2AWGA

Structure of the ppiase domain of the human fk506-binding protein 8
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
GSPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the human FK-506 binding protein 8
rcsb
source organism Homo sapiens
molecule tags Signaling protein inhibitor
molecule keywords 38 kDa FK-506 binding protein
total genus 30
structure length 118
sequence length 118
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2awgA00
1FKBA 3IK8A 2LKNA 3PRDA 1Q6HA 2N87A 4JFJA 1J4HA 2RURA 4ODQA 4O2TA 1FKGA 2F2DA 5GPGA 1L1PA 3NRKA 2MLYA 3O5QA 3UI4A 5HWBA 1J6YA 4QT2A 2KI3A 1D7IA 4LAYA 3PRBA 3KADA 2XP5A 1Q6IA 4DRMA 3UI5A 4DT4A 2LJ4A 4LAWA 1YATA 4IQ2A 2ZQTA 3CGNA 3UQIA 1JNTA 4DRJA 1JNSA 4GGQA 4QIBA 2PBCA 4ODOA 5HW7A 2LGOA 3IKGA 4FN2A 1FKKA 3TCZA 4G50A 3RFWA 2XPBA 1W26A 3OOBA 2PPOA 3UQAA 3O5GA 5HWCA 2KR7A 1R9HA 1U79A 2MF9A 4U84A 1FAPA 2XP8A 1FKTA 4TX0A 4DRIA 2MNTA 3NTPA 2VN1A 4JYSA 1Q1CA 2PV3A 2XP4A 4ODLA 4DZ3A 5I98A 2XPAA 3O5KA 4ODPA 2XP9A 2JZVA 2AWGA 2RUDA 4MGVA 2FAPA 3KACA 2M2AA 2LPVA 1FD9A 3H9RB 4IPXA 2M08A 1BL4A 3JXVA 1YW5A 1D7JA 3O5MA 3VAWA 4J4NA 2VCDA 2MLZA 1D6OA 1QZ2A 1ZCNA 2PV1A 3KABA 3KCEA 3NI6A 4W9OA 4DROA 1F40A 4DH0A 2XP6A 3O5LA 3B7XA 4ODNA 2F4EA 3KAFA 2DG3A 3UI6A 2FKEA 5D75A 2K8IA 2F21A 3O5RA 4N19A 1BKFA 5B8IC 1N1AA 3I6CA 2MLXA 3O5OA 4C02B 3O5IA 4J4OA 1FKLA 2XP7A 1FKIA 2DG9A 4ODRA 5DIUA 3O5FA 3CGMA 4DIPA 3JYMA 1FKFA 4DRNA 4ITZA 1NMWA 5HKGA 3UQBA 4R0XA 2PV2A 1EYMA 2PPNA 1NSGA 2PPPA 3KAIA 1FKDA 4DRPA 2RUQA 3O5JA 4FAPA 5HW6A 5HT1A 2ZR5A 3LUOA 3WH0A 4BF8A 5HUAA 1F8AB 5DIVA 2DG4A 3O5EA 4JFLA 4DRQA 5HW8A 1Y0OA 2Y78A 3O5PA 1PBKA 4W9PA 1Q6UA 2ZQUA 1A7XA 1QPFA 2KE0A 4TW6A 2RSEA 2MPHA 1PINA 4JFMA 1B6CA 1C9HA 4ODMA 4U86A 1FKHA 4NNRA 2D9FA 1M5YA 1TCOC 3TC5A 1ROUA 1EQ3A 1J4RA 1KT1A 2XP3A 2ZQSA 1D7HA 4DZ2A 4JFIA 3KAGA 2ZR6A 2L2SA 3FAPA 4JFKA 1JVWA 4TW8A 4LAVA 3IHZA 3TDBA 4IQCA 1FKJA 4LAXA 1FKSA 1QPLA 1NMVA 2KO7A 2UZ5A 4DRHA 4TNSA 2ITKA 3UF8A 5J6EA 2IF4A 4GIVA 4QT3A 1J4IA 2M1IA 2ZQVA 3JYJA 3ODKA 1KT0A 2KGJA 4U85A 4W9QA 3RGCA 2Q5AA 1ZK6A 2RQSA 5DITA 1P5QA 2KFWA 2RUCA 3GPKA 1ROTA 3MDYB 4ODKA 2ZR4A 3PA7A 5BXJA 1FKRA 4TYOA 4DRKA 3O5DA 3KAHA 5HTGA 3IKDA 1T11A 4TW7A 4MSPA 2OFNA 4G2PA 3EY6A 1FJDA 1HXVA 3KZ7A
chains in the Genus database with same CATH superfamily
3IK8A 2LKNA 3QOKA 3B9EA 3FY1A 1E6ZA 4O2TA 3O5QA 1OGGA 5DEZA 1LL4A 4QT2A 1ZBCA 1D7IA 3WD1A 3KADA 1KFWA 4DRMA 1ZBVA 1JNSA 2ZQTA 4P8WA 5GQBA 4GGQA 2PBCA 4ODOA 4FN2A 1SYTA 3TCZA 3WL1A 5HWCA 2WM0A 2KR7A 2DSVA 2DT3A 4HARA 2DSWA 2OLHA 1Q1CA 2PV3A 3CZ8A 2XP9A 2AWGA 3KACA 4MPKA 1BL4A 3ARZA 1D7JA 2DT1A 3WD4A 3AS2A 1O6IA 2VCDA 1F40A 1QZ2A 4ODNA 3UI6A 1GUVA 1UR8A 1BKFA 4C02B 1FKIA 5DIUA 1VF8A 3CGMA 4DRNA 2PV2A 1LL7A 4UDMA 3KAIA 2RUQA 5HW6A 1E6RA 1W1PA 4L3NA 1E44A 3ARSA 4KR0B 1D2KA 3ALFA 4MNJA 3ARWA 2WLYA 1C9HA 1FKHA 4HBOA 3AQUA 2ZR6A 3FAPA 2G41A 3TDBA 1K9TA 3IHZA 4IQCA 1W1VA 5J6EA 1E6PA 4GIVA 2G8ZA 3RM9A 1J4IA 3RM8A 3ODKA 4IT4A 3ARTA 4MNMA 3AROA 5DITA 3WD3A 2KFWA 1E6NA 1X6NA 4ODKA 3WIJA 2ZR4A 4LGXA 4TYOA 4DRKA 4ZPTR 1NWRA 4MSPA 4G2PA 3CHCA 3PRDA 4ODQA 2N87A 1FKGA 5GPGA 4DWSA 4MAVA 3NRKA 3UI4A 2A3CA 2ETNA 3CHEA 5DF0A 4LAYA 3PRBA 4DT4A 2A3BA 3G6LA 4IQ2A 3UQIA 4Z2JA 2EULA 5HW7A 2LGOA 1FKKA 4G50A 3RFWA 2ESCA 1W26A 3WQVA 2PPOA 3UQAA 1ZL1A 1HKIA 1W9VA 5I98A 1LQ0A 4Z2KA 1JNEA 3B9AA 3H9RB 1E15A 3JXVA 1HJVA 4ZPVR 1JCHB 4P8VA 1GPFA 3VAWA 1CTNA 2PV1A 1ZCNA 3KCEA 3PR9A 4S3KA 4DROA 5HBFA 5D75A 2K8IA 5B8IC 2MLXA 4J4OA 4MNLA 1FKLA 2WK2A 2P4VA 4DWSB 4DIPA 4R0XA 1W9UA 3AS0A 2PPNA 2PPPA 1FKDA 1NH6A 2A3AA 3WD0A 2ZR5A 4BF8A 4WKAA 4WIWA 2DG4A 4ML4A 4ZS6A 5HW8A 1X6LA 1Y0OA 2Y78A 2FDMA 1Q6UA 3G6MA 2KE0A 1HKMA 4TW6A 2RSEA 4U86A 1B6CA 1ZBKA 1GRJA 4Z2IA 3TC5A 4WKFA 1EQ3A 3CH9A 2XP3A 2ZQSA 3KAGA 1JNDA 2L2SA 3PRAA 1LG2A 4TW8A 4LAVA 1FKJA 4LAXA 4DRHA 5JH8A 4TNSA 1KT0A 2KGJA 4W9QA 1EHNA 1WNOA 3PA7A 5BXJA 3KAHA 5HTGA 4MTVA 1HKKA 2OFNA 1WB0A 1HJXA 4JFJA 1J4HA 4Q22A 5HWBA 1J6YA 1FFQA 4Z2GA 1Q6IA 4URIA 4LAWA 4DRJA 3CGNA 3GTYX 1JNTA 4QIBA 3OOBA 1H0IA 3O5GA 3ARUA 4U84A 4W5UA 1FAPA 2B31A 2XP8A 4TX0A 2MNTA 4JYSA 2VN1A 4ODLA 4DZ3A 1H0GA 5DO2A 4PTMA 4S3JA 4ZPWR 2RUDA 3RMEA 2FAPA 2M2AA 2LPVA 4IPXA 1EDQA 2YBUA 4J4NA 4IT6A 1D6OA 4NZCA 3NI6A 4KQZA 1EIBA 3B7XA 2DG3A 2FKEA 3O5RA 2F21A 3W4RA 3BMBA 1N1AA 3I6CA 1TFVA 3AS3A 3O5IA 3FXYA 2XP7A 2DG9A 2F23A 3O5FA 3JYMA 1FKFA 3UQBA 3GU0A 4XAKA 4WKHA 3WQWA 4DRPA 3O5JA 3B8SA 3LUOA 1F8AB 5DIVA 1LL6A 3O5EA 4JFLA 4DRQA 4HBEA 1ZBWA 2ZQUA 1A7XA 1E9LA 3AS1A 4ODMA 3ARXA 4NNRA 2B5UB 2D9FA 1M5YA 1TCOC 1KT1A 4DZ2A 1D7HA 4JFIA 4JFKA 1JVWA 3ARRA 3ARQA 2QF8A 1FKSA 1ITXA 2ITKA 3UF8A 1LJYA 2ZQVA 2M1IA 1XHGA 4L72B 4QZVB 4U85A 3WL0A 2RQSA 1ZK6A 3ALGA 3B9DA 5GPRA 1WAWA 3MDYB 1HJWA 2O9OA 1FKRA 1W1YA 1ZU8A 3O5DA 1T11A 4TW7A 1NWTA 3EY6A 1RD6A 4WJXA 1FJDA 1FKBA 1ZB5A 1Q6HA 3EIPA 2RURA 2F2DA 3OA5A 1L1PA 2MLYA 2KI3A 2XP5A 3UI5A 2LJ4A 2DPEA 1YATA 1HKJA 3IKGA 4Z2LA 2XPBA 1R9HA 1U79A 2MF9A 4DWSD 1UR9A 1FKTA 4DRIA 3NTPA 2XP4A 2XPAA 3O5KA 4ODPA 2JZVA 4MGVA 1FFRA 3RM4A 1FD9A 2M08A 1YW5A 1SR0A 3O5MA 1W1TA 2MLZA 1IX5A 2DSUA 3KABA 4W9OA 4P8XA 3CHFA 4DH0A 2XP6A 3O5LA 2F4EA 3KAFA 4N19A 4AY1A 1GOIA 3O5OA 1NWSA 4MNKA 4ODRA 5HKGA 4ITZA 1NMWA 4DWSC 3WD2A 1EYMA 1W9PA 4R5EA 4Z2HA 1NSGA 2IUZA 4FAPA 5HT1A 5HUAA 3WH0A 2AOSA 3O5PA 1PBKA 2O92A 4W9PA 2YBTA 1QPFA 2DT2A 2MPHA 1PINA 4JFMA 3BXWA 4NSBA 2A3EA 1ROUA 1J4RA 1XRVA 1QPLA 1NMVA 2KO7A 2UZ5A 2IF4A 2WLZA 2DSZA 4QT3A 4WK9A 3WKZA 3JYJA 1LG1A 3ARVA 2DT0A 1OWQA 1OGBA 3RGCA 2Q5AA 4Q7NA 1P5QA 2RUCA 3GPKA 3ARYA 3ARPA 1NWUA 1ROTA 4P8UA 2PI6A 3CHDA 2PN0A 3IKDA 1HXVA 3KZ7A
chains in the Genus database with same CATH topology
3IK8A 2LKNA 3QOKA 3B9EA 3FY1A 1E6ZA 4O2TA 3O5QA 1OGGA 5DEZA 1LL4A 4QT2A 1ZBCA 1D7IA 3WD1A 3KADA 1KFWA 4DRMA 1ZBVA 1JNSA 2ZQTA 4P8WA 5GQBA 4GGQA 2PBCA 4ODOA 4FN2A 1SYTA 3TCZA 3WL1A 5HWCA 2WM0A 2KR7A 2DSVA 2DT3A 4HARA 2DSWA 2OLHA 1Q1CA 2PV3A 3CZ8A 2XP9A 2AWGA 3KACA 4MPKA 1BL4A 3ARZA 1D7JA 2DT1A 3WD4A 3AS2A 1O6IA 2VCDA 1F40A 1QZ2A 4ODNA 3UI6A 1GUVA 1UR8A 1BKFA 4C02B 1FKIA 5DIUA 1VF8A 3CGMA 4DRNA 2PV2A 1LL7A 3KAIA 2RUQA 5HW6A 1E6RA 1W1PA 4L3NA 3ARSA 4KR0B 1D2KA 3ALFA 4MNJA 3ARWA 2WLYA 1C9HA 1FKHA 4HBOA 3AQUA 2ZR6A 3FAPA 2G41A 3TDBA 1K9TA 3IHZA 4IQCA 1W1VA 5J6EA 1E6PA 4GIVA 2G8ZA 3RM9A 1J4IA 3RM8A 3ODKA 4IT4A 3ARTA 4MNMA 3AROA 5DITA 3WD3A 2KFWA 1E6NA 1X6NA 4ODKA 3WIJA 2ZR4A 4LGXA 4TYOA 4DRKA 4ZPTR 1NWRA 4MSPA 4G2PA 3CHCA 3PRDA 4ODQA 2N87A 1FKGA 5GPGA 4DWSA 4MAVA 3NRKA 3UI4A 2A3CA 3CHEA 5DF0A 4LAYA 3PRBA 4DT4A 2A3BA 3G6LA 4IQ2A 3UQIA 4Z2JA 5HW7A 2LGOA 1FKKA 4G50A 3RFWA 2ESCA 1W26A 3WQVA 2PPOA 3UQAA 1ZL1A 1HKIA 1W9VA 5I98A 1LQ0A 4Z2KA 1JNEA 3B9AA 3H9RB 1E15A 3JXVA 1HJVA 4ZPVR 4P8VA 1GPFA 3VAWA 1CTNA 2PV1A 1ZCNA 3KCEA 3PR9A 4S3KA 4DROA 5HBFA 5D75A 2K8IA 5B8IC 2MLXA 4J4OA 4MNLA 1FKLA 2WK2A 4DWSB 4DIPA 4R0XA 1W9UA 3AS0A 2PPNA 2PPPA 1FKDA 1NH6A 2A3AA 3WD0A 2ZR5A 4BF8A 4WKAA 4WIWA 2DG4A 4ML4A 4ZS6A 5HW8A 1X6LA 1Y0OA 2Y78A 2FDMA 1Q6UA 3G6MA 2KE0A 1HKMA 4TW6A 2RSEA 4U86A 1B6CA 1ZBKA 4Z2IA 3TC5A 4WKFA 1EQ3A 3CH9A 2XP3A 2ZQSA 3KAGA 1JNDA 2L2SA 3PRAA 1LG2A 4TW8A 4LAVA 1FKJA 4LAXA 4DRHA 5JH8A 4TNSA 1KT0A 2KGJA 4W9QA 1EHNA 1WNOA 3PA7A 5BXJA 3KAHA 5HTGA 4MTVA 1HKKA 2OFNA 1WB0A 1HJXA 4JFJA 1J4HA 4Q22A 5HWBA 1J6YA 1FFQA 4Z2GA 1Q6IA 4URIA 4LAWA 4DRJA 3CGNA 1JNTA 4QIBA 3OOBA 1H0IA 3O5GA 3ARUA 4U84A 4W5UA 1FAPA 2B31A 2XP8A 4TX0A 2MNTA 4JYSA 2VN1A 4ODLA 4DZ3A 1H0GA 5DO2A 4PTMA 4S3JA 4ZPWR 2RUDA 3RMEA 2FAPA 2M2AA 2LPVA 4IPXA 1EDQA 2YBUA 4J4NA 4IT6A 1D6OA 4NZCA 3NI6A 4KQZA 1EIBA 3B7XA 2DG3A 2FKEA 3O5RA 2F21A 3W4RA 1N1AA 3I6CA 1TFVA 3AS3A 3O5IA 3FXYA 2XP7A 2DG9A 3O5FA 3JYMA 1FKFA 3UQBA 4XAKA 4WKHA 3WQWA 4DRPA 3O5JA 3B8SA 3LUOA 1F8AB 5DIVA 1LL6A 3O5EA 4JFLA 4DRQA 4HBEA 1ZBWA 2ZQUA 1A7XA 1E9LA 3AS1A 4ODMA 3ARXA 4NNRA 2D9FA 1M5YA 1TCOC 1KT1A 4DZ2A 1D7HA 4JFIA 4JFKA 1JVWA 3ARRA 3ARQA 2QF8A 1FKSA 1ITXA 2ITKA 3UF8A 1LJYA 2ZQVA 2M1IA 1XHGA 4L72B 4QZVB 4U85A 3WL0A 2RQSA 1ZK6A 3ALGA 3B9DA 5GPRA 1WAWA 3MDYB 1HJWA 2O9OA 1FKRA 1W1YA 1ZU8A 3O5DA 1T11A 4TW7A 1NWTA 3EY6A 1RD6A 4WJXA 1FJDA 1FKBA 1ZB5A 1Q6HA 2RURA 2F2DA 3OA5A 1L1PA 2MLYA 2KI3A 2XP5A 3UI5A 2LJ4A 2DPEA 1YATA 1HKJA 3IKGA 4Z2LA 2XPBA 1R9HA 1U79A 2MF9A 4DWSD 1UR9A 1FKTA 4DRIA 3NTPA 2XP4A 2XPAA 3O5KA 4ODPA 2JZVA 4MGVA 1FFRA 3RM4A 1FD9A 2M08A 1YW5A 1SR0A 3O5MA 1W1TA 2MLZA 1IX5A 2DSUA 3KABA 4W9OA 4P8XA 3CHFA 4DH0A 2XP6A 3O5LA 2F4EA 3KAFA 4N19A 4AY1A 1GOIA 3O5OA 1NWSA 4MNKA 4ODRA 5HKGA 4ITZA 1NMWA 4DWSC 3WD2A 1EYMA 1W9PA 4R5EA 4Z2HA 1NSGA 2IUZA 4FAPA 5HT1A 5HUAA 3WH0A 2AOSA 3O5PA 1PBKA 2O92A 4W9PA 2YBTA 1QPFA 2DT2A 2MPHA 1PINA 4JFMA 3BXWA 4NSBA 2A3EA 1ROUA 1J4RA 1XRVA 1QPLA 1NMVA 2KO7A 2UZ5A 2IF4A 2WLZA 2DSZA 4QT3A 4WK9A 3WKZA 3JYJA 1LG1A 3ARVA 2DT0A 1OWQA 1OGBA 3RGCA 2Q5AA 4Q7NA 1P5QA 2RUCA 3GPKA 3ARYA 3ARPA 1NWUA 1ROTA 4P8UA 2PI6A 3CHDA 3IKDA 1HXVA 3KZ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKB A;  3IK8 A;  2LKN A;  3PRD A;  1Q6H A;  2N87 A;  4JFJ A;  1J4H A;  2RUR A;  4ODQ A;  4O2T A;  1FKG A;  2F2D A;  5GPG A;  1L1P A;  3NRK A;  2MLY A;  3O5Q A;  3UI4 A;  5HWB A;  1J6Y A;  4QT2 A;  2KI3 A;  1D7I A;  4LAY A;  3PRB A;  3KAD A;  2XP5 A;  1Q6I A;  4DRM A;  3UI5 A;  4DT4 A;  2LJ4 A;  4LAW A;  1YAT A;  4IQ2 A;  2ZQT A;  3CGN A;  3UQI A;  1JNT A;  4DRJ A;  1JNS A;  4GGQ A;  4QIB A;  2PBC A;  4ODO A;  5HW7 A;  2LGO A;  3IKG A;  4FN2 A;  1FKK A;  3TCZ A;  4G50 A;  3RFW A;  2XPB A;  1W26 A;  3OOB A;  2PPO A;  3UQA A;  3O5G A;  5HWC A;  2KR7 A;  1R9H A;  1U79 A;  2MF9 A;  4U84 A;  1FAP A;  2XP8 A;  1FKT A;  4TX0 A;  4DRI A;  2MNT A;  3NTP A;  2VN1 A;  4JYS A;  1Q1C A;  2PV3 A;  2XP4 A;  4ODL A;  4DZ3 A;  5I98 A;  2XPA A;  3O5K A;  4ODP A;  2XP9 A;  2JZV A;  2AWG A;  2RUD A;  4MGV A;  2FAP A;  3KAC A;  2M2A A;  2LPV A;  1FD9 A;  3H9R B;  4IPX A;  2M08 A;  1BL4 A;  3JXV A;  1YW5 A;  1D7J A;  3O5M A;  3VAW A;  4J4N A;  2VCD A;  2MLZ A;  1D6O A;  1QZ2 A;  1ZCN A;  2PV1 A;  3KAB A;  3KCE A;  3NI6 A;  4W9O A;  4DRO A;  1F40 A;  4DH0 A;  2XP6 A;  3O5L A;  3B7X A;  4ODN A;  2F4E A;  3KAF A;  2DG3 A;  3UI6 A;  2FKE A;  5D75 A;  2K8I A;  2F21 A;  3O5R A;  4N19 A;  1BKF A;  5B8I C;  1N1A A;  3I6C A;  2MLX A;  3O5O A;  4C02 B;  3O5I A;  4J4O A;  1FKL A;  2XP7 A;  1FKI A;  2DG9 A;  4ODR A;  5DIU A;  3O5F A;  3CGM A;  4DIP A;  3JYM A;  1FKF A;  4DRN A;  4ITZ A;  1NMW A;  5HKG A;  3UQB A;  4R0X A;  2PV2 A;  1EYM A;  2PPN A;  1NSG A;  2PPP A;  3KAI A;  1FKD A;  4DRP A;  2RUQ A;  3O5J A;  4FAP A;  5HW6 A;  5HT1 A;  2ZR5 A;  3LUO A;  3WH0 A;  4BF8 A;  5HUA A;  1F8A B;  5DIV A;  2DG4 A;  3O5E A;  4JFL A;  4DRQ A;  5HW8 A;  1Y0O A;  2Y78 A;  3O5P A;  1PBK A;  4W9P A;  1Q6U A;  2ZQU A;  1A7X A;  1QPF A;  2KE0 A;  4TW6 A;  2RSE A;  2MPH A;  1PIN A;  4JFM A;  1B6C A;  1C9H A;  4ODM A;  4U86 A;  1FKH A;  4NNR A;  2D9F A;  1M5Y A;  1TCO C;  3TC5 A;  1ROU A;  1EQ3 A;  1J4R A;  1KT1 A;  2XP3 A;  2ZQS A;  1D7H A;  4DZ2 A;  4JFI A;  3KAG A;  2ZR6 A;  2L2S A;  3FAP A;  4JFK A;  1JVW A;  4TW8 A;  4LAV A;  3IHZ A;  3TDB A;  4IQC A;  1FKJ A;  4LAX A;  1FKS A;  1QPL A;  1NMV A;  2KO7 A;  2UZ5 A;  4DRH A;  4TNS A;  2ITK A;  3UF8 A;  5J6E A;  2IF4 A;  4GIV A;  4QT3 A;  1J4I A;  2M1I A;  2ZQV A;  3JYJ A;  3ODK A;  1KT0 A;  2KGJ A;  4U85 A;  4W9Q A;  3RGC A;  2Q5A A;  1ZK6 A;  2RQS A;  5DIT A;  1P5Q A;  2KFW A;  2RUC A;  3GPK A;  1ROT A;  3MDY B;  4ODK A;  2ZR4 A;  3PA7 A;  5BXJ A;  1FKR A;  4TYO A;  4DRK A;  3O5D A;  3KAH A;  5HTG A;  3IKD A;  1T11 A;  4TW7 A;  4MSP A;  2OFN A;  4G2P A;  3EY6 A;  1FJD A;  1HXV A;  3KZ7 A; 
#chains in the Genus database with same CATH topology
 3IK8 A;  2LKN A;  3QOK A;  3B9E A;  3FY1 A;  1E6Z A;  4O2T A;  3O5Q A;  1OGG A;  5DEZ A;  1LL4 A;  4QT2 A;  1ZBC A;  1D7I A;  3WD1 A;  3KAD A;  1KFW A;  4DRM A;  1ZBV A;  1JNS A;  2ZQT A;  4P8W A;  5GQB A;  4GGQ A;  2PBC A;  4ODO A;  4FN2 A;  1SYT A;  3TCZ A;  3WL1 A;  5HWC A;  2WM0 A;  2KR7 A;  2DSV A;  2DT3 A;  4HAR A;  2DSW A;  2OLH A;  1Q1C A;  2PV3 A;  3CZ8 A;  2XP9 A;  2AWG A;  3KAC A;  4MPK A;  1BL4 A;  3ARZ A;  1D7J A;  2DT1 A;  3WD4 A;  3AS2 A;  1O6I A;  2VCD A;  1F40 A;  1QZ2 A;  4ODN A;  3UI6 A;  1GUV A;  1UR8 A;  1BKF A;  4C02 B;  1FKI A;  5DIU A;  1VF8 A;  3CGM A;  4DRN A;  2PV2 A;  1LL7 A;  4UDM A;  3KAI A;  2RUQ A;  5HW6 A;  1E6R A;  1W1P A;  4L3N A;  1E44 A;  3ARS A;  4KR0 B;  1D2K A;  3ALF A;  4MNJ A;  3ARW A;  2WLY A;  1C9H A;  1FKH A;  4HBO A;  3AQU A;  2ZR6 A;  3FAP A;  2G41 A;  3TDB A;  1K9T A;  3IHZ A;  4IQC A;  1W1V A;  5J6E A;  1E6P A;  4GIV A;  2G8Z A;  3RM9 A;  1J4I A;  3RM8 A;  3ODK A;  4IT4 A;  3ART A;  4MNM A;  3ARO A;  5DIT A;  3WD3 A;  2KFW A;  1E6N A;  1X6N A;  4ODK A;  3WIJ A;  2ZR4 A;  4LGX A;  4TYO A;  4DRK A;  4ZPT R;  1NWR A;  4MSP A;  4G2P A;  3CHC A;  3PRD A;  4ODQ A;  2N87 A;  1FKG A;  5GPG A;  4DWS A;  4MAV A;  3NRK A;  3UI4 A;  2A3C A;  2ETN A;  3CHE A;  5DF0 A;  4LAY A;  3PRB A;  4DT4 A;  2A3B A;  3G6L A;  4IQ2 A;  3UQI A;  4Z2J A;  2EUL A;  5HW7 A;  2LGO A;  1FKK A;  4G50 A;  3RFW A;  2ESC A;  1W26 A;  3WQV A;  2PPO A;  3UQA A;  1ZL1 A;  1HKI A;  1W9V A;  5I98 A;  1LQ0 A;  4Z2K A;  1JNE A;  3B9A A;  3H9R B;  1E15 A;  3JXV A;  1HJV A;  4ZPV R;  1JCH B;  4P8V A;  1GPF A;  3VAW A;  1CTN A;  2PV1 A;  1ZCN A;  3KCE A;  3PR9 A;  4S3K A;  4DRO A;  5HBF A;  5D75 A;  2K8I A;  5B8I C;  2MLX A;  4J4O A;  4MNL A;  1FKL A;  2WK2 A;  2P4V A;  4DWS B;  4DIP A;  4R0X A;  1W9U A;  3AS0 A;  2PPN A;  2PPP A;  1FKD A;  1NH6 A;  2A3A A;  3WD0 A;  2ZR5 A;  4BF8 A;  4WKA A;  4WIW A;  2DG4 A;  4ML4 A;  4ZS6 A;  5HW8 A;  1X6L A;  1Y0O A;  2Y78 A;  2FDM A;  1Q6U A;  3G6M A;  2KE0 A;  1HKM A;  4TW6 A;  2RSE A;  4U86 A;  1B6C A;  1ZBK A;  1GRJ A;  4Z2I A;  3TC5 A;  4WKF A;  1EQ3 A;  3CH9 A;  2XP3 A;  2ZQS A;  3KAG A;  1JND A;  2L2S A;  3PRA A;  1LG2 A;  4TW8 A;  4LAV A;  1FKJ A;  4LAX A;  4DRH A;  5JH8 A;  4TNS A;  1KT0 A;  2KGJ A;  4W9Q A;  1EHN A;  1WNO A;  3PA7 A;  5BXJ A;  3KAH A;  5HTG A;  4MTV A;  1HKK A;  2OFN A;  1WB0 A;  1HJX A;  4JFJ A;  1J4H A;  4Q22 A;  5HWB A;  1J6Y A;  1FFQ A;  4Z2G A;  1Q6I A;  4URI A;  4LAW A;  4DRJ A;  3CGN A;  3GTY X;  1JNT A;  4QIB A;  3OOB A;  1H0I A;  3O5G A;  3ARU A;  4U84 A;  4W5U A;  1FAP A;  2B31 A;  2XP8 A;  4TX0 A;  2MNT A;  4JYS A;  2VN1 A;  4ODL A;  4DZ3 A;  1H0G A;  5DO2 A;  4PTM A;  4S3J A;  4ZPW R;  2RUD A;  3RME A;  2FAP A;  2M2A A;  2LPV A;  4IPX A;  1EDQ A;  2YBU A;  4J4N A;  4IT6 A;  1D6O A;  4NZC A;  3NI6 A;  4KQZ A;  1EIB A;  3B7X A;  2DG3 A;  2FKE A;  3O5R A;  2F21 A;  3W4R A;  3BMB A;  1N1A A;  3I6C A;  1TFV A;  3AS3 A;  3O5I A;  3FXY A;  2XP7 A;  2DG9 A;  2F23 A;  3O5F A;  3JYM A;  1FKF A;  3UQB A;  3GU0 A;  4XAK A;  4WKH A;  3WQW A;  4DRP A;  3O5J A;  3B8S A;  3LUO A;  1F8A B;  5DIV A;  1LL6 A;  3O5E A;  4JFL A;  4DRQ A;  4HBE A;  1ZBW A;  2ZQU A;  1A7X A;  1E9L A;  3AS1 A;  4ODM A;  3ARX A;  4NNR A;  2B5U B;  2D9F A;  1M5Y A;  1TCO C;  1KT1 A;  4DZ2 A;  1D7H A;  4JFI A;  4JFK A;  1JVW A;  3ARR A;  3ARQ A;  2QF8 A;  1FKS A;  1ITX A;  2ITK A;  3UF8 A;  1LJY A;  2ZQV A;  2M1I A;  1XHG A;  4L72 B;  4QZV B;  4U85 A;  3WL0 A;  2RQS A;  1ZK6 A;  3ALG A;  3B9D A;  5GPR A;  1WAW A;  3MDY B;  1HJW A;  2O9O A;  1FKR A;  1W1Y A;  1ZU8 A;  3O5D A;  1T11 A;  4TW7 A;  1NWT A;  3EY6 A;  1RD6 A;  4WJX A;  1FJD A;  1FKB A;  1ZB5 A;  1Q6H A;  3EIP A;  2RUR A;  2F2D A;  3OA5 A;  1L1P A;  2MLY A;  2KI3 A;  2XP5 A;  3UI5 A;  2LJ4 A;  2DPE A;  1YAT A;  1HKJ A;  3IKG A;  4Z2L A;  2XPB A;  1R9H A;  1U79 A;  2MF9 A;  4DWS D;  1UR9 A;  1FKT A;  4DRI A;  3NTP A;  2XP4 A;  2XPA A;  3O5K A;  4ODP A;  2JZV A;  4MGV A;  1FFR A;  3RM4 A;  1FD9 A;  2M08 A;  1YW5 A;  1SR0 A;  3O5M A;  1W1T A;  2MLZ A;  1IX5 A;  2DSU A;  3KAB A;  4W9O A;  4P8X A;  3CHF A;  4DH0 A;  2XP6 A;  3O5L A;  2F4E A;  3KAF A;  4N19 A;  4AY1 A;  1GOI A;  3O5O A;  1NWS A;  4MNK A;  4ODR A;  5HKG A;  4ITZ A;  1NMW A;  4DWS C;  3WD2 A;  1EYM A;  1W9P A;  4R5E A;  4Z2H A;  1NSG A;  2IUZ A;  4FAP A;  5HT1 A;  5HUA A;  3WH0 A;  2AOS A;  3O5P A;  1PBK A;  2O92 A;  4W9P A;  2YBT A;  1QPF A;  2DT2 A;  2MPH A;  1PIN A;  4JFM A;  3BXW A;  4NSB A;  2A3E A;  1ROU A;  1J4R A;  1XRV A;  1QPL A;  1NMV A;  2KO7 A;  2UZ5 A;  2IF4 A;  2WLZ A;  2DSZ A;  4QT3 A;  4WK9 A;  3WKZ A;  3JYJ A;  1LG1 A;  3ARV A;  2DT0 A;  1OWQ A;  1OGB A;  3RGC A;  2Q5A A;  4Q7N A;  1P5Q A;  2RUC A;  3GPK A;  3ARY A;  3ARP A;  1NWU A;  1ROT A;  4P8U A;  2PI6 A;  3CHD A;  2PN0 A;  3IKD A;  1HXV A;  3KZ7 A; 
#chains in the Genus database with same CATH homology
 3IK8 A;  2LKN A;  3QOK A;  3B9E A;  3FY1 A;  1E6Z A;  4O2T A;  3O5Q A;  1OGG A;  5DEZ A;  1LL4 A;  4QT2 A;  1ZBC A;  1D7I A;  3WD1 A;  3KAD A;  1KFW A;  4DRM A;  1ZBV A;  1JNS A;  2ZQT A;  4P8W A;  5GQB A;  4GGQ A;  2PBC A;  4ODO A;  4FN2 A;  1SYT A;  3TCZ A;  3WL1 A;  5HWC A;  2WM0 A;  2KR7 A;  2DSV A;  2DT3 A;  4HAR A;  2DSW A;  2OLH A;  1Q1C A;  2PV3 A;  3CZ8 A;  2XP9 A;  2AWG A;  3KAC A;  4MPK A;  1BL4 A;  3ARZ A;  1D7J A;  2DT1 A;  3WD4 A;  3AS2 A;  1O6I A;  2VCD A;  1F40 A;  1QZ2 A;  4ODN A;  3UI6 A;  1GUV A;  1UR8 A;  1BKF A;  4C02 B;  1FKI A;  5DIU A;  1VF8 A;  3CGM A;  4DRN A;  2PV2 A;  1LL7 A;  3KAI A;  2RUQ A;  5HW6 A;  1E6R A;  1W1P A;  4L3N A;  3ARS A;  4KR0 B;  1D2K A;  3ALF A;  4MNJ A;  3ARW A;  2WLY A;  1C9H A;  1FKH A;  4HBO A;  3AQU A;  2ZR6 A;  3FAP A;  2G41 A;  3TDB A;  1K9T A;  3IHZ A;  4IQC A;  1W1V A;  5J6E A;  1E6P A;  4GIV A;  2G8Z A;  3RM9 A;  1J4I A;  3RM8 A;  3ODK A;  4IT4 A;  3ART A;  4MNM A;  3ARO A;  5DIT A;  3WD3 A;  2KFW A;  1E6N A;  1X6N A;  4ODK A;  3WIJ A;  2ZR4 A;  4LGX A;  4TYO A;  4DRK A;  4ZPT R;  1NWR A;  4MSP A;  4G2P A;  3CHC A;  3PRD A;  4ODQ A;  2N87 A;  1FKG A;  5GPG A;  4DWS A;  4MAV A;  3NRK A;  3UI4 A;  2A3C A;  3CHE A;  5DF0 A;  4LAY A;  3PRB A;  4DT4 A;  2A3B A;  3G6L A;  4IQ2 A;  3UQI A;  4Z2J A;  5HW7 A;  2LGO A;  1FKK A;  4G50 A;  3RFW A;  2ESC A;  1W26 A;  3WQV A;  2PPO A;  3UQA A;  1ZL1 A;  1HKI A;  1W9V A;  5I98 A;  1LQ0 A;  4Z2K A;  1JNE A;  3B9A A;  3H9R B;  1E15 A;  3JXV A;  1HJV A;  4ZPV R;  4P8V A;  1GPF A;  3VAW A;  1CTN A;  2PV1 A;  1ZCN A;  3KCE A;  3PR9 A;  4S3K A;  4DRO A;  5HBF A;  5D75 A;  2K8I A;  5B8I C;  2MLX A;  4J4O A;  4MNL A;  1FKL A;  2WK2 A;  4DWS B;  4DIP A;  4R0X A;  1W9U A;  3AS0 A;  2PPN A;  2PPP A;  1FKD A;  1NH6 A;  2A3A A;  3WD0 A;  2ZR5 A;  4BF8 A;  4WKA A;  4WIW A;  2DG4 A;  4ML4 A;  4ZS6 A;  5HW8 A;  1X6L A;  1Y0O A;  2Y78 A;  2FDM A;  1Q6U A;  3G6M A;  2KE0 A;  1HKM A;  4TW6 A;  2RSE A;  4U86 A;  1B6C A;  1ZBK A;  4Z2I A;  3TC5 A;  4WKF A;  1EQ3 A;  3CH9 A;  2XP3 A;  2ZQS A;  3KAG A;  1JND A;  2L2S A;  3PRA A;  1LG2 A;  4TW8 A;  4LAV A;  1FKJ A;  4LAX A;  4DRH A;  5JH8 A;  4TNS A;  1KT0 A;  2KGJ A;  4W9Q A;  1EHN A;  1WNO A;  3PA7 A;  5BXJ A;  3KAH A;  5HTG A;  4MTV A;  1HKK A;  2OFN A;  1WB0 A;  1HJX A;  4JFJ A;  1J4H A;  4Q22 A;  5HWB A;  1J6Y A;  1FFQ A;  4Z2G A;  1Q6I A;  4URI A;  4LAW A;  4DRJ A;  3CGN A;  1JNT A;  4QIB A;  3OOB A;  1H0I A;  3O5G A;  3ARU A;  4U84 A;  4W5U A;  1FAP A;  2B31 A;  2XP8 A;  4TX0 A;  2MNT A;  4JYS A;  2VN1 A;  4ODL A;  4DZ3 A;  1H0G A;  5DO2 A;  4PTM A;  4S3J A;  4ZPW R;  2RUD A;  3RME A;  2FAP A;  2M2A A;  2LPV A;  4IPX A;  1EDQ A;  2YBU A;  4J4N A;  4IT6 A;  1D6O A;  4NZC A;  3NI6 A;  4KQZ A;  1EIB A;  3B7X A;  2DG3 A;  2FKE A;  3O5R A;  2F21 A;  3W4R A;  1N1A A;  3I6C A;  1TFV A;  3AS3 A;  3O5I A;  3FXY A;  2XP7 A;  2DG9 A;  3O5F A;  3JYM A;  1FKF A;  3UQB A;  4XAK A;  4WKH A;  3WQW A;  4DRP A;  3O5J A;  3B8S A;  3LUO A;  1F8A B;  5DIV A;  1LL6 A;  3O5E A;  4JFL A;  4DRQ A;  4HBE A;  1ZBW A;  2ZQU A;  1A7X A;  1E9L A;  3AS1 A;  4ODM A;  3ARX A;  4NNR A;  2D9F A;  1M5Y A;  1TCO C;  1KT1 A;  4DZ2 A;  1D7H A;  4JFI A;  4JFK A;  1JVW A;  3ARR A;  3ARQ A;  2QF8 A;  1FKS A;  1ITX A;  2ITK A;  3UF8 A;  1LJY A;  2ZQV A;  2M1I A;  1XHG A;  4L72 B;  4QZV B;  4U85 A;  3WL0 A;  2RQS A;  1ZK6 A;  3ALG A;  3B9D A;  5GPR A;  1WAW A;  3MDY B;  1HJW A;  2O9O A;  1FKR A;  1W1Y A;  1ZU8 A;  3O5D A;  1T11 A;  4TW7 A;  1NWT A;  3EY6 A;  1RD6 A;  4WJX A;  1FJD A;  1FKB A;  1ZB5 A;  1Q6H A;  2RUR A;  2F2D A;  3OA5 A;  1L1P A;  2MLY A;  2KI3 A;  2XP5 A;  3UI5 A;  2LJ4 A;  2DPE A;  1YAT A;  1HKJ A;  3IKG A;  4Z2L A;  2XPB A;  1R9H A;  1U79 A;  2MF9 A;  4DWS D;  1UR9 A;  1FKT A;  4DRI A;  3NTP A;  2XP4 A;  2XPA A;  3O5K A;  4ODP A;  2JZV A;  4MGV A;  1FFR A;  3RM4 A;  1FD9 A;  2M08 A;  1YW5 A;  1SR0 A;  3O5M A;  1W1T A;  2MLZ A;  1IX5 A;  2DSU A;  3KAB A;  4W9O A;  4P8X A;  3CHF A;  4DH0 A;  2XP6 A;  3O5L A;  2F4E A;  3KAF A;  4N19 A;  4AY1 A;  1GOI A;  3O5O A;  1NWS A;  4MNK A;  4ODR A;  5HKG A;  4ITZ A;  1NMW A;  4DWS C;  3WD2 A;  1EYM A;  1W9P A;  4R5E A;  4Z2H A;  1NSG A;  2IUZ A;  4FAP A;  5HT1 A;  5HUA A;  3WH0 A;  2AOS A;  3O5P A;  1PBK A;  2O92 A;  4W9P A;  2YBT A;  1QPF A;  2DT2 A;  2MPH A;  1PIN A;  4JFM A;  3BXW A;  4NSB A;  2A3E A;  1ROU A;  1J4R A;  1XRV A;  1QPL A;  1NMV A;  2KO7 A;  2UZ5 A;  2IF4 A;  2WLZ A;  2DSZ A;  4QT3 A;  4WK9 A;  3WKZ A;  3JYJ A;  1LG1 A;  3ARV A;  2DT0 A;  1OWQ A;  1OGB A;  3RGC A;  2Q5A A;  4Q7N A;  1P5Q A;  2RUC A;  3GPK A;  3ARY A;  3ARP A;  1NWU A;  1ROT A;  4P8U A;  2PI6 A;  3CHD A;  3IKD A;  1HXV A;  3KZ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...