2DG4A

Fk506-binding protein mutant wf59 complexed with rapamycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGFEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 1A
publication title Energetic and structural analysis of the role of tryptophan 59 in FKBP12
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 22
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2dg4A00
2XP7A 3OOBA 4ODQA 2MLXA 4C02B 1D7JA 5HTGA 4JYSA 2ZQSA 1FKKA 1J4RA 2LPVA 1NMWA 3KAFA 3TCZA 4DRNA 4DZ2A 3JYMA 1FKSA 1P5QA 1FKFA 1KT1A 3RFWA 1D7HA 3KAHA 2IF4A 3UI6A 1JNTA 4ODLA 4LAXA 4TW7A 1Q6IA 1NSGA 1FD9A 1FKBA 4QT2A 1FKGA 2FAPA 2XP3A 2JZVA 2M2AA 3I6CA 2FKEA 3KACA 2PPPA 2MLZA 4J4OA 3VAWA 2D9FA 1YATA 4LAWA 3UF8A 1Q1CA 1Y0OA 3EY6A 1D7IA 2KE0A 1J6YA 3UQIA 2ZR5A 3RGCA 4BF8A 3TDBA 1JNSA 2Q5AA 4IPXA 4ODMA 2PV2A 4TW6A 1C9HA 4GGQA 5J6EA 1EQ3A 2DG3A 5DIUA 1FAPA 4W9OA 4DT4A 5HUAA 2ZQUA 3MDYB 4ODPA 4ODNA 4FAPA 2LGOA 2M08A 3NTPA 1QPFA 3ODKA 4DH0A 3NI6A 1NMVA 2VN1A 2ZR6A 1J4HA 1FKDA 2ITKA 2XP6A 2MPHA 4ITZA 4TX0A 4DROA 5B8IC 1BKFA 4DIPA 2PV3A 4JFLA 2XP4A 1F40A 3UQAA 1J4IA 1N1AA 1ROUA 3KAGA 3O5KA 1FJDA 1QPLA 4U86A 5D75A 3O5GA 1KT0A 2LJ4A 4ODOA 2LKNA 2M1IA 2N87A 5I98A 3WH0A 1YW5A 1FKLA 3O5LA 1JVWA 3CGMA 3IK8A 3KAIA 3JXVA 3KZ7A 3UI5A 3CGNA 2PPNA 2RUQA 1ZK6A 4N19A 4DRHA 2XP9A 2PPOA 1FKJA 2PV1A 5HW6A 4J4NA 5HW8A 3UQBA 5GPGA 2RQSA 1M5YA 2OFNA 4GIVA 4R0XA 2Y78A 3GPKA 4DRJA 3H9RB 4IQ2A 4W9PA 4ODKA 5DIVA 1B6CA 1QZ2A 2DG9A 3TC5A 3UI4A 3PRDA 3IKDA 3O5FA 4G2PA 3O5JA 5HKGA 4JFKA 3O5RA 4DZ3A 4DRPA 2RUDA 4NNRA 2K8IA 1ROTA 4FN2A 2KO7A 4IQCA 4DRIA 4LAVA 4TNSA 2L2SA 1EYMA 2XPBA 2ZR4A 4TW8A 1FKRA 2AWGA 3NRKA 4ODRA 4DRQA 1FKIA 3KABA 3KADA 4JFIA 4JFMA 5HT1A 2MNTA 3IKGA 3O5EA 1D6OA 3O5QA 1Q6UA 3O5OA 2DG4A 4DRMA 5HW7A 3JYJA 3B7XA 1F8AB 2MLYA 1FKHA 1FKTA 1R9HA 2MF9A 2XP5A 3KCEA 3PRBA 4LAYA 4MGVA 4QT3A 5HWBA 2XP8A 3O5MA 1TCOC 2KGJA 1ZCNA 2RSEA 1PBKA 2ZQVA 3FAPA 3O5PA 5HWCA 3O5DA 1A7XA 1W26A 3IHZA 4JFJA 1T11A 2RUCA 4G50A 5DITA 1HXVA 4QIBA 4U84A 2XPAA 4W9QA 5BXJA 2RURA 1U79A 4O2TA 2ZQTA 4U85A 3LUOA 1PINA 2KFWA 2KR7A 1BL4A 2PBCA 4MSPA 4DRKA 2F2DA 2F21A 3O5IA 4TYOA 1L1PA 2UZ5A 3PA7A 2F4EA 1Q6HA 2VCDA 2KI3A
chains in the Genus database with same CATH superfamily
1VF8A 4WIWA 4JYSA 2ZQSA 4MTVA 2LPVA 1LL4A 3TCZA 1FKSA 1X6LA 2A3AA 3RFWA 1D7HA 1JNDA 4QT2A 1FKGA 3I6CA 4ZS6A 3KACA 2FKEA 3VAWA 3ARVA 2AOSA 3ARXA 4HBOA 4LAWA 3W4RA 2YBUA 3B9AA 2A3CA 4WKHA 1J6YA 2ZR5A 4BF8A 1ZBCA 3WD3A 4MNMA 4IPXA 2WK2A 2PV2A 4TW6A 1C9HA 1GOIA 1W9VA 3AROA 1ZL1A 1E44A 2LGOA 3ODKA 1CTNA 1HJWA 1NMVA 2ITKA 1GPFA 2G41A 1RD6A 1BKFA 3CHEA 4Q7NA 1F40A 3UQAA 1ROUA 3AS1A 4NSBA 1FJDA 2ETNA 2DT2A 1NWTA 1W1PA 4NZCA 3IK8A 3JXVA 3KZ7A 2RUQA 1ZK6A 4N19A 1IX5A 2PPOA 5HW6A 3ALFA 2OFNA 4R0XA 2Y78A 4P8UA 4MAVA 4W9PA 4IQ2A 4ODKA 3TC5A 1QZ2A 1FFRA 3PRDA 4G2PA 4JFKA 1HKJA 1EIBA 3WKZA 1E6NA 4TNSA 2L2SA 4S3KA 4Z2JA 3BXWA 3NRKA 4ODRA 4DRQA 4JFIA 4MNJA 1LL6A 3B7XA 2MLYA 2O92A 3PRBA 4MPKA 1ZCNA 1A7XA 4JFJA 3CHDA 4Z2GA 2RUCA 1HXVA 4Z2LA 4HBEA 3WD0A 1JNEA 4L3NA 2PI6A 3EIPA 1SYTA 1U79A 1W1VA 4DRKA 1PINA 2PBCA 2KR7A 2F21A 2WLZA 4DWSD 1Q6HA 2KI3A 1ZBVA 2XP7A 1HJXA 3KAFA 3JYMA 1KT1A 3BMBA 2IF4A 3FXYA 3UI6A 1ZBWA 2FDMA 1Q6IA 2XP3A 1LL7A 2M2AA 2WLYA 2D9FA 1YATA 3UF8A 1Q1CA 4S3JA 1D7IA 3RGCA 1X6NA 4ZPTR 5J6EA 5DIUA 4W9OA 5HUAA 2ZQUA 3MDYB 3ARPA 2M08A 3NTPA 2ZR6A 3OA5A 1H0GA 1FFQA 4DIPA 2PV3A 3KAGA 1N1AA 2LJ4A 2LKNA 3ARWA 5DF0A 5I98A 3B9EA 3GU0A 2IUZA 4MNKA 1JVWA 3CGMA 3RM4A 4DWSA 3ARRA 3UI5A 2XP9A 1XRVA 1NWUA 5HW8A 1HKMA 2RQSA 3G6MA 4GIVA 5DIVA 1ZU8A 2DG9A 2DSWA 3IKDA 1K9TA 4DZ3A 4DRIA 3AS0A 5HBFA 1HJVA 2B31A 1EYMA 4Z2KA 1D2KA 4TW8A 3KADA 4JFMA 2MNTA 4L72B 2DG4A 4DRMA 5HW7A 4ML4A 1FKTA 1GUVA 2MF9A 4LAYA 3O5MA 2KGJA 4WJXA 1PBKA 3FAPA 1HKIA 2DSVA 3ALGA 4QIBA 2XPAA 1E9LA 5BXJA 4U85A 2KFWA 1BL4A 2F2DA 1L1PA 3PA7A 2F4EA 2VCDA 3OOBA 3G6LA 4C02B 1FKKA 4DZ2A 1NMWA 4DWSB 3KAHA 2OLHA 1ZB5A 1E6PA 1JNTA 2P4VA 2FAPA 4UDMA 2JZVA 2PN0A 2MLZA 4J4OA 4WKFA 1UR9A 1EDQA 3AS2A 2KE0A 2QF8A 3UQIA 3TDBA 3ARZA 1OGBA 1OWQA 2Q5AA 4ODMA 2DG3A 4DT4A 1FAPA 4ODPA 2A3BA 4FAPA 5GPRA 2G8ZA 2VN1A 4ITZA 1FKDA 5GQBA 4DROA 5B8IC 2MPHA 4TX0A 1H0IA 3RM9A 4JFLA 3QOKA 1J4IA 3O5KA 4P8WA 2WM0A 1E6ZA 1QPLA 4U86A 1W1TA 1KT0A 4ODOA 2M1IA 3WH0A 5DO2A 3ARYA 4HARA 1YW5A 3O5LA 1NWRA 2ESCA 4Q22A 4AY1A 3CGNA 4DRHA 3WL0A 4R5EA 2PV1A 4J4NA 3B8SA 5GPGA 1LG1A 4WK9A 3H9RB 1E15A 3FY1A 3WQWA 3O5JA 4P8XA 5HKGA 1LQ0A 2RUDA 2K8IA 1ROTA 4IQCA 4KR0B 1W9PA 4ZPVR 2DT0A 1OGGA 2DT3A 5HT1A 3IKGA 3O5EA 2EULA 3O5QA 3WIJA 3ARTA 1F8AB 3CHFA 4QT3A 2XP8A 1TCOC 2ZQVA 3O5DA 3RM8A 3WL1A 3IHZA 3ARSA 1T11A 1HKKA 4U84A 4XAKA 3AS3A 3CZ8A 2RURA 2ZQTA 3LUOA 2UZ5A 1SR0A 4ODQA 2MLXA 1D7JA 4DWSC 5HTGA 1J4RA 4DRNA 3AQUA 1P5QA 1FKFA 1NWSA 1LJYA 3WD4A 4ODLA 4WKAA 4LAXA 4TW7A 1NSGA 1FD9A 1FKBA 4ZPWR 2PPPA 1WNOA 1Y0OA 3EY6A 4QZVB 1GRJA 1JNSA 1TFVA 4W5UA 4GGQA 1EQ3A 1UR8A 3B9DA 3GTYX 2A3EA 4ODNA 4LGXA 3ARUA 1QPFA 2O9OA 5DEZA 4DH0A 2F23A 1KFWA 3CH9A 3NI6A 4KQZA 1J4HA 2XP6A 1E6RA 1JCHB 1WB0A 5JH8A 2XP4A 4MNLA 5D75A 3O5GA 4PTMA 4IT4A 2N87A 2YBTA 1FKLA 4IT6A 3KAIA 2PPNA 1FKJA 3PRAA 2DPEA 3UQBA 1O6IA 4DRJA 1M5YA 3GPKA 1NH6A 4Z2IA 1B6CA 3UI4A 1WAWA 3O5FA 3O5RA 4DRPA 4NNRA 4FN2A 2KO7A 4LAVA 2XPBA 2ZR4A 4P8VA 1FKRA 2DT1A 2AWGA 1FKIA 3KABA 2B5UB 1D6OA 1Q6UA 1LG2A 3O5OA 3JYJA 2DSUA 1FKHA 1R9HA 2XP5A 4MGVA 3KCEA 4URIA 5HWBA 3RMEA 3WQVA 2RSEA 3O5PA 5HWCA 3PR9A 1W26A 1ITXA 1W1YA 4G50A 5DITA 1ZBKA 1EHNA 3ARQA 1XHGA 1W9UA 4W9QA 3CHCA 4O2TA 3WD1A 4MSPA 4Z2HA 3O5IA 4TYOA 3WD2A 2DSZA
chains in the Genus database with same CATH topology
1VF8A 4WIWA 4JYSA 2ZQSA 4MTVA 2LPVA 1LL4A 3TCZA 1FKSA 1X6LA 2A3AA 3RFWA 1D7HA 1JNDA 4QT2A 1FKGA 3I6CA 4ZS6A 3KACA 2FKEA 3VAWA 3ARVA 2AOSA 3ARXA 4HBOA 4LAWA 3W4RA 2YBUA 3B9AA 2A3CA 4WKHA 1J6YA 2ZR5A 4BF8A 1ZBCA 3WD3A 4MNMA 4IPXA 2WK2A 2PV2A 4TW6A 1C9HA 1GOIA 1W9VA 3AROA 1ZL1A 2LGOA 3ODKA 1CTNA 1HJWA 1NMVA 2ITKA 1GPFA 2G41A 1RD6A 1BKFA 3CHEA 4Q7NA 1F40A 3UQAA 1ROUA 3AS1A 4NSBA 1FJDA 2DT2A 1NWTA 1W1PA 4NZCA 3IK8A 3JXVA 3KZ7A 2RUQA 1ZK6A 4N19A 1IX5A 2PPOA 5HW6A 3ALFA 2OFNA 4R0XA 2Y78A 4P8UA 4MAVA 4W9PA 4IQ2A 4ODKA 3TC5A 1QZ2A 1FFRA 3PRDA 4G2PA 4JFKA 1HKJA 1EIBA 3WKZA 1E6NA 4TNSA 2L2SA 4S3KA 4Z2JA 3BXWA 3NRKA 4ODRA 4DRQA 4JFIA 4MNJA 1LL6A 3B7XA 2MLYA 2O92A 3PRBA 4MPKA 1ZCNA 1A7XA 4JFJA 3CHDA 4Z2GA 2RUCA 1HXVA 4Z2LA 4HBEA 3WD0A 1JNEA 4L3NA 2PI6A 1SYTA 1U79A 1W1VA 4DRKA 1PINA 2PBCA 2KR7A 2F21A 2WLZA 4DWSD 1Q6HA 2KI3A 1ZBVA 2XP7A 1HJXA 3KAFA 3JYMA 1KT1A 2IF4A 3FXYA 3UI6A 1ZBWA 2FDMA 1Q6IA 2XP3A 1LL7A 2M2AA 2WLYA 2D9FA 1YATA 3UF8A 1Q1CA 4S3JA 1D7IA 3RGCA 1X6NA 4ZPTR 5J6EA 5DIUA 4W9OA 5HUAA 2ZQUA 3MDYB 3ARPA 2M08A 3NTPA 2ZR6A 3OA5A 1H0GA 1FFQA 4DIPA 2PV3A 3KAGA 1N1AA 2LJ4A 2LKNA 3ARWA 5DF0A 5I98A 3B9EA 2IUZA 4MNKA 1JVWA 3CGMA 3RM4A 4DWSA 3ARRA 3UI5A 2XP9A 1XRVA 1NWUA 5HW8A 1HKMA 2RQSA 3G6MA 4GIVA 5DIVA 1ZU8A 2DG9A 2DSWA 3IKDA 1K9TA 4DZ3A 4DRIA 3AS0A 5HBFA 1HJVA 2B31A 1EYMA 4Z2KA 1D2KA 4TW8A 3KADA 4JFMA 2MNTA 4L72B 2DG4A 4DRMA 5HW7A 4ML4A 1FKTA 1GUVA 2MF9A 4LAYA 3O5MA 2KGJA 4WJXA 1PBKA 3FAPA 1HKIA 2DSVA 3ALGA 4QIBA 2XPAA 1E9LA 5BXJA 4U85A 2KFWA 1BL4A 2F2DA 1L1PA 3PA7A 2F4EA 2VCDA 3OOBA 3G6LA 4C02B 1FKKA 4DZ2A 1NMWA 4DWSB 3KAHA 2OLHA 1ZB5A 1E6PA 1JNTA 2FAPA 2JZVA 2MLZA 4J4OA 4WKFA 1UR9A 1EDQA 3AS2A 2KE0A 2QF8A 3UQIA 3TDBA 3ARZA 1OGBA 1OWQA 2Q5AA 4ODMA 2DG3A 4DT4A 1FAPA 4ODPA 2A3BA 4FAPA 5GPRA 2G8ZA 2VN1A 4ITZA 1FKDA 5GQBA 4DROA 5B8IC 2MPHA 4TX0A 1H0IA 3RM9A 4JFLA 3QOKA 1J4IA 3O5KA 4P8WA 2WM0A 1E6ZA 1QPLA 4U86A 1W1TA 1KT0A 4ODOA 2M1IA 3WH0A 5DO2A 3ARYA 4HARA 1YW5A 3O5LA 1NWRA 2ESCA 4Q22A 4AY1A 3CGNA 4DRHA 3WL0A 4R5EA 2PV1A 4J4NA 3B8SA 5GPGA 1LG1A 4WK9A 3H9RB 1E15A 3FY1A 3WQWA 3O5JA 4P8XA 5HKGA 1LQ0A 2RUDA 2K8IA 1ROTA 4IQCA 4KR0B 1W9PA 4ZPVR 2DT0A 1OGGA 2DT3A 5HT1A 3IKGA 3O5EA 3O5QA 3WIJA 3ARTA 1F8AB 3CHFA 4QT3A 2XP8A 1TCOC 2ZQVA 3O5DA 3RM8A 3WL1A 3IHZA 3ARSA 1T11A 1HKKA 4U84A 4XAKA 3AS3A 3CZ8A 2RURA 2ZQTA 3LUOA 2UZ5A 1SR0A 4ODQA 2MLXA 1D7JA 4DWSC 5HTGA 1J4RA 4DRNA 3AQUA 1P5QA 1FKFA 1NWSA 1LJYA 3WD4A 4ODLA 4WKAA 4LAXA 4TW7A 1NSGA 1FD9A 1FKBA 4ZPWR 2PPPA 1WNOA 1Y0OA 3EY6A 4QZVB 1JNSA 1TFVA 4W5UA 4GGQA 1EQ3A 1UR8A 3B9DA 4ODNA 2A3EA 4LGXA 3ARUA 1QPFA 2O9OA 5DEZA 4DH0A 1KFWA 3CH9A 3NI6A 4KQZA 1J4HA 2XP6A 1E6RA 1WB0A 5JH8A 2XP4A 4MNLA 5D75A 3O5GA 4PTMA 4IT4A 2N87A 2YBTA 1FKLA 4IT6A 3KAIA 2PPNA 1FKJA 3PRAA 2DPEA 3UQBA 1O6IA 4DRJA 1M5YA 3GPKA 1NH6A 4Z2IA 1B6CA 3UI4A 1WAWA 3O5FA 3O5RA 4DRPA 4NNRA 4FN2A 2KO7A 4LAVA 2XPBA 2ZR4A 4P8VA 1FKRA 2DT1A 2AWGA 1FKIA 3KABA 1D6OA 1Q6UA 1LG2A 3O5OA 3JYJA 2DSUA 1FKHA 1R9HA 2XP5A 4MGVA 3KCEA 4URIA 5HWBA 3RMEA 3WQVA 2RSEA 3O5PA 5HWCA 3PR9A 1W26A 1ITXA 1W1YA 4G50A 5DITA 1ZBKA 1EHNA 3ARQA 1XHGA 1W9UA 4W9QA 3CHCA 4O2TA 3WD1A 4MSPA 4Z2HA 3O5IA 4TYOA 3WD2A 2DSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XP7 A;  3OOB A;  4ODQ A;  2MLX A;  4C02 B;  1D7J A;  5HTG A;  4JYS A;  2ZQS A;  1FKK A;  1J4R A;  2LPV A;  1NMW A;  3KAF A;  3TCZ A;  4DRN A;  4DZ2 A;  3JYM A;  1FKS A;  1P5Q A;  1FKF A;  1KT1 A;  3RFW A;  1D7H A;  3KAH A;  2IF4 A;  3UI6 A;  1JNT A;  4ODL A;  4LAX A;  4TW7 A;  1Q6I A;  1NSG A;  1FD9 A;  1FKB A;  4QT2 A;  1FKG A;  2FAP A;  2XP3 A;  2JZV A;  2M2A A;  3I6C A;  2FKE A;  3KAC A;  2PPP A;  2MLZ A;  4J4O A;  3VAW A;  2D9F A;  1YAT A;  4LAW A;  3UF8 A;  1Q1C A;  1Y0O A;  3EY6 A;  1D7I A;  2KE0 A;  1J6Y A;  3UQI A;  2ZR5 A;  3RGC A;  4BF8 A;  3TDB A;  1JNS A;  2Q5A A;  4IPX A;  4ODM A;  2PV2 A;  4TW6 A;  1C9H A;  4GGQ A;  5J6E A;  1EQ3 A;  2DG3 A;  5DIU A;  1FAP A;  4W9O A;  4DT4 A;  5HUA A;  2ZQU A;  3MDY B;  4ODP A;  4ODN A;  4FAP A;  2LGO A;  2M08 A;  3NTP A;  1QPF A;  3ODK A;  4DH0 A;  3NI6 A;  1NMV A;  2VN1 A;  2ZR6 A;  1J4H A;  1FKD A;  2ITK A;  2XP6 A;  2MPH A;  4ITZ A;  4TX0 A;  4DRO A;  5B8I C;  1BKF A;  4DIP A;  2PV3 A;  4JFL A;  2XP4 A;  1F40 A;  3UQA A;  1J4I A;  1N1A A;  1ROU A;  3KAG A;  3O5K A;  1FJD A;  1QPL A;  4U86 A;  5D75 A;  3O5G A;  1KT0 A;  2LJ4 A;  4ODO A;  2LKN A;  2M1I A;  2N87 A;  5I98 A;  3WH0 A;  1YW5 A;  1FKL A;  3O5L A;  1JVW A;  3CGM A;  3IK8 A;  3KAI A;  3JXV A;  3KZ7 A;  3UI5 A;  3CGN A;  2PPN A;  2RUQ A;  1ZK6 A;  4N19 A;  4DRH A;  2XP9 A;  2PPO A;  1FKJ A;  2PV1 A;  5HW6 A;  4J4N A;  5HW8 A;  3UQB A;  5GPG A;  2RQS A;  1M5Y A;  2OFN A;  4GIV A;  4R0X A;  2Y78 A;  3GPK A;  4DRJ A;  3H9R B;  4IQ2 A;  4W9P A;  4ODK A;  5DIV A;  1B6C A;  1QZ2 A;  2DG9 A;  3TC5 A;  3UI4 A;  3PRD A;  3IKD A;  3O5F A;  4G2P A;  3O5J A;  5HKG A;  4JFK A;  3O5R A;  4DZ3 A;  4DRP A;  2RUD A;  4NNR A;  2K8I A;  1ROT A;  4FN2 A;  2KO7 A;  4IQC A;  4DRI A;  4LAV A;  4TNS A;  2L2S A;  1EYM A;  2XPB A;  2ZR4 A;  4TW8 A;  1FKR A;  2AWG A;  3NRK A;  4ODR A;  4DRQ A;  1FKI A;  3KAB A;  3KAD A;  4JFI A;  4JFM A;  5HT1 A;  2MNT A;  3IKG A;  3O5E A;  1D6O A;  3O5Q A;  1Q6U A;  3O5O A;  2DG4 A;  4DRM A;  5HW7 A;  3JYJ A;  3B7X A;  1F8A B;  2MLY A;  1FKH A;  1FKT A;  1R9H A;  2MF9 A;  2XP5 A;  3KCE A;  3PRB A;  4LAY A;  4MGV A;  4QT3 A;  5HWB A;  2XP8 A;  3O5M A;  1TCO C;  2KGJ A;  1ZCN A;  2RSE A;  1PBK A;  2ZQV A;  3FAP A;  3O5P A;  5HWC A;  3O5D A;  1A7X A;  1W26 A;  3IHZ A;  4JFJ A;  1T11 A;  2RUC A;  4G50 A;  5DIT A;  1HXV A;  4QIB A;  4U84 A;  2XPA A;  4W9Q A;  5BXJ A;  2RUR A;  1U79 A;  4O2T A;  2ZQT A;  4U85 A;  3LUO A;  1PIN A;  2KFW A;  2KR7 A;  1BL4 A;  2PBC A;  4MSP A;  4DRK A;  2F2D A;  2F21 A;  3O5I A;  4TYO A;  1L1P A;  2UZ5 A;  3PA7 A;  2F4E A;  1Q6H A;  2VCD A;  2KI3 A; 
#chains in the Genus database with same CATH topology
 1VF8 A;  4WIW A;  4JYS A;  2ZQS A;  4MTV A;  2LPV A;  1LL4 A;  3TCZ A;  1FKS A;  1X6L A;  2A3A A;  3RFW A;  1D7H A;  1JND A;  4QT2 A;  1FKG A;  3I6C A;  4ZS6 A;  3KAC A;  2FKE A;  3VAW A;  3ARV A;  2AOS A;  3ARX A;  4HBO A;  4LAW A;  3W4R A;  2YBU A;  3B9A A;  2A3C A;  4WKH A;  1J6Y A;  2ZR5 A;  4BF8 A;  1ZBC A;  3WD3 A;  4MNM A;  4IPX A;  2WK2 A;  2PV2 A;  4TW6 A;  1C9H A;  1GOI A;  1W9V A;  3ARO A;  1ZL1 A;  1E44 A;  2LGO A;  3ODK A;  1CTN A;  1HJW A;  1NMV A;  2ITK A;  1GPF A;  2G41 A;  1RD6 A;  1BKF A;  3CHE A;  4Q7N A;  1F40 A;  3UQA A;  1ROU A;  3AS1 A;  4NSB A;  1FJD A;  2ETN A;  2DT2 A;  1NWT A;  1W1P A;  4NZC A;  3IK8 A;  3JXV A;  3KZ7 A;  2RUQ A;  1ZK6 A;  4N19 A;  1IX5 A;  2PPO A;  5HW6 A;  3ALF A;  2OFN A;  4R0X A;  2Y78 A;  4P8U A;  4MAV A;  4W9P A;  4IQ2 A;  4ODK A;  3TC5 A;  1QZ2 A;  1FFR A;  3PRD A;  4G2P A;  4JFK A;  1HKJ A;  1EIB A;  3WKZ A;  1E6N A;  4TNS A;  2L2S A;  4S3K A;  4Z2J A;  3BXW A;  3NRK A;  4ODR A;  4DRQ A;  4JFI A;  4MNJ A;  1LL6 A;  3B7X A;  2MLY A;  2O92 A;  3PRB A;  4MPK A;  1ZCN A;  1A7X A;  4JFJ A;  3CHD A;  4Z2G A;  2RUC A;  1HXV A;  4Z2L A;  4HBE A;  3WD0 A;  1JNE A;  4L3N A;  2PI6 A;  3EIP A;  1SYT A;  1U79 A;  1W1V A;  4DRK A;  1PIN A;  2PBC A;  2KR7 A;  2F21 A;  2WLZ A;  4DWS D;  1Q6H A;  2KI3 A;  1ZBV A;  2XP7 A;  1HJX A;  3KAF A;  3JYM A;  1KT1 A;  3BMB A;  2IF4 A;  3FXY A;  3UI6 A;  1ZBW A;  2FDM A;  1Q6I A;  2XP3 A;  1LL7 A;  2M2A A;  2WLY A;  2D9F A;  1YAT A;  3UF8 A;  1Q1C A;  4S3J A;  1D7I A;  3RGC A;  1X6N A;  4ZPT R;  5J6E A;  5DIU A;  4W9O A;  5HUA A;  2ZQU A;  3MDY B;  3ARP A;  2M08 A;  3NTP A;  2ZR6 A;  3OA5 A;  1H0G A;  1FFQ A;  4DIP A;  2PV3 A;  3KAG A;  1N1A A;  2LJ4 A;  2LKN A;  3ARW A;  5DF0 A;  5I98 A;  3B9E A;  3GU0 A;  2IUZ A;  4MNK A;  1JVW A;  3CGM A;  3RM4 A;  4DWS A;  3ARR A;  3UI5 A;  2XP9 A;  1XRV A;  1NWU A;  5HW8 A;  1HKM A;  2RQS A;  3G6M A;  4GIV A;  5DIV A;  1ZU8 A;  2DG9 A;  2DSW A;  3IKD A;  1K9T A;  4DZ3 A;  4DRI A;  3AS0 A;  5HBF A;  1HJV A;  2B31 A;  1EYM A;  4Z2K A;  1D2K A;  4TW8 A;  3KAD A;  4JFM A;  2MNT A;  4L72 B;  2DG4 A;  4DRM A;  5HW7 A;  4ML4 A;  1FKT A;  1GUV A;  2MF9 A;  4LAY A;  3O5M A;  2KGJ A;  4WJX A;  1PBK A;  3FAP A;  1HKI A;  2DSV A;  3ALG A;  4QIB A;  2XPA A;  1E9L A;  5BXJ A;  4U85 A;  2KFW A;  1BL4 A;  2F2D A;  1L1P A;  3PA7 A;  2F4E A;  2VCD A;  3OOB A;  3G6L A;  4C02 B;  1FKK A;  4DZ2 A;  1NMW A;  4DWS B;  3KAH A;  2OLH A;  1ZB5 A;  1E6P A;  1JNT A;  2P4V A;  2FAP A;  4UDM A;  2JZV A;  2PN0 A;  2MLZ A;  4J4O A;  4WKF A;  1UR9 A;  1EDQ A;  3AS2 A;  2KE0 A;  2QF8 A;  3UQI A;  3TDB A;  3ARZ A;  1OGB A;  1OWQ A;  2Q5A A;  4ODM A;  2DG3 A;  4DT4 A;  1FAP A;  4ODP A;  2A3B A;  4FAP A;  5GPR A;  2G8Z A;  2VN1 A;  4ITZ A;  1FKD A;  5GQB A;  4DRO A;  5B8I C;  2MPH A;  4TX0 A;  1H0I A;  3RM9 A;  4JFL A;  3QOK A;  1J4I A;  3O5K A;  4P8W A;  2WM0 A;  1E6Z A;  1QPL A;  4U86 A;  1W1T A;  1KT0 A;  4ODO A;  2M1I A;  3WH0 A;  5DO2 A;  3ARY A;  4HAR A;  1YW5 A;  3O5L A;  1NWR A;  2ESC A;  4Q22 A;  4AY1 A;  3CGN A;  4DRH A;  3WL0 A;  4R5E A;  2PV1 A;  4J4N A;  3B8S A;  5GPG A;  1LG1 A;  4WK9 A;  3H9R B;  1E15 A;  3FY1 A;  3WQW A;  3O5J A;  4P8X A;  5HKG A;  1LQ0 A;  2RUD A;  2K8I A;  1ROT A;  4IQC A;  4KR0 B;  1W9P A;  4ZPV R;  2DT0 A;  1OGG A;  2DT3 A;  5HT1 A;  3IKG A;  3O5E A;  2EUL A;  3O5Q A;  3WIJ A;  3ART A;  1F8A B;  3CHF A;  4QT3 A;  2XP8 A;  1TCO C;  2ZQV A;  3O5D A;  3RM8 A;  3WL1 A;  3IHZ A;  3ARS A;  1T11 A;  1HKK A;  4U84 A;  4XAK A;  3AS3 A;  3CZ8 A;  2RUR A;  2ZQT A;  3LUO A;  2UZ5 A;  1SR0 A;  4ODQ A;  2MLX A;  1D7J A;  4DWS C;  5HTG A;  1J4R A;  4DRN A;  3AQU A;  1P5Q A;  1FKF A;  1NWS A;  1LJY A;  3WD4 A;  4ODL A;  4WKA A;  4LAX A;  4TW7 A;  1NSG A;  1FD9 A;  1FKB A;  4ZPW R;  2PPP A;  1WNO A;  1Y0O A;  3EY6 A;  4QZV B;  1GRJ A;  1JNS A;  1TFV A;  4W5U A;  4GGQ A;  1EQ3 A;  1UR8 A;  3B9D A;  3GTY X;  2A3E A;  4ODN A;  4LGX A;  3ARU A;  1QPF A;  2O9O A;  5DEZ A;  4DH0 A;  2F23 A;  1KFW A;  3CH9 A;  3NI6 A;  4KQZ A;  1J4H A;  2XP6 A;  1E6R A;  1JCH B;  1WB0 A;  5JH8 A;  2XP4 A;  4MNL A;  5D75 A;  3O5G A;  4PTM A;  4IT4 A;  2N87 A;  2YBT A;  1FKL A;  4IT6 A;  3KAI A;  2PPN A;  1FKJ A;  3PRA A;  2DPE A;  3UQB A;  1O6I A;  4DRJ A;  1M5Y A;  3GPK A;  1NH6 A;  4Z2I A;  1B6C A;  3UI4 A;  1WAW A;  3O5F A;  3O5R A;  4DRP A;  4NNR A;  4FN2 A;  2KO7 A;  4LAV A;  2XPB A;  2ZR4 A;  4P8V A;  1FKR A;  2DT1 A;  2AWG A;  1FKI A;  3KAB A;  2B5U B;  1D6O A;  1Q6U A;  1LG2 A;  3O5O A;  3JYJ A;  2DSU A;  1FKH A;  1R9H A;  2XP5 A;  4MGV A;  3KCE A;  4URI A;  5HWB A;  3RME A;  3WQV A;  2RSE A;  3O5P A;  5HWC A;  3PR9 A;  1W26 A;  1ITX A;  1W1Y A;  4G50 A;  5DIT A;  1ZBK A;  1EHN A;  3ARQ A;  1XHG A;  1W9U A;  4W9Q A;  3CHC A;  4O2T A;  3WD1 A;  4MSP A;  4Z2H A;  3O5I A;  4TYO A;  3WD2 A;  2DSZ A; 
#chains in the Genus database with same CATH homology
 1VF8 A;  4WIW A;  4JYS A;  2ZQS A;  4MTV A;  2LPV A;  1LL4 A;  3TCZ A;  1FKS A;  1X6L A;  2A3A A;  3RFW A;  1D7H A;  1JND A;  4QT2 A;  1FKG A;  3I6C A;  4ZS6 A;  3KAC A;  2FKE A;  3VAW A;  3ARV A;  2AOS A;  3ARX A;  4HBO A;  4LAW A;  3W4R A;  2YBU A;  3B9A A;  2A3C A;  4WKH A;  1J6Y A;  2ZR5 A;  4BF8 A;  1ZBC A;  3WD3 A;  4MNM A;  4IPX A;  2WK2 A;  2PV2 A;  4TW6 A;  1C9H A;  1GOI A;  1W9V A;  3ARO A;  1ZL1 A;  2LGO A;  3ODK A;  1CTN A;  1HJW A;  1NMV A;  2ITK A;  1GPF A;  2G41 A;  1RD6 A;  1BKF A;  3CHE A;  4Q7N A;  1F40 A;  3UQA A;  1ROU A;  3AS1 A;  4NSB A;  1FJD A;  2DT2 A;  1NWT A;  1W1P A;  4NZC A;  3IK8 A;  3JXV A;  3KZ7 A;  2RUQ A;  1ZK6 A;  4N19 A;  1IX5 A;  2PPO A;  5HW6 A;  3ALF A;  2OFN A;  4R0X A;  2Y78 A;  4P8U A;  4MAV A;  4W9P A;  4IQ2 A;  4ODK A;  3TC5 A;  1QZ2 A;  1FFR A;  3PRD A;  4G2P A;  4JFK A;  1HKJ A;  1EIB A;  3WKZ A;  1E6N A;  4TNS A;  2L2S A;  4S3K A;  4Z2J A;  3BXW A;  3NRK A;  4ODR A;  4DRQ A;  4JFI A;  4MNJ A;  1LL6 A;  3B7X A;  2MLY A;  2O92 A;  3PRB A;  4MPK A;  1ZCN A;  1A7X A;  4JFJ A;  3CHD A;  4Z2G A;  2RUC A;  1HXV A;  4Z2L A;  4HBE A;  3WD0 A;  1JNE A;  4L3N A;  2PI6 A;  1SYT A;  1U79 A;  1W1V A;  4DRK A;  1PIN A;  2PBC A;  2KR7 A;  2F21 A;  2WLZ A;  4DWS D;  1Q6H A;  2KI3 A;  1ZBV A;  2XP7 A;  1HJX A;  3KAF A;  3JYM A;  1KT1 A;  2IF4 A;  3FXY A;  3UI6 A;  1ZBW A;  2FDM A;  1Q6I A;  2XP3 A;  1LL7 A;  2M2A A;  2WLY A;  2D9F A;  1YAT A;  3UF8 A;  1Q1C A;  4S3J A;  1D7I A;  3RGC A;  1X6N A;  4ZPT R;  5J6E A;  5DIU A;  4W9O A;  5HUA A;  2ZQU A;  3MDY B;  3ARP A;  2M08 A;  3NTP A;  2ZR6 A;  3OA5 A;  1H0G A;  1FFQ A;  4DIP A;  2PV3 A;  3KAG A;  1N1A A;  2LJ4 A;  2LKN A;  3ARW A;  5DF0 A;  5I98 A;  3B9E A;  2IUZ A;  4MNK A;  1JVW A;  3CGM A;  3RM4 A;  4DWS A;  3ARR A;  3UI5 A;  2XP9 A;  1XRV A;  1NWU A;  5HW8 A;  1HKM A;  2RQS A;  3G6M A;  4GIV A;  5DIV A;  1ZU8 A;  2DG9 A;  2DSW A;  3IKD A;  1K9T A;  4DZ3 A;  4DRI A;  3AS0 A;  5HBF A;  1HJV A;  2B31 A;  1EYM A;  4Z2K A;  1D2K A;  4TW8 A;  3KAD A;  4JFM A;  2MNT A;  4L72 B;  2DG4 A;  4DRM A;  5HW7 A;  4ML4 A;  1FKT A;  1GUV A;  2MF9 A;  4LAY A;  3O5M A;  2KGJ A;  4WJX A;  1PBK A;  3FAP A;  1HKI A;  2DSV A;  3ALG A;  4QIB A;  2XPA A;  1E9L A;  5BXJ A;  4U85 A;  2KFW A;  1BL4 A;  2F2D A;  1L1P A;  3PA7 A;  2F4E A;  2VCD A;  3OOB A;  3G6L A;  4C02 B;  1FKK A;  4DZ2 A;  1NMW A;  4DWS B;  3KAH A;  2OLH A;  1ZB5 A;  1E6P A;  1JNT A;  2FAP A;  2JZV A;  2MLZ A;  4J4O A;  4WKF A;  1UR9 A;  1EDQ A;  3AS2 A;  2KE0 A;  2QF8 A;  3UQI A;  3TDB A;  3ARZ A;  1OGB A;  1OWQ A;  2Q5A A;  4ODM A;  2DG3 A;  4DT4 A;  1FAP A;  4ODP A;  2A3B A;  4FAP A;  5GPR A;  2G8Z A;  2VN1 A;  4ITZ A;  1FKD A;  5GQB A;  4DRO A;  5B8I C;  2MPH A;  4TX0 A;  1H0I A;  3RM9 A;  4JFL A;  3QOK A;  1J4I A;  3O5K A;  4P8W A;  2WM0 A;  1E6Z A;  1QPL A;  4U86 A;  1W1T A;  1KT0 A;  4ODO A;  2M1I A;  3WH0 A;  5DO2 A;  3ARY A;  4HAR A;  1YW5 A;  3O5L A;  1NWR A;  2ESC A;  4Q22 A;  4AY1 A;  3CGN A;  4DRH A;  3WL0 A;  4R5E A;  2PV1 A;  4J4N A;  3B8S A;  5GPG A;  1LG1 A;  4WK9 A;  3H9R B;  1E15 A;  3FY1 A;  3WQW A;  3O5J A;  4P8X A;  5HKG A;  1LQ0 A;  2RUD A;  2K8I A;  1ROT A;  4IQC A;  4KR0 B;  1W9P A;  4ZPV R;  2DT0 A;  1OGG A;  2DT3 A;  5HT1 A;  3IKG A;  3O5E A;  3O5Q A;  3WIJ A;  3ART A;  1F8A B;  3CHF A;  4QT3 A;  2XP8 A;  1TCO C;  2ZQV A;  3O5D A;  3RM8 A;  3WL1 A;  3IHZ A;  3ARS A;  1T11 A;  1HKK A;  4U84 A;  4XAK A;  3AS3 A;  3CZ8 A;  2RUR A;  2ZQT A;  3LUO A;  2UZ5 A;  1SR0 A;  4ODQ A;  2MLX A;  1D7J A;  4DWS C;  5HTG A;  1J4R A;  4DRN A;  3AQU A;  1P5Q A;  1FKF A;  1NWS A;  1LJY A;  3WD4 A;  4ODL A;  4WKA A;  4LAX A;  4TW7 A;  1NSG A;  1FD9 A;  1FKB A;  4ZPW R;  2PPP A;  1WNO A;  1Y0O A;  3EY6 A;  4QZV B;  1JNS A;  1TFV A;  4W5U A;  4GGQ A;  1EQ3 A;  1UR8 A;  3B9D A;  4ODN A;  2A3E A;  4LGX A;  3ARU A;  1QPF A;  2O9O A;  5DEZ A;  4DH0 A;  1KFW A;  3CH9 A;  3NI6 A;  4KQZ A;  1J4H A;  2XP6 A;  1E6R A;  1WB0 A;  5JH8 A;  2XP4 A;  4MNL A;  5D75 A;  3O5G A;  4PTM A;  4IT4 A;  2N87 A;  2YBT A;  1FKL A;  4IT6 A;  3KAI A;  2PPN A;  1FKJ A;  3PRA A;  2DPE A;  3UQB A;  1O6I A;  4DRJ A;  1M5Y A;  3GPK A;  1NH6 A;  4Z2I A;  1B6C A;  3UI4 A;  1WAW A;  3O5F A;  3O5R A;  4DRP A;  4NNR A;  4FN2 A;  2KO7 A;  4LAV A;  2XPB A;  2ZR4 A;  4P8V A;  1FKR A;  2DT1 A;  2AWG A;  1FKI A;  3KAB A;  1D6O A;  1Q6U A;  1LG2 A;  3O5O A;  3JYJ A;  2DSU A;  1FKH A;  1R9H A;  2XP5 A;  4MGV A;  3KCE A;  4URI A;  5HWB A;  3RME A;  3WQV A;  2RSE A;  3O5P A;  5HWC A;  3PR9 A;  1W26 A;  1ITX A;  1W1Y A;  4G50 A;  5DIT A;  1ZBK A;  1EHN A;  3ARQ A;  1XHG A;  1W9U A;  4W9Q A;  3CHC A;  4O2T A;  3WD1 A;  4MSP A;  4Z2H A;  3O5I A;  4TYO A;  3WD2 A;  2DSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...