2DG4A

Fk506-binding protein mutant wf59 complexed with rapamycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGFEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Energetic and structural analysis of the role of tryptophan 59 in FKBP12
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords FK506-binding protein 1A
total genus 22
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2dg4A00
4LAVA 4GIVA 1Q6UA 1NMVA 3KAFA 1FKBA 3KCEA 3O5FA 1Q1CA 2LPVA 2FAPA 1D7IA 4W9OA 2N87A 3RGCA 2KO7A 2ZQUA 5HUAA 2PV2A 3KAGA 2RUCA 1P5QA 3O5QA 5HKGA 2KGJA 3TDBA 5BXJA 3IK8A 1NSGA 1U79A 1A7XA 2RUDA 4DRPA 3CGNA 3IKGA 5HW7A 2XP8A 4QT2A 3O5JA 4JFJA 2M08A 4W9PA 4QIBA 3RFWA 4TW6A 4JFIA 1J4IA 1YATA 3I6CA 1FKLA 4ODOA 4JFKA 2DG4A 3O5RA 5GPGA 2ZQVA 2PV3A 4O2TA 4JFMA 3NTPA 3VAWA 4DIPA 4TNSA 2ZR5A 5B8IC 1F40A 1FD9A 5HTGA 2F21A 4DH0A 5DIUA 2XP4A 4G50A 2DG3A 1FKDA 1T11A 2LJ4A 3O5DA 4LAWA 3UF8A 1QPFA 3KAHA 4C02B 2KI3A 4LAXA 1PBKA 3WH0A 4DRJA 3O5PA 4DRIA 2XP6A 4ODRA 5HW6A 4FAPA 4IQCA 1C9HA 4DRMA 4ODNA 1D7JA 4JFLA 3IKDA 3UQAA 2RSEA 1Q6IA 2OFNA 1FKKA 3O5OA 1FKGA 2PV1A 2LGOA 2F4EA 1PINA 1ZK6A 3MDYB 4U84A 1EQ3A 4ODKA 4NNRA 3TCZA 4U85A 5DITA 1FKFA 1KT0A 1ROTA 2KE0A 3KZ7A 2M2AA 2ZQSA 3KADA 2RURA 2LKNA 2Y78A 4TYOA 3UI4A 2MLXA 1F8AB 2F2DA 2ITKA 2MLZA 3UI6A 3O5MA 1ZCNA 2VCDA 4R0XA 1HXVA 1BL4A 3O5KA 4QT3A 3O5GA 1YW5A 3PRDA 4MGVA 5D75A 3KAIA 4U86A 1FJDA 3OOBA 4DRNA 3FAPA 3UQBA 1QZ2A 3O5IA 2IF4A 2XPAA 1ROUA 2ZR4A 2MNTA 2ZR6A 4IQ2A 1QPLA 3JYMA 4N19A 2MLYA 2M1IA 4ODPA 2MF9A 4DZ2A 2PPPA 4DRQA 1JVWA 3JXVA 3LUOA 3KACA 1BKFA 4IPXA 4J4OA 4ODMA 2PPOA 4DROA 4ODQA 4DRKA 1FKJA 2XPBA 5DIVA 1FKSA 2FKEA 2K8IA 4TX0A 2D9FA 4G2PA 2PPNA 1B6CA 1NMWA 1J4HA 5HW8A 4TW7A 3TC5A 1FKTA 2VN1A 4BF8A 1FAPA 1J6YA 2Q5AA 1D7HA 1M5YA 3GPKA 2KR7A 1Q6HA 5HWCA 1EYMA 3PA7A 5HWBA 3ODKA 4JYSA 2L2SA 4TW8A 2DG9A 5HT1A 1J4RA 4J4NA 1KT1A 3UI5A 4DZ3A 1N1AA 1JNSA 2UZ5A 3CGMA 4FN2A 3NRKA 1FKIA 2XP7A 2XP9A 2XP5A 3JYJA 1R9HA 3NI6A 3H9RB 5J6EA 2MPHA 5I98A 3O5EA 2AWGA 3UQIA 4DRHA 2XP3A 1JNTA 1TCOC 3IHZA 4ITZA 4ODLA 4DT4A 2KFWA 1Y0OA 2JZVA 2PBCA 1W26A 3B7XA 4LAYA 1D6OA 3KABA 4MSPA 2ZQTA 2RQSA 2RUQA 1L1PA 3EY6A 4W9QA 3PRBA 4GGQA 3O5LA 1FKHA 1FKRA
chains in the Genus database with same CATH superfamily
4Z2IA 2EULA 4GIVA 1NWSA 1NMVA 2PN0A 1ZBWA 2B5UB 2FAPA 3CHDA 1LQ0A 2P4VA 3IK8A 1NSGA 1U79A 2DSUA 1A7XA 5HW7A 2M08A 4Q7NA 4KQZA 4JFIA 2DSVA 1YATA 4S3JA 4ODOA 1LG1A 2DG4A 4UDMA 2ZQVA 4XAKA 2ZR5A 1FD9A 3CHCA 5DIUA 2XP4A 5DEZA 2DG3A 1EDQA 1FKDA 1X6LA 5HKGA 3KAHA 4C02B 2KI3A 2WK2A 4DRJA 2XP6A 4ODRA 4IQCA 2A3AA 4ODNA 4JFLA 1E15A 3IKDA 2RSEA 1FKKA 1JCHB 2LGOA 1EQ3A 5DO2A 3TCZA 4U85A 1GUVA 1ROTA 2KE0A 2PI6A 4L3NA 2F2DA 1KFWA 1FFRA 3ARYA 3WD2A 5JH8A 3GTYX 2AOSA 3KAIA 4MPKA 4Z2GA 4DRNA 3FAPA 3UQBA 2ZR6A 4N19A 4ODPA 2MF9A 4DRQA 4DRKA 4J4OA 3CHFA 4IPXA 4MNMA 2K8IA 4TX0A 2PPNA 1B6CA 3ARXA 5HW8A 3TC5A 4HBEA 3QOKA 3ARPA 4BF8A 1JNEA 1J6YA 1D7HA 1Q6HA 5HWCA 3PA7A 2L2SA 1HKIA 5HT1A 4J4NA 1KT1A 3CGMA 2XP7A 2XP5A 5I98A 3O5EA 3UQIA 1JNTA 4WK9A 1Y0OA 4MSPA 1HJWA 2RUQA 3G6LA 1LL6A 3PRBA 3O5LA 2A3BA 4LAVA 1SR0A 1D7IA 3RGCA 2KO7A 5HUAA 2RUCA 3O5QA 1W9UA 5BXJA 2YBUA 2OLHA 3CGNA 4S3KA 3AROA 4QT2A 5DF0A 4W9PA 3RFWA 3FY1A 4JFKA 4WIWA 3O5RA 3W4RA 1W9VA 3RM8A 4L72B 1HJXA 4JFMA 3VAWA 3WIJA 1EHNA 1PBKA 3O5PA 3CHEA 4WKHA 3WD0A 4DRMA 3AS1A 3O5OA 4P8UA 2F4EA 1LG2A 3ALGA 5GQBA 1FKFA 3KADA 1ZCNA 1GPFA 1HXVA 4QT3A 4U86A 2ESCA 3AS0A 3ARWA 1E6PA 5GPRA 2IF4A 1H0GA 1JVWA 3LUOA 1BKFA 4ODMA 4IT4A 4Z2JA 1VF8A 5DIVA 4ZPTR 1FKSA 2FKEA 1FFQA 1J4HA 1UR8A 2A3EA 2B31A 4TW7A 1FKTA 3G6MA 2VN1A 1IX5A 2DT0A 2Q5AA 1M5YA 2ETNA 1EIBA 1H0IA 5HWBA 3ODKA 4TW8A 1ZB5A 3UI5A 4DWSD 4DZ3A 1N1AA 2WM0A 3RM4A 3NRKA 4MAVA 3JYJA 2WLZA 3H9RB 5J6EA 4HBOA 4DT4A 3IHZA 2A3CA 1JNDA 3KABA 4Q22A 4Z2HA 2ZQTA 1GRJA 3EY6A 4W9QA 4DWSA 1FKHA 3ARVA 1Q6UA 3B8SA 3KAFA 3O5FA 1Q1CA 4W9OA 4ZPVR 3BMBA 3RM9A 2ZQUA 2PV2A 4DWSC 2WLYA 3ARUA 3WKZA 4MNKA 4LGXA 4DRPA 3IKGA 4ML4A 3CZ8A 2XP8A 3O5JA 4JFJA 4W5UA 4TW6A 3CH9A 1FKLA 3WL0A 5GPGA 3AS2A 2PV3A 2DT3A 2DT1A 3NTPA 4TNSA 3ARTA 1XHGA 1D2KA 4G50A 3O5DA 4LAWA 2LJ4A 4P8VA 1ZL1A 4LAXA 4DRIA 5HBFA 3FXYA 4FAPA 1C9HA 1W1YA 4ZS6A 1CTNA 2OFNA 1SYTA 1HKJA 1ZK6A 4URIA 4NNRA 1E6NA 5DITA 4WJXA 3KZ7A 3ARQA 2M2AA 2ZQSA 2LKNA 2Y78A 4TYOA 3UI4A 2ITKA 2MLZA 3O5MA 1ZBKA 4R0XA 1BL4A 4NSBA 3O5GA 1YW5A 3PRDA 4MGVA 3WD4A 1QZ2A 3O5IA 1ROUA 2M1IA 2PPPA 4DROA 3KACA 3WL1A 1FKJA 2XPBA 1O6IA 2G8ZA 2DT2A 3EIPA 3RMEA 2D9FA 1W9PA 2YBTA 1W1VA 1K9TA 1NMWA 1FAPA 3B9EA 1W1PA 1LJYA 3GPKA 4MNJA 2KR7A 1EYMA 4JYSA 2DG9A 4WKFA 1J4RA 1X6NA 2IUZA 2QF8A 4Z2KA 1JNSA 4FN2A 4IT6A 1FKIA 2XP9A 2MPHA 4DRHA 1E6RA 4ITZA 1W1TA 2JZVA 2PBCA 3B7XA 4LAYA 1D6OA 4MTVA 4P8XA 2RQSA 1L1PA 1ZBCA 1FKRA 3ALFA 1LL7A 4KR0B 4ZPWR 1FKBA 3KCEA 2LPVA 3GU0A 2N87A 1XRVA 3KAGA 1P5QA 2KGJA 3TDBA 2F23A 2RUDA 1E9LA 3OA5A 2DSZA 1HKMA 1HJVA 4QIBA 1J4IA 3I6CA 1HKKA 1NWTA 4WKAA 4R5EA 4NZCA 1WNOA 4O2TA 1NWRA 4PTMA 4DIPA 5B8IC 1F40A 2DSWA 1NWUA 1E44A 5HTGA 2F21A 4DH0A 1T11A 3PR9A 3UF8A 1QPFA 1TFVA 3WH0A 5HW6A 4QZVB 1ZU8A 1D7JA 3UQAA 4P8WA 1Q6IA 2FDMA 3WQVA 3ARSA 1FKGA 2PV1A 1PINA 3MDYB 4U84A 4ODKA 1KT0A 3AQUA 3WD1A 1WB0A 2RURA 4DWSB 1ZBVA 2MLXA 1F8AB 3UI6A 3WQWA 2VCDA 3O5KA 4AY1A 2O9OA 1ITXA 5D75A 4MNLA 4HARA 1OGBA 3WD3A 1FJDA 3OOBA 4IQ2A 1OGGA 2XPAA 2ZR4A 2MNTA 1QPLA 3JYMA 2MLYA 4DZ2A 3JXVA 1GOIA 2PPOA 4ODQA 3AS3A 1E6ZA 1WAWA 4G2PA 3ARZA 1OWQA 3B9AA 1LL4A 3ARRA 1NH6A 3B9DA 2G41A 3BXWA 2DPEA 2UZ5A 1R9HA 3NI6A 1UR9A 2AWGA 2XP3A 4ODLA 1TCOC 2KFWA 1RD6A 1W26A 4Z2LA 2O92A 3PRAA 4GGQA
chains in the Genus database with same CATH topology
4Z2IA 4GIVA 1NWSA 1NMVA 1ZBWA 2FAPA 3CHDA 1LQ0A 3IK8A 1NSGA 1U79A 2DSUA 1A7XA 5HW7A 2M08A 4Q7NA 4KQZA 4JFIA 2DSVA 1YATA 4S3JA 4ODOA 1LG1A 2DG4A 2ZQVA 4XAKA 2ZR5A 1FD9A 3CHCA 5DIUA 2XP4A 5DEZA 2DG3A 1EDQA 1FKDA 1X6LA 5HKGA 3KAHA 4C02B 2KI3A 2WK2A 4DRJA 2XP6A 4ODRA 4IQCA 2A3AA 4ODNA 4JFLA 1E15A 3IKDA 2RSEA 1FKKA 2LGOA 1EQ3A 5DO2A 3TCZA 4U85A 1GUVA 1ROTA 2KE0A 2PI6A 4L3NA 2F2DA 1KFWA 1FFRA 3ARYA 3WD2A 5JH8A 2AOSA 3KAIA 4MPKA 4Z2GA 4DRNA 3FAPA 3UQBA 2ZR6A 4N19A 4ODPA 2MF9A 4DRQA 4DRKA 4J4OA 3CHFA 4IPXA 4MNMA 2K8IA 4TX0A 2PPNA 1B6CA 3ARXA 5HW8A 3TC5A 4HBEA 3QOKA 3ARPA 4BF8A 1JNEA 1J6YA 1D7HA 1Q6HA 5HWCA 3PA7A 2L2SA 1HKIA 5HT1A 4J4NA 1KT1A 3CGMA 2XP7A 2XP5A 5I98A 3O5EA 3UQIA 1JNTA 4WK9A 1Y0OA 4MSPA 1HJWA 2RUQA 3G6LA 1LL6A 3PRBA 3O5LA 2A3BA 4LAVA 1SR0A 1D7IA 3RGCA 2KO7A 5HUAA 2RUCA 3O5QA 1W9UA 5BXJA 2YBUA 2OLHA 3CGNA 4S3KA 3AROA 4QT2A 5DF0A 4W9PA 3RFWA 3FY1A 4JFKA 4WIWA 3O5RA 3W4RA 1W9VA 3RM8A 4L72B 1HJXA 4JFMA 3VAWA 3WIJA 1EHNA 1PBKA 3O5PA 3CHEA 4WKHA 3WD0A 4DRMA 3AS1A 3O5OA 4P8UA 2F4EA 1LG2A 3ALGA 5GQBA 1FKFA 3KADA 1ZCNA 1GPFA 1HXVA 4QT3A 4U86A 2ESCA 3AS0A 3ARWA 1E6PA 5GPRA 2IF4A 1H0GA 1JVWA 3LUOA 1BKFA 4ODMA 4IT4A 4Z2JA 1VF8A 5DIVA 4ZPTR 1FKSA 2FKEA 1FFQA 1J4HA 1UR8A 2A3EA 2B31A 4TW7A 1FKTA 3G6MA 2VN1A 1IX5A 2DT0A 2Q5AA 1M5YA 1EIBA 1H0IA 5HWBA 3ODKA 4TW8A 1ZB5A 3UI5A 4DWSD 4DZ3A 1N1AA 2WM0A 3RM4A 3NRKA 4MAVA 3JYJA 2WLZA 3H9RB 5J6EA 4HBOA 4DT4A 3IHZA 2A3CA 1JNDA 3KABA 4Q22A 4Z2HA 2ZQTA 3EY6A 4W9QA 4DWSA 1FKHA 3ARVA 1Q6UA 3B8SA 3KAFA 3O5FA 1Q1CA 4W9OA 4ZPVR 3RM9A 2ZQUA 2PV2A 4DWSC 2WLYA 3ARUA 3WKZA 4MNKA 4LGXA 4DRPA 3IKGA 4ML4A 3CZ8A 2XP8A 3O5JA 4JFJA 4W5UA 4TW6A 3CH9A 1FKLA 3WL0A 5GPGA 3AS2A 2PV3A 2DT3A 2DT1A 3NTPA 4TNSA 3ARTA 1XHGA 1D2KA 4G50A 3O5DA 4LAWA 2LJ4A 4P8VA 1ZL1A 4LAXA 4DRIA 5HBFA 3FXYA 4FAPA 1C9HA 1W1YA 4ZS6A 1CTNA 2OFNA 1SYTA 1HKJA 1ZK6A 4URIA 4NNRA 1E6NA 5DITA 4WJXA 3KZ7A 3ARQA 2M2AA 2ZQSA 2LKNA 2Y78A 4TYOA 3UI4A 2ITKA 2MLZA 3O5MA 1ZBKA 4R0XA 1BL4A 4NSBA 3O5GA 1YW5A 3PRDA 4MGVA 3WD4A 1QZ2A 3O5IA 1ROUA 2M1IA 2PPPA 4DROA 3KACA 3WL1A 1FKJA 2XPBA 1O6IA 2G8ZA 2DT2A 3RMEA 2D9FA 1W9PA 2YBTA 1W1VA 1K9TA 1NMWA 1FAPA 3B9EA 1W1PA 1LJYA 3GPKA 4MNJA 2KR7A 1EYMA 4JYSA 2DG9A 4WKFA 1J4RA 1X6NA 2IUZA 2QF8A 4Z2KA 1JNSA 4FN2A 4IT6A 1FKIA 2XP9A 2MPHA 4DRHA 1E6RA 4ITZA 1W1TA 2JZVA 2PBCA 3B7XA 4LAYA 1D6OA 4MTVA 4P8XA 2RQSA 1L1PA 1ZBCA 1FKRA 3ALFA 1LL7A 4KR0B 4ZPWR 1FKBA 3KCEA 2LPVA 2N87A 1XRVA 3KAGA 1P5QA 2KGJA 3TDBA 2RUDA 1E9LA 3OA5A 2DSZA 1HKMA 1HJVA 4QIBA 1J4IA 3I6CA 1HKKA 1NWTA 4WKAA 4R5EA 4NZCA 1WNOA 4O2TA 1NWRA 4PTMA 4DIPA 5B8IC 1F40A 2DSWA 1NWUA 5HTGA 2F21A 4DH0A 1T11A 3PR9A 3UF8A 1QPFA 1TFVA 3WH0A 5HW6A 4QZVB 1ZU8A 1D7JA 3UQAA 4P8WA 1Q6IA 2FDMA 3WQVA 3ARSA 1FKGA 2PV1A 1PINA 3MDYB 4U84A 4ODKA 1KT0A 3AQUA 3WD1A 1WB0A 2RURA 4DWSB 1ZBVA 2MLXA 1F8AB 3UI6A 3WQWA 2VCDA 3O5KA 4AY1A 2O9OA 1ITXA 5D75A 4MNLA 4HARA 1OGBA 3WD3A 1FJDA 3OOBA 1OGGA 2XPAA 2ZR4A 4IQ2A 2MNTA 1QPLA 3JYMA 2MLYA 4DZ2A 3JXVA 1GOIA 2PPOA 4ODQA 3AS3A 1E6ZA 1WAWA 4G2PA 3ARZA 1OWQA 3B9AA 1LL4A 3ARRA 1NH6A 3B9DA 2G41A 3BXWA 2DPEA 2UZ5A 1R9HA 3NI6A 1UR9A 2AWGA 2XP3A 4ODLA 1TCOC 2KFWA 1RD6A 1W26A 4Z2LA 2O92A 3PRAA 4GGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LAV A;  4GIV A;  1Q6U A;  1NMV A;  3KAF A;  1FKB A;  3KCE A;  3O5F A;  1Q1C A;  2LPV A;  2FAP A;  1D7I A;  4W9O A;  2N87 A;  3RGC A;  2KO7 A;  2ZQU A;  5HUA A;  2PV2 A;  3KAG A;  2RUC A;  1P5Q A;  3O5Q A;  5HKG A;  2KGJ A;  3TDB A;  5BXJ A;  3IK8 A;  1NSG A;  1U79 A;  1A7X A;  2RUD A;  4DRP A;  3CGN A;  3IKG A;  5HW7 A;  2XP8 A;  4QT2 A;  3O5J A;  4JFJ A;  2M08 A;  4W9P A;  4QIB A;  3RFW A;  4TW6 A;  4JFI A;  1J4I A;  1YAT A;  3I6C A;  1FKL A;  4ODO A;  4JFK A;  2DG4 A;  3O5R A;  5GPG A;  2ZQV A;  2PV3 A;  4O2T A;  4JFM A;  3NTP A;  3VAW A;  4DIP A;  4TNS A;  2ZR5 A;  5B8I C;  1F40 A;  1FD9 A;  5HTG A;  2F21 A;  4DH0 A;  5DIU A;  2XP4 A;  4G50 A;  2DG3 A;  1FKD A;  1T11 A;  2LJ4 A;  3O5D A;  4LAW A;  3UF8 A;  1QPF A;  3KAH A;  4C02 B;  2KI3 A;  4LAX A;  1PBK A;  3WH0 A;  4DRJ A;  3O5P A;  4DRI A;  2XP6 A;  4ODR A;  5HW6 A;  4FAP A;  4IQC A;  1C9H A;  4DRM A;  4ODN A;  1D7J A;  4JFL A;  3IKD A;  3UQA A;  2RSE A;  1Q6I A;  2OFN A;  1FKK A;  3O5O A;  1FKG A;  2PV1 A;  2LGO A;  2F4E A;  1PIN A;  1ZK6 A;  3MDY B;  4U84 A;  1EQ3 A;  4ODK A;  4NNR A;  3TCZ A;  4U85 A;  5DIT A;  1FKF A;  1KT0 A;  1ROT A;  2KE0 A;  3KZ7 A;  2M2A A;  2ZQS A;  3KAD A;  2RUR A;  2LKN A;  2Y78 A;  4TYO A;  3UI4 A;  2MLX A;  1F8A B;  2F2D A;  2ITK A;  2MLZ A;  3UI6 A;  3O5M A;  1ZCN A;  2VCD A;  4R0X A;  1HXV A;  1BL4 A;  3O5K A;  4QT3 A;  3O5G A;  1YW5 A;  3PRD A;  4MGV A;  5D75 A;  3KAI A;  4U86 A;  1FJD A;  3OOB A;  4DRN A;  3FAP A;  3UQB A;  1QZ2 A;  3O5I A;  2IF4 A;  2XPA A;  1ROU A;  2ZR4 A;  2MNT A;  2ZR6 A;  4IQ2 A;  1QPL A;  3JYM A;  4N19 A;  2MLY A;  2M1I A;  4ODP A;  2MF9 A;  4DZ2 A;  2PPP A;  4DRQ A;  1JVW A;  3JXV A;  3LUO A;  3KAC A;  1BKF A;  4IPX A;  4J4O A;  4ODM A;  2PPO A;  4DRO A;  4ODQ A;  4DRK A;  1FKJ A;  2XPB A;  5DIV A;  1FKS A;  2FKE A;  2K8I A;  4TX0 A;  2D9F A;  4G2P A;  2PPN A;  1B6C A;  1NMW A;  1J4H A;  5HW8 A;  4TW7 A;  3TC5 A;  1FKT A;  2VN1 A;  4BF8 A;  1FAP A;  1J6Y A;  2Q5A A;  1D7H A;  1M5Y A;  3GPK A;  2KR7 A;  1Q6H A;  5HWC A;  1EYM A;  3PA7 A;  5HWB A;  3ODK A;  4JYS A;  2L2S A;  4TW8 A;  2DG9 A;  5HT1 A;  1J4R A;  4J4N A;  1KT1 A;  3UI5 A;  4DZ3 A;  1N1A A;  1JNS A;  2UZ5 A;  3CGM A;  4FN2 A;  3NRK A;  1FKI A;  2XP7 A;  2XP9 A;  2XP5 A;  3JYJ A;  1R9H A;  3NI6 A;  3H9R B;  5J6E A;  2MPH A;  5I98 A;  3O5E A;  2AWG A;  3UQI A;  4DRH A;  2XP3 A;  1JNT A;  1TCO C;  3IHZ A;  4ITZ A;  4ODL A;  4DT4 A;  2KFW A;  1Y0O A;  2JZV A;  2PBC A;  1W26 A;  3B7X A;  4LAY A;  1D6O A;  3KAB A;  4MSP A;  2ZQT A;  2RQS A;  2RUQ A;  1L1P A;  3EY6 A;  4W9Q A;  3PRB A;  4GGQ A;  3O5L A;  1FKH A;  1FKR A; 
#chains in the Genus database with same CATH topology
 4Z2I A;  2EUL A;  4GIV A;  1NWS A;  1NMV A;  2PN0 A;  1ZBW A;  2B5U B;  2FAP A;  3CHD A;  1LQ0 A;  2P4V A;  3IK8 A;  1NSG A;  1U79 A;  2DSU A;  1A7X A;  5HW7 A;  2M08 A;  4Q7N A;  4KQZ A;  4JFI A;  2DSV A;  1YAT A;  4S3J A;  4ODO A;  1LG1 A;  2DG4 A;  4UDM A;  2ZQV A;  4XAK A;  2ZR5 A;  1FD9 A;  3CHC A;  5DIU A;  2XP4 A;  5DEZ A;  2DG3 A;  1EDQ A;  1FKD A;  1X6L A;  5HKG A;  3KAH A;  4C02 B;  2KI3 A;  2WK2 A;  4DRJ A;  2XP6 A;  4ODR A;  4IQC A;  2A3A A;  4ODN A;  4JFL A;  1E15 A;  3IKD A;  2RSE A;  1FKK A;  1JCH B;  2LGO A;  1EQ3 A;  5DO2 A;  3TCZ A;  4U85 A;  1GUV A;  1ROT A;  2KE0 A;  2PI6 A;  4L3N A;  2F2D A;  1KFW A;  1FFR A;  3ARY A;  3WD2 A;  5JH8 A;  3GTY X;  2AOS A;  3KAI A;  4MPK A;  4Z2G A;  4DRN A;  3FAP A;  3UQB A;  2ZR6 A;  4N19 A;  4ODP A;  2MF9 A;  4DRQ A;  4DRK A;  4J4O A;  3CHF A;  4IPX A;  4MNM A;  2K8I A;  4TX0 A;  2PPN A;  1B6C A;  3ARX A;  5HW8 A;  3TC5 A;  4HBE A;  3QOK A;  3ARP A;  4BF8 A;  1JNE A;  1J6Y A;  1D7H A;  1Q6H A;  5HWC A;  3PA7 A;  2L2S A;  1HKI A;  5HT1 A;  4J4N A;  1KT1 A;  3CGM A;  2XP7 A;  2XP5 A;  5I98 A;  3O5E A;  3UQI A;  1JNT A;  4WK9 A;  1Y0O A;  4MSP A;  1HJW A;  2RUQ A;  3G6L A;  1LL6 A;  3PRB A;  3O5L A;  2A3B A;  4LAV A;  1SR0 A;  1D7I A;  3RGC A;  2KO7 A;  5HUA A;  2RUC A;  3O5Q A;  1W9U A;  5BXJ A;  2YBU A;  2OLH A;  3CGN A;  4S3K A;  3ARO A;  4QT2 A;  5DF0 A;  4W9P A;  3RFW A;  3FY1 A;  4JFK A;  4WIW A;  3O5R A;  3W4R A;  1W9V A;  3RM8 A;  4L72 B;  1HJX A;  4JFM A;  3VAW A;  3WIJ A;  1EHN A;  1PBK A;  3O5P A;  3CHE A;  4WKH A;  3WD0 A;  4DRM A;  3AS1 A;  3O5O A;  4P8U A;  2F4E A;  1LG2 A;  3ALG A;  5GQB A;  1FKF A;  3KAD A;  1ZCN A;  1GPF A;  1HXV A;  4QT3 A;  4U86 A;  2ESC A;  3AS0 A;  3ARW A;  1E6P A;  5GPR A;  2IF4 A;  1H0G A;  1JVW A;  3LUO A;  1BKF A;  4ODM A;  4IT4 A;  4Z2J A;  1VF8 A;  5DIV A;  4ZPT R;  1FKS A;  2FKE A;  1FFQ A;  1J4H A;  1UR8 A;  2A3E A;  2B31 A;  4TW7 A;  1FKT A;  3G6M A;  2VN1 A;  1IX5 A;  2DT0 A;  2Q5A A;  1M5Y A;  2ETN A;  1EIB A;  1H0I A;  5HWB A;  3ODK A;  4TW8 A;  1ZB5 A;  3UI5 A;  4DWS D;  4DZ3 A;  1N1A A;  2WM0 A;  3RM4 A;  3NRK A;  4MAV A;  3JYJ A;  2WLZ A;  3H9R B;  5J6E A;  4HBO A;  4DT4 A;  3IHZ A;  2A3C A;  1JND A;  3KAB A;  4Q22 A;  4Z2H A;  2ZQT A;  1GRJ A;  3EY6 A;  4W9Q A;  4DWS A;  1FKH A;  3ARV A;  1Q6U A;  3B8S A;  3KAF A;  3O5F A;  1Q1C A;  4W9O A;  4ZPV R;  3BMB A;  3RM9 A;  2ZQU A;  2PV2 A;  4DWS C;  2WLY A;  3ARU A;  3WKZ A;  4MNK A;  4LGX A;  4DRP A;  3IKG A;  4ML4 A;  3CZ8 A;  2XP8 A;  3O5J A;  4JFJ A;  4W5U A;  4TW6 A;  3CH9 A;  1FKL A;  3WL0 A;  5GPG A;  3AS2 A;  2PV3 A;  2DT3 A;  2DT1 A;  3NTP A;  4TNS A;  3ART A;  1XHG A;  1D2K A;  4G50 A;  3O5D A;  4LAW A;  2LJ4 A;  4P8V A;  1ZL1 A;  4LAX A;  4DRI A;  5HBF A;  3FXY A;  4FAP A;  1C9H A;  1W1Y A;  4ZS6 A;  1CTN A;  2OFN A;  1SYT A;  1HKJ A;  1ZK6 A;  4URI A;  4NNR A;  1E6N A;  5DIT A;  4WJX A;  3KZ7 A;  3ARQ A;  2M2A A;  2ZQS A;  2LKN A;  2Y78 A;  4TYO A;  3UI4 A;  2ITK A;  2MLZ A;  3O5M A;  1ZBK A;  4R0X A;  1BL4 A;  4NSB A;  3O5G A;  1YW5 A;  3PRD A;  4MGV A;  3WD4 A;  1QZ2 A;  3O5I A;  1ROU A;  2M1I A;  2PPP A;  4DRO A;  3KAC A;  3WL1 A;  1FKJ A;  2XPB A;  1O6I A;  2G8Z A;  2DT2 A;  3EIP A;  3RME A;  2D9F A;  1W9P A;  2YBT A;  1W1V A;  1K9T A;  1NMW A;  1FAP A;  3B9E A;  1W1P A;  1LJY A;  3GPK A;  4MNJ A;  2KR7 A;  1EYM A;  4JYS A;  2DG9 A;  4WKF A;  1J4R A;  1X6N A;  2IUZ A;  2QF8 A;  4Z2K A;  1JNS A;  4FN2 A;  4IT6 A;  1FKI A;  2XP9 A;  2MPH A;  4DRH A;  1E6R A;  4ITZ A;  1W1T A;  2JZV A;  2PBC A;  3B7X A;  4LAY A;  1D6O A;  4MTV A;  4P8X A;  2RQS A;  1L1P A;  1ZBC A;  1FKR A;  3ALF A;  1LL7 A;  4KR0 B;  4ZPW R;  1FKB A;  3KCE A;  2LPV A;  3GU0 A;  2N87 A;  1XRV A;  3KAG A;  1P5Q A;  2KGJ A;  3TDB A;  2F23 A;  2RUD A;  1E9L A;  3OA5 A;  2DSZ A;  1HKM A;  1HJV A;  4QIB A;  1J4I A;  3I6C A;  1HKK A;  1NWT A;  4WKA A;  4R5E A;  4NZC A;  1WNO A;  4O2T A;  1NWR A;  4PTM A;  4DIP A;  5B8I C;  1F40 A;  2DSW A;  1NWU A;  1E44 A;  5HTG A;  2F21 A;  4DH0 A;  1T11 A;  3PR9 A;  3UF8 A;  1QPF A;  1TFV A;  3WH0 A;  5HW6 A;  4QZV B;  1ZU8 A;  1D7J A;  3UQA A;  4P8W A;  1Q6I A;  2FDM A;  3WQV A;  3ARS A;  1FKG A;  2PV1 A;  1PIN A;  3MDY B;  4U84 A;  4ODK A;  1KT0 A;  3AQU A;  3WD1 A;  1WB0 A;  2RUR A;  4DWS B;  1ZBV A;  2MLX A;  1F8A B;  3UI6 A;  3WQW A;  2VCD A;  3O5K A;  4AY1 A;  2O9O A;  1ITX A;  5D75 A;  4MNL A;  4HAR A;  1OGB A;  3WD3 A;  1FJD A;  3OOB A;  4IQ2 A;  1OGG A;  2XPA A;  2ZR4 A;  2MNT A;  1QPL A;  3JYM A;  2MLY A;  4DZ2 A;  3JXV A;  1GOI A;  2PPO A;  4ODQ A;  3AS3 A;  1E6Z A;  1WAW A;  4G2P A;  3ARZ A;  1OWQ A;  3B9A A;  1LL4 A;  3ARR A;  1NH6 A;  3B9D A;  2G41 A;  3BXW A;  2DPE A;  2UZ5 A;  1R9H A;  3NI6 A;  1UR9 A;  2AWG A;  2XP3 A;  4ODL A;  1TCO C;  2KFW A;  1RD6 A;  1W26 A;  4Z2L A;  2O92 A;  3PRA A;  4GGQ A; 
#chains in the Genus database with same CATH homology
 4Z2I A;  4GIV A;  1NWS A;  1NMV A;  1ZBW A;  2FAP A;  3CHD A;  1LQ0 A;  3IK8 A;  1NSG A;  1U79 A;  2DSU A;  1A7X A;  5HW7 A;  2M08 A;  4Q7N A;  4KQZ A;  4JFI A;  2DSV A;  1YAT A;  4S3J A;  4ODO A;  1LG1 A;  2DG4 A;  2ZQV A;  4XAK A;  2ZR5 A;  1FD9 A;  3CHC A;  5DIU A;  2XP4 A;  5DEZ A;  2DG3 A;  1EDQ A;  1FKD A;  1X6L A;  5HKG A;  3KAH A;  4C02 B;  2KI3 A;  2WK2 A;  4DRJ A;  2XP6 A;  4ODR A;  4IQC A;  2A3A A;  4ODN A;  4JFL A;  1E15 A;  3IKD A;  2RSE A;  1FKK A;  2LGO A;  1EQ3 A;  5DO2 A;  3TCZ A;  4U85 A;  1GUV A;  1ROT A;  2KE0 A;  2PI6 A;  4L3N A;  2F2D A;  1KFW A;  1FFR A;  3ARY A;  3WD2 A;  5JH8 A;  2AOS A;  3KAI A;  4MPK A;  4Z2G A;  4DRN A;  3FAP A;  3UQB A;  2ZR6 A;  4N19 A;  4ODP A;  2MF9 A;  4DRQ A;  4DRK A;  4J4O A;  3CHF A;  4IPX A;  4MNM A;  2K8I A;  4TX0 A;  2PPN A;  1B6C A;  3ARX A;  5HW8 A;  3TC5 A;  4HBE A;  3QOK A;  3ARP A;  4BF8 A;  1JNE A;  1J6Y A;  1D7H A;  1Q6H A;  5HWC A;  3PA7 A;  2L2S A;  1HKI A;  5HT1 A;  4J4N A;  1KT1 A;  3CGM A;  2XP7 A;  2XP5 A;  5I98 A;  3O5E A;  3UQI A;  1JNT A;  4WK9 A;  1Y0O A;  4MSP A;  1HJW A;  2RUQ A;  3G6L A;  1LL6 A;  3PRB A;  3O5L A;  2A3B A;  4LAV A;  1SR0 A;  1D7I A;  3RGC A;  2KO7 A;  5HUA A;  2RUC A;  3O5Q A;  1W9U A;  5BXJ A;  2YBU A;  2OLH A;  3CGN A;  4S3K A;  3ARO A;  4QT2 A;  5DF0 A;  4W9P A;  3RFW A;  3FY1 A;  4JFK A;  4WIW A;  3O5R A;  3W4R A;  1W9V A;  3RM8 A;  4L72 B;  1HJX A;  4JFM A;  3VAW A;  3WIJ A;  1EHN A;  1PBK A;  3O5P A;  3CHE A;  4WKH A;  3WD0 A;  4DRM A;  3AS1 A;  3O5O A;  4P8U A;  2F4E A;  1LG2 A;  3ALG A;  5GQB A;  1FKF A;  3KAD A;  1ZCN A;  1GPF A;  1HXV A;  4QT3 A;  4U86 A;  2ESC A;  3AS0 A;  3ARW A;  1E6P A;  5GPR A;  2IF4 A;  1H0G A;  1JVW A;  3LUO A;  1BKF A;  4ODM A;  4IT4 A;  4Z2J A;  1VF8 A;  5DIV A;  4ZPT R;  1FKS A;  2FKE A;  1FFQ A;  1J4H A;  1UR8 A;  2A3E A;  2B31 A;  4TW7 A;  1FKT A;  3G6M A;  2VN1 A;  1IX5 A;  2DT0 A;  2Q5A A;  1M5Y A;  1EIB A;  1H0I A;  5HWB A;  3ODK A;  4TW8 A;  1ZB5 A;  3UI5 A;  4DWS D;  4DZ3 A;  1N1A A;  2WM0 A;  3RM4 A;  3NRK A;  4MAV A;  3JYJ A;  2WLZ A;  3H9R B;  5J6E A;  4HBO A;  4DT4 A;  3IHZ A;  2A3C A;  1JND A;  3KAB A;  4Q22 A;  4Z2H A;  2ZQT A;  3EY6 A;  4W9Q A;  4DWS A;  1FKH A;  3ARV A;  1Q6U A;  3B8S A;  3KAF A;  3O5F A;  1Q1C A;  4W9O A;  4ZPV R;  3RM9 A;  2ZQU A;  2PV2 A;  4DWS C;  2WLY A;  3ARU A;  3WKZ A;  4MNK A;  4LGX A;  4DRP A;  3IKG A;  4ML4 A;  3CZ8 A;  2XP8 A;  3O5J A;  4JFJ A;  4W5U A;  4TW6 A;  3CH9 A;  1FKL A;  3WL0 A;  5GPG A;  3AS2 A;  2PV3 A;  2DT3 A;  2DT1 A;  3NTP A;  4TNS A;  3ART A;  1XHG A;  1D2K A;  4G50 A;  3O5D A;  4LAW A;  2LJ4 A;  4P8V A;  1ZL1 A;  4LAX A;  4DRI A;  5HBF A;  3FXY A;  4FAP A;  1C9H A;  1W1Y A;  4ZS6 A;  1CTN A;  2OFN A;  1SYT A;  1HKJ A;  1ZK6 A;  4URI A;  4NNR A;  1E6N A;  5DIT A;  4WJX A;  3KZ7 A;  3ARQ A;  2M2A A;  2ZQS A;  2LKN A;  2Y78 A;  4TYO A;  3UI4 A;  2ITK A;  2MLZ A;  3O5M A;  1ZBK A;  4R0X A;  1BL4 A;  4NSB A;  3O5G A;  1YW5 A;  3PRD A;  4MGV A;  3WD4 A;  1QZ2 A;  3O5I A;  1ROU A;  2M1I A;  2PPP A;  4DRO A;  3KAC A;  3WL1 A;  1FKJ A;  2XPB A;  1O6I A;  2G8Z A;  2DT2 A;  3RME A;  2D9F A;  1W9P A;  2YBT A;  1W1V A;  1K9T A;  1NMW A;  1FAP A;  3B9E A;  1W1P A;  1LJY A;  3GPK A;  4MNJ A;  2KR7 A;  1EYM A;  4JYS A;  2DG9 A;  4WKF A;  1J4R A;  1X6N A;  2IUZ A;  2QF8 A;  4Z2K A;  1JNS A;  4FN2 A;  4IT6 A;  1FKI A;  2XP9 A;  2MPH A;  4DRH A;  1E6R A;  4ITZ A;  1W1T A;  2JZV A;  2PBC A;  3B7X A;  4LAY A;  1D6O A;  4MTV A;  4P8X A;  2RQS A;  1L1P A;  1ZBC A;  1FKR A;  3ALF A;  1LL7 A;  4KR0 B;  4ZPW R;  1FKB A;  3KCE A;  2LPV A;  2N87 A;  1XRV A;  3KAG A;  1P5Q A;  2KGJ A;  3TDB A;  2RUD A;  1E9L A;  3OA5 A;  2DSZ A;  1HKM A;  1HJV A;  4QIB A;  1J4I A;  3I6C A;  1HKK A;  1NWT A;  4WKA A;  4R5E A;  4NZC A;  1WNO A;  4O2T A;  1NWR A;  4PTM A;  4DIP A;  5B8I C;  1F40 A;  2DSW A;  1NWU A;  5HTG A;  2F21 A;  4DH0 A;  1T11 A;  3PR9 A;  3UF8 A;  1QPF A;  1TFV A;  3WH0 A;  5HW6 A;  4QZV B;  1ZU8 A;  1D7J A;  3UQA A;  4P8W A;  1Q6I A;  2FDM A;  3WQV A;  3ARS A;  1FKG A;  2PV1 A;  1PIN A;  3MDY B;  4U84 A;  4ODK A;  1KT0 A;  3AQU A;  3WD1 A;  1WB0 A;  2RUR A;  4DWS B;  1ZBV A;  2MLX A;  1F8A B;  3UI6 A;  3WQW A;  2VCD A;  3O5K A;  4AY1 A;  2O9O A;  1ITX A;  5D75 A;  4MNL A;  4HAR A;  1OGB A;  3WD3 A;  1FJD A;  3OOB A;  1OGG A;  2XPA A;  2ZR4 A;  4IQ2 A;  2MNT A;  1QPL A;  3JYM A;  2MLY A;  4DZ2 A;  3JXV A;  1GOI A;  2PPO A;  4ODQ A;  3AS3 A;  1E6Z A;  1WAW A;  4G2P A;  3ARZ A;  1OWQ A;  3B9A A;  1LL4 A;  3ARR A;  1NH6 A;  3B9D A;  2G41 A;  3BXW A;  2DPE A;  2UZ5 A;  1R9H A;  3NI6 A;  1UR9 A;  2AWG A;  2XP3 A;  4ODL A;  1TCO C;  2KFW A;  1RD6 A;  1W26 A;  4Z2L A;  2O92 A;  3PRA A;  4GGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...