2DG4A

Fk506-binding protein mutant wf59 complexed with rapamycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGFEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 1A
publication title Energetic and structural analysis of the role of tryptophan 59 in FKBP12
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 22
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2dg4A00
4ODLA 1KT0A 1FD9A 1Q6UA 3CGNA 4R0XA 4JFMA 3PRDA 1BKFA 2PV1A 4DIPA 4TW6A 4DZ3A 3PA7A 3NI6A 1YATA 2KE0A 2PV2A 3O5DA 3RFWA 4DRNA 2F2DA 3KAGA 4QT3A 1JNTA 3KAIA 1HXVA 1F40A 3EY6A 2ITKA 3JYJA 4DH0A 2AWGA 2M08A 1FKLA 4DT4A 2DG4A 4LAVA 3IHZA 2FKEA 5HW8A 1FKJA 4DRHA 4JFJA 4LAYA 1FKFA 4ODRA 1Q6HA 5I98A 4O2TA 1YW5A 5HTGA 2RQSA 2RUCA 3KAFA 3IKDA 1NMWA 4J4OA 2UZ5A 2XP7A 2MLZA 1NMVA 3B7XA 2KFWA 4ODKA 1L1PA 1FKTA 1D7HA 4W9QA 3UI4A 1T11A 3O5IA 4QT2A 1C9HA 3JYMA 4DRJA 2KI3A 3O5GA 4MSPA 2XP8A 2XP3A 1JVWA 1QZ2A 3O5OA 2PV3A 4U85A 1FKRA 4FN2A 2IF4A 4DRPA 1FKGA 2XPBA 3KZ7A 3GPKA 3PRBA 5HWCA 2Y78A 2XP4A 1TCOC 1ROTA 2Q5AA 1J6YA 2RSEA 2DG9A 4IPXA 1JNSA 1J4HA 3KADA 2ZR6A 4MGVA 3O5KA 4ODMA 3VAWA 3NTPA 1F8AB 2OFNA 4G2PA 4TW7A 3UF8A 2LJ4A 2M1IA 3UI5A 5HUAA 1D6OA 3OOBA 3LUOA 4BF8A 1EQ3A 1B6CA 2LKNA 2XP5A 2K8IA 4LAWA 3IK8A 1Q1CA 5D75A 3UQAA 1FKSA 2RURA 2FAPA 1PINA 1R9HA 4QIBA 2MF9A 1NSGA 3TDBA 3O5MA 5BXJA 2F21A 4JFLA 2LGOA 2MLXA 3RGCA 4TNSA 1N1AA 2JZVA 3WH0A 4ODPA 5HKGA 1FKBA 1ZK6A 4G50A 2XP6A 2L2SA 1BL4A 2ZR4A 3KCEA 3O5EA 5DIVA 2PPNA 1U79A 2PPPA 1A7XA 1KT1A 2M2AA 4ITZA 3O5LA 4DRMA 3JXVA 1FAPA 1J4RA 3O5FA 4JFIA 2D9FA 1P5QA 1FKHA 1FKIA 3IKGA 3KABA 4LAXA 4U84A 4ODQA 4ODOA 4DRKA 4IQCA 4TW8A 2ZQSA 5GPGA 3TC5A 2MNTA 3UI6A 2VN1A 4JFKA 3TCZA 1ZCNA 4TYOA 1Q6IA 3NRKA 2MPHA 5HWBA 4DRQA 2MLYA 5B8IC 1QPFA 1QPLA 3KAHA 4C02B 2RUQA 1D7JA 2ZR5A 4TX0A 2KGJA 2PPOA 2N87A 4DRIA 2KR7A 2DG3A 2LPVA 3H9RB 4GGQA 3FAPA 1Y0OA 3O5RA 5HW7A 1EYMA 5J6EA 1FJDA 1FKDA 4NNRA 1D7IA 2KO7A 2ZQUA 4DROA 4FAPA 2ZQVA 4J4NA 5HW6A 3O5QA 5DIUA 4DZ2A 3I6CA 2PBCA 2VCDA 4GIVA 3UQIA 4JYSA 3O5PA 1ROUA 4IQ2A 2XPAA 1PBKA 2ZQTA 2XP9A 1J4IA 3MDYB 3O5JA 4U86A 5DITA 1FKKA 5HT1A 2RUDA 4N19A 3UQBA 4ODNA 3CGMA 3ODKA 2F4EA 3KACA 1W26A 4W9PA 1M5YA 4W9OA
chains in the Genus database with same CATH superfamily
4MNMA 3AROA 4DWSD 1K9TA 3CGNA 4TW6A 5HBFA 4R5EA 3CHDA 3NI6A 1YATA 2PV2A 3O5DA 4QT3A 1JNTA 1OGGA 3EY6A 4Z2GA 4DT4A 1RD6A 4LAVA 1WAWA 1FKJA 2DSVA 2YBTA 5I98A 2YBUA 2RQSA 2RUCA 3KAFA 3WD1A 1NMWA 2XP7A 1XRVA 1HKJA 3B7XA 1D7HA 3JYMA 4DRJA 2PI6A 1IX5A 1HKIA 2IUZA 1LG2A 3B8SA 1FKGA 2XPBA 3KZ7A 4HBOA 1X6NA 3ARQA 4S3KA 2Q5AA 4IPXA 1E44A 3RM8A 3KADA 4MGVA 3O5KA 4MPKA 4G2PA 3ARWA 4WK9A 3UQAA 4L3NA 4QIBA 2MF9A 5BXJA 3O5MA 4JFLA 1GPFA 1N1AA 1ZK6A 1FFQA 2XP6A 2L2SA 1BL4A 2ZR4A 2A3AA 3GTYX 1KT1A 1HKMA 3JXVA 4DWSA 4JFIA 4UDMA 4ODQA 1ZB5A 3UI6A 2VN1A 5HWBA 3NRKA 5B8IC 1E6NA 4TX0A 4S3JA 2PPOA 3WD4A 4DRIA 3ALGA 3H9RB 2LPVA 5HW7A 5J6EA 1FJDA 2KO7A 2ZQVA 1ZL1A 5DIUA 3UQIA 2FDMA 3ARYA 1E6RA 4URIA 3O5JA 1H0GA 3CGMA 4KQZA 3OA5A 4ZS6A 3ARRA 1M5YA 2A3CA 1KT0A 1FD9A 4JFMA 3PRDA 2P4VA 3ARSA 1E6PA 4DRNA 1CTNA 1JCHB 1JNDA 4WIWA 1NWRA 1NWUA 2FKEA 5HW8A 4DRHA 4JFJA 1SR0A 1ZBCA 3WKZA 4O2TA 1ZBVA 1L1PA 3UI4A 3RMEA 1T11A 3FXYA 2PN0A 3O5IA 4QT2A 2WLZA 3CZ8A 4MSPA 3RM9A 1JVWA 3ALFA 3O5OA 2PV3A 1W1VA 4FN2A 3ARTA 3PRBA 5HWCA 2ETNA 2XP4A 1TFVA 1ROTA 4XAKA 2WK2A 4ODMA 4TW7A 1EDQA 1KFWA 3QOKA 1D6OA 4Z2KA 3OOBA 4PTMA 2A3BA 2K8IA 3IK8A 1LL7A 1FKSA 1R9HA 3CHFA 3TDBA 1O6IA 4G50A 4Z2HA 1W9VA 5DIVA 2PPNA 1A7XA 2M2AA 4IT6A 4ITZA 4MNKA 1LQ0A 4QZVB 1SYTA 4DRMA 4Z2IA 1J4RA 2D9FA 4WKAA 3KABA 1E6ZA 2ZQSA 5GPGA 3TC5A 2MNTA 4JFKA 1UR9A 4TYOA 4HBEA 5DF0A 1QPFA 1UR8A 2DSWA 1HJXA 1OWQA 1WB0A 2KGJA 2N87A 4ZPTR 4GGQA 2DG3A 1W9UA 1EYMA 2G8ZA 1ZU8A 1NH6A 2DT1A 4AY1A 2ZQUA 4DROA 4FAPA 3RM4A 4J4NA 3AS1A 3O5QA 2O92A 2PBCA 4JYSA 3O5PA 4IQ2A 1PBKA 3MDYB 4DH0A 1J4IA 4U86A 5DITA 2RUDA 4N19A 5JH8A 2DT3A 3ARVA 4ODLA 4R0XA 3BXWA 4DIPA 4DZ3A 3RFWA 1XHGA 3KAGA 4MTVA 3KAIA 4Q22A 1GRJA 2AWGA 1LG1A 2M08A 3AS3A 3AS2A 2DG4A 1X6LA 3IHZA 2WLYA 4P8VA 4LAYA 4ODRA 2AOSA 4J4OA 2MLZA 4ODKA 2KFWA 1FKTA 4W9QA 2XP8A 1LL4A 5GPRA 4U85A 2IF4A 3WIJA 4DRPA 3PR9A 3AS0A 2Y78A 3B9AA 1J6YA 2RSEA 2DG9A 2A3EA 2OLHA 3B9DA 3VAWA 3CHCA 3NTPA 2F23A 4WKFA 4IT4A 4MAVA 2LJ4A 2M1IA 3UI5A 5HUAA 4LGXA 2ESCA 3LUOA 4BF8A 1B6CA 2XP5A 4ZPWR 3FY1A 4LAWA 3G6LA 5D75A 1PINA 3AQUA 1NSGA 2LGOA 1WNOA 3RGCA 4TNSA 5DEZA 3BMBA 1H0IA 2JZVA 3WH0A 4KR0B 4ML4A 4DWSB 3B9EA 3KCEA 1EHNA 1ITXA 2WM0A 1FAPA 3O5FA 4LAXA 1FKHA 1FKIA 4IQCA 1JNEA 3TCZA 1ZCNA 1Q6IA 2MPHA 1W9PA 1EIBA 1QPLA 1LL6A 2RUQA 2B31A 2ZR5A 4HARA 1Y0OA 1FKDA 4NNRA 1GOIA 4P8WA 3I6CA 4GIVA 1ZBWA 2XPAA 4Z2JA 2ZQTA 3UQBA 1FKKA 2O9OA 3WQVA 4NSBA 3W4RA 3WD0A 1W26A 2B5UB 1Q6UA 3WL1A 1HJWA 1NWSA 1BKFA 1ZBKA 2PV1A 2DT0A 3PA7A 2KE0A 2F2DA 3PRAA 1HXVA 1F40A 1FFRA 2ITKA 3JYJA 4MNLA 1FKLA 4Q7NA 1FKFA 1Q6HA 5DO2A 1YW5A 5HTGA 4L72B 3IKDA 2UZ5A 1NMVA 4ZPVR 1C9HA 3ARUA 1NWTA 2KI3A 3O5GA 4WKHA 4DWSC 2XP3A 1QZ2A 1FKRA 1E15A 1W1TA 3GPKA 1TCOC 1GUVA 2DPEA 1JNSA 1J4HA 4NZCA 2ZR6A 1F8AB 2OFNA 2DT2A 3UF8A 3WL0A 1EQ3A 2LKNA 1Q1CA 2RURA 2FAPA 4P8UA 1HKKA 2EULA 3ARZA 2F21A 2MLXA 4WJXA 4ODPA 5HKGA 1FKBA 4Z2LA 3CH9A 1OGBA 3EIPA 3O5EA 1U79A 2PPPA 3WD2A 1D2KA 3O5LA 4P8XA 4W5UA 1LJYA 1P5QA 1VF8A 1HJVA 3IKGA 4U84A 4ODOA 4DRKA 2G41A 4TW8A 3WD3A 2DSUA 3ARXA 4MNJA 2MLYA 4DRQA 3KAHA 4C02B 1D7JA 1W1PA 1W1YA 2KR7A 3FAPA 3O5RA 4W9PA 1D7IA 3CHEA 2QF8A 5HW6A 4DZ2A 2VCDA 3G6MA 3WQWA 1ROUA 1E9LA 2XP9A 5HT1A 4ODNA 3ODKA 2F4EA 3KACA 3ARPA 5GQBA 3GU0A 2DSZA 4W9OA
chains in the Genus database with same CATH topology
4MNMA 3AROA 4DWSD 1K9TA 3CGNA 4TW6A 5HBFA 4R5EA 3CHDA 3NI6A 1YATA 2PV2A 3O5DA 4QT3A 1JNTA 1OGGA 3EY6A 4Z2GA 4DT4A 1RD6A 4LAVA 1WAWA 1FKJA 2DSVA 2YBTA 5I98A 2YBUA 2RQSA 2RUCA 3KAFA 3WD1A 1NMWA 2XP7A 1XRVA 1HKJA 3B7XA 1D7HA 3JYMA 4DRJA 2PI6A 1IX5A 1HKIA 2IUZA 1LG2A 3B8SA 1FKGA 2XPBA 3KZ7A 4HBOA 1X6NA 3ARQA 4S3KA 2Q5AA 4IPXA 3RM8A 3KADA 4MGVA 3O5KA 4MPKA 4G2PA 3ARWA 4WK9A 3UQAA 4L3NA 4QIBA 2MF9A 5BXJA 3O5MA 4JFLA 1GPFA 1N1AA 1ZK6A 1FFQA 2XP6A 2L2SA 1BL4A 2ZR4A 2A3AA 1KT1A 1HKMA 3JXVA 4DWSA 4JFIA 4ODQA 1ZB5A 3UI6A 2VN1A 5HWBA 3NRKA 5B8IC 1E6NA 4TX0A 4S3JA 2PPOA 3WD4A 4DRIA 3ALGA 3H9RB 2LPVA 5HW7A 5J6EA 1FJDA 2KO7A 2ZQVA 1ZL1A 5DIUA 3UQIA 2FDMA 3ARYA 1E6RA 4URIA 3O5JA 1H0GA 3CGMA 4KQZA 3OA5A 4ZS6A 3ARRA 1M5YA 2A3CA 1KT0A 1FD9A 4JFMA 3PRDA 3ARSA 1E6PA 4DRNA 1CTNA 1JNDA 4WIWA 1NWRA 1NWUA 2FKEA 5HW8A 4DRHA 4JFJA 1SR0A 1ZBCA 3WKZA 4O2TA 1ZBVA 1L1PA 3UI4A 3RMEA 1T11A 3FXYA 3O5IA 4QT2A 2WLZA 3CZ8A 4MSPA 3RM9A 1JVWA 3ALFA 3O5OA 2PV3A 1W1VA 4FN2A 3ARTA 3PRBA 5HWCA 2XP4A 1TFVA 1ROTA 4XAKA 2WK2A 4ODMA 4TW7A 1EDQA 1KFWA 3QOKA 1D6OA 4Z2KA 3OOBA 4PTMA 2A3BA 2K8IA 3IK8A 1LL7A 1FKSA 1R9HA 3CHFA 3TDBA 1O6IA 4G50A 4Z2HA 1W9VA 5DIVA 2PPNA 1A7XA 2M2AA 4IT6A 4ITZA 4MNKA 1LQ0A 4QZVB 1SYTA 4DRMA 4Z2IA 1J4RA 2D9FA 4WKAA 3KABA 1E6ZA 2ZQSA 5GPGA 3TC5A 2MNTA 4JFKA 1UR9A 4TYOA 4HBEA 5DF0A 1QPFA 1UR8A 2DSWA 1HJXA 1OWQA 1WB0A 2KGJA 2N87A 4ZPTR 4GGQA 2DG3A 1W9UA 1EYMA 2G8ZA 1ZU8A 1NH6A 2DT1A 4AY1A 2ZQUA 4DROA 4FAPA 3RM4A 4J4NA 3AS1A 3O5QA 2O92A 2PBCA 4JYSA 3O5PA 4IQ2A 1PBKA 3MDYB 4DH0A 1J4IA 4U86A 5DITA 2RUDA 4N19A 5JH8A 2DT3A 3ARVA 4ODLA 4R0XA 3BXWA 4DIPA 4DZ3A 3RFWA 1XHGA 3KAGA 4MTVA 3KAIA 4Q22A 2AWGA 1LG1A 2M08A 3AS3A 3AS2A 2DG4A 1X6LA 3IHZA 2WLYA 4P8VA 4LAYA 4ODRA 2AOSA 4J4OA 2MLZA 4ODKA 2KFWA 1FKTA 4W9QA 2XP8A 1LL4A 5GPRA 4U85A 2IF4A 3WIJA 4DRPA 3PR9A 3AS0A 2Y78A 3B9AA 1J6YA 2RSEA 2DG9A 2A3EA 2OLHA 3B9DA 3VAWA 3CHCA 3NTPA 4WKFA 4IT4A 4MAVA 2LJ4A 2M1IA 3UI5A 5HUAA 4LGXA 2ESCA 3LUOA 4BF8A 1B6CA 2XP5A 4ZPWR 3FY1A 4LAWA 3G6LA 5D75A 1PINA 3AQUA 1NSGA 2LGOA 1WNOA 3RGCA 4TNSA 5DEZA 1H0IA 2JZVA 3WH0A 4KR0B 4ML4A 4DWSB 3B9EA 3KCEA 1EHNA 1ITXA 2WM0A 1FAPA 3O5FA 4LAXA 1FKHA 1FKIA 4IQCA 1JNEA 3TCZA 1ZCNA 1Q6IA 2MPHA 1W9PA 1EIBA 1QPLA 1LL6A 2RUQA 2B31A 2ZR5A 4HARA 1Y0OA 1FKDA 4NNRA 1GOIA 4P8WA 3I6CA 4GIVA 1ZBWA 2XPAA 4Z2JA 2ZQTA 3UQBA 1FKKA 2O9OA 3WQVA 4NSBA 3W4RA 3WD0A 1W26A 1Q6UA 3WL1A 1HJWA 1NWSA 1BKFA 1ZBKA 2PV1A 2DT0A 3PA7A 2KE0A 2F2DA 3PRAA 1HXVA 1F40A 1FFRA 2ITKA 3JYJA 4MNLA 1FKLA 4Q7NA 1FKFA 1Q6HA 5DO2A 1YW5A 5HTGA 4L72B 3IKDA 2UZ5A 1NMVA 4ZPVR 1C9HA 3ARUA 1NWTA 2KI3A 3O5GA 4WKHA 4DWSC 2XP3A 1QZ2A 1FKRA 1E15A 1W1TA 3GPKA 1TCOC 1GUVA 2DPEA 1JNSA 1J4HA 4NZCA 2ZR6A 1F8AB 2OFNA 2DT2A 3UF8A 3WL0A 1EQ3A 2LKNA 1Q1CA 2RURA 2FAPA 4P8UA 1HKKA 3ARZA 2F21A 2MLXA 4WJXA 4ODPA 5HKGA 1FKBA 4Z2LA 3CH9A 1OGBA 3O5EA 1U79A 2PPPA 3WD2A 1D2KA 3O5LA 4P8XA 4W5UA 1LJYA 1P5QA 1VF8A 1HJVA 3IKGA 4U84A 4ODOA 4DRKA 2G41A 4TW8A 3WD3A 2DSUA 3ARXA 4MNJA 2MLYA 4DRQA 3KAHA 4C02B 1D7JA 1W1PA 1W1YA 2KR7A 3FAPA 3O5RA 4W9PA 1D7IA 3CHEA 2QF8A 5HW6A 4DZ2A 2VCDA 3G6MA 3WQWA 1ROUA 1E9LA 2XP9A 5HT1A 4ODNA 3ODKA 2F4EA 3KACA 3ARPA 5GQBA 2DSZA 4W9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ODL A;  1KT0 A;  1FD9 A;  1Q6U A;  3CGN A;  4R0X A;  4JFM A;  3PRD A;  1BKF A;  2PV1 A;  4DIP A;  4TW6 A;  4DZ3 A;  3PA7 A;  3NI6 A;  1YAT A;  2KE0 A;  2PV2 A;  3O5D A;  3RFW A;  4DRN A;  2F2D A;  3KAG A;  4QT3 A;  1JNT A;  3KAI A;  1HXV A;  1F40 A;  3EY6 A;  2ITK A;  3JYJ A;  4DH0 A;  2AWG A;  2M08 A;  1FKL A;  4DT4 A;  2DG4 A;  4LAV A;  3IHZ A;  2FKE A;  5HW8 A;  1FKJ A;  4DRH A;  4JFJ A;  4LAY A;  1FKF A;  4ODR A;  1Q6H A;  5I98 A;  4O2T A;  1YW5 A;  5HTG A;  2RQS A;  2RUC A;  3KAF A;  3IKD A;  1NMW A;  4J4O A;  2UZ5 A;  2XP7 A;  2MLZ A;  1NMV A;  3B7X A;  2KFW A;  4ODK A;  1L1P A;  1FKT A;  1D7H A;  4W9Q A;  3UI4 A;  1T11 A;  3O5I A;  4QT2 A;  1C9H A;  3JYM A;  4DRJ A;  2KI3 A;  3O5G A;  4MSP A;  2XP8 A;  2XP3 A;  1JVW A;  1QZ2 A;  3O5O A;  2PV3 A;  4U85 A;  1FKR A;  4FN2 A;  2IF4 A;  4DRP A;  1FKG A;  2XPB A;  3KZ7 A;  3GPK A;  3PRB A;  5HWC A;  2Y78 A;  2XP4 A;  1TCO C;  1ROT A;  2Q5A A;  1J6Y A;  2RSE A;  2DG9 A;  4IPX A;  1JNS A;  1J4H A;  3KAD A;  2ZR6 A;  4MGV A;  3O5K A;  4ODM A;  3VAW A;  3NTP A;  1F8A B;  2OFN A;  4G2P A;  4TW7 A;  3UF8 A;  2LJ4 A;  2M1I A;  3UI5 A;  5HUA A;  1D6O A;  3OOB A;  3LUO A;  4BF8 A;  1EQ3 A;  1B6C A;  2LKN A;  2XP5 A;  2K8I A;  4LAW A;  3IK8 A;  1Q1C A;  5D75 A;  3UQA A;  1FKS A;  2RUR A;  2FAP A;  1PIN A;  1R9H A;  4QIB A;  2MF9 A;  1NSG A;  3TDB A;  3O5M A;  5BXJ A;  2F21 A;  4JFL A;  2LGO A;  2MLX A;  3RGC A;  4TNS A;  1N1A A;  2JZV A;  3WH0 A;  4ODP A;  5HKG A;  1FKB A;  1ZK6 A;  4G50 A;  2XP6 A;  2L2S A;  1BL4 A;  2ZR4 A;  3KCE A;  3O5E A;  5DIV A;  2PPN A;  1U79 A;  2PPP A;  1A7X A;  1KT1 A;  2M2A A;  4ITZ A;  3O5L A;  4DRM A;  3JXV A;  1FAP A;  1J4R A;  3O5F A;  4JFI A;  2D9F A;  1P5Q A;  1FKH A;  1FKI A;  3IKG A;  3KAB A;  4LAX A;  4U84 A;  4ODQ A;  4ODO A;  4DRK A;  4IQC A;  4TW8 A;  2ZQS A;  5GPG A;  3TC5 A;  2MNT A;  3UI6 A;  2VN1 A;  4JFK A;  3TCZ A;  1ZCN A;  4TYO A;  1Q6I A;  3NRK A;  2MPH A;  5HWB A;  4DRQ A;  2MLY A;  5B8I C;  1QPF A;  1QPL A;  3KAH A;  4C02 B;  2RUQ A;  1D7J A;  2ZR5 A;  4TX0 A;  2KGJ A;  2PPO A;  2N87 A;  4DRI A;  2KR7 A;  2DG3 A;  2LPV A;  3H9R B;  4GGQ A;  3FAP A;  1Y0O A;  3O5R A;  5HW7 A;  1EYM A;  5J6E A;  1FJD A;  1FKD A;  4NNR A;  1D7I A;  2KO7 A;  2ZQU A;  4DRO A;  4FAP A;  2ZQV A;  4J4N A;  5HW6 A;  3O5Q A;  5DIU A;  4DZ2 A;  3I6C A;  2PBC A;  2VCD A;  4GIV A;  3UQI A;  4JYS A;  3O5P A;  1ROU A;  4IQ2 A;  2XPA A;  1PBK A;  2ZQT A;  2XP9 A;  1J4I A;  3MDY B;  3O5J A;  4U86 A;  5DIT A;  1FKK A;  5HT1 A;  2RUD A;  4N19 A;  3UQB A;  4ODN A;  3CGM A;  3ODK A;  2F4E A;  3KAC A;  1W26 A;  4W9P A;  1M5Y A;  4W9O A; 
#chains in the Genus database with same CATH topology
 4MNM A;  3ARO A;  4DWS D;  1K9T A;  3CGN A;  4TW6 A;  5HBF A;  4R5E A;  3CHD A;  3NI6 A;  1YAT A;  2PV2 A;  3O5D A;  4QT3 A;  1JNT A;  1OGG A;  3EY6 A;  4Z2G A;  4DT4 A;  1RD6 A;  4LAV A;  1WAW A;  1FKJ A;  2DSV A;  2YBT A;  5I98 A;  2YBU A;  2RQS A;  2RUC A;  3KAF A;  3WD1 A;  1NMW A;  2XP7 A;  1XRV A;  1HKJ A;  3B7X A;  1D7H A;  3JYM A;  4DRJ A;  2PI6 A;  1IX5 A;  1HKI A;  2IUZ A;  1LG2 A;  3B8S A;  1FKG A;  2XPB A;  3KZ7 A;  4HBO A;  1X6N A;  3ARQ A;  4S3K A;  2Q5A A;  4IPX A;  1E44 A;  3RM8 A;  3KAD A;  4MGV A;  3O5K A;  4MPK A;  4G2P A;  3ARW A;  4WK9 A;  3UQA A;  4L3N A;  4QIB A;  2MF9 A;  5BXJ A;  3O5M A;  4JFL A;  1GPF A;  1N1A A;  1ZK6 A;  1FFQ A;  2XP6 A;  2L2S A;  1BL4 A;  2ZR4 A;  2A3A A;  3GTY X;  1KT1 A;  1HKM A;  3JXV A;  4DWS A;  4JFI A;  4UDM A;  4ODQ A;  1ZB5 A;  3UI6 A;  2VN1 A;  5HWB A;  3NRK A;  5B8I C;  1E6N A;  4TX0 A;  4S3J A;  2PPO A;  3WD4 A;  4DRI A;  3ALG A;  3H9R B;  2LPV A;  5HW7 A;  5J6E A;  1FJD A;  2KO7 A;  2ZQV A;  1ZL1 A;  5DIU A;  3UQI A;  2FDM A;  3ARY A;  1E6R A;  4URI A;  3O5J A;  1H0G A;  3CGM A;  4KQZ A;  3OA5 A;  4ZS6 A;  3ARR A;  1M5Y A;  2A3C A;  1KT0 A;  1FD9 A;  4JFM A;  3PRD A;  2P4V A;  3ARS A;  1E6P A;  4DRN A;  1CTN A;  1JCH B;  1JND A;  4WIW A;  1NWR A;  1NWU A;  2FKE A;  5HW8 A;  4DRH A;  4JFJ A;  1SR0 A;  1ZBC A;  3WKZ A;  4O2T A;  1ZBV A;  1L1P A;  3UI4 A;  3RME A;  1T11 A;  3FXY A;  2PN0 A;  3O5I A;  4QT2 A;  2WLZ A;  3CZ8 A;  4MSP A;  3RM9 A;  1JVW A;  3ALF A;  3O5O A;  2PV3 A;  1W1V A;  4FN2 A;  3ART A;  3PRB A;  5HWC A;  2ETN A;  2XP4 A;  1TFV A;  1ROT A;  4XAK A;  2WK2 A;  4ODM A;  4TW7 A;  1EDQ A;  1KFW A;  3QOK A;  1D6O A;  4Z2K A;  3OOB A;  4PTM A;  2A3B A;  2K8I A;  3IK8 A;  1LL7 A;  1FKS A;  1R9H A;  3CHF A;  3TDB A;  1O6I A;  4G50 A;  4Z2H A;  1W9V A;  5DIV A;  2PPN A;  1A7X A;  2M2A A;  4IT6 A;  4ITZ A;  4MNK A;  1LQ0 A;  4QZV B;  1SYT A;  4DRM A;  4Z2I A;  1J4R A;  2D9F A;  4WKA A;  3KAB A;  1E6Z A;  2ZQS A;  5GPG A;  3TC5 A;  2MNT A;  4JFK A;  1UR9 A;  4TYO A;  4HBE A;  5DF0 A;  1QPF A;  1UR8 A;  2DSW A;  1HJX A;  1OWQ A;  1WB0 A;  2KGJ A;  2N87 A;  4ZPT R;  4GGQ A;  2DG3 A;  1W9U A;  1EYM A;  2G8Z A;  1ZU8 A;  1NH6 A;  2DT1 A;  4AY1 A;  2ZQU A;  4DRO A;  4FAP A;  3RM4 A;  4J4N A;  3AS1 A;  3O5Q A;  2O92 A;  2PBC A;  4JYS A;  3O5P A;  4IQ2 A;  1PBK A;  3MDY B;  4DH0 A;  1J4I A;  4U86 A;  5DIT A;  2RUD A;  4N19 A;  5JH8 A;  2DT3 A;  3ARV A;  4ODL A;  4R0X A;  3BXW A;  4DIP A;  4DZ3 A;  3RFW A;  1XHG A;  3KAG A;  4MTV A;  3KAI A;  4Q22 A;  1GRJ A;  2AWG A;  1LG1 A;  2M08 A;  3AS3 A;  3AS2 A;  2DG4 A;  1X6L A;  3IHZ A;  2WLY A;  4P8V A;  4LAY A;  4ODR A;  2AOS A;  4J4O A;  2MLZ A;  4ODK A;  2KFW A;  1FKT A;  4W9Q A;  2XP8 A;  1LL4 A;  5GPR A;  4U85 A;  2IF4 A;  3WIJ A;  4DRP A;  3PR9 A;  3AS0 A;  2Y78 A;  3B9A A;  1J6Y A;  2RSE A;  2DG9 A;  2A3E A;  2OLH A;  3B9D A;  3VAW A;  3CHC A;  3NTP A;  2F23 A;  4WKF A;  4IT4 A;  4MAV A;  2LJ4 A;  2M1I A;  3UI5 A;  5HUA A;  4LGX A;  2ESC A;  3LUO A;  4BF8 A;  1B6C A;  2XP5 A;  4ZPW R;  3FY1 A;  4LAW A;  3G6L A;  5D75 A;  1PIN A;  3AQU A;  1NSG A;  2LGO A;  1WNO A;  3RGC A;  4TNS A;  5DEZ A;  3BMB A;  1H0I A;  2JZV A;  3WH0 A;  4KR0 B;  4ML4 A;  4DWS B;  3B9E A;  3KCE A;  1EHN A;  1ITX A;  2WM0 A;  1FAP A;  3O5F A;  4LAX A;  1FKH A;  1FKI A;  4IQC A;  1JNE A;  3TCZ A;  1ZCN A;  1Q6I A;  2MPH A;  1W9P A;  1EIB A;  1QPL A;  1LL6 A;  2RUQ A;  2B31 A;  2ZR5 A;  4HAR A;  1Y0O A;  1FKD A;  4NNR A;  1GOI A;  4P8W A;  3I6C A;  4GIV A;  1ZBW A;  2XPA A;  4Z2J A;  2ZQT A;  3UQB A;  1FKK A;  2O9O A;  3WQV A;  4NSB A;  3W4R A;  3WD0 A;  1W26 A;  2B5U B;  1Q6U A;  3WL1 A;  1HJW A;  1NWS A;  1BKF A;  1ZBK A;  2PV1 A;  2DT0 A;  3PA7 A;  2KE0 A;  2F2D A;  3PRA A;  1HXV A;  1F40 A;  1FFR A;  2ITK A;  3JYJ A;  4MNL A;  1FKL A;  4Q7N A;  1FKF A;  1Q6H A;  5DO2 A;  1YW5 A;  5HTG A;  4L72 B;  3IKD A;  2UZ5 A;  1NMV A;  4ZPV R;  1C9H A;  3ARU A;  1NWT A;  2KI3 A;  3O5G A;  4WKH A;  4DWS C;  2XP3 A;  1QZ2 A;  1FKR A;  1E15 A;  1W1T A;  3GPK A;  1TCO C;  1GUV A;  2DPE A;  1JNS A;  1J4H A;  4NZC A;  2ZR6 A;  1F8A B;  2OFN A;  2DT2 A;  3UF8 A;  3WL0 A;  1EQ3 A;  2LKN A;  1Q1C A;  2RUR A;  2FAP A;  4P8U A;  1HKK A;  2EUL A;  3ARZ A;  2F21 A;  2MLX A;  4WJX A;  4ODP A;  5HKG A;  1FKB A;  4Z2L A;  3CH9 A;  1OGB A;  3EIP A;  3O5E A;  1U79 A;  2PPP A;  3WD2 A;  1D2K A;  3O5L A;  4P8X A;  4W5U A;  1LJY A;  1P5Q A;  1VF8 A;  1HJV A;  3IKG A;  4U84 A;  4ODO A;  4DRK A;  2G41 A;  4TW8 A;  3WD3 A;  2DSU A;  3ARX A;  4MNJ A;  2MLY A;  4DRQ A;  3KAH A;  4C02 B;  1D7J A;  1W1P A;  1W1Y A;  2KR7 A;  3FAP A;  3O5R A;  4W9P A;  1D7I A;  3CHE A;  2QF8 A;  5HW6 A;  4DZ2 A;  2VCD A;  3G6M A;  3WQW A;  1ROU A;  1E9L A;  2XP9 A;  5HT1 A;  4ODN A;  3ODK A;  2F4E A;  3KAC A;  3ARP A;  5GQB A;  3GU0 A;  2DSZ A;  4W9O A; 
#chains in the Genus database with same CATH homology
 4MNM A;  3ARO A;  4DWS D;  1K9T A;  3CGN A;  4TW6 A;  5HBF A;  4R5E A;  3CHD A;  3NI6 A;  1YAT A;  2PV2 A;  3O5D A;  4QT3 A;  1JNT A;  1OGG A;  3EY6 A;  4Z2G A;  4DT4 A;  1RD6 A;  4LAV A;  1WAW A;  1FKJ A;  2DSV A;  2YBT A;  5I98 A;  2YBU A;  2RQS A;  2RUC A;  3KAF A;  3WD1 A;  1NMW A;  2XP7 A;  1XRV A;  1HKJ A;  3B7X A;  1D7H A;  3JYM A;  4DRJ A;  2PI6 A;  1IX5 A;  1HKI A;  2IUZ A;  1LG2 A;  3B8S A;  1FKG A;  2XPB A;  3KZ7 A;  4HBO A;  1X6N A;  3ARQ A;  4S3K A;  2Q5A A;  4IPX A;  3RM8 A;  3KAD A;  4MGV A;  3O5K A;  4MPK A;  4G2P A;  3ARW A;  4WK9 A;  3UQA A;  4L3N A;  4QIB A;  2MF9 A;  5BXJ A;  3O5M A;  4JFL A;  1GPF A;  1N1A A;  1ZK6 A;  1FFQ A;  2XP6 A;  2L2S A;  1BL4 A;  2ZR4 A;  2A3A A;  1KT1 A;  1HKM A;  3JXV A;  4DWS A;  4JFI A;  4ODQ A;  1ZB5 A;  3UI6 A;  2VN1 A;  5HWB A;  3NRK A;  5B8I C;  1E6N A;  4TX0 A;  4S3J A;  2PPO A;  3WD4 A;  4DRI A;  3ALG A;  3H9R B;  2LPV A;  5HW7 A;  5J6E A;  1FJD A;  2KO7 A;  2ZQV A;  1ZL1 A;  5DIU A;  3UQI A;  2FDM A;  3ARY A;  1E6R A;  4URI A;  3O5J A;  1H0G A;  3CGM A;  4KQZ A;  3OA5 A;  4ZS6 A;  3ARR A;  1M5Y A;  2A3C A;  1KT0 A;  1FD9 A;  4JFM A;  3PRD A;  3ARS A;  1E6P A;  4DRN A;  1CTN A;  1JND A;  4WIW A;  1NWR A;  1NWU A;  2FKE A;  5HW8 A;  4DRH A;  4JFJ A;  1SR0 A;  1ZBC A;  3WKZ A;  4O2T A;  1ZBV A;  1L1P A;  3UI4 A;  3RME A;  1T11 A;  3FXY A;  3O5I A;  4QT2 A;  2WLZ A;  3CZ8 A;  4MSP A;  3RM9 A;  1JVW A;  3ALF A;  3O5O A;  2PV3 A;  1W1V A;  4FN2 A;  3ART A;  3PRB A;  5HWC A;  2XP4 A;  1TFV A;  1ROT A;  4XAK A;  2WK2 A;  4ODM A;  4TW7 A;  1EDQ A;  1KFW A;  3QOK A;  1D6O A;  4Z2K A;  3OOB A;  4PTM A;  2A3B A;  2K8I A;  3IK8 A;  1LL7 A;  1FKS A;  1R9H A;  3CHF A;  3TDB A;  1O6I A;  4G50 A;  4Z2H A;  1W9V A;  5DIV A;  2PPN A;  1A7X A;  2M2A A;  4IT6 A;  4ITZ A;  4MNK A;  1LQ0 A;  4QZV B;  1SYT A;  4DRM A;  4Z2I A;  1J4R A;  2D9F A;  4WKA A;  3KAB A;  1E6Z A;  2ZQS A;  5GPG A;  3TC5 A;  2MNT A;  4JFK A;  1UR9 A;  4TYO A;  4HBE A;  5DF0 A;  1QPF A;  1UR8 A;  2DSW A;  1HJX A;  1OWQ A;  1WB0 A;  2KGJ A;  2N87 A;  4ZPT R;  4GGQ A;  2DG3 A;  1W9U A;  1EYM A;  2G8Z A;  1ZU8 A;  1NH6 A;  2DT1 A;  4AY1 A;  2ZQU A;  4DRO A;  4FAP A;  3RM4 A;  4J4N A;  3AS1 A;  3O5Q A;  2O92 A;  2PBC A;  4JYS A;  3O5P A;  4IQ2 A;  1PBK A;  3MDY B;  4DH0 A;  1J4I A;  4U86 A;  5DIT A;  2RUD A;  4N19 A;  5JH8 A;  2DT3 A;  3ARV A;  4ODL A;  4R0X A;  3BXW A;  4DIP A;  4DZ3 A;  3RFW A;  1XHG A;  3KAG A;  4MTV A;  3KAI A;  4Q22 A;  2AWG A;  1LG1 A;  2M08 A;  3AS3 A;  3AS2 A;  2DG4 A;  1X6L A;  3IHZ A;  2WLY A;  4P8V A;  4LAY A;  4ODR A;  2AOS A;  4J4O A;  2MLZ A;  4ODK A;  2KFW A;  1FKT A;  4W9Q A;  2XP8 A;  1LL4 A;  5GPR A;  4U85 A;  2IF4 A;  3WIJ A;  4DRP A;  3PR9 A;  3AS0 A;  2Y78 A;  3B9A A;  1J6Y A;  2RSE A;  2DG9 A;  2A3E A;  2OLH A;  3B9D A;  3VAW A;  3CHC A;  3NTP A;  4WKF A;  4IT4 A;  4MAV A;  2LJ4 A;  2M1I A;  3UI5 A;  5HUA A;  4LGX A;  2ESC A;  3LUO A;  4BF8 A;  1B6C A;  2XP5 A;  4ZPW R;  3FY1 A;  4LAW A;  3G6L A;  5D75 A;  1PIN A;  3AQU A;  1NSG A;  2LGO A;  1WNO A;  3RGC A;  4TNS A;  5DEZ A;  1H0I A;  2JZV A;  3WH0 A;  4KR0 B;  4ML4 A;  4DWS B;  3B9E A;  3KCE A;  1EHN A;  1ITX A;  2WM0 A;  1FAP A;  3O5F A;  4LAX A;  1FKH A;  1FKI A;  4IQC A;  1JNE A;  3TCZ A;  1ZCN A;  1Q6I A;  2MPH A;  1W9P A;  1EIB A;  1QPL A;  1LL6 A;  2RUQ A;  2B31 A;  2ZR5 A;  4HAR A;  1Y0O A;  1FKD A;  4NNR A;  1GOI A;  4P8W A;  3I6C A;  4GIV A;  1ZBW A;  2XPA A;  4Z2J A;  2ZQT A;  3UQB A;  1FKK A;  2O9O A;  3WQV A;  4NSB A;  3W4R A;  3WD0 A;  1W26 A;  1Q6U A;  3WL1 A;  1HJW A;  1NWS A;  1BKF A;  1ZBK A;  2PV1 A;  2DT0 A;  3PA7 A;  2KE0 A;  2F2D A;  3PRA A;  1HXV A;  1F40 A;  1FFR A;  2ITK A;  3JYJ A;  4MNL A;  1FKL A;  4Q7N A;  1FKF A;  1Q6H A;  5DO2 A;  1YW5 A;  5HTG A;  4L72 B;  3IKD A;  2UZ5 A;  1NMV A;  4ZPV R;  1C9H A;  3ARU A;  1NWT A;  2KI3 A;  3O5G A;  4WKH A;  4DWS C;  2XP3 A;  1QZ2 A;  1FKR A;  1E15 A;  1W1T A;  3GPK A;  1TCO C;  1GUV A;  2DPE A;  1JNS A;  1J4H A;  4NZC A;  2ZR6 A;  1F8A B;  2OFN A;  2DT2 A;  3UF8 A;  3WL0 A;  1EQ3 A;  2LKN A;  1Q1C A;  2RUR A;  2FAP A;  4P8U A;  1HKK A;  3ARZ A;  2F21 A;  2MLX A;  4WJX A;  4ODP A;  5HKG A;  1FKB A;  4Z2L A;  3CH9 A;  1OGB A;  3O5E A;  1U79 A;  2PPP A;  3WD2 A;  1D2K A;  3O5L A;  4P8X A;  4W5U A;  1LJY A;  1P5Q A;  1VF8 A;  1HJV A;  3IKG A;  4U84 A;  4ODO A;  4DRK A;  2G41 A;  4TW8 A;  3WD3 A;  2DSU A;  3ARX A;  4MNJ A;  2MLY A;  4DRQ A;  3KAH A;  4C02 B;  1D7J A;  1W1P A;  1W1Y A;  2KR7 A;  3FAP A;  3O5R A;  4W9P A;  1D7I A;  3CHE A;  2QF8 A;  5HW6 A;  4DZ2 A;  2VCD A;  3G6M A;  3WQW A;  1ROU A;  1E9L A;  2XP9 A;  5HT1 A;  4ODN A;  3ODK A;  2F4E A;  3KAC A;  3ARP A;  5GQB A;  2DSZ A;  4W9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...