2DG4A

Fk506-binding protein mutant wf59 complexed with rapamycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGFEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 1A
publication title Energetic and structural analysis of the role of tryptophan 59 in FKBP12
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 22
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2dg4A00
2Q5AA 5HW6A 4JFLA 1FKHA 4IPXA 2KR7A 5DIVA 3IK8A 2OFNA 4LAXA 3B7XA 4NNRA 2XPAA 1FKGA 3O5MA 4TNSA 4DIPA 4DRNA 3TDBA 4MGVA 3IKGA 1R9HA 1EYMA 2KGJA 3JYMA 3O5QA 5HT1A 1BKFA 2LPVA 3O5JA 4JFMA 2RQSA 3KAHA 3UI4A 3UQAA 2F21A 3NI6A 3O5DA 1U79A 2DG3A 2DG9A 2ZQSA 1JNSA 1ZCNA 1FKKA 4JYSA 2PV2A 1YATA 2PPOA 4LAWA 2XPBA 1L1PA 4O2TA 3PRDA 4C02B 2DG4A 3KAIA 2LJ4A 5D75A 2XP6A 2M2AA 1Q6IA 5HW7A 1Q1CA 5HTGA 5HWCA 1FKSA 3JYJA 3UI5A 2XP3A 1QPLA 1D6OA 1D7IA 3KAGA 1FKIA 2PV1A 3IHZA 4BF8A 1F40A 2JZVA 1P5QA 2F4EA 3TCZA 1EQ3A 2ZR6A 1QPFA 4ODLA 1NMVA 4DZ3A 2XP7A 4DT4A 1FAPA 3I6CA 2FKEA 2N87A 2RUDA 3O5LA 1Q6UA 3WH0A 1J6YA 2LKNA 4ODMA 4DZ2A 1J4HA 3O5GA 3UF8A 3KACA 3TC5A 2XP8A 4G50A 3KZ7A 3O5EA 2PBCA 1PINA 4J4OA 4MSPA 1FKTA 2XP5A 1ZK6A 1TCOC 2ZR4A 4R0XA 4JFJA 1BL4A 2AWGA 2F2DA 4DH0A 5HWBA 3IKDA 1FKJA 2VN1A 5I98A 2K8IA 3UI6A 2XP9A 1FKDA 2XP4A 4G2PA 1Q6HA 3UQBA 3O5KA 4TW8A 2RUQA 1FKFA 3EY6A 1KT0A 2ZR5A 5B8IC 1FD9A 2VCDA 2KO7A 4ODKA 2MF9A 3GPKA 1PBKA 1W26A 2D9FA 2PV3A 3KADA 4IQ2A 2Y78A 4IQCA 1M5YA 4ODOA 3UQIA 4ODPA 2IF4A 4FN2A 4ODQA 1J4IA 4LAVA 4QT2A 4U85A 4DRIA 2MLXA 1ROUA 2MNTA 1QZ2A 5DITA 5HUAA 4LAYA 3RFWA 1A7XA 4DRKA 1JNTA 3KAFA 1JVWA 3O5IA 3CGNA 4W9OA 5HW8A 3RGCA 1ROTA 4ITZA 4JFIA 1FJDA 4FAPA 3LUOA 3O5PA 4J4NA 2PPNA 1KT1A 3KCEA 4TX0A 3JXVA 3PA7A 4TW6A 1F8AB 3NRKA 4DRPA 2ITKA 2ZQTA 5J6EA 2KE0A 2KFWA 1FKBA 1T11A 4TYOA 2L2SA 1J4RA 4DROA 1C9HA 1B6CA 4QT3A 5HKGA 2M08A 1FKLA 1N1AA 3MDYB 3KABA 5GPGA 4DRMA 3H9RB 2RURA 4GIVA 4ODRA 4DRHA 2FAPA 4W9PA 2M1IA 1FKRA 4DRQA 5BXJA 2MPHA 5DIUA 2RSEA 3NTPA 2ZQVA 1YW5A 2ZQUA 3OOBA 2MLZA 1D7JA 1NSGA 4QIBA 4TW7A 2MLYA 2RUCA 1NMWA 3O5OA 4GGQA 4DRJA 3O5FA 3PRBA 1D7HA 1Y0OA 3ODKA 4JFKA 2LGOA 3CGMA 2KI3A 3O5RA 4N19A 4U86A 3FAPA 4W9QA 4U84A 2UZ5A 4ODNA 3VAWA 1HXVA 2PPPA
chains in the Genus database with same CATH superfamily
5HW6A 4JFLA 2OFNA 2XPAA 1FKGA 4MGVA 3JYMA 2KGJA 2PN0A 4JFMA 2RQSA 3KAHA 3UI4A 4R5EA 2DPEA 1ZCNA 4DWSD 1ZBKA 1L1PA 2DG4A 3WIJA 5D75A 2M2AA 5JH8A 5GQBA 1D6OA 3KAGA 2O9OA 1P5QA 2ZR6A 1NMVA 3I6CA 2F23A 4DZ2A 3O5GA 2AOSA 3BXWA 3KACA 2XP8A 4G50A 2ZR4A 1FKTA 4R0XA 4JFJA 1BL4A 2B31A 4ML4A 2VN1A 2DSUA 3FXYA 2K8IA 4G2PA 4S3KA 3ARXA 2DT2A 2ZR5A 3ARYA 3FY1A 1NH6A 4ODKA 1W26A 2PV3A 1LJYA 4ODOA 4ODPA 4FN2A 3CHCA 4AY1A 1J4IA 4DRIA 5DEZA 4S3JA 1XHGA 4MNMA 4LAYA 4MTVA 4DRKA 4W9OA 1SR0A 3CGNA 2ETNA 4ITZA 2EULA 3ARUA 3LUOA 4J4NA 4MAVA 1KT1A 4TW6A 3PA7A 2ZQTA 1H0GA 1X6NA 3B8SA 1C9HA 3G6LA 4ZPTR 4ZS6A 1EDQA 4WIWA 2M08A 3GTYX 3WD0A 4ODRA 4DRHA 4W9PA 5BXJA 4HBEA 2A3AA 3NTPA 3RMEA 2ZQVA 4IT6A 4LGXA 1SYTA 3PRBA 4JFKA 1LL6A 3ARTA 3VAWA 1E9LA 1OGBA 4IPXA 5DIVA 2IUZA 3IK8A 1FFQA 3WD1A 3TDBA 1R9HA 3O5QA 3B9DA 3RM9A 1HJVA 1WAWA 5HT1A 3O5JA 2YBUA 2F21A 2DG3A 1GUVA 1ZB5A 3G6MA 1W9VA 4WKHA 1FKKA 1YATA 2PPOA 1E6NA 3KAIA 1W1YA 2DSVA 3B9AA 3WD3A 3JYJA 3UI5A 1D2KA 4KQZA 1NWSA 1QPLA 3IHZA 4DWSA 2F4EA 1QPFA 4ODLA 3ARPA 1TFVA 4DT4A 2FKEA 2RUDA 3O5LA 3GU0A 1J6YA 3UF8A 1E6ZA 2DT1A 1RD6A 3TC5A 3O5EA 2PBCA 4TW7A 1CTNA 1LL7A 1W9UA 2XP5A 1ZK6A 4DRJA 5HWBA 2AWGA 1UR9A 1NWUA 3IKDA 1FKDA 2XP4A 1Q6HA 3UQBA 3O5KA 4W5UA 1FKFA 1HKJA 1OGGA 1WB0A 1IX5A 5B8IC 2VCDA 2MF9A 1XRVA 4IQ2A 2Y78A 1JCHB 1M5YA 1EIBA 4Z2HA 2IF4A 1K9TA 4WKFA 4ODQA 4XAKA 2MLXA 5DITA 1HKIA 1ZL1A 2G8ZA 1JNTA 3O5IA 3WQVA 5HW8A 3RGCA 4JFIA 2P4VA 1FJDA 1JNDA 2ITKA 1LL4A 4MPKA 4TYOA 1T11A 3W4RA 2DT3A 4DROA 3B9EA 4DWSC 1N1AA 1O6IA 5GPGA 4GIVA 2M1IA 1W1PA 3WQWA 1ZU8A 2WLYA 2RSEA 1YW5A 3OOBA 2MLZA 3ALGA 3AS1A 4MNKA 3O5OA 4Z2IA 3O5FA 1D7HA 2LGOA 3TCZA 3WL0A 4U86A 2PPPA 1FKHA 1E6PA 2KR7A 4LAXA 3B7XA 4NNRA 4WKAA 5HBFA 1JNEA 3O5MA 4TNSA 4DIPA 3IKGA 2O92A 4P8XA 4ZPWR 1BKFA 4HBOA 3WD2A 3UQAA 2WK2A 3NI6A 3EIPA 1JNSA 4JYSA 2PV2A 1VF8A 3AS3A 2XPBA 4O2TA 2LJ4A 2B5UB 2XP6A 1Q6IA 1W9PA 2PI6A 1Q1CA 4QZVB 1E6RA 5HWCA 1E44A 2DSZA 1GOIA 1D7IA 1FKIA 4BF8A 2JZVA 1LQ0A 3OA5A 1X6LA 4DZ3A 2XP7A 1W1TA 1FAPA 4Z2JA 3AS0A 1Q6UA 4L72B 3WH0A 4J4OA 3KZ7A 4MSPA 4DRMA 1OWQA 2WM0A 3CZ8A 1TCOC 5I98A 2F2DA 3UI6A 3ARSA 4TW8A 4Z2KA 1HKKA 2RUQA 1HJWA 2QF8A 1PBKA 3KADA 3CH9A 4Z2LA 1W1VA 4LAVA 4QT2A 1WNOA 5HUAA 1JVWA 4P8WA 1FFRA 1HKMA 2KFWA 2L2SA 4NZCA 3ARRA 1J4RA 4Q22A 1B6CA 1LG1A 3AS2A 3MDYB 3KABA 1NWTA 2ESCA 3H9RB 4IT4A 3RM4A 2FAPA 1GPFA 3PRAA 2DSWA 1KFWA 4MNLA 2A3BA 2MPHA 4ZPVR 4DRQA 3CHFA 4P8UA 1EHNA 1D7JA 4QIBA 2MLYA 2RUCA 1NMWA 4GGQA 1Y0OA 3ODKA 3RM8A 3CGMA 2KI3A 4W9QA 3CHEA 2UZ5A 4ODNA 4U84A 5HKGA 3AROA 2Q5AA 3ARVA 1ZBWA 4WJXA 4WK9A 4DRNA 3ARWA 1EYMA 4HARA 2OLHA 2LPVA 3O5DA 1LG2A 1U79A 2YBTA 2DG9A 2ZQSA 2DT0A 4LAWA 3WKZA 3PRDA 4C02B 5HW7A 5GPRA 5HTGA 1FKSA 2XP3A 2PV1A 1F40A 1EQ3A 2A3CA 3WD4A 2N87A 2LKNA 4ODMA 1J4HA 1HJXA 3ALFA 1PINA 1ZBCA 1E15A 3QOKA 4DH0A 1FKJA 1H0IA 4PTMA 4L3NA 3PR9A 2XP9A 3AQUA 2A3EA 3EY6A 1KT0A 3BMBA 1FD9A 2KO7A 3GPKA 2D9FA 4IQCA 3UQIA 2WLZA 4U85A 4Q7NA 4URIA 4DWSB 4Z2GA 1ROUA 2MNTA 1QZ2A 2G41A 3RFWA 1A7XA 3KAFA 4UDMA 1ROTA 5DF0A 4FAPA 3O5PA 2PPNA 1ITXA 3KCEA 4TX0A 5DO2A 3JXVA 4DRPA 1F8AB 3NRKA 5J6EA 2KE0A 1FKBA 2FDMA 3WL1A 3CHDA 4QT3A 4NSBA 1FKLA 1ZBVA 1FKRA 2RURA 5DIUA 4P8VA 2ZQUA 1NSGA 3ARZA 1NWRA 1UR8A 3ARQA 1GRJA 3O5RA 4N19A 4KR0B 3FAPA 1HXVA 4MNJA
chains in the Genus database with same CATH topology
5HW6A 4JFLA 2OFNA 2XPAA 1FKGA 4MGVA 3JYMA 2KGJA 4JFMA 2RQSA 3KAHA 3UI4A 4R5EA 2DPEA 1ZCNA 4DWSD 1ZBKA 1L1PA 2DG4A 3WIJA 5D75A 2M2AA 5JH8A 5GQBA 1D6OA 3KAGA 2O9OA 1P5QA 2ZR6A 1NMVA 3I6CA 4DZ2A 3O5GA 2AOSA 3BXWA 3KACA 2XP8A 4G50A 2ZR4A 1FKTA 4R0XA 4JFJA 1BL4A 2B31A 4ML4A 2VN1A 2DSUA 3FXYA 2K8IA 4G2PA 4S3KA 3ARXA 2DT2A 2ZR5A 3ARYA 3FY1A 1NH6A 4ODKA 1W26A 2PV3A 1LJYA 4ODOA 4ODPA 4FN2A 3CHCA 4AY1A 1J4IA 4DRIA 5DEZA 4S3JA 1XHGA 4MNMA 4LAYA 4MTVA 4DRKA 4W9OA 1SR0A 3CGNA 4ITZA 3ARUA 3LUOA 4J4NA 4MAVA 1KT1A 4TW6A 3PA7A 2ZQTA 1H0GA 1X6NA 3B8SA 1C9HA 3G6LA 4ZPTR 4ZS6A 1EDQA 4WIWA 2M08A 3WD0A 4ODRA 4DRHA 4W9PA 5BXJA 4HBEA 2A3AA 3NTPA 3RMEA 2ZQVA 4IT6A 4LGXA 1SYTA 3PRBA 4JFKA 1LL6A 3ARTA 3VAWA 1E9LA 1OGBA 4IPXA 5DIVA 2IUZA 3IK8A 1FFQA 3WD1A 3TDBA 1R9HA 3O5QA 3B9DA 3RM9A 1HJVA 1WAWA 5HT1A 3O5JA 2YBUA 2F21A 2DG3A 1GUVA 1ZB5A 3G6MA 1W9VA 4WKHA 1FKKA 1YATA 2PPOA 1E6NA 3KAIA 1W1YA 2DSVA 3B9AA 3WD3A 3JYJA 3UI5A 1D2KA 4KQZA 1NWSA 1QPLA 3IHZA 4DWSA 2F4EA 1QPFA 4ODLA 3ARPA 1TFVA 4DT4A 2FKEA 2RUDA 3O5LA 1J6YA 3UF8A 1E6ZA 2DT1A 1RD6A 3TC5A 3O5EA 2PBCA 4TW7A 1CTNA 1LL7A 1W9UA 2XP5A 1ZK6A 4DRJA 5HWBA 2AWGA 1UR9A 1NWUA 3IKDA 1FKDA 2XP4A 1Q6HA 3UQBA 3O5KA 4W5UA 1FKFA 1HKJA 1OGGA 1WB0A 1IX5A 5B8IC 2VCDA 2MF9A 1XRVA 4IQ2A 2Y78A 1M5YA 1EIBA 4Z2HA 2IF4A 1K9TA 4WKFA 4ODQA 4XAKA 2MLXA 5DITA 1HKIA 1ZL1A 2G8ZA 1JNTA 3O5IA 3WQVA 5HW8A 3RGCA 4JFIA 1FJDA 1JNDA 2ITKA 1LL4A 4MPKA 4TYOA 1T11A 3W4RA 2DT3A 4DROA 3B9EA 4DWSC 1N1AA 1O6IA 5GPGA 4GIVA 2M1IA 1W1PA 3WQWA 1ZU8A 2WLYA 2RSEA 1YW5A 3OOBA 2MLZA 3ALGA 3AS1A 4MNKA 3O5OA 4Z2IA 3O5FA 1D7HA 2LGOA 3TCZA 3WL0A 4U86A 2PPPA 1FKHA 1E6PA 2KR7A 4LAXA 3B7XA 4NNRA 4WKAA 5HBFA 1JNEA 3O5MA 4TNSA 4DIPA 3IKGA 2O92A 4P8XA 4ZPWR 1BKFA 4HBOA 3WD2A 3UQAA 2WK2A 3NI6A 1JNSA 4JYSA 2PV2A 1VF8A 3AS3A 2XPBA 4O2TA 2LJ4A 2XP6A 4QZVB 1Q6IA 1W9PA 2PI6A 1Q1CA 1E6RA 5HWCA 2DSZA 1GOIA 1D7IA 1FKIA 4BF8A 2JZVA 1LQ0A 3OA5A 1X6LA 4DZ3A 2XP7A 1W1TA 1FAPA 4Z2JA 3AS0A 1Q6UA 4L72B 3WH0A 4J4OA 3KZ7A 4MSPA 4DRMA 1OWQA 2WM0A 3CZ8A 1TCOC 5I98A 2F2DA 3UI6A 3ARSA 4TW8A 4Z2KA 1HKKA 2RUQA 1HJWA 2QF8A 1PBKA 3KADA 3CH9A 4Z2LA 1W1VA 4LAVA 4QT2A 1WNOA 5HUAA 1JVWA 4P8WA 1FFRA 1HKMA 2KFWA 2L2SA 4NZCA 3ARRA 1J4RA 4Q22A 1B6CA 1LG1A 3AS2A 3MDYB 3KABA 1NWTA 2ESCA 3H9RB 4IT4A 3RM4A 2FAPA 1GPFA 3PRAA 2DSWA 1KFWA 4MNLA 2A3BA 2MPHA 4ZPVR 4DRQA 3CHFA 4P8UA 1EHNA 1D7JA 4QIBA 2MLYA 2RUCA 1NMWA 4GGQA 1Y0OA 3ODKA 3RM8A 3CGMA 2KI3A 4W9QA 3CHEA 2UZ5A 4ODNA 4U84A 5HKGA 3AROA 2Q5AA 3ARVA 1ZBWA 4WJXA 4WK9A 4DRNA 3ARWA 1EYMA 4HARA 2OLHA 2LPVA 3O5DA 1LG2A 1U79A 2YBTA 2DG9A 2ZQSA 2DT0A 4LAWA 3WKZA 3PRDA 4C02B 5HW7A 5GPRA 5HTGA 1FKSA 2XP3A 2PV1A 1F40A 1EQ3A 2A3CA 3WD4A 2N87A 2LKNA 4ODMA 1J4HA 1HJXA 3ALFA 1PINA 1ZBCA 1E15A 3QOKA 4DH0A 1FKJA 1H0IA 4PTMA 4L3NA 3PR9A 2XP9A 3AQUA 2A3EA 3EY6A 1KT0A 1FD9A 2KO7A 3GPKA 2D9FA 4IQCA 3UQIA 2WLZA 4U85A 4Q7NA 4URIA 4DWSB 4Z2GA 1ROUA 2MNTA 1QZ2A 2G41A 3RFWA 1A7XA 3KAFA 1ROTA 5DF0A 4FAPA 3O5PA 2PPNA 1ITXA 3KCEA 4TX0A 5DO2A 3JXVA 4DRPA 1F8AB 3NRKA 5J6EA 2KE0A 1FKBA 2FDMA 3WL1A 3CHDA 4QT3A 4NSBA 1FKLA 1ZBVA 1FKRA 2RURA 5DIUA 4P8VA 2ZQUA 1NSGA 3ARZA 1NWRA 1UR8A 3ARQA 3O5RA 4N19A 4KR0B 3FAPA 1HXVA 4MNJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q5A A;  5HW6 A;  4JFL A;  1FKH A;  4IPX A;  2KR7 A;  5DIV A;  3IK8 A;  2OFN A;  4LAX A;  3B7X A;  4NNR A;  2XPA A;  1FKG A;  3O5M A;  4TNS A;  4DIP A;  4DRN A;  3TDB A;  4MGV A;  3IKG A;  1R9H A;  1EYM A;  2KGJ A;  3JYM A;  3O5Q A;  5HT1 A;  1BKF A;  2LPV A;  3O5J A;  4JFM A;  2RQS A;  3KAH A;  3UI4 A;  3UQA A;  2F21 A;  3NI6 A;  3O5D A;  1U79 A;  2DG3 A;  2DG9 A;  2ZQS A;  1JNS A;  1ZCN A;  1FKK A;  4JYS A;  2PV2 A;  1YAT A;  2PPO A;  4LAW A;  2XPB A;  1L1P A;  4O2T A;  3PRD A;  4C02 B;  2DG4 A;  3KAI A;  2LJ4 A;  5D75 A;  2XP6 A;  2M2A A;  1Q6I A;  5HW7 A;  1Q1C A;  5HTG A;  5HWC A;  1FKS A;  3JYJ A;  3UI5 A;  2XP3 A;  1QPL A;  1D6O A;  1D7I A;  3KAG A;  1FKI A;  2PV1 A;  3IHZ A;  4BF8 A;  1F40 A;  2JZV A;  1P5Q A;  2F4E A;  3TCZ A;  1EQ3 A;  2ZR6 A;  1QPF A;  4ODL A;  1NMV A;  4DZ3 A;  2XP7 A;  4DT4 A;  1FAP A;  3I6C A;  2FKE A;  2N87 A;  2RUD A;  3O5L A;  1Q6U A;  3WH0 A;  1J6Y A;  2LKN A;  4ODM A;  4DZ2 A;  1J4H A;  3O5G A;  3UF8 A;  3KAC A;  3TC5 A;  2XP8 A;  4G50 A;  3KZ7 A;  3O5E A;  2PBC A;  1PIN A;  4J4O A;  4MSP A;  1FKT A;  2XP5 A;  1ZK6 A;  1TCO C;  2ZR4 A;  4R0X A;  4JFJ A;  1BL4 A;  2AWG A;  2F2D A;  4DH0 A;  5HWB A;  3IKD A;  1FKJ A;  2VN1 A;  5I98 A;  2K8I A;  3UI6 A;  2XP9 A;  1FKD A;  2XP4 A;  4G2P A;  1Q6H A;  3UQB A;  3O5K A;  4TW8 A;  2RUQ A;  1FKF A;  3EY6 A;  1KT0 A;  2ZR5 A;  5B8I C;  1FD9 A;  2VCD A;  2KO7 A;  4ODK A;  2MF9 A;  3GPK A;  1PBK A;  1W26 A;  2D9F A;  2PV3 A;  3KAD A;  4IQ2 A;  2Y78 A;  4IQC A;  1M5Y A;  4ODO A;  3UQI A;  4ODP A;  2IF4 A;  4FN2 A;  4ODQ A;  1J4I A;  4LAV A;  4QT2 A;  4U85 A;  4DRI A;  2MLX A;  1ROU A;  2MNT A;  1QZ2 A;  5DIT A;  5HUA A;  4LAY A;  3RFW A;  1A7X A;  4DRK A;  1JNT A;  3KAF A;  1JVW A;  3O5I A;  3CGN A;  4W9O A;  5HW8 A;  3RGC A;  1ROT A;  4ITZ A;  4JFI A;  1FJD A;  4FAP A;  3LUO A;  3O5P A;  4J4N A;  2PPN A;  1KT1 A;  3KCE A;  4TX0 A;  3JXV A;  3PA7 A;  4TW6 A;  1F8A B;  3NRK A;  4DRP A;  2ITK A;  2ZQT A;  5J6E A;  2KE0 A;  2KFW A;  1FKB A;  1T11 A;  4TYO A;  2L2S A;  1J4R A;  4DRO A;  1C9H A;  1B6C A;  4QT3 A;  5HKG A;  2M08 A;  1FKL A;  1N1A A;  3MDY B;  3KAB A;  5GPG A;  4DRM A;  3H9R B;  2RUR A;  4GIV A;  4ODR A;  4DRH A;  2FAP A;  4W9P A;  2M1I A;  1FKR A;  4DRQ A;  5BXJ A;  2MPH A;  5DIU A;  2RSE A;  3NTP A;  2ZQV A;  1YW5 A;  2ZQU A;  3OOB A;  2MLZ A;  1D7J A;  1NSG A;  4QIB A;  4TW7 A;  2MLY A;  2RUC A;  1NMW A;  3O5O A;  4GGQ A;  4DRJ A;  3O5F A;  3PRB A;  1D7H A;  1Y0O A;  3ODK A;  4JFK A;  2LGO A;  3CGM A;  2KI3 A;  3O5R A;  4N19 A;  4U86 A;  3FAP A;  4W9Q A;  4U84 A;  2UZ5 A;  4ODN A;  3VAW A;  1HXV A;  2PPP A; 
#chains in the Genus database with same CATH topology
 5HW6 A;  4JFL A;  2OFN A;  2XPA A;  1FKG A;  4MGV A;  3JYM A;  2KGJ A;  2PN0 A;  4JFM A;  2RQS A;  3KAH A;  3UI4 A;  4R5E A;  2DPE A;  1ZCN A;  4DWS D;  1ZBK A;  1L1P A;  2DG4 A;  3WIJ A;  5D75 A;  2M2A A;  5JH8 A;  5GQB A;  1D6O A;  3KAG A;  2O9O A;  1P5Q A;  2ZR6 A;  1NMV A;  3I6C A;  2F23 A;  4DZ2 A;  3O5G A;  2AOS A;  3BXW A;  3KAC A;  2XP8 A;  4G50 A;  2ZR4 A;  1FKT A;  4R0X A;  4JFJ A;  1BL4 A;  2B31 A;  4ML4 A;  2VN1 A;  2DSU A;  3FXY A;  2K8I A;  4G2P A;  4S3K A;  3ARX A;  2DT2 A;  2ZR5 A;  3ARY A;  3FY1 A;  1NH6 A;  4ODK A;  1W26 A;  2PV3 A;  1LJY A;  4ODO A;  4ODP A;  4FN2 A;  3CHC A;  4AY1 A;  1J4I A;  4DRI A;  5DEZ A;  4S3J A;  1XHG A;  4MNM A;  4LAY A;  4MTV A;  4DRK A;  4W9O A;  1SR0 A;  3CGN A;  2ETN A;  4ITZ A;  2EUL A;  3ARU A;  3LUO A;  4J4N A;  4MAV A;  1KT1 A;  4TW6 A;  3PA7 A;  2ZQT A;  1H0G A;  1X6N A;  3B8S A;  1C9H A;  3G6L A;  4ZPT R;  4ZS6 A;  1EDQ A;  4WIW A;  2M08 A;  3GTY X;  3WD0 A;  4ODR A;  4DRH A;  4W9P A;  5BXJ A;  4HBE A;  2A3A A;  3NTP A;  3RME A;  2ZQV A;  4IT6 A;  4LGX A;  1SYT A;  3PRB A;  4JFK A;  1LL6 A;  3ART A;  3VAW A;  1E9L A;  1OGB A;  4IPX A;  5DIV A;  2IUZ A;  3IK8 A;  1FFQ A;  3WD1 A;  3TDB A;  1R9H A;  3O5Q A;  3B9D A;  3RM9 A;  1HJV A;  1WAW A;  5HT1 A;  3O5J A;  2YBU A;  2F21 A;  2DG3 A;  1GUV A;  1ZB5 A;  3G6M A;  1W9V A;  4WKH A;  1FKK A;  1YAT A;  2PPO A;  1E6N A;  3KAI A;  1W1Y A;  2DSV A;  3B9A A;  3WD3 A;  3JYJ A;  3UI5 A;  1D2K A;  4KQZ A;  1NWS A;  1QPL A;  3IHZ A;  4DWS A;  2F4E A;  1QPF A;  4ODL A;  3ARP A;  1TFV A;  4DT4 A;  2FKE A;  2RUD A;  3O5L A;  3GU0 A;  1J6Y A;  3UF8 A;  1E6Z A;  2DT1 A;  1RD6 A;  3TC5 A;  3O5E A;  2PBC A;  4TW7 A;  1CTN A;  1LL7 A;  1W9U A;  2XP5 A;  1ZK6 A;  4DRJ A;  5HWB A;  2AWG A;  1UR9 A;  1NWU A;  3IKD A;  1FKD A;  2XP4 A;  1Q6H A;  3UQB A;  3O5K A;  4W5U A;  1FKF A;  1HKJ A;  1OGG A;  1WB0 A;  1IX5 A;  5B8I C;  2VCD A;  2MF9 A;  1XRV A;  4IQ2 A;  2Y78 A;  1JCH B;  1M5Y A;  1EIB A;  4Z2H A;  2IF4 A;  1K9T A;  4WKF A;  4ODQ A;  4XAK A;  2MLX A;  5DIT A;  1HKI A;  1ZL1 A;  2G8Z A;  1JNT A;  3O5I A;  3WQV A;  5HW8 A;  3RGC A;  4JFI A;  2P4V A;  1FJD A;  1JND A;  2ITK A;  1LL4 A;  4MPK A;  4TYO A;  1T11 A;  3W4R A;  2DT3 A;  4DRO A;  3B9E A;  4DWS C;  1N1A A;  1O6I A;  5GPG A;  4GIV A;  2M1I A;  1W1P A;  3WQW A;  1ZU8 A;  2WLY A;  2RSE A;  1YW5 A;  3OOB A;  2MLZ A;  3ALG A;  3AS1 A;  4MNK A;  3O5O A;  4Z2I A;  3O5F A;  1D7H A;  2LGO A;  3TCZ A;  3WL0 A;  4U86 A;  2PPP A;  1FKH A;  1E6P A;  2KR7 A;  4LAX A;  3B7X A;  4NNR A;  4WKA A;  5HBF A;  1JNE A;  3O5M A;  4TNS A;  4DIP A;  3IKG A;  2O92 A;  4P8X A;  4ZPW R;  1BKF A;  4HBO A;  3WD2 A;  3UQA A;  2WK2 A;  3NI6 A;  3EIP A;  1JNS A;  4JYS A;  2PV2 A;  1VF8 A;  3AS3 A;  2XPB A;  4O2T A;  2LJ4 A;  2B5U B;  2XP6 A;  1Q6I A;  1W9P A;  2PI6 A;  1Q1C A;  4QZV B;  1E6R A;  5HWC A;  1E44 A;  2DSZ A;  1GOI A;  1D7I A;  1FKI A;  4BF8 A;  2JZV A;  1LQ0 A;  3OA5 A;  1X6L A;  4DZ3 A;  2XP7 A;  1W1T A;  1FAP A;  4Z2J A;  3AS0 A;  1Q6U A;  4L72 B;  3WH0 A;  4J4O A;  3KZ7 A;  4MSP A;  4DRM A;  1OWQ A;  2WM0 A;  3CZ8 A;  1TCO C;  5I98 A;  2F2D A;  3UI6 A;  3ARS A;  4TW8 A;  4Z2K A;  1HKK A;  2RUQ A;  1HJW A;  2QF8 A;  1PBK A;  3KAD A;  3CH9 A;  4Z2L A;  1W1V A;  4LAV A;  4QT2 A;  1WNO A;  5HUA A;  1JVW A;  4P8W A;  1FFR A;  1HKM A;  2KFW A;  2L2S A;  4NZC A;  3ARR A;  1J4R A;  4Q22 A;  1B6C A;  1LG1 A;  3AS2 A;  3MDY B;  3KAB A;  1NWT A;  2ESC A;  3H9R B;  4IT4 A;  3RM4 A;  2FAP A;  1GPF A;  3PRA A;  2DSW A;  1KFW A;  4MNL A;  2A3B A;  2MPH A;  4ZPV R;  4DRQ A;  3CHF A;  4P8U A;  1EHN A;  1D7J A;  4QIB A;  2MLY A;  2RUC A;  1NMW A;  4GGQ A;  1Y0O A;  3ODK A;  3RM8 A;  3CGM A;  2KI3 A;  4W9Q A;  3CHE A;  2UZ5 A;  4ODN A;  4U84 A;  5HKG A;  3ARO A;  2Q5A A;  3ARV A;  1ZBW A;  4WJX A;  4WK9 A;  4DRN A;  3ARW A;  1EYM A;  4HAR A;  2OLH A;  2LPV A;  3O5D A;  1LG2 A;  1U79 A;  2YBT A;  2DG9 A;  2ZQS A;  2DT0 A;  4LAW A;  3WKZ A;  3PRD A;  4C02 B;  5HW7 A;  5GPR A;  5HTG A;  1FKS A;  2XP3 A;  2PV1 A;  1F40 A;  1EQ3 A;  2A3C A;  3WD4 A;  2N87 A;  2LKN A;  4ODM A;  1J4H A;  1HJX A;  3ALF A;  1PIN A;  1ZBC A;  1E15 A;  3QOK A;  4DH0 A;  1FKJ A;  1H0I A;  4PTM A;  4L3N A;  3PR9 A;  2XP9 A;  3AQU A;  2A3E A;  3EY6 A;  1KT0 A;  3BMB A;  1FD9 A;  2KO7 A;  3GPK A;  2D9F A;  4IQC A;  3UQI A;  2WLZ A;  4U85 A;  4Q7N A;  4URI A;  4DWS B;  4Z2G A;  1ROU A;  2MNT A;  1QZ2 A;  2G41 A;  3RFW A;  1A7X A;  3KAF A;  4UDM A;  1ROT A;  5DF0 A;  4FAP A;  3O5P A;  2PPN A;  1ITX A;  3KCE A;  4TX0 A;  5DO2 A;  3JXV A;  4DRP A;  1F8A B;  3NRK A;  5J6E A;  2KE0 A;  1FKB A;  2FDM A;  3WL1 A;  3CHD A;  4QT3 A;  4NSB A;  1FKL A;  1ZBV A;  1FKR A;  2RUR A;  5DIU A;  4P8V A;  2ZQU A;  1NSG A;  3ARZ A;  1NWR A;  1UR8 A;  3ARQ A;  1GRJ A;  3O5R A;  4N19 A;  4KR0 B;  3FAP A;  1HXV A;  4MNJ A; 
#chains in the Genus database with same CATH homology
 5HW6 A;  4JFL A;  2OFN A;  2XPA A;  1FKG A;  4MGV A;  3JYM A;  2KGJ A;  4JFM A;  2RQS A;  3KAH A;  3UI4 A;  4R5E A;  2DPE A;  1ZCN A;  4DWS D;  1ZBK A;  1L1P A;  2DG4 A;  3WIJ A;  5D75 A;  2M2A A;  5JH8 A;  5GQB A;  1D6O A;  3KAG A;  2O9O A;  1P5Q A;  2ZR6 A;  1NMV A;  3I6C A;  4DZ2 A;  3O5G A;  2AOS A;  3BXW A;  3KAC A;  2XP8 A;  4G50 A;  2ZR4 A;  1FKT A;  4R0X A;  4JFJ A;  1BL4 A;  2B31 A;  4ML4 A;  2VN1 A;  2DSU A;  3FXY A;  2K8I A;  4G2P A;  4S3K A;  3ARX A;  2DT2 A;  2ZR5 A;  3ARY A;  3FY1 A;  1NH6 A;  4ODK A;  1W26 A;  2PV3 A;  1LJY A;  4ODO A;  4ODP A;  4FN2 A;  3CHC A;  4AY1 A;  1J4I A;  4DRI A;  5DEZ A;  4S3J A;  1XHG A;  4MNM A;  4LAY A;  4MTV A;  4DRK A;  4W9O A;  1SR0 A;  3CGN A;  4ITZ A;  3ARU A;  3LUO A;  4J4N A;  4MAV A;  1KT1 A;  4TW6 A;  3PA7 A;  2ZQT A;  1H0G A;  1X6N A;  3B8S A;  1C9H A;  3G6L A;  4ZPT R;  4ZS6 A;  1EDQ A;  4WIW A;  2M08 A;  3WD0 A;  4ODR A;  4DRH A;  4W9P A;  5BXJ A;  4HBE A;  2A3A A;  3NTP A;  3RME A;  2ZQV A;  4IT6 A;  4LGX A;  1SYT A;  3PRB A;  4JFK A;  1LL6 A;  3ART A;  3VAW A;  1E9L A;  1OGB A;  4IPX A;  5DIV A;  2IUZ A;  3IK8 A;  1FFQ A;  3WD1 A;  3TDB A;  1R9H A;  3O5Q A;  3B9D A;  3RM9 A;  1HJV A;  1WAW A;  5HT1 A;  3O5J A;  2YBU A;  2F21 A;  2DG3 A;  1GUV A;  1ZB5 A;  3G6M A;  1W9V A;  4WKH A;  1FKK A;  1YAT A;  2PPO A;  1E6N A;  3KAI A;  1W1Y A;  2DSV A;  3B9A A;  3WD3 A;  3JYJ A;  3UI5 A;  1D2K A;  4KQZ A;  1NWS A;  1QPL A;  3IHZ A;  4DWS A;  2F4E A;  1QPF A;  4ODL A;  3ARP A;  1TFV A;  4DT4 A;  2FKE A;  2RUD A;  3O5L A;  1J6Y A;  3UF8 A;  1E6Z A;  2DT1 A;  1RD6 A;  3TC5 A;  3O5E A;  2PBC A;  4TW7 A;  1CTN A;  1LL7 A;  1W9U A;  2XP5 A;  1ZK6 A;  4DRJ A;  5HWB A;  2AWG A;  1UR9 A;  1NWU A;  3IKD A;  1FKD A;  2XP4 A;  1Q6H A;  3UQB A;  3O5K A;  4W5U A;  1FKF A;  1HKJ A;  1OGG A;  1WB0 A;  1IX5 A;  5B8I C;  2VCD A;  2MF9 A;  1XRV A;  4IQ2 A;  2Y78 A;  1M5Y A;  1EIB A;  4Z2H A;  2IF4 A;  1K9T A;  4WKF A;  4ODQ A;  4XAK A;  2MLX A;  5DIT A;  1HKI A;  1ZL1 A;  2G8Z A;  1JNT A;  3O5I A;  3WQV A;  5HW8 A;  3RGC A;  4JFI A;  1FJD A;  1JND A;  2ITK A;  1LL4 A;  4MPK A;  4TYO A;  1T11 A;  3W4R A;  2DT3 A;  4DRO A;  3B9E A;  4DWS C;  1N1A A;  1O6I A;  5GPG A;  4GIV A;  2M1I A;  1W1P A;  3WQW A;  1ZU8 A;  2WLY A;  2RSE A;  1YW5 A;  3OOB A;  2MLZ A;  3ALG A;  3AS1 A;  4MNK A;  3O5O A;  4Z2I A;  3O5F A;  1D7H A;  2LGO A;  3TCZ A;  3WL0 A;  4U86 A;  2PPP A;  1FKH A;  1E6P A;  2KR7 A;  4LAX A;  3B7X A;  4NNR A;  4WKA A;  5HBF A;  1JNE A;  3O5M A;  4TNS A;  4DIP A;  3IKG A;  2O92 A;  4P8X A;  4ZPW R;  1BKF A;  4HBO A;  3WD2 A;  3UQA A;  2WK2 A;  3NI6 A;  1JNS A;  4JYS A;  2PV2 A;  1VF8 A;  3AS3 A;  2XPB A;  4O2T A;  2LJ4 A;  2XP6 A;  4QZV B;  1Q6I A;  1W9P A;  2PI6 A;  1Q1C A;  1E6R A;  5HWC A;  2DSZ A;  1GOI A;  1D7I A;  1FKI A;  4BF8 A;  2JZV A;  1LQ0 A;  3OA5 A;  1X6L A;  4DZ3 A;  2XP7 A;  1W1T A;  1FAP A;  4Z2J A;  3AS0 A;  1Q6U A;  4L72 B;  3WH0 A;  4J4O A;  3KZ7 A;  4MSP A;  4DRM A;  1OWQ A;  2WM0 A;  3CZ8 A;  1TCO C;  5I98 A;  2F2D A;  3UI6 A;  3ARS A;  4TW8 A;  4Z2K A;  1HKK A;  2RUQ A;  1HJW A;  2QF8 A;  1PBK A;  3KAD A;  3CH9 A;  4Z2L A;  1W1V A;  4LAV A;  4QT2 A;  1WNO A;  5HUA A;  1JVW A;  4P8W A;  1FFR A;  1HKM A;  2KFW A;  2L2S A;  4NZC A;  3ARR A;  1J4R A;  4Q22 A;  1B6C A;  1LG1 A;  3AS2 A;  3MDY B;  3KAB A;  1NWT A;  2ESC A;  3H9R B;  4IT4 A;  3RM4 A;  2FAP A;  1GPF A;  3PRA A;  2DSW A;  1KFW A;  4MNL A;  2A3B A;  2MPH A;  4ZPV R;  4DRQ A;  3CHF A;  4P8U A;  1EHN A;  1D7J A;  4QIB A;  2MLY A;  2RUC A;  1NMW A;  4GGQ A;  1Y0O A;  3ODK A;  3RM8 A;  3CGM A;  2KI3 A;  4W9Q A;  3CHE A;  2UZ5 A;  4ODN A;  4U84 A;  5HKG A;  3ARO A;  2Q5A A;  3ARV A;  1ZBW A;  4WJX A;  4WK9 A;  4DRN A;  3ARW A;  1EYM A;  4HAR A;  2OLH A;  2LPV A;  3O5D A;  1LG2 A;  1U79 A;  2YBT A;  2DG9 A;  2ZQS A;  2DT0 A;  4LAW A;  3WKZ A;  3PRD A;  4C02 B;  5HW7 A;  5GPR A;  5HTG A;  1FKS A;  2XP3 A;  2PV1 A;  1F40 A;  1EQ3 A;  2A3C A;  3WD4 A;  2N87 A;  2LKN A;  4ODM A;  1J4H A;  1HJX A;  3ALF A;  1PIN A;  1ZBC A;  1E15 A;  3QOK A;  4DH0 A;  1FKJ A;  1H0I A;  4PTM A;  4L3N A;  3PR9 A;  2XP9 A;  3AQU A;  2A3E A;  3EY6 A;  1KT0 A;  1FD9 A;  2KO7 A;  3GPK A;  2D9F A;  4IQC A;  3UQI A;  2WLZ A;  4U85 A;  4Q7N A;  4URI A;  4DWS B;  4Z2G A;  1ROU A;  2MNT A;  1QZ2 A;  2G41 A;  3RFW A;  1A7X A;  3KAF A;  1ROT A;  5DF0 A;  4FAP A;  3O5P A;  2PPN A;  1ITX A;  3KCE A;  4TX0 A;  5DO2 A;  3JXV A;  4DRP A;  1F8A B;  3NRK A;  5J6E A;  2KE0 A;  1FKB A;  2FDM A;  3WL1 A;  3CHD A;  4QT3 A;  4NSB A;  1FKL A;  1ZBV A;  1FKR A;  2RUR A;  5DIU A;  4P8V A;  2ZQU A;  1NSG A;  3ARZ A;  1NWR A;  1UR8 A;  3ARQ A;  3O5R A;  4N19 A;  4KR0 B;  3FAP A;  1HXV A;  4MNJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...