2AWGA

Structure of the ppiase domain of the human fk506-binding protein 8
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
b'GSPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 38 kDa FK-506 binding protein
publication title Structure of the human FK-506 binding protein 8
rcsb
source organism Homo sapiens
molecule tags Signaling protein inhibitor
total genus 30
structure length 118
sequence length 118
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2awgA00
4QIBA 3KAGA 3KADA 2LKNA 2ZR6A 2RUQA 2MF9A 1Q6UA 2ZQTA 5DITA 2ZQSA 3B7XA 2MLZA 4DZ2A 4DRIA 3GPKA 5HWCA 2VCDA 4DRHA 1KT0A 2KFWA 3KCEA 3O5GA 4ODOA 1QZ2A 1J4RA 4IPXA 3UQIA 2PV2A 3VAWA 1HXVA 2MLYA 3O5MA 1B6CA 4TX0A 1QPFA 2XPAA 3KAHA 2LPVA 2MLXA 3PRDA 3O5LA 2XP5A 2D9FA 1FJDA 4GGQA 4ODNA 5HW6A 4U85A 2RQSA 4LAYA 4DRMA 1U79A 1W26A 1A7XA 1NMWA 4U84A 3O5PA 1BKFA 1JNSA 3O5OA 3OOBA 3O5IA 4J4NA 1R9HA 3FAPA 4QT2A 4O2TA 2Y78A 3H9RB 3KACA 1P5QA 3ODKA 1FD9A 3RGCA 1FKJA 2RURA 1NMVA 1FKIA 1NSGA 2RUCA 3KABA 3O5DA 3EY6A 3JXVA 3NI6A 4JFJA 4N19A 4TNSA 4BF8A 5HW8A 2PPPA 5HUAA 3O5FA 2UZ5A 4ODMA 4DT4A 5BXJA 1D7HA 1FKDA 1FKKA 3UI4A 2FKEA 3JYJA 2PPNA 4TW8A 2KGJA 4ODPA 4DZ3A 5B8IC 3NTPA 4FN2A 1J4HA 2M2AA 3IKGA 4DRQA 4G2PA 2PV1A 1FKTA 2ZR4A 4DROA 2L2SA 2F2DA 4LAXA 1Q1CA 1Q6HA 1C9HA 2IF4A 3O5JA 2AWGA 2PV3A 2FAPA 2Q5AA 2DG9A 1FKRA 1ZK6A 2F4EA 1Y0OA 1F40A 4JFMA 3IKDA 4GIVA 2KR7A 4R0XA 5I98A 3JYMA 1FKSA 4QT3A 2XP8A 1YATA 1J4IA 5DIUA 4J4OA 1QPLA 1FKLA 4DIPA 4C02B 4W9PA 2DG4A 1TCOC 2MPHA 4MGVA 1KT1A 2XP9A 4U86A 2OFNA 3UI5A 1JNTA 1D7IA 1M5YA 2ZQVA 2M1IA 1L1PA 4NNRA 4DRNA 2JZVA 2XP3A 1YW5A 2RSEA 5DIVA 1EQ3A 3PRBA 3KAFA 1FKGA 4DRKA 2XP7A 2M08A 4ODLA 1FAPA 4ODQA 2RUDA 3UQBA 1FKFA 4DH0A 3PA7A 3CGMA 1JVWA 5HT1A 1PBKA 1D6OA 3KZ7A 1ROUA 3I6CA 2N87A 2K8IA 1ROTA 3RFWA 4TYOA 3CGNA 3TDBA 2ITKA 3UF8A 1EYMA 5HW7A 3O5KA 2ZR5A 2F21A 4G50A 1Q6IA 2KI3A 4ODRA 4ODKA 3MDYB 5GPGA 5J6EA 2DG3A 2LJ4A 2KE0A 2VN1A 5HWBA 1T11A 4JFLA 4DRPA 1FKBA 2ZQUA 2XPBA 4W9QA 5D75A 5HTGA 2MNTA 4LAVA 1BL4A 4LAWA 4MSPA 4IQCA 3IK8A 1F8AB 2KO7A 4FAPA 2PPOA 4TW7A 3O5QA 3IHZA 1PINA 1ZCNA 2XP4A 4JYSA 3TCZA 2PBCA 4IQ2A 4W9OA 4ITZA 3NRKA 3O5EA 3TC5A 1D7JA 1FKHA 2XP6A 3KAIA 4JFKA 3UQAA 4DRJA 3WH0A 3LUOA 4JFIA 2LGOA 4TW6A 1N1AA 5HKGA 3O5RA 1J6YA 3UI6A
chains in the Genus database with same CATH superfamily
3ALFA 3AS0A 2LKNA 1HJVA 2ZQTA 3RM9A 1KT0A 1W1TA 4QZVB 1QZ2A 3VAWA 3O5MA 1B6CA 4TX0A 1QPFA 2MLXA 1W9UA 3O5LA 2XP5A 2D9FA 4GGQA 1RD6A 4U85A 4LAYA 1U79A 1NMWA 1BKFA 1JNSA 4QT2A 3FAPA 2Y78A 4XAKA 3ODKA 1HJWA 1FKJA 2RURA 1NMVA 3PRAA 4DWSD 4BF8A 2UZ5A 4ODMA 1FKDA 1OGBA 3ARPA 3B9AA 2PPNA 2KGJA 5B8IC 4WKAA 3NTPA 4FN2A 3IKGA 4DRQA 2ZR4A 1Q1CA 1WAWA 1ZB5A 2IF4A 3CHFA 2PV3A 4P8UA 1F40A 1D2KA 1LL4A 2KR7A 4GIVA 3JYMA 1FKSA 2XP8A 1FFRA 1FKLA 4Q7NA 4DWSA 4C02B 4W9PA 2DG4A 2XP9A 2M1IA 2A3AA 4NNRA 4DRNA 1YW5A 5GQBA 4ZPTR 1UR9A 2A3BA 3GTYX 4DRKA 2M08A 3WD3A 2G41A 1FAPA 4ODQA 1E15A 2N87A 1O6IA 1ROTA 1SYTA 2G8ZA 3FY1A 3TDBA 5HW7A 2ZR5A 4G50A 4ODRA 2KI3A 3EIPA 2VN1A 3B8SA 2YBUA 1T11A 4JFLA 2ZQUA 5HTGA 1BL4A 4WIWA 4LAWA 3IK8A 1LG1A 3IHZA 1ZCNA 3ARYA 2A3CA 2PBCA 3NRKA 1FKHA 3KAIA 3UQAA 4DRJA 2DSUA 2WLYA 4MPKA 4QIBA 1JCHB 1Q6UA 4WKFA 5HWCA 5DF0A 4DRHA 3UQIA 1HXVA 2DT1A 2XPAA 3ARXA 3GU0A 3PRDA 1ZBCA 1UR8A 1E6PA 2AOSA 5HW6A 4DRMA 2RQSA 2A3EA 4U84A 3OOBA 2DSWA 4J4NA 1P5QA 3AS2A 1FD9A 3RGCA 1FKIA 2RUCA 3CHCA 3KABA 4TNSA 4JFJA 5HUAA 1K9TA 3ARZA 3O5FA 3ARWA 1FKKA 1GRJA 3UI4A 3ARSA 3JYJA 4ODPA 1NWUA 2FDMA 3WD2A 2L2SA 4HARA 3CZ8A 1Q6HA 4IT6A 2Q5AA 2DG9A 1FKRA 4IT4A 4JFMA 4R0XA 4AY1A 1J4IA 5DO2A 3ALGA 1OWQA 1QPLA 1IX5A 3WQWA 1ITXA 4MGVA 1KT1A 5GPRA 1JNTA 1L1PA 1E6RA 3WQVA 4P8VA 2PN0A 2XP3A 5DIVA 4KQZA 1FKGA 2XP7A 3WL1A 1LG2A 1FKFA 3G6LA 3CGMA 1JVWA 1LL6A 4HBEA 5JH8A 3B9DA 1HKIA 1TFVA 3UF8A 1EYMA 4L3NA 4ZS6A 1Q6IA 1HKJA 2DG3A 1X6NA 2LJ4A 1NWRA 1FKBA 2XPBA 4DWSC 4LAVA 1CTNA 4MSPA 1F8AB 1W1VA 2PPOA 1ZL1A 1PINA 3AQUA 4PTMA 1D7JA 3WL0A 4JFKA 2O92A 3WH0A 1WNOA 2LGOA 4TW6A 5HKGA 3O5RA 4P8WA 3UI6A 1GUVA 3KADA 3BMBA 5DITA 2RUQA 2ZQSA 4DZ2A 3GPKA 4NZCA 2VCDA 4ZPVR 4ODOA 1J4RA 4IPXA 1SR0A 1W9VA 3KAHA 4MNKA 2LPVA 4Z2KA 4ODNA 1KFWA 1W26A 1A7XA 1NH6A 4R5EA 3O5IA 3H9RB 4URIA 4NSBA 3G6MA 4N19A 3O5DA 5HW8A 3JXVA 3NI6A 4Z2HA 4DT4A 5BXJA 1D7HA 2FKEA 1XRVA 2M2AA 4G2PA 3WD1A 2F2DA 1NWTA 4LAXA 1C9HA 3AROA 3W4RA 2DSZA 2F4EA 1Y0OA 3ARTA 5I98A 2O9OA 1YATA 2EULA 5DIUA 1W1PA 4DIPA 1GPFA 4U86A 3ARQA 2WK2A 4ML4A 3PRBA 4UDMA 1E6NA 3AS1A 4ODLA 1WB0A 1JNDA 1LJYA 4HBOA 4Z2LA 3PA7A 1H0GA 1HJXA 5HT1A 1PBKA 1ROUA 1X6LA 2DT2A 2F23A 3ARVA 5J6EA 5GPGA 5DEZA 5HWBA 3B9EA 3PR9A 4DRPA 4W9QA 1EIBA 3WKZA 3CHEA 3QOKA 2DT0A 3BXWA 2KO7A 1E6ZA 4TW7A 3O5QA 1OGGA 1H0IA 4LGXA 2XP4A 4JYSA 3ARUA 4ITZA 3O5EA 2XP6A 4WKHA 4WJXA 2ESCA 1N1AA 1ZU8A 1EDQA 3KAGA 3CH9A 2ZR6A 2MF9A 2PI6A 3B7XA 2MLZA 2DPEA 4DRIA 4DWSB 2KFWA 3KCEA 3O5GA 2PV2A 3OA5A 2MLYA 5HBFA 4WK9A 3WD0A 4S3KA 4MNJA 1FJDA 1FFQA 3WIJA 1JNEA 3O5PA 2WLZA 3O5OA 1R9HA 4W5UA 1VF8A 4O2TA 3RMEA 3KACA 4MNMA 2ETNA 4L72B 1NSGA 3EY6A 2PPPA 2B5UB 2QF8A 4TW8A 4DZ3A 1J4HA 2PV1A 1FKTA 4DROA 1GOIA 2B31A 4Z2IA 3O5JA 2AWGA 2FAPA 1W1YA 3WD4A 1ZK6A 1E44A 3IKDA 4QT3A 1W9PA 1EHNA 4J4OA 1ZBKA 1LL7A 1TCOC 2MPHA 4KR0B 2OFNA 3UI5A 1HKMA 1D7IA 1M5YA 2ZQVA 1HKKA 4MNLA 2JZVA 2RSEA 1EQ3A 3KAFA 2YBTA 2RUDA 3UQBA 4DH0A 2DSVA 1D6OA 3KZ7A 4S3JA 4P8XA 2OLHA 2IUZA 2K8IA 3RFWA 1NWSA 4TYOA 3CGNA 2ITKA 3O5KA 4ODKA 2F21A 3MDYB 2KE0A 3RM4A 2P4VA 3ARRA 4Z2JA 5D75A 1ZBWA 1LQ0A 2MNTA 3AS3A 3RM8A 4IQCA 4ZPWR 4Z2GA 4MAVA 4FAPA 2WM0A 1E9LA 2DT3A 3FXYA 3TCZA 1ZBVA 3CHDA 4W9OA 3TC5A 4Q22A 3LUOA 4MTVA 4JFIA 1J6YA 3I6CA 4IQ2A 1XHGA
chains in the Genus database with same CATH topology
3ALFA 3AS0A 2LKNA 1HJVA 2ZQTA 3RM9A 1KT0A 1W1TA 4QZVB 1QZ2A 3VAWA 3O5MA 1B6CA 4TX0A 1QPFA 2MLXA 1W9UA 3O5LA 2XP5A 2D9FA 4GGQA 1RD6A 4U85A 4LAYA 1U79A 1NMWA 1BKFA 1JNSA 4QT2A 3FAPA 2Y78A 4XAKA 3ODKA 1HJWA 1FKJA 2RURA 1NMVA 3PRAA 4DWSD 4BF8A 2UZ5A 4ODMA 1FKDA 1OGBA 3ARPA 3B9AA 2PPNA 2KGJA 5B8IC 4WKAA 3NTPA 4FN2A 3IKGA 4DRQA 2ZR4A 1Q1CA 1WAWA 1ZB5A 2IF4A 3CHFA 2PV3A 4P8UA 1F40A 1D2KA 1LL4A 2KR7A 4GIVA 3JYMA 1FKSA 2XP8A 1FFRA 1FKLA 4Q7NA 4DWSA 4C02B 4W9PA 2DG4A 2XP9A 2M1IA 2A3AA 4NNRA 4DRNA 1YW5A 5GQBA 4ZPTR 1UR9A 2A3BA 4DRKA 2M08A 3WD3A 2G41A 1FAPA 4ODQA 1E15A 2N87A 1O6IA 1ROTA 1SYTA 2G8ZA 3FY1A 3TDBA 5HW7A 2ZR5A 4G50A 4ODRA 2KI3A 2VN1A 3B8SA 2YBUA 1T11A 4JFLA 2ZQUA 5HTGA 1BL4A 4WIWA 4LAWA 3IK8A 1LG1A 3IHZA 1ZCNA 3ARYA 2A3CA 2PBCA 3NRKA 1FKHA 3KAIA 3UQAA 4DRJA 2DSUA 2WLYA 4MPKA 4QIBA 1Q6UA 4WKFA 5HWCA 5DF0A 4DRHA 3UQIA 1HXVA 2DT1A 2XPAA 3ARXA 3PRDA 1ZBCA 1UR8A 1E6PA 2AOSA 5HW6A 4DRMA 2RQSA 2A3EA 4U84A 3OOBA 2DSWA 4J4NA 1P5QA 3AS2A 1FD9A 3RGCA 1FKIA 2RUCA 3CHCA 3KABA 4TNSA 4JFJA 5HUAA 1K9TA 3ARZA 3O5FA 3ARWA 1FKKA 3UI4A 3ARSA 3JYJA 4ODPA 1NWUA 2FDMA 3WD2A 2L2SA 4HARA 3CZ8A 1Q6HA 4IT6A 2Q5AA 2DG9A 1FKRA 4IT4A 4JFMA 4R0XA 4AY1A 1J4IA 5DO2A 3ALGA 1OWQA 1QPLA 1IX5A 3WQWA 1ITXA 4MGVA 1KT1A 5GPRA 1JNTA 1L1PA 1E6RA 3WQVA 4P8VA 2XP3A 5DIVA 4KQZA 1FKGA 2XP7A 3WL1A 1LG2A 1FKFA 3G6LA 3CGMA 1JVWA 1LL6A 4HBEA 5JH8A 3B9DA 1HKIA 1TFVA 3UF8A 1EYMA 4L3NA 4ZS6A 1Q6IA 1HKJA 2DG3A 1X6NA 2LJ4A 1NWRA 1FKBA 2XPBA 4DWSC 4LAVA 1CTNA 4MSPA 1F8AB 1W1VA 2PPOA 1ZL1A 1PINA 3AQUA 4PTMA 1D7JA 3WL0A 4JFKA 2O92A 3WH0A 1WNOA 2LGOA 4TW6A 5HKGA 3O5RA 4P8WA 3UI6A 1GUVA 3KADA 5DITA 2RUQA 2ZQSA 4DZ2A 3GPKA 4NZCA 2VCDA 4ZPVR 4ODOA 1J4RA 4IPXA 1SR0A 1W9VA 3KAHA 4MNKA 2LPVA 4Z2KA 4ODNA 1KFWA 1W26A 1A7XA 1NH6A 4R5EA 3O5IA 3H9RB 4URIA 4NSBA 3G6MA 4N19A 3O5DA 5HW8A 3JXVA 3NI6A 4Z2HA 4DT4A 5BXJA 1D7HA 2FKEA 1XRVA 2M2AA 4G2PA 3WD1A 2F2DA 1NWTA 4LAXA 1C9HA 3AROA 3W4RA 2DSZA 2F4EA 1Y0OA 3ARTA 5I98A 2O9OA 1YATA 5DIUA 1W1PA 4DIPA 1GPFA 4U86A 3ARQA 2WK2A 4ML4A 3PRBA 1E6NA 3AS1A 4ODLA 1WB0A 1JNDA 1LJYA 4HBOA 4Z2LA 3PA7A 1H0GA 1HJXA 5HT1A 1PBKA 1ROUA 1X6LA 2DT2A 3ARVA 5J6EA 5GPGA 5DEZA 5HWBA 3B9EA 3PR9A 4DRPA 4W9QA 1EIBA 3WKZA 3CHEA 3QOKA 2DT0A 3BXWA 2KO7A 1E6ZA 4TW7A 3O5QA 1OGGA 1H0IA 4LGXA 2XP4A 4JYSA 3ARUA 4ITZA 3O5EA 2XP6A 4WKHA 4WJXA 2ESCA 1N1AA 1ZU8A 1EDQA 3KAGA 3CH9A 2ZR6A 2MF9A 2PI6A 3B7XA 2MLZA 2DPEA 4DRIA 4DWSB 2KFWA 3KCEA 3O5GA 2PV2A 3OA5A 2MLYA 5HBFA 4WK9A 3WD0A 4S3KA 4MNJA 1FJDA 1FFQA 3WIJA 1JNEA 3O5PA 2WLZA 3O5OA 1R9HA 4W5UA 1VF8A 4O2TA 3RMEA 3KACA 4MNMA 4L72B 1NSGA 3EY6A 2PPPA 2QF8A 4TW8A 4DZ3A 1J4HA 2PV1A 1FKTA 4DROA 1GOIA 2B31A 4Z2IA 3O5JA 2AWGA 2FAPA 1W1YA 3WD4A 1ZK6A 3IKDA 4QT3A 1W9PA 1EHNA 4J4OA 1ZBKA 1LL7A 1TCOC 2MPHA 4KR0B 2OFNA 3UI5A 1HKMA 1D7IA 1M5YA 2ZQVA 1HKKA 4MNLA 2JZVA 2RSEA 1EQ3A 3KAFA 2YBTA 2RUDA 3UQBA 4DH0A 2DSVA 1D6OA 3KZ7A 4S3JA 4P8XA 2OLHA 2IUZA 2K8IA 3RFWA 1NWSA 4TYOA 3CGNA 2ITKA 3O5KA 4ODKA 2F21A 3MDYB 2KE0A 3RM4A 3ARRA 4Z2JA 5D75A 1ZBWA 1LQ0A 2MNTA 3AS3A 3RM8A 4IQCA 4ZPWR 4Z2GA 4MAVA 4FAPA 2WM0A 1E9LA 2DT3A 3FXYA 3TCZA 1ZBVA 3CHDA 4W9OA 3TC5A 4Q22A 3LUOA 4MTVA 4JFIA 1J6YA 3I6CA 4IQ2A 1XHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QIB A;  3KAG A;  3KAD A;  2LKN A;  2ZR6 A;  2RUQ A;  2MF9 A;  1Q6U A;  2ZQT A;  5DIT A;  2ZQS A;  3B7X A;  2MLZ A;  4DZ2 A;  4DRI A;  3GPK A;  5HWC A;  2VCD A;  4DRH A;  1KT0 A;  2KFW A;  3KCE A;  3O5G A;  4ODO A;  1QZ2 A;  1J4R A;  4IPX A;  3UQI A;  2PV2 A;  3VAW A;  1HXV A;  2MLY A;  3O5M A;  1B6C A;  4TX0 A;  1QPF A;  2XPA A;  3KAH A;  2LPV A;  2MLX A;  3PRD A;  3O5L A;  2XP5 A;  2D9F A;  1FJD A;  4GGQ A;  4ODN A;  5HW6 A;  4U85 A;  2RQS A;  4LAY A;  4DRM A;  1U79 A;  1W26 A;  1A7X A;  1NMW A;  4U84 A;  3O5P A;  1BKF A;  1JNS A;  3O5O A;  3OOB A;  3O5I A;  4J4N A;  1R9H A;  3FAP A;  4QT2 A;  4O2T A;  2Y78 A;  3H9R B;  3KAC A;  1P5Q A;  3ODK A;  1FD9 A;  3RGC A;  1FKJ A;  2RUR A;  1NMV A;  1FKI A;  1NSG A;  2RUC A;  3KAB A;  3O5D A;  3EY6 A;  3JXV A;  3NI6 A;  4JFJ A;  4N19 A;  4TNS A;  4BF8 A;  5HW8 A;  2PPP A;  5HUA A;  3O5F A;  2UZ5 A;  4ODM A;  4DT4 A;  5BXJ A;  1D7H A;  1FKD A;  1FKK A;  3UI4 A;  2FKE A;  3JYJ A;  2PPN A;  4TW8 A;  2KGJ A;  4ODP A;  4DZ3 A;  5B8I C;  3NTP A;  4FN2 A;  1J4H A;  2M2A A;  3IKG A;  4DRQ A;  4G2P A;  2PV1 A;  1FKT A;  2ZR4 A;  4DRO A;  2L2S A;  2F2D A;  4LAX A;  1Q1C A;  1Q6H A;  1C9H A;  2IF4 A;  3O5J A;  2AWG A;  2PV3 A;  2FAP A;  2Q5A A;  2DG9 A;  1FKR A;  1ZK6 A;  2F4E A;  1Y0O A;  1F40 A;  4JFM A;  3IKD A;  4GIV A;  2KR7 A;  4R0X A;  5I98 A;  3JYM A;  1FKS A;  4QT3 A;  2XP8 A;  1YAT A;  1J4I A;  5DIU A;  4J4O A;  1QPL A;  1FKL A;  4DIP A;  4C02 B;  4W9P A;  2DG4 A;  1TCO C;  2MPH A;  4MGV A;  1KT1 A;  2XP9 A;  4U86 A;  2OFN A;  3UI5 A;  1JNT A;  1D7I A;  1M5Y A;  2ZQV A;  2M1I A;  1L1P A;  4NNR A;  4DRN A;  2JZV A;  2XP3 A;  1YW5 A;  2RSE A;  5DIV A;  1EQ3 A;  3PRB A;  3KAF A;  1FKG A;  4DRK A;  2XP7 A;  2M08 A;  4ODL A;  1FAP A;  4ODQ A;  2RUD A;  3UQB A;  1FKF A;  4DH0 A;  3PA7 A;  3CGM A;  1JVW A;  5HT1 A;  1PBK A;  1D6O A;  3KZ7 A;  1ROU A;  3I6C A;  2N87 A;  2K8I A;  1ROT A;  3RFW A;  4TYO A;  3CGN A;  3TDB A;  2ITK A;  3UF8 A;  1EYM A;  5HW7 A;  3O5K A;  2ZR5 A;  2F21 A;  4G50 A;  1Q6I A;  2KI3 A;  4ODR A;  4ODK A;  3MDY B;  5GPG A;  5J6E A;  2DG3 A;  2LJ4 A;  2KE0 A;  2VN1 A;  5HWB A;  1T11 A;  4JFL A;  4DRP A;  1FKB A;  2ZQU A;  2XPB A;  4W9Q A;  5D75 A;  5HTG A;  2MNT A;  4LAV A;  1BL4 A;  4LAW A;  4MSP A;  4IQC A;  3IK8 A;  1F8A B;  2KO7 A;  4FAP A;  2PPO A;  4TW7 A;  3O5Q A;  3IHZ A;  1PIN A;  1ZCN A;  2XP4 A;  4JYS A;  3TCZ A;  2PBC A;  4IQ2 A;  4W9O A;  4ITZ A;  3NRK A;  3O5E A;  3TC5 A;  1D7J A;  1FKH A;  2XP6 A;  3KAI A;  4JFK A;  3UQA A;  4DRJ A;  3WH0 A;  3LUO A;  4JFI A;  2LGO A;  4TW6 A;  1N1A A;  5HKG A;  3O5R A;  1J6Y A;  3UI6 A; 
#chains in the Genus database with same CATH topology
 3ALF A;  3AS0 A;  2LKN A;  1HJV A;  2ZQT A;  3RM9 A;  1KT0 A;  1W1T A;  4QZV B;  1QZ2 A;  3VAW A;  3O5M A;  1B6C A;  4TX0 A;  1QPF A;  2MLX A;  1W9U A;  3O5L A;  2XP5 A;  2D9F A;  4GGQ A;  1RD6 A;  4U85 A;  4LAY A;  1U79 A;  1NMW A;  1BKF A;  1JNS A;  4QT2 A;  3FAP A;  2Y78 A;  4XAK A;  3ODK A;  1HJW A;  1FKJ A;  2RUR A;  1NMV A;  3PRA A;  4DWS D;  4BF8 A;  2UZ5 A;  4ODM A;  1FKD A;  1OGB A;  3ARP A;  3B9A A;  2PPN A;  2KGJ A;  5B8I C;  4WKA A;  3NTP A;  4FN2 A;  3IKG A;  4DRQ A;  2ZR4 A;  1Q1C A;  1WAW A;  1ZB5 A;  2IF4 A;  3CHF A;  2PV3 A;  4P8U A;  1F40 A;  1D2K A;  1LL4 A;  2KR7 A;  4GIV A;  3JYM A;  1FKS A;  2XP8 A;  1FFR A;  1FKL A;  4Q7N A;  4DWS A;  4C02 B;  4W9P A;  2DG4 A;  2XP9 A;  2M1I A;  2A3A A;  4NNR A;  4DRN A;  1YW5 A;  5GQB A;  4ZPT R;  1UR9 A;  2A3B A;  3GTY X;  4DRK A;  2M08 A;  3WD3 A;  2G41 A;  1FAP A;  4ODQ A;  1E15 A;  2N87 A;  1O6I A;  1ROT A;  1SYT A;  2G8Z A;  3FY1 A;  3TDB A;  5HW7 A;  2ZR5 A;  4G50 A;  4ODR A;  2KI3 A;  3EIP A;  2VN1 A;  3B8S A;  2YBU A;  1T11 A;  4JFL A;  2ZQU A;  5HTG A;  1BL4 A;  4WIW A;  4LAW A;  3IK8 A;  1LG1 A;  3IHZ A;  1ZCN A;  3ARY A;  2A3C A;  2PBC A;  3NRK A;  1FKH A;  3KAI A;  3UQA A;  4DRJ A;  2DSU A;  2WLY A;  4MPK A;  4QIB A;  1JCH B;  1Q6U A;  4WKF A;  5HWC A;  5DF0 A;  4DRH A;  3UQI A;  1HXV A;  2DT1 A;  2XPA A;  3ARX A;  3GU0 A;  3PRD A;  1ZBC A;  1UR8 A;  1E6P A;  2AOS A;  5HW6 A;  4DRM A;  2RQS A;  2A3E A;  4U84 A;  3OOB A;  2DSW A;  4J4N A;  1P5Q A;  3AS2 A;  1FD9 A;  3RGC A;  1FKI A;  2RUC A;  3CHC A;  3KAB A;  4TNS A;  4JFJ A;  5HUA A;  1K9T A;  3ARZ A;  3O5F A;  3ARW A;  1FKK A;  1GRJ A;  3UI4 A;  3ARS A;  3JYJ A;  4ODP A;  1NWU A;  2FDM A;  3WD2 A;  2L2S A;  4HAR A;  3CZ8 A;  1Q6H A;  4IT6 A;  2Q5A A;  2DG9 A;  1FKR A;  4IT4 A;  4JFM A;  4R0X A;  4AY1 A;  1J4I A;  5DO2 A;  3ALG A;  1OWQ A;  1QPL A;  1IX5 A;  3WQW A;  1ITX A;  4MGV A;  1KT1 A;  5GPR A;  1JNT A;  1L1P A;  1E6R A;  3WQV A;  4P8V A;  2PN0 A;  2XP3 A;  5DIV A;  4KQZ A;  1FKG A;  2XP7 A;  3WL1 A;  1LG2 A;  1FKF A;  3G6L A;  3CGM A;  1JVW A;  1LL6 A;  4HBE A;  5JH8 A;  3B9D A;  1HKI A;  1TFV A;  3UF8 A;  1EYM A;  4L3N A;  4ZS6 A;  1Q6I A;  1HKJ A;  2DG3 A;  1X6N A;  2LJ4 A;  1NWR A;  1FKB A;  2XPB A;  4DWS C;  4LAV A;  1CTN A;  4MSP A;  1F8A B;  1W1V A;  2PPO A;  1ZL1 A;  1PIN A;  3AQU A;  4PTM A;  1D7J A;  3WL0 A;  4JFK A;  2O92 A;  3WH0 A;  1WNO A;  2LGO A;  4TW6 A;  5HKG A;  3O5R A;  4P8W A;  3UI6 A;  1GUV A;  3KAD A;  3BMB A;  5DIT A;  2RUQ A;  2ZQS A;  4DZ2 A;  3GPK A;  4NZC A;  2VCD A;  4ZPV R;  4ODO A;  1J4R A;  4IPX A;  1SR0 A;  1W9V A;  3KAH A;  4MNK A;  2LPV A;  4Z2K A;  4ODN A;  1KFW A;  1W26 A;  1A7X A;  1NH6 A;  4R5E A;  3O5I A;  3H9R B;  4URI A;  4NSB A;  3G6M A;  4N19 A;  3O5D A;  5HW8 A;  3JXV A;  3NI6 A;  4Z2H A;  4DT4 A;  5BXJ A;  1D7H A;  2FKE A;  1XRV A;  2M2A A;  4G2P A;  3WD1 A;  2F2D A;  1NWT A;  4LAX A;  1C9H A;  3ARO A;  3W4R A;  2DSZ A;  2F4E A;  1Y0O A;  3ART A;  5I98 A;  2O9O A;  1YAT A;  2EUL A;  5DIU A;  1W1P A;  4DIP A;  1GPF A;  4U86 A;  3ARQ A;  2WK2 A;  4ML4 A;  3PRB A;  4UDM A;  1E6N A;  3AS1 A;  4ODL A;  1WB0 A;  1JND A;  1LJY A;  4HBO A;  4Z2L A;  3PA7 A;  1H0G A;  1HJX A;  5HT1 A;  1PBK A;  1ROU A;  1X6L A;  2DT2 A;  2F23 A;  3ARV A;  5J6E A;  5GPG A;  5DEZ A;  5HWB A;  3B9E A;  3PR9 A;  4DRP A;  4W9Q A;  1EIB A;  3WKZ A;  3CHE A;  3QOK A;  2DT0 A;  3BXW A;  2KO7 A;  1E6Z A;  4TW7 A;  3O5Q A;  1OGG A;  1H0I A;  4LGX A;  2XP4 A;  4JYS A;  3ARU A;  4ITZ A;  3O5E A;  2XP6 A;  4WKH A;  4WJX A;  2ESC A;  1N1A A;  1ZU8 A;  1EDQ A;  3KAG A;  3CH9 A;  2ZR6 A;  2MF9 A;  2PI6 A;  3B7X A;  2MLZ A;  2DPE A;  4DRI A;  4DWS B;  2KFW A;  3KCE A;  3O5G A;  2PV2 A;  3OA5 A;  2MLY A;  5HBF A;  4WK9 A;  3WD0 A;  4S3K A;  4MNJ A;  1FJD A;  1FFQ A;  3WIJ A;  1JNE A;  3O5P A;  2WLZ A;  3O5O A;  1R9H A;  4W5U A;  1VF8 A;  4O2T A;  3RME A;  3KAC A;  4MNM A;  2ETN A;  4L72 B;  1NSG A;  3EY6 A;  2PPP A;  2B5U B;  2QF8 A;  4TW8 A;  4DZ3 A;  1J4H A;  2PV1 A;  1FKT A;  4DRO A;  1GOI A;  2B31 A;  4Z2I A;  3O5J A;  2AWG A;  2FAP A;  1W1Y A;  3WD4 A;  1ZK6 A;  1E44 A;  3IKD A;  4QT3 A;  1W9P A;  1EHN A;  4J4O A;  1ZBK A;  1LL7 A;  1TCO C;  2MPH A;  4KR0 B;  2OFN A;  3UI5 A;  1HKM A;  1D7I A;  1M5Y A;  2ZQV A;  1HKK A;  4MNL A;  2JZV A;  2RSE A;  1EQ3 A;  3KAF A;  2YBT A;  2RUD A;  3UQB A;  4DH0 A;  2DSV A;  1D6O A;  3KZ7 A;  4S3J A;  4P8X A;  2OLH A;  2IUZ A;  2K8I A;  3RFW A;  1NWS A;  4TYO A;  3CGN A;  2ITK A;  3O5K A;  4ODK A;  2F21 A;  3MDY B;  2KE0 A;  3RM4 A;  2P4V A;  3ARR A;  4Z2J A;  5D75 A;  1ZBW A;  1LQ0 A;  2MNT A;  3AS3 A;  3RM8 A;  4IQC A;  4ZPW R;  4Z2G A;  4MAV A;  4FAP A;  2WM0 A;  1E9L A;  2DT3 A;  3FXY A;  3TCZ A;  1ZBV A;  3CHD A;  4W9O A;  3TC5 A;  4Q22 A;  3LUO A;  4MTV A;  4JFI A;  1J6Y A;  3I6C A;  4IQ2 A;  1XHG A; 
#chains in the Genus database with same CATH homology
 3ALF A;  3AS0 A;  2LKN A;  1HJV A;  2ZQT A;  3RM9 A;  1KT0 A;  1W1T A;  4QZV B;  1QZ2 A;  3VAW A;  3O5M A;  1B6C A;  4TX0 A;  1QPF A;  2MLX A;  1W9U A;  3O5L A;  2XP5 A;  2D9F A;  4GGQ A;  1RD6 A;  4U85 A;  4LAY A;  1U79 A;  1NMW A;  1BKF A;  1JNS A;  4QT2 A;  3FAP A;  2Y78 A;  4XAK A;  3ODK A;  1HJW A;  1FKJ A;  2RUR A;  1NMV A;  3PRA A;  4DWS D;  4BF8 A;  2UZ5 A;  4ODM A;  1FKD A;  1OGB A;  3ARP A;  3B9A A;  2PPN A;  2KGJ A;  5B8I C;  4WKA A;  3NTP A;  4FN2 A;  3IKG A;  4DRQ A;  2ZR4 A;  1Q1C A;  1WAW A;  1ZB5 A;  2IF4 A;  3CHF A;  2PV3 A;  4P8U A;  1F40 A;  1D2K A;  1LL4 A;  2KR7 A;  4GIV A;  3JYM A;  1FKS A;  2XP8 A;  1FFR A;  1FKL A;  4Q7N A;  4DWS A;  4C02 B;  4W9P A;  2DG4 A;  2XP9 A;  2M1I A;  2A3A A;  4NNR A;  4DRN A;  1YW5 A;  5GQB A;  4ZPT R;  1UR9 A;  2A3B A;  4DRK A;  2M08 A;  3WD3 A;  2G41 A;  1FAP A;  4ODQ A;  1E15 A;  2N87 A;  1O6I A;  1ROT A;  1SYT A;  2G8Z A;  3FY1 A;  3TDB A;  5HW7 A;  2ZR5 A;  4G50 A;  4ODR A;  2KI3 A;  2VN1 A;  3B8S A;  2YBU A;  1T11 A;  4JFL A;  2ZQU A;  5HTG A;  1BL4 A;  4WIW A;  4LAW A;  3IK8 A;  1LG1 A;  3IHZ A;  1ZCN A;  3ARY A;  2A3C A;  2PBC A;  3NRK A;  1FKH A;  3KAI A;  3UQA A;  4DRJ A;  2DSU A;  2WLY A;  4MPK A;  4QIB A;  1Q6U A;  4WKF A;  5HWC A;  5DF0 A;  4DRH A;  3UQI A;  1HXV A;  2DT1 A;  2XPA A;  3ARX A;  3PRD A;  1ZBC A;  1UR8 A;  1E6P A;  2AOS A;  5HW6 A;  4DRM A;  2RQS A;  2A3E A;  4U84 A;  3OOB A;  2DSW A;  4J4N A;  1P5Q A;  3AS2 A;  1FD9 A;  3RGC A;  1FKI A;  2RUC A;  3CHC A;  3KAB A;  4TNS A;  4JFJ A;  5HUA A;  1K9T A;  3ARZ A;  3O5F A;  3ARW A;  1FKK A;  3UI4 A;  3ARS A;  3JYJ A;  4ODP A;  1NWU A;  2FDM A;  3WD2 A;  2L2S A;  4HAR A;  3CZ8 A;  1Q6H A;  4IT6 A;  2Q5A A;  2DG9 A;  1FKR A;  4IT4 A;  4JFM A;  4R0X A;  4AY1 A;  1J4I A;  5DO2 A;  3ALG A;  1OWQ A;  1QPL A;  1IX5 A;  3WQW A;  1ITX A;  4MGV A;  1KT1 A;  5GPR A;  1JNT A;  1L1P A;  1E6R A;  3WQV A;  4P8V A;  2XP3 A;  5DIV A;  4KQZ A;  1FKG A;  2XP7 A;  3WL1 A;  1LG2 A;  1FKF A;  3G6L A;  3CGM A;  1JVW A;  1LL6 A;  4HBE A;  5JH8 A;  3B9D A;  1HKI A;  1TFV A;  3UF8 A;  1EYM A;  4L3N A;  4ZS6 A;  1Q6I A;  1HKJ A;  2DG3 A;  1X6N A;  2LJ4 A;  1NWR A;  1FKB A;  2XPB A;  4DWS C;  4LAV A;  1CTN A;  4MSP A;  1F8A B;  1W1V A;  2PPO A;  1ZL1 A;  1PIN A;  3AQU A;  4PTM A;  1D7J A;  3WL0 A;  4JFK A;  2O92 A;  3WH0 A;  1WNO A;  2LGO A;  4TW6 A;  5HKG A;  3O5R A;  4P8W A;  3UI6 A;  1GUV A;  3KAD A;  5DIT A;  2RUQ A;  2ZQS A;  4DZ2 A;  3GPK A;  4NZC A;  2VCD A;  4ZPV R;  4ODO A;  1J4R A;  4IPX A;  1SR0 A;  1W9V A;  3KAH A;  4MNK A;  2LPV A;  4Z2K A;  4ODN A;  1KFW A;  1W26 A;  1A7X A;  1NH6 A;  4R5E A;  3O5I A;  3H9R B;  4URI A;  4NSB A;  3G6M A;  4N19 A;  3O5D A;  5HW8 A;  3JXV A;  3NI6 A;  4Z2H A;  4DT4 A;  5BXJ A;  1D7H A;  2FKE A;  1XRV A;  2M2A A;  4G2P A;  3WD1 A;  2F2D A;  1NWT A;  4LAX A;  1C9H A;  3ARO A;  3W4R A;  2DSZ A;  2F4E A;  1Y0O A;  3ART A;  5I98 A;  2O9O A;  1YAT A;  5DIU A;  1W1P A;  4DIP A;  1GPF A;  4U86 A;  3ARQ A;  2WK2 A;  4ML4 A;  3PRB A;  1E6N A;  3AS1 A;  4ODL A;  1WB0 A;  1JND A;  1LJY A;  4HBO A;  4Z2L A;  3PA7 A;  1H0G A;  1HJX A;  5HT1 A;  1PBK A;  1ROU A;  1X6L A;  2DT2 A;  3ARV A;  5J6E A;  5GPG A;  5DEZ A;  5HWB A;  3B9E A;  3PR9 A;  4DRP A;  4W9Q A;  1EIB A;  3WKZ A;  3CHE A;  3QOK A;  2DT0 A;  3BXW A;  2KO7 A;  1E6Z A;  4TW7 A;  3O5Q A;  1OGG A;  1H0I A;  4LGX A;  2XP4 A;  4JYS A;  3ARU A;  4ITZ A;  3O5E A;  2XP6 A;  4WKH A;  4WJX A;  2ESC A;  1N1A A;  1ZU8 A;  1EDQ A;  3KAG A;  3CH9 A;  2ZR6 A;  2MF9 A;  2PI6 A;  3B7X A;  2MLZ A;  2DPE A;  4DRI A;  4DWS B;  2KFW A;  3KCE A;  3O5G A;  2PV2 A;  3OA5 A;  2MLY A;  5HBF A;  4WK9 A;  3WD0 A;  4S3K A;  4MNJ A;  1FJD A;  1FFQ A;  3WIJ A;  1JNE A;  3O5P A;  2WLZ A;  3O5O A;  1R9H A;  4W5U A;  1VF8 A;  4O2T A;  3RME A;  3KAC A;  4MNM A;  4L72 B;  1NSG A;  3EY6 A;  2PPP A;  2QF8 A;  4TW8 A;  4DZ3 A;  1J4H A;  2PV1 A;  1FKT A;  4DRO A;  1GOI A;  2B31 A;  4Z2I A;  3O5J A;  2AWG A;  2FAP A;  1W1Y A;  3WD4 A;  1ZK6 A;  3IKD A;  4QT3 A;  1W9P A;  1EHN A;  4J4O A;  1ZBK A;  1LL7 A;  1TCO C;  2MPH A;  4KR0 B;  2OFN A;  3UI5 A;  1HKM A;  1D7I A;  1M5Y A;  2ZQV A;  1HKK A;  4MNL A;  2JZV A;  2RSE A;  1EQ3 A;  3KAF A;  2YBT A;  2RUD A;  3UQB A;  4DH0 A;  2DSV A;  1D6O A;  3KZ7 A;  4S3J A;  4P8X A;  2OLH A;  2IUZ A;  2K8I A;  3RFW A;  1NWS A;  4TYO A;  3CGN A;  2ITK A;  3O5K A;  4ODK A;  2F21 A;  3MDY B;  2KE0 A;  3RM4 A;  3ARR A;  4Z2J A;  5D75 A;  1ZBW A;  1LQ0 A;  2MNT A;  3AS3 A;  3RM8 A;  4IQC A;  4ZPW R;  4Z2G A;  4MAV A;  4FAP A;  2WM0 A;  1E9L A;  2DT3 A;  3FXY A;  3TCZ A;  1ZBV A;  3CHD A;  4W9O A;  3TC5 A;  4Q22 A;  3LUO A;  4MTV A;  4JFI A;  1J6Y A;  3I6C A;  4IQ2 A;  1XHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...