2VN1A

Crystal structure of the fk506-binding domain of plasmodium falciparum fkbp35 in complex with fk506
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
123
structure length
123
Chain Sequence
b'FEKVELTADGGVIKTILKKGDEGEENIPKKGNEVTVHYVGKLESTGKVFDSSFDRNVPFKFHLEQGEVIKGWDICVSSMRKNEKCLVRIESMYGYGDEGCGESIPGNSVLLFEIELLSFRELE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 70 KDA PEPTIDYLPROLYL ISOMERASE
publication title Crystal Structure of the Fk506 Binding Domain of Plasmodium Falciparum Fkbp35 in Complex with Fk506.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
total genus 31
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2vn1A01
4TNSA 1FKFA 3KADA 4JFJA 3UF8A 4FAPA 1FD9A 2ZR6A 2M08A 2PV3A 2KR7A 3NRKA 4JFLA 4DRPA 3MDYB 3KABA 3UQBA 1M5YA 5HUAA 2ZQSA 2K8IA 4ODNA 1FKTA 2JZVA 3H9RB 1FKDA 3TCZA 3PRBA 2KO7A 4DZ3A 3IKDA 2MF9A 3NI6A 5BXJA 3TDBA 3O5GA 4IQCA 1T11A 2PV2A 2F4EA 4GIVA 4ODRA 5DIUA 5HKGA 1FJDA 1FKGA 2OFNA 2M1IA 2ZR4A 4ODPA 4TX0A 1FKKA 1B6CA 2XP8A 4R0XA 1BKFA 2XP9A 2PBCA 4DH0A 3O5DA 2DG4A 4ODQA 4ODKA 5HW7A 3CGNA 3O5QA 2AWGA 5J6EA 1FKBA 4IQ2A 3O5PA 4LAXA 4W9PA 5I98A 4QIBA 4J4OA 3B7XA 3OOBA 1FKJA 1Y0OA 3IHZA 4BF8A 2KFWA 2DG3A 3O5RA 1A7XA 1W26A 3KAIA 5DITA 5GPGA 4C02B 2Q5AA 2UZ5A 4U86A 4W9OA 4TW6A 4LAWA 1FKHA 3O5OA 5HTGA 2PPOA 1FKLA 2VN1A 1FAPA 4G2PA 1ZCNA 2LGOA 2ZQUA 3IKGA 3O5MA 4FN2A 4GGQA 4ITZA 4ODLA 4DRIA 4QT2A 2M2AA 4DZ2A 1F40A 5B8IC 3LUOA 3O5LA 4TYOA 3UQIA 4DT4A 1Q6UA 1D7IA 2L2SA 4TW7A 1EYMA 1P5QA 1QZ2A 3KCEA 4JFIA 1D6OA 1EQ3A 2MLXA 2FKEA 1TCOC 1ROUA 2XP5A 4G50A 2RSEA 3ODKA 3UI5A 5HWCA 3RFWA 1QPFA 4ODMA 3TC5A 4DRHA 2XP7A 4LAVA 3UQAA 1PBKA 1N1AA 3GPKA 2DG9A 2ZR5A 3CGMA 4LAYA 3PRDA 1D7HA 1FKSA 4MGVA 2D9FA 2PV1A 4MSPA 2RQSA 1KT0A 4U85A 2N87A 3VAWA 2VCDA 2ZQVA 1Q1CA 2MLZA 4N19A 1PINA 1HXVA 1FKIA 1ZK6A 2IF4A 2MNTA 2MLYA 2XP4A 5DIVA 2FAPA 3PA7A 4J4NA 1Q6HA 3O5JA 4DRQA 4DIPA 2F21A 2LKNA 4IPXA 2KGJA 3NTPA 2KI3A 4DRNA 1C9HA 5HW6A 2RUDA 1J4RA 3JXVA 1J4IA 3KAFA 3KAHA 2LJ4A 2ITKA 3RGCA 5HT1A 4DRKA 1J6YA 3O5EA 1J4HA 1L1PA 1F8AB 1D7JA 1JNSA 1QPLA 1BL4A 2PPNA 1Q6IA 2Y78A 1U79A 4DRMA 4DROA 3KZ7A 1NSGA 1ROTA 3O5FA 1JVWA 2XP3A 1NMVA 1YW5A 3FAPA 4W9QA 3EY6A 4ODOA 1R9HA 3WH0A 1JNTA 5HWBA 1YATA 3O5IA 4JFMA 2MPHA 2RURA 4TW8A 2KE0A 4QT3A 3I6CA 3JYJA 4U84A 4JFKA 2XP6A 2XPBA 4NNRA 3UI4A 2PPPA 3JYMA 3KACA 1NMWA 3O5KA 5D75A 4DRJA 5HW8A 2ZQTA 2F2DA 3IK8A 1KT1A 4O2TA 3KAGA 2LPVA 2RUQA 2RUCA 3UI6A 4JYSA 1FKRA 2XPAA
chains in the Genus database with same CATH superfamily
4Z2KA 2DPEA 4FAPA 2ZR6A 3WD4A 4JFLA 4DRPA 3UQBA 1WAWA 3AQUA 5HBFA 2F23A 1JNDA 3W4RA 2WLYA 5BXJA 1SR0A 1T11A 4GIVA 1FKGA 2M1IA 4TX0A 1B6CA 3WD1A 2PBCA 2DT0A 1FKBA 4IQ2A 3O5PA 4IT6A 1W1TA 4LAXA 1HJXA 3OOBA 1FKJA 3IHZA 4IT4A 1LQ0A 2DG3A 3PR9A 2Q5AA 2UZ5A 4W9OA 4LAWA 3O5OA 2VN1A 3WD2A 3AS0A 4ODLA 4DRIA 4ITZA 4MNJA 4DZ2A 1F40A 3B9DA 1FFRA 3LUOA 4NSBA 4DT4A 1Q6UA 1D6OA 4ZS6A 1TFVA 2XP5A 2RSEA 1ZL1A 3ODKA 3RFWA 3TC5A 4DRHA 4LAVA 1PBKA 2FDMA 2ETNA 4MGVA 4Q22A 1E6NA 1HKKA 1ZBCA 2IF4A 1D2KA 4J4NA 2A3BA 3O5JA 3ARWA 4DRNA 2KGJA 1J4RA 3JXVA 3FXYA 4WKAA 3KAHA 2LJ4A 4DRKA 3WIJA 1O6IA 1L1PA 1W1PA 1EIBA 4DRMA 1UR8A 1NSGA 1ROTA 1JVWA 1YW5A 3RM4A 3FAPA 4XAKA 3FY1A 4ODOA 1XRVA 1YATA 4MAVA 1ZBVA 1KFWA 2KE0A 1X6NA 3JYJA 4U84A 4JFKA 2XP6A 2PI6A 4Z2JA 2PPPA 3KACA 3CHEA 5D75A 3B9AA 4Q7NA 2ZQTA 1EHNA 2LPVA 3G6LA 1FKRA 4TNSA 1GUVA 3KADA 1FD9A 2M08A 2DSVA 2PV3A 3NRKA 4HBEA 3MDYB 2AOSA 4PTMA 2K8IA 1FKDA 4DZ3A 3NI6A 3BMBA 1OWQA 3O5GA 4NZCA 4IQCA 5HKGA 2F4EA 1IX5A 1BKFA 3O5DA 2DG4A 2A3EA 4HARA 2WK2A 4S3KA 1E6RA 4WKHA 4W9PA 4J4OA 1W9PA 1Y0OA 5GQBA 3ARYA 5DITA 3B8SA 4C02B 4U86A 1NWTA 1FAPA 3O5MA 4FN2A 4QT2A 1E6ZA 4Z2HA 1SYTA 3KCEA 1CTNA 4JFIA 4MTVA 3ARUA 1ROUA 4G50A 5HWCA 3UI5A 1WNOA 3OA5A 3ARQA 2XP7A 1NWUA 3AROA 2DG9A 3CGMA 3PRDA 3WD0A 1KT0A 1FFQA 2VCDA 2ZQVA 1Q1CA 2MLZA 4N19A 1PINA 1NWRA 1OGBA 1HXVA 2XP4A 4IPXA 3NTPA 2DT3A 3WQVA 4ZPWR 3KAFA 2ITKA 2EULA 3RGCA 1W9UA 5HT1A 1HJVA 1J6YA 3O5EA 1J4HA 2DSWA 3EIPA 2Y78A 5DEZA 1RD6A 3B9EA 1EDQA 1HKIA 2XP3A 1R9HA 3WH0A 1JNTA 1H0IA 3O5IA 4JFMA 1LL7A 4HBOA 4QT3A 3AS3A 4NNRA 4P8XA 2WLZA 4O2TA 4AY1A 1FKFA 2QF8A 4QZVB 1E6PA 3UF8A 4Z2IA 1LJYA 2KR7A 1WB0A 2B31A 3ARSA 1HKMA 3KABA 1M5YA 5HUAA 1FKTA 2KO7A 2MF9A 3RM8A 1H0GA 4DWSD 1K9TA 5DIUA 1FJDA 2P4VA 3CHDA 3GU0A 2OFNA 2WM0A 2ZR4A 3PRAA 1ITXA 2XP8A 4KR0B 2XP9A 4R0XA 2DSZA 5HW7A 5J6EA 3CGNA 3O5QA 1OGGA 4R5EA 2G8ZA 4MPKA 4QIBA 3RM9A 3B7XA 1JNEA 1ZBWA 4BF8A 2KFWA 4WIWA 1W1YA 3ALGA 1W26A 3KAIA 4TW6A 3CH9A 1FKHA 1UR9A 2DT2A 3GTYX 5HTGA 1FKLA 1W9VA 4LGXA 1ZCNA 2LGOA 2ZQUA 2M2AA 4Z2LA 1HJWA 4ML4A 1D7IA 2L2SA 3WKZA 1EYMA 3CHFA 5DO2A 1ZU8A 2MLXA 1TCOC 2IUZA 4WK9A 4ODMA 1LG1A 2G41A 3UQAA 4L3NA 3GPKA 2ZR5A 4LAYA 2O92A 1D7HA 4ZPVR 2D9FA 2PV1A 4MSPA 4MNLA 3VAWA 1FKIA 1ZK6A 2MNTA 2MLYA 1Q6HA 4DIPA 2LKNA 4W5UA 2KI3A 2RUDA 1D7JA 1JNSA 1QPLA 2B5UB 1BL4A 1Q6IA 1E9LA 4DROA 3O5FA 4WKFA 4WJXA 5DF0A 4W9QA 3EY6A 5HWBA 1NWSA 5JH8A 2A3AA 3O5KA 4MNMA 4DWSB 3ARTA 1E15A 2F2DA 1KT1A 2A3CA 2RUCA 4JYSA 4MNKA 4ZPTR 4JFJA 1LL4A 4KQZA 4UDMA 3ARXA 1GOIA 2ZQSA 4ODNA 2JZVA 3H9RB 3TCZA 3WQWA 3PRBA 3IKDA 3TDBA 2PV2A 4ODRA 1GPFA 2OLHA 5GPRA 4ODPA 1FKKA 1E44A 4DH0A 4L72B 4ODQA 4ODKA 3WL1A 2AWGA 3CZ8A 1JCHB 1NH6A 5I98A 3O5RA 1A7XA 5GPGA 1GRJA 3G6MA 4P8WA 4DWSC 4P8UA 4URIA 4DWSA 2PPOA 4G2PA 3BXWA 1VF8A 3ARRA 3IKGA 4GGQA 1HKJA 1ZBKA 5B8IC 1X6LA 3O5LA 4TYOA 3UQIA 4TW7A 1P5QA 1QZ2A 1EQ3A 2FKEA 3AS2A 1QPFA 3RMEA 1W1VA 3ALFA 1N1AA 3AS1A 3WL0A 3ARZA 1FKSA 2YBUA 1LL6A 2RQSA 4U85A 2N87A 2O9OA 5DIVA 4DRQA 4S3JA 2FAPA 3PA7A 2F21A 5HW6A 1C9HA 1J4IA 2ESCA 2DT1A 1F8AB 1ZB5A 2PPNA 1U79A 3KZ7A 3QOKA 2DSUA 4Z2GA 1NMVA 1XHGA 4P8VA 3ARPA 2MPHA 3CHCA 2RURA 2YBTA 4TW8A 3I6CA 2XPBA 3UI4A 3JYMA 4DRJA 1NMWA 3WD3A 5HW8A 3IK8A 3KAGA 3ARVA 3UI6A 2RUQA 2PN0A 1LG2A 2XPAA
chains in the Genus database with same CATH topology
4Z2KA 2DPEA 4FAPA 2ZR6A 3WD4A 4JFLA 4DRPA 3UQBA 1WAWA 3AQUA 5HBFA 1JNDA 3W4RA 2WLYA 5BXJA 1SR0A 1T11A 4GIVA 1FKGA 2M1IA 4TX0A 1B6CA 3WD1A 2PBCA 2DT0A 1FKBA 4IQ2A 3O5PA 4IT6A 1W1TA 4LAXA 1HJXA 3OOBA 1FKJA 3IHZA 4IT4A 1LQ0A 2DG3A 3PR9A 2Q5AA 2UZ5A 4W9OA 4LAWA 3O5OA 2VN1A 3WD2A 3AS0A 4ODLA 4DRIA 4ITZA 4MNJA 4DZ2A 1F40A 3B9DA 1FFRA 3LUOA 4NSBA 4DT4A 1Q6UA 1D6OA 4ZS6A 1TFVA 2XP5A 2RSEA 1ZL1A 3ODKA 3RFWA 3TC5A 4DRHA 4LAVA 1PBKA 2FDMA 4MGVA 4Q22A 1E6NA 1HKKA 1ZBCA 2IF4A 1D2KA 4J4NA 2A3BA 3O5JA 3ARWA 4DRNA 2KGJA 1J4RA 3JXVA 3FXYA 4WKAA 3KAHA 2LJ4A 4DRKA 3WIJA 1O6IA 1L1PA 1W1PA 1EIBA 4DRMA 1UR8A 1NSGA 1ROTA 1JVWA 1YW5A 3RM4A 3FAPA 4XAKA 3FY1A 4ODOA 1XRVA 1YATA 4MAVA 1ZBVA 1KFWA 2KE0A 1X6NA 3JYJA 4U84A 4JFKA 2XP6A 2PI6A 4Z2JA 2PPPA 3KACA 3CHEA 5D75A 3B9AA 4Q7NA 2ZQTA 1EHNA 2LPVA 3G6LA 1FKRA 4TNSA 1GUVA 3KADA 1FD9A 2M08A 2DSVA 2PV3A 3NRKA 4HBEA 3MDYB 2AOSA 4PTMA 2K8IA 1FKDA 4DZ3A 3NI6A 1OWQA 3O5GA 4NZCA 4IQCA 5HKGA 2F4EA 1IX5A 1BKFA 3O5DA 2DG4A 2A3EA 4HARA 2WK2A 4S3KA 1E6RA 4WKHA 4W9PA 4J4OA 1W9PA 1Y0OA 5GQBA 3ARYA 5DITA 3B8SA 4C02B 4U86A 1NWTA 1FAPA 3O5MA 4FN2A 4QT2A 1E6ZA 4Z2HA 1SYTA 3KCEA 1CTNA 4JFIA 4MTVA 3ARUA 1ROUA 4G50A 5HWCA 3UI5A 1WNOA 3OA5A 3ARQA 2XP7A 1NWUA 3AROA 2DG9A 3CGMA 3PRDA 3WD0A 1KT0A 1FFQA 2VCDA 2ZQVA 1Q1CA 2MLZA 4N19A 1PINA 1NWRA 1OGBA 1HXVA 2XP4A 4IPXA 3NTPA 2DT3A 3WQVA 4ZPWR 3KAFA 2ITKA 3RGCA 1W9UA 5HT1A 1HJVA 1J6YA 3O5EA 1J4HA 2DSWA 2Y78A 5DEZA 1RD6A 3B9EA 1EDQA 1HKIA 2XP3A 1R9HA 3WH0A 1JNTA 1H0IA 3O5IA 4JFMA 1LL7A 4HBOA 4QT3A 3AS3A 4NNRA 4P8XA 2WLZA 4O2TA 4AY1A 1FKFA 2QF8A 4QZVB 1E6PA 3UF8A 4Z2IA 1LJYA 2KR7A 1WB0A 2B31A 3ARSA 1HKMA 3KABA 1M5YA 5HUAA 1FKTA 2KO7A 2MF9A 3RM8A 1H0GA 4DWSD 1K9TA 5DIUA 1FJDA 3CHDA 2OFNA 2WM0A 2ZR4A 3PRAA 1ITXA 2XP8A 4KR0B 2XP9A 4R0XA 2DSZA 5HW7A 5J6EA 3CGNA 3O5QA 1OGGA 4R5EA 2G8ZA 4MPKA 4QIBA 3RM9A 3B7XA 1JNEA 1ZBWA 4BF8A 2KFWA 4WIWA 1W1YA 3ALGA 1W26A 3KAIA 4TW6A 3CH9A 1FKHA 1UR9A 2DT2A 5HTGA 1FKLA 1W9VA 4LGXA 1ZCNA 2LGOA 2ZQUA 2M2AA 4Z2LA 1HJWA 4ML4A 1D7IA 2L2SA 3WKZA 1EYMA 3CHFA 5DO2A 1ZU8A 2MLXA 1TCOC 2IUZA 4WK9A 4ODMA 1LG1A 2G41A 3UQAA 4L3NA 3GPKA 2ZR5A 4LAYA 2O92A 1D7HA 4ZPVR 2D9FA 2PV1A 4MSPA 4MNLA 3VAWA 1FKIA 1ZK6A 2MNTA 2MLYA 1Q6HA 4DIPA 2LKNA 4W5UA 2KI3A 2RUDA 1D7JA 1JNSA 1QPLA 1BL4A 1Q6IA 1E9LA 4DROA 3O5FA 4WKFA 4WJXA 5DF0A 4W9QA 3EY6A 5HWBA 1NWSA 5JH8A 2A3AA 3O5KA 4MNMA 4DWSB 3ARTA 1E15A 2F2DA 1KT1A 2A3CA 2RUCA 4JYSA 4MNKA 4ZPTR 4JFJA 1LL4A 4KQZA 3ARXA 1GOIA 2ZQSA 4ODNA 2JZVA 3H9RB 3TCZA 3WQWA 3PRBA 3IKDA 3TDBA 2PV2A 4ODRA 1GPFA 2OLHA 5GPRA 4ODPA 1FKKA 4DH0A 4L72B 4ODQA 4ODKA 3WL1A 2AWGA 3CZ8A 1NH6A 5I98A 3O5RA 1A7XA 5GPGA 3G6MA 4P8WA 4DWSC 4P8UA 4URIA 4DWSA 2PPOA 4G2PA 3BXWA 1VF8A 3ARRA 3IKGA 4GGQA 1HKJA 1ZBKA 5B8IC 1X6LA 3O5LA 4TYOA 3UQIA 4TW7A 1P5QA 1QZ2A 1EQ3A 2FKEA 3AS2A 1QPFA 3RMEA 1W1VA 3ALFA 1N1AA 3AS1A 3WL0A 3ARZA 1FKSA 2YBUA 1LL6A 2RQSA 4U85A 2N87A 2O9OA 5DIVA 4DRQA 4S3JA 2FAPA 3PA7A 2F21A 5HW6A 1C9HA 1J4IA 2ESCA 2DT1A 1F8AB 1ZB5A 2PPNA 1U79A 3KZ7A 3QOKA 2DSUA 4Z2GA 1NMVA 1XHGA 4P8VA 3ARPA 2MPHA 3CHCA 2RURA 2YBTA 4TW8A 3I6CA 2XPBA 3UI4A 3JYMA 4DRJA 1NMWA 3WD3A 5HW8A 3IK8A 3KAGA 3ARVA 3UI6A 2RUQA 1LG2A 2XPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TNS A;  1FKF A;  3KAD A;  4JFJ A;  3UF8 A;  4FAP A;  1FD9 A;  2ZR6 A;  2M08 A;  2PV3 A;  2KR7 A;  3NRK A;  4JFL A;  4DRP A;  3MDY B;  3KAB A;  3UQB A;  1M5Y A;  5HUA A;  2ZQS A;  2K8I A;  4ODN A;  1FKT A;  2JZV A;  3H9R B;  1FKD A;  3TCZ A;  3PRB A;  2KO7 A;  4DZ3 A;  3IKD A;  2MF9 A;  3NI6 A;  5BXJ A;  3TDB A;  3O5G A;  4IQC A;  1T11 A;  2PV2 A;  2F4E A;  4GIV A;  4ODR A;  5DIU A;  5HKG A;  1FJD A;  1FKG A;  2OFN A;  2M1I A;  2ZR4 A;  4ODP A;  4TX0 A;  1FKK A;  1B6C A;  2XP8 A;  4R0X A;  1BKF A;  2XP9 A;  2PBC A;  4DH0 A;  3O5D A;  2DG4 A;  4ODQ A;  4ODK A;  5HW7 A;  3CGN A;  3O5Q A;  2AWG A;  5J6E A;  1FKB A;  4IQ2 A;  3O5P A;  4LAX A;  4W9P A;  5I98 A;  4QIB A;  4J4O A;  3B7X A;  3OOB A;  1FKJ A;  1Y0O A;  3IHZ A;  4BF8 A;  2KFW A;  2DG3 A;  3O5R A;  1A7X A;  1W26 A;  3KAI A;  5DIT A;  5GPG A;  4C02 B;  2Q5A A;  2UZ5 A;  4U86 A;  4W9O A;  4TW6 A;  4LAW A;  1FKH A;  3O5O A;  5HTG A;  2PPO A;  1FKL A;  2VN1 A;  1FAP A;  4G2P A;  1ZCN A;  2LGO A;  2ZQU A;  3IKG A;  3O5M A;  4FN2 A;  4GGQ A;  4ITZ A;  4ODL A;  4DRI A;  4QT2 A;  2M2A A;  4DZ2 A;  1F40 A;  5B8I C;  3LUO A;  3O5L A;  4TYO A;  3UQI A;  4DT4 A;  1Q6U A;  1D7I A;  2L2S A;  4TW7 A;  1EYM A;  1P5Q A;  1QZ2 A;  3KCE A;  4JFI A;  1D6O A;  1EQ3 A;  2MLX A;  2FKE A;  1TCO C;  1ROU A;  2XP5 A;  4G50 A;  2RSE A;  3ODK A;  3UI5 A;  5HWC A;  3RFW A;  1QPF A;  4ODM A;  3TC5 A;  4DRH A;  2XP7 A;  4LAV A;  3UQA A;  1PBK A;  1N1A A;  3GPK A;  2DG9 A;  2ZR5 A;  3CGM A;  4LAY A;  3PRD A;  1D7H A;  1FKS A;  4MGV A;  2D9F A;  2PV1 A;  4MSP A;  2RQS A;  1KT0 A;  4U85 A;  2N87 A;  3VAW A;  2VCD A;  2ZQV A;  1Q1C A;  2MLZ A;  4N19 A;  1PIN A;  1HXV A;  1FKI A;  1ZK6 A;  2IF4 A;  2MNT A;  2MLY A;  2XP4 A;  5DIV A;  2FAP A;  3PA7 A;  4J4N A;  1Q6H A;  3O5J A;  4DRQ A;  4DIP A;  2F21 A;  2LKN A;  4IPX A;  2KGJ A;  3NTP A;  2KI3 A;  4DRN A;  1C9H A;  5HW6 A;  2RUD A;  1J4R A;  3JXV A;  1J4I A;  3KAF A;  3KAH A;  2LJ4 A;  2ITK A;  3RGC A;  5HT1 A;  4DRK A;  1J6Y A;  3O5E A;  1J4H A;  1L1P A;  1F8A B;  1D7J A;  1JNS A;  1QPL A;  1BL4 A;  2PPN A;  1Q6I A;  2Y78 A;  1U79 A;  4DRM A;  4DRO A;  3KZ7 A;  1NSG A;  1ROT A;  3O5F A;  1JVW A;  2XP3 A;  1NMV A;  1YW5 A;  3FAP A;  4W9Q A;  3EY6 A;  4ODO A;  1R9H A;  3WH0 A;  1JNT A;  5HWB A;  1YAT A;  3O5I A;  4JFM A;  2MPH A;  2RUR A;  4TW8 A;  2KE0 A;  4QT3 A;  3I6C A;  3JYJ A;  4U84 A;  4JFK A;  2XP6 A;  2XPB A;  4NNR A;  3UI4 A;  2PPP A;  3JYM A;  3KAC A;  1NMW A;  3O5K A;  5D75 A;  4DRJ A;  5HW8 A;  2ZQT A;  2F2D A;  3IK8 A;  1KT1 A;  4O2T A;  3KAG A;  2LPV A;  2RUQ A;  2RUC A;  3UI6 A;  4JYS A;  1FKR A;  2XPA A; 
#chains in the Genus database with same CATH topology
 4Z2K A;  2DPE A;  4FAP A;  2ZR6 A;  3WD4 A;  4JFL A;  4DRP A;  3UQB A;  1WAW A;  3AQU A;  5HBF A;  2F23 A;  1JND A;  3W4R A;  2WLY A;  5BXJ A;  1SR0 A;  1T11 A;  4GIV A;  1FKG A;  2M1I A;  4TX0 A;  1B6C A;  3WD1 A;  2PBC A;  2DT0 A;  1FKB A;  4IQ2 A;  3O5P A;  4IT6 A;  1W1T A;  4LAX A;  1HJX A;  3OOB A;  1FKJ A;  3IHZ A;  4IT4 A;  1LQ0 A;  2DG3 A;  3PR9 A;  2Q5A A;  2UZ5 A;  4W9O A;  4LAW A;  3O5O A;  2VN1 A;  3WD2 A;  3AS0 A;  4ODL A;  4DRI A;  4ITZ A;  4MNJ A;  4DZ2 A;  1F40 A;  3B9D A;  1FFR A;  3LUO A;  4NSB A;  4DT4 A;  1Q6U A;  1D6O A;  4ZS6 A;  1TFV A;  2XP5 A;  2RSE A;  1ZL1 A;  3ODK A;  3RFW A;  3TC5 A;  4DRH A;  4LAV A;  1PBK A;  2FDM A;  2ETN A;  4MGV A;  4Q22 A;  1E6N A;  1HKK A;  1ZBC A;  2IF4 A;  1D2K A;  4J4N A;  2A3B A;  3O5J A;  3ARW A;  4DRN A;  2KGJ A;  1J4R A;  3JXV A;  3FXY A;  4WKA A;  3KAH A;  2LJ4 A;  4DRK A;  3WIJ A;  1O6I A;  1L1P A;  1W1P A;  1EIB A;  4DRM A;  1UR8 A;  1NSG A;  1ROT A;  1JVW A;  1YW5 A;  3RM4 A;  3FAP A;  4XAK A;  3FY1 A;  4ODO A;  1XRV A;  1YAT A;  4MAV A;  1ZBV A;  1KFW A;  2KE0 A;  1X6N A;  3JYJ A;  4U84 A;  4JFK A;  2XP6 A;  2PI6 A;  4Z2J A;  2PPP A;  3KAC A;  3CHE A;  5D75 A;  3B9A A;  4Q7N A;  2ZQT A;  1EHN A;  2LPV A;  3G6L A;  1FKR A;  4TNS A;  1GUV A;  3KAD A;  1FD9 A;  2M08 A;  2DSV A;  2PV3 A;  3NRK A;  4HBE A;  3MDY B;  2AOS A;  4PTM A;  2K8I A;  1FKD A;  4DZ3 A;  3NI6 A;  3BMB A;  1OWQ A;  3O5G A;  4NZC A;  4IQC A;  5HKG A;  2F4E A;  1IX5 A;  1BKF A;  3O5D A;  2DG4 A;  2A3E A;  4HAR A;  2WK2 A;  4S3K A;  1E6R A;  4WKH A;  4W9P A;  4J4O A;  1W9P A;  1Y0O A;  5GQB A;  3ARY A;  5DIT A;  3B8S A;  4C02 B;  4U86 A;  1NWT A;  1FAP A;  3O5M A;  4FN2 A;  4QT2 A;  1E6Z A;  4Z2H A;  1SYT A;  3KCE A;  1CTN A;  4JFI A;  4MTV A;  3ARU A;  1ROU A;  4G50 A;  5HWC A;  3UI5 A;  1WNO A;  3OA5 A;  3ARQ A;  2XP7 A;  1NWU A;  3ARO A;  2DG9 A;  3CGM A;  3PRD A;  3WD0 A;  1KT0 A;  1FFQ A;  2VCD A;  2ZQV A;  1Q1C A;  2MLZ A;  4N19 A;  1PIN A;  1NWR A;  1OGB A;  1HXV A;  2XP4 A;  4IPX A;  3NTP A;  2DT3 A;  3WQV A;  4ZPW R;  3KAF A;  2ITK A;  2EUL A;  3RGC A;  1W9U A;  5HT1 A;  1HJV A;  1J6Y A;  3O5E A;  1J4H A;  2DSW A;  3EIP A;  2Y78 A;  5DEZ A;  1RD6 A;  3B9E A;  1EDQ A;  1HKI A;  2XP3 A;  1R9H A;  3WH0 A;  1JNT A;  1H0I A;  3O5I A;  4JFM A;  1LL7 A;  4HBO A;  4QT3 A;  3AS3 A;  4NNR A;  4P8X A;  2WLZ A;  4O2T A;  4AY1 A;  1FKF A;  2QF8 A;  4QZV B;  1E6P A;  3UF8 A;  4Z2I A;  1LJY A;  2KR7 A;  1WB0 A;  2B31 A;  3ARS A;  1HKM A;  3KAB A;  1M5Y A;  5HUA A;  1FKT A;  2KO7 A;  2MF9 A;  3RM8 A;  1H0G A;  4DWS D;  1K9T A;  5DIU A;  1FJD A;  2P4V A;  3CHD A;  3GU0 A;  2OFN A;  2WM0 A;  2ZR4 A;  3PRA A;  1ITX A;  2XP8 A;  4KR0 B;  2XP9 A;  4R0X A;  2DSZ A;  5HW7 A;  5J6E A;  3CGN A;  3O5Q A;  1OGG A;  4R5E A;  2G8Z A;  4MPK A;  4QIB A;  3RM9 A;  3B7X A;  1JNE A;  1ZBW A;  4BF8 A;  2KFW A;  4WIW A;  1W1Y A;  3ALG A;  1W26 A;  3KAI A;  4TW6 A;  3CH9 A;  1FKH A;  1UR9 A;  2DT2 A;  3GTY X;  5HTG A;  1FKL A;  1W9V A;  4LGX A;  1ZCN A;  2LGO A;  2ZQU A;  2M2A A;  4Z2L A;  1HJW A;  4ML4 A;  1D7I A;  2L2S A;  3WKZ A;  1EYM A;  3CHF A;  5DO2 A;  1ZU8 A;  2MLX A;  1TCO C;  2IUZ A;  4WK9 A;  4ODM A;  1LG1 A;  2G41 A;  3UQA A;  4L3N A;  3GPK A;  2ZR5 A;  4LAY A;  2O92 A;  1D7H A;  4ZPV R;  2D9F A;  2PV1 A;  4MSP A;  4MNL A;  3VAW A;  1FKI A;  1ZK6 A;  2MNT A;  2MLY A;  1Q6H A;  4DIP A;  2LKN A;  4W5U A;  2KI3 A;  2RUD A;  1D7J A;  1JNS A;  1QPL A;  2B5U B;  1BL4 A;  1Q6I A;  1E9L A;  4DRO A;  3O5F A;  4WKF A;  4WJX A;  5DF0 A;  4W9Q A;  3EY6 A;  5HWB A;  1NWS A;  5JH8 A;  2A3A A;  3O5K A;  4MNM A;  4DWS B;  3ART A;  1E15 A;  2F2D A;  1KT1 A;  2A3C A;  2RUC A;  4JYS A;  4MNK A;  4ZPT R;  4JFJ A;  1LL4 A;  4KQZ A;  4UDM A;  3ARX A;  1GOI A;  2ZQS A;  4ODN A;  2JZV A;  3H9R B;  3TCZ A;  3WQW A;  3PRB A;  3IKD A;  3TDB A;  2PV2 A;  4ODR A;  1GPF A;  2OLH A;  5GPR A;  4ODP A;  1FKK A;  1E44 A;  4DH0 A;  4L72 B;  4ODQ A;  4ODK A;  3WL1 A;  2AWG A;  3CZ8 A;  1JCH B;  1NH6 A;  5I98 A;  3O5R A;  1A7X A;  5GPG A;  1GRJ A;  3G6M A;  4P8W A;  4DWS C;  4P8U A;  4URI A;  4DWS A;  2PPO A;  4G2P A;  3BXW A;  1VF8 A;  3ARR A;  3IKG A;  4GGQ A;  1HKJ A;  1ZBK A;  5B8I C;  1X6L A;  3O5L A;  4TYO A;  3UQI A;  4TW7 A;  1P5Q A;  1QZ2 A;  1EQ3 A;  2FKE A;  3AS2 A;  1QPF A;  3RME A;  1W1V A;  3ALF A;  1N1A A;  3AS1 A;  3WL0 A;  3ARZ A;  1FKS A;  2YBU A;  1LL6 A;  2RQS A;  4U85 A;  2N87 A;  2O9O A;  5DIV A;  4DRQ A;  4S3J A;  2FAP A;  3PA7 A;  2F21 A;  5HW6 A;  1C9H A;  1J4I A;  2ESC A;  2DT1 A;  1F8A B;  1ZB5 A;  2PPN A;  1U79 A;  3KZ7 A;  3QOK A;  2DSU A;  4Z2G A;  1NMV A;  1XHG A;  4P8V A;  3ARP A;  2MPH A;  3CHC A;  2RUR A;  2YBT A;  4TW8 A;  3I6C A;  2XPB A;  3UI4 A;  3JYM A;  4DRJ A;  1NMW A;  3WD3 A;  5HW8 A;  3IK8 A;  3KAG A;  3ARV A;  3UI6 A;  2RUQ A;  2PN0 A;  1LG2 A;  2XPA A; 
#chains in the Genus database with same CATH homology
 4Z2K A;  2DPE A;  4FAP A;  2ZR6 A;  3WD4 A;  4JFL A;  4DRP A;  3UQB A;  1WAW A;  3AQU A;  5HBF A;  1JND A;  3W4R A;  2WLY A;  5BXJ A;  1SR0 A;  1T11 A;  4GIV A;  1FKG A;  2M1I A;  4TX0 A;  1B6C A;  3WD1 A;  2PBC A;  2DT0 A;  1FKB A;  4IQ2 A;  3O5P A;  4IT6 A;  1W1T A;  4LAX A;  1HJX A;  3OOB A;  1FKJ A;  3IHZ A;  4IT4 A;  1LQ0 A;  2DG3 A;  3PR9 A;  2Q5A A;  2UZ5 A;  4W9O A;  4LAW A;  3O5O A;  2VN1 A;  3WD2 A;  3AS0 A;  4ODL A;  4DRI A;  4ITZ A;  4MNJ A;  4DZ2 A;  1F40 A;  3B9D A;  1FFR A;  3LUO A;  4NSB A;  4DT4 A;  1Q6U A;  1D6O A;  4ZS6 A;  1TFV A;  2XP5 A;  2RSE A;  1ZL1 A;  3ODK A;  3RFW A;  3TC5 A;  4DRH A;  4LAV A;  1PBK A;  2FDM A;  4MGV A;  4Q22 A;  1E6N A;  1HKK A;  1ZBC A;  2IF4 A;  1D2K A;  4J4N A;  2A3B A;  3O5J A;  3ARW A;  4DRN A;  2KGJ A;  1J4R A;  3JXV A;  3FXY A;  4WKA A;  3KAH A;  2LJ4 A;  4DRK A;  3WIJ A;  1O6I A;  1L1P A;  1W1P A;  1EIB A;  4DRM A;  1UR8 A;  1NSG A;  1ROT A;  1JVW A;  1YW5 A;  3RM4 A;  3FAP A;  4XAK A;  3FY1 A;  4ODO A;  1XRV A;  1YAT A;  4MAV A;  1ZBV A;  1KFW A;  2KE0 A;  1X6N A;  3JYJ A;  4U84 A;  4JFK A;  2XP6 A;  2PI6 A;  4Z2J A;  2PPP A;  3KAC A;  3CHE A;  5D75 A;  3B9A A;  4Q7N A;  2ZQT A;  1EHN A;  2LPV A;  3G6L A;  1FKR A;  4TNS A;  1GUV A;  3KAD A;  1FD9 A;  2M08 A;  2DSV A;  2PV3 A;  3NRK A;  4HBE A;  3MDY B;  2AOS A;  4PTM A;  2K8I A;  1FKD A;  4DZ3 A;  3NI6 A;  1OWQ A;  3O5G A;  4NZC A;  4IQC A;  5HKG A;  2F4E A;  1IX5 A;  1BKF A;  3O5D A;  2DG4 A;  2A3E A;  4HAR A;  2WK2 A;  4S3K A;  1E6R A;  4WKH A;  4W9P A;  4J4O A;  1W9P A;  1Y0O A;  5GQB A;  3ARY A;  5DIT A;  3B8S A;  4C02 B;  4U86 A;  1NWT A;  1FAP A;  3O5M A;  4FN2 A;  4QT2 A;  1E6Z A;  4Z2H A;  1SYT A;  3KCE A;  1CTN A;  4JFI A;  4MTV A;  3ARU A;  1ROU A;  4G50 A;  5HWC A;  3UI5 A;  1WNO A;  3OA5 A;  3ARQ A;  2XP7 A;  1NWU A;  3ARO A;  2DG9 A;  3CGM A;  3PRD A;  3WD0 A;  1KT0 A;  1FFQ A;  2VCD A;  2ZQV A;  1Q1C A;  2MLZ A;  4N19 A;  1PIN A;  1NWR A;  1OGB A;  1HXV A;  2XP4 A;  4IPX A;  3NTP A;  2DT3 A;  3WQV A;  4ZPW R;  3KAF A;  2ITK A;  3RGC A;  1W9U A;  5HT1 A;  1HJV A;  1J6Y A;  3O5E A;  1J4H A;  2DSW A;  2Y78 A;  5DEZ A;  1RD6 A;  3B9E A;  1EDQ A;  1HKI A;  2XP3 A;  1R9H A;  3WH0 A;  1JNT A;  1H0I A;  3O5I A;  4JFM A;  1LL7 A;  4HBO A;  4QT3 A;  3AS3 A;  4NNR A;  4P8X A;  2WLZ A;  4O2T A;  4AY1 A;  1FKF A;  2QF8 A;  4QZV B;  1E6P A;  3UF8 A;  4Z2I A;  1LJY A;  2KR7 A;  1WB0 A;  2B31 A;  3ARS A;  1HKM A;  3KAB A;  1M5Y A;  5HUA A;  1FKT A;  2KO7 A;  2MF9 A;  3RM8 A;  1H0G A;  4DWS D;  1K9T A;  5DIU A;  1FJD A;  3CHD A;  2OFN A;  2WM0 A;  2ZR4 A;  3PRA A;  1ITX A;  2XP8 A;  4KR0 B;  2XP9 A;  4R0X A;  2DSZ A;  5HW7 A;  5J6E A;  3CGN A;  3O5Q A;  1OGG A;  4R5E A;  2G8Z A;  4MPK A;  4QIB A;  3RM9 A;  3B7X A;  1JNE A;  1ZBW A;  4BF8 A;  2KFW A;  4WIW A;  1W1Y A;  3ALG A;  1W26 A;  3KAI A;  4TW6 A;  3CH9 A;  1FKH A;  1UR9 A;  2DT2 A;  5HTG A;  1FKL A;  1W9V A;  4LGX A;  1ZCN A;  2LGO A;  2ZQU A;  2M2A A;  4Z2L A;  1HJW A;  4ML4 A;  1D7I A;  2L2S A;  3WKZ A;  1EYM A;  3CHF A;  5DO2 A;  1ZU8 A;  2MLX A;  1TCO C;  2IUZ A;  4WK9 A;  4ODM A;  1LG1 A;  2G41 A;  3UQA A;  4L3N A;  3GPK A;  2ZR5 A;  4LAY A;  2O92 A;  1D7H A;  4ZPV R;  2D9F A;  2PV1 A;  4MSP A;  4MNL A;  3VAW A;  1FKI A;  1ZK6 A;  2MNT A;  2MLY A;  1Q6H A;  4DIP A;  2LKN A;  4W5U A;  2KI3 A;  2RUD A;  1D7J A;  1JNS A;  1QPL A;  1BL4 A;  1Q6I A;  1E9L A;  4DRO A;  3O5F A;  4WKF A;  4WJX A;  5DF0 A;  4W9Q A;  3EY6 A;  5HWB A;  1NWS A;  5JH8 A;  2A3A A;  3O5K A;  4MNM A;  4DWS B;  3ART A;  1E15 A;  2F2D A;  1KT1 A;  2A3C A;  2RUC A;  4JYS A;  4MNK A;  4ZPT R;  4JFJ A;  1LL4 A;  4KQZ A;  3ARX A;  1GOI A;  2ZQS A;  4ODN A;  2JZV A;  3H9R B;  3TCZ A;  3WQW A;  3PRB A;  3IKD A;  3TDB A;  2PV2 A;  4ODR A;  1GPF A;  2OLH A;  5GPR A;  4ODP A;  1FKK A;  4DH0 A;  4L72 B;  4ODQ A;  4ODK A;  3WL1 A;  2AWG A;  3CZ8 A;  1NH6 A;  5I98 A;  3O5R A;  1A7X A;  5GPG A;  3G6M A;  4P8W A;  4DWS C;  4P8U A;  4URI A;  4DWS A;  2PPO A;  4G2P A;  3BXW A;  1VF8 A;  3ARR A;  3IKG A;  4GGQ A;  1HKJ A;  1ZBK A;  5B8I C;  1X6L A;  3O5L A;  4TYO A;  3UQI A;  4TW7 A;  1P5Q A;  1QZ2 A;  1EQ3 A;  2FKE A;  3AS2 A;  1QPF A;  3RME A;  1W1V A;  3ALF A;  1N1A A;  3AS1 A;  3WL0 A;  3ARZ A;  1FKS A;  2YBU A;  1LL6 A;  2RQS A;  4U85 A;  2N87 A;  2O9O A;  5DIV A;  4DRQ A;  4S3J A;  2FAP A;  3PA7 A;  2F21 A;  5HW6 A;  1C9H A;  1J4I A;  2ESC A;  2DT1 A;  1F8A B;  1ZB5 A;  2PPN A;  1U79 A;  3KZ7 A;  3QOK A;  2DSU A;  4Z2G A;  1NMV A;  1XHG A;  4P8V A;  3ARP A;  2MPH A;  3CHC A;  2RUR A;  2YBT A;  4TW8 A;  3I6C A;  2XPB A;  3UI4 A;  3JYM A;  4DRJ A;  1NMW A;  3WD3 A;  5HW8 A;  3IK8 A;  3KAG A;  3ARV A;  3UI6 A;  2RUQ A;  1LG2 A;  2XPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...