2VN1A

Crystal structure of the fk506-binding domain of plasmodium falciparum fkbp35 in complex with fk506
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
123
structure length
123
Chain Sequence
FEKVELTADGGVIKTILKKGDEGEENIPKKGNEVTVHYVGKLESTGKVFDSSFDRNVPFKFHLEQGEVIKGWDICVSSMRKNEKCLVRIESMYGYGDEGCGESIPGNSVLLFEIELLSFRELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords 70 KDA PEPTIDYLPROLYL ISOMERASE
publication title Crystal Structure of the Fk506 Binding Domain of Plasmodium Falciparum Fkbp35 in Complex with Fk506.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 31
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2vn1A01
4W9OA 3UI6A 2M1IA 4QIBA 3EY6A 4JFLA 2LKNA 4DRKA 1FKBA 5HUAA 1TCOC 1FKFA 3TDBA 4ODKA 2MLYA 1FKGA 2KFWA 2XP7A 3PRDA 2ZR5A 4IPXA 1NSGA 4MSPA 3MDYB 3NRKA 4QT2A 3NI6A 4LAVA 4JFMA 1FKLA 1J4HA 1QPFA 3IKGA 3KADA 4LAYA 1R9HA 3UF8A 2Q5AA 1NMVA 5BXJA 1D7HA 2N87A 2F21A 1J6YA 1Q6HA 1HXVA 4JFIA 2ZQVA 2PV3A 3KABA 2ITKA 2PPPA 1FKDA 1F8AB 4DRMA 1FAPA 1FD9A 1YW5A 3KCEA 1EQ3A 1JNTA 4TNSA 4ODOA 3O5QA 2KR7A 2PV1A 3IKDA 3KACA 3KAIA 2D9FA 2XP9A 1Q1CA 3O5DA 3CGMA 3O5PA 4DIPA 4DROA 2RSEA 3JYMA 3IHZA 2Y78A 3NTPA 2RURA 2FAPA 4W9QA 4ITZA 4DT4A 1JVWA 3O5FA 1D7IA 2XPBA 4DRPA 1W26A 2KE0A 4JFKA 3CGNA 5D75A 4DZ3A 1KT0A 1FKSA 1PBKA 1P5QA 1A7XA 4W9PA 1J4RA 3PRBA 1BKFA 4DH0A 1L1PA 3B7XA 3IK8A 4LAXA 2LJ4A 4DRQA 1N1AA 4TW6A 1ROTA 2M2AA 2XP6A 5DIVA 2FKEA 4NNRA 5GPGA 1D7JA 3TCZA 1FJDA 2UZ5A 4IQ2A 2RUQA 2MNTA 2XP3A 1FKKA 4GIVA 5J6EA 1ROUA 4JFJA 2LPVA 3RFWA 3KZ7A 2DG3A 3JXVA 3ODKA 1QZ2A 1U79A 4ODPA 5HW6A 1ZK6A 4ODRA 1M5YA 5I98A 1ZCNA 3O5GA 2MLXA 1C9HA 1NMWA 1Q6IA 4ODMA 1Q6UA 4O2TA 1YATA 4ODLA 3KAHA 3JYJA 3UI5A 2RUDA 3KAFA 1J4IA 3O5EA 2PV2A 2KGJA 4ODQA 4DRHA 4R0XA 4BF8A 4MGVA 2PPOA 4DRIA 2MF9A 4DZ2A 5HWBA 3PA7A 1PINA 2M08A 1FKJA 5HTGA 1KT1A 2ZQTA 3O5IA 3LUOA 4TW8A 4IQCA 1FKTA 2IF4A 3O5OA 2RUCA 2XP5A 2KO7A 5DIUA 5DITA 3UI4A 5HWCA 3UQBA 3O5MA 1F40A 2RQSA 1B6CA 4G2PA 4DRJA 4C02B 1EYMA 1T11A 2VN1A 4U86A 2L2SA 3VAWA 3O5KA 4U84A 1FKHA 2LGOA 3OOBA 4JYSA 3KAGA 2MPHA 4G50A 3TC5A 1D6OA 1QPLA 2MLZA 2ZQUA 2KI3A 4J4OA 3O5LA 1FKRA 2PBCA 4ODNA 2DG4A 2OFNA 3UQIA 4DRNA 2ZR4A 2AWGA 2ZR6A 4LAWA 2F2DA 1Y0OA 3H9RB 2K8IA 3O5JA 3RGCA 3WH0A 1FKIA 1JNSA 3FAPA 2F4EA 2PPNA 5HW8A 2XP4A 2ZQSA 2XPAA 3O5RA 3GPKA 2DG9A 5B8IC 2VCDA 4FAPA 3UQAA 4TYOA 2JZVA 4FN2A 4GGQA 4QT3A 5HKGA 4TX0A 5HT1A 1BL4A 2XP8A 3I6CA 4N19A 4J4NA 4U85A 5HW7A 4TW7A
chains in the Genus database with same CATH superfamily
4W9OA 1D2KA 4NSBA 1JNEA 4ZPTR 1FKBA 1FKFA 3FXYA 4MSPA 3MDYB 2ETNA 1H0GA 3IKGA 1LJYA 3KADA 1R9HA 2Q5AA 2N87A 2F21A 4P8UA 1Q6HA 1NWUA 1EQ3A 2DT2A 4TNSA 2DT0A 4ODOA 3O5QA 2PV1A 3AQUA 3IKDA 5DO2A 3JYMA 2RURA 4W9QA 2YBTA 3GTYX 1CTNA 3ARZA 2P4VA 3CHFA 1SR0A 5D75A 1KT0A 3ARRA 1J4RA 3PRBA 4IT6A 5GQBA 4LAXA 4P8VA 3WQWA 1N1AA 2A3EA 1FFRA 3WL1A 1FJDA 1LL4A 2RUQA 2A3BA 1FKKA 4JFJA 2LPVA 1QZ2A 4ODRA 1XHGA 1M5YA 2MLXA 4ODMA 4P8WA 4ZPWR 3UI5A 2RUDA 1E6PA 1ZL1A 4DZ2A 2PPOA 2MF9A 2DSVA 3ARQA 4MNJA 3ARXA 1ZBWA 1JCHB 1GRJA 3LUOA 3O5OA 2RUCA 4Z2LA 5HWCA 3O5MA 2RQSA 4G2PA 1LL6A 1EYMA 1T11A 4U86A 1KFWA 1H0IA 2ESCA 2MLZA 2KI3A 1UR8A 4W5UA 1SYTA 1OGGA 2PBCA 3UQIA 2OFNA 4XAKA 2FDMA 2F2DA 2K8IA 3WH0A 1NH6A 3ARVA 4NZCA 1ITXA 3GPKA 3WD1A 4TYOA 3WD2A 2B5UB 2OLHA 4S3KA 3PR9A 5HT1A 2YBUA 2AOSA 2XP8A 4MPKA 2A3CA 1ZBCA 1HKKA 1UR9A 2DT1A 2XP7A 1O6IA 4Z2JA 1J4HA 1QPFA 4LAYA 3G6MA 1NMVA 4AY1A 1HXVA 4JFIA 2PV3A 3KABA 1ZBVA 2PPPA 4Q7NA 4DRMA 1JNTA 2KR7A 2D9FA 2XP9A 1Q1CA 3O5PA 4IT4A 3IHZA 3NTPA 3O5FA 2XPBA 3G6LA 4LGXA 4DRPA 1W26A 4URIA 4JFKA 1FKSA 1PBKA 1A7XA 4DH0A 1L1PA 3B7XA 1WB0A 3B8SA 2M2AA 2FKEA 4NNRA 2XP3A 4GIVA 4MTVA 1ROUA 1E44A 2DSWA 4DWSC 3ODKA 4ODPA 2EULA 3AS1A 3O5GA 1YATA 4ODLA 3JYJA 3KAFA 1W1YA 1OWQA 1WNOA 4MGVA 2WLYA 1PINA 1FKJA 5HTGA 2DSUA 1KT1A 4WJXA 2QF8A 2WM0A 3O5IA 4IQCA 2O9OA 3FY1A 4R5EA 2L2SA 3VAWA 3O5KA 1FKHA 1HJWA 3KAGA 4WIWA 2MPHA 4L3NA 3TC5A 1QPLA 2ZQUA 4J4OA 4HBOA 3WKZA 4WK9A 1E6NA 2ZR4A 2AWGA 2ZR6A 3H9RB 1FKIA 2G41A 3B9EA 3O5RA 4FAPA 3UQAA 1IX5A 4FN2A 3RM9A 4N19A 2F23A 1W1VA 4U85A 4TW7A 5HW7A 4DRKA 1HJVA 4ODKA 1XRVA 1FKGA 2KFWA 3PRDA 4Z2KA 4IPXA 4QT2A 1NSGA 5HW6A 1EDQA 3WD0A 4WKAA 3WL0A 3ALGA 4JFMA 3GU0A 1J6YA 2O92A 1E15A 1W9PA 1FKDA 1FAPA 1YW5A 4MNKA 3ARSA 3CGMA 2PI6A 4KQZA 3OA5A 2KE0A 3CGNA 4DZ3A 1WAWA 3AS2A 2LJ4A 4DRQA 4TW6A 1ROTA 2XP6A 5GPGA 1D7JA 3TCZA 4IQ2A 2MNTA 2DT3A 3RFWA 3JXVA 1HKJA 1X6NA 3ARTA 1E6ZA 1C9HA 1NMWA 1GPFA 1Q6IA 4O2TA 3KAHA 1W1TA 1J4IA 1LL7A 3CHEA 4ZS6A 3O5EA 3WQVA 2KGJA 5I98A 4R0XA 4BF8A 4DRIA 3PA7A 1E6RA 2M08A 3AS0A 1TFVA 4HARA 4DWSB 5GPRA 5DIUA 3UI4A 4DRJA 4C02B 1LG2A 2LGOA 4JYSA 3ARPA 3O5LA 3B9AA 1W9UA 3BXWA 2A3AA 3AS3A 4ODNA 2DG4A 4DRNA 3BMBA 1VF8A 1NWTA 3FAPA 2F4EA 2PPNA 1OGBA 2XP4A 2ZQSA 3CHCA 4L72B 2DG9A 5HKGA 3CHDA 1W1PA 1BL4A 1ZBKA 3I6CA 3UI6A 2M1IA 4QIBA 3WD4A 3B9DA 3EY6A 2G8ZA 2LKNA 4JFLA 3RM8A 5HUAA 1TCOC 1GOIA 3TDBA 2MLYA 4S3JA 2ZR5A 4MNLA 3NRKA 1HJXA 3NI6A 4LAVA 1ZB5A 4ZPVR 1FKLA 5HBFA 3UF8A 5BXJA 1D7HA 3ARYA 1HKMA 2ZQVA 2ITKA 4UDMA 1NWSA 1F8AB 1FD9A 3KCEA 2IUZA 1LG1A 1E9LA 3KAIA 3KACA 4DWSA 3O5DA 4DIPA 4DROA 2RSEA 2Y78A 2FAPA 1RD6A 4ITZA 4DT4A 1JVWA 1D7IA 4MAVA 1P5QA 3WIJA 4W9PA 1BKFA 3IK8A 4DWSD 5DIVA 5DF0A 2UZ5A 5J6EA 2WLZA 3KZ7A 3QOKA 2DG3A 3ARUA 1U79A 1ZK6A 1ZCNA 3ARWA 3RMEA 2B31A 4WKFA 1Q6UA 3W4RA 3PRAA 1HKIA 4ML4A 1FFQA 2PV2A 4ODQA 4DRHA 5HWBA 1JNSA 4Q22A 4WKHA 3WD3A 2WK2A 4KR0B 2ZQTA 1JNDA 3CZ8A 4TW8A 1FKTA 2IF4A 2XP5A 2KO7A 1ZU8A 4Z2GA 2PN0A 5DITA 3UQBA 1EIBA 1F40A 4Z2HA 1B6CA 2DSZA 3ALFA 3AROA 2VN1A 4U84A 3OOBA 3EIPA 4P8XA 4HBEA 4G50A 1D6OA 1X6LA 5JH8A 2DPEA 3RM4A 1FKRA 4MNMA 4Z2IA 4PTMA 4LAWA 3O5JA 1Y0OA 1GUVA 3RGCA 1EHNA 5HW8A 4QZVB 1K9TA 2XPAA 5B8IC 3CH9A 2VCDA 5DEZA 1W9VA 2JZVA 4GGQA 4QT3A 1LQ0A 4TX0A 4J4NA 1NWRA
chains in the Genus database with same CATH topology
4W9OA 1D2KA 4NSBA 1JNEA 4ZPTR 1FKBA 1FKFA 3FXYA 4MSPA 3MDYB 1H0GA 3IKGA 1LJYA 3KADA 1R9HA 2Q5AA 2N87A 2F21A 4P8UA 1Q6HA 1NWUA 1EQ3A 2DT2A 4TNSA 2DT0A 4ODOA 3O5QA 2PV1A 3AQUA 3IKDA 5DO2A 3JYMA 2RURA 4W9QA 2YBTA 1CTNA 3ARZA 3CHFA 1SR0A 5D75A 1KT0A 3ARRA 1J4RA 3PRBA 4IT6A 5GQBA 4LAXA 4P8VA 3WQWA 1N1AA 2A3EA 1FFRA 3WL1A 1FJDA 1LL4A 2RUQA 2A3BA 1FKKA 4JFJA 2LPVA 1QZ2A 4ODRA 1XHGA 1M5YA 2MLXA 4ODMA 4P8WA 4ZPWR 3UI5A 2RUDA 1E6PA 1ZL1A 4DZ2A 2PPOA 2MF9A 2DSVA 3ARQA 4MNJA 3ARXA 1ZBWA 3LUOA 3O5OA 2RUCA 4Z2LA 5HWCA 3O5MA 2RQSA 4G2PA 1LL6A 1EYMA 1T11A 4U86A 1KFWA 1H0IA 2ESCA 2MLZA 2KI3A 1UR8A 4W5UA 1SYTA 1OGGA 2PBCA 3UQIA 2OFNA 4XAKA 2FDMA 2F2DA 2K8IA 3WH0A 1NH6A 3ARVA 4NZCA 1ITXA 3GPKA 3WD1A 4TYOA 3WD2A 2OLHA 4S3KA 3PR9A 5HT1A 2YBUA 2AOSA 2XP8A 4MPKA 2A3CA 1ZBCA 1HKKA 1UR9A 2DT1A 2XP7A 1O6IA 4Z2JA 1J4HA 1QPFA 4LAYA 3G6MA 1NMVA 4AY1A 1HXVA 4JFIA 2PV3A 3KABA 1ZBVA 2PPPA 4Q7NA 4DRMA 1JNTA 2KR7A 2D9FA 2XP9A 1Q1CA 3O5PA 4IT4A 3IHZA 3NTPA 3O5FA 2XPBA 3G6LA 4LGXA 4DRPA 1W26A 4URIA 4JFKA 1FKSA 1PBKA 1A7XA 4DH0A 1L1PA 3B7XA 1WB0A 3B8SA 2M2AA 2FKEA 4NNRA 2XP3A 4GIVA 4MTVA 1ROUA 2DSWA 4DWSC 3ODKA 4ODPA 3AS1A 3O5GA 1YATA 4ODLA 3JYJA 3KAFA 1W1YA 1OWQA 1WNOA 4MGVA 2WLYA 1PINA 1FKJA 5HTGA 2DSUA 1KT1A 4WJXA 2QF8A 2WM0A 3O5IA 4IQCA 2O9OA 3FY1A 4R5EA 2L2SA 3VAWA 3O5KA 1FKHA 1HJWA 3KAGA 4WIWA 2MPHA 4L3NA 3TC5A 1QPLA 2ZQUA 4J4OA 4HBOA 3WKZA 4WK9A 1E6NA 2ZR4A 2AWGA 2ZR6A 3H9RB 1FKIA 2G41A 3B9EA 3O5RA 4FAPA 3UQAA 1IX5A 4FN2A 3RM9A 4N19A 1W1VA 4U85A 5HW7A 4TW7A 4DRKA 1HJVA 4ODKA 1XRVA 1FKGA 2KFWA 3PRDA 4Z2KA 4IPXA 4QT2A 1NSGA 5HW6A 1EDQA 3WD0A 4WKAA 3WL0A 3ALGA 4JFMA 1J6YA 2O92A 1E15A 1W9PA 1FKDA 1FAPA 1YW5A 4MNKA 3ARSA 3CGMA 2PI6A 4KQZA 3OA5A 2KE0A 3CGNA 4DZ3A 1WAWA 3AS2A 2LJ4A 4DRQA 4TW6A 1ROTA 2XP6A 5GPGA 1D7JA 3TCZA 4IQ2A 2MNTA 2DT3A 3RFWA 3JXVA 1HKJA 1X6NA 3ARTA 1E6ZA 1C9HA 1NMWA 1GPFA 1Q6IA 4O2TA 3KAHA 1W1TA 1J4IA 1LL7A 3CHEA 4ZS6A 3O5EA 3WQVA 2KGJA 5I98A 4R0XA 4BF8A 4DRIA 3PA7A 1E6RA 2M08A 3AS0A 1TFVA 4HARA 4DWSB 5GPRA 5DIUA 3UI4A 4DRJA 4C02B 1LG2A 2LGOA 4JYSA 3ARPA 3O5LA 3B9AA 1W9UA 3BXWA 2A3AA 3AS3A 4ODNA 2DG4A 4DRNA 1VF8A 1NWTA 3FAPA 2F4EA 2PPNA 1OGBA 2XP4A 2ZQSA 3CHCA 4L72B 2DG9A 5HKGA 3CHDA 1W1PA 1BL4A 1ZBKA 3I6CA 3UI6A 2M1IA 4QIBA 3WD4A 3B9DA 3EY6A 2G8ZA 2LKNA 4JFLA 3RM8A 5HUAA 1TCOC 1GOIA 3TDBA 2MLYA 4S3JA 2ZR5A 4MNLA 3NRKA 1HJXA 3NI6A 4LAVA 1ZB5A 4ZPVR 1FKLA 5HBFA 3UF8A 5BXJA 1D7HA 3ARYA 1HKMA 2ZQVA 2ITKA 1NWSA 1F8AB 1FD9A 3KCEA 2IUZA 1LG1A 1E9LA 3KAIA 3KACA 4DWSA 3O5DA 4DIPA 4DROA 2RSEA 2Y78A 2FAPA 1RD6A 4ITZA 4DT4A 1JVWA 1D7IA 4MAVA 1P5QA 3WIJA 4W9PA 1BKFA 3IK8A 4DWSD 5DIVA 5DF0A 2UZ5A 5J6EA 2WLZA 3KZ7A 3QOKA 2DG3A 3ARUA 1U79A 1ZK6A 1ZCNA 3ARWA 3RMEA 2B31A 4WKFA 1Q6UA 3W4RA 3PRAA 1HKIA 4ML4A 1FFQA 2PV2A 4ODQA 4DRHA 5HWBA 1JNSA 4Q22A 4WKHA 3WD3A 2WK2A 4KR0B 2ZQTA 1JNDA 3CZ8A 4TW8A 1FKTA 2IF4A 2XP5A 2KO7A 1ZU8A 4Z2GA 5DITA 3UQBA 1EIBA 1F40A 4Z2HA 1B6CA 2DSZA 3ALFA 3AROA 2VN1A 4U84A 3OOBA 4P8XA 4HBEA 4G50A 1D6OA 1X6LA 5JH8A 2DPEA 3RM4A 1FKRA 4MNMA 4Z2IA 4PTMA 4LAWA 3O5JA 1Y0OA 1GUVA 3RGCA 1EHNA 5HW8A 4QZVB 1K9TA 2XPAA 5B8IC 3CH9A 2VCDA 5DEZA 1W9VA 2JZVA 4GGQA 4QT3A 1LQ0A 4TX0A 4J4NA 1NWRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9O A;  3UI6 A;  2M1I A;  4QIB A;  3EY6 A;  4JFL A;  2LKN A;  4DRK A;  1FKB A;  5HUA A;  1TCO C;  1FKF A;  3TDB A;  4ODK A;  2MLY A;  1FKG A;  2KFW A;  2XP7 A;  3PRD A;  2ZR5 A;  4IPX A;  1NSG A;  4MSP A;  3MDY B;  3NRK A;  4QT2 A;  3NI6 A;  4LAV A;  4JFM A;  1FKL A;  1J4H A;  1QPF A;  3IKG A;  3KAD A;  4LAY A;  1R9H A;  3UF8 A;  2Q5A A;  1NMV A;  5BXJ A;  1D7H A;  2N87 A;  2F21 A;  1J6Y A;  1Q6H A;  1HXV A;  4JFI A;  2ZQV A;  2PV3 A;  3KAB A;  2ITK A;  2PPP A;  1FKD A;  1F8A B;  4DRM A;  1FAP A;  1FD9 A;  1YW5 A;  3KCE A;  1EQ3 A;  1JNT A;  4TNS A;  4ODO A;  3O5Q A;  2KR7 A;  2PV1 A;  3IKD A;  3KAC A;  3KAI A;  2D9F A;  2XP9 A;  1Q1C A;  3O5D A;  3CGM A;  3O5P A;  4DIP A;  4DRO A;  2RSE A;  3JYM A;  3IHZ A;  2Y78 A;  3NTP A;  2RUR A;  2FAP A;  4W9Q A;  4ITZ A;  4DT4 A;  1JVW A;  3O5F A;  1D7I A;  2XPB A;  4DRP A;  1W26 A;  2KE0 A;  4JFK A;  3CGN A;  5D75 A;  4DZ3 A;  1KT0 A;  1FKS A;  1PBK A;  1P5Q A;  1A7X A;  4W9P A;  1J4R A;  3PRB A;  1BKF A;  4DH0 A;  1L1P A;  3B7X A;  3IK8 A;  4LAX A;  2LJ4 A;  4DRQ A;  1N1A A;  4TW6 A;  1ROT A;  2M2A A;  2XP6 A;  5DIV A;  2FKE A;  4NNR A;  5GPG A;  1D7J A;  3TCZ A;  1FJD A;  2UZ5 A;  4IQ2 A;  2RUQ A;  2MNT A;  2XP3 A;  1FKK A;  4GIV A;  5J6E A;  1ROU A;  4JFJ A;  2LPV A;  3RFW A;  3KZ7 A;  2DG3 A;  3JXV A;  3ODK A;  1QZ2 A;  1U79 A;  4ODP A;  5HW6 A;  1ZK6 A;  4ODR A;  1M5Y A;  5I98 A;  1ZCN A;  3O5G A;  2MLX A;  1C9H A;  1NMW A;  1Q6I A;  4ODM A;  1Q6U A;  4O2T A;  1YAT A;  4ODL A;  3KAH A;  3JYJ A;  3UI5 A;  2RUD A;  3KAF A;  1J4I A;  3O5E A;  2PV2 A;  2KGJ A;  4ODQ A;  4DRH A;  4R0X A;  4BF8 A;  4MGV A;  2PPO A;  4DRI A;  2MF9 A;  4DZ2 A;  5HWB A;  3PA7 A;  1PIN A;  2M08 A;  1FKJ A;  5HTG A;  1KT1 A;  2ZQT A;  3O5I A;  3LUO A;  4TW8 A;  4IQC A;  1FKT A;  2IF4 A;  3O5O A;  2RUC A;  2XP5 A;  2KO7 A;  5DIU A;  5DIT A;  3UI4 A;  5HWC A;  3UQB A;  3O5M A;  1F40 A;  2RQS A;  1B6C A;  4G2P A;  4DRJ A;  4C02 B;  1EYM A;  1T11 A;  2VN1 A;  4U86 A;  2L2S A;  3VAW A;  3O5K A;  4U84 A;  1FKH A;  2LGO A;  3OOB A;  4JYS A;  3KAG A;  2MPH A;  4G50 A;  3TC5 A;  1D6O A;  1QPL A;  2MLZ A;  2ZQU A;  2KI3 A;  4J4O A;  3O5L A;  1FKR A;  2PBC A;  4ODN A;  2DG4 A;  2OFN A;  3UQI A;  4DRN A;  2ZR4 A;  2AWG A;  2ZR6 A;  4LAW A;  2F2D A;  1Y0O A;  3H9R B;  2K8I A;  3O5J A;  3RGC A;  3WH0 A;  1FKI A;  1JNS A;  3FAP A;  2F4E A;  2PPN A;  5HW8 A;  2XP4 A;  2ZQS A;  2XPA A;  3O5R A;  3GPK A;  2DG9 A;  5B8I C;  2VCD A;  4FAP A;  3UQA A;  4TYO A;  2JZV A;  4FN2 A;  4GGQ A;  4QT3 A;  5HKG A;  4TX0 A;  5HT1 A;  1BL4 A;  2XP8 A;  3I6C A;  4N19 A;  4J4N A;  4U85 A;  5HW7 A;  4TW7 A; 
#chains in the Genus database with same CATH topology
 4W9O A;  1D2K A;  4NSB A;  1JNE A;  4ZPT R;  1FKB A;  1FKF A;  3FXY A;  4MSP A;  3MDY B;  2ETN A;  1H0G A;  3IKG A;  1LJY A;  3KAD A;  1R9H A;  2Q5A A;  2N87 A;  2F21 A;  4P8U A;  1Q6H A;  1NWU A;  1EQ3 A;  2DT2 A;  4TNS A;  2DT0 A;  4ODO A;  3O5Q A;  2PV1 A;  3AQU A;  3IKD A;  5DO2 A;  3JYM A;  2RUR A;  4W9Q A;  2YBT A;  3GTY X;  1CTN A;  3ARZ A;  2P4V A;  3CHF A;  1SR0 A;  5D75 A;  1KT0 A;  3ARR A;  1J4R A;  3PRB A;  4IT6 A;  5GQB A;  4LAX A;  4P8V A;  3WQW A;  1N1A A;  2A3E A;  1FFR A;  3WL1 A;  1FJD A;  1LL4 A;  2RUQ A;  2A3B A;  1FKK A;  4JFJ A;  2LPV A;  1QZ2 A;  4ODR A;  1XHG A;  1M5Y A;  2MLX A;  4ODM A;  4P8W A;  4ZPW R;  3UI5 A;  2RUD A;  1E6P A;  1ZL1 A;  4DZ2 A;  2PPO A;  2MF9 A;  2DSV A;  3ARQ A;  4MNJ A;  3ARX A;  1ZBW A;  1JCH B;  1GRJ A;  3LUO A;  3O5O A;  2RUC A;  4Z2L A;  5HWC A;  3O5M A;  2RQS A;  4G2P A;  1LL6 A;  1EYM A;  1T11 A;  4U86 A;  1KFW A;  1H0I A;  2ESC A;  2MLZ A;  2KI3 A;  1UR8 A;  4W5U A;  1SYT A;  1OGG A;  2PBC A;  3UQI A;  2OFN A;  4XAK A;  2FDM A;  2F2D A;  2K8I A;  3WH0 A;  1NH6 A;  3ARV A;  4NZC A;  1ITX A;  3GPK A;  3WD1 A;  4TYO A;  3WD2 A;  2B5U B;  2OLH A;  4S3K A;  3PR9 A;  5HT1 A;  2YBU A;  2AOS A;  2XP8 A;  4MPK A;  2A3C A;  1ZBC A;  1HKK A;  1UR9 A;  2DT1 A;  2XP7 A;  1O6I A;  4Z2J A;  1J4H A;  1QPF A;  4LAY A;  3G6M A;  1NMV A;  4AY1 A;  1HXV A;  4JFI A;  2PV3 A;  3KAB A;  1ZBV A;  2PPP A;  4Q7N A;  4DRM A;  1JNT A;  2KR7 A;  2D9F A;  2XP9 A;  1Q1C A;  3O5P A;  4IT4 A;  3IHZ A;  3NTP A;  3O5F A;  2XPB A;  3G6L A;  4LGX A;  4DRP A;  1W26 A;  4URI A;  4JFK A;  1FKS A;  1PBK A;  1A7X A;  4DH0 A;  1L1P A;  3B7X A;  1WB0 A;  3B8S A;  2M2A A;  2FKE A;  4NNR A;  2XP3 A;  4GIV A;  4MTV A;  1ROU A;  1E44 A;  2DSW A;  4DWS C;  3ODK A;  4ODP A;  2EUL A;  3AS1 A;  3O5G A;  1YAT A;  4ODL A;  3JYJ A;  3KAF A;  1W1Y A;  1OWQ A;  1WNO A;  4MGV A;  2WLY A;  1PIN A;  1FKJ A;  5HTG A;  2DSU A;  1KT1 A;  4WJX A;  2QF8 A;  2WM0 A;  3O5I A;  4IQC A;  2O9O A;  3FY1 A;  4R5E A;  2L2S A;  3VAW A;  3O5K A;  1FKH A;  1HJW A;  3KAG A;  4WIW A;  2MPH A;  4L3N A;  3TC5 A;  1QPL A;  2ZQU A;  4J4O A;  4HBO A;  3WKZ A;  4WK9 A;  1E6N A;  2ZR4 A;  2AWG A;  2ZR6 A;  3H9R B;  1FKI A;  2G41 A;  3B9E A;  3O5R A;  4FAP A;  3UQA A;  1IX5 A;  4FN2 A;  3RM9 A;  4N19 A;  2F23 A;  1W1V A;  4U85 A;  4TW7 A;  5HW7 A;  4DRK A;  1HJV A;  4ODK A;  1XRV A;  1FKG A;  2KFW A;  3PRD A;  4Z2K A;  4IPX A;  4QT2 A;  1NSG A;  5HW6 A;  1EDQ A;  3WD0 A;  4WKA A;  3WL0 A;  3ALG A;  4JFM A;  3GU0 A;  1J6Y A;  2O92 A;  1E15 A;  1W9P A;  1FKD A;  1FAP A;  1YW5 A;  4MNK A;  3ARS A;  3CGM A;  2PI6 A;  4KQZ A;  3OA5 A;  2KE0 A;  3CGN A;  4DZ3 A;  1WAW A;  3AS2 A;  2LJ4 A;  4DRQ A;  4TW6 A;  1ROT A;  2XP6 A;  5GPG A;  1D7J A;  3TCZ A;  4IQ2 A;  2MNT A;  2DT3 A;  3RFW A;  3JXV A;  1HKJ A;  1X6N A;  3ART A;  1E6Z A;  1C9H A;  1NMW A;  1GPF A;  1Q6I A;  4O2T A;  3KAH A;  1W1T A;  1J4I A;  1LL7 A;  3CHE A;  4ZS6 A;  3O5E A;  3WQV A;  2KGJ A;  5I98 A;  4R0X A;  4BF8 A;  4DRI A;  3PA7 A;  1E6R A;  2M08 A;  3AS0 A;  1TFV A;  4HAR A;  4DWS B;  5GPR A;  5DIU A;  3UI4 A;  4DRJ A;  4C02 B;  1LG2 A;  2LGO A;  4JYS A;  3ARP A;  3O5L A;  3B9A A;  1W9U A;  3BXW A;  2A3A A;  3AS3 A;  4ODN A;  2DG4 A;  4DRN A;  3BMB A;  1VF8 A;  1NWT A;  3FAP A;  2F4E A;  2PPN A;  1OGB A;  2XP4 A;  2ZQS A;  3CHC A;  4L72 B;  2DG9 A;  5HKG A;  3CHD A;  1W1P A;  1BL4 A;  1ZBK A;  3I6C A;  3UI6 A;  2M1I A;  4QIB A;  3WD4 A;  3B9D A;  3EY6 A;  2G8Z A;  2LKN A;  4JFL A;  3RM8 A;  5HUA A;  1TCO C;  1GOI A;  3TDB A;  2MLY A;  4S3J A;  2ZR5 A;  4MNL A;  3NRK A;  1HJX A;  3NI6 A;  4LAV A;  1ZB5 A;  4ZPV R;  1FKL A;  5HBF A;  3UF8 A;  5BXJ A;  1D7H A;  3ARY A;  1HKM A;  2ZQV A;  2ITK A;  4UDM A;  1NWS A;  1F8A B;  1FD9 A;  3KCE A;  2IUZ A;  1LG1 A;  1E9L A;  3KAI A;  3KAC A;  4DWS A;  3O5D A;  4DIP A;  4DRO A;  2RSE A;  2Y78 A;  2FAP A;  1RD6 A;  4ITZ A;  4DT4 A;  1JVW A;  1D7I A;  4MAV A;  1P5Q A;  3WIJ A;  4W9P A;  1BKF A;  3IK8 A;  4DWS D;  5DIV A;  5DF0 A;  2UZ5 A;  5J6E A;  2WLZ A;  3KZ7 A;  3QOK A;  2DG3 A;  3ARU A;  1U79 A;  1ZK6 A;  1ZCN A;  3ARW A;  3RME A;  2B31 A;  4WKF A;  1Q6U A;  3W4R A;  3PRA A;  1HKI A;  4ML4 A;  1FFQ A;  2PV2 A;  4ODQ A;  4DRH A;  5HWB A;  1JNS A;  4Q22 A;  4WKH A;  3WD3 A;  2WK2 A;  4KR0 B;  2ZQT A;  1JND A;  3CZ8 A;  4TW8 A;  1FKT A;  2IF4 A;  2XP5 A;  2KO7 A;  1ZU8 A;  4Z2G A;  2PN0 A;  5DIT A;  3UQB A;  1EIB A;  1F40 A;  4Z2H A;  1B6C A;  2DSZ A;  3ALF A;  3ARO A;  2VN1 A;  4U84 A;  3OOB A;  3EIP A;  4P8X A;  4HBE A;  4G50 A;  1D6O A;  1X6L A;  5JH8 A;  2DPE A;  3RM4 A;  1FKR A;  4MNM A;  4Z2I A;  4PTM A;  4LAW A;  3O5J A;  1Y0O A;  1GUV A;  3RGC A;  1EHN A;  5HW8 A;  4QZV B;  1K9T A;  2XPA A;  5B8I C;  3CH9 A;  2VCD A;  5DEZ A;  1W9V A;  2JZV A;  4GGQ A;  4QT3 A;  1LQ0 A;  4TX0 A;  4J4N A;  1NWR A; 
#chains in the Genus database with same CATH homology
 4W9O A;  1D2K A;  4NSB A;  1JNE A;  4ZPT R;  1FKB A;  1FKF A;  3FXY A;  4MSP A;  3MDY B;  1H0G A;  3IKG A;  1LJY A;  3KAD A;  1R9H A;  2Q5A A;  2N87 A;  2F21 A;  4P8U A;  1Q6H A;  1NWU A;  1EQ3 A;  2DT2 A;  4TNS A;  2DT0 A;  4ODO A;  3O5Q A;  2PV1 A;  3AQU A;  3IKD A;  5DO2 A;  3JYM A;  2RUR A;  4W9Q A;  2YBT A;  1CTN A;  3ARZ A;  3CHF A;  1SR0 A;  5D75 A;  1KT0 A;  3ARR A;  1J4R A;  3PRB A;  4IT6 A;  5GQB A;  4LAX A;  4P8V A;  3WQW A;  1N1A A;  2A3E A;  1FFR A;  3WL1 A;  1FJD A;  1LL4 A;  2RUQ A;  2A3B A;  1FKK A;  4JFJ A;  2LPV A;  1QZ2 A;  4ODR A;  1XHG A;  1M5Y A;  2MLX A;  4ODM A;  4P8W A;  4ZPW R;  3UI5 A;  2RUD A;  1E6P A;  1ZL1 A;  4DZ2 A;  2PPO A;  2MF9 A;  2DSV A;  3ARQ A;  4MNJ A;  3ARX A;  1ZBW A;  3LUO A;  3O5O A;  2RUC A;  4Z2L A;  5HWC A;  3O5M A;  2RQS A;  4G2P A;  1LL6 A;  1EYM A;  1T11 A;  4U86 A;  1KFW A;  1H0I A;  2ESC A;  2MLZ A;  2KI3 A;  1UR8 A;  4W5U A;  1SYT A;  1OGG A;  2PBC A;  3UQI A;  2OFN A;  4XAK A;  2FDM A;  2F2D A;  2K8I A;  3WH0 A;  1NH6 A;  3ARV A;  4NZC A;  1ITX A;  3GPK A;  3WD1 A;  4TYO A;  3WD2 A;  2OLH A;  4S3K A;  3PR9 A;  5HT1 A;  2YBU A;  2AOS A;  2XP8 A;  4MPK A;  2A3C A;  1ZBC A;  1HKK A;  1UR9 A;  2DT1 A;  2XP7 A;  1O6I A;  4Z2J A;  1J4H A;  1QPF A;  4LAY A;  3G6M A;  1NMV A;  4AY1 A;  1HXV A;  4JFI A;  2PV3 A;  3KAB A;  1ZBV A;  2PPP A;  4Q7N A;  4DRM A;  1JNT A;  2KR7 A;  2D9F A;  2XP9 A;  1Q1C A;  3O5P A;  4IT4 A;  3IHZ A;  3NTP A;  3O5F A;  2XPB A;  3G6L A;  4LGX A;  4DRP A;  1W26 A;  4URI A;  4JFK A;  1FKS A;  1PBK A;  1A7X A;  4DH0 A;  1L1P A;  3B7X A;  1WB0 A;  3B8S A;  2M2A A;  2FKE A;  4NNR A;  2XP3 A;  4GIV A;  4MTV A;  1ROU A;  2DSW A;  4DWS C;  3ODK A;  4ODP A;  3AS1 A;  3O5G A;  1YAT A;  4ODL A;  3JYJ A;  3KAF A;  1W1Y A;  1OWQ A;  1WNO A;  4MGV A;  2WLY A;  1PIN A;  1FKJ A;  5HTG A;  2DSU A;  1KT1 A;  4WJX A;  2QF8 A;  2WM0 A;  3O5I A;  4IQC A;  2O9O A;  3FY1 A;  4R5E A;  2L2S A;  3VAW A;  3O5K A;  1FKH A;  1HJW A;  3KAG A;  4WIW A;  2MPH A;  4L3N A;  3TC5 A;  1QPL A;  2ZQU A;  4J4O A;  4HBO A;  3WKZ A;  4WK9 A;  1E6N A;  2ZR4 A;  2AWG A;  2ZR6 A;  3H9R B;  1FKI A;  2G41 A;  3B9E A;  3O5R A;  4FAP A;  3UQA A;  1IX5 A;  4FN2 A;  3RM9 A;  4N19 A;  1W1V A;  4U85 A;  5HW7 A;  4TW7 A;  4DRK A;  1HJV A;  4ODK A;  1XRV A;  1FKG A;  2KFW A;  3PRD A;  4Z2K A;  4IPX A;  4QT2 A;  1NSG A;  5HW6 A;  1EDQ A;  3WD0 A;  4WKA A;  3WL0 A;  3ALG A;  4JFM A;  1J6Y A;  2O92 A;  1E15 A;  1W9P A;  1FKD A;  1FAP A;  1YW5 A;  4MNK A;  3ARS A;  3CGM A;  2PI6 A;  4KQZ A;  3OA5 A;  2KE0 A;  3CGN A;  4DZ3 A;  1WAW A;  3AS2 A;  2LJ4 A;  4DRQ A;  4TW6 A;  1ROT A;  2XP6 A;  5GPG A;  1D7J A;  3TCZ A;  4IQ2 A;  2MNT A;  2DT3 A;  3RFW A;  3JXV A;  1HKJ A;  1X6N A;  3ART A;  1E6Z A;  1C9H A;  1NMW A;  1GPF A;  1Q6I A;  4O2T A;  3KAH A;  1W1T A;  1J4I A;  1LL7 A;  3CHE A;  4ZS6 A;  3O5E A;  3WQV A;  2KGJ A;  5I98 A;  4R0X A;  4BF8 A;  4DRI A;  3PA7 A;  1E6R A;  2M08 A;  3AS0 A;  1TFV A;  4HAR A;  4DWS B;  5GPR A;  5DIU A;  3UI4 A;  4DRJ A;  4C02 B;  1LG2 A;  2LGO A;  4JYS A;  3ARP A;  3O5L A;  3B9A A;  1W9U A;  3BXW A;  2A3A A;  3AS3 A;  4ODN A;  2DG4 A;  4DRN A;  1VF8 A;  1NWT A;  3FAP A;  2F4E A;  2PPN A;  1OGB A;  2XP4 A;  2ZQS A;  3CHC A;  4L72 B;  2DG9 A;  5HKG A;  3CHD A;  1W1P A;  1BL4 A;  1ZBK A;  3I6C A;  3UI6 A;  2M1I A;  4QIB A;  3WD4 A;  3B9D A;  3EY6 A;  2G8Z A;  2LKN A;  4JFL A;  3RM8 A;  5HUA A;  1TCO C;  1GOI A;  3TDB A;  2MLY A;  4S3J A;  2ZR5 A;  4MNL A;  3NRK A;  1HJX A;  3NI6 A;  4LAV A;  1ZB5 A;  4ZPV R;  1FKL A;  5HBF A;  3UF8 A;  5BXJ A;  1D7H A;  3ARY A;  1HKM A;  2ZQV A;  2ITK A;  1NWS A;  1F8A B;  1FD9 A;  3KCE A;  2IUZ A;  1LG1 A;  1E9L A;  3KAI A;  3KAC A;  4DWS A;  3O5D A;  4DIP A;  4DRO A;  2RSE A;  2Y78 A;  2FAP A;  1RD6 A;  4ITZ A;  4DT4 A;  1JVW A;  1D7I A;  4MAV A;  1P5Q A;  3WIJ A;  4W9P A;  1BKF A;  3IK8 A;  4DWS D;  5DIV A;  5DF0 A;  2UZ5 A;  5J6E A;  2WLZ A;  3KZ7 A;  3QOK A;  2DG3 A;  3ARU A;  1U79 A;  1ZK6 A;  1ZCN A;  3ARW A;  3RME A;  2B31 A;  4WKF A;  1Q6U A;  3W4R A;  3PRA A;  1HKI A;  4ML4 A;  1FFQ A;  2PV2 A;  4ODQ A;  4DRH A;  5HWB A;  1JNS A;  4Q22 A;  4WKH A;  3WD3 A;  2WK2 A;  4KR0 B;  2ZQT A;  1JND A;  3CZ8 A;  4TW8 A;  1FKT A;  2IF4 A;  2XP5 A;  2KO7 A;  1ZU8 A;  4Z2G A;  5DIT A;  3UQB A;  1EIB A;  1F40 A;  4Z2H A;  1B6C A;  2DSZ A;  3ALF A;  3ARO A;  2VN1 A;  4U84 A;  3OOB A;  4P8X A;  4HBE A;  4G50 A;  1D6O A;  1X6L A;  5JH8 A;  2DPE A;  3RM4 A;  1FKR A;  4MNM A;  4Z2I A;  4PTM A;  4LAW A;  3O5J A;  1Y0O A;  1GUV A;  3RGC A;  1EHN A;  5HW8 A;  4QZV B;  1K9T A;  2XPA A;  5B8I C;  3CH9 A;  2VCD A;  5DEZ A;  1W9V A;  2JZV A;  4GGQ A;  4QT3 A;  1LQ0 A;  4TX0 A;  4J4N A;  1NWR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...