2VN1A

Crystal structure of the fk506-binding domain of plasmodium falciparum fkbp35 in complex with fk506
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
123
structure length
123
Chain Sequence
FEKVELTADGGVIKTILKKGDEGEENIPKKGNEVTVHYVGKLESTGKVFDSSFDRNVPFKFHLEQGEVIKGWDICVSSMRKNEKCLVRIESMYGYGDEGCGESIPGNSVLLFEIELLSFRELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Fk506 Binding Domain of Plasmodium Falciparum Fkbp35 in Complex with Fk506.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
molecule keywords 70 KDA PEPTIDYLPROLYL ISOMERASE
total genus 31
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2vn1A01
4TNSA 3PRBA 1BL4A 3JYMA 2PV3A 1KT0A 3O5GA 1YW5A 3IKDA 1J4HA 2ZQUA 1J6YA 2Q5AA 1KT1A 1FKDA 2PV2A 4DRJA 4NNRA 1Y0OA 3KZ7A 3OOBA 2LKNA 4IPXA 5BXJA 2F4EA 1JNSA 2M2AA 3LUOA 4J4NA 1FKLA 1NMWA 4DZ3A 3GPKA 3H9RB 3I6CA 4C02B 3KAIA 4DRHA 5DITA 1NSGA 2M08A 2F21A 2XP6A 4JFIA 4R0XA 4BF8A 2ZR5A 4LAWA 4MGVA 3PA7A 4DRQA 1FKIA 3IHZA 3RFWA 5HW8A 2FAPA 5HW6A 4GGQA 3O5MA 3KAGA 1P5QA 2RUDA 1HXVA 3IKGA 1B6CA 4GIVA 1T11A 4JFJA 4TW7A 2ZR6A 4DH0A 4ODQA 4LAVA 1W26A 3CGMA 4DIPA 2DG9A 1FAPA 5DIUA 5B8IC 2KI3A 1D7HA 4ODKA 4IQ2A 2VN1A 2RUQA 2KGJA 1FKFA 2PPNA 2KR7A 4J4OA 5HWBA 4JYSA 2RQSA 4DT4A 3UQAA 1TCOC 1F40A 3EY6A 2PV1A 1D6OA 3O5FA 3TCZA 1D7IA 2MNTA 1JNTA 4DRIA 5HUAA 5I98A 1U79A 2XPAA 2MLYA 4U84A 1Q6HA 4LAYA 3KAFA 4DZ2A 1M5YA 1ROTA 3CGNA 3JYJA 2ZQVA 4DRNA 4W9PA 2D9FA 3IK8A 2KFWA 2RUCA 2MLZA 4FN2A 4TW8A 4ODLA 4DRPA 3NRKA 3O5OA 5HW7A 1FKHA 3UQIA 3UQBA 2PPPA 1ZK6A 2XP3A 3UI6A 2XP5A 2M1IA 2PBCA 3MDYB 3O5PA 2K8IA 4ODPA 4U85A 3O5KA 3O5LA 2Y78A 4ODMA 3TC5A 1Q1CA 4W9QA 1EQ3A 2JZVA 4TYOA 1J4RA 2DG4A 2RSEA 2XP7A 3O5QA 3PRDA 1FJDA 2L2SA 1Q6IA 1JVWA 1R9HA 3VAWA 1FKRA 4U86A 3KADA 3UF8A 2IF4A 2LPVA 5GPGA 4ODNA 2ZQSA 4MSPA 1FKBA 4DRMA 1FKTA 1PBKA 2XP4A 2FKEA 3KAHA 3O5JA 5HKGA 1FD9A 4G2PA 3RGCA 1A7XA 4QIBA 2RURA 1FKGA 1FKSA 1PINA 2OFNA 4ODOA 4QT3A 2ITKA 4ITZA 1FKKA 1F8AB 1J4IA 4DROA 4DRKA 2LGOA 3O5DA 1ROUA 3O5IA 1FKJA 1Q6UA 2LJ4A 3KCEA 5D75A 5HWCA 3UI5A 2XP8A 4JFMA 2KO7A 2KE0A 2XPBA 3KACA 4W9OA 4LAXA 1QZ2A 3KABA 2XP9A 2VCDA 5HT1A 1BKFA 4JFLA 2AWGA 1YATA 3ODKA 2ZQTA 5HTGA 2ZR4A 1ZCNA 2MPHA 4QT2A 4TX0A 2F2DA 4FAPA 3NI6A 4N19A 4TW6A 3JXVA 5J6EA 4G50A 1D7JA 2PPOA 3O5RA 4JFKA 1C9HA 2DG3A 2UZ5A 4O2TA 4ODRA 5DIVA 4IQCA 3TDBA 2N87A 1EYMA 1L1PA 1QPFA 1QPLA 2MLXA 3FAPA 1N1AA 3NTPA 3O5EA 3UI4A 3WH0A 2MF9A 1NMVA 3B7XA
chains in the Genus database with same CATH superfamily
4TNSA 3PRBA 3BMBA 5GQBA 4XAKA 3O5GA 3IKDA 1J4HA 2ZQUA 1FKDA 2PV2A 4DRJA 3OOBA 3LUOA 4P8UA 3GPKA 3I6CA 3KAIA 1JCHB 1E6RA 1FKIA 3RFWA 5HW8A 2RUDA 4WKAA 1B6CA 2ZR6A 4DH0A 4DIPA 3CGMA 1FAPA 1W1YA 4WKHA 3WL0A 1WAWA 2KGJA 2PI6A 5HWBA 4JYSA 2RQSA 3UQAA 3TCZA 4MTVA 4DRIA 2MNTA 4NSBA 5I98A 1U79A 3G6LA 4DZ2A 2DT0A 1ZB5A 4FN2A 2O92A 3O5OA 1FKHA 2XP5A 2M1IA 4U85A 3O5PA 2K8IA 1O6IA 3ARRA 1EQ3A 2RSEA 2F23A 3O5QA 4Q7NA 1ZU8A 1Q6IA 4UDMA 2YBUA 3KADA 3UF8A 2IF4A 5GPGA 4MSPA 1FKTA 5DEZA 4KQZA 3B9AA 1FKSA 4QT3A 2ITKA 4DROA 1UR8A 1ROUA 2O9OA 1E6PA 2PN0A 1EIBA 2KE0A 2AOSA 1W9VA 1HJXA 1E44A 2VCDA 2A3CA 1YATA 1HKIA 2ZQTA 3BXWA 2ZR4A 3WD1A 1NWRA 3AS2A 3WQWA 3ALGA 1X6NA 1WNOA 3CHFA 3NI6A 2B5UB 3JXVA 4ODPA 3O5RA 5DIVA 2UZ5A 3ARPA 1JNDA 1EYMA 1GOIA 1QPLA 2MLXA 3FAPA 1ZBWA 1ITXA 1LG1A 1W1PA 1HKJA 3WQVA 4URIA 1FFRA 1J6YA 3B8SA 5BXJA 2F4EA 1JNSA 4J4NA 3WD2A 1NMWA 3GTYX 4NZCA 4MPKA 5DITA 1NSGA 2M08A 2XP6A 4DRQA 4MNLA 3PA7A 4Z2LA 1ZL1A 2P4VA 3KAGA 1P5QA 4GIVA 1E9LA 4ODQA 1W26A 3FY1A 1HKKA 2KR7A 4J4OA 1TCOC 1D6OA 1D7IA 1JNTA 5HUAA 4MNJA 4LAYA 3KAFA 3CHCA 1GPFA 1M5YA 2A3BA 3CGNA 3JYJA 4ZPVR 1XRVA 2D9FA 2EULA 3QOKA 1JNEA 3NRKA 4DWSA 5HW7A 4ZS6A 3UI6A 3MDYB 3O5KA 2Y78A 4ODMA 3OA5A 1J4RA 1E15A 3RM8A 3PRDA 2L2SA 1HKMA 1KFWA 1PBKA 5HKGA 2B31A 1GUVA 4S3JA 4ITZA 1F8AB 1J4IA 2WLYA 4HBEA 2LJ4A 1RD6A 3KACA 3ALFA 4W9OA 5HBFA 4LAXA 2XP9A 1WB0A 2AWGA 4WK9A 4P8VA 1ZCNA 3CH9A 3B9DA 4TX0A 2ETNA 1D2KA 1X6LA 4G50A 1D7JA 2PPOA 1C9HA 2DG3A 3EIPA 3B9EA 3TDBA 2G8ZA 1QPFA 1NH6A 3WD3A 2QF8A 3UI4A 2MF9A 3RMEA 2DT1A 3W4RA 3JYMA 2PV3A 1KT0A 1NWSA 1YW5A 3CHEA 3ARUA 2Q5AA 4P8XA 4DWSB 1NWTA 3KZ7A 4IPXA 2LKNA 3WL1A 1FKLA 4WIWA 1W1TA 3H9RB 2DT3A 2F21A 4JFIA 1LL7A 4MGVA 1HJWA 1H0IA 4GGQA 3WD4A 2WLZA 1T11A 4JFJA 2DSZA 4LAVA 1IX5A 2DG9A 1K9TA 1D7HA 4ODKA 2VN1A 2RUQA 1FKFA 1W9UA 2DSWA 2PPNA 1OWQA 2A3EA 2G41A 1F40A 3EY6A 2PV1A 3CHDA 3O5FA 3RM4A 2MLYA 4W5UA 3G6MA 3AS1A 1TFVA 1ROTA 4QZVB 1OGBA 3AQUA 4DRNA 4W9PA 3IK8A 4TW8A 2RUCA 2MLZA 2WK2A 3UQIA 3PR9A 1ZK6A 2XP3A 1CTNA 5HW6A 1LQ0A 2WM0A 3O5LA 2IUZA 3TC5A 3FXYA 2JZVA 4TYOA 4L72B 3ARXA 4S3KA 3ARTA 1FKRA 4WJXA 4ODNA 4WKFA 1FKBA 3KAHA 2FKEA 1EHNA 4G2PA 1A7XA 4QIBA 2RURA 1PINA 1FKKA 4DRKA 2LGOA 1FKJA 1UR9A 3KCEA 5D75A 3UI5A 1SR0A 2XP8A 2XPBA 1LJYA 1QZ2A 3KABA 1BKFA 4JFLA 5HTGA 3WD0A 4QT2A 1EDQA 3ARZA 2F2DA 2ESCA 4O2TA 4Z2HA 4IT4A 4IQCA 4P8WA 4DWSD 4L3NA 4LGXA 3O5EA 4KR0B 2DT2A 3AROA 3WH0A 1BL4A 3ARWA 1E6ZA 1KT1A 4NNRA 1Y0OA 3WKZA 2M2AA 4DZ3A 2YBTA 1HJVA 1LL6A 4C02B 4MNKA 4DRHA 4PTMA 4R0XA 4BF8A 1SYTA 2ZR5A 4LAWA 3IHZA 4ZPWR 2DSVA 1E6NA 2FAPA 5JH8A 3O5MA 1W1VA 1HXVA 3IKGA 3ARVA 4TW7A 5GPRA 3WIJA 2OLHA 5DIUA 5B8IC 2DSUA 2KI3A 4IQ2A 3ARQA 4IT6A 4DT4A 3AS0A 2FDMA 5DO2A 2XPAA 1H0GA 4U84A 1Q6HA 1NWUA 2ZQVA 1ZBKA 2KFWA 3CZ8A 1GRJA 4ODLA 4DRPA 3UQBA 2PPPA 4ZPTR 2A3AA 4R5EA 2PBCA 3PRAA 4Z2JA 1Q1CA 4W9QA 4MAVA 2XP7A 2DG4A 3GU0A 1FJDA 1W9PA 1R9HA 1JVWA 3VAWA 4U86A 1FFQA 4AY1A 2LPVA 1OGGA 3AS3A 2ZQSA 4HARA 4DRMA 3ARSA 2XP4A 3O5JA 4Q22A 1LL4A 4Z2IA 1FD9A 4MNMA 3RGCA 4DWSC 1FKGA 4ODOA 2OFNA 5DF0A 1LG2A 4ML4A 3O5IA 3O5DA 2DPEA 4Z2KA 3ARYA 1Q6UA 1ZBVA 1VF8A 3RM9A 5HWCA 4JFMA 2KO7A 5HT1A 3ODKA 2MPHA 4FAPA 4N19A 4TW6A 5J6EA 4ODRA 4JFKA 2N87A 1L1PA 4HBOA 1N1AA 3NTPA 1XHGA 1ZBCA 1NMVA 4Z2GA 3B7XA
chains in the Genus database with same CATH topology
4TNSA 3PRBA 5GQBA 4XAKA 3O5GA 3IKDA 1J4HA 2ZQUA 1FKDA 2PV2A 4DRJA 3OOBA 3LUOA 4P8UA 3GPKA 3I6CA 3KAIA 1E6RA 1FKIA 3RFWA 5HW8A 2RUDA 4WKAA 1B6CA 2ZR6A 4DH0A 4DIPA 3CGMA 1FAPA 1W1YA 4WKHA 3WL0A 1WAWA 2KGJA 2PI6A 5HWBA 4JYSA 2RQSA 3UQAA 3TCZA 4MTVA 4DRIA 2MNTA 4NSBA 5I98A 1U79A 3G6LA 4DZ2A 2DT0A 1ZB5A 4FN2A 2O92A 3O5OA 1FKHA 2XP5A 2M1IA 4U85A 3O5PA 2K8IA 1O6IA 3ARRA 1EQ3A 2RSEA 3O5QA 4Q7NA 1ZU8A 1Q6IA 2YBUA 3KADA 3UF8A 2IF4A 5GPGA 4MSPA 1FKTA 5DEZA 4KQZA 3B9AA 1FKSA 4QT3A 2ITKA 4DROA 1UR8A 1ROUA 2O9OA 1E6PA 1EIBA 2KE0A 2AOSA 1W9VA 1HJXA 2VCDA 2A3CA 1YATA 1HKIA 2ZQTA 3BXWA 2ZR4A 3WD1A 1NWRA 3AS2A 3WQWA 3ALGA 1X6NA 1WNOA 3CHFA 3NI6A 3JXVA 4ODPA 3O5RA 5DIVA 2UZ5A 3ARPA 1JNDA 1EYMA 1GOIA 1QPLA 2MLXA 3FAPA 1ZBWA 1ITXA 1LG1A 1W1PA 1HKJA 3WQVA 4URIA 1FFRA 1J6YA 3B8SA 5BXJA 2F4EA 1JNSA 4J4NA 3WD2A 1NMWA 4NZCA 4MPKA 5DITA 1NSGA 2M08A 2XP6A 4DRQA 4MNLA 3PA7A 4Z2LA 1ZL1A 3KAGA 1P5QA 4GIVA 1E9LA 4ODQA 1W26A 3FY1A 1HKKA 2KR7A 4J4OA 1TCOC 1D6OA 1D7IA 1JNTA 5HUAA 4MNJA 4LAYA 3KAFA 3CHCA 1GPFA 1M5YA 2A3BA 3CGNA 3JYJA 4ZPVR 1XRVA 2D9FA 3QOKA 1JNEA 3NRKA 4DWSA 5HW7A 4ZS6A 3UI6A 3MDYB 3O5KA 2Y78A 4ODMA 3OA5A 1J4RA 1E15A 3RM8A 3PRDA 2L2SA 1HKMA 1KFWA 1PBKA 5HKGA 2B31A 1GUVA 4S3JA 4ITZA 1F8AB 1J4IA 2WLYA 4HBEA 2LJ4A 1RD6A 3KACA 3ALFA 4W9OA 5HBFA 4LAXA 2XP9A 1WB0A 2AWGA 4WK9A 4P8VA 1ZCNA 3CH9A 3B9DA 4TX0A 1D2KA 1X6LA 4G50A 1D7JA 2PPOA 1C9HA 2DG3A 3B9EA 3TDBA 2G8ZA 1QPFA 1NH6A 3WD3A 2QF8A 3UI4A 2MF9A 3RMEA 2DT1A 3W4RA 3JYMA 2PV3A 1KT0A 1NWSA 1YW5A 3CHEA 3ARUA 2Q5AA 4P8XA 4DWSB 1NWTA 3KZ7A 4IPXA 2LKNA 3WL1A 1FKLA 4WIWA 1W1TA 3H9RB 2DT3A 2F21A 4JFIA 1LL7A 4MGVA 1HJWA 1H0IA 4GGQA 3WD4A 2WLZA 1T11A 4JFJA 2DSZA 4LAVA 1IX5A 2DG9A 1K9TA 1D7HA 4ODKA 2VN1A 2RUQA 1FKFA 1W9UA 2DSWA 2PPNA 1OWQA 2A3EA 2G41A 1F40A 3EY6A 2PV1A 3CHDA 3O5FA 3RM4A 2MLYA 4W5UA 3G6MA 3AS1A 1TFVA 1ROTA 4QZVB 1OGBA 3AQUA 4DRNA 4W9PA 3IK8A 4TW8A 2RUCA 2MLZA 2WK2A 3UQIA 3PR9A 1ZK6A 2XP3A 1CTNA 5HW6A 1LQ0A 2WM0A 3O5LA 2IUZA 3TC5A 3FXYA 2JZVA 4TYOA 4L72B 3ARXA 4S3KA 3ARTA 1FKRA 4WJXA 4ODNA 4WKFA 1FKBA 3KAHA 2FKEA 1EHNA 4G2PA 1A7XA 4QIBA 2RURA 1PINA 1FKKA 4DRKA 2LGOA 1FKJA 1UR9A 3KCEA 5D75A 3UI5A 1SR0A 2XP8A 2XPBA 1LJYA 1QZ2A 3KABA 1BKFA 4JFLA 5HTGA 3WD0A 4QT2A 1EDQA 3ARZA 2F2DA 2ESCA 4O2TA 4Z2HA 4IT4A 4IQCA 4P8WA 4DWSD 4L3NA 4LGXA 3O5EA 4KR0B 2DT2A 3AROA 3WH0A 1BL4A 3ARWA 1E6ZA 1KT1A 4NNRA 1Y0OA 3WKZA 2M2AA 4DZ3A 2YBTA 1HJVA 1LL6A 4C02B 4MNKA 4DRHA 4PTMA 4R0XA 4BF8A 1SYTA 2ZR5A 4LAWA 3IHZA 4ZPWR 2DSVA 1E6NA 2FAPA 5JH8A 3O5MA 1W1VA 1HXVA 3IKGA 3ARVA 4TW7A 5GPRA 3WIJA 2OLHA 5DIUA 5B8IC 2DSUA 2KI3A 4IQ2A 3ARQA 4IT6A 4DT4A 3AS0A 2FDMA 5DO2A 2XPAA 1H0GA 4U84A 1Q6HA 1NWUA 2ZQVA 1ZBKA 2KFWA 3CZ8A 4DRPA 4ODLA 3UQBA 2PPPA 4ZPTR 2A3AA 4R5EA 2PBCA 3PRAA 4Z2JA 1Q1CA 4W9QA 4MAVA 2XP7A 2DG4A 1FJDA 1W9PA 1R9HA 1JVWA 3VAWA 4U86A 1FFQA 4AY1A 2LPVA 1OGGA 3AS3A 2ZQSA 4HARA 4DRMA 3ARSA 2XP4A 3O5JA 4Q22A 1LL4A 4Z2IA 1FD9A 4MNMA 3RGCA 4DWSC 1FKGA 4ODOA 2OFNA 5DF0A 1LG2A 4ML4A 3O5IA 3O5DA 2DPEA 4Z2KA 3ARYA 1Q6UA 1ZBVA 1VF8A 3RM9A 5HWCA 4JFMA 2KO7A 5HT1A 3ODKA 2MPHA 4FAPA 4N19A 4TW6A 5J6EA 4ODRA 4JFKA 2N87A 1L1PA 4HBOA 1N1AA 3NTPA 1XHGA 1ZBCA 1NMVA 4Z2GA 3B7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TNS A;  3PRB A;  1BL4 A;  3JYM A;  2PV3 A;  1KT0 A;  3O5G A;  1YW5 A;  3IKD A;  1J4H A;  2ZQU A;  1J6Y A;  2Q5A A;  1KT1 A;  1FKD A;  2PV2 A;  4DRJ A;  4NNR A;  1Y0O A;  3KZ7 A;  3OOB A;  2LKN A;  4IPX A;  5BXJ A;  2F4E A;  1JNS A;  2M2A A;  3LUO A;  4J4N A;  1FKL A;  1NMW A;  4DZ3 A;  3GPK A;  3H9R B;  3I6C A;  4C02 B;  3KAI A;  4DRH A;  5DIT A;  1NSG A;  2M08 A;  2F21 A;  2XP6 A;  4JFI A;  4R0X A;  4BF8 A;  2ZR5 A;  4LAW A;  4MGV A;  3PA7 A;  4DRQ A;  1FKI A;  3IHZ A;  3RFW A;  5HW8 A;  2FAP A;  5HW6 A;  4GGQ A;  3O5M A;  3KAG A;  1P5Q A;  2RUD A;  1HXV A;  3IKG A;  1B6C A;  4GIV A;  1T11 A;  4JFJ A;  4TW7 A;  2ZR6 A;  4DH0 A;  4ODQ A;  4LAV A;  1W26 A;  3CGM A;  4DIP A;  2DG9 A;  1FAP A;  5DIU A;  5B8I C;  2KI3 A;  1D7H A;  4ODK A;  4IQ2 A;  2VN1 A;  2RUQ A;  2KGJ A;  1FKF A;  2PPN A;  2KR7 A;  4J4O A;  5HWB A;  4JYS A;  2RQS A;  4DT4 A;  3UQA A;  1TCO C;  1F40 A;  3EY6 A;  2PV1 A;  1D6O A;  3O5F A;  3TCZ A;  1D7I A;  2MNT A;  1JNT A;  4DRI A;  5HUA A;  5I98 A;  1U79 A;  2XPA A;  2MLY A;  4U84 A;  1Q6H A;  4LAY A;  3KAF A;  4DZ2 A;  1M5Y A;  1ROT A;  3CGN A;  3JYJ A;  2ZQV A;  4DRN A;  4W9P A;  2D9F A;  3IK8 A;  2KFW A;  2RUC A;  2MLZ A;  4FN2 A;  4TW8 A;  4ODL A;  4DRP A;  3NRK A;  3O5O A;  5HW7 A;  1FKH A;  3UQI A;  3UQB A;  2PPP A;  1ZK6 A;  2XP3 A;  3UI6 A;  2XP5 A;  2M1I A;  2PBC A;  3MDY B;  3O5P A;  2K8I A;  4ODP A;  4U85 A;  3O5K A;  3O5L A;  2Y78 A;  4ODM A;  3TC5 A;  1Q1C A;  4W9Q A;  1EQ3 A;  2JZV A;  4TYO A;  1J4R A;  2DG4 A;  2RSE A;  2XP7 A;  3O5Q A;  3PRD A;  1FJD A;  2L2S A;  1Q6I A;  1JVW A;  1R9H A;  3VAW A;  1FKR A;  4U86 A;  3KAD A;  3UF8 A;  2IF4 A;  2LPV A;  5GPG A;  4ODN A;  2ZQS A;  4MSP A;  1FKB A;  4DRM A;  1FKT A;  1PBK A;  2XP4 A;  2FKE A;  3KAH A;  3O5J A;  5HKG A;  1FD9 A;  4G2P A;  3RGC A;  1A7X A;  4QIB A;  2RUR A;  1FKG A;  1FKS A;  1PIN A;  2OFN A;  4ODO A;  4QT3 A;  2ITK A;  4ITZ A;  1FKK A;  1F8A B;  1J4I A;  4DRO A;  4DRK A;  2LGO A;  3O5D A;  1ROU A;  3O5I A;  1FKJ A;  1Q6U A;  2LJ4 A;  3KCE A;  5D75 A;  5HWC A;  3UI5 A;  2XP8 A;  4JFM A;  2KO7 A;  2KE0 A;  2XPB A;  3KAC A;  4W9O A;  4LAX A;  1QZ2 A;  3KAB A;  2XP9 A;  2VCD A;  5HT1 A;  1BKF A;  4JFL A;  2AWG A;  1YAT A;  3ODK A;  2ZQT A;  5HTG A;  2ZR4 A;  1ZCN A;  2MPH A;  4QT2 A;  4TX0 A;  2F2D A;  4FAP A;  3NI6 A;  4N19 A;  4TW6 A;  3JXV A;  5J6E A;  4G50 A;  1D7J A;  2PPO A;  3O5R A;  4JFK A;  1C9H A;  2DG3 A;  2UZ5 A;  4O2T A;  4ODR A;  5DIV A;  4IQC A;  3TDB A;  2N87 A;  1EYM A;  1L1P A;  1QPF A;  1QPL A;  2MLX A;  3FAP A;  1N1A A;  3NTP A;  3O5E A;  3UI4 A;  3WH0 A;  2MF9 A;  1NMV A;  3B7X A; 
#chains in the Genus database with same CATH topology
 4TNS A;  3PRB A;  3BMB A;  5GQB A;  4XAK A;  3O5G A;  3IKD A;  1J4H A;  2ZQU A;  1FKD A;  2PV2 A;  4DRJ A;  3OOB A;  3LUO A;  4P8U A;  3GPK A;  3I6C A;  3KAI A;  1JCH B;  1E6R A;  1FKI A;  3RFW A;  5HW8 A;  2RUD A;  4WKA A;  1B6C A;  2ZR6 A;  4DH0 A;  4DIP A;  3CGM A;  1FAP A;  1W1Y A;  4WKH A;  3WL0 A;  1WAW A;  2KGJ A;  2PI6 A;  5HWB A;  4JYS A;  2RQS A;  3UQA A;  3TCZ A;  4MTV A;  4DRI A;  2MNT A;  4NSB A;  5I98 A;  1U79 A;  3G6L A;  4DZ2 A;  2DT0 A;  1ZB5 A;  4FN2 A;  2O92 A;  3O5O A;  1FKH A;  2XP5 A;  2M1I A;  4U85 A;  3O5P A;  2K8I A;  1O6I A;  3ARR A;  1EQ3 A;  2RSE A;  2F23 A;  3O5Q A;  4Q7N A;  1ZU8 A;  1Q6I A;  4UDM A;  2YBU A;  3KAD A;  3UF8 A;  2IF4 A;  5GPG A;  4MSP A;  1FKT A;  5DEZ A;  4KQZ A;  3B9A A;  1FKS A;  4QT3 A;  2ITK A;  4DRO A;  1UR8 A;  1ROU A;  2O9O A;  1E6P A;  2PN0 A;  1EIB A;  2KE0 A;  2AOS A;  1W9V A;  1HJX A;  1E44 A;  2VCD A;  2A3C A;  1YAT A;  1HKI A;  2ZQT A;  3BXW A;  2ZR4 A;  3WD1 A;  1NWR A;  3AS2 A;  3WQW A;  3ALG A;  1X6N A;  1WNO A;  3CHF A;  3NI6 A;  2B5U B;  3JXV A;  4ODP A;  3O5R A;  5DIV A;  2UZ5 A;  3ARP A;  1JND A;  1EYM A;  1GOI A;  1QPL A;  2MLX A;  3FAP A;  1ZBW A;  1ITX A;  1LG1 A;  1W1P A;  1HKJ A;  3WQV A;  4URI A;  1FFR A;  1J6Y A;  3B8S A;  5BXJ A;  2F4E A;  1JNS A;  4J4N A;  3WD2 A;  1NMW A;  3GTY X;  4NZC A;  4MPK A;  5DIT A;  1NSG A;  2M08 A;  2XP6 A;  4DRQ A;  4MNL A;  3PA7 A;  4Z2L A;  1ZL1 A;  2P4V A;  3KAG A;  1P5Q A;  4GIV A;  1E9L A;  4ODQ A;  1W26 A;  3FY1 A;  1HKK A;  2KR7 A;  4J4O A;  1TCO C;  1D6O A;  1D7I A;  1JNT A;  5HUA A;  4MNJ A;  4LAY A;  3KAF A;  3CHC A;  1GPF A;  1M5Y A;  2A3B A;  3CGN A;  3JYJ A;  4ZPV R;  1XRV A;  2D9F A;  2EUL A;  3QOK A;  1JNE A;  3NRK A;  4DWS A;  5HW7 A;  4ZS6 A;  3UI6 A;  3MDY B;  3O5K A;  2Y78 A;  4ODM A;  3OA5 A;  1J4R A;  1E15 A;  3RM8 A;  3PRD A;  2L2S A;  1HKM A;  1KFW A;  1PBK A;  5HKG A;  2B31 A;  1GUV A;  4S3J A;  4ITZ A;  1F8A B;  1J4I A;  2WLY A;  4HBE A;  2LJ4 A;  1RD6 A;  3KAC A;  3ALF A;  4W9O A;  5HBF A;  4LAX A;  2XP9 A;  1WB0 A;  2AWG A;  4WK9 A;  4P8V A;  1ZCN A;  3CH9 A;  3B9D A;  4TX0 A;  2ETN A;  1D2K A;  1X6L A;  4G50 A;  1D7J A;  2PPO A;  1C9H A;  2DG3 A;  3EIP A;  3B9E A;  3TDB A;  2G8Z A;  1QPF A;  1NH6 A;  3WD3 A;  2QF8 A;  3UI4 A;  2MF9 A;  3RME A;  2DT1 A;  3W4R A;  3JYM A;  2PV3 A;  1KT0 A;  1NWS A;  1YW5 A;  3CHE A;  3ARU A;  2Q5A A;  4P8X A;  4DWS B;  1NWT A;  3KZ7 A;  4IPX A;  2LKN A;  3WL1 A;  1FKL A;  4WIW A;  1W1T A;  3H9R B;  2DT3 A;  2F21 A;  4JFI A;  1LL7 A;  4MGV A;  1HJW A;  1H0I A;  4GGQ A;  3WD4 A;  2WLZ A;  1T11 A;  4JFJ A;  2DSZ A;  4LAV A;  1IX5 A;  2DG9 A;  1K9T A;  1D7H A;  4ODK A;  2VN1 A;  2RUQ A;  1FKF A;  1W9U A;  2DSW A;  2PPN A;  1OWQ A;  2A3E A;  2G41 A;  1F40 A;  3EY6 A;  2PV1 A;  3CHD A;  3O5F A;  3RM4 A;  2MLY A;  4W5U A;  3G6M A;  3AS1 A;  1TFV A;  1ROT A;  4QZV B;  1OGB A;  3AQU A;  4DRN A;  4W9P A;  3IK8 A;  4TW8 A;  2RUC A;  2MLZ A;  2WK2 A;  3UQI A;  3PR9 A;  1ZK6 A;  2XP3 A;  1CTN A;  5HW6 A;  1LQ0 A;  2WM0 A;  3O5L A;  2IUZ A;  3TC5 A;  3FXY A;  2JZV A;  4TYO A;  4L72 B;  3ARX A;  4S3K A;  3ART A;  1FKR A;  4WJX A;  4ODN A;  4WKF A;  1FKB A;  3KAH A;  2FKE A;  1EHN A;  4G2P A;  1A7X A;  4QIB A;  2RUR A;  1PIN A;  1FKK A;  4DRK A;  2LGO A;  1FKJ A;  1UR9 A;  3KCE A;  5D75 A;  3UI5 A;  1SR0 A;  2XP8 A;  2XPB A;  1LJY A;  1QZ2 A;  3KAB A;  1BKF A;  4JFL A;  5HTG A;  3WD0 A;  4QT2 A;  1EDQ A;  3ARZ A;  2F2D A;  2ESC A;  4O2T A;  4Z2H A;  4IT4 A;  4IQC A;  4P8W A;  4DWS D;  4L3N A;  4LGX A;  3O5E A;  4KR0 B;  2DT2 A;  3ARO A;  3WH0 A;  1BL4 A;  3ARW A;  1E6Z A;  1KT1 A;  4NNR A;  1Y0O A;  3WKZ A;  2M2A A;  4DZ3 A;  2YBT A;  1HJV A;  1LL6 A;  4C02 B;  4MNK A;  4DRH A;  4PTM A;  4R0X A;  4BF8 A;  1SYT A;  2ZR5 A;  4LAW A;  3IHZ A;  4ZPW R;  2DSV A;  1E6N A;  2FAP A;  5JH8 A;  3O5M A;  1W1V A;  1HXV A;  3IKG A;  3ARV A;  4TW7 A;  5GPR A;  3WIJ A;  2OLH A;  5DIU A;  5B8I C;  2DSU A;  2KI3 A;  4IQ2 A;  3ARQ A;  4IT6 A;  4DT4 A;  3AS0 A;  2FDM A;  5DO2 A;  2XPA A;  1H0G A;  4U84 A;  1Q6H A;  1NWU A;  2ZQV A;  1ZBK A;  2KFW A;  3CZ8 A;  1GRJ A;  4ODL A;  4DRP A;  3UQB A;  2PPP A;  4ZPT R;  2A3A A;  4R5E A;  2PBC A;  3PRA A;  4Z2J A;  1Q1C A;  4W9Q A;  4MAV A;  2XP7 A;  2DG4 A;  3GU0 A;  1FJD A;  1W9P A;  1R9H A;  1JVW A;  3VAW A;  4U86 A;  1FFQ A;  4AY1 A;  2LPV A;  1OGG A;  3AS3 A;  2ZQS A;  4HAR A;  4DRM A;  3ARS A;  2XP4 A;  3O5J A;  4Q22 A;  1LL4 A;  4Z2I A;  1FD9 A;  4MNM A;  3RGC A;  4DWS C;  1FKG A;  4ODO A;  2OFN A;  5DF0 A;  1LG2 A;  4ML4 A;  3O5I A;  3O5D A;  2DPE A;  4Z2K A;  3ARY A;  1Q6U A;  1ZBV A;  1VF8 A;  3RM9 A;  5HWC A;  4JFM A;  2KO7 A;  5HT1 A;  3ODK A;  2MPH A;  4FAP A;  4N19 A;  4TW6 A;  5J6E A;  4ODR A;  4JFK A;  2N87 A;  1L1P A;  4HBO A;  1N1A A;  3NTP A;  1XHG A;  1ZBC A;  1NMV A;  4Z2G A;  3B7X A; 
#chains in the Genus database with same CATH homology
 4TNS A;  3PRB A;  5GQB A;  4XAK A;  3O5G A;  3IKD A;  1J4H A;  2ZQU A;  1FKD A;  2PV2 A;  4DRJ A;  3OOB A;  3LUO A;  4P8U A;  3GPK A;  3I6C A;  3KAI A;  1E6R A;  1FKI A;  3RFW A;  5HW8 A;  2RUD A;  4WKA A;  1B6C A;  2ZR6 A;  4DH0 A;  4DIP A;  3CGM A;  1FAP A;  1W1Y A;  4WKH A;  3WL0 A;  1WAW A;  2KGJ A;  2PI6 A;  5HWB A;  4JYS A;  2RQS A;  3UQA A;  3TCZ A;  4MTV A;  4DRI A;  2MNT A;  4NSB A;  5I98 A;  1U79 A;  3G6L A;  4DZ2 A;  2DT0 A;  1ZB5 A;  4FN2 A;  2O92 A;  3O5O A;  1FKH A;  2XP5 A;  2M1I A;  4U85 A;  3O5P A;  2K8I A;  1O6I A;  3ARR A;  1EQ3 A;  2RSE A;  3O5Q A;  4Q7N A;  1ZU8 A;  1Q6I A;  2YBU A;  3KAD A;  3UF8 A;  2IF4 A;  5GPG A;  4MSP A;  1FKT A;  5DEZ A;  4KQZ A;  3B9A A;  1FKS A;  4QT3 A;  2ITK A;  4DRO A;  1UR8 A;  1ROU A;  2O9O A;  1E6P A;  1EIB A;  2KE0 A;  2AOS A;  1W9V A;  1HJX A;  2VCD A;  2A3C A;  1YAT A;  1HKI A;  2ZQT A;  3BXW A;  2ZR4 A;  3WD1 A;  1NWR A;  3AS2 A;  3WQW A;  3ALG A;  1X6N A;  1WNO A;  3CHF A;  3NI6 A;  3JXV A;  4ODP A;  3O5R A;  5DIV A;  2UZ5 A;  3ARP A;  1JND A;  1EYM A;  1GOI A;  1QPL A;  2MLX A;  3FAP A;  1ZBW A;  1ITX A;  1LG1 A;  1W1P A;  1HKJ A;  3WQV A;  4URI A;  1FFR A;  1J6Y A;  3B8S A;  5BXJ A;  2F4E A;  1JNS A;  4J4N A;  3WD2 A;  1NMW A;  4NZC A;  4MPK A;  5DIT A;  1NSG A;  2M08 A;  2XP6 A;  4DRQ A;  4MNL A;  3PA7 A;  4Z2L A;  1ZL1 A;  3KAG A;  1P5Q A;  4GIV A;  1E9L A;  4ODQ A;  1W26 A;  3FY1 A;  1HKK A;  2KR7 A;  4J4O A;  1TCO C;  1D6O A;  1D7I A;  1JNT A;  5HUA A;  4MNJ A;  4LAY A;  3KAF A;  3CHC A;  1GPF A;  1M5Y A;  2A3B A;  3CGN A;  3JYJ A;  4ZPV R;  1XRV A;  2D9F A;  3QOK A;  1JNE A;  3NRK A;  4DWS A;  5HW7 A;  4ZS6 A;  3UI6 A;  3MDY B;  3O5K A;  2Y78 A;  4ODM A;  3OA5 A;  1J4R A;  1E15 A;  3RM8 A;  3PRD A;  2L2S A;  1HKM A;  1KFW A;  1PBK A;  5HKG A;  2B31 A;  1GUV A;  4S3J A;  4ITZ A;  1F8A B;  1J4I A;  2WLY A;  4HBE A;  2LJ4 A;  1RD6 A;  3KAC A;  3ALF A;  4W9O A;  5HBF A;  4LAX A;  2XP9 A;  1WB0 A;  2AWG A;  4WK9 A;  4P8V A;  1ZCN A;  3CH9 A;  3B9D A;  4TX0 A;  1D2K A;  1X6L A;  4G50 A;  1D7J A;  2PPO A;  1C9H A;  2DG3 A;  3B9E A;  3TDB A;  2G8Z A;  1QPF A;  1NH6 A;  3WD3 A;  2QF8 A;  3UI4 A;  2MF9 A;  3RME A;  2DT1 A;  3W4R A;  3JYM A;  2PV3 A;  1KT0 A;  1NWS A;  1YW5 A;  3CHE A;  3ARU A;  2Q5A A;  4P8X A;  4DWS B;  1NWT A;  3KZ7 A;  4IPX A;  2LKN A;  3WL1 A;  1FKL A;  4WIW A;  1W1T A;  3H9R B;  2DT3 A;  2F21 A;  4JFI A;  1LL7 A;  4MGV A;  1HJW A;  1H0I A;  4GGQ A;  3WD4 A;  2WLZ A;  1T11 A;  4JFJ A;  2DSZ A;  4LAV A;  1IX5 A;  2DG9 A;  1K9T A;  1D7H A;  4ODK A;  2VN1 A;  2RUQ A;  1FKF A;  1W9U A;  2DSW A;  2PPN A;  1OWQ A;  2A3E A;  2G41 A;  1F40 A;  3EY6 A;  2PV1 A;  3CHD A;  3O5F A;  3RM4 A;  2MLY A;  4W5U A;  3G6M A;  3AS1 A;  1TFV A;  1ROT A;  4QZV B;  1OGB A;  3AQU A;  4DRN A;  4W9P A;  3IK8 A;  4TW8 A;  2RUC A;  2MLZ A;  2WK2 A;  3UQI A;  3PR9 A;  1ZK6 A;  2XP3 A;  1CTN A;  5HW6 A;  1LQ0 A;  2WM0 A;  3O5L A;  2IUZ A;  3TC5 A;  3FXY A;  2JZV A;  4TYO A;  4L72 B;  3ARX A;  4S3K A;  3ART A;  1FKR A;  4WJX A;  4ODN A;  4WKF A;  1FKB A;  3KAH A;  2FKE A;  1EHN A;  4G2P A;  1A7X A;  4QIB A;  2RUR A;  1PIN A;  1FKK A;  4DRK A;  2LGO A;  1FKJ A;  1UR9 A;  3KCE A;  5D75 A;  3UI5 A;  1SR0 A;  2XP8 A;  2XPB A;  1LJY A;  1QZ2 A;  3KAB A;  1BKF A;  4JFL A;  5HTG A;  3WD0 A;  4QT2 A;  1EDQ A;  3ARZ A;  2F2D A;  2ESC A;  4O2T A;  4Z2H A;  4IT4 A;  4IQC A;  4P8W A;  4DWS D;  4L3N A;  4LGX A;  3O5E A;  4KR0 B;  2DT2 A;  3ARO A;  3WH0 A;  1BL4 A;  3ARW A;  1E6Z A;  1KT1 A;  4NNR A;  1Y0O A;  3WKZ A;  2M2A A;  4DZ3 A;  2YBT A;  1HJV A;  1LL6 A;  4C02 B;  4MNK A;  4DRH A;  4PTM A;  4R0X A;  4BF8 A;  1SYT A;  2ZR5 A;  4LAW A;  3IHZ A;  4ZPW R;  2DSV A;  1E6N A;  2FAP A;  5JH8 A;  3O5M A;  1W1V A;  1HXV A;  3IKG A;  3ARV A;  4TW7 A;  5GPR A;  3WIJ A;  2OLH A;  5DIU A;  5B8I C;  2DSU A;  2KI3 A;  4IQ2 A;  3ARQ A;  4IT6 A;  4DT4 A;  3AS0 A;  2FDM A;  5DO2 A;  2XPA A;  1H0G A;  4U84 A;  1Q6H A;  1NWU A;  2ZQV A;  1ZBK A;  2KFW A;  3CZ8 A;  4DRP A;  4ODL A;  3UQB A;  2PPP A;  4ZPT R;  2A3A A;  4R5E A;  2PBC A;  3PRA A;  4Z2J A;  1Q1C A;  4W9Q A;  4MAV A;  2XP7 A;  2DG4 A;  1FJD A;  1W9P A;  1R9H A;  1JVW A;  3VAW A;  4U86 A;  1FFQ A;  4AY1 A;  2LPV A;  1OGG A;  3AS3 A;  2ZQS A;  4HAR A;  4DRM A;  3ARS A;  2XP4 A;  3O5J A;  4Q22 A;  1LL4 A;  4Z2I A;  1FD9 A;  4MNM A;  3RGC A;  4DWS C;  1FKG A;  4ODO A;  2OFN A;  5DF0 A;  1LG2 A;  4ML4 A;  3O5I A;  3O5D A;  2DPE A;  4Z2K A;  3ARY A;  1Q6U A;  1ZBV A;  1VF8 A;  3RM9 A;  5HWC A;  4JFM A;  2KO7 A;  5HT1 A;  3ODK A;  2MPH A;  4FAP A;  4N19 A;  4TW6 A;  5J6E A;  4ODR A;  4JFK A;  2N87 A;  1L1P A;  4HBO A;  1N1A A;  3NTP A;  1XHG A;  1ZBC A;  1NMV A;  4Z2G A;  3B7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...