2VN1A

Crystal structure of the fk506-binding domain of plasmodium falciparum fkbp35 in complex with fk506
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
123
structure length
123
Chain Sequence
FEKVELTADGGVIKTILKKGDEGEENIPKKGNEVTVHYVGKLESTGKVFDSSFDRNVPFKFHLEQGEVIKGWDICVSSMRKNEKCLVRIESMYGYGDEGCGESIPGNSVLLFEIELLSFRELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 70 KDA PEPTIDYLPROLYL ISOMERASE
publication title Crystal Structure of the Fk506 Binding Domain of Plasmodium Falciparum Fkbp35 in Complex with Fk506.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
total genus 31
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2vn1A01
1Q6IA 1FKGA 2MF9A 5DIVA 4DRHA 3KCEA 3H9RB 1P5QA 2OFNA 1Q6UA 5HUAA 4FAPA 2LGOA 5I98A 3VAWA 3JXVA 1Q6HA 2RUCA 4ODLA 4TYOA 1HXVA 4JFMA 4ODOA 4TW7A 1TCOC 1NSGA 3UQBA 2RUQA 3EY6A 4JFLA 4U84A 4DRQA 4DRPA 3PRBA 4U86A 3O5IA 2M08A 1FKDA 2XPAA 1FKRA 2FKEA 1Q1CA 3IKGA 1FKKA 2XP4A 4DRNA 2JZVA 1FAPA 2KE0A 1D6OA 2MNTA 1BL4A 2VN1A 2XP8A 2RURA 2XP6A 4TW8A 2RSEA 4DRKA 2RUDA 1R9HA 5HWCA 3KADA 5HWBA 2ZR5A 4QT3A 3CGMA 2M1IA 3IKDA 1FKIA 5B8IC 2PPPA 2KI3A 3IK8A 3O5DA 3KAHA 5HKGA 4ITZA 5HW8A 3RGCA 3O5JA 2K8IA 3JYMA 5HT1A 1FKLA 2PV2A 2KGJA 2ZQUA 2DG4A 1BKFA 2M2AA 3LUOA 4ODMA 4ODKA 4JFJA 3PRDA 4DIPA 5HTGA 1D7IA 3O5EA 3FAPA 1FJDA 2ZQSA 1ZCNA 2LPVA 1FKJA 1EYMA 4IQCA 1F40A 1N1AA 3B7XA 4U85A 2D9FA 2LJ4A 1W26A 2FAPA 3NTPA 3I6CA 1M5YA 2XP5A 3O5LA 4IQ2A 4W9PA 4FN2A 4DRJA 4DRIA 4TX0A 3UI6A 1L1PA 2ZQTA 4ODPA 4QIBA 2F21A 2MPHA 4LAYA 4TW6A 2PBCA 2ZR4A 2ZQVA 2VCDA 1B6CA 1FKTA 1PBKA 3PA7A 2DG3A 3KAFA 2KO7A 1FD9A 2KR7A 4GIVA 4J4NA 5D75A 1JNSA 1FKSA 1QPFA 1C9HA 1QZ2A 1NMVA 2F2DA 5DITA 1FKHA 1EQ3A 2ITKA 3JYJA 4O2TA 4ODNA 1J4HA 3O5QA 2XP9A 3UF8A 3UQIA 3WH0A 4JYSA 3O5MA 1FKBA 2XP7A 5HW6A 4DRMA 1J6YA 1T11A 3TCZA 2IF4A 3O5RA 1FKFA 3O5OA 3O5FA 4QT2A 1PINA 3GPKA 3O5KA 1J4RA 2LKNA 1ROUA 4LAVA 5DIUA 1A7XA 2L2SA 3ODKA 4G50A 2MLXA 4DT4A 3NRKA 3KACA 1KT0A 3KAGA 3UI5A 2PV1A 2Q5AA 3MDYB 4J4OA 4JFKA 4MGVA 3TC5A 4JFIA 3KZ7A 3UQAA 1QPLA 3IHZA 4W9QA 1D7JA 3KABA 5J6EA 4N19A 5GPGA 4DH0A 1KT1A 2XPBA 3RFWA 2UZ5A 5HW7A 1JVWA 1F8AB 1J4IA 2AWGA 4TNSA 1D7HA 4R0XA 4DROA 2PPOA 1JNTA 1ZK6A 4LAXA 1YW5A 2DG9A 2PPNA 3O5GA 4NNRA 3CGNA 4ODQA 3NI6A 1NMWA 1U79A 3TDBA 2Y78A 3KAIA 4BF8A 4C02B 1ROTA 2KFWA 1Y0OA 4IPXA 3O5PA 4W9OA 3OOBA 1YATA 2F4EA 2RQSA 4LAWA 2PV3A 2MLYA 3UI4A 2ZR6A 4GGQA 4DZ2A 2N87A 4MSPA 2XP3A 5BXJA 4G2PA 4ODRA 2MLZA 4DZ3A
chains in the Genus database with same CATH superfamily
2WM0A 4ZS6A 3H9RB 4L3NA 2OFNA 3CHCA 3VAWA 2A3EA 4TW7A 1NSGA 3EIPA 4DRQA 4DRPA 1SYTA 3WD0A 1FKRA 1Q1CA 4WKFA 4DRNA 3WD2A 2XP8A 4TW8A 3AROA 1EDQA 3RMEA 4QT3A 3CGMA 5B8IC 3IK8A 1JNEA 3RGCA 1FKLA 2PV2A 2ZQUA 4HBOA 3LUOA 4DIPA 5HTGA 3CHEA 3O5EA 2O9OA 4DWSC 2PI6A 3B7XA 2D9FA 1ZL1A 4W9PA 4FN2A 3WQWA 2F21A 1IX5A 4LAYA 2PBCA 2IUZA 3PA7A 2DG3A 3KAFA 1H0IA 1FKSA 1C9HA 2F23A 3AQUA 4URIA 1SR0A 4Q22A 4ODNA 1NWSA 2XP9A 3UQIA 5HW6A 1FKBA 4DWSA 2IF4A 3O5OA 4LGXA 1OGGA 2LKNA 1ROUA 5DIUA 3WL0A 3ODKA 1JCHB 3NRKA 3UI5A 2PV1A 1GRJA 4MGVA 4JFIA 4PTMA 3KABA 4DH0A 1KT1A 3ARZA 5DEZA 1JVWA 2AWGA 1D7HA 3FXYA 4LAXA 1W1YA 2PPNA 4NZCA 3O5GA 2DSZA 1LL7A 1LG2A 1OGBA 1KFWA 3O5PA 3OOBA 4IT4A 1HKJA 2RQSA 2F4EA 2PV3A 3QOKA 4G2PA 2DSUA 4DZ3A 1WAWA 4WIWA 4FAPA 2B5UB 2LGOA 3WD4A 2RUCA 4ODLA 4JFMA 3UQBA 3B9DA 4U84A 4MNMA 1ZBKA 4UDMA 4P8XA 3PRBA 3B9AA 3BXWA 3IKGA 4MNLA 1W9PA 1FKKA 2XP4A 4QZVB 2KE0A 1D6OA 1ZU8A 3ARWA 2RSEA 3FY1A 2RUDA 2EULA 4HARA 1HJXA 1HKMA 4Z2HA 1H0GA 2ETNA 3AS1A 3O5JA 5HW8A 2B31A 2KGJA 4ODMA 1BKFA 2M2AA 4DWSD 1FJDA 2QF8A 1ITXA 1FKJA 1F40A 4U85A 3I6CA 4IQ2A 1L1PA 3UI6A 4ODPA 4QIBA 4MNJA 2ZR4A 3RM8A 1NWRA 3WKZA 2ESCA 4J4NA 4GIVA 1QPFA 1QZ2A 2A3CA 4P8VA 5DITA 1JNDA 3JYJA 4KR0B 3CHFA 4JYSA 2XP7A 1T11A 1ZB5A 3O5RA 1FKFA 3O5KA 3AS2A 2DSVA 1GOIA 2L2SA 4G50A 2MLXA 4L72B 1E15A 4J4OA 3W4RA 1NWTA 3WIJA 4W9QA 1LJYA 5J6EA 4N19A 5HW7A 2UZ5A 2DT3A 1F8AB 4S3JA 4R0XA 4R5EA 4DROA 4ODQA 4NNRA 3CGNA 4KQZA 4DWSB 2DPEA 3NI6A 1K9TA 4IPXA 4W9OA 1YATA 2DT1A 4LAWA 1CTNA 4ZPVR 3PRAA 1HJVA 1Q6IA 1FKGA 3RM9A 1ZBVA 4IT6A 1Q6HA 1ZBCA 4TYOA 1HXVA 1NH6A 2AOSA 4P8UA 5GQBA 4WKHA 2RUQA 1E44A 4JFLA 4Z2LA 1HKKA 3O5IA 2M08A 4WKAA 2XPAA 2FKEA 2DT0A 3B9EA 1E6ZA 1FAPA 1W1VA 2MNTA 1BL4A 2VN1A 2RURA 2XP6A 4Q7NA 5DF0A 3WQVA 4DRKA 5HWCA 3ARVA 2PPPA 1FFQA 3KAHA 2K8IA 3JYMA 5HT1A 1OWQA 1LQ0A 1X6LA 4JFJA 3PRDA 1D7IA 1EYMA 3AS3A 2A3BA 2LJ4A 1M5YA 1ZBWA 2YBTA 4XAKA 4ZPWR 4DRIA 2ZQTA 2DT2A 4WK9A 3AS0A 4TW6A 2VCDA 1B6CA 1WNOA 1PBKA 5GPRA 5D75A 1E9LA 1W1PA 1NMVA 3B8SA 2ITKA 4O2TA 1X6NA 2O92A 1J4HA 3UF8A 3WH0A 4AY1A 3WD1A 1J6YA 4DRMA 1LL6A 3TCZA 3O5FA 2DSWA 4QT2A 1E6PA 1EHNA 4LAVA 4P8WA 1A7XA 1UR8A 1KT0A 2Q5AA 3MDYB 4HBEA 4JFKA 4ZPTR 3IHZA 5JH8A 1J4IA 4TNSA 4Z2GA 3ALGA 1JNTA 1ZK6A 2YBUA 2DG9A 4Z2KA 1U79A 3ARUA 3TDBA 2Y78A 4WJXA 4C02B 1Y0OA 3CH9A 2MLYA 2ZR6A 1E6RA 4MSPA 1UR9A 4NSBA 2XP3A 3ALFA 5BXJA 2FDMA 3G6MA 1LG1A 2MF9A 5DIVA 4DRHA 3KCEA 4MPKA 1P5QA 5DO2A 1Q6UA 5HUAA 5I98A 3OA5A 3JXVA 2WK2A 4MTVA 3CHDA 4ODOA 1TCOC 3ARSA 1GPFA 1W9VA 3EY6A 1FFRA 4Z2JA 4U86A 1D2KA 1FKDA 1EIBA 3GU0A 2G8ZA 3ARPA 2JZVA 4ML4A 3ARTA 2OLHA 1O6IA 1R9HA 2WLZA 2P4VA 3ARQA 3KADA 5HWBA 2ZR5A 2M1IA 3IKDA 1FKIA 1W1TA 2KI3A 3O5DA 5HKGA 4S3KA 3GTYX 4ITZA 2A3AA 1JNSA 2DG4A 3WD3A 1XHGA 4ODKA 3FAPA 2ZQSA 1ZCNA 2LPVA 1HKIA 4IQCA 3WL1A 1LL4A 1N1AA 3ARXA 1W26A 2FAPA 3NTPA 2XP5A 3ARRA 3O5LA 4DRJA 4MNKA 4TX0A 4Z2IA 2MPHA 2G41A 2ZQVA 1FKTA 2WLYA 2KO7A 1FD9A 2KR7A 3CZ8A 2F2DA 1W9UA 1FKHA 3ARYA 3RM4A 5HBFA 1EQ3A 1NWUA 3O5QA 3O5MA 1PINA 3GPKA 4MAVA 1J4RA 1E6NA 4DT4A 3KACA 3KAGA 1VF8A 3PR9A 3TC5A 3UQAA 3KZ7A 1QPLA 1XRVA 1D7JA 5GPGA 2XPBA 3RFWA 1GUVA 1TFVA 2PPOA 1YW5A 2PN0A 1HJWA 1NMWA 1WB0A 3KAIA 4BF8A 1RD6A 1ROTA 2KFWA 3G6LA 3BMBA 4W5UA 3UI4A 4GGQA 4DZ2A 2N87A 4ODRA 2MLZA
chains in the Genus database with same CATH topology
2WM0A 4ZS6A 3H9RB 4L3NA 2OFNA 3CHCA 3VAWA 2A3EA 4TW7A 1NSGA 4DRQA 4DRPA 1SYTA 3WD0A 1FKRA 1Q1CA 4WKFA 4DRNA 3WD2A 2XP8A 4TW8A 3AROA 1EDQA 3RMEA 4QT3A 3CGMA 5B8IC 3IK8A 1JNEA 3RGCA 1FKLA 2PV2A 2ZQUA 4HBOA 3LUOA 4DIPA 5HTGA 3CHEA 3O5EA 2O9OA 4DWSC 2PI6A 3B7XA 2D9FA 1ZL1A 4W9PA 4FN2A 3WQWA 2F21A 1IX5A 4LAYA 2PBCA 2IUZA 3PA7A 2DG3A 3KAFA 1H0IA 1FKSA 1C9HA 3AQUA 4URIA 1SR0A 4Q22A 4ODNA 1NWSA 2XP9A 3UQIA 5HW6A 1FKBA 4DWSA 2IF4A 3O5OA 4LGXA 1OGGA 2LKNA 1ROUA 5DIUA 3WL0A 3ODKA 3NRKA 3UI5A 2PV1A 4MGVA 4JFIA 4PTMA 3KABA 4DH0A 1KT1A 3ARZA 5DEZA 1JVWA 2AWGA 1D7HA 3FXYA 4LAXA 1W1YA 2PPNA 4NZCA 3O5GA 2DSZA 1LL7A 1LG2A 1OGBA 1KFWA 3O5PA 3OOBA 4IT4A 1HKJA 2RQSA 2F4EA 2PV3A 3QOKA 4G2PA 2DSUA 4DZ3A 1WAWA 4WIWA 4FAPA 2LGOA 3WD4A 2RUCA 4ODLA 4JFMA 3UQBA 3B9DA 4U84A 4MNMA 1ZBKA 4P8XA 3PRBA 3B9AA 3BXWA 3IKGA 4MNLA 1W9PA 1FKKA 2XP4A 4QZVB 2KE0A 1D6OA 1ZU8A 3ARWA 2RSEA 3FY1A 2RUDA 4HARA 1HJXA 1HKMA 4Z2HA 1H0GA 3AS1A 5HW8A 3O5JA 2B31A 2KGJA 4ODMA 1BKFA 2M2AA 4DWSD 1FJDA 2QF8A 1ITXA 1FKJA 1F40A 4U85A 3I6CA 4IQ2A 1L1PA 3UI6A 4ODPA 4QIBA 4MNJA 2ZR4A 3RM8A 1NWRA 3WKZA 2ESCA 4J4NA 4GIVA 1QPFA 1QZ2A 2A3CA 4P8VA 5DITA 1JNDA 3JYJA 4KR0B 3CHFA 4JYSA 2XP7A 1T11A 1ZB5A 3O5RA 1FKFA 3O5KA 3AS2A 2DSVA 1GOIA 2L2SA 4G50A 2MLXA 4L72B 1E15A 4J4OA 3W4RA 1NWTA 3WIJA 4W9QA 1LJYA 5J6EA 4N19A 5HW7A 2UZ5A 2DT3A 1F8AB 4S3JA 4R0XA 4R5EA 4DROA 4ODQA 4NNRA 3CGNA 4KQZA 4DWSB 2DPEA 3NI6A 1K9TA 4IPXA 4W9OA 1YATA 2DT1A 4LAWA 1CTNA 4ZPVR 3PRAA 1HJVA 1Q6IA 1FKGA 3RM9A 1ZBVA 4IT6A 1Q6HA 1ZBCA 4TYOA 1HXVA 1NH6A 2AOSA 4P8UA 5GQBA 4WKHA 2RUQA 4JFLA 4Z2LA 1HKKA 3O5IA 2M08A 4WKAA 2XPAA 2FKEA 2DT0A 3B9EA 1E6ZA 1FAPA 1W1VA 2MNTA 1BL4A 2VN1A 2RURA 2XP6A 4Q7NA 5DF0A 3WQVA 4DRKA 5HWCA 3ARVA 2PPPA 1FFQA 3KAHA 2K8IA 3JYMA 5HT1A 1OWQA 1LQ0A 1X6LA 4JFJA 3PRDA 1D7IA 1EYMA 3AS3A 2A3BA 2LJ4A 1M5YA 1ZBWA 2YBTA 4XAKA 4ZPWR 4DRIA 2ZQTA 2DT2A 4WK9A 3AS0A 4TW6A 2VCDA 1B6CA 1WNOA 1PBKA 5GPRA 5D75A 1E9LA 1W1PA 1NMVA 3B8SA 2ITKA 4O2TA 1X6NA 2O92A 1J4HA 3UF8A 3WH0A 4AY1A 3WD1A 1J6YA 4DRMA 1LL6A 3TCZA 3O5FA 2DSWA 4QT2A 1E6PA 1EHNA 4LAVA 4P8WA 1A7XA 1UR8A 1KT0A 2Q5AA 3MDYB 4HBEA 4JFKA 4ZPTR 3IHZA 5JH8A 1J4IA 4TNSA 4Z2GA 3ALGA 1JNTA 1ZK6A 2YBUA 2DG9A 4Z2KA 1U79A 3ARUA 3TDBA 2Y78A 4WJXA 4C02B 1Y0OA 3CH9A 2MLYA 2ZR6A 1E6RA 4MSPA 1UR9A 4NSBA 2XP3A 3ALFA 5BXJA 2FDMA 3G6MA 1LG1A 2MF9A 5DIVA 4DRHA 3KCEA 4MPKA 1P5QA 5DO2A 1Q6UA 5HUAA 5I98A 3OA5A 3JXVA 2WK2A 4MTVA 3CHDA 4ODOA 1TCOC 3ARSA 1GPFA 1W9VA 3EY6A 1FFRA 4Z2JA 4U86A 1D2KA 1FKDA 1EIBA 2G8ZA 3ARPA 2JZVA 4ML4A 3ARTA 2OLHA 1O6IA 1R9HA 2WLZA 3ARQA 3KADA 5HWBA 2ZR5A 2M1IA 3IKDA 1FKIA 1W1TA 2KI3A 3O5DA 5HKGA 4S3KA 4ITZA 2A3AA 1JNSA 2DG4A 3WD3A 1XHGA 4ODKA 3FAPA 2ZQSA 1ZCNA 2LPVA 1HKIA 4IQCA 3WL1A 1LL4A 1N1AA 3ARXA 1W26A 2FAPA 3NTPA 2XP5A 3ARRA 3O5LA 4DRJA 4MNKA 4TX0A 4Z2IA 2MPHA 2G41A 2ZQVA 1FKTA 2WLYA 2KO7A 1FD9A 2KR7A 3CZ8A 2F2DA 1W9UA 1FKHA 3ARYA 3RM4A 5HBFA 1EQ3A 1NWUA 3O5QA 3O5MA 1PINA 3GPKA 4MAVA 1J4RA 1E6NA 4DT4A 3KACA 3KAGA 1VF8A 3PR9A 3TC5A 3UQAA 3KZ7A 1QPLA 1XRVA 1D7JA 5GPGA 2XPBA 3RFWA 1GUVA 1TFVA 2PPOA 1YW5A 1HJWA 1NMWA 1WB0A 3KAIA 4BF8A 1RD6A 1ROTA 2KFWA 3G6LA 4W5UA 3UI4A 4GGQA 4DZ2A 2N87A 4ODRA 2MLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q6I A;  1FKG A;  2MF9 A;  5DIV A;  4DRH A;  3KCE A;  3H9R B;  1P5Q A;  2OFN A;  1Q6U A;  5HUA A;  4FAP A;  2LGO A;  5I98 A;  3VAW A;  3JXV A;  1Q6H A;  2RUC A;  4ODL A;  4TYO A;  1HXV A;  4JFM A;  4ODO A;  4TW7 A;  1TCO C;  1NSG A;  3UQB A;  2RUQ A;  3EY6 A;  4JFL A;  4U84 A;  4DRQ A;  4DRP A;  3PRB A;  4U86 A;  3O5I A;  2M08 A;  1FKD A;  2XPA A;  1FKR A;  2FKE A;  1Q1C A;  3IKG A;  1FKK A;  2XP4 A;  4DRN A;  2JZV A;  1FAP A;  2KE0 A;  1D6O A;  2MNT A;  1BL4 A;  2VN1 A;  2XP8 A;  2RUR A;  2XP6 A;  4TW8 A;  2RSE A;  4DRK A;  2RUD A;  1R9H A;  5HWC A;  3KAD A;  5HWB A;  2ZR5 A;  4QT3 A;  3CGM A;  2M1I A;  3IKD A;  1FKI A;  5B8I C;  2PPP A;  2KI3 A;  3IK8 A;  3O5D A;  3KAH A;  5HKG A;  4ITZ A;  5HW8 A;  3RGC A;  3O5J A;  2K8I A;  3JYM A;  5HT1 A;  1FKL A;  2PV2 A;  2KGJ A;  2ZQU A;  2DG4 A;  1BKF A;  2M2A A;  3LUO A;  4ODM A;  4ODK A;  4JFJ A;  3PRD A;  4DIP A;  5HTG A;  1D7I A;  3O5E A;  3FAP A;  1FJD A;  2ZQS A;  1ZCN A;  2LPV A;  1FKJ A;  1EYM A;  4IQC A;  1F40 A;  1N1A A;  3B7X A;  4U85 A;  2D9F A;  2LJ4 A;  1W26 A;  2FAP A;  3NTP A;  3I6C A;  1M5Y A;  2XP5 A;  3O5L A;  4IQ2 A;  4W9P A;  4FN2 A;  4DRJ A;  4DRI A;  4TX0 A;  3UI6 A;  1L1P A;  2ZQT A;  4ODP A;  4QIB A;  2F21 A;  2MPH A;  4LAY A;  4TW6 A;  2PBC A;  2ZR4 A;  2ZQV A;  2VCD A;  1B6C A;  1FKT A;  1PBK A;  3PA7 A;  2DG3 A;  3KAF A;  2KO7 A;  1FD9 A;  2KR7 A;  4GIV A;  4J4N A;  5D75 A;  1JNS A;  1FKS A;  1QPF A;  1C9H A;  1QZ2 A;  1NMV A;  2F2D A;  5DIT A;  1FKH A;  1EQ3 A;  2ITK A;  3JYJ A;  4O2T A;  4ODN A;  1J4H A;  3O5Q A;  2XP9 A;  3UF8 A;  3UQI A;  3WH0 A;  4JYS A;  3O5M A;  1FKB A;  2XP7 A;  5HW6 A;  4DRM A;  1J6Y A;  1T11 A;  3TCZ A;  2IF4 A;  3O5R A;  1FKF A;  3O5O A;  3O5F A;  4QT2 A;  1PIN A;  3GPK A;  3O5K A;  1J4R A;  2LKN A;  1ROU A;  4LAV A;  5DIU A;  1A7X A;  2L2S A;  3ODK A;  4G50 A;  2MLX A;  4DT4 A;  3NRK A;  3KAC A;  1KT0 A;  3KAG A;  3UI5 A;  2PV1 A;  2Q5A A;  3MDY B;  4J4O A;  4JFK A;  4MGV A;  3TC5 A;  4JFI A;  3KZ7 A;  3UQA A;  1QPL A;  3IHZ A;  4W9Q A;  1D7J A;  3KAB A;  5J6E A;  4N19 A;  5GPG A;  4DH0 A;  1KT1 A;  2XPB A;  3RFW A;  2UZ5 A;  5HW7 A;  1JVW A;  1F8A B;  1J4I A;  2AWG A;  4TNS A;  1D7H A;  4R0X A;  4DRO A;  2PPO A;  1JNT A;  1ZK6 A;  4LAX A;  1YW5 A;  2DG9 A;  2PPN A;  3O5G A;  4NNR A;  3CGN A;  4ODQ A;  3NI6 A;  1NMW A;  1U79 A;  3TDB A;  2Y78 A;  3KAI A;  4BF8 A;  4C02 B;  1ROT A;  2KFW A;  1Y0O A;  4IPX A;  3O5P A;  4W9O A;  3OOB A;  1YAT A;  2F4E A;  2RQS A;  4LAW A;  2PV3 A;  2MLY A;  3UI4 A;  2ZR6 A;  4GGQ A;  4DZ2 A;  2N87 A;  4MSP A;  2XP3 A;  5BXJ A;  4G2P A;  4ODR A;  2MLZ A;  4DZ3 A; 
#chains in the Genus database with same CATH topology
 2WM0 A;  4ZS6 A;  3H9R B;  4L3N A;  2OFN A;  3CHC A;  3VAW A;  2A3E A;  4TW7 A;  1NSG A;  3EIP A;  4DRQ A;  4DRP A;  1SYT A;  3WD0 A;  1FKR A;  1Q1C A;  4WKF A;  4DRN A;  3WD2 A;  2XP8 A;  4TW8 A;  3ARO A;  1EDQ A;  3RME A;  4QT3 A;  3CGM A;  5B8I C;  3IK8 A;  1JNE A;  3RGC A;  1FKL A;  2PV2 A;  2ZQU A;  4HBO A;  3LUO A;  4DIP A;  5HTG A;  3CHE A;  3O5E A;  2O9O A;  4DWS C;  2PI6 A;  3B7X A;  2D9F A;  1ZL1 A;  4W9P A;  4FN2 A;  3WQW A;  2F21 A;  1IX5 A;  4LAY A;  2PBC A;  2IUZ A;  3PA7 A;  2DG3 A;  3KAF A;  1H0I A;  1FKS A;  1C9H A;  2F23 A;  3AQU A;  4URI A;  1SR0 A;  4Q22 A;  4ODN A;  1NWS A;  2XP9 A;  3UQI A;  5HW6 A;  1FKB A;  4DWS A;  2IF4 A;  3O5O A;  4LGX A;  1OGG A;  2LKN A;  1ROU A;  5DIU A;  3WL0 A;  3ODK A;  1JCH B;  3NRK A;  3UI5 A;  2PV1 A;  1GRJ A;  4MGV A;  4JFI A;  4PTM A;  3KAB A;  4DH0 A;  1KT1 A;  3ARZ A;  5DEZ A;  1JVW A;  2AWG A;  1D7H A;  3FXY A;  4LAX A;  1W1Y A;  2PPN A;  4NZC A;  3O5G A;  2DSZ A;  1LL7 A;  1LG2 A;  1OGB A;  1KFW A;  3O5P A;  3OOB A;  4IT4 A;  1HKJ A;  2RQS A;  2F4E A;  2PV3 A;  3QOK A;  4G2P A;  2DSU A;  4DZ3 A;  1WAW A;  4WIW A;  4FAP A;  2B5U B;  2LGO A;  3WD4 A;  2RUC A;  4ODL A;  4JFM A;  3UQB A;  3B9D A;  4U84 A;  4MNM A;  1ZBK A;  4UDM A;  4P8X A;  3PRB A;  3B9A A;  3BXW A;  3IKG A;  4MNL A;  1W9P A;  1FKK A;  2XP4 A;  4QZV B;  2KE0 A;  1D6O A;  1ZU8 A;  3ARW A;  2RSE A;  3FY1 A;  2RUD A;  2EUL A;  4HAR A;  1HJX A;  1HKM A;  4Z2H A;  1H0G A;  2ETN A;  3AS1 A;  3O5J A;  5HW8 A;  2B31 A;  2KGJ A;  4ODM A;  1BKF A;  2M2A A;  4DWS D;  1FJD A;  2QF8 A;  1ITX A;  1FKJ A;  1F40 A;  4U85 A;  3I6C A;  4IQ2 A;  1L1P A;  3UI6 A;  4ODP A;  4QIB A;  4MNJ A;  2ZR4 A;  3RM8 A;  1NWR A;  3WKZ A;  2ESC A;  4J4N A;  4GIV A;  1QPF A;  1QZ2 A;  2A3C A;  4P8V A;  5DIT A;  1JND A;  3JYJ A;  4KR0 B;  3CHF A;  4JYS A;  2XP7 A;  1T11 A;  1ZB5 A;  3O5R A;  1FKF A;  3O5K A;  3AS2 A;  2DSV A;  1GOI A;  2L2S A;  4G50 A;  2MLX A;  4L72 B;  1E15 A;  4J4O A;  3W4R A;  1NWT A;  3WIJ A;  4W9Q A;  1LJY A;  5J6E A;  4N19 A;  5HW7 A;  2UZ5 A;  2DT3 A;  1F8A B;  4S3J A;  4R0X A;  4R5E A;  4DRO A;  4ODQ A;  4NNR A;  3CGN A;  4KQZ A;  4DWS B;  2DPE A;  3NI6 A;  1K9T A;  4IPX A;  4W9O A;  1YAT A;  2DT1 A;  4LAW A;  1CTN A;  4ZPV R;  3PRA A;  1HJV A;  1Q6I A;  1FKG A;  3RM9 A;  1ZBV A;  4IT6 A;  1Q6H A;  1ZBC A;  4TYO A;  1HXV A;  1NH6 A;  2AOS A;  4P8U A;  5GQB A;  4WKH A;  2RUQ A;  1E44 A;  4JFL A;  4Z2L A;  1HKK A;  3O5I A;  2M08 A;  4WKA A;  2XPA A;  2FKE A;  2DT0 A;  3B9E A;  1E6Z A;  1FAP A;  1W1V A;  2MNT A;  1BL4 A;  2VN1 A;  2RUR A;  2XP6 A;  4Q7N A;  5DF0 A;  3WQV A;  4DRK A;  5HWC A;  3ARV A;  2PPP A;  1FFQ A;  3KAH A;  2K8I A;  3JYM A;  5HT1 A;  1OWQ A;  1LQ0 A;  1X6L A;  4JFJ A;  3PRD A;  1D7I A;  1EYM A;  3AS3 A;  2A3B A;  2LJ4 A;  1M5Y A;  1ZBW A;  2YBT A;  4XAK A;  4ZPW R;  4DRI A;  2ZQT A;  2DT2 A;  4WK9 A;  3AS0 A;  4TW6 A;  2VCD A;  1B6C A;  1WNO A;  1PBK A;  5GPR A;  5D75 A;  1E9L A;  1W1P A;  1NMV A;  3B8S A;  2ITK A;  4O2T A;  1X6N A;  2O92 A;  1J4H A;  3UF8 A;  3WH0 A;  4AY1 A;  3WD1 A;  1J6Y A;  4DRM A;  1LL6 A;  3TCZ A;  3O5F A;  2DSW A;  4QT2 A;  1E6P A;  1EHN A;  4LAV A;  4P8W A;  1A7X A;  1UR8 A;  1KT0 A;  2Q5A A;  3MDY B;  4HBE A;  4JFK A;  4ZPT R;  3IHZ A;  5JH8 A;  1J4I A;  4TNS A;  4Z2G A;  3ALG A;  1JNT A;  1ZK6 A;  2YBU A;  2DG9 A;  4Z2K A;  1U79 A;  3ARU A;  3TDB A;  2Y78 A;  4WJX A;  4C02 B;  1Y0O A;  3CH9 A;  2MLY A;  2ZR6 A;  1E6R A;  4MSP A;  1UR9 A;  4NSB A;  2XP3 A;  3ALF A;  5BXJ A;  2FDM A;  3G6M A;  1LG1 A;  2MF9 A;  5DIV A;  4DRH A;  3KCE A;  4MPK A;  1P5Q A;  5DO2 A;  1Q6U A;  5HUA A;  5I98 A;  3OA5 A;  3JXV A;  2WK2 A;  4MTV A;  3CHD A;  4ODO A;  1TCO C;  3ARS A;  1GPF A;  1W9V A;  3EY6 A;  1FFR A;  4Z2J A;  4U86 A;  1D2K A;  1FKD A;  1EIB A;  3GU0 A;  2G8Z A;  3ARP A;  2JZV A;  4ML4 A;  3ART A;  2OLH A;  1O6I A;  1R9H A;  2WLZ A;  2P4V A;  3ARQ A;  3KAD A;  5HWB A;  2ZR5 A;  2M1I A;  3IKD A;  1FKI A;  1W1T A;  2KI3 A;  3O5D A;  5HKG A;  4S3K A;  3GTY X;  4ITZ A;  2A3A A;  1JNS A;  2DG4 A;  3WD3 A;  1XHG A;  4ODK A;  3FAP A;  2ZQS A;  1ZCN A;  2LPV A;  1HKI A;  4IQC A;  3WL1 A;  1LL4 A;  1N1A A;  3ARX A;  1W26 A;  2FAP A;  3NTP A;  2XP5 A;  3ARR A;  3O5L A;  4DRJ A;  4MNK A;  4TX0 A;  4Z2I A;  2MPH A;  2G41 A;  2ZQV A;  1FKT A;  2WLY A;  2KO7 A;  1FD9 A;  2KR7 A;  3CZ8 A;  2F2D A;  1W9U A;  1FKH A;  3ARY A;  3RM4 A;  5HBF A;  1EQ3 A;  1NWU A;  3O5Q A;  3O5M A;  1PIN A;  3GPK A;  4MAV A;  1J4R A;  1E6N A;  4DT4 A;  3KAC A;  3KAG A;  1VF8 A;  3PR9 A;  3TC5 A;  3UQA A;  3KZ7 A;  1QPL A;  1XRV A;  1D7J A;  5GPG A;  2XPB A;  3RFW A;  1GUV A;  1TFV A;  2PPO A;  1YW5 A;  2PN0 A;  1HJW A;  1NMW A;  1WB0 A;  3KAI A;  4BF8 A;  1RD6 A;  1ROT A;  2KFW A;  3G6L A;  3BMB A;  4W5U A;  3UI4 A;  4GGQ A;  4DZ2 A;  2N87 A;  4ODR A;  2MLZ A; 
#chains in the Genus database with same CATH homology
 2WM0 A;  4ZS6 A;  3H9R B;  4L3N A;  2OFN A;  3CHC A;  3VAW A;  2A3E A;  4TW7 A;  1NSG A;  4DRQ A;  4DRP A;  1SYT A;  3WD0 A;  1FKR A;  1Q1C A;  4WKF A;  4DRN A;  3WD2 A;  2XP8 A;  4TW8 A;  3ARO A;  1EDQ A;  3RME A;  4QT3 A;  3CGM A;  5B8I C;  3IK8 A;  1JNE A;  3RGC A;  1FKL A;  2PV2 A;  2ZQU A;  4HBO A;  3LUO A;  4DIP A;  5HTG A;  3CHE A;  3O5E A;  2O9O A;  4DWS C;  2PI6 A;  3B7X A;  2D9F A;  1ZL1 A;  4W9P A;  4FN2 A;  3WQW A;  2F21 A;  1IX5 A;  4LAY A;  2PBC A;  2IUZ A;  3PA7 A;  2DG3 A;  3KAF A;  1H0I A;  1FKS A;  1C9H A;  3AQU A;  4URI A;  1SR0 A;  4Q22 A;  4ODN A;  1NWS A;  2XP9 A;  3UQI A;  5HW6 A;  1FKB A;  4DWS A;  2IF4 A;  3O5O A;  4LGX A;  1OGG A;  2LKN A;  1ROU A;  5DIU A;  3WL0 A;  3ODK A;  3NRK A;  3UI5 A;  2PV1 A;  4MGV A;  4JFI A;  4PTM A;  3KAB A;  4DH0 A;  1KT1 A;  3ARZ A;  5DEZ A;  1JVW A;  2AWG A;  1D7H A;  3FXY A;  4LAX A;  1W1Y A;  2PPN A;  4NZC A;  3O5G A;  2DSZ A;  1LL7 A;  1LG2 A;  1OGB A;  1KFW A;  3O5P A;  3OOB A;  4IT4 A;  1HKJ A;  2RQS A;  2F4E A;  2PV3 A;  3QOK A;  4G2P A;  2DSU A;  4DZ3 A;  1WAW A;  4WIW A;  4FAP A;  2LGO A;  3WD4 A;  2RUC A;  4ODL A;  4JFM A;  3UQB A;  3B9D A;  4U84 A;  4MNM A;  1ZBK A;  4P8X A;  3PRB A;  3B9A A;  3BXW A;  3IKG A;  4MNL A;  1W9P A;  1FKK A;  2XP4 A;  4QZV B;  2KE0 A;  1D6O A;  1ZU8 A;  3ARW A;  2RSE A;  3FY1 A;  2RUD A;  4HAR A;  1HJX A;  1HKM A;  4Z2H A;  1H0G A;  3AS1 A;  5HW8 A;  3O5J A;  2B31 A;  2KGJ A;  4ODM A;  1BKF A;  2M2A A;  4DWS D;  1FJD A;  2QF8 A;  1ITX A;  1FKJ A;  1F40 A;  4U85 A;  3I6C A;  4IQ2 A;  1L1P A;  3UI6 A;  4ODP A;  4QIB A;  4MNJ A;  2ZR4 A;  3RM8 A;  1NWR A;  3WKZ A;  2ESC A;  4J4N A;  4GIV A;  1QPF A;  1QZ2 A;  2A3C A;  4P8V A;  5DIT A;  1JND A;  3JYJ A;  4KR0 B;  3CHF A;  4JYS A;  2XP7 A;  1T11 A;  1ZB5 A;  3O5R A;  1FKF A;  3O5K A;  3AS2 A;  2DSV A;  1GOI A;  2L2S A;  4G50 A;  2MLX A;  4L72 B;  1E15 A;  4J4O A;  3W4R A;  1NWT A;  3WIJ A;  4W9Q A;  1LJY A;  5J6E A;  4N19 A;  5HW7 A;  2UZ5 A;  2DT3 A;  1F8A B;  4S3J A;  4R0X A;  4R5E A;  4DRO A;  4ODQ A;  4NNR A;  3CGN A;  4KQZ A;  4DWS B;  2DPE A;  3NI6 A;  1K9T A;  4IPX A;  4W9O A;  1YAT A;  2DT1 A;  4LAW A;  1CTN A;  4ZPV R;  3PRA A;  1HJV A;  1Q6I A;  1FKG A;  3RM9 A;  1ZBV A;  4IT6 A;  1Q6H A;  1ZBC A;  4TYO A;  1HXV A;  1NH6 A;  2AOS A;  4P8U A;  5GQB A;  4WKH A;  2RUQ A;  4JFL A;  4Z2L A;  1HKK A;  3O5I A;  2M08 A;  4WKA A;  2XPA A;  2FKE A;  2DT0 A;  3B9E A;  1E6Z A;  1FAP A;  1W1V A;  2MNT A;  1BL4 A;  2VN1 A;  2RUR A;  2XP6 A;  4Q7N A;  5DF0 A;  3WQV A;  4DRK A;  5HWC A;  3ARV A;  2PPP A;  1FFQ A;  3KAH A;  2K8I A;  3JYM A;  5HT1 A;  1OWQ A;  1LQ0 A;  1X6L A;  4JFJ A;  3PRD A;  1D7I A;  1EYM A;  3AS3 A;  2A3B A;  2LJ4 A;  1M5Y A;  1ZBW A;  2YBT A;  4XAK A;  4ZPW R;  4DRI A;  2ZQT A;  2DT2 A;  4WK9 A;  3AS0 A;  4TW6 A;  2VCD A;  1B6C A;  1WNO A;  1PBK A;  5GPR A;  5D75 A;  1E9L A;  1W1P A;  1NMV A;  3B8S A;  2ITK A;  4O2T A;  1X6N A;  2O92 A;  1J4H A;  3UF8 A;  3WH0 A;  4AY1 A;  3WD1 A;  1J6Y A;  4DRM A;  1LL6 A;  3TCZ A;  3O5F A;  2DSW A;  4QT2 A;  1E6P A;  1EHN A;  4LAV A;  4P8W A;  1A7X A;  1UR8 A;  1KT0 A;  2Q5A A;  3MDY B;  4HBE A;  4JFK A;  4ZPT R;  3IHZ A;  5JH8 A;  1J4I A;  4TNS A;  4Z2G A;  3ALG A;  1JNT A;  1ZK6 A;  2YBU A;  2DG9 A;  4Z2K A;  1U79 A;  3ARU A;  3TDB A;  2Y78 A;  4WJX A;  4C02 B;  1Y0O A;  3CH9 A;  2MLY A;  2ZR6 A;  1E6R A;  4MSP A;  1UR9 A;  4NSB A;  2XP3 A;  3ALF A;  5BXJ A;  2FDM A;  3G6M A;  1LG1 A;  2MF9 A;  5DIV A;  4DRH A;  3KCE A;  4MPK A;  1P5Q A;  5DO2 A;  1Q6U A;  5HUA A;  5I98 A;  3OA5 A;  3JXV A;  2WK2 A;  4MTV A;  3CHD A;  4ODO A;  1TCO C;  3ARS A;  1GPF A;  1W9V A;  3EY6 A;  1FFR A;  4Z2J A;  4U86 A;  1D2K A;  1FKD A;  1EIB A;  2G8Z A;  3ARP A;  2JZV A;  4ML4 A;  3ART A;  2OLH A;  1O6I A;  1R9H A;  2WLZ A;  3ARQ A;  3KAD A;  5HWB A;  2ZR5 A;  2M1I A;  3IKD A;  1FKI A;  1W1T A;  2KI3 A;  3O5D A;  5HKG A;  4S3K A;  4ITZ A;  2A3A A;  1JNS A;  2DG4 A;  3WD3 A;  1XHG A;  4ODK A;  3FAP A;  2ZQS A;  1ZCN A;  2LPV A;  1HKI A;  4IQC A;  3WL1 A;  1LL4 A;  1N1A A;  3ARX A;  1W26 A;  2FAP A;  3NTP A;  2XP5 A;  3ARR A;  3O5L A;  4DRJ A;  4MNK A;  4TX0 A;  4Z2I A;  2MPH A;  2G41 A;  2ZQV A;  1FKT A;  2WLY A;  2KO7 A;  1FD9 A;  2KR7 A;  3CZ8 A;  2F2D A;  1W9U A;  1FKH A;  3ARY A;  3RM4 A;  5HBF A;  1EQ3 A;  1NWU A;  3O5Q A;  3O5M A;  1PIN A;  3GPK A;  4MAV A;  1J4R A;  1E6N A;  4DT4 A;  3KAC A;  3KAG A;  1VF8 A;  3PR9 A;  3TC5 A;  3UQA A;  3KZ7 A;  1QPL A;  1XRV A;  1D7J A;  5GPG A;  2XPB A;  3RFW A;  1GUV A;  1TFV A;  2PPO A;  1YW5 A;  1HJW A;  1NMW A;  1WB0 A;  3KAI A;  4BF8 A;  1RD6 A;  1ROT A;  2KFW A;  3G6L A;  4W5U A;  3UI4 A;  4GGQ A;  4DZ2 A;  2N87 A;  4ODR A;  2MLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...