2YBUA

Crystal structure of human acidic chitinase in complex with bisdionin f
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
376
structure length
376
Chain Sequence
AYQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analyzing airway inflammation with chemical biology: dissection of acidic mammalian chitinase function with a selective drug-like inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords ACIDIC MAMMALIAN CHITINASE
total genus 129
structure length 376
sequence length 376
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2011-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ybuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2ybuA01
1OGSA 4U2ZA 5JIPA 1E1EA 3SUWA 4MNLA 2BXYA 3AXHA 3GM8A 3VNZA 2UWFA 1E71M 2CBVA 4AY1A 1UWUA 3SCPA 1MFUA 2WMFA 2WZHA 2O9OA 3GH7A 1E6NA 2G4FA 5DT7A 5ABGA 5JBEA 4W7UA 1OBAA 3SCQA 2HVMA 4A3HA 1BGGA 3CZKA 2WHMA 3WF3A 5CQ1A 5C71A 1C90A 2ZUWA 2C0HA 2VR5A 2WM0A 2WBKA 1WZKA 5IHSA 4E8DA 1RP9A 3THCA 2EPOA 3L4WA 1UQZA 1V02E 1CXKA 4MJ4A 2XM2A 1EOMA 2G41A 3VGEA 2JALA 4JKLA 3O6AA 5I79A 1VAHA 4AZ6A 2E9LA 4PN2A 2NT1A 2V3GA 2J77A 3U5UA 4GZJA 4CUCA 2VX7A 3TP4A 3VD9A 1PZ3A 3WNOA 1GOQA 1MW0A 4Q7NA 2GJXA 2EQDA 3UCQA 2YA1A 2WHJA 4UFJA 3WDIA 2W92A 2X8RA 4JHZA 2D0HA 2ZXQA 3OLGA 1ITCA 1I1WA 2AMGA 2ZXBA 3ALGA 4UOJA 5CPSA 1E6QM 4HOZA 4HZ7A 1EQCA 3ARPA 2QMKA 2A3CA 1B90A 3VIJA 3U5YA 3DYOA 3O2LA 3EDEA 4WKHA 1SR0A 4GO8A 4GZEA 1VEPA 4MTVA 2YDQA 3BLPX 1XV8A 1WDQA 2NT0A 1W1YA 4QP0A 2AOSA 4ZEPA 3LPGA 2WZIA 5ECUA 1HVQA 1DWIM 4HMCA 2OWCA 3FHAA 1U33A 4OJYA 2JF6A 3WMBA 3GH5A 4J27A 4CCEA 1E5NA 1EGZA 4WK9A 3CHEA 1OT2A 3FW6A 4A4AA 1TA3B 4DUVA 1Q6CA 1UA7A 4H8VA 4D6FA 1MW2A 1CEOA 4H8HA 3ARQA 4B3LA 1V3JA 3ZR6A 3A4XA 3SURA 2PBGA 3WDRA 2NW0A 2BHYA 4UFIA 4XX6A 2YL5A 4JKKA 2YA0A 3PBGA 1KBBA 3VPLA 5HPCA 3F5KA 4UFMA 1WZMA 1XC6A 4PMDA 4PMOA 2QPUA 1IV8A 3PZVA 1PZ2A 1BVNP 3QHOA 3A6OA 3LPFA 1QI2A 3AS0A 5I78A 4QDMA 1UD5A 1VJSA 3WH8A 5CSUA 2CBUA 2RGMA 2XFFA 4OKDA 5FOOA 1KGUA 3PTMA 2ZX5A 1JZ6A 5CLWA 1W3KA 1HNYA 4MADA 1J0HA 3WDHA 3MUIA 5FL0A 4P8XA 1VJZA 3QOKA 5A6BA 1PPIA 3MSDA 1CZ1A 2XGIA 4UFHA 1KB3A 2VTFA 2CHNA 5HOSA 2EO7A 2D0GA 4J3UA 4S3JA 3WEOA 1EO7A 1J0KA 2W91A 1W1TA 4RE4A 5HXMA 1WE5A 4LQ1A 5D4YA 2BVTA 3WD2A 5ABFB 3RJXA 4Z2GA 1VBUA 4UOQA 5EBAA 1BYAA 1UHVA 1NQ6A 1ISYA 4PSPA 2Y8KA 4JL2A 4J3XA 3F4VA 4UQEA 5E6ZA 2WCSA 1R7OA 4WF7A 3WELA 3VGBA 4ATDA 1OGGA 3VUPA 3SUTA 2UY5A 1FP9A 3APGA 1H11A 3WMSA 1SMDA 2OWWA 2JEQA 5AY7A 3UESA 1QI4A 1UR2A 3PZGA 3VIPA 1LWJA 5C8BB 1AQMA 3MUZ1 1XCXA 3L4UA 3AIVA 4HU8A 1OD8A 2PB1A 1X1NA 3OGSA 4AZHA 2XWEA 2CBIA 2IXVA 1HXJA 1OT1A 2CXGA 1PEZA 2D1ZA 1XGZA 5F7UA 3N12A 3VIGA 1PJ9A 1G5AA 1GONA 3WUEA 1H0IA 3SEPA 1I1XA 3VD4A 2BFGA 4B15A 2B31A 1W9BM 3LPOA 3ECQA 1AQ0A 3SCUA 2J7EA 2F8QA 4QLLA 3WKZA 1XH0A 3RIKA 3UG4A 2X09A 3DHPA 1UR0A 3CHCA 5IFTA 2PF0A 1V02A 2WNWA 3WNLA 3OGRA 3T0BA 4FLQA 7CGTA 4DWSC 3ZM8A 5E70A 1FP8A 3GZAA 4U3CA 4HU0A 2JIEA 2GJRA 2XTKA 4TX8A 5DT5A 4S3KA 5I77A 4DM1A 3S6TA 1KGWA 5LYRA 5M5DA 1D2KA 1QNRA 1CWYA 3IJ9A 4CGTA 1CTNA 2ZXDA 2FHCA 1J0YA 1ESWA 3WF0A 2CKRA 3AIUA 4IUGA 1UR8A 1JI2A 1W3LA 1W2PA 2D3LA 2OSYA 6A3HA 5A3HA 4ZFMA 2WCAA 3WF2A 4D6GA 4GINA 1GOIA 4HP5A 1W3JA 2W5FA 1TVNA 1A3HA 4OBSA 2F2HA 1MXGA 1J9YA 5A6LA 3CZ8A 3CPUA 1KCLA 1LLOA 3WFZA 2G3JA 3SUUA 2FH8A 3OGVA 3FHQA 1NWUA 5GNYA 2WMIA 1FFRA 2W62A 1V6VA 5M03A 1H4PA 2J78A 4TXEA 5LA0A 4B16A 3GXIA 1V3MA 1CPUA 4Z2KA 3HU7A 1WP6A 5AC5A 3WH5A 1V3LA 4UFKA 1QHPA 3IJ8A 3BSHA 1HKMA 3VTRA 4ATLA 1W2VA 2XWDA 4H8UA 5A6AA 1UG6A 2DT1A 3CZJA 5JBFA 2YIHA 3CTTA 4UQBA 5JUVA 1UWQA 1BG4A 3GTNA 3EYPA 3WIJA 4P8VA 3DC0A 2EBNA 4BQ2A 1CNVA 1HN1A 4MJ2A 3AISA 2ZUUA 3CUJA 1KWKA 4W8BA 4CKQA 2WMHA 3NSXA 4PTWA 4U3AA 3MMDA 2XVLA 4AIEA 2A3HA 2E8ZA 1AVAA 1B9ZA 1BTCA 2BS9A 1MQRA 4B3KA 4PMQA 1CGXA 1C8QA 3SCNA 4CD8A 1VFMA 2CITA 2GK1B 4CCCA 1MW3A 5I5RA 3EDDA 1WZAA 1XSIA 4OZOA 3MO4A 2YKKA 3ALFA 2OLHA 3AMKA 2BHZA 2DH3A 5A2AA 2WSKA 1CENA 4NRRA 1XH2A 5A94A 3MMWA 3GXFA 2G8ZA 2D2OA 1C7TA 2EPMX 2VZUA 3CIVA 1NOFA 3BCFA 4F8XA 2XJ7A 2Q8XA 3NIYA 1W9XA 1L8NA 2BXZA 5A8NA 2J62A 3RO8A 2CCRA 4B9ZA 1WNOA 1Q4NX 3WD3A 1CGUA 3GBDA 3ZT5A 2WW5A 3L2LA 4ZXOA 1W1PA 3VDBA 3MUY1 4W86A 1OD0A 4CU7A 1BLIA 3VMPA 1IZKA 2XHYA 1RD6A 1QI0A 2DH2A 4N42A 5D8ZA 1WAWA 2ZX9A 1E70M 1E9LA 4FLOA 3IANA 3W82A 5E0CA 1QPKA 4AD3A 1CXHA 2CPUA 3ZJ8A 2FHBA 3W53A 1W9PA 3D3AA 1GJWA 3BGAA 4XB3A 1TG7A 3VGHA 3AS2A 3K46A 4MAZA 1ISWA 4P7LA 1B2YA 2CEQA 3G6MA 4W87A 2WWDA 1CXLA 2XSBA 1M04A 3MU7A 1NP2A 1EHNA 3T09A 1E56A 1F4AA 4YPJA 2J8FA 4CN6A 1E4NA 2J7HA 3U7VA 3SCVA 2WSPA 1JZ3A 4M80A 1EXPA 3D5HA 4UOZA 3BAIA 3A47A 3B9AA 4C7FA 2XGBA 3AIWA 3WQ6A 4CVWA 1GOWA 2XG9A 3RPMA 3GNRA 2VVSA 3CLWA 3WDJA 1GQJA 2ZX6A 1ZJAA 3PHAA 1W32A 4B9YA 1E40A 3VX1A 1NOWA 4MB4A 3W25A 2HISA 1HP4A 5LA2A 4AD5A 1WDPA 4LX4A 4N0RA 1UD8A 3NDYA 2WK2A 1CECA 1LL6A 1HKIA 3AMDA 3WQWA 2BY3A 4UNIA 3UG5A 3GNPA 4HA3A 3GXMA 1AMYA 5JIWA 2JEPA 4P8UA 2D23A 1UWIA 5ABEA 3AI0A 3QHNA 4HZ8A 2VRKA 1MVYA 1MFVA 4L4OA 1VENA 1E15A 4UQAA 4W7WA 3W38A 1XYFA 2XIBA 3WQVA 4J28A 1KQZA 1GNXA 1R86A 3KL5A 4OOUA 3A4WA 2F61A 2D22A 3NUKA 4JKMA 4PTMA 2VT0A 1JD9A 4PMVA 4V27A 4AYSA 2Y24A 1JD7A 3MMUA 4MB3A 3L4ZA 3K8LA 4BA0A 4DWSD 4UQCA 1HJSA 1E0XA 3WBEA 4X9YA 1OM0A 1UA3A 2YL9A 3BSGA 4PTVA 3SUSA 3AIRA 2DT0A 1KXTA 3AOFA 1JYXA 4CCDA 4GI9A 2DSKA 1UOKA 4Y7EA 2C7FA 1DWGM 2EPKX 1LF1A 5JH8A 2WAGA 3AHYA 1VB9A 1OWQA 4TX6A 1B31A 1DTUA 4BQ5A 1BPLB 3L4VA 1GOOA 4OIFA 2E8YA 4W84A 1JI1A 3ARYA 4KRUA 4AMCA 4AZCA 1UR1A 1XRVA 1GUVA 1W3HA 4PSRA 1DWFM 1JAKA 1TZ7A 2VMFA 1BQCA 4GI8A 4U2YA 1UWSA 2XFRA 3CUFA 8A3HA 4IPNB 1HF6A 1JL8A 1E4IA 4PRWA 5A6JA 5FKYA 4MNMA 3ARWA 1LJYA 1S46A 2FHFA 3OBAA 1XH1A 2WVVB 4PYSA 3CZLA 1D3CA 3SCWA 2W61A 3ARTA 2WBGA 3N04A 4LYPA 4JCMA 1MYRA 3VO0A 1GORA 1U2YA 3ZR5A 2JE8A 3EDKA 3DYMA 1H09A 2XFYA 1Q6EA 3WL0A 2DIJA 4MB1A 1OIFA 1TMQA 2GK1A 3VIKA 3AZTA 1X6LA 1B3WA 4CN4A 4U33A 5GNZA 3O9NA 2OYKA 3PZOA 4U5KA 1BVZA 3RMEA 2CIPA 1XSJA 4CD5A 3PZTA 5DO8A 1V6UA 2IUZA 3ZIZA 1F4HA 2VRQA 5I2UA 2WLYA 3VMNA 1MWOA 4QLKA 1E0VA 4XUYA 3WQ4A 1NOUA 4TVUA 1UKTA 3NDZA 1H1NA 2PC8A 2VUYA 1UQYA 1IZJA 1UWTA 5CPTA 1FA2A 1H2JA 4WIWA 2WMKA 1CBGA 3HMCA 4JFTA 4E2OA 1O7AA 1GQLA 2FDMA 5JBDA 2DSWA 2WZEA 2ZWZA 1BG9A 1UKPA 4YHEA 5A6KA 5BCAA 2DQXA 2VNCA 3SUVA 2VQTA 3ZT6A 3ARUA 4WKFA 4AD1A 2WC3A 3FY1A 1B3VA 2ZUTA 2CKSA 5CG0A 2J7GA 3J7HA 3GYCA 4PMNA 4FF5A 3PTQA 1QNSA 1HIZA 3W29A 4CU8A 2GSJA 4KGJA 4J3SA 5I24A 1NARA 2E4TA 3AXIA 1DWAM 4D6JA 3E1F1 5LA1A 1VEMA 2Y8VA 3EDFA 2AAAA 1E6XM 5A6MA 3VILA 3BH4A 4AXNA 1GW1A 3W81A 2WKGA 1J11A 3NJ3A 4AZ7A 1VFFA 6TAAA 5DF0A 4W85A 2VX4A 3WUGA 1OINA 1CLVA 2WPGA 3BAKA 4D71A 2BVYA 3KEHA 1UUQA 4KH2A 1NP0A 5EMYA 3VGGA 3IAQA 4OUEA 1ISZA 1BYDA 5C70A 4HA1A 1B30A 1U30A 4LYQA 4QFUA 2G3MA 3MV01 1VF8A 4HTYA 5CLTA 1CDGA 2ZUVA 5DMYA 4D1IA 2QV4A 1XYZA 2WKLA 4HA4A 4DWSB 1E3XA 3RM9A 4D1JA 3UR7A 2DPEA 3M7SA 2A3BA 4AD0A 4MPKA 3HN3A 2J7CA 4OBRA 1H3GA 3B9DA 3DECA 1KXVA 5M17A 2WC7A 3TTQA 2QLYA 4DWSA 1E4LA 3MANA 2YBUA 2GJPA 1GHRA 3TOPA 3PZNA 3GDBA 4HPHA 5GPRA 3ZO9A 2ZIDA 4PMZA 3WD1A 3WNNA 2G3NA 1FH7A 2J7FA 1PX4A 4AIUA 5GQBA 3POCA 4GZIA 4GPNA 2WB5A 4JFUA 1CXIA 3ARRA 3AHTA 1NWSA 3BC9A 4W8LA 1JZ2A 1FHLA 3PZIA 1K9TA 4CD4A 2VCBA 3T08A 3GH4A 3ZT7A 3CZEA 1R7AA 5A8PA 4LGXA 1CIUA 1QI5A 1TFVA 1RH9A 1UD4A 1J18A 3N9KA 2X1IA 3DHUA 4H41A 2QF8A 4P8WA 3UETA 4D72A 3CHDA 4TOQA 3KL3A 2FH6A 3G6LA 1G1YA 1HL8A 4UCFA 1V3HA 3AXXA 3RILA 4NRSA 5ABFA 3TTYA 2BY2A 3VINA 2EEXA 3VM5A 1VEOA 4D6IA 4LPCA 3A4AA 2WHKA 4H2CA 1EHAA 3T2QA 4PBGA 4AISA 1OSEA 1RPKA 4GXPA 5EB8A 3NSMA 4M8UA 4AD2A 3VVGA 1QW8A 4ACZA 5ABHA 4D6EA 4TVCA 2XM1A 1JZ7A 1CXEA 1FHDA 3WF1A 3OZPA 3CHFA 2D24A 2EPLX 4FLRA 1X6NA 2VZSA 1CXFA 1JFHA 3VDHA 4MNKA 1O6IA 1XHGA 1MQPA 5HDRA 1BGAA 5A8QA 1V6WA 3MS8A 1JDDA 4P7OA 3WD0A 4C7GA 5I23A 2TAAA 1K9DA 4GQRA 2O92A 5D9PA 3THDA 1G9HA 1WO2A 1GVIA 2OYMA 2WANA 3EMZA 1FH9A 4KGLA 2E9MA 4PMYA 3W4RA 1US2A 4EE9A 1B3ZA 3AMLA 4KMQA 1ZBVA 1HJUA 2E0PA 5IFPA 3ZSTA 1MQQA 5A2BA 1JNDA 1HKKA 4JFSA 3AYRA 1V0NA 3VIOA 5CJ5A 1UKSA 1GJUA 1UD3A 4J7RA 3I3BA 4JL1A 3BXWA 2VZVA 3L2MA 1ISVA 1QI3A 3I3DA 3JUGA 4UFLA 4UZSA 2WHLA 5DEZA 4J3TA 1K9EA 1E6ZA 4ZE4A 1NWTA 1GPFA 1ZBKA 1DWHM 1DP0A 1JGIA 1C93A 1WB0A 2W63A 4BQ4A 4ZENA 3WH9A 3N11A 1KCKA 3WDQA 3VM7A 8CGTA 4BF7A 1E0WA 2WVTA 1R8LA 3M46A 3WNPA 1DWJM 2EJ1A 1FH8A 2FGZA 1RP8A 3W0KA 5BWFA 1XD0A 4W5UA 2ZWYA 3L4TA 4V2XA 5E9AA 4RL3A 3BLKA 3CGTA 2DSZA 1K9FA 4HOWA 3N17A 3SCOA 1Q6DA 2VCCA 5TD4A 5CSYA 1SMAA 5CPQA 4PUEA 2DT3A 5D9NA 4AEEA 2JFEX 4EK7A 1Z32X 1ZU8A 3WEZA 3RM4A 1BAGA 3RCNA 3WQ5A 1UZ4A 3VGFA 4AZGA 1LWHA 1M03A 2CESA 1EOKA 4URIA 4TTGA 5BRQA 3B8SA 4TVDA 1ZBWA 4W8AA 3W27A 1C92A 2O9RA 4PMUA 4MB5A 4M1RA 1EQPA 1M7XA 1UYQA 1ZJBA 1JYVA 5HBFA 1ITXA 1BF2A 2GDUA 4CD7A 1OGBA 3S2CA 2WMIB 3MSGA 4Z2IA 4IPLA 5E09A 3A3HA 3N13A 4NF7A 5EFDA 1FFQA 4Z2LA 1Q6FA 1PX3A 4JFVA 4W7VA 3K1DA 1V3IA 4UZUA 3VMOA 1JZ8A 1US3A 2YDRA 2NSXA 1KR1A 2A3EA 1OIMA 3PZQA 1KXQA 1V0KA 3AFBA 3QOMA 1HKJA 1E3ZA 4ZE5A 2VCAA 1H5VA 1VFOA 5BXTA 1EA9C 2GVYA 1J0JA 1N82A 5AYIA 3MKKA 2J7DA 1DHKA 3TONA 1ZS2A 2CYGA 1B1YA 5AYBA 2ZOXA 4M56A 2D3NA 1QHZA 1JF5A 2X0HA 1GVYA 3LMYA 3QR3A 4MNJA 3UR8A 3ZOAA 5BRPA 2EPNA 4DUXA 2VX5A 3L4XA 1HX0A 3FAWA 5I6SA 3U57A 3IK2A 5A8MA 1QHOA 4J3WA 3VX0A 1TE1A 3EDJA 2VC9A 4D6CA 3VD7A 3WN6A 2ZUSA 2PBOA 4IM4A 2WVSA 3AIQA 4BCEA 3OA5A 1LG2A 2YOCA 1D7FA 3PZUA 1H41A 3OIHA 1E5JA 3KL0A 1PAMA 3WBAA 1V6YA 2GUYA 4E8CA 3T2PA 1WDSA 2VO5A 5BYWA 2WCGA 3W28A 2V3DA 4UTFA 1E55A 3WUFA 3NYDA 2UY2A 3SCRA 4F9DA 1BYCA 2VRJA 2ZX7A 1HJXA 4F79A 2PWEA 1BFNA 4M29A 4UQDA 3AS1A 5D9OA 1PBGA 1KXHA 3VD3A 3W6LA 2XIIA 3AICA 1KFWA 1JIBA 4KWUA 2Z1KA 3AQUA 4GIAA 1W1VA 2VL4A 1TVPA 2BNJA 3F5LA 3GXDA 4MDOA 4IISA 1KR0A 1ZB5A 2VZTA 4R5EA 4F9JA 1JDAA 1GQKA 1V0LA 1K6AA 4TTUA 3RJYA 4BQ3A 3BMWA 4AEFA 4NZCA 2MANA 2E3ZA 3QHMA 1OCQA 5HPOA 3OB8A 1DEDA 3AMCA 5AC4A 2XVGA 3BMVA 4JAWA 1C8YA 4C7DA 1C91A 3MUAA 4LYRA 1LQ0A 2EXOA 6CGTA 1GQIA 1GCYA 3T0AA 4K68A 2YLLA 4P7RA 2UY4A 4HZ6A 3BAXA 4M82A 2ZX8A 3CUHA 1JAEA 2V3FA 2YBTA 3AHVA 2BV9A 3QGVA 1HJVA 1VFUA 2CNCA 4AZ5A 3WDPP 3WF4A 4Q22A 3N1AA 2W4XA 3WL1A 3DYPA 4EAMA 4PTXA 3RM8A 1V0MA 1V08A 2FGLA 2WXDM 3W24A 2WLZA 1B3XA 3BCDA 5A8OA 4H04A 3VIHA 3CH9A 4J3VA 1AQHA 4MAVA 1E43A 4GQQA 1UR4A 1M53A 3WUBA 3OLEA 4LXFA 1TCMA 4AZBA 1B0IA 1BYBA 3ARVA 1KBKA 2V5CA 2YJQA 1HP5A 2JIWA 2QHAA 4A3YA 1QOXA 2CBJA 1BSIA 2O9PA 5BROA 4BZYA 1HL9A 1MXDA 1CGTA 2XVNA 2VJXA 3OG2A 1V3KA 9CGTA 1C8XA 1JF6A 4X0VA 1E4MM 3VU2A 5A6BD 4MDPA 4Z2JA 2VURA 4TUFA 4AIOA 3IAPA 2YL8A 2E40A 2Z1SA 2OYLA 3K8KA 4W88A 4PEEA 4CU6A 2X2YA 4AD4A 1CGYA 1EH9A 1FOBA 3OLDA 5KZ6A 2WMJA 4PUDA 1R87A 4YHGA 5EFFA 1HJWA 1JFXA 4P7QA 1J0IA 1WPCA 2CERA 1CYGA 3PZ9A 4GI6A 3SIMA 1QBBA 2X0YA 5D8WA 3AJ7A 4WLCA 4F66A 4WJXA 1E6PA 4CD6A 1XSKA 2WYSA 3K8MA 3N15A 1B3YA 3BAWA 1Q6GA 1CGVA 1ISXA 1WKYA 3CO4A 2DT2A 2YA2A 1ODUA 3WNKA 5CGTA 1G94A 5A1AA 1G0CA 2DSVA 3SCTA 3ARSA 3L4YA 1JNEA 1Y7VA 3AS3A 2Y2WA 4L4PA 1VIWA 4U5IA 4HPGA 2J79A 2XSAA 3F5JA 4HOXA 1UH2A 1JXKA 1J10A 1JZ5A 3VKKA 1CGWA 1KWGA 1JZ4A 4R27A 2CHOA 5CGMA 3ZJKA 5DFAA 2W66A 1QNQA 2VI0A 4U31A 1JDCA 3W37A 1NM9A 4X0NA 3VGDA 4JZ5A 3VOCA 2VVNA 3VIMA 4AW7A 2WVUA 3OZOA 3AIBA 1EIBA 4UQ9A 5A95A 4XZWA 4Z2HA 4XV0A 3POHA 3WNMA 3ZJ7A 2D20A 2BY1A 1YHTA 4AZIA 3I3EA 3WY1A 3WQ8A 1UR9A 2C8NA 4PMRA 3AHXA 3WH6A 3GNOA 3VIIA 1UH4A 3PZMA 1GHSA 2QPSA 1J0ZA 2VR4A 2XYLA 1JYWA 1I75A 1WCGA 3KZSA 3HJEA 3VIFA 4FLSA 3NCOA 1VRXA 3WENA 3LPPA 4NI3A 5HNNA 3FAXA 4H7VA 2DIEA 3PTKA 2Y5EA 2XVKA 4ML4A 2XPKA 4AWEA 3MV11 3WFLA 4EANA 5BXPA 2BVDA 1TUXA 2BHUA 3FN9A 4QLJA 2PWGA 2YDSA 4CVUA 1V6XA 3BAJA 1ECEA 2UY3A 4QCFA 2V5DA 2J4GA 2GJXB 1LG1A 3AHZA 2XUCA 4D6DA 1BHGA 4HMEA 1ZBCA 1P6WA 4PCTA 4XZBA 4ATWA 1KQYA 2W67A 2J25A 3AIEA 1J12A 2WC4A 2DDXA 3N18A 2ESCA 3GBEA 1JXJA 2VOTA 2D0FA 1L0PA 5IHRA 3T0DA 3CMGA 1EO5A 1GZJA 3CUGA 1QNOA 1QNPA 3IJ7A 4OOZA 3U7BA 1UD6A 4W89A 2PI6A 3TTOA 3UG3A 5CXPA 3CMJA 3AYSA 3M6DA 2G3IA 5FL1A 3ARZA 1XD1A 1XCWA 2PWFA 1TR1A 2J7BA 3BAYA 3WEMA 4PCSA 3EBVA 3VD5A 3W6MA 1E72M 4ACYA 5IXEA 4E4PA 1TA3A 1UKOA 2ZUNA 4P7NA 1KGXA 1HVXA 1LL4A 1E1FA 1UKQA 2ZE0A 4PMXA 2ZXAA 4D6HA 1NWRA 2WMGA 3CZGA 3M07A 3TTSA 3VNYA 2OWXA 2YL6A 4CN1A 1WZLA 2WWCA 5A69A 1W9VA 1G01A 1E73M 2V38A 1M01A 2J47A 4QCEA 5FD0A 3K4AA 3ZSSA 3AROA 3KWXA 2VX6A 5M3WA 1UZ1A 3KE0A 3ARXA 4KRTA 1YQ2A 3TA9A 2J8GA 2GFTA 1SYTA 4QAWA 2JF7A 1UH3A 3W26A 5BXRA 2RGLA 4WSJA 1EDGA 1LL7A 3ZMRA 1PX8A 1E6SM 1QBAA 1UWRA 4ZXLA 4YN5A 1V03A 2X05A 4GKLA 4UR9A 3AZSA 1IT0A 2PWDA 3T2OA 2DGAA 3FXYA 4NSBA 3FNDA 3ZJ6A 5A2CA 3WSUA 1H49A 1A47A 7A3HA 1VBRA 4DM2A 2Y4SA 1EDQA 1HJQA 1NH6A 4JCLA 4M24A 3WD4A 3ZQ9A 1WDRA 5GNXA 2GDVA 2OSXA 3SCSA 1QVBA 2WVVA 1R85A 3VDAA 1C7SA 1GOMA 5BXSA 3UERA 2E9BA 3EMQA 1UD2A 3WMCA 3K4DA 3WH7A 7TAAA 4ACZB 1W9DM 4AC1X 5KEZA 3AZRA 1C3FA 2VZOA 1CLXA 2QMJA 1EDTA 2VQUA 1MW1A 2CETA 4EKJA 1ZL1A 1ODZA 5E0FA 5I0DA 3VDCA 1SFSA 3CBWA 4RE2A 1JG9A 5A6SA 4AZCB 4WKAA 3RDKA 2ZUMA 5FIPA 4GO9A 4W93A 2ZICA 5FCZA 2A3AA 1OB0A 4DUWA 2J75A 2XVPA 4JHOA 4W5ZA 3EMCA 1W9UA 4BS0A 3PN8A 1HT6A 2DSUA 2PWHA 5CZKA 1QW9A 2OSWA 4FK9A 3B9EA 2J74A 2V3EA 3CUIA 5IDIA 3UEQA 2O9TA 3AMGA 4JIEA 2YLAA 1J01A 1GOKA 3NSNA 5I3DA 4RE3A 1W91A 5E6YA 4FMVA 4WSKA 1PIGA 4V28A 2BY0A 2IXUA 1PIFA 1H0GA 2DEPA 4M81A 1E6RA 3II1A 4JFWA 3OLIA 4HMDA 1JYNA 5D9MA
chains in the Genus database with same CATH superfamily
3PUOA 3F4WA 3AXHA 3VNZA 4XAYA 4GNKB 2AKMA 1FTXA 1E1CA 1MEWA 3H7VA 1IEIA 3LTYA 1TWIA 1MFUA 3QTPA 3RGCA 2WMFA 2KFWA 2WZHA 3LLDA 5HMEA 5MF5A 5FSEC 2O9OA 3D3FA 4NAEA 1E6NA 4HJFA 2R8WA 4ODRA 1OBAA 1UB3A 4LCRA 3SQLA 1QU4A 2HVMA 4HSHA 4XG1A 3UXDA 4ZBCA 2VFDA 1Z9AA 3ITGA 5C71A 3UVIA 4FF7A 3C61A 4O50A 1YMYA 2BGQA 3IIOA 3REQA 1QPQA 1V02E 1V8EA 4JKLA 1VAHA 4JN7A 4B90A 2NT1A 3NQ8A 3SAZA 2V3GA 3UXKA 3LBOA 2VX7A 1PBKA 2QIIA 2FZ8A 1PZ3A 5K9XA 4Q7NA 2EQDA 3TQPA 4KETA 2YA1A 2WHJA 3WDIA 2W92A 2X8RA 2BVWA 4WHBA 3PG9A 4FN2A 1ROTA 3MMTA 1VPXA 3MA8A 1EJ7L 4BJHA 3B8TA 1E6QM 2A3CA 1BRLB 3G77A 4QX4A 4GO8A 5KETA 3TK7A 3DI1A 3O5MA 1VEPA 1JVNA 4MTVA 2YDQA 5IDZA 5KSWA 4IMGA 3B0XA 2XPBA 1R3VA 1XLDA 1W1YA 2AOSA 1FDJA 1RY8A 1HVQA 4HMCA 4HPXA 3FHAA 2WQDA 3W1XA 4AF0B 4OE7A 2F6XA 4P2VA 3LUOA 2ZC8A 4IT1A 1E5NA 4WK9A 2CZFA 2V5JA 4DROA 1OT2A 3HGJA 4GE8A 4UIOA 5MKGB 3G8RA 3TSDA 4D6FA 1MW2A 5DRIA 4H8HA 3A4XA 5BW6A 3F2CA 3KTXA 3WDRA 2ETNA 4NYYA 1OFDA 2BHYA 4K8HA 3IRDA 4UFIA 5I3KA 4YVPA 3AUJA 3F4DA 3VPLA 3F5KA 1YKWA 1WZMA 5EU9A 4O13A 4PMDA 2NQHA 1P5QA 3GDMA 4XO7A 4AX7A 1IV8A 6TIMA 1BVNP 2NV2A 3PB2A 1AJ2A 3I7SA 3A6OA 5HUPA 1A3WA 3EXSA 3P0WA 3WH8A 5CSUA 2RGMA 1MDLA 5D32A 5FOOA 4B5UA 1S2CA 3FAPA 2B7PA 1EJTC 2J27A 2DG9A 1F74A 3PAJA 4FOKA 1BQGA 1X39A 4H7ZA 2R94A 3Q45A 4P8XA 4Q6JA 1BVWA 1JNSA 3PANA 3MSDA 2XGIA 5H8PA 1KB3A 4AG0A 1OABA 4Q8TA 4JYSA 1E9ZB 1EZWA 1DQWA 4S3JA 3WEOA 2ON3A 1J0KA 2Q5AA 1C9WA 3LHYA 4RE4A 3GTIA 5TQLA 2YFOA 3M7WA 4DI8A 3UJEA 1WE5A 2PP3A 2ZRXA 1QXLA 3WD2A 5ABFB 3RJXA 4Z2GA 1VBUA 2HE8A 4UOQA 3MYPA 1NQ6A 2ABAA 1ISYA 3TA6A 2Y8KA 4JOMA 4V1XA 4JL2A 4JEJA 3ZR4A 4UQEA 5E6ZA 4O52A 2IPFA 5T9CE 3H8AA 1XDJA 2IMRA 2UY5A 3E0FA 4DB7A 3H12A 2VGIA 1H11A 4QJ4B 4JY8A 4QZVB 3WQPA 5AY7A 1QI4A 3QJAA 4EXAA 3O5KA 4PCFA 4TW6A 1A5BA 4UTMA 2B0MA 3MUZ1 4JFKA 2WSQA 1X1NA 4AZHA 1OT1A 1OYCA 3TROA 1XGZA 2DVTA 1G5AA 3WUEA 4DJED 5BOOA 3RITA 3NQEA 3HV8A 4DZ3A 3VD4A 3BARA 1S5WA 5LKYA 1ZPTA 1MMFA 2BB0A 1AQ0A 2J7EA 2F8QA 1VCGA 4N7QA 3TLLA 1F3TA 3T0TA 5AFDA 3A9IA 1V02A 3WNLA 3OGRA 3T0BA 4FLQA 7CGTA 3CU2A 3VOFA 5K4XA 1CWYA 1CTNA 4PMJA 3SN4A 3NO5A 1UR8A 3RXZA 2MF9A 1W2PA 3OZYA 1TWDA 4GINA 4HP5A 1MNSA 3KFTA 4L61A 3CV1A 3WLHA 3H4WA 1A3HA 2F2HA 1XYBA 3CPUA 3OTRA 1LLOA 3AXKA 2YXOA 3LGDA 3PUGA 1XLGA 3OGVA 3FHQA 3S1WA 1NWUA 2WMIA 4DPPA 2CZ5A 1V6VA 1FJDA 2UZ9A 2J78A 3IWPA 1FKKA 5LA0A 3PPGA 3S5OA 4AWSA 4I9TA 1NSJA 3SN0A 1LOQA 3HU7A 1WP6A 2QVHA 1V3LA 3IV8A 4DZHA 4P5UA 4I9JA 1Q45A 4L72B 3IJ8A 5AZ0A 4ATLA 1WXYA 1NAL1 4ZO9A 2XWDA 4R53A 2P10A 2YIHA 5JUVA 3DC0A 4KIEA 5HUAA 2OLAA 3ZYZA 1H1YA 5K2ZA 4IFKA 4AVFA 4BQ2A 4MJ2A 3AISA 1JDEA 1BF6A 5CC7A 4TO8A 3VUSA 3P81A 1AL8A 1TZ9A 3DERA 1Q3NA 2KZHA 4U3AA 2XVLA 4IIDA 2E8ZA 1B9ZA 1MQRA 1C8QA 4A3UA 4YTTA 3EOOA 1Q1CA 3UXIA 1L2QA 3QGAC 2QW5A 3WLNA 4XAPA 3BO9A 4H6KA 2AL1A 1DXFA 3BQ6A 2DZVA 3MY9A 2BHZA 5J5DA 2DH3A 2WSKA 1CB2A 4IFOA 1CENA 4LS1A 5A94A 3BV7A 3MWAA 2IQDA 1ZJIA 2VZUA 4LBUA 1F6PA 4AYGA 4LAKA 5CPLA 1GRJA 4GC3A 3W00A 4Q8NA 1OVDA 2J62A 1WNOA 1Q4NX 2TMDA 3PJUA 2IW0A 2WW5A 3R8RA 1W1PA 4GCXA 2EG6A 4LUYA 2F6UA 4IHCA 2XHYA 1RD6A 3VNIA 3WX7A 5I3JA 5FF0A 3OODA 6XIAA 1M7OA 3ZJ8A 2FHBA 1L2UA 1W9PA 1W5MA 3IIPA 1B4EA 1XP3A 1B2YA 2CEQA 3NTPA 5BZAA 3WZ0E 2W9MA 3B8WA 3CAVA 1UUMA 1E56A 4N6EA 1F4AA 3ATZA 3N19B 2J7HA 3ABXA 2V2CA 3SCVA 1F2JA 2WSPA 1JZ3A 1PINA 3EXTA 2DW6A 4UOZA 1VD6A 1KLYA 3ITXA 3EWZA 5K9DA 3DIPA 3B9AA 3M16A 3MYOA 4FAMA 1GOWA 4XIAA 1Q6UA 1CI1A 1BKFA 3CAWA 4LALA 5GJPA 1LLWA 1GQJA 2ZX6A 3PHAA 3HFYA 3TLQA 1Q7MA 3BDKA 4B9YA 5JH1A 4FHAA 1WDPA 4WOQA 3TJLA 4N0RA 1UD8A 1CECA 4NZ4A 1LL6A 1V7YA 2E5BA 2X16A 3OVPA 4H19A 1IEVA 1RHCA 3GNPA 4HA3A 1WV2A 1VGAA 2G4JA 4P8UA 3L7RA 5FA5A 2OZ3A 4R9XA 4JQ4A 3ABRA 2VRKA 3PK7A 1MFVA 4QT2A 4Q7BA 3H23A 3DOPA 2OOGA 1E15A 3W38A 3TTEA 1DJHA 1XYFA 3P74A 4B5SA 2OZTA 1K7FA 3W74A 1GNXA 2PPOA 4FNSA 4LAWA 3H9RB 1ZAIA 4WD0A 2D22A 4WJEA 4JKMA 2X1SA 3AUOA 4NJIA 2WPBA 3DU0A 4C6LA 4AYSA 1FCQA 3K8LA 2Y8UA 5CZJA 1MEHA 4JYDA 2NV9A 1VFTA 1PWLA 2GQ3A 4L3NA 1E0XA 1TTQA 4DJDC 1UA3A 2YL9A 2A2IA 3KAIA 2EF9A 3AIRA 1Q85A 1MUCA 5AB3A 5C9WA 4Y7EA 3RRXA 1DWGM 2BDQA 5LXXA 4MKSA 2OJPA 3M64A 3OJGA 4DLMA 1JPIA 1IR2A 3S1XA 4OIFA 3ARYA 1BXBA 4AZCA 1XLMA 5LIYX 3N2TA 1DWFM 2OOFA 1W17A 4DLFA 2DZXA 2XFRA 3A64A 3SY5A 4BR1A 2DZBA 5L9FA 1HF6A 1JL8A 2VEMA 5I3IA 5DCBA 2PFHA 4PR4A 4PYSA 3LX9A 3N04A 1MYRA 3VO0A 2IKHA 3KBMA 3ZR5A 1QWKA 3LS9A 3VABA 1WBHA 1XRFA 3EDKA 4ICNA 3A9BA 4OGZA 1Q6EA 1TMQA 1DOSA 4C6BA 1GTEA 3PZOA 4TU1A 2LJ4A 3LI0A 4WQ6A 4Z1AA 2E09A 5HW7A 1O5QA 1V6UA 2IUZA 3ZIZA 2VRQA 1O1ZA 1P0BA 2QJMA 3KWSA 3FDKA 1EJUC 4DO6A 5LHFA 3WQ4A 4HBKA 3RFWA 4GQGA 1S5TA 5XIMA 2OEKA 1IZJA 4AWTA 1UWTA 3ITOA 1FA2A 1J93A 4JTLA 1E1CB 5D2WA 1SQ7A 3GHTA 1FKHA 1DJQA 2FDMA 2BLEA 2C1IA 1K7EA 3L9CA 1UKPA 2PGWA 4YHEA 1I45A 3V0UA 4FNTA 3STPA 4S2CA 4IQEA 2A79A 4MPQA 2VNCA 3SUVA 5HQLA 3O5DA 2P1FA 4WKFA 1TV3A 4IQ2A 5CG0A 2J7GA 3GYCA 2L5HA 1QNSA 4QHRA 1G7UA 3EKZA 4Z1DA 1ME7A 3VKAA 1D8CA 3E1F1 2BOFX 1UW9A 2AAAA 3EB2A 1E6XM 3WLQA 2FFCA 3NG3A 1J11A 4AZ7A 3T6CA 3UU0A 2VYOA 6TAAA 5DF0A 4W85A 1OINA 2Y63A 2IQ0A 3VKDA 3CV7A 4XD3A 4E4FA 2DUZA 4KH2A 1NP0A 1OX4B 3VGGA 3IAQA 2RJGA 5CBIA 4OUEA 3I65A 4HA1A 4LYQA 4QFUA 1H7XA 3MV01 1VF8A 2X2GA 4D1IA 2QV4A 2WKLA 1FX6A 3BOFA 1E3XA 1YTDA 1BRLA 5CAKA 4CNSA 2FPTA 2DU2A 4O19A 4AD0A 2M08A 3DN5A 4ZL1A 4UB9A 1UIOA 2WC7A 4IL0A 4UTLA 3KM8A 1XIHA 4S3AA 3N4AA 1GJPA 1WOAA 3RYSA 3GAYA 3WD1A 5LXEA 1GQNA 4ZOAA 4YJ5A 1Q5MA 3NQGA 4ODQA 1K8YA 1K4GA 1J6OA 3POCA 1IWBA 4GZIA 3ANVA 4JTGA 3S42A 3QZ6A 4GHRA 4MVAA 4Y96A 2Z26A 3CEPA 8RUCA 2VCBA 3T08A 2HV5A 4IPPA 1Z41A 1WXZA 4F0LA 1QUMA 1UD4A 1HO1A 4GJJA 1BSLA 3QPZA 4D72A 5G1YA 1K70A 2FH6A 2VM8A 2V6AA 4ICMA 4GUIA 3VKBA 1V3HA 1TJ1A 3TTYA 3UCCA 3VM5A 4N9DA 4LPCA 4DO4A 3ABSA 2WNNA 2I17A 2PLMA 3M41A 4GXPA 3H7RA 5TBOA 3RU6A 1MUMA 4Y6GA 1ZRQA 1KT1A 1IYXA 4CEXC 1CXEA 1TJ2A 4O1CA 1ICPA 2WO5A 2D24A 2VZSA 1SO6A 1CXFA 1RJPA 3FDGA 3IKGA 2OKOA 3T81A 2ZTJA 3O16A 5JXQA 2ISWA 4C6FA 3KCOA 4YTSA 3GS6A 3H7UA 4O1BA 4GQRA 3LQLA 1KKRA 4AHQA 1EZ2A 4S3BA 1WO2A 2OYMA 4DRSA 5D30A 3G0UA 3FGCA 1HQTA 4JTQA 1EFZA 2E9MA 3N29A 4R33A 2A3LA 1XICA 2XN0A 1B3ZA 4KMQA 4OUIA 3UXLA 2VWTA 3ENLA 4MLJA 5A2BA 1JNDA 3V18A 3VIOA 4OFCA 3CWHA 3DZ1A 5CJ5A 2V82A 2HXUA 1TRDA 2P50A 4QG8A 4PUUA 1Q2RA 3R12A 2ZR6A 1ISVA 3I3DA 3HGSA 3U48A 5DEZA 1Q6OA 1TZZA 4QGCA 1E6ZA 1UMLA 4A3RA 3P5ZA 1NWTA 4Q4RA 2MLYA 5T8GA 1WB0A 4JFIA 2VFHA 1KBIA 3PAOA 4RW5A 4LCQA 3WH9A 3BWWA 1P0NA 2DZAA 6ENLA 3BOLA 3VM7A 4BF7A 1E0WA 4IMCA 2NZLA 4FX8A 1XRTA 4Y9NA 3M46A 2E28A 3WNPA 1DWJM 3U8GA 1X8FA 1A5LC 4RXFA 2XP6A 3NOEA 2ALRA 5BWFA 5C55A 2NVDA 5E9AA 2DSZA 1MO0A 1XYMA 1K9FA 1D7JA 3N17A 3EEGA 5EY5A 1Q6DA 4G7EA 4J9JA 1SMAA 2JFEX 4UBPC 4ORMA 4AF0A 3WQ5A 3USBA 2Y6ZA 1LWHA 3BICA 2Z6IA 1KM2A 2CESA 4DQWA 5IM51 3ATYA 3OVRA 1P7TA 4URIA 3CAQA 2HWGA 4TVDA 3HM7A 2L2SA 1QOPA 3NPVA 3KXQA 2O9RA 4PMUA 4MB5A 1EYEA 1M65A 1RCOB 4EAYA 1RVGA 2GGHA 2OVLA 3R1ZA 5DMNA 1ZJBA 4TR9A 1JYVA 5HBFA 4D8AA 4XKYA 1VYRA 4WEVX 1OGBA 2Q6ZA 3MSGA 3MW7A 3N13A 1PX3A 1JCTA 5TIMA 3TYCA 3UZXA 3BE7A 2NSXA 4K36A 2A3EA 4L1WA 4FNPA 1V0KA 3IS4A 1E3ZA 4POCA 4UTWC 3PWAA 2VCAA 3GG1A 4OQVA 1KM4A 4BEQA 2PV2A 5DCEA 4M51A 4QE5A 3MI3A 3O8AA 4ZB2A 1GG0A 1B1YA 5EA9A 4M56A 2A7PA 3GVRA 4N9CA 1QHZA 3EOSA 5FI8A 3LMYA 4MNJA 3W1UA 4HT3A 3ZOAA 3W22A 2EPNA 3G2GA 3N6HA 4RLIA 4HN8A 3L4XA 1JCHB 3FAWA 4DXVA 1F6YA 3G18A 4D6CA 4EPBC 5I00A 1PTGA 1ML1A 3UA4A 4E2DA 3W86A 4ZOEA 1V79A 1F76A 4IM4A 4GIYA 4BCEA 3DFOA 5DIVA 2YOCA 3C0SA 3KL0A 3CGNA 2GUYA 2VO5A 3UY7A 2PUZA 1E9YB 2VXNA 4ICCX 1PZ1A 3DI0A 4C6CA 4GI4A 1N8WA 2ZX7A 4H7CA 2PTDA 4O15A 4TIMA 4UQDA 1RCXB 4BF9A 3PBMA 3HO8A 3URNA 4UTJA 1JIBA 1DIDA 4GIAA 2R1KA 3EZ4A 2BNJA 2E7FA 2NLIA 1JPDX 1KR0A 3FGCB 1G67A 1MSSA 3UWYA 1JDAA 1NMWA 1ZUAX 1K6AA 3AALA 5G5IA 2H9AA 4HNUA 1OFPA 2OXNA 4B4HA 2MANA 4GYJA 3QHMA 1XKYA 3LD5A 4QQ3A 5HPOA 1FRBA 3OB8A 2XVGA 4JAWA 2V68A 1NU5A 2GGIA 3W1AA 5C9UA 2PSNA 1C91A 1XDLA 3CIXA 3KRBA 2I5QA 3NPWA 1GQIA 2H9AB 1GCYA 4NXSA 1T6MA 5GPGA 2YLLA 3B4UA 5I03A 5B7YA 3V5FA 3TIMA 3PUEA 3RO6A 3NURA 5J6EA 1FWRA 3BCJA 2BV9A 4OTKA 3QGVA 2DQWA 3B97A 4A3QA 3WF4A 4ZQMA 4HIBA 1A4LA 3P84A 2W4XA 5CPMA 4BK9A 2FGLA 3ABQA 4D8LA 1B3XA 1R47A 4HNNA 4LAOA 3BCDA 4J4NA 4LH8A 3VIHA 4JDYA 3MUCA 3O1NA 5HUOA 4J3VA 1VP5A 3QR0A 5F2IA 5LIUX 4QDWA 3NVDA 2JGYA 1KBKA 3UQNA 2PDGA 2PODA 4A3YA 1BEUA 3NQ7A 4BZYA 1HL9A 3NL5A 1L1PA 3OG2A 9CGTA 2YXXA 1JF6A 2QZRA 2GWGA 1E4MM 4FR6A 2F6KA 4HBOA 3VU2A 4H9VA 4ECLA 2XZ7A 3UWUA 2X1UA 2VURA 3VAVA 3IAPA 2YL8A 3QEZA 2OYLA 3G8EA 4EWND 1A0DA 2GOKA 2X2YA 1CGYA 1EH9A 1FOBA 3OLDA 2RURA 1EWDA 2OX1A 1A0EA 2YCEA 1R87A 4Q4OA 4YHGA 5EFFA 3B8DA 2ZA2A 4PA8A 3SSJA 1J0IA 3WBYA 2CERA 5EGRA 3GTFA 4JTKA 3TC6A 3SIMA 1MRAA 2W0UA 3O5OA 5U7SA 1KFLA 4F66A 5HQMA 1E6PA 2ISFA 4OBTA 5AYXA 2WYSA 2XSXA 3UF9A 4A2RA 3F03K 1ISXA 1LORA 4KWWA 2B81A 2YA2A 1PVNA 2GGEA 5CGTA 4U86A 3K13A 3OEXA 5CH9A 4X63A 3DUGA 1TR9A 2GOUA 3VA8A 4DVOA 1R5YA 1E51A 3ARSA 2VFGA 1WAUA 3GZ3A 2YZ5A 4C6JA 3KS5A 2AQWA 1JZ5A 3B9NA 4C5YA 3DENA 1Z48A 4U4MA 3ZJKA 3LXBA 3U3HA 2NQZA 3STCA 1NM9A 4I8DA 3L5LA 4C6MA 1XC4A 3W02A 1EYMA 4KQNA 5E9XA 4LAVA 4IUOA 1EIBA 1C29A 1TUFA 5C7VA 3LB0A 4GC4A 3IUHA 3MHFA 2EKCA 4XZWA 4XV0A 2UBPC 4YLWA 3SQMA 4UDMA 2BY1A 1H60A 1YBQA 2Q09A 3DGBA 4PMRA 1UH4A 1SZEA 1XLHA 3GU2A 5LNWA 1J0ZA 3SO7A 2VR4A 3H22A 2BMBA 3HJEA 1MI3A 3HGRA 3O07A 2KX9A 1DXEA 3D46A 3W1TA 5XINA 2A21A 4XZMX 2WNQA 4XD4A 2QCCA 3E2VA 4NI3A 3GVWA 4LNYA 1HL2A 3JZEA 4Q8QA 4AWEA 4O1DA 1H61A 2G95A 5KINA 4AFYA 5BXPA 1GZ1A 2BVDA 4DRKA 1Q6LA 3FN9A 2WJDA 4AWUA 4JD4A 1NMVA 2RDWA 3EPOA 3UPBA 4Q4MA 2UY3A 2V5DA 4WUIA 3AHZA 4KFNA 1VCFA 4JYEA 1BHGA 1JNTA 3S9YA 3BURA 1OX4A 4BY3A 1GYNA 1KQYA 1YDYA 2WC4A 5D04C 4EPEC 1M9HA 1A5NC 2BOGX 3BZJA 3GBEA 3UQIA 4Y8FA 2HRWA 4LAYA 1GZJA 2D2HA 3FYYA 1UD6A 2FVLA 3XISA 2CLLA 1EB3A 1TIWA 3HPAA 2PDUA 1KTBA 3K4WA 1XCWA 4QNWA 3RLVA 3A22A 3OQ8A 5FF7A 4ITZA 3WEMA 3W1NA 2I1OA 3W6MA 1KCZA 4ACYA 4GQBA 2QCMA 1OCBA 1EYWA 1FWNA 5DX7A 1OF6A 4OHQA 4D9PA 4D6HA 1NWRA 1K3UA 2JK2A 5BU6A 3VNYA 2OWXA 3W70A 4ROQA 2A6NA 4NYUA 1XR2A 3L12A 2I14A 1E73M 2V38A 3VE7A 2J47A 4DELA 1RUSA 3LTSA 3WLSA 2FZNA 5M3WA 3URBA 3GFZA 1PZ0A 3S1UA 4L64A 3L67A 3OBKA 3TA9A 2PDCA 2XZ9A 2GFTA 4X22A 1ZHAA 3NPXA 1NF0A 1SYTA 5HTGA 2JF7A 1RQHA 4UCGA 2NXIA 1E6SM 1RXOB 4IMFA 4HJWA 4LANA 1Z42A 5CJMA 5LNUA 1UWRA 3NQVA 4LS0A 4ZXLA 1JGMA 1V03A 4TV5A 1UROA 3FXYA 2PS2A 3NQCA 3NQAA 3T40A 2ODOA 3WSUA 1A47A 2X42A 1XL9A 2ACSA 2H3DA 1NH6A 4M24A 1LCOA 1K8XA 3WD4A 3IUDA 5GNXA 4S39A 4LUTA 4M7TA 2OSXA 1JJKA 1QVBA 2WVVA 3VDAA 3EOLA 4H2HA 2SFPA 1GOMA 5BXSA 4J4OA 3EMQA 3R43A 5HQEA 1W9DM 1DJNA 3N25A 1C3FA 3ITTA 3MI6A 2VZOA 2QMJA 4R0XA 1ZJHA 4JTAA 2ALDA 5EMUA 4WDXA 4EKJA 3CEUA 5E0FA 1VS1A 3VDCA 3W85A 1JG9A 4OT7A 3LNMA 5A6SA 1F9CA 4O4WA 1GT8A 3NOYA 4LV9A 5FIPA 3HG5A 1OB0A 4QS5A 4XSLA 5FSDC 4A29A 3FJNA 1DVJA 4JIIX 1QPNA 4QSHA 2DSUA 2PWHA 5E5CA 3M5ZA 3NO1A 2OSWA 4DRMA 2J74A 4UTIA 4DO7A 3I6RA 3AMGA 3U2EA 5FEXA 2YLAA 4AIBA 4GGHA 5E6YA 3PRDA 4WSKA 4K6AA 2BY0A 2BASA 2DEPA 2VEKA 3QFWA 1E6RA 4M81A 3MBFA 1FWCC 4YWIA 1JYNA 1J4IA 4LC8A 3SUWA 1YNYA 2BXYA 4RR4A 3O0KA 4RNJA 3DFSA 1E71M 2CBVA 1Q4WA 4AY1A 3WK3A 4YMZA 5AECA 1W31A 3FK4A 4FOUA 3VC6A 5HINA 3R4IA 3AO0A 4FX7A 4C02B 3NAVA 4DIAA 5DT7A 4IIBA 4PTNA 3KRZA 4HK5A 5J5RA 3E6EA 3GG0A 1TMLA 1BGGA 4GIRA 1MEIA 2C0HA 2CC0A 3DFYA 2WBKA 2OQYA 1FUYA 5IHSA 1Q6RA 4E8DA 1RP9A 3APYA 4HNVA 1EKOA 3EKGA 1UQZA 1VPQA 4WGXA 4U28A 2JALA 4C1KA 4PN2A 3UJFA 4ZTYA 2OGYA 1WYIA 3U5UA 4GZJA 4UTKA 4MWAB 2ZZ2A 2GJXA 2P0IA 4JQ2A 4QJ3B 3WLRA 3E0VA 4GUJA 4JHZA 2D0HA 3PJWA 1I1WA 2OKTA 2OFNA 2R14A 1AZ1A 4IPJA 1WUFA 1OFAA 4F0SA 2QMKA 1J6PA 1TPFA 3DYOA 3O2LA 5KZMA 4WKHA 1SR0A 4GZEA 3QV6A 4XZ9A 4ZQRA 1NY1A 4XISA 5CCZA 1QMLA 2PV1A 3BLPX 3GK0A 1WDQA 2QF7A 4NG3A 3TW9A 3G22A 4O54A 4QP0A 4K7YA 1VFSA 4ZEPA 3I68A 1DWIM 3TC3A 4NJJA 3KAFA 4ZO8A 2ANUA 2O7QA 2GSEA 4S3DA 4ZSTA 3WMBA 4J27A 5C9RA 3C86A 3VI2A 2BX7A 4N9BA 4YWSA 2PU0A 1NIUA 3S3GA 4QTGA 1V3JA 3ZR6A 1XISA 5AC7A 3C2EA 2YL5A 4PTDA 1WQ5A 3VCRA 1O94A 3XINA 5LIXX 1KBBA 3FA3A 3P5YA 4UFMA 3B03A 4O4VA 5DXXA 2Y0FA 3FCPA 4PMOA 2EKGA 5GJMA 2NUWA 1HGYA 1OC7A 3LTPA 5K9CA 1QI2A 3GVVA 4NHVA 4QDMA 5AC8A 2BSLA 4JNYA 2CBUA 3USZA 2OU4A 3EX2A 3CB8A 4WVXA 3NZPA 4HYRA 3C8NA 1JZ6A 5CLWA 2DUXA 1HNYA 1J0HA 3AAMA 4XZNX 2GJNA 5FL0A 1VJZA 3QOKA 1PPIA 1QK2A 2VEPA 2CHNA 1FAPA 3HQNA 5HOSA 2EO7A 2PTXA 4E2VA 3KRUA 1OK6A 1UJQA 2VC7A 4HSNA 1P48A 3OZMA 3QQ0A 1W1TA 3UR5A 4GX8A 3GFYA 2BVTA 4HPNA 4PUKA 3T44A 1YNPA 2QDHA 2PE4A 2DFAA 3K1GA 3RNDA 5EBAA 1BYAA 5KTLA 2E1DA 5HULA 1FCVA 3MQTA 4CCZA 3YPIA 5LNVA 4WF7A 5D2VA 4FNQA 4ATDA 3G0XA 3CB3A 2JEQA 3RPTA 3N6JA 6PTDA 2QAFA 1UMYA 4J2PA 3LGGA 3L4UA 1G6CA 3CL8A 2PB1A 3G1SA 3OGSA 3ZZ1A 2J9XA 2CBIA 4HHPA 3W73A 4B5TA 2QYGA 3N12A 2DZWA 4LVGA 1HZYA 4NU7A 1YDOA 1XYAA 3UGVA 1JRCA 1I1XA 4GNVA 3LCLA 3CJPA 4B15A 1BKHA 4NZ3A 1W9BM 3LPOA 1F8IA 1P1MA 3ECQA 3TZNA 3LU2A 4ZSUA 4DRIA 4QLLA 3RIKA 1QO5A 2ZZ7A 2X09A 3CLMA 4R7OA 3CHCA 2PF0A 4LUIA 1G69A 2REQA 2A7RA 4J35A 1LOSA 5E70A 3GZAA 4ODOA 4KPLA 4U3CA 2JIEA 2GJRA 1AG1O 5DT5A 5I77A 1KGWA 5LYRA 3TCEA 3IJ9A 3QLDA 2FHCA 1ESWA 1S38A 1OK4A 3WF0A 4GY7A 2FZDA 3AIUA 4ADTA 1JI2A 1ZCCA 3UI6A 1KM3A 5A3HA 3VNJA 4ZFMA 1GOIA 4IXXA 4LOCA 1W3JA 3W72A 1FKWA 4C6NA 4OBSA 1J9YA 3CZ8A 1KCLA 4XK2A 3WFZA 3SUUA 3GC2A 3NR0A 3Q65A 1Q8JA 1H4PA 2QCNA 2YW3A 1EP1A 4Q4SA 4DHGA 3H26A 4Z2KA 4YTQA 5AC5A 4WDUA 3WH5A 4UFKA 4IFKB 2I7GA 1QHPA 3WQDA 1JPHA 3H4XA 3H4GA 1UG6A 1TSIA 4LB3A 3CZJA 3UNDA 1UWQA 1BG4A 3W7NA 4Q6XA 1W54A 1OFBA 1H1ZA 1Y65A 2P3EA 3MJYA 2GVJA 2Y7EA 2ZUUA 3IV3A 4M5PA 2NQLA 4KEMA 2WMHA 2I5IA 5BXJA 4PTWA 1EA0A 1NSGA 3MMDA 4AIEA 3ANUA 5T26A 2AWGA 1Y5VA 3W7JA 3SW6A 1AVAA 1BTCA 4F48A 2BS9A 4DBEA 3NQ2A 1ITUA 2YCLA 3SCNA 3WQFA 4CD8A 2PAJA 2CITA 4C1LA 1EJXC 4MYXA 4RNFA 3N2BA 1XSIA 5F1UA 3EWWA 2GQ9A 3AMKA 5A2AA 1W5OA 1TRIA 2PTZA 3STEA 3G0SA 1NDZA 2G8ZA 2PWUA 2FKEA 4AVNA 2GUUA 1K7XA 1NOFA 3DX5A 4H8NA 3BCFA 2XJ7A 1PDYA 2PDWA 4RDYA 2PEVA 4ADUA 3NIYA 1W9XA 3B8UA 3NVTA 3CUXA 3RO8A 4TQTA 2CCRA 4B9ZA 3Q2DA 1CGUA 3ZT5A 1FWWA 3LQGA 3L2LA 3KCEA 4ZXOA 3KDNA 1EBHA 4AC7C 5CPNA 1VBJA 5H1WA 2E68A 4CU7A 1IZKA 4GIEA 4UTUA 2DH2A 5D8ZA 2ZX9A 1E70M 4QR6A 1PKYA 1E9LA 4LRTA 4H9YA 3N3MA 4XAZA 3R79A 4LTSA 3W53A 2WJEA 1GJWA 1MUWA 4QT3A 3VGHA 3AS2A 3R58A 3FYPA 4C6EA 2RFGA 4F0KA 1ISWA 3BANA 1WKDA 1GPWA 1T8XA 2DUAA 1CCWB 2WWDA 3EA1A 3ISIX 2XSBA 3MU7A 1WA3A 2FVMA 2J8FA 3W71A 2E25A 1REQB 3GB6A 1E4NA 4YCPA 2BXVA 2G50A 3GIYA 1GGOA 2HPIA 3QV7A 4O57A 4V15A 2QCEA 1OC5A 3S46A 4ES4A 4N4PA 4DBUA 2PPGA 2XGBA 4CVWA 3RPMA 3H2CA 1FWIC 3GNRA 2VVSA 4IJBA 1I9CB 1N2VA 2WOQA 2V5LA 3CLWA 3MP3A 2CLOA 4NJGA 1IX5A 4DEFA 4CQ9A 3VX1A 1NOWA 4MB4A 3W25A 2WM1A 2HISA 5LA2A 5FF3A 2WK2A 1HKIA 3WQWA 4UNIA 1AFSA 3GXMA 3TR2A 1P5BA 2JEPA 3LK6A 5BOEA 3KTSA 1UWIA 3ZLHA 3TH6A 3QHNA 2HCVA 2EG8A 4IICA 3CUZA 2GSHA 4IQDA 1AH3A 3E0WA 4UQAA 3SGGA 1VJIA 3N14A 1US0A 3KLLA 4YIWA 4J28A 1KQZA 3WLOA 5C9XA 4OOUA 2WSYA 1BD0A 4DX3A 2C19A 4ML9A 2CLEA 1JD9A 4JIRA 2XISA 4L6DA 2Y24A 3IK4A 4BKNA 2Z4GA 5C54A 1IEWA 3N2CA 4O16A 4UQCA 1TMHA 3S83A 3WQEA 3SFKA 4X2PA 4X9YA 3MUXA 3Q94A 3UA3A 2DT0A 1JYXA 3AOFA 3SGZA 5D05A 1UOKA 3QQWA 3R11A 5DMMA 2WAGA 3WJYA 1VB9A 4C6OA 4G50A 4F4RA 3B3DA 4G56A 2ZBTA 3L4VA 5FF2A 1XG4A 1ZENA 1QT1A 2YPIA 1GOOA 3L5MA 2VFIA 3ES7A 4EPDC 4JTIA 3UZYA 1Q6QA 3B04A 5G4EA 1B54A 1UR1A 1LBMA 1NEYA 1W3HA 3PF3A 2ZZ5A 1TZ7A 2VMFA 3TC5A 2QUVA 3VZYA 3MB9A 5A6JA 1LJYA 1R2SA 3OBAA 1XH1A 4GYFA 2WVVB 4FZIA 3E02A 3H70A 1M1BA 4LYPA 4A2SA 4F40A 5G2IA 1N8IA 1D7KA 1GORA 1NDWA 2E5DA 4L80A 1X98A 1H09A 2PGEA 4LB4A 2VGGA 4CNTA 2P76A 1OIFA 4LFYA 3KBWA 1B3WA 3GX9A 4U33A 4FOJA 3EA3A 3IJ6A 4U5KA 1BVZA 3S2JA 4DNHA 3EIPA 1J79A 3RMEA 1XSJA 3OQEA 6REQB 4WGHA 4GIVA 3CQKA 1F4HA 3H2EA 2RDTA 3VMNA 2ZDRA 2OQHA 1MWOA 4QLKA 1XW8A 4PB5A 1UKTA 1H1NA 2PC8A 5AYZA 2VUYA 2QS8A 1UQYA 4W4QA 3GLCA 1H2JA 3ABOA 5AHEA 5HWBA 1UPPA 2DG3A 1XQKA 1H50A 4MWAD 1SJAA 3T4CA 2ZQSA 4IG2B 2WZEA 3DFTA 4Z1CA 1WOBA 4WR3A 1GTHA 2O4QA 3ZT6A 1OJXA 4HTBA 3ARUA 1E44A 1QPRA 2WC3A 2CKSA 2GVLA 3GE7A 4ZQPA 1O66A 3T8QA 4PMNA 2MLXA 3FSUA 3PTQA 4O11A 1ADDA 1HIZA 1XJBA 3TSMA 3A5VA 7REQB 4KGJA 1NARA 4KKXA 2E4TA 3BG3A 4NI8A 5IOBA 2ATMA 3UPWA 1VYPX 4XZLX 3PR9A 3SGUA 2GGJA 2NUYA 3BH4A 2FTPA 5D2YA 3W81A 3NJ3A 2NXGA 1I2RA 3K5XA 2XN1A 2VX4A 3LRLA 2WPGA 2BVYA 1UUQA 3V4BA 3ZFHA 1ISZA 1BYDA 5C70A 2ASHA 2C79A 1B30A 3NRKA 3LOTA 2WQPA 3DAQA 3R25A 2FB3A 3FJ4A 4HTYA 5CLTA 2ZUVA 1VQTA 1H7NA 4HA4A 1TX0A 4HBEA 1XLLA 4IGSA 1G4EA 4D1JA 3CM4A 2DPEA 1UBPC 2A3BA 3M7SA 3MT1A 5I09A 2J7CA 2Y5JA 4B2DA 1YW1A 4NNAA 3B9DA 1KXVA 5M17A 3W01A 2BOEX 3O6DA 4JQAA 1KRCC 3UBPC 3TEVA 3IVUA 3GTYX 1O1HA 4DT4A 1IT8A 3TOPA 4NAFB 3O05A 3GDBA 4HPHA 3ZO9A 2ZIDA 3WNNA 1VR6A 1SZNA 1YDNA 4MKNA 1K1DA 1FH7A 4FI4A 2QDEA 1DPMA 1N7KA 1T40A 5FAGA 5CZSA 2WB5A 3FS2A 4JFUA 4EXBA 3BC9A 4RNIA 1YPFA 1RQBA 3PZIA 1K9TA 1SM9A 2E6DA 3CZEA 4LGXA 1QI5A 1X6UA 2TODA 1A4MA 1RH9A 3GO2A 2X1IA 2D73A 4P8WA 4J4KA 3UETA 2I57A 3PFMA 2X1TA 3LHZA 4LU0A 1HL8A 3W2NA 1PYFA 1KM6A 4YTRA 4NRSA 5ABFA 1B6CA 2BY2A 3UZWA 2UV8G 4UR7A 4GJ1A 3R10A 3EGJA 4H2CA 1EHAA 4JN8A 4PBGA 2C16A 1ENUA 1FDZA 3PSWA 5A8GA 1RPKA 3Q37A 3WK0A 1YYAA 1XGDA 3TJ4A 3NSMA 2QPXA 4M8UA 1QW8A 3ITVA 3M0YA 5ABHA 4DRJA 2XM1A 1DIKA 2PD9A 1FHDA 3WF1A 1EJSC 4HK6A 1ZFJA 4JTJA 1S5NA 1LWIA 3ZVHA 1PCKA 1EEPA 1XX1A 1O6IA 1MQPA 2DZSA 3HG4A 3M44A 1M7PA 3HB9A 5HDRA 4AHPA 1KFEA 1BGAA 1DXIA 1JDDA 2JKPA 4TX9A 3WD0A 1ZZMA 2DW7A 1V7AA 4WZHA 3GVGA 1K9DA 3THDA 3QKZA 1BKSA 2DZUA 5JH2A 1FKIA 4MGVA 2WANA 1KW1A 1FKSA 5T9BG 2Q71A 1F07A 3ZWTA 1UWAA 1OG0A 3LI1A 3E2QA 1J2BA 4XZIA 2R24A 4PMYA 3AMLA 3OA3A 5BRBA 1UP2A 8XIAA 2BBFA 1SR9A 2A85A 4EIVA 1HKKA 4JFSA 3AYRA 1V0NA 1S2TA 2PRHA 3O7UA 3FKRA 1UKSA 1UD3A 3C0QA 3I3BA 1C9DA 3O5EA 1TWZA 2VOMA 5EMMA 4C1NA 1YRRA 4O8RA 4NASA 1ZBKA 5JMUA 1DWHM 4GACA 5AVNA 1JGIA 1FDYA 3BTNA 3BLLA 3I6EA 4BWLC 4JPGA 3QTGA 1L9WA 1XLAA 1EGVA 3WDQA 1Q6HA 2REQB 2Y7FA 3NXLA 1R9ZA 4XUGA 3W7IA 3W76A 2FGZA 1SFTA 3W0KA 3CNYA 1QWGA 3SFWA 5CEWA 1HO4A 2ACQA 4V2XA 1X1OA 2FIQA 1R3RA 3BLKA 3CGTA 4JHMA 4H6RA 3BW2A 1S39A 1BWLA 2VCCA 1P7TB 5CSYA 3QY6A 4PUEA 3VYLA 4EK7A 3WCZA 4K37A 3P6LA 3RM4A 2LGOA 3L5AA 4PL2A 1OFQA 1PHQA 1UZ4A 4XKMA 3VFLA 2DVUA 3LCIA 1R0MA 4ADSA 3TOYA 4HNOA 3ID7A 2JGQA 3WLTA 1VFHA 1EOKA 3GDTA 1JR1A 4BHYA 3U2CA 4PUMA 5AOUA 2G97A 3W27A 3TFCA 4IPIA 1HFBA 3WBXA 5E0KA 3ICJA 1C92A 2POZA 4Y9MA 4M1RA 3G1AA 2ZQVA 1EQPA 1FXPA 1M3UA 2GDUA 1LYXA 4CD7A 3VZXA 3A3HA 1Q6FA 4JFVA 4W7VA 3VMOA 2BODX 4GABA 4N4QA 4JR5A 3V75A 1UC5A 1JUKA 5I98A 5I02A 3N4FA 1R9HA 1IZCA 4ZE5A 4AUBA 3NL2A 1H5VA 1POKA 5CG7A 4E6MA 2F84A 2PTYA 2POTA 3B9OA 2J7DA 1GKPA 3GR4A 5LNRA 5AYBA 2ZOXA 4A21A 2Z2BA 1QCWA 1LUCA 5HK4A 1GVYA 3QR3A 1IXOA 1JRBA 1HX0A 4PRTA 3RN6A 5A8MA 4MFEA 4LUTB 1EPVA 1OX5A 3ANYA 2VP8A 3NNTA 3WN6A 1KBJA 4FPSA 2ZUSA 2PBOA 3EX6A 3HFTA 4H3DA 5I07A 2DZTA 2NX1A 1LG2A 3HPXA 4BEUA 1D7FA 3PZUA 3W7CA 4GUGA 3QGKC 1TWWA 1U1JA 4NUWA 4Z17A 3T2PA 3UJRA 4KCWA 1KA9F 2V3DA 2OGJA 3RG6A 3OHIA 2OODA 3WUFA 1BYCA 3T78A 1TVLA 1OC6A 1PHWA 1HJXA 1TPC1 3OG3A 4HN4A 5D9OA 1PBGA 1KXHA 4DAIA 2XIIA 4KWUA 2Z1KA 3AQUA 1VIZA 1W1IE 4RPQA 2I9UA 1TVPA 1F40A 3CQ0A 4IISA 4MSSA 3GKAA 4FO4A 1PWMA 1GG1A 1V0LA 1IEXA 2YDAA 4QQUA 4DXXA 3S1GA 4NZCA 3SN1A 1KNWA 5H6HA 4G9PA 3TJXA 1I8JA 4C7DA 3QRHA 2EXOA 4FIRA 1EQ3A 1UPMB 5HMSA 4EACA 2UY4A 1A5MC 4HZ6A 1GVQA 1KRMA 3NI6A 1EBGA 3AHVA 2XGZA 1UZHA 4AZ5A 3U0HA 4I5RA 2QIWA 2Z7KA 3N1AA 4DIPA 4OV4A 4YXGA 5DQPA 1E0UA 1V0MA 2FFIA 4DYEA 3GHUA 5A8OA 1U5HA 2ISDA 2XH4A 3L68A 2PA6A 3WG6A 1AQHA 1E43A 3NEVA 3NZGA 2GUBA 3OVQA 2XH7A 1TCMA 1FKXA 2JQXA 3MSRA 1UZDA 4IP7A 3UPMA 3CAKA 1HP5A 3CS2A 1XLFA 5IBXC 4HU3A 1DJIA 4RDVA 3CMFA 2YCIX 2CBJA 1BSIA 5BROA 1MXDA 1CGTA 1S3TC 5ABTA 1AQFA 4PODA 3QW4B 2YSWA 3O3RA 3RAOA 4EF8A 4XQ6A 5BMWA 4CU6A 4MFDA 3H2OA 3TE9A 4PUDA 4X9SA 3CV2A 1I2NA 5TAOA 4NX5A 4P7QA 1NQKA 4K8EA 3OBEA 5D8WA 3M0VA 1JPKA 2B7OA 3W83A 2PDPA 1OHLA 3TYDA 3N15A 3SIZA 3BAWA 4UR8A 4A8NA 1I60A 1CGVA 2TPSA 1WKYA 3CO4A 1UIPA 1D3GA 1NVMA 3G3DA 5G1TA 5H91A 4MM1A 2DT2A 4Z42C 3WNKA 1G94A 2MUCA 3UWQA 2OZ8A 1G0CA 2O4MA 3OPSA 2DSVA 2R1LA 3GTHA 3TN5A 1Y7VA 2Y2WA 3AS3A 1P0DA 4L4PA 3SY1A 2XIQA 3DFPA 3ZWSA 3F5JA 5G2HA 1UH2A 1JXKA 3QY8A 3VKKA 1CGWA 1KWGA 2CHOA 2GPTA 2INFA 3W07A 4I3GA 4U31A 5E93A 3BG5A 3GVQA 4H9TA 4KIRA 3VGDA 2YCJA 2VVNA 1H7RA 3AIBA 5A95A 1A5UA 2FMNA 2QCDA 3TSBA 4FXFA 1DBTA 3POHA 5CBBA 1GZGA 1R3WA 3ZJ7A 4O28A 1RA5A 3I3EA 4TMBA 3WQ8A 1UR9A 1A50A 3SSZA 3WH6A 3MCNA 1XIIA 3QR1A 2QULA 2VEGA 3M0KA 5BWAA 4Q33A 5D2XA 1FVPA 3PJTA 1J6YA 3KZSA 1PTDA 3VIFA 3OVGA 4NIRA 1VRXA 2VGBA 1FXQA 4NNBA 4UTHA 4LRSA 1D6OA 3REQB 3HPSA 3LPPA 5HNNA 1SW3A 1FWTA 1W1A1 2BP1A 1W26A 5CZ0A 1YADA 1TUXA 2BHUA 2PWGA 3CXOA 1K8ZA 3LCHA 4O17A 1M68A 1ECEA 4QCFA 4XBKA 2VD8A 2XP3A 2QUUA 4JY9A 1LG1A 3FA5A 1F73A 5LZLA 3PA7A 4JS3A 2V63A 5B80A 4UUIA 1P6WA 4LAUA 4ATWA 2OPJA 3H53A 2J25A 1J12A 1RALA 3TWBA 3LCFA 2C91A 3MHGA 3HQPA 3D47A 3T0DA 1EO5A 3URAA 3GIQA 1M6JA 1IE7C 3KVMA 2QDDA 1XIJA 1QNPA 3DBNA 3GUWA 3U7BA 3TTOA 5FJTA 3TZFA 4LBRA 5KITA 3BGJA 2G3IA 4MY9A 5HNRA 3P93A 1ZTVA 3G1FA 1WKEA 3COTA 2PWFA 2QJIA 3VNDA 1YTKA 2J7BA 3BAYA 7ENLA 4PCSA 4EP8C 3EBVA 1G4PA 2ZVRA 4KWSA 3VD5A 2PD5A 1E72M 4E3TA 5IXEA 4IX0A 4E4PA 4G2DA 1R3QA 4RV3A 2ZUNA 1KGXA 3HTWA 1S1RA 4ZQCA 1B9BA 1UUOA 2PCQA 4JXCA 4HKPA 3U2ZA 4ZTXA 3GXPA 5DIUA 4CN1A 1WZLA 2EJAA 1W9VA 3FVMA 4CNUA 1G01A 3E5BA 3H6OA 2PP1A 3ITCA 5DLCA 1UZ1A 3GC4A 3FYOA 4FAPA 3QFEA 1YQ2A 1FKLA 3WBWA 5HWJA 1KD0A 4QAWA 1UH3A 1RCQA 1TE6A 1EC7A 3DDMA 4WSJA 1J4EA 2RUCA 2D69A 4AY7A 1PX8A 3GUGA 4DXKA 3HGOA 2NUXA 2CLFA 3EEZA 4IIEA 4YN5A 2X05A 1KC7A 4GKLA 1IT0A 4KWOA 1SUXA 2PWDA 4O1FA 4YCOA 4BF8A 3WLLA 5C2GA 3FNDA 5FJRA 4XZHA 2VUNA 4JTEA 5LSMA 3ZLFA 3P7YA 2Y4SA 1EDQA 5JQ9A 3ZQ9A 2FQIA 2GDVA 2HQAA 3UI5A 2ZE3A 4F2BA 1YATA 4FX6M 4BI7A 3W7LA 5AHLA 3KHDA 4M3PA 1EJWC 3UERA 3O0FA 3WMCA 4FEZA 3K4DA 3WH7A 2XP9A 2J6VA 3LYEA 4C65A 1CLXA 3PNUA 1ZL1A 4U84A 4IPXA 1WDWA 1W8GA 4RE2A 4ERIA 4LF2A 4AZCB 1YLVA 1U5VA 5AN7A 2ZUMA 2ONEA 4GY1A 4MOZA 2IPJA 4DUWA 8XIMA 1KRBC 3EMCA 4RXGA 1KO0A 3PN8A 1Y5WA 3QV9A 3M5XA 2ZDSA 3GNDA 3E0LA 2WJZA 3SRDA 2DJXA 4OV9A 3W75A 3RU8X 1O95A 3CUIA 3ZVHB 4Y8EA 3UEQA 3FOKA 1LM1A 1PO9A 2INZA 5I3DA 1W91A 1GKRA 2J9YA 4ZPVR 4JTCA 4PFHA 2IXUA 5DCDA 4JFWA 3OLIA 4HMDA 2YR1A 1OGSA 2R1MA 2I9EA 1JUBA 1XLJA 3GM8A 3QN3A 2UWFA 3HA1A 3OYXA 3G1YA 3LDVA 3NTYA 2G37A 1XYCA 1WDDA 4EXQA 1UWUA 2AMXA 3R7MA 3KVKA 4GLEA 1SW0A 7REQA 2G4FA 5ABGA 5JBEA 3SCQA 2YB1A 4I6VA 4LVDA 2AGTA 2Z0IA 4A3HA 3EY6A 2HTMA 3QSTA 3CZKA 4B5NA 2WHMA 3C5QA 1C90A 5C9ZA 2WM0A 1WZKA 4LUSA 2VENA 2EPOA 1A5SA 2GYIA 3L4WA 3IARA 4MJ4A 4L6OA 2XM2A 1EOMA 2G41A 3VGEA 5T91A 5C6MA 3O6AA 4ZPTR 3I4EA 4NAFA 2E9LA 3LCWA 1KV8A 2A6LA 2WJFA 3TP4A 2OT1A 3VD9A 3WNOA 1GOQA 1MW0A 4IJRA 2ZRZA 1R2TA 5DO2A 4UFJA 3SBFA 2ZXQA 4M7SA 2AMGA 3ALGA 2JKEA 3K30A 4DAFA 4HZ7A 3P3BA 1EQCA 3ARPA 3VIJA 4JX6A 1EJRC 2QNEA 3CQHA 1QASA 2WKJA 2QGYA 5HKGA 2G0WA 3M0LA 5TNVA 1XV8A 2HK1A 2QJJA 2NT0A 3FJLA 3IJQA 3TFXA 3N3TA 4CNPA 3M9YA 1ONWA 3L21A 3LPGA 2WZIA 5ECUA 2OWCA 3KP0A 2VDIA 4HU4A 1XPGA 2GLKA 4HNLA 4KCUA 4GBDA 3KP1A 3RX2A 2XPAA 1UJPA 1AZ2A 1MNZA 2PPNA 4MYAA 3NGFA 3CHEA 3FW6A 1YDVA 3N4EA 1P6BA 1Q6CA 1UA7A 2OFJA 3VOIA 4H8VA 5HANA 1CEOA 4QJ5B 3ARQA 5I3GA 4B3LA 3VAWA 1VBGA 3GW0A 3SURA 2PBGA 5CZTA 4IQJA 2NW0A 1TJRA 2GZXA 3MCMA 2IQTA 1IXQA 3O5FA 3HIJA 1G4SA 3QVQA 5F2LA 4R34A 2HS8A 3SJNA 1N8FA 3PBGA 5KZDA 1XYLA 3GHRA 5HPCA 4GG9A 3RUBL 2QPUA 3PWGA 1PZ2A 3N6QA 3WLMA 1QO2A 3QHOA 3TAOA 3LBCA 1O60A 3LPFA 3AS0A 4O53A 4GVGA 1VJSA 2X7WA 1FWHC 4EX4A 2XFFA 4OKDA 4HCHA 3PTMA 1REQA 6REQA 1W3KA 3OO2A 2NX9A 4MADA 3RMJA 4O2TA 3MUIA 3S2MA 3A5FA 3TW7A 3MKCA 1CZ1A 1AJZA 4TMCA 3SI9A 4UFHA 4REQA 3QZEA 3SADA 2I56A 2VDGA 3UZZA 2D0GA 4KFOA 4C60A 3IHZA 1BWKA 2W91A 5HXMA 2J8TA 1TB3A 4LQ1A 5D4YA 2HNHA 3G5EA 1B4KA 3CWOX 3P67A 4XAKA 2DIKA 4LEFA 1XRSA 1NTHA 2WZTA 3UWWA 1JCNA 3QF0A 4IP5A 4OVXA 3F4VA 2H8ZA 2WCSA 4GVIA 1R7OA 3W2UA 2R82A 3VGBA 2FTYA 1OGGA 3DESA 3VUPA 3SUTA 3W87A 1ZGDA 4BFAA 3APGA 1FKRA 3S9ZA 4PE8A 1SMDA 2HMCA 2OWWA 4V1YA 3PZGA 3TR9A 2HVNA 2EPHA 3VIPA 1LWJA 1XCXA 2E6FA 3O5LA 3LGEA 1VLIA 1RK6A 3W6YA 2QAPA 3C0JA 3MZ2A 2FZBA 1PEZA 2D1ZA 4FALA 4ODKA 2QT3A 1OFEA 3VIGA 1XS2A 2QGHA 5HJYA 1GONA 5I06A 1H0IA 3SEPA 1XIMA 2FDSA 3UZ5A 2B31A 2NWSA 1LZOA 5AHIA 2OTDA 3WKZA 1XH0A 3DHPA 4L9YA 1UR0A 1WUEA 1Q13A 3H54A 4KERA 2WNWA 3N9RA 3HBLA 3VKCA 4DWSC 3ZM8A 1FP8A 3IKDA 4HU0A 3QSRA 2Q8ZA 4LSBA 3UZJA 3S6TA 5M5DA 4CGTA 2ZXDA 3C3UA 4IUGA 3CV6A 3IJIA 2D3LA 3PULA 3AWNA 6A3HA 1ZAJA 1AW1A 3WF2A 4D6GA 1T41A 3SJ3A 1TVNA 1EWEA 3L0NA 5G1MA 1MXGA 5LGXA 1ZLPA 5A6LA 3PY2A 2OQLA 2G3JA 2ZFAA 1KTNA 2ZZ6A 4C6KA 2FH8A 1TPWA 3BGGA 1LBLA 3P62A 4DF1A 3RCMA 5GNYA 2W62A 5M03A 5CJNA 4TXEA 4B16A 2X0SA 1CPUA 1BWVA 1A80A 3O5PA 4PL1A 3A12A 1HKMA 3BSHA 3Q4DA 2GVEA 5DXYA 3W1LA 1SU5A 4H8UA 3DG7A 5A6AA 5BNKA 3WIJA 3JU2A 1P0EA 2LKNA 3LZ3A 4YVXA 3V35A 4GFSA 5HR6A 5REQB 3CUJA 3THQA 2TRSA 3PSVA 2RUSA 3SR7A 3TUUA 3NSXA 3UJSA 1VYSX 4GMEA 1LBFA 3LHVA 3THUA 4I8YA 2Z28A 2Q3RA 4B3KA 3RRAA 1FWDC 3MWCA 4ZO6A 3IIZA 4CCCA 5I5RA 2QV5A 1DKWA 4GA8A 3S2NA 1WZAA 1OG6A 4YNGA 3PBUA 5B7ZA 1JDFA 3MO4A 4MIMA 2YKKA 4PB4A 4GUHA 3EWYA 5GJNA 1PS9A 4FXSA 2F7FA 4NRRA 1XH2A 3CGMA 1XIDA 3GXFA 4GYPA 1TTPA 1C7TA 3JZUA 4KW2A 2EPMX 3LLXA 1IWAA 4I6KA 3CIVA 7PTDA 3OU8A 2M1IA 3NA8A 1ROUA 1SZFA 2P88A 1LLZA 5TF0A 2Q8XA 3RX3A 1D3HA 1L8NA 3NXFA 5A8NA 3G1VA 4WRHA 2NSOA 3WD3A 1EL3A 2E6YA 1QR7A 1R9YA 4QROA 3MP4A 2P0OA 4ZB0A 3KVLA 4AX6A 1S1PA 3PBWA 4O10A 3S0CA 1OX6A 4NVTA 3C2YA 4H00A 3ZXWA 4FLOA 3W82A 1CXHA 3DH7A 1V6TA 3D3AA 1YNQA 3BGAA 4XB3A 6XIMA 1TG7A 3BLOA 1QJWA 1FHVA 3GXTA 3K46A 1GW9A 5DN1A 4P7LA 4UNLA 1RAKA 1NP2A 1EHNA 2KI3A 4YPJA 3NZ1A 1YIXA 4CN6A 3F4CA 3TN3A 4CNOA 1ZNNA 3V5CA 4QITA 4M80A 3D5HA 3W2LA 2Y88A 1VH7A 4HVXA 1O68A 2XDFA 3A47A 1DE6A 5K3VA 3CL6A 2GL5A 3AIWA 3WQ6A 2XG9A 2E1WA 4M0XA 1T5AA 1NFBA 4A8IA 3A21A 2FKPA 2V2HA 4HSOA 1E40A 3KAGA 3EOUA 4JNMA 4AD5A 3L0KA 1NFGA 4LX4A 3NDYA 4L1XA 1QRQA 4FNUA 3AMDA 4NZFA 3UG5A 1FY6A 1Z6KA 4Q8WA 4KBXA 5JIWA 3L65A 2D23A 3AI0A 2QJNA 2J9ZA 5AC6A 4OECA 1QPOA 1Y0OA 5HW6A 4FR1A 2CZVA 4NZ1A 1R86A 3KL5A 5HNTA 4XAGA 2VFEA 1W1ZA 2JBMA 3MZNA 3SRHA 3CASA 1XINA 1XPYA 1QNVA 4V27A 4FP1A 1JD7A 3TMQA 3MMUA 1KKOA 1YX1A 2J66A 4LV4A 1OM0A 3SUSA 2Z6JA 1KXTA 3QLLA 3O63A 5D37A 3VNKA 3DGRA 1B3OA 4GI9A 2PDNA 1X96A 2PLJA 4GH1A 2EPKX 1LF1A 5JH8A 5C5YA 3AHYA 2J24A 4NZJA 1W0MA 4TX6A 1B31A 1O4UA 4BQ5A 5CSRA 2D2JA 4GX9A 3V5OA 1JI1A 3VCNA 4G8TA 4E5TA 5HMFA 1XRVA 1GUVA 4PSRA 4PFMA 2PN0A 1IT7A 1ITQA 1BQCA 4GI8A 1EUNA 1DHPA 2PURA 8A3HA 4GVFA 3IGSA 2QCHA 2QCDB 3P80A 2FHFA 3DEQA 3GXNA 4MZ8A 4R7JA 3TYBA 5F4WA 3CZLA 1D3CA 1P6CA 4KRZA 4PB3A 4JEQA 2WBGA 3BJSA 4KWVA 3PTDA 3TV8A 1AK5A 1HGWA 3DHFA 1G7VA 3E74A 1U2YA 5A5WA 2GGGA 3JR2A 3DYMA 1DV7A 3PPCA 3RK8A 4TYOA 4LAMA 2DIJA 4XVDA 3LM7A 4P61A 2GK1A 3VIKA 3SY8A 2DZPA 3R0KA 4CN4A 5GNZA 1DJXA 1W56A 4G1NA 5DY3A 3W7QA 3P2VA 1HKVA 1R30A 3KS6A 4CD5A 9XIAA 4MSPA 4ZPWR 5I2UA 2WLYA 4PUWA 4UWMA 3VNLA 1NOUA 4IP4A 3XIMA 3NDZA 3PP7A 1V4YA 2F2KA 2VC5A 2PP0A 1CBGA 1THFD 3HMCA 1PV8A 1F6KA 4E2OA 1O7AA 2C71A 1GQLA 2TYSA 5JBDA 2DSWA 4K38A 3IIXA 4A8LA 3LMZA 1IEQA 2H6RA 3W2MA 3IEBA 4NP7A 3FY1A 3UYCA 1RPXA 5J04A 7ODCA 5F4SA 2A4AA 5DITA 1FHUA 2P5NA 2ABBA 4WSHA 5I24A 4DZ5A 3T42A 4KCTA 1DWAM 1BL4A 4D6JA 5LA1A 3LCXA 1I2QA 1VEMA 3GDRA 4MUZA 1JCXA 4AXNA 1N1AA 1GW1A 3KBSA 2PCEA 1VFFA 4I7UA 1XIEA 4KEUA 3BAKA 3UVAA 4JFJA 4DNMA 5DRCA 1QDSA 3M6YA 4TNSA 1VHCA 4JICA 4QEHA 4QS6A 5EMLA 5HR7A 2ZRVA 2NV1A 2PDIA 1U30A 2B5UB 2RSEA 3MKVA 2F2DA 1XYZA 4DWSB 3IVTA 3RM9A <