2VN1A

Crystal structure of the fk506-binding domain of plasmodium falciparum fkbp35 in complex with fk506
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
123
structure length
123
Chain Sequence
FEKVELTADGGVIKTILKKGDEGEENIPKKGNEVTVHYVGKLESTGKVFDSSFDRNVPFKFHLEQGEVIKGWDICVSSMRKNEKCLVRIESMYGYGDEGCGESIPGNSVLLFEIELLSFRELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Fk506 Binding Domain of Plasmodium Falciparum Fkbp35 in Complex with Fk506.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
molecule keywords 70 KDA PEPTIDYLPROLYL ISOMERASE
total genus 31
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2vn1A01
1NSGA 3JYJA 1PBKA 3JYMA 3UI5A 2PPNA 4DRJA 4ODRA 3NI6A 4LAVA 4U84A 3O5QA 4J4NA 3PRDA 2DG9A 3CGMA 4ODNA 3O5IA 3OOBA 3UQAA 1FKRA 2LJ4A 2RQSA 4O2TA 4R0XA 4G2PA 4GIVA 5HT1A 5HUAA 3TCZA 3NRKA 1A7XA 2KE0A 3GPKA 2XP9A 1YW5A 2PV1A 4DRIA 1PINA 4DIPA 2MNTA 3KCEA 2RSEA 1L1PA 3IKDA 3I6CA 3UF8A 1FD9A 5DIUA 1FKJA 1FKSA 1KT0A 1FKFA 1Q6UA 3KABA 4JYSA 2DG4A 1J4HA 2KI3A 4NNRA 2PPPA 2LPVA 3VAWA 2VCDA 1JVWA 4JFKA 2ITKA 2PBCA 4ODLA 3UI6A 1EQ3A 1Y0OA 2N87A 2ZQTA 4N19A 3UQIA 4TX0A 3WH0A 4JFLA 3KAHA 2FAPA 1FKKA 3PA7A 2MPHA 2ZQUA 4G50A 3O5PA 1D7JA 3KADA 4LAXA 4TW7A 5D75A 4C02B 5J6EA 4LAYA 2RUCA 2XPAA 1FKHA 2FKEA 2PV2A 2M1IA 1NMWA 3MDYB 2UZ5A 3O5MA 3TC5A 3RGCA 2JZVA 3NTPA 3O5OA 4U86A 1HXVA 2MLZA 3O5FA 5HW8A 1ZK6A 2OFNA 4IQ2A 4ODOA 1FKDA 2Y78A 4DRMA 4W9PA 3UI4A 2XPBA 1N1AA 1NMVA 1B6CA 2KGJA 4W9OA 2KO7A 2ZQVA 1J4RA 3KAIA 3O5JA 2AWGA 3O5EA 4ITZA 4TYOA 2LGOA 1FAPA 1J6YA 2DG3A 4TNSA 3UQBA 4ODKA 1YATA 5HTGA 1Q1CA 2D9FA 1ZCNA 2RUDA 5DIVA 1ROTA 1W26A 3H9RB 1Q6IA 2ZR4A 4MSPA 4FN2A 4MGVA 1JNTA 1FKBA 1T11A 4ODQA 4BF8A 3KACA 2M2AA 3IHZA 2MF9A 4J4OA 4JFMA 4DRKA 4JFIA 5DITA 5HWBA 4GGQA 5HWCA 4QT2A 1QPLA 2ZQSA 3KZ7A 2XP8A 1FKIA 4DRHA 1D7IA 4IPXA 3O5RA 1FKTA 3B7XA 3IK8A 1BKFA 1P5QA 3PRBA 4QIBA 2MLXA 3O5KA 4DRQA 4DZ2A 4U85A 2KR7A 4DH0A 5HKGA 1F8AB 5GPGA 2XP5A 4DROA 2MLYA 4DT4A 4W9QA 3EY6A 3KAFA 1QPFA 1Q6HA 1KT1A 2XP3A 2XP7A 1ROUA 2KFWA 1R9HA 3RFWA 2L2SA 2ZR5A 2VN1A 5B8IC 4ODPA 2PV3A 3O5LA 4DRPA 2ZR6A 3LUOA 2M08A 5HW6A 1JNSA 1TCOC 4DZ3A 2F2DA 3ODKA 1U79A 1D7HA 1J4IA 3IKGA 2RUQA 2XP4A 2F21A 4ODMA 4FAPA 1C9HA 2Q5AA 2F4EA 3CGNA 1F40A 5I98A 3JXVA 1EYMA 4LAWA 5HW7A 3TDBA 1FKGA 1BL4A 4JFJA 4TW6A 1FJDA 4QT3A 3FAPA 4DRNA 1D6OA 4IQCA 2IF4A 1FKLA 1M5YA 1QZ2A 2RURA 5BXJA 2K8IA 2XP6A 2LKNA 3O5DA 3KAGA 2PPOA 4TW8A 3O5GA
chains in the Genus database with same CATH superfamily
1E15A 1D2KA 3NI6A 4ODRA 4LAVA 2O9OA 3AS2A 3PRDA 4G2PA 3TCZA 1YW5A 4IT6A 2PV1A 2DT0A 3KCEA 2RSEA 1LL7A 1FD9A 4NNRA 1X6NA 2VCDA 4JFKA 2PBCA 1Y0OA 2ZQTA 4PTMA 3WH0A 3UQIA 2FAPA 4C02B 5J6EA 1H0GA 3ALFA 1FKHA 2PV2A 3RGCA 2JZVA 3O5OA 1W1YA 1HXVA 1LJYA 3W4RA 3UI4A 2XPBA 1N1AA 2KGJA 3BMBA 1O6IA 1J4RA 3O5JA 3O5EA 4ITZA 4ODKA 2D9FA 2OLHA 4WKHA 1ROTA 2DSUA 2O92A 1HKJA 4Z2IA 3KACA 3IHZA 4J4OA 4JFIA 5DITA 1HJWA 1RD6A 2ZQSA 1NWSA 3WKZA 3ARVA 3IK8A 1BKFA 1NWRA 2KR7A 1XHGA 2DSVA 4MAVA 3WQWA 3B9EA 1GUVA 4MTVA 4HBEA 5GQBA 2XP3A 1ROUA 2KFWA 4HBOA 3RFWA 3ARQA 2PV3A 4DRPA 2M08A 1TCOC 2F2DA 3ALGA 4DWSC 1J4IA 2RUQA 2XP4A 4DWSB 3AROA 4ODMA 1C9HA 1FFQA 1UR9A 2F4EA 3CGNA 1EYMA 3FY1A 4IT4A 4ZPTR 1FKLA 1M5YA 2RURA 3RM4A 3WL1A 5DF0A 1NSGA 3JYMA 2AOSA 3UI5A 4U84A 4Z2HA 3O5QA 3WD2A 3UQAA 4Q22A 2LJ4A 5HT1A 1TFVA 4Z2GA 2KE0A 4S3JA 4DIPA 4DWSD 1SYTA 1ZBKA 1L1PA 3I6CA 3ARPA 3WIJA 1FKJA 1FKFA 1Q6UA 4JYSA 1LG1A 1J4HA 2KI3A 3OA5A 1WNOA 3FXYA 1GOIA 2A3EA 4DRJA 5B8IC 1LQ0A 3KAHA 2MPHA 2ZQUA 4LAXA 5DEZA 2RUCA 2XPAA 2FKEA 4ZS6A 3O5MA 4UDMA 1OWQA 4MNMA 1GRJA 4ODOA 2FDMA 5GPRA 4DRMA 4W9OA 2KO7A 2AWGA 4L3NA 1J6YA 2DG3A 3UQBA 4XAKA 1ZCNA 1W9PA 2DSZA 3ARUA 3PR9A 3WQVA 2WM0A 1W1PA 1Q6IA 2ZR4A 4MSPA 4MGVA 4BF8A 3CHCA 4DRKA 4QT2A 3KZ7A 2XP8A 4DRHA 1ZBWA 4NSBA 3B7XA 3PRBA 1P5QA 2B31A 3O5KA 4DZ2A 2XP5A 3WD4A 4DROA 4Q7NA 1QPFA 4LGXA 2XP7A 1R9HA 2L2SA 2ZR5A 1LG2A 3O5LA 1JNEA 1HKIA 3ARWA 4ZPWR 3IKGA 3ARXA 2F21A 4FAPA 3JXVA 4JFJA 4TW6A 3G6LA 2YBUA 1QZ2A 1OGBA 2XP6A 2PPOA 3O5GA 1PBKA 3ARYA 3AS1A 4J4NA 2DPEA 4R5EA 3CGMA 2A3AA 2P4VA 4R0XA 2RQSA 5HUAA 4GIVA 3ARSA 2YBTA 1OGGA 2XP9A 3GPKA 3RMEA 4DRIA 1JCHB 4URIA 3IKDA 3UF8A 5DIUA 1KT0A 3VAWA 1E44A 1JVWA 4ODLA 4Z2LA 3UI6A 1EQ3A 2N87A 4N19A 5HWBA 4TX0A 2B5UB 4JFLA 3PA7A 4TW7A 3O5PA 1KFWA 1D7JA 3KADA 3QOKA 5D75A 4LAYA 3MDYB 2ETNA 3TC5A 5JH8A 1LL6A 4S3KA 3NTPA 4Z2JA 3O5FA 3RM8A 1ZK6A 2OFNA 1FKDA 2G41A 4W9PA 4ML4A 1B6CA 1K9TA 4TYOA 4MPKA 2EULA 4TNSA 1HJXA 2RUDA 1W9VA 2PN0A 4FN2A 4W5UA 3B9DA 1E9LA 1IX5A 2MF9A 4JFMA 3ARRA 5HWCA 1QPLA 4MNJA 4KQZA 3B9AA 1FKIA 3GTYX 1D7IA 4WIWA 4IPXA 3CH9A 1FFRA 4QIBA 2MLXA 4KR0B 4DH0A 2IUZA 4WK9A 2WLYA 4WKAA 2WLZA 4DT4A 1ZL1A 3EY6A 3KAFA 1Q6HA 1XRVA 2DT2A 4P8VA 5DO2A 4HARA 1JNSA 4P8XA 2QF8A 3CZ8A 3G6MA 1HKMA 2Q5AA 3GU0A 3WD0A 3CHFA 4NZCA 5HW7A 4LAWA 3TDBA 1FKGA 2DT1A 1BL4A 4QT3A 1X6LA 3FAPA 1D6OA 2DT3A 4IQCA 2IF4A 1ZBVA 1WAWA 3WD3A 1EDQA 2K8IA 1HJVA 3O5DA 3KAGA 4TW8A 3JYJA 4MNLA 1NH6A 2PPNA 1W9UA 2DG9A 4ODNA 3O5IA 3OOBA 1FKRA 4O2TA 1EIBA 3NRKA 1A7XA 3CHDA 1PINA 2MNTA 1NWTA 1ZU8A 1FKSA 3KABA 2DG4A 2PPPA 2LPVA 1NWUA 2ITKA 1E6RA 3PRAA 1E6ZA 1FKKA 4G50A 2G8ZA 1E6NA 2A3BA 4GGQA 5HTGA 2M1IA 1NMWA 1ITXA 2UZ5A 4DWSA 3ARZA 4U86A 4WKFA 1CTNA 2MLZA 1GPFA 1WB0A 5HW8A 4IQ2A 1E6PA 3CHEA 2Y78A 2ESCA 1NMVA 2ZQVA 3KAIA 4P8WA 1FAPA 2LGOA 1SR0A 1YATA 1Q1CA 3B8SA 5DIVA 4WJXA 4ZPVR 1W26A 3H9RB 4MNKA 2PI6A 4AY1A 1JNTA 1H0IA 1FKBA 1T11A 4ODQA 2M2AA 4L72B 1HKKA 3WD1A 1ZB5A 3BXWA 1ZBCA 3AS3A 4QZVB 3O5RA 1FKTA 4DRQA 3RM9A 5HKGA 4U85A 1W1VA 3AQUA 1F8AB 5GPGA 4P8UA 1W1TA 2MLYA 4W9QA 1KT1A 5HBFA 3ARTA 1LL4A 2VN1A 3EIPA 4ODPA 2F23A 5HW6A 2ZR6A 3LUOA 4DZ3A 1VF8A 3ODKA 1UR8A 1U79A 1D7HA 1F40A 5I98A 1FJDA 4DRNA 3WL0A 1EHNA 4Z2KA 1JNDA 5BXJA 3AS0A 2DSWA 2LKNA 2WK2A 2A3CA
chains in the Genus database with same CATH topology
1E15A 1D2KA 3NI6A 4ODRA 4LAVA 2O9OA 3AS2A 3PRDA 4G2PA 3TCZA 1YW5A 4IT6A 2PV1A 2DT0A 3KCEA 2RSEA 1LL7A 1FD9A 4NNRA 1X6NA 2VCDA 4JFKA 2PBCA 1Y0OA 2ZQTA 4PTMA 3WH0A 3UQIA 2FAPA 4C02B 5J6EA 1H0GA 3ALFA 1FKHA 2PV2A 3RGCA 2JZVA 3O5OA 1W1YA 1HXVA 1LJYA 3W4RA 3UI4A 2XPBA 1N1AA 2KGJA 1O6IA 1J4RA 3O5JA 3O5EA 4ITZA 4ODKA 2D9FA 2OLHA 4WKHA 1ROTA 2DSUA 2O92A 1HKJA 4Z2IA 3KACA 3IHZA 4J4OA 4JFIA 5DITA 1HJWA 1RD6A 2ZQSA 1NWSA 3WKZA 3ARVA 3IK8A 1BKFA 1NWRA 2KR7A 1XHGA 2DSVA 4MAVA 3WQWA 3B9EA 1GUVA 4MTVA 4HBEA 5GQBA 2XP3A 1ROUA 2KFWA 4HBOA 3RFWA 3ARQA 2PV3A 4DRPA 2M08A 1TCOC 2F2DA 3ALGA 4DWSC 1J4IA 2RUQA 2XP4A 4DWSB 3AROA 4ODMA 1C9HA 1FFQA 1UR9A 2F4EA 3CGNA 1EYMA 3FY1A 4IT4A 4ZPTR 1FKLA 1M5YA 2RURA 3RM4A 3WL1A 5DF0A 1NSGA 3JYMA 2AOSA 3UI5A 4U84A 4Z2HA 3O5QA 3WD2A 3UQAA 4Q22A 2LJ4A 5HT1A 1TFVA 4Z2GA 2KE0A 4S3JA 4DIPA 4DWSD 1SYTA 1ZBKA 1L1PA 3I6CA 3ARPA 3WIJA 1FKJA 1FKFA 1Q6UA 4JYSA 1LG1A 1J4HA 2KI3A 3OA5A 1WNOA 3FXYA 1GOIA 2A3EA 4DRJA 5B8IC 1LQ0A 3KAHA 2MPHA 2ZQUA 4LAXA 5DEZA 2RUCA 2XPAA 2FKEA 4ZS6A 3O5MA 1OWQA 4MNMA 4ODOA 2FDMA 5GPRA 4DRMA 4W9OA 2KO7A 2AWGA 4L3NA 1J6YA 2DG3A 3UQBA 4XAKA 1ZCNA 1W9PA 2DSZA 3ARUA 3PR9A 3WQVA 2WM0A 1W1PA 1Q6IA 2ZR4A 4MSPA 4MGVA 4BF8A 3CHCA 4DRKA 4QT2A 3KZ7A 2XP8A 4DRHA 1ZBWA 4NSBA 3B7XA 3PRBA 1P5QA 2B31A 3O5KA 4DZ2A 2XP5A 3WD4A 4DROA 4Q7NA 1QPFA 4LGXA 2XP7A 1R9HA 2L2SA 2ZR5A 1LG2A 3O5LA 1JNEA 1HKIA 3ARWA 4ZPWR 3IKGA 3ARXA 2F21A 4FAPA 3JXVA 4JFJA 4TW6A 3G6LA 2YBUA 1QZ2A 1OGBA 2XP6A 2PPOA 3O5GA 1PBKA 3ARYA 3AS1A 4J4NA 2DPEA 4R5EA 3CGMA 2A3AA 4R0XA 2RQSA 5HUAA 4GIVA 3ARSA 2YBTA 1OGGA 2XP9A 3GPKA 3RMEA 4DRIA 4URIA 3IKDA 3UF8A 5DIUA 1KT0A 3VAWA 1JVWA 4ODLA 4Z2LA 3UI6A 1EQ3A 2N87A 4N19A 5HWBA 4TX0A 4JFLA 3PA7A 4TW7A 3O5PA 1KFWA 1D7JA 3KADA 3QOKA 5D75A 4LAYA 3MDYB 3TC5A 5JH8A 1LL6A 4S3KA 3NTPA 4Z2JA 3O5FA 3RM8A 1ZK6A 2OFNA 1FKDA 2G41A 4W9PA 4ML4A 1B6CA 1K9TA 4TYOA 4MPKA 4TNSA 1HJXA 2RUDA 1W9VA 4FN2A 4W5UA 3B9DA 1E9LA 1IX5A 2MF9A 4JFMA 3ARRA 5HWCA 1QPLA 4MNJA 4KQZA 3B9AA 1FKIA 1D7IA 4WIWA 4IPXA 3CH9A 1FFRA 4QIBA 2MLXA 4KR0B 4DH0A 2IUZA 4WK9A 2WLYA 4WKAA 2WLZA 4DT4A 1ZL1A 3EY6A 3KAFA 1Q6HA 1XRVA 2DT2A 4P8VA 5DO2A 4HARA 1JNSA 4P8XA 2QF8A 3CZ8A 3G6MA 1HKMA 2Q5AA 3WD0A 3CHFA 4NZCA 5HW7A 4LAWA 3TDBA 1FKGA 2DT1A 1BL4A 4QT3A 1X6LA 3FAPA 1D6OA 2DT3A 4IQCA 2IF4A 1ZBVA 1WAWA 3WD3A 1EDQA 2K8IA 1HJVA 3O5DA 3KAGA 4TW8A 3JYJA 4MNLA 1NH6A 2PPNA 1W9UA 2DG9A 4ODNA 3O5IA 3OOBA 1FKRA 4O2TA 1EIBA 3NRKA 1A7XA 3CHDA 1PINA 2MNTA 1NWTA 1ZU8A 1FKSA 3KABA 2DG4A 2PPPA 2LPVA 1NWUA 2ITKA 1E6RA 3PRAA 1E6ZA 1FKKA 4G50A 2G8ZA 1E6NA 2A3BA 4GGQA 5HTGA 2M1IA 1NMWA 1ITXA 2UZ5A 4DWSA 3ARZA 4U86A 4WKFA 1CTNA 2MLZA 1GPFA 1WB0A 5HW8A 4IQ2A 1E6PA 3CHEA 2Y78A 2ESCA 1NMVA 2ZQVA 3KAIA 4P8WA 1FAPA 2LGOA 1SR0A 1YATA 1Q1CA 3B8SA 5DIVA 4WJXA 4ZPVR 1W26A 3H9RB 4MNKA 2PI6A 4AY1A 1JNTA 1H0IA 1FKBA 1T11A 4ODQA 2M2AA 4L72B 1HKKA 3WD1A 1ZB5A 3BXWA 1ZBCA 3AS3A 4QZVB 3O5RA 1FKTA 4DRQA 3RM9A 5HKGA 4U85A 1W1VA 3AQUA 1F8AB 5GPGA 4P8UA 1W1TA 2MLYA 4W9QA 1KT1A 5HBFA 3ARTA 1LL4A 2VN1A 4ODPA 5HW6A 2ZR6A 3LUOA 4DZ3A 1VF8A 3ODKA 1UR8A 1U79A 1D7HA 1F40A 5I98A 1FJDA 4DRNA 3WL0A 1EHNA 4Z2KA 1JNDA 5BXJA 3AS0A 2DSWA 2LKNA 2WK2A 2A3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NSG A;  3JYJ A;  1PBK A;  3JYM A;  3UI5 A;  2PPN A;  4DRJ A;  4ODR A;  3NI6 A;  4LAV A;  4U84 A;  3O5Q A;  4J4N A;  3PRD A;  2DG9 A;  3CGM A;  4ODN A;  3O5I A;  3OOB A;  3UQA A;  1FKR A;  2LJ4 A;  2RQS A;  4O2T A;  4R0X A;  4G2P A;  4GIV A;  5HT1 A;  5HUA A;  3TCZ A;  3NRK A;  1A7X A;  2KE0 A;  3GPK A;  2XP9 A;  1YW5 A;  2PV1 A;  4DRI A;  1PIN A;  4DIP A;  2MNT A;  3KCE A;  2RSE A;  1L1P A;  3IKD A;  3I6C A;  3UF8 A;  1FD9 A;  5DIU A;  1FKJ A;  1FKS A;  1KT0 A;  1FKF A;  1Q6U A;  3KAB A;  4JYS A;  2DG4 A;  1J4H A;  2KI3 A;  4NNR A;  2PPP A;  2LPV A;  3VAW A;  2VCD A;  1JVW A;  4JFK A;  2ITK A;  2PBC A;  4ODL A;  3UI6 A;  1EQ3 A;  1Y0O A;  2N87 A;  2ZQT A;  4N19 A;  3UQI A;  4TX0 A;  3WH0 A;  4JFL A;  3KAH A;  2FAP A;  1FKK A;  3PA7 A;  2MPH A;  2ZQU A;  4G50 A;  3O5P A;  1D7J A;  3KAD A;  4LAX A;  4TW7 A;  5D75 A;  4C02 B;  5J6E A;  4LAY A;  2RUC A;  2XPA A;  1FKH A;  2FKE A;  2PV2 A;  2M1I A;  1NMW A;  3MDY B;  2UZ5 A;  3O5M A;  3TC5 A;  3RGC A;  2JZV A;  3NTP A;  3O5O A;  4U86 A;  1HXV A;  2MLZ A;  3O5F A;  5HW8 A;  1ZK6 A;  2OFN A;  4IQ2 A;  4ODO A;  1FKD A;  2Y78 A;  4DRM A;  4W9P A;  3UI4 A;  2XPB A;  1N1A A;  1NMV A;  1B6C A;  2KGJ A;  4W9O A;  2KO7 A;  2ZQV A;  1J4R A;  3KAI A;  3O5J A;  2AWG A;  3O5E A;  4ITZ A;  4TYO A;  2LGO A;  1FAP A;  1J6Y A;  2DG3 A;  4TNS A;  3UQB A;  4ODK A;  1YAT A;  5HTG A;  1Q1C A;  2D9F A;  1ZCN A;  2RUD A;  5DIV A;  1ROT A;  1W26 A;  3H9R B;  1Q6I A;  2ZR4 A;  4MSP A;  4FN2 A;  4MGV A;  1JNT A;  1FKB A;  1T11 A;  4ODQ A;  4BF8 A;  3KAC A;  2M2A A;  3IHZ A;  2MF9 A;  4J4O A;  4JFM A;  4DRK A;  4JFI A;  5DIT A;  5HWB A;  4GGQ A;  5HWC A;  4QT2 A;  1QPL A;  2ZQS A;  3KZ7 A;  2XP8 A;  1FKI A;  4DRH A;  1D7I A;  4IPX A;  3O5R A;  1FKT A;  3B7X A;  3IK8 A;  1BKF A;  1P5Q A;  3PRB A;  4QIB A;  2MLX A;  3O5K A;  4DRQ A;  4DZ2 A;  4U85 A;  2KR7 A;  4DH0 A;  5HKG A;  1F8A B;  5GPG A;  2XP5 A;  4DRO A;  2MLY A;  4DT4 A;  4W9Q A;  3EY6 A;  3KAF A;  1QPF A;  1Q6H A;  1KT1 A;  2XP3 A;  2XP7 A;  1ROU A;  2KFW A;  1R9H A;  3RFW A;  2L2S A;  2ZR5 A;  2VN1 A;  5B8I C;  4ODP A;  2PV3 A;  3O5L A;  4DRP A;  2ZR6 A;  3LUO A;  2M08 A;  5HW6 A;  1JNS A;  1TCO C;  4DZ3 A;  2F2D A;  3ODK A;  1U79 A;  1D7H A;  1J4I A;  3IKG A;  2RUQ A;  2XP4 A;  2F21 A;  4ODM A;  4FAP A;  1C9H A;  2Q5A A;  2F4E A;  3CGN A;  1F40 A;  5I98 A;  3JXV A;  1EYM A;  4LAW A;  5HW7 A;  3TDB A;  1FKG A;  1BL4 A;  4JFJ A;  4TW6 A;  1FJD A;  4QT3 A;  3FAP A;  4DRN A;  1D6O A;  4IQC A;  2IF4 A;  1FKL A;  1M5Y A;  1QZ2 A;  2RUR A;  5BXJ A;  2K8I A;  2XP6 A;  2LKN A;  3O5D A;  3KAG A;  2PPO A;  4TW8 A;  3O5G A; 
#chains in the Genus database with same CATH topology
 1E15 A;  1D2K A;  3NI6 A;  4ODR A;  4LAV A;  2O9O A;  3AS2 A;  3PRD A;  4G2P A;  3TCZ A;  1YW5 A;  4IT6 A;  2PV1 A;  2DT0 A;  3KCE A;  2RSE A;  1LL7 A;  1FD9 A;  4NNR A;  1X6N A;  2VCD A;  4JFK A;  2PBC A;  1Y0O A;  2ZQT A;  4PTM A;  3WH0 A;  3UQI A;  2FAP A;  4C02 B;  5J6E A;  1H0G A;  3ALF A;  1FKH A;  2PV2 A;  3RGC A;  2JZV A;  3O5O A;  1W1Y A;  1HXV A;  1LJY A;  3W4R A;  3UI4 A;  2XPB A;  1N1A A;  2KGJ A;  3BMB A;  1O6I A;  1J4R A;  3O5J A;  3O5E A;  4ITZ A;  4ODK A;  2D9F A;  2OLH A;  4WKH A;  1ROT A;  2DSU A;  2O92 A;  1HKJ A;  4Z2I A;  3KAC A;  3IHZ A;  4J4O A;  4JFI A;  5DIT A;  1HJW A;  1RD6 A;  2ZQS A;  1NWS A;  3WKZ A;  3ARV A;  3IK8 A;  1BKF A;  1NWR A;  2KR7 A;  1XHG A;  2DSV A;  4MAV A;  3WQW A;  3B9E A;  1GUV A;  4MTV A;  4HBE A;  5GQB A;  2XP3 A;  1ROU A;  2KFW A;  4HBO A;  3RFW A;  3ARQ A;  2PV3 A;  4DRP A;  2M08 A;  1TCO C;  2F2D A;  3ALG A;  4DWS C;  1J4I A;  2RUQ A;  2XP4 A;  4DWS B;  3ARO A;  4ODM A;  1C9H A;  1FFQ A;  1UR9 A;  2F4E A;  3CGN A;  1EYM A;  3FY1 A;  4IT4 A;  4ZPT R;  1FKL A;  1M5Y A;  2RUR A;  3RM4 A;  3WL1 A;  5DF0 A;  1NSG A;  3JYM A;  2AOS A;  3UI5 A;  4U84 A;  4Z2H A;  3O5Q A;  3WD2 A;  3UQA A;  4Q22 A;  2LJ4 A;  5HT1 A;  1TFV A;  4Z2G A;  2KE0 A;  4S3J A;  4DIP A;  4DWS D;  1SYT A;  1ZBK A;  1L1P A;  3I6C A;  3ARP A;  3WIJ A;  1FKJ A;  1FKF A;  1Q6U A;  4JYS A;  1LG1 A;  1J4H A;  2KI3 A;  3OA5 A;  1WNO A;  3FXY A;  1GOI A;  2A3E A;  4DRJ A;  5B8I C;  1LQ0 A;  3KAH A;  2MPH A;  2ZQU A;  4LAX A;  5DEZ A;  2RUC A;  2XPA A;  2FKE A;  4ZS6 A;  3O5M A;  4UDM A;  1OWQ A;  4MNM A;  1GRJ A;  4ODO A;  2FDM A;  5GPR A;  4DRM A;  4W9O A;  2KO7 A;  2AWG A;  4L3N A;  1J6Y A;  2DG3 A;  3UQB A;  4XAK A;  1ZCN A;  1W9P A;  2DSZ A;  3ARU A;  3PR9 A;  3WQV A;  2WM0 A;  1W1P A;  1Q6I A;  2ZR4 A;  4MSP A;  4MGV A;  4BF8 A;  3CHC A;  4DRK A;  4QT2 A;  3KZ7 A;  2XP8 A;  4DRH A;  1ZBW A;  4NSB A;  3B7X A;  3PRB A;  1P5Q A;  2B31 A;  3O5K A;  4DZ2 A;  2XP5 A;  3WD4 A;  4DRO A;  4Q7N A;  1QPF A;  4LGX A;  2XP7 A;  1R9H A;  2L2S A;  2ZR5 A;  1LG2 A;  3O5L A;  1JNE A;  1HKI A;  3ARW A;  4ZPW R;  3IKG A;  3ARX A;  2F21 A;  4FAP A;  3JXV A;  4JFJ A;  4TW6 A;  3G6L A;  2YBU A;  1QZ2 A;  1OGB A;  2XP6 A;  2PPO A;  3O5G A;  1PBK A;  3ARY A;  3AS1 A;  4J4N A;  2DPE A;  4R5E A;  3CGM A;  2A3A A;  2P4V A;  4R0X A;  2RQS A;  5HUA A;  4GIV A;  3ARS A;  2YBT A;  1OGG A;  2XP9 A;  3GPK A;  3RME A;  4DRI A;  1JCH B;  4URI A;  3IKD A;  3UF8 A;  5DIU A;  1KT0 A;  3VAW A;  1E44 A;  1JVW A;  4ODL A;  4Z2L A;  3UI6 A;  1EQ3 A;  2N87 A;  4N19 A;  5HWB A;  4TX0 A;  2B5U B;  4JFL A;  3PA7 A;  4TW7 A;  3O5P A;  1KFW A;  1D7J A;  3KAD A;  3QOK A;  5D75 A;  4LAY A;  3MDY B;  2ETN A;  3TC5 A;  5JH8 A;  1LL6 A;  4S3K A;  3NTP A;  4Z2J A;  3O5F A;  3RM8 A;  1ZK6 A;  2OFN A;  1FKD A;  2G41 A;  4W9P A;  4ML4 A;  1B6C A;  1K9T A;  4TYO A;  4MPK A;  2EUL A;  4TNS A;  1HJX A;  2RUD A;  1W9V A;  2PN0 A;  4FN2 A;  4W5U A;  3B9D A;  1E9L A;  1IX5 A;  2MF9 A;  4JFM A;  3ARR A;  5HWC A;  1QPL A;  4MNJ A;  4KQZ A;  3B9A A;  1FKI A;  3GTY X;  1D7I A;  4WIW A;  4IPX A;  3CH9 A;  1FFR A;  4QIB A;  2MLX A;  4KR0 B;  4DH0 A;  2IUZ A;  4WK9 A;  2WLY A;  4WKA A;  2WLZ A;  4DT4 A;  1ZL1 A;  3EY6 A;  3KAF A;  1Q6H A;  1XRV A;  2DT2 A;  4P8V A;  5DO2 A;  4HAR A;  1JNS A;  4P8X A;  2QF8 A;  3CZ8 A;  3G6M A;  1HKM A;  2Q5A A;  3GU0 A;  3WD0 A;  3CHF A;  4NZC A;  5HW7 A;  4LAW A;  3TDB A;  1FKG A;  2DT1 A;  1BL4 A;  4QT3 A;  1X6L A;  3FAP A;  1D6O A;  2DT3 A;  4IQC A;  2IF4 A;  1ZBV A;  1WAW A;  3WD3 A;  1EDQ A;  2K8I A;  1HJV A;  3O5D A;  3KAG A;  4TW8 A;  3JYJ A;  4MNL A;  1NH6 A;  2PPN A;  1W9U A;  2DG9 A;  4ODN A;  3O5I A;  3OOB A;  1FKR A;  4O2T A;  1EIB A;  3NRK A;  1A7X A;  3CHD A;  1PIN A;  2MNT A;  1NWT A;  1ZU8 A;  1FKS A;  3KAB A;  2DG4 A;  2PPP A;  2LPV A;  1NWU A;  2ITK A;  1E6R A;  3PRA A;  1E6Z A;  1FKK A;  4G50 A;  2G8Z A;  1E6N A;  2A3B A;  4GGQ A;  5HTG A;  2M1I A;  1NMW A;  1ITX A;  2UZ5 A;  4DWS A;  3ARZ A;  4U86 A;  4WKF A;  1CTN A;  2MLZ A;  1GPF A;  1WB0 A;  5HW8 A;  4IQ2 A;  1E6P A;  3CHE A;  2Y78 A;  2ESC A;  1NMV A;  2ZQV A;  3KAI A;  4P8W A;  1FAP A;  2LGO A;  1SR0 A;  1YAT A;  1Q1C A;  3B8S A;  5DIV A;  4WJX A;  4ZPV R;  1W26 A;  3H9R B;  4MNK A;  2PI6 A;  4AY1 A;  1JNT A;  1H0I A;  1FKB A;  1T11 A;  4ODQ A;  2M2A A;  4L72 B;  1HKK A;  3WD1 A;  1ZB5 A;  3BXW A;  1ZBC A;  3AS3 A;  4QZV B;  3O5R A;  1FKT A;  4DRQ A;  3RM9 A;  5HKG A;  4U85 A;  1W1V A;  3AQU A;  1F8A B;  5GPG A;  4P8U A;  1W1T A;  2MLY A;  4W9Q A;  1KT1 A;  5HBF A;  3ART A;  1LL4 A;  2VN1 A;  3EIP A;  4ODP A;  2F23 A;  5HW6 A;  2ZR6 A;  3LUO A;  4DZ3 A;  1VF8 A;  3ODK A;  1UR8 A;  1U79 A;  1D7H A;  1F40 A;  5I98 A;  1FJD A;  4DRN A;  3WL0 A;  1EHN A;  4Z2K A;  1JND A;  5BXJ A;  3AS0 A;  2DSW A;  2LKN A;  2WK2 A;  2A3C A; 
#chains in the Genus database with same CATH homology
 1E15 A;  1D2K A;  3NI6 A;  4ODR A;  4LAV A;  2O9O A;  3AS2 A;  3PRD A;  4G2P A;  3TCZ A;  1YW5 A;  4IT6 A;  2PV1 A;  2DT0 A;  3KCE A;  2RSE A;  1LL7 A;  1FD9 A;  4NNR A;  1X6N A;  2VCD A;  4JFK A;  2PBC A;  1Y0O A;  2ZQT A;  4PTM A;  3WH0 A;  3UQI A;  2FAP A;  4C02 B;  5J6E A;  1H0G A;  3ALF A;  1FKH A;  2PV2 A;  3RGC A;  2JZV A;  3O5O A;  1W1Y A;  1HXV A;  1LJY A;  3W4R A;  3UI4 A;  2XPB A;  1N1A A;  2KGJ A;  1O6I A;  1J4R A;  3O5J A;  3O5E A;  4ITZ A;  4ODK A;  2D9F A;  2OLH A;  4WKH A;  1ROT A;  2DSU A;  2O92 A;  1HKJ A;  4Z2I A;  3KAC A;  3IHZ A;  4J4O A;  4JFI A;  5DIT A;  1HJW A;  1RD6 A;  2ZQS A;  1NWS A;  3WKZ A;  3ARV A;  3IK8 A;  1BKF A;  1NWR A;  2KR7 A;  1XHG A;  2DSV A;  4MAV A;  3WQW A;  3B9E A;  1GUV A;  4MTV A;  4HBE A;  5GQB A;  2XP3 A;  1ROU A;  2KFW A;  4HBO A;  3RFW A;  3ARQ A;  2PV3 A;  4DRP A;  2M08 A;  1TCO C;  2F2D A;  3ALG A;  4DWS C;  1J4I A;  2RUQ A;  2XP4 A;  4DWS B;  3ARO A;  4ODM A;  1C9H A;  1FFQ A;  1UR9 A;  2F4E A;  3CGN A;  1EYM A;  3FY1 A;  4IT4 A;  4ZPT R;  1FKL A;  1M5Y A;  2RUR A;  3RM4 A;  3WL1 A;  5DF0 A;  1NSG A;  3JYM A;  2AOS A;  3UI5 A;  4U84 A;  4Z2H A;  3O5Q A;  3WD2 A;  3UQA A;  4Q22 A;  2LJ4 A;  5HT1 A;  1TFV A;  4Z2G A;  2KE0 A;  4S3J A;  4DIP A;  4DWS D;  1SYT A;  1ZBK A;  1L1P A;  3I6C A;  3ARP A;  3WIJ A;  1FKJ A;  1FKF A;  1Q6U A;  4JYS A;  1LG1 A;  1J4H A;  2KI3 A;  3OA5 A;  1WNO A;  3FXY A;  1GOI A;  2A3E A;  4DRJ A;  5B8I C;  1LQ0 A;  3KAH A;  2MPH A;  2ZQU A;  4LAX A;  5DEZ A;  2RUC A;  2XPA A;  2FKE A;  4ZS6 A;  3O5M A;  1OWQ A;  4MNM A;  4ODO A;  2FDM A;  5GPR A;  4DRM A;  4W9O A;  2KO7 A;  2AWG A;  4L3N A;  1J6Y A;  2DG3 A;  3UQB A;  4XAK A;  1ZCN A;  1W9P A;  2DSZ A;  3ARU A;  3PR9 A;  3WQV A;  2WM0 A;  1W1P A;  1Q6I A;  2ZR4 A;  4MSP A;  4MGV A;  4BF8 A;  3CHC A;  4DRK A;  4QT2 A;  3KZ7 A;  2XP8 A;  4DRH A;  1ZBW A;  4NSB A;  3B7X A;  3PRB A;  1P5Q A;  2B31 A;  3O5K A;  4DZ2 A;  2XP5 A;  3WD4 A;  4DRO A;  4Q7N A;  1QPF A;  4LGX A;  2XP7 A;  1R9H A;  2L2S A;  2ZR5 A;  1LG2 A;  3O5L A;  1JNE A;  1HKI A;  3ARW A;  4ZPW R;  3IKG A;  3ARX A;  2F21 A;  4FAP A;  3JXV A;  4JFJ A;  4TW6 A;  3G6L A;  2YBU A;  1QZ2 A;  1OGB A;  2XP6 A;  2PPO A;  3O5G A;  1PBK A;  3ARY A;  3AS1 A;  4J4N A;  2DPE A;  4R5E A;  3CGM A;  2A3A A;  4R0X A;  2RQS A;  5HUA A;  4GIV A;  3ARS A;  2YBT A;  1OGG A;  2XP9 A;  3GPK A;  3RME A;  4DRI A;  4URI A;  3IKD A;  3UF8 A;  5DIU A;  1KT0 A;  3VAW A;  1JVW A;  4ODL A;  4Z2L A;  3UI6 A;  1EQ3 A;  2N87 A;  4N19 A;  5HWB A;  4TX0 A;  4JFL A;  3PA7 A;  4TW7 A;  3O5P A;  1KFW A;  1D7J A;  3KAD A;  3QOK A;  5D75 A;  4LAY A;  3MDY B;  3TC5 A;  5JH8 A;  1LL6 A;  4S3K A;  3NTP A;  4Z2J A;  3O5F A;  3RM8 A;  1ZK6 A;  2OFN A;  1FKD A;  2G41 A;  4W9P A;  4ML4 A;  1B6C A;  1K9T A;  4TYO A;  4MPK A;  4TNS A;  1HJX A;  2RUD A;  1W9V A;  4FN2 A;  4W5U A;  3B9D A;  1E9L A;  1IX5 A;  2MF9 A;  4JFM A;  3ARR A;  5HWC A;  1QPL A;  4MNJ A;  4KQZ A;  3B9A A;  1FKI A;  1D7I A;  4WIW A;  4IPX A;  3CH9 A;  1FFR A;  4QIB A;  2MLX A;  4KR0 B;  4DH0 A;  2IUZ A;  4WK9 A;  2WLY A;  4WKA A;  2WLZ A;  4DT4 A;  1ZL1 A;  3EY6 A;  3KAF A;  1Q6H A;  1XRV A;  2DT2 A;  4P8V A;  5DO2 A;  4HAR A;  1JNS A;  4P8X A;  2QF8 A;  3CZ8 A;  3G6M A;  1HKM A;  2Q5A A;  3WD0 A;  3CHF A;  4NZC A;  5HW7 A;  4LAW A;  3TDB A;  1FKG A;  2DT1 A;  1BL4 A;  4QT3 A;  1X6L A;  3FAP A;  1D6O A;  2DT3 A;  4IQC A;  2IF4 A;  1ZBV A;  1WAW A;  3WD3 A;  1EDQ A;  2K8I A;  1HJV A;  3O5D A;  3KAG A;  4TW8 A;  3JYJ A;  4MNL A;  1NH6 A;  2PPN A;  1W9U A;  2DG9 A;  4ODN A;  3O5I A;  3OOB A;  1FKR A;  4O2T A;  1EIB A;  3NRK A;  1A7X A;  3CHD A;  1PIN A;  2MNT A;  1NWT A;  1ZU8 A;  1FKS A;  3KAB A;  2DG4 A;  2PPP A;  2LPV A;  1NWU A;  2ITK A;  1E6R A;  3PRA A;  1E6Z A;  1FKK A;  4G50 A;  2G8Z A;  1E6N A;  2A3B A;  4GGQ A;  5HTG A;  2M1I A;  1NMW A;  1ITX A;  2UZ5 A;  4DWS A;  3ARZ A;  4U86 A;  4WKF A;  1CTN A;  2MLZ A;  1GPF A;  1WB0 A;  5HW8 A;  4IQ2 A;  1E6P A;  3CHE A;  2Y78 A;  2ESC A;  1NMV A;  2ZQV A;  3KAI A;  4P8W A;  1FAP A;  2LGO A;  1SR0 A;  1YAT A;  1Q1C A;  3B8S A;  5DIV A;  4WJX A;  4ZPV R;  1W26 A;  3H9R B;  4MNK A;  2PI6 A;  4AY1 A;  1JNT A;  1H0I A;  1FKB A;  1T11 A;  4ODQ A;  2M2A A;  4L72 B;  1HKK A;  3WD1 A;  1ZB5 A;  3BXW A;  1ZBC A;  3AS3 A;  4QZV B;  3O5R A;  1FKT A;  4DRQ A;  3RM9 A;  5HKG A;  4U85 A;  1W1V A;  3AQU A;  1F8A B;  5GPG A;  4P8U A;  1W1T A;  2MLY A;  4W9Q A;  1KT1 A;  5HBF A;  3ART A;  1LL4 A;  2VN1 A;  4ODP A;  5HW6 A;  2ZR6 A;  3LUO A;  4DZ3 A;  1VF8 A;  3ODK A;  1UR8 A;  1U79 A;  1D7H A;  1F40 A;  5I98 A;  1FJD A;  4DRN A;  3WL0 A;  1EHN A;  4Z2K A;  1JND A;  5BXJ A;  3AS0 A;  2DSW A;  2LKN A;  2WK2 A;  2A3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...