2DG4A

Fk506-binding protein mutant wf59 complexed with rapamycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGFEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FK506-binding protein 1A
publication title Energetic and structural analysis of the role of tryptophan 59 in FKBP12
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2dg4A00
4JFJA 2ZQTA 2LKNA 3PA7A 3NRKA 3IKGA 1FKSA 1U79A 2RURA 2XPBA 1HXVA 1KT1A 1FKGA 5HKGA 2F4EA 5HTGA 2ZQSA 4N19A 2KI3A 4QT3A 5D75A 2XP3A 3KZ7A 4W9QA 5DIVA 4DRIA 4FAPA 2LJ4A 3UQAA 3IHZA 3O5EA 2AWGA 3UI4A 5BXJA 2KFWA 2M2AA 1ROUA 3IK8A 3GPKA 3KADA 1D6OA 4TW7A 5HWCA 1EQ3A 3O5KA 3TCZA 3O5FA 1KT0A 3RGCA 3O5GA 3UF8A 4W9OA 3UI6A 5I98A 4J4NA 2PV2A 3PRBA 4U84A 1FAPA 1FKTA 1YATA 3O5MA 1NMVA 1PBKA 1QPLA 1Y0OA 2F2DA 4W9PA 1JVWA 2XP9A 3KCEA 4LAYA 2DG3A 4JFIA 3MDYB 4ODMA 1Q6HA 3OOBA 1FKKA 2L2SA 2MNTA 3ODKA 1FKFA 1Q1CA 5DITA 2MLZA 4DZ2A 4O2TA 1A7XA 4JFMA 4QT2A 4DRNA 1D7HA 4DT4A 2XP7A 4IQ2A 4QIBA 4DZ3A 3KAGA 3O5LA 1J4HA 3O5OA 4JFKA 4TW6A 1FKRA 1FKIA 1C9HA 4NNRA 3UI5A 4DRQA 2MLYA 4JYSA 4U85A 4IQCA 3UQBA 1FKLA 2UZ5A 2M08A 4MGVA 5GPGA 3O5PA 3I6CA 1F8AB 2FKEA 2MLXA 4LAWA 2K8IA 2Q5AA 4ODQA 4DRPA 1Q6UA 2D9FA 1JNTA 1J4IA 2DG9A 3O5JA 3KABA 1B6CA 1FKJA 1QPFA 2PPPA 1FKBA 3EY6A 1J6YA 1D7IA 3JYMA 4DH0A 3JXVA 2PV1A 4ODKA 5DIUA 3O5DA 4TW8A 3CGNA 2PV3A 4DRHA 4ITZA 1QZ2A 3TC5A 3JYJA 5J6EA 4DRKA 1NMWA 2ITKA 2XP5A 4TNSA 1N1AA 1T11A 1FKHA 2ZQUA 3CGMA 1F40A 4JFLA 2PPOA 4ODOA 5HW7A 1PINA 2ZR6A 2MPHA 3LUOA 3H9RB 4ODPA 5HWBA 5HW6A 4BF8A 5B8IC 1FKDA 3KAHA 3O5IA 3IKDA 1P5QA 2ZQVA 4R0XA 2DG4A 1L1PA 3O5QA 4IPXA 2RQSA 1JNSA 2RUCA 1D7JA 1NSGA 2XP6A 4DROA 4ODNA 1BL4A 4GGQA 1M5YA 1R9HA 2M1IA 3RFWA 4DRJA 2RUQA 4DIPA 2XP8A 1ROTA 5HT1A 2ZR4A 3UQIA 3TDBA 1EYMA 2XP4A 1Q6IA 2JZVA 3FAPA 1YW5A 3NI6A 2IF4A 2KGJA 1J4RA 2VN1A 3VAWA 4TYOA 1FD9A 4U86A 3B7XA 3KAFA 2PPNA 3KACA 2LPVA 3O5RA 2FAPA 2F21A 4G2PA 2XPAA 4GIVA 5HUAA 5HW8A 2KO7A 1FJDA 4C02B 4G50A 3KAIA 2RUDA 1ZK6A 3NTPA 3WH0A 4DRMA 4FN2A 4ODRA 4LAXA 2VCDA 4TX0A 2KR7A 2N87A 4LAVA 2Y78A 1TCOC 1BKFA 2OFNA 4MSPA 2MF9A 1W26A 4ODLA 1ZCNA 2ZR5A 2RSEA 3PRDA 2LGOA 4J4OA 2KE0A 2PBCA
chains in the Genus database with same CATH superfamily
1KFWA 3NRKA 1H0GA 2XPBA 3RM4A 1LG2A 1FKGA 3ALFA 5HKGA 5HTGA 3GU0A 4N19A 2DSUA 4DWSB 2XP3A 5DIVA 3ARXA 1ITXA 2ETNA 1E6RA 5BXJA 2A3CA 2KFWA 3GPKA 4Z2GA 1E44A 1ZU8A 2PV2A 4Z2IA 3W4RA 1FAPA 1FKTA 1OGGA 3ARSA 1PBKA 1GRJA 4XAKA 2DG3A 4ODMA 2DT3A 1LG1A 1FKFA 4DZ2A 1W1VA 4DRNA 1FKRA 4TW6A 1HJWA 5DO2A 4R5EA 3ARQA 5GPGA 2M08A 2MLXA 2FKEA 4LAWA 1J4IA 4P8VA 1B6CA 4IT6A 2PPPA 1JCHB 1NWSA 1EIBA 4WKHA 4ODKA 3CGNA 4ITZA 3ARTA 3TC5A 5J6EA 3CZ8A 1NMWA 1D2KA 1N1AA 1OWQA 3CH9A 2MPHA 3LUOA 2DT2A 4P8XA 1FKDA 4Z2KA 1ZL1A 1LL7A 3AS0A 4R0XA 4NSBA 3O5QA 2OLHA 3RM8A 4DWSC 1WAWA 4Z2JA 4DRJA 2G8ZA 1EHNA 4QZVB 2RUQA 1RD6A 1ROTA 2G41A 3WQVA 1E9LA 1NWTA 2VN1A 3B9AA 4PTMA 3VAWA 1ZB5A 1FD9A 3B7XA 2DT0A 4GIVA 2KO7A 1FJDA 4MNLA 3ARUA 1ZK6A 3WH0A 4FN2A 1BKFA 1ZCNA 2ZR5A 4LAVA 2LGOA 2PBCA 4JFJA 1FKSA 1U79A 1KT1A 1HKIA 1ZBVA 5D75A 4DRIA 1W9PA 3AS2A 4FAPA 2LJ4A 3UQAA 2AOSA 2AWGA 2PN0A 3O5EA 1HKJA 3IK8A 3ALGA 1LQ0A 3O5FA 1E6PA 4HBEA 1JNDA 1E15A 3B8SA 3WL0A 1Y0OA 2F2DA 3WKZA 3KCEA 2XP9A 4Z2HA 1FKKA 1SYTA 2MNTA 5DITA 4O2TA 1A7XA 4JFMA 4DT4A 2XP7A 3AS3A 4IQ2A 4QIBA 4W5UA 4DZ3A 1GOIA 3O5OA 4ZPTR 4DRQA 2MLYA 4IQCA 2UZ5A 4MGVA 4DRPA 1F8AB 4ODQA 4Q22A 3WIJA 2D9FA 2DSWA 1WNOA 1QPFA 3AROA 1FKBA 3EY6A 3B9EA 1D7IA 1ZBCA 1W1TA 1NWUA 3O5DA 2PV3A 3FY1A 2F23A 2ZQUA 3CGMA 1F40A 2PPOA 5HW7A 1X6NA 5HWBA 1HJXA 1W9VA 3EIPA 3KAHA 3O5IA 2ZQVA 2DG4A 2ESCA 4DROA 1NSGA 2XP6A 5JH8A 4GGQA 4Q7NA 1M5YA 1R9HA 1FFQA 1UR9A 3PR9A 1H0IA 1GUVA 3FAPA 4HARA 1WB0A 3PRAA 4U86A 1K9TA 2A3EA 3O5RA 3GTYX 4L72B 2F21A 3WQWA 5HW8A 4ZPVR 1FFRA 4C02B 4G50A 1ZBKA 2QF8A 4ODRA 2KR7A 1TFVA 2OFNA 1HJVA 2MF9A 4ODLA 5HBFA 4URIA 3I6CA 4WIWA 4S3JA 2ZQTA 2EULA 3IKGA 4WJXA 1NWRA 1HXVA 4MPKA 3KZ7A 4W9QA 3BMBA 2PI6A 3IHZA 3UI4A 1W1PA 2M2AA 4UDMA 5HWCA 4ZPWR 4TW7A 4MNKA 4ML4A 3O5KA 3TCZA 3ARVA 3CHCA 4W9OA 1LL4A 4J4NA 4ZS6A 3BXWA 4KQZA 1YATA 3O5MA 5DF0A 1NMVA 1QPLA 4W9PA 4LAYA 4WKAA 3B9DA 1Q6HA 2O92A 4QT2A 1D7HA 4KR0B 4JFKA 1C9HA 3UI5A 4P8UA 2P4VA 4JYSA 3ARZA 4U85A 3UQBA 1FKLA 1JNSA 3O5PA 2Q5AA 1LL6A 2A3AA 1E6ZA 1JNTA 2DG9A 3KABA 3ARYA 4MNJA 1FKJA 4DWSD 1X6LA 3JYMA 2A3BA 5GQBA 4L3NA 3JXVA 3G6LA 1XHGA 4TW8A 4DRHA 3JYJA 4DRKA 2XP5A 4JFLA 4ODOA 3AS1A 1PINA 5HW6A 5B8IC 3IKDA 1L1PA 3ARPA 4IPXA 4ODNA 1BL4A 2WK2A 3RFWA 3WD4A 4DIPA 5HT1A 2WM0A 2ZR4A 3UQIA 3TDBA 1EYMA 1W1YA 4S3KA 1IX5A 3NI6A 2KGJA 5GPRA 1OGBA 1J4RA 4TYOA 1GPFA 3KAFA 3KACA 2FAPA 1W9UA 3AQUA 4G2PA 5HUAA 4IT4A 1JNEA 3OA5A 2RUDA 2VCDA 4TX0A 1W26A 3PRDA 2RSEA 4JFIA 2WLZA 5I98A 2YBTA 1SR0A 2LKNA 3PA7A 3ARRA 2RURA 2WLYA 4DWSA 2B5UB 2F4EA 2ZQSA 2KI3A 4QT3A 3ARWA 1HKKA 1ROUA 3KADA 1EQ3A 1D6OA 5DEZA 1KT0A 3RGCA 3O5GA 2FDMA 3RM9A 3UF8A 3UI6A 2IUZA 2B31A 4WKFA 3G6MA 3CHDA 3PRBA 3RMEA 4U84A 1O6IA 3WL1A 1JVWA 4NZCA 1XRVA 3MDYB 1UR8A 2YBUA 3OOBA 3QOKA 2DT1A 2L2SA 3ODKA 1Q1CA 2MLZA 3WD1A 3KAGA 3O5LA 1J4HA 1FKIA 4NNRA 4LGXA 2K8IA 1Q6UA 1J6YA 4DH0A 3CHFA 2PV1A 5DIUA 1QZ2A 2ITKA 4TNSA 2DPEA 1T11A 1FKHA 4WK9A 1CTNA 2ZR6A 4AY1A 2DSVA 3H9RB 4ODPA 4P8WA 4BF8A 3CHEA 1P5QA 3WD2A 2RQSA 2RUCA 1D7JA 4MNMA 1VF8A 1ZBWA 2M1IA 1HKMA 4MAVA 3WD3A 2XP8A 3WD0A 4Z2LA 4HBOA 2XP4A 1E6NA 1Q6IA 2JZVA 3FXYA 1YW5A 2O9OA 2IF4A 2PPNA 2LPVA 2XPAA 4MTVA 2DSZA 3KAIA 1EDQA 3NTPA 4DRMA 4LAXA 1LJYA 2N87A 2Y78A 1TCOC 1NH6A 4MSPA 3O5JA 4J4OA 2KE0A
chains in the Genus database with same CATH topology
1KFWA 3NRKA 1H0GA 2XPBA 3RM4A 1LG2A 1FKGA 3ALFA 5HKGA 5HTGA 4N19A 2DSUA 4DWSB 2XP3A 5DIVA 3ARXA 1ITXA 1E6RA 5BXJA 2A3CA 2KFWA 3GPKA 4Z2GA 1ZU8A 2PV2A 4Z2IA 3W4RA 1FAPA 1FKTA 1OGGA 3ARSA 1PBKA 4XAKA 2DG3A 4ODMA 2DT3A 1LG1A 1FKFA 4DZ2A 1W1VA 4DRNA 1FKRA 4TW6A 1HJWA 5DO2A 4R5EA 3ARQA 5GPGA 2M08A 2MLXA 2FKEA 4LAWA 1J4IA 4P8VA 1B6CA 4IT6A 2PPPA 1NWSA 1EIBA 4WKHA 4ODKA 3CGNA 4ITZA 3ARTA 3TC5A 5J6EA 3CZ8A 1NMWA 1D2KA 1N1AA 1OWQA 3CH9A 2MPHA 3LUOA 2DT2A 4P8XA 1FKDA 4Z2KA 1ZL1A 1LL7A 3AS0A 4R0XA 4NSBA 3O5QA 2OLHA 3RM8A 4DWSC 1WAWA 4Z2JA 4DRJA 2G8ZA 1EHNA 4QZVB 2RUQA 1RD6A 1ROTA 2G41A 3WQVA 1E9LA 1NWTA 2VN1A 3B9AA 4PTMA 3VAWA 1ZB5A 1FD9A 3B7XA 2DT0A 4GIVA 2KO7A 1FJDA 4MNLA 3ARUA 1ZK6A 3WH0A 4FN2A 1BKFA 1ZCNA 2ZR5A 4LAVA 2LGOA 2PBCA 4JFJA 1FKSA 1U79A 1KT1A 1HKIA 1ZBVA 5D75A 4DRIA 1W9PA 3AS2A 4FAPA 2LJ4A 3UQAA 2AOSA 2AWGA 3O5EA 1HKJA 3IK8A 3ALGA 1LQ0A 3O5FA 1E6PA 4HBEA 1JNDA 1E15A 3B8SA 3WL0A 1Y0OA 2F2DA 3WKZA 3KCEA 2XP9A 4Z2HA 1FKKA 1SYTA 2MNTA 5DITA 4O2TA 1A7XA 4JFMA 4DT4A 2XP7A 3AS3A 4IQ2A 4QIBA 4W5UA 4DZ3A 1GOIA 3O5OA 4ZPTR 4DRQA 2MLYA 4IQCA 2UZ5A 4MGVA 4DRPA 1F8AB 4ODQA 4Q22A 3WIJA 2D9FA 2DSWA 1WNOA 1QPFA 3AROA 1FKBA 3EY6A 3B9EA 1D7IA 1ZBCA 1W1TA 1NWUA 3O5DA 2PV3A 3FY1A 2ZQUA 3CGMA 1F40A 2PPOA 5HW7A 1X6NA 5HWBA 1HJXA 1W9VA 3KAHA 3O5IA 2ZQVA 2DG4A 2ESCA 4DROA 1NSGA 2XP6A 5JH8A 4GGQA 4Q7NA 1M5YA 1R9HA 1FFQA 1UR9A 3PR9A 1H0IA 1GUVA 3FAPA 4HARA 1WB0A 3PRAA 4U86A 1K9TA 2A3EA 3O5RA 4L72B 2F21A 3WQWA 5HW8A 4ZPVR 1FFRA 4C02B 4G50A 1ZBKA 2QF8A 4ODRA 2KR7A 1TFVA 2OFNA 1HJVA 2MF9A 4ODLA 5HBFA 4URIA 3I6CA 4WIWA 4S3JA 2ZQTA 3IKGA 4WJXA 1NWRA 1HXVA 4MPKA 3KZ7A 4W9QA 2PI6A 3IHZA 3UI4A 1W1PA 2M2AA 5HWCA 4ZPWR 4TW7A 4MNKA 4ML4A 3O5KA 3TCZA 3ARVA 3CHCA 4W9OA 1LL4A 4J4NA 4ZS6A 3BXWA 4KQZA 1YATA 3O5MA 5DF0A 1NMVA 1QPLA 4W9PA 4LAYA 4WKAA 3B9DA 1Q6HA 2O92A 4QT2A 1D7HA 4KR0B 4JFKA 1C9HA 3UI5A 4P8UA 4JYSA 3ARZA 4U85A 3UQBA 1FKLA 1JNSA 3O5PA 2Q5AA 1LL6A 2A3AA 1E6ZA 1JNTA 2DG9A 3KABA 3ARYA 4MNJA 1FKJA 4DWSD 1X6LA 3JYMA 2A3BA 5GQBA 4L3NA 3JXVA 3G6LA 1XHGA 4TW8A 4DRHA 3JYJA 4DRKA 2XP5A 4JFLA 4ODOA 3AS1A 1PINA 5HW6A 5B8IC 3IKDA 1L1PA 3ARPA 4IPXA 4ODNA 1BL4A 2WK2A 3RFWA 3WD4A 4DIPA 5HT1A 2WM0A 2ZR4A 3UQIA 3TDBA 1EYMA 1W1YA 4S3KA 1IX5A 3NI6A 2KGJA 5GPRA 1OGBA 1J4RA 4TYOA 1GPFA 3KAFA 3KACA 2FAPA 1W9UA 3AQUA 4G2PA 5HUAA 4IT4A 1JNEA 3OA5A 2RUDA 2VCDA 4TX0A 1W26A 3PRDA 2RSEA 4JFIA 2WLZA 5I98A 2YBTA 1SR0A 2LKNA 3PA7A 3ARRA 2RURA 2WLYA 4DWSA 2F4EA 2ZQSA 2KI3A 4QT3A 3ARWA 1HKKA 1ROUA 3KADA 1EQ3A 1D6OA 5DEZA 1KT0A 3RGCA 3O5GA 2FDMA 3RM9A 3UF8A 3UI6A 2IUZA 2B31A 4WKFA 3G6MA 3CHDA 3PRBA 3RMEA 4U84A 1O6IA 3WL1A 1JVWA 4NZCA 1XRVA 3MDYB 1UR8A 2YBUA 3OOBA 3QOKA 2DT1A 2L2SA 3ODKA 1Q1CA 2MLZA 3WD1A 3KAGA 3O5LA 1J4HA 1FKIA 4NNRA 4LGXA 2K8IA 1Q6UA 1J6YA 4DH0A 3CHFA 2PV1A 5DIUA 1QZ2A 2ITKA 4TNSA 2DPEA 1T11A 1FKHA 4WK9A 1CTNA 2ZR6A 4AY1A 2DSVA 3H9RB 4ODPA 4P8WA 4BF8A 3CHEA 1P5QA 3WD2A 2RQSA 2RUCA 1D7JA 4MNMA 1VF8A 1ZBWA 2M1IA 1HKMA 4MAVA 3WD3A 2XP8A 3WD0A 4Z2LA 4HBOA 2XP4A 1E6NA 1Q6IA 2JZVA 3FXYA 1YW5A 2O9OA 2IF4A 2PPNA 2LPVA 2XPAA 4MTVA 2DSZA 3KAIA 1EDQA 3NTPA 4DRMA 4LAXA 1LJYA 2N87A 2Y78A 1TCOC 1NH6A 4MSPA 3O5JA 4J4OA 2KE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JFJ A;  2ZQT A;  2LKN A;  3PA7 A;  3NRK A;  3IKG A;  1FKS A;  1U79 A;  2RUR A;  2XPB A;  1HXV A;  1KT1 A;  1FKG A;  5HKG A;  2F4E A;  5HTG A;  2ZQS A;  4N19 A;  2KI3 A;  4QT3 A;  5D75 A;  2XP3 A;  3KZ7 A;  4W9Q A;  5DIV A;  4DRI A;  4FAP A;  2LJ4 A;  3UQA A;  3IHZ A;  3O5E A;  2AWG A;  3UI4 A;  5BXJ A;  2KFW A;  2M2A A;  1ROU A;  3IK8 A;  3GPK A;  3KAD A;  1D6O A;  4TW7 A;  5HWC A;  1EQ3 A;  3O5K A;  3TCZ A;  3O5F A;  1KT0 A;  3RGC A;  3O5G A;  3UF8 A;  4W9O A;  3UI6 A;  5I98 A;  4J4N A;  2PV2 A;  3PRB A;  4U84 A;  1FAP A;  1FKT A;  1YAT A;  3O5M A;  1NMV A;  1PBK A;  1QPL A;  1Y0O A;  2F2D A;  4W9P A;  1JVW A;  2XP9 A;  3KCE A;  4LAY A;  2DG3 A;  4JFI A;  3MDY B;  4ODM A;  1Q6H A;  3OOB A;  1FKK A;  2L2S A;  2MNT A;  3ODK A;  1FKF A;  1Q1C A;  5DIT A;  2MLZ A;  4DZ2 A;  4O2T A;  1A7X A;  4JFM A;  4QT2 A;  4DRN A;  1D7H A;  4DT4 A;  2XP7 A;  4IQ2 A;  4QIB A;  4DZ3 A;  3KAG A;  3O5L A;  1J4H A;  3O5O A;  4JFK A;  4TW6 A;  1FKR A;  1FKI A;  1C9H A;  4NNR A;  3UI5 A;  4DRQ A;  2MLY A;  4JYS A;  4U85 A;  4IQC A;  3UQB A;  1FKL A;  2UZ5 A;  2M08 A;  4MGV A;  5GPG A;  3O5P A;  3I6C A;  1F8A B;  2FKE A;  2MLX A;  4LAW A;  2K8I A;  2Q5A A;  4ODQ A;  4DRP A;  1Q6U A;  2D9F A;  1JNT A;  1J4I A;  2DG9 A;  3O5J A;  3KAB A;  1B6C A;  1FKJ A;  1QPF A;  2PPP A;  1FKB A;  3EY6 A;  1J6Y A;  1D7I A;  3JYM A;  4DH0 A;  3JXV A;  2PV1 A;  4ODK A;  5DIU A;  3O5D A;  4TW8 A;  3CGN A;  2PV3 A;  4DRH A;  4ITZ A;  1QZ2 A;  3TC5 A;  3JYJ A;  5J6E A;  4DRK A;  1NMW A;  2ITK A;  2XP5 A;  4TNS A;  1N1A A;  1T11 A;  1FKH A;  2ZQU A;  3CGM A;  1F40 A;  4JFL A;  2PPO A;  4ODO A;  5HW7 A;  1PIN A;  2ZR6 A;  2MPH A;  3LUO A;  3H9R B;  4ODP A;  5HWB A;  5HW6 A;  4BF8 A;  5B8I C;  1FKD A;  3KAH A;  3O5I A;  3IKD A;  1P5Q A;  2ZQV A;  4R0X A;  2DG4 A;  1L1P A;  3O5Q A;  4IPX A;  2RQS A;  1JNS A;  2RUC A;  1D7J A;  1NSG A;  2XP6 A;  4DRO A;  4ODN A;  1BL4 A;  4GGQ A;  1M5Y A;  1R9H A;  2M1I A;  3RFW A;  4DRJ A;  2RUQ A;  4DIP A;  2XP8 A;  1ROT A;  5HT1 A;  2ZR4 A;  3UQI A;  3TDB A;  1EYM A;  2XP4 A;  1Q6I A;  2JZV A;  3FAP A;  1YW5 A;  3NI6 A;  2IF4 A;  2KGJ A;  1J4R A;  2VN1 A;  3VAW A;  4TYO A;  1FD9 A;  4U86 A;  3B7X A;  3KAF A;  2PPN A;  3KAC A;  2LPV A;  3O5R A;  2FAP A;  2F21 A;  4G2P A;  2XPA A;  4GIV A;  5HUA A;  5HW8 A;  2KO7 A;  1FJD A;  4C02 B;  4G50 A;  3KAI A;  2RUD A;  1ZK6 A;  3NTP A;  3WH0 A;  4DRM A;  4FN2 A;  4ODR A;  4LAX A;  2VCD A;  4TX0 A;  2KR7 A;  2N87 A;  4LAV A;  2Y78 A;  1TCO C;  1BKF A;  2OFN A;  4MSP A;  2MF9 A;  1W26 A;  4ODL A;  1ZCN A;  2ZR5 A;  2RSE A;  3PRD A;  2LGO A;  4J4O A;  2KE0 A;  2PBC A; 
#chains in the Genus database with same CATH topology
 1KFW A;  3NRK A;  1H0G A;  2XPB A;  3RM4 A;  1LG2 A;  1FKG A;  3ALF A;  5HKG A;  5HTG A;  3GU0 A;  4N19 A;  2DSU A;  4DWS B;  2XP3 A;  5DIV A;  3ARX A;  1ITX A;  2ETN A;  1E6R A;  5BXJ A;  2A3C A;  2KFW A;  3GPK A;  4Z2G A;  1E44 A;  1ZU8 A;  2PV2 A;  4Z2I A;  3W4R A;  1FAP A;  1FKT A;  1OGG A;  3ARS A;  1PBK A;  1GRJ A;  4XAK A;  2DG3 A;  4ODM A;  2DT3 A;  1LG1 A;  1FKF A;  4DZ2 A;  1W1V A;  4DRN A;  1FKR A;  4TW6 A;  1HJW A;  5DO2 A;  4R5E A;  3ARQ A;  5GPG A;  2M08 A;  2MLX A;  2FKE A;  4LAW A;  1J4I A;  4P8V A;  1B6C A;  4IT6 A;  2PPP A;  1JCH B;  1NWS A;  1EIB A;  4WKH A;  4ODK A;  3CGN A;  4ITZ A;  3ART A;  3TC5 A;  5J6E A;  3CZ8 A;  1NMW A;  1D2K A;  1N1A A;  1OWQ A;  3CH9 A;  2MPH A;  3LUO A;  2DT2 A;  4P8X A;  1FKD A;  4Z2K A;  1ZL1 A;  1LL7 A;  3AS0 A;  4R0X A;  4NSB A;  3O5Q A;  2OLH A;  3RM8 A;  4DWS C;  1WAW A;  4Z2J A;  4DRJ A;  2G8Z A;  1EHN A;  4QZV B;  2RUQ A;  1RD6 A;  1ROT A;  2G41 A;  3WQV A;  1E9L A;  1NWT A;  2VN1 A;  3B9A A;  4PTM A;  3VAW A;  1ZB5 A;  1FD9 A;  3B7X A;  2DT0 A;  4GIV A;  2KO7 A;  1FJD A;  4MNL A;  3ARU A;  1ZK6 A;  3WH0 A;  4FN2 A;  1BKF A;  1ZCN A;  2ZR5 A;  4LAV A;  2LGO A;  2PBC A;  4JFJ A;  1FKS A;  1U79 A;  1KT1 A;  1HKI A;  1ZBV A;  5D75 A;  4DRI A;  1W9P A;  3AS2 A;  4FAP A;  2LJ4 A;  3UQA A;  2AOS A;  2AWG A;  2PN0 A;  3O5E A;  1HKJ A;  3IK8 A;  3ALG A;  1LQ0 A;  3O5F A;  1E6P A;  4HBE A;  1JND A;  1E15 A;  3B8S A;  3WL0 A;  1Y0O A;  2F2D A;  3WKZ A;  3KCE A;  2XP9 A;  4Z2H A;  1FKK A;  1SYT A;  2MNT A;  5DIT A;  4O2T A;  1A7X A;  4JFM A;  4DT4 A;  2XP7 A;  3AS3 A;  4IQ2 A;  4QIB A;  4W5U A;  4DZ3 A;  1GOI A;  3O5O A;  4ZPT R;  4DRQ A;  2MLY A;  4IQC A;  2UZ5 A;  4MGV A;  4DRP A;  1F8A B;  4ODQ A;  4Q22 A;  3WIJ A;  2D9F A;  2DSW A;  1WNO A;  1QPF A;  3ARO A;  1FKB A;  3EY6 A;  3B9E A;  1D7I A;  1ZBC A;  1W1T A;  1NWU A;  3O5D A;  2PV3 A;  3FY1 A;  2F23 A;  2ZQU A;  3CGM A;  1F40 A;  2PPO A;  5HW7 A;  1X6N A;  5HWB A;  1HJX A;  1W9V A;  3EIP A;  3KAH A;  3O5I A;  2ZQV A;  2DG4 A;  2ESC A;  4DRO A;  1NSG A;  2XP6 A;  5JH8 A;  4GGQ A;  4Q7N A;  1M5Y A;  1R9H A;  1FFQ A;  1UR9 A;  3PR9 A;  1H0I A;  1GUV A;  3FAP A;  4HAR A;  1WB0 A;  3PRA A;  4U86 A;  1K9T A;  2A3E A;  3O5R A;  3GTY X;  4L72 B;  2F21 A;  3WQW A;  5HW8 A;  4ZPV R;  1FFR A;  4C02 B;  4G50 A;  1ZBK A;  2QF8 A;  4ODR A;  2KR7 A;  1TFV A;  2OFN A;  1HJV A;  2MF9 A;  4ODL A;  5HBF A;  4URI A;  3I6C A;  4WIW A;  4S3J A;  2ZQT A;  2EUL A;  3IKG A;  4WJX A;  1NWR A;  1HXV A;  4MPK A;  3KZ7 A;  4W9Q A;  3BMB A;  2PI6 A;  3IHZ A;  3UI4 A;  1W1P A;  2M2A A;  4UDM A;  5HWC A;  4ZPW R;  4TW7 A;  4MNK A;  4ML4 A;  3O5K A;  3TCZ A;  3ARV A;  3CHC A;  4W9O A;  1LL4 A;  4J4N A;  4ZS6 A;  3BXW A;  4KQZ A;  1YAT A;  3O5M A;  5DF0 A;  1NMV A;  1QPL A;  4W9P A;  4LAY A;  4WKA A;  3B9D A;  1Q6H A;  2O92 A;  4QT2 A;  1D7H A;  4KR0 B;  4JFK A;  1C9H A;  3UI5 A;  4P8U A;  2P4V A;  4JYS A;  3ARZ A;  4U85 A;  3UQB A;  1FKL A;  1JNS A;  3O5P A;  2Q5A A;  1LL6 A;  2A3A A;  1E6Z A;  1JNT A;  2DG9 A;  3KAB A;  3ARY A;  4MNJ A;  1FKJ A;  4DWS D;  1X6L A;  3JYM A;  2A3B A;  5GQB A;  4L3N A;  3JXV A;  3G6L A;  1XHG A;  4TW8 A;  4DRH A;  3JYJ A;  4DRK A;  2XP5 A;  4JFL A;  4ODO A;  3AS1 A;  1PIN A;  5HW6 A;  5B8I C;  3IKD A;  1L1P A;  3ARP A;  4IPX A;  4ODN A;  1BL4 A;  2WK2 A;  3RFW A;  3WD4 A;  4DIP A;  5HT1 A;  2WM0 A;  2ZR4 A;  3UQI A;  3TDB A;  1EYM A;  1W1Y A;  4S3K A;  1IX5 A;  3NI6 A;  2KGJ A;  5GPR A;  1OGB A;  1J4R A;  4TYO A;  1GPF A;  3KAF A;  3KAC A;  2FAP A;  1W9U A;  3AQU A;  4G2P A;  5HUA A;  4IT4 A;  1JNE A;  3OA5 A;  2RUD A;  2VCD A;  4TX0 A;  1W26 A;  3PRD A;  2RSE A;  4JFI A;  2WLZ A;  5I98 A;  2YBT A;  1SR0 A;  2LKN A;  3PA7 A;  3ARR A;  2RUR A;  2WLY A;  4DWS A;  2B5U B;  2F4E A;  2ZQS A;  2KI3 A;  4QT3 A;  3ARW A;  1HKK A;  1ROU A;  3KAD A;  1EQ3 A;  1D6O A;  5DEZ A;  1KT0 A;  3RGC A;  3O5G A;  2FDM A;  3RM9 A;  3UF8 A;  3UI6 A;  2IUZ A;  2B31 A;  4WKF A;  3G6M A;  3CHD A;  3PRB A;  3RME A;  4U84 A;  1O6I A;  3WL1 A;  1JVW A;  4NZC A;  1XRV A;  3MDY B;  1UR8 A;  2YBU A;  3OOB A;  3QOK A;  2DT1 A;  2L2S A;  3ODK A;  1Q1C A;  2MLZ A;  3WD1 A;  3KAG A;  3O5L A;  1J4H A;  1FKI A;  4NNR A;  4LGX A;  2K8I A;  1Q6U A;  1J6Y A;  4DH0 A;  3CHF A;  2PV1 A;  5DIU A;  1QZ2 A;  2ITK A;  4TNS A;  2DPE A;  1T11 A;  1FKH A;  4WK9 A;  1CTN A;  2ZR6 A;  4AY1 A;  2DSV A;  3H9R B;  4ODP A;  4P8W A;  4BF8 A;  3CHE A;  1P5Q A;  3WD2 A;  2RQS A;  2RUC A;  1D7J A;  4MNM A;  1VF8 A;  1ZBW A;  2M1I A;  1HKM A;  4MAV A;  3WD3 A;  2XP8 A;  3WD0 A;  4Z2L A;  4HBO A;  2XP4 A;  1E6N A;  1Q6I A;  2JZV A;  3FXY A;  1YW5 A;  2O9O A;  2IF4 A;  2PPN A;  2LPV A;  2XPA A;  4MTV A;  2DSZ A;  3KAI A;  1EDQ A;  3NTP A;  4DRM A;  4LAX A;  1LJY A;  2N87 A;  2Y78 A;  1TCO C;  1NH6 A;  4MSP A;  3O5J A;  4J4O A;  2KE0 A; 
#chains in the Genus database with same CATH homology
 1KFW A;  3NRK A;  1H0G A;  2XPB A;  3RM4 A;  1LG2 A;  1FKG A;  3ALF A;  5HKG A;  5HTG A;  4N19 A;  2DSU A;  4DWS B;  2XP3 A;  5DIV A;  3ARX A;  1ITX A;  1E6R A;  5BXJ A;  2A3C A;  2KFW A;  3GPK A;  4Z2G A;  1ZU8 A;  2PV2 A;  4Z2I A;  3W4R A;  1FAP A;  1FKT A;  1OGG A;  3ARS A;  1PBK A;  4XAK A;  2DG3 A;  4ODM A;  2DT3 A;  1LG1 A;  1FKF A;  4DZ2 A;  1W1V A;  4DRN A;  1FKR A;  4TW6 A;  1HJW A;  5DO2 A;  4R5E A;  3ARQ A;  5GPG A;  2M08 A;  2MLX A;  2FKE A;  4LAW A;  1J4I A;  4P8V A;  1B6C A;  4IT6 A;  2PPP A;  1NWS A;  1EIB A;  4WKH A;  4ODK A;  3CGN A;  4ITZ A;  3ART A;  3TC5 A;  5J6E A;  3CZ8 A;  1NMW A;  1D2K A;  1N1A A;  1OWQ A;  3CH9 A;  2MPH A;  3LUO A;  2DT2 A;  4P8X A;  1FKD A;  4Z2K A;  1ZL1 A;  1LL7 A;  3AS0 A;  4R0X A;  4NSB A;  3O5Q A;  2OLH A;  3RM8 A;  4DWS C;  1WAW A;  4Z2J A;  4DRJ A;  2G8Z A;  1EHN A;  4QZV B;  2RUQ A;  1RD6 A;  1ROT A;  2G41 A;  3WQV A;  1E9L A;  1NWT A;  2VN1 A;  3B9A A;  4PTM A;  3VAW A;  1ZB5 A;  1FD9 A;  3B7X A;  2DT0 A;  4GIV A;  2KO7 A;  1FJD A;  4MNL A;  3ARU A;  1ZK6 A;  3WH0 A;  4FN2 A;  1BKF A;  1ZCN A;  2ZR5 A;  4LAV A;  2LGO A;  2PBC A;  4JFJ A;  1FKS A;  1U79 A;  1KT1 A;  1HKI A;  1ZBV A;  5D75 A;  4DRI A;  1W9P A;  3AS2 A;  4FAP A;  2LJ4 A;  3UQA A;  2AOS A;  2AWG A;  3O5E A;  1HKJ A;  3IK8 A;  3ALG A;  1LQ0 A;  3O5F A;  1E6P A;  4HBE A;  1JND A;  1E15 A;  3B8S A;  3WL0 A;  1Y0O A;  2F2D A;  3WKZ A;  3KCE A;  2XP9 A;  4Z2H A;  1FKK A;  1SYT A;  2MNT A;  5DIT A;  4O2T A;  1A7X A;  4JFM A;  4DT4 A;  2XP7 A;  3AS3 A;  4IQ2 A;  4QIB A;  4W5U A;  4DZ3 A;  1GOI A;  3O5O A;  4ZPT R;  4DRQ A;  2MLY A;  4IQC A;  2UZ5 A;  4MGV A;  4DRP A;  1F8A B;  4ODQ A;  4Q22 A;  3WIJ A;  2D9F A;  2DSW A;  1WNO A;  1QPF A;  3ARO A;  1FKB A;  3EY6 A;  3B9E A;  1D7I A;  1ZBC A;  1W1T A;  1NWU A;  3O5D A;  2PV3 A;  3FY1 A;  2ZQU A;  3CGM A;  1F40 A;  2PPO A;  5HW7 A;  1X6N A;  5HWB A;  1HJX A;  1W9V A;  3KAH A;  3O5I A;  2ZQV A;  2DG4 A;  2ESC A;  4DRO A;  1NSG A;  2XP6 A;  5JH8 A;  4GGQ A;  4Q7N A;  1M5Y A;  1R9H A;  1FFQ A;  1UR9 A;  3PR9 A;  1H0I A;  1GUV A;  3FAP A;  4HAR A;  1WB0 A;  3PRA A;  4U86 A;  1K9T A;  2A3E A;  3O5R A;  4L72 B;  2F21 A;  3WQW A;  5HW8 A;  4ZPV R;  1FFR A;  4C02 B;  4G50 A;  1ZBK A;  2QF8 A;  4ODR A;  2KR7 A;  1TFV A;  2OFN A;  1HJV A;  2MF9 A;  4ODL A;  5HBF A;  4URI A;  3I6C A;  4WIW A;  4S3J A;  2ZQT A;  3IKG A;  4WJX A;  1NWR A;  1HXV A;  4MPK A;  3KZ7 A;  4W9Q A;  2PI6 A;  3IHZ A;  3UI4 A;  1W1P A;  2M2A A;  5HWC A;  4ZPW R;  4TW7 A;  4MNK A;  4ML4 A;  3O5K A;  3TCZ A;  3ARV A;  3CHC A;  4W9O A;  1LL4 A;  4J4N A;  4ZS6 A;  3BXW A;  4KQZ A;  1YAT A;  3O5M A;  5DF0 A;  1NMV A;  1QPL A;  4W9P A;  4LAY A;  4WKA A;  3B9D A;  1Q6H A;  2O92 A;  4QT2 A;  1D7H A;  4KR0 B;  4JFK A;  1C9H A;  3UI5 A;  4P8U A;  4JYS A;  3ARZ A;  4U85 A;  3UQB A;  1FKL A;  1JNS A;  3O5P A;  2Q5A A;  1LL6 A;  2A3A A;  1E6Z A;  1JNT A;  2DG9 A;  3KAB A;  3ARY A;  4MNJ A;  1FKJ A;  4DWS D;  1X6L A;  3JYM A;  2A3B A;  5GQB A;  4L3N A;  3JXV A;  3G6L A;  1XHG A;  4TW8 A;  4DRH A;  3JYJ A;  4DRK A;  2XP5 A;  4JFL A;  4ODO A;  3AS1 A;  1PIN A;  5HW6 A;  5B8I C;  3IKD A;  1L1P A;  3ARP A;  4IPX A;  4ODN A;  1BL4 A;  2WK2 A;  3RFW A;  3WD4 A;  4DIP A;  5HT1 A;  2WM0 A;  2ZR4 A;  3UQI A;  3TDB A;  1EYM A;  1W1Y A;  4S3K A;  1IX5 A;  3NI6 A;  2KGJ A;  5GPR A;  1OGB A;  1J4R A;  4TYO A;  1GPF A;  3KAF A;  3KAC A;  2FAP A;  1W9U A;  3AQU A;  4G2P A;  5HUA A;  4IT4 A;  1JNE A;  3OA5 A;  2RUD A;  2VCD A;  4TX0 A;  1W26 A;  3PRD A;  2RSE A;  4JFI A;  2WLZ A;  5I98 A;  2YBT A;  1SR0 A;  2LKN A;  3PA7 A;  3ARR A;  2RUR A;  2WLY A;  4DWS A;  2F4E A;  2ZQS A;  2KI3 A;  4QT3 A;  3ARW A;  1HKK A;  1ROU A;  3KAD A;  1EQ3 A;  1D6O A;  5DEZ A;  1KT0 A;  3RGC A;  3O5G A;  2FDM A;  3RM9 A;  3UF8 A;  3UI6 A;  2IUZ A;  2B31 A;  4WKF A;  3G6M A;  3CHD A;  3PRB A;  3RME A;  4U84 A;  1O6I A;  3WL1 A;  1JVW A;  4NZC A;  1XRV A;  3MDY B;  1UR8 A;  2YBU A;  3OOB A;  3QOK A;  2DT1 A;  2L2S A;  3ODK A;  1Q1C A;  2MLZ A;  3WD1 A;  3KAG A;  3O5L A;  1J4H A;  1FKI A;  4NNR A;  4LGX A;  2K8I A;  1Q6U A;  1J6Y A;  4DH0 A;  3CHF A;  2PV1 A;  5DIU A;  1QZ2 A;  2ITK A;  4TNS A;  2DPE A;  1T11 A;  1FKH A;  4WK9 A;  1CTN A;  2ZR6 A;  4AY1 A;  2DSV A;  3H9R B;  4ODP A;  4P8W A;  4BF8 A;  3CHE A;  1P5Q A;  3WD2 A;  2RQS A;  2RUC A;  1D7J A;  4MNM A;  1VF8 A;  1ZBW A;  2M1I A;  1HKM A;  4MAV A;  3WD3 A;  2XP8 A;  3WD0 A;  4Z2L A;  4HBO A;  2XP4 A;  1E6N A;  1Q6I A;  2JZV A;  3FXY A;  1YW5 A;  2O9O A;  2IF4 A;  2PPN A;  2LPV A;  2XPA A;  4MTV A;  2DSZ A;  3KAI A;  1EDQ A;  3NTP A;  4DRM A;  4LAX A;  1LJY A;  2N87 A;  2Y78 A;  1TCO C;  1NH6 A;  4MSP A;  3O5J A;  4J4O A;  2KE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...