Q6H A;  1WNO A;  2XP3 A;  3O5E A;  4IPX A;  3VAW A;  4DRP A;  4QIB A;  2DG9 A;  3KAG A;  3PRD A;  1W9P A;  3ARQ A;  3CHD A;  2AOS A;  4DZ3 A;  3WD1 A;  3WD4 A;  3B9A A;  1QPF A;  3G6L A;  4MSP A;  4NZC A;  4LGX A;  5HWB A;  1E6N A;  1FKS A;  2UZ5 A;  2IUZ A;  2A3A A;  2LPV A;  1BL4 A;  4Z2H A;  5DF0 A;  4W9O A;  4L3N A;  1W1V A;  3ARW A;  1FKG A;  2XPB A;  3UI4 A;  4AY1 A;  2KR7 A;  1HKJ A;  1LL7 A;  2PV3 A;  1LL4 A;  3BXW A;  1ZL1 A;  2PBC A;  5DIV A;  1NMW A;  4JYS A;  5HW7 A;  3CHF A;  4O2T A;  1ITX A;  3O5F A;  4HBO A;  3ARZ A;  1EYM A;  3KAD A;  4JFJ A;  1BKF A;  2FKE A;  3WKZ A;  3B9E A;  1JNS A;  4PTM A;  2RQS A;  3KAF A;  1XHG A;  5GPR A;  1H0G A;  4DH0 A;  1KFW A;  1SYT A;  1LL6 A;  4QT3 A;  3ARP A;  2LKN A;  1QZ2 A;  1OGB A;  1E6P A;  2O9O A;  4MNK A;  4R0X A;  5GPG A;  2PPP A;  3O5Q A;  2YBT A;  3O5O A;  2L2S A;  1J6Y A;  3CHE A;  2WLZ A;  2M1I A;  3PRA A;  5HUA A;  1NMV A;  1FJD A;  3CH9 A;  2FAP A;  3AS2 A;  3WD0 A;  2DSW A;  1FAP A;  1K9T A;  4WKF A;  1P5Q A;  4LAY A;  3RFW A;  4TW7 A;  3AQU A;  2XP7 A;  1GOI A;  1U79 A;  2DG4 A;  3RM9 A;  5BXJ A;  2DT0 A;  4XAK A;  1PIN A;  2DT3 A;  3I6C A;  3UQB A;  4Z2I A;  2B31 A;  4ZS6 A;  1W9U A;  3TCZ A;  3O5D A;  4FAP A;  1W1Y A;  1JNT A;  3NRK A;  1D7I A;  1LG2 A;  5HKG A;  4ODM A;  1ZB5 A;  2LGO A;  2A3C A;  2DSV A;  1HJX A;  2MPH A;  1KT0 A;  5D75 A;  1D6O A;  4U84 A;  3UF8 A;  2MLZ A;  1Q6I A;  1EQ3 A;  3O5M A;  4Z2L A;  2ZQV A;  1N1A A;  2RSE A;  4U85 A;  2XP5 A;  2G41 A;  3KAI A;  1CTN A;  1W1T A;  4J4N A;  2PPO A;  4QZV B;  2DT1 A;  1LG1 A;  3CHC A;  4TW8 A;  3QOK A;  3RM4 A;  1ZK6 A;  4TNS A;  4C02 B;  4DRM A;  2KFW A;  4JFM A;  1E6Z A;  3ARR A;  1LJY A;  2ZR6 A;  3AS0 A;  4FN2 A;  4TX0 A;  1EDQ A;  2QF8 A;  1ZCN A;  2KGJ A;  2RUC A;  4KR0 B;  4Q22 A;  2LJ4 A;  4L72 B;  4NNR A;  3ODK A;  2F21 A;  4W9Q A;  2ZQT A;  1IX5 A;  1HXV A;  3UI6 A;  5HBF A;  4J4O A;  4IT6 A;  5HW8 A;  1HJV A;  4GIV A;  2RUR A;  4ODN A;  3NI6 A;  3W4R A;  1X6N A;  4S3J A;  1HKK A;  2DG3 A;  2OLH A;  4ZPW R;  3AS3 A;  3UQI A;  2WLY A;  3TC5 A;  2A3B A;  2RUD A;  3OOB A;  4HAR A;  3RM8 A;  3UQA A;  4Q7N A;  4ODK A;  1O6I A;  3B9D A;  1NSG A;  4DRI A;  3PRB A;  4Z2J A;  5DIU A;  1NWT A;  2XP4 A;  3IHZ A;  1W26 A;  2DSZ A;  2ZR5 A;  3IKD A;  4LAV A;  3O5P A;  5B8I C;  4Z2G A;  4MPK A;  4WKH A;  1XRV A;  3IK8 A;  3ALG A;  4W5U A;  4JFI A;  4MGV A;  1ZU8 A;  1FKK A;  1YAT A;  2VCD A;  3ART A;  1EHN A;  1E15 A;  4JFK A;  1ZBK A;  3GPK A;  5HWC A;  2MNT A;  2DSU A;  4WK9 A;  5DEZ A;  5GQB A;  2FDM A;  1HKM A;  2A3E A;  3O5R A;  4MAV A;  3B7X A;  4HBE A;  1WAW A;  2MLX A;  2MLY A;  1FKB A;  3KAC A;  4DWS C;  1J4H A;  4JFL A;  3NTP A;  4TW6 A;  1X6L A;  1FKR A;  4DRH A;  4ML4 A;  3JYM A;  3O5I A;  1M5Y A;  1FKF A;  1ZBC A;  3OA5 A;  1UR8 A;  3FY1 A;  1FKI A;  2IF4 A;  2OFN A;  4G2P A;  3MDY B;  1FKH A;  2F2D A;  2XP8 A;  5JH8 A;  3KCE A;  5J6E A;  3JYJ A;  4IQC A;  1FFR A;  3WH0 A;  4ODP A;  1FKD A;  4WKA A;  3CZ8 A;  1D7J A;  4DZ2 A;  3WQV A;  1ZBV A;  3PA7 A;  3FXY A;  3UI5 A;  1NH6 A;  1GUV A;  3KZ7 A;  3JXV A;  1OWQ A;  2VN1 A;  4Z2K A;  1JNE A;  4U86 A;  1EIB A;  5DIT A;  3O5K A;  3WD3 A;  2AWG A;  1J4I A;  3KAH A;  1ROU A;  1PBK A;  4MNL A;  1F8A B;  4P8V A;  4ZPV R;  2Y78 A;  3WIJ A;  1UR9 A;  3ARX A;  1ZBW A;  2K8I A;  1WB0 A;  2M2A A;  2XPA A;  3LUO A;  1YW5 A;  1W1P A;  3WQW A;  4DWS B;  1QPL A;  2G8Z A;  4URI A;  2YBU A;  1H0I A;  1FD9 A;  4WJX A;  3WL0 A;  4R5E A;  2JZV A;  1ROT A;  1NWS A;  2ZQS A;  3ALF A;  4BF8 A;  5DO2 A;  4DT4 A;  3H9R B;  1FKJ A;  1SR0 A;  1KT1 A;  1C9H A;  4DRQ A;  2WM0 A;  2DT2 A;  2ZQU A;  4ODL A;  3EY6 A;  4MNJ A;  2D9F A;  3CGN A;  3TDB A;  1D2K A;  2ITK A;  1JVW A;  3G6M A;  2WK2 A;  4ZPT R;  1T11 A;  1F40 A;  4ODR A;  2RUQ A;  4G50 A;  1NWU A;  1NWR A;  3RME A;  4TYO A;  2KI3 A;  3O5J A;  4MNM A;  1Q1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...