2YBUA

Crystal structure of human acidic chitinase in complex with bisdionin f
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
376
structure length
376
Chain Sequence
AYQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analyzing airway inflammation with chemical biology: dissection of acidic mammalian chitinase function with a selective drug-like inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords ACIDIC MAMMALIAN CHITINASE
total genus 129
structure length 376
sequence length 376
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2011-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ybuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2ybuA01
5CPTA 2XYLA 2VZOA 3GNRA 4JFSA 4UQAA 3OGVA 4KRTA 1MFUA 2WB5A 1V0KA 1PPIA 1OD8A 4P8XA 3OGRA 5A3HA 1WKYA 1HJVA 2YBUA 1GOKA 3L4WA 3T08A 5ABHA 5KZ6A 2D24A 3M7SA 1B3XA 1E6NA 1H3GA 1E6QM 2YDSA 3MUZ1 1GOOA 3SURA 3RJYA 4CUCA 3VD7A 2WVUA 1NQ6A 2PWFA 5CJ5A 2OSWA 3UG4A 3L4YA 1JFXA 3VTRA 1B2YA 2DIJA 2UY3A 1J18A 1QNPA 3N9KA 1JAKA 1CXKA 2FDMA 2MANA 2YOCA 3A3HA 3NUKA 4X9YA 3K46A 3AS2A 5DF0A 3WD0A 2VUYA 1WNOA 1J0KA 4U5IA 5BROA 4P8VA 3L4XA 3SCWA 1BGAA 3WDRA 2WC7A 1JIBA 1CXLA 1X6NA 3VD4A 1ECEA 2BHYA 5LA0A 1J12A 1G01A 1F4HA 4WLCA 4H8HA 3AMCA 4PMDA 2ZOXA 1LQ0A 1V0MA 3AHYA 3CZ8A 4CGTA 4Z2IA 1E43A 2E8ZA 2WC4A 3VO0A 3OG2A 3PZQA 1JZ5A 5AYBA 1UOKA 3QOKA 1GHSA 1ISYA 2W61A 2C8NA 2CKRA 5A1AA 4Z2HA 4OOUA 5FKYA 3VDAA 3UR7A 3WDJA 3BMWA 1M04A 1PAMA 1QI3A 2XGIA 2VC9A 4Q22A 3ZJ7A 3G6MA 3AI0A 3WF1A 1W3JA 4QLJA 2YA1A 2WW5A 1LJYA 1FP9A 2ZUSA 1FH8A 1VFMA 2ZUNA 5BRQA 3WEMA 4CN6A 5ECUA 1QW9A 4CU6A 1KWGA 4CD4A 4GPNA 4OOZA 1PJ9A 3W29A 3VIIA 1BYBA 5FL0A 1TA3B 1U30A 1B3YA 1WZKA 3RCNA 3GYCA 3OLIA 4GI8A 2Q8XA 4J27A 4F9DA 3T0DA 5D8ZA 2VZVA 2UY4A 4DUVA 1H11A 1KCKA 5JUVA 2XG9A 1M01A 1J11A 3WNKA 7TAAA 3SUWA 1QVBA 4HTYA 4BQ3A 2PWEA 2VQTA 1B3WA 2DSKA 1E0XA 3WFLA 1XYZA 5LA1A 4AYSA 4PMYA 2J74A 4TX8A 3THDA 1UD3A 1V3IA 4RE2A 3TOPA 1B3VA 1JYXA 4F66A 1OBAA 4AIUA 2WHLA 2W91A 1UZ4A 1BF2A 1VFFA 5JIWA 2ZX6A 3CGTA 1DWHM 3AHTA 1QNOA 3ZT7A 3FHQA 3N15A 4UOQA 5JBDA 2CBIA 3PTKA 1V0NA 4OKDA 3M07A 1XHGA 4ZXLA 1Q6CA 1VEPA 3ZT5A 1FH9A 4CD7A 6A3HA 1ZBKA 3VIKA 2W5FA 1EHAA 2OYLA 1W1VA 3AHZA 1OINA 2D22A 4W7WA 1CXEA 1XH0A 3GXMA 3ARUA 1Q4NX 2WBGA 5HNNA 3KWXA 1NOWA 2EPMX 4S3JA 4J3SA 3VIJA 3VGHA 1UD2A 4GQRA 1BSIA 1CLXA 2J8FA 2VTFA 5A2BA 3MUY1 1W1PA 5C70A 3WEZA 4PTMA 1UR9A 3GTNA 3IAQA 1D3CA 1JF5A 2WANA 5E9AA 4DUWA 1HP4A 3IJ7A 2CYGA 3VNZA 2NW0A 1OWQA 2QHAA 3AIBA 1MVYA 3VD3A 1KXTA 1E0VA 3AZRA 1GHRA 1BYAA 3CHEA 4LQ1A 3LPFA 4B3KA 2CCRA 2DSUA 3VMOA 2A3CA 4CCEA 3W26A 3AZSA 2CITA 3WN6A 3ZMRA 1VAHA 4NSBA 5EBAA 4C7FA 1CGWA 2D0HA 1XC6A 2A3AA 4MDOA 3WY1A 1JD7A 5AC5A 2A3HA 4PRWA 4M81A 1J0HA 2XSAA 2JEQA 3WENA 4QP0A 1R8LA 1GJWA 1W9DM 2E4TA 1HVQA 1ODUA 3AS0A 3NDYA 1WO2A 2CHOA 3WUBA 2CKSA 3ZJ8A 1JDDA 4F79A 1V08A 4EK7A 2D3LA 2VMFA 2CXGA 2WXDM 2VZTA 3A4WA 3WELA 3KL0A 1ZB5A 1LWJA 4U33A 5GQBA 2PWHA 8CGTA 4TTGA 1HP5A 3O2LA 1VEMA 2EQDA 3VDHA 1E5JA 1OIFA 1JAEA 1Y7VA 5BRPA 1S46A 1OGGA 4J7RA 1FFRA 1JG9A 3UERA 1PBGA 4W5ZA 1MW3A 3ARYA 4XX6A 3WNLA 4CVWA 1TR1A 3ZJ6A 3N18A 4EANA 1CNVA 1DHKA 5IXEA 1CZ1A 1C8XA 3RO8A 1Q6DA 4B3LA 3GH5A 2W66A 4OBRA 2J8GA 2XVKA 3EMCA 1O6IA 1Q6EA 1PX3A 2WVVA 2JE8A 3AS1A 1ZBCA 4XUYA 1AQ0A 4UOJA 3II1A 3RIKA 3AMGA 1IT0A 4FF5A 1XSIA 2YL5A 3EDEA 4W87A 1C8QA 3THCA 1TCMA 1UKSA 2O9PA 1E4IA 4JCMA 6TAAA 1E4MM 3HMCA 2F61A 1VJZA 3PZMA 4JHOA 4NRRA 1V6YA 3SCPA 2XVNA 1V3KA 4QLKA 5I6SA 3AIVA 2Y4SA 1ESWA 2Y8KA 3QHMA 2NT0A 3WQWA 1QHOA 5A6BA 1W3LA 1PX4A 3K4DA 2UY5A 4GZIA 4JKKA 4W88A 3WBEA 1HIZA 4AZGA 1QNQA 7A3HA 1R85A 1J01A 2XFRA 4GIAA 3B9AA 2DEPA 4D1JA 3PZOA 3FNDA 4GZEA 4JZ5A 1UZ1A 4MPKA 4UQEA 4PMNA 2XWDA 2FHCA 2WLYA 1X6LA 4J3XA 2RGLA 2VT0A 2WCSA 1TFVA 3OLDA 1FOBA 4H41A 1F4AA 1UWIA 2O9TA 4GO9A 2Y8VA 4JL2A 4W93A 4PMXA 2JEPA 1W2VA 4Z2KA 3PN8A 1XCWA 1I1XA 1SYTA 2ZXAA 4A3YA 3LPGA 4PCTA 3AXHA 3AISA 1XH2A 2X0YA 1JD9A 4CU7A 2WHMA 2VX4A 3WUGA 2WMIB 4KGJA 3VINA 2E9BA 4BF7A 2ZUWA 1NM9A 1W9BM 1R86A 1R7AA 9CGTA 4UCFA 1J0IA 2JF7A 1EGZA 3BAKA 1JZ2A 4Z2GA 3I3EA 1HL9A 2JALA 3A6OA 1DEDA 4YHGA 5EMYA 3ZIZA 1GCYA 4DM1A 4XB3A 4D72A 4HMCA 4PEEA 1MFVA 4CU8A 3JUGA 4GZJA 4WKHA 2DPEA 1H0IA 3D3AA 1UKPA 2XFFA 3BAJA 1CDGA 5TD4A 3T2PA 3BLPX 3AIWA 2ZIDA 3AMLA 3BAWA 5CSYA 5BXPA 4V28A 3AXXA 4UFLA 5AC4A 4RE3A 3U5YA 2WWCA 2V3FA 1HF6A 3U7BA 3GNOA 4UR9A 3L2LA 3AICA 4U5KA 2XPKA 1VFOA 3KL5A 3L4TA 4NZCA 3APGA 5EB8A 5M03A 2FHFA 2CIPA 3WQ8A 3DECA 3VILA 1UD4A 1E3XA 1HKMA 1HVXA 1VB9A 3K8MA 3NCOA 4IUGA 2W63A 4U2YA 4KMQA 3UCQA 2ZWZA 4UFMA 5A6LA 3D5HA 1MXGA 4PTXA 5A2CA 4GO8A 5D9OA 1GVIA 3GZAA 1ZL1A 1ISXA 1UQYA 4B16A 1V6WA 3TA9A 2GVYA 1BVNP 3O6AA 4HA1A 1BAGA 3DYOA 1LL4A 1U33A 4LX4A 1LG2A 5DT5A 1HJSA 3WF2A 2YA2A 1GQIA 1B30A 3VGGA 2D0FA 3W0KA 1CPUA 2YBTA 3QHNA 3F4VA 1JDAA 2ZXDA 2UY2A 2WC3A 2WSKA 1UKQA 5GNXA 4MNJA 3AIQA 1E71M 3AHVA 3BAIA 4D6GA 1EQPA 2DSWA 3PZVA 3AOFA 1GOQA 3WDPP 4LYRA 5DT7A 1RD6A 1BYDA 1GNXA 2D3NA 1CLVA 3GBDA 5HPCA 1V02A 3MANA 2YDQA 1KFWA 3KL3A 3EDKA 4KRUA 2ZX7A 1OGBA 3I3BA 1UR8A 1FFQA 1H4PA 4OJYA 4W8AA 1VF8A 3MSGA 4ZE4A 3PHAA 1NWTA 2DT2A 4L4OA 2OSYA 3G6LA 1Q6GA 4B9YA 4X0NA 1KGXA 1V3HA 4PSRA 1ISVA 3AIUA 3CIVA 4AD5A 2J62A 3VUPA 3GXIA 3K1DA 5CGTA 2GFTA 1X1NA 1BYCA 3ZJKA 1KGUA 5AY7A 1GZJA 1N82A 2BVDA 1RH9A 3PZUA 4AEEA 2VRKA 1CGVA 3W25A 5E70A 2QLYA 4IM4A 4CKQA 4XV0A 2VRQA 2X09A 4Z2LA 1XGZA 2XJ7A 3SCTA 1HJQA 3CZGA 3F5KA 4WSJA 4JFUA 5E6ZA 5A6AA 2XM1A 5LA2A 1E4LA 4MB4A 1GW1A 4U3AA 2WVSA 3S6TA 1BG9A 4F8XA 2XM2A 4EE9A 1KR1A 3FN9A 5A8QA 5ABEA 2PWDA 4QDMA 2OWXA 2A3BA 3B8SA 2Y5EA 1QHZA 3T2OA 2EPOA 2QPUA 2YL8A 3EMZA 1NH6A 3B9DA 1V03A 1XD0A 3IAPA 5BYWA 1MYRA 2G8ZA 3OBAA 4ZXOA 3W28A 1W3HA 2C7FA 3SCQA 5A94A 1E6RA 1CGTA 3AMKA 4AW7A 2ZX9A 5D4YA 1E6ZA 3TTYA 2WWDA 5I0DA 1BQCA 2JF6A 4PYSA 4P7RA 1UKOA 3L4UA 1JYWA 3WMSA 1HKKA 1JXJA 1OT2A 4PCSA 3VIHA 5I24A 4ATWA 5DMYA 3WL0A 3OZPA 3EDDA 3CMGA 1WE5A 4TVCA 3CUHA 4AWEA 3CHDA 4UFHA 3ZO9A 1H09A 5DO8A 2OWWA 1IZKA 3AYSA 1C92A 4YHEA 2OLHA 1E1FA 3VIOA 5E0FA 5A95A 3CUFA 1SMDA 3RDKA 1C91A 2UWFA 4N42A 1XCXA 3K8KA 3F5JA 1VJSA 3VD5A 2W4XA 1V02E 1AQHA 2J75A 3QOMA 2J7EA 4JFWA 3RM9A 1RP9A 4OUEA 1DWFM 1GOIA 3WF0A 3GNPA 2QV4A 1UH2A 3VPLA 1HJWA 2BS9A 3AS3A 5JIPA 4H7VA 2PC8A 1D2KA 3RILA 1XSKA 1W1YA 1UYQA 2GUYA 2Y24A 3ARWA 2WZEA 3WNNA 4TX6A 4HZ8A 3SEPA 5CGMA 4HOXA 4PMZA 3CUIA 1OGSA 4FLQA 4M82A 1DP0A 4UZUA 4HA3A 1CGYA 2BHZA 1WB0A 1NWUA 1GQKA 1UWTA 4WSKA 1UR2A 2QMJA 1EHNA 4YN5A 1GPFA 3GM8A 3WQVA 2DIEA 3BSGA 2J77A 4HP5A 3POCA 1MQQA 4EKJA 2W62A 2XIBA 1MXDA 2W92A 1W2PA 1H49A 5A6BD 1TA3A 3HN3A 1KXVA 3WIJA 2DT1A 4HPHA 3L2MA 4AZBA 5E09A 4ACYA 1C8YA 3RPMA 3PBGA 1US2A 3CHCA 3F5LA 2TAAA 4D1IA 2E40A 1JFHA 5I5RA 3WBAA 1DWAM 2VURA 5CPQA 1M53A 4P7QA 2G3JA 2B31A 3HJEA 3VX0A 3SUTA 1MQRA 2J78A 2BHUA 1TE1A 1IV8A 2YDRA 3ZSTA 4RL3A 2V3DA 5CXPA 4AXNA 3FAXA 3A4AA 4LGXA 4C7DA 3WEOA 4ML4A 2HISA 1MWOA 1KWKA 4K68A 1E56A 3CLWA 4J3WA 1HJUA 4MNKA 2IXVA 5IFPA 5IFTA 3FHAA 2DGAA 3TTOA 2WKGA 2D2OA 4D6FA 5HPOA 3PZNA 3U5UA 4W86A 3VOCA 2E3ZA 3ARTA 3AIRA 2XVLA 2BXZA 4GQQA 5M3WA 4UNIA 5GNZA 1NP0A 5GPRA 3UG3A 1NP2A 4FK9A 1JNDA 1ZJBA 4TTUA 2Y2WA 2WK2A 1B0IA 4HA4A 4M80A 1CBGA 4AEFA 3TONA 4MNLA 3ARRA 1E4NA 1CWYA 2WLZA 2GK1B 4V2XA 1AVAA 2HVMA 2WHJA 3WSUA 3CHFA 1VEOA 2ZWYA 3NDZA 4AMCA 4IPNB 1QOXA 2BVYA 3QR3A 2EPKX 3IANA 2YKKA 5HDRA 3DHPA 4WIWA 2VOTA 1MQPA 1M7XA 1PX8A 2VVSA 5BWFA 4PMVA 3QGVA 2WVTA 4MJ4A 1W91A 3EDJA 5GNYA 4BS0A 1Q6FA 1UA7A 1HL8A 2ZUVA 4DWSD 3T0AA 4JAWA 3WQ6A 2E9LA 2ZE0A 4R5EA 1WAWA 3A47A 3EDFA 3CMJA 3N17A 2VI0A 2BV9A 1ZJAA 5BXSA 5ABFA 1H5VA 1UD5A 2CETA 3I3DA 4XZBA 1QPKA 1UWRA 3SUSA 4AZ6A 1UHVA 1G5AA 4KWUA 3W38A 1NOFA 1EDQA 3WNOA 3EBVA 2RGMA 1E70M 1BPLB 2XIIA 2V5DA 5A8OA 3SCNA 3VDCA 2BNJA 1JZ7A 3WD1A 4ZEPA 1E15A 5KEZA 5A69A 2PB1A 1VFUA 2XVGA 5BXRA 4RE4A 1WZLA 4HOZA 2O92A 1EO5A 2YL9A 1PZ3A 3FY1A 8A3HA 1ZU8A 1KBKA 4YPJA 4F9JA 5D9MA 3T0BA 4W5UA 5HXMA 4QCEA 2WBKA 3MV01 5HOSA 3MUIA 2J7GA 1W9UA 1NWRA 3WDIA 3WF4A 3CUJA 4UQDA 4H8VA 2VX6A 4FLRA 1VENA 4ATDA 2C0HA 4AD0A 3AMDA 3CO4A 3ARXA 1GUVA 3BXWA 4WKFA 3WQ5A 1AMYA 2WCGA 3WD3A 1QNRA 2WCAA 3TTSA 3N12A 1QHPA 3FAWA 4AZCA 1L8NA 5CPSA 2X2YA 5EFFA 3W81A 3UESA 4CD8A 1XSJA 2E0PA 1L0PA 5I23A 5FD0A 1KGWA 3AJ7A 1C93A 4JFVA 1E73M 3NSXA 1DWJM 1K9DA 1BVZA 1BG4A 1LF1A 2FH8A 2ZUTA 4A3HA 2F8QA 2CBVA 1GQLA 4PMRA 3CUGA 4M24A 3RMEA 2AOSA 2EBNA 3M46A 4HMDA 5D8WA 3W27A 5M5DA 3OA5A 3M6DA 5LYRA 4U2ZA 3ALFA 2FGLA 3WH8A 2BFGA 5I2UA 4MJ2A 3U7VA 1NWSA 1UH3A 3BAYA 3VDBA 3VIGA 1YHTA 2VX5A 3ALGA 1QI5A 4MAVA 1EO7A 1HN1A 2FH6A 3DYPA 1FP8A 1UD6A 4AIOA 4HPGA 1XRVA 3ZM8A 1UH4A 4PUDA 1PIFA 2WM0A 1E3ZA 2XFYA 2VCAA 1A47A 2FHBA 5BXTA 3DYMA 4OZOA 1UKTA 4Y7EA 1BGGA 4UFKA 3WF3A 2X1IA 1BTCA 1MW2A 4M29A 1LG1A 1MW1A 1E55A 3CZJA 1EIBA 3AXIA 3OLGA 2VR4A 3UR8A 5I77A 4GI9A 1WDRA 2OYKA 4LXFA 2CNCA 1JDCA 3ECQA 2X8RA 3VKKA 5JH8A 1KXHA 1EOMA 1H2JA 4ZFMA 1R7OA 3VGFA 4DWSB 3MS8A 4JCLA 2GJXB 4A4AA 1V3LA 3NJ3A 4CN4A 2Z1KA 1ITXA 1JF6A 4UFIA 2BVTA 4WK9A 1LWHA 1HNYA 4CCDA 2XUCA 1C7TA 1KCLA 3DHUA 5CSUA 3OZOA 1QBBA 5CQ1A 4QCFA 4ACZA 4DWSA 4ACZB 5C8BB 5FOOA 1CGXA 1U2YA 1B3ZA 4W8BA 4CCCA 1JZ3A 1VBUA 2NT1A 4TXEA 1ISWA 2VCBA 4W7VA 4JHZA 4PMQA 2CESA 5E0CA 5ABGA 1UWUA 1WDSA 1E40A 2JFEX 4PUEA 4BA0A 2ZX5A 2GDVA 2CHNA 4AIEA 1Z32X 4D6CA 1O7AA 4JL1A 4HMEA 2XSBA 5A2AA 4MADA 2E9MA 5F7UA 2IUZA 4AC1X 3UEQA 2YL6A 2JIWA 2VCCA 3OIHA 3S2CA 2EXOA 2ZXBA 2DSVA 4R27A 3WH5A 2VJXA 3SCRA 4QLLA 2GJRA 1J0ZA 3WNPA 3T2QA 1VBRA 3ZR6A 3AYRA 1YQ2A 4IPLA 4B9ZA 4ZE5A 4BQ4A 1A3HA 2DT0A 1E0WA 1UR1A 1FA2A 3WMCA 2VO5A 5IHRA 2BY1A 3UETA 1E6PA 3WKZA 3VGBA 4GKLA 4AD2A 1WDQA 1OD0A 4AD4A 5JBEA 4TUFA 1UR4A 1B31A 1EOKA 2EO7A 4H04A 4N0RA 1FH7A 2WSPA 4PTVA 2GDUA 2PWGA 1K9EA 4B15A 2BY0A 3LPOA 2CERA 4QAWA 2QPSA 4W89A 4EAMA 1JYNA 4AY1A 1CYGA 1UQZA 4DWSC 3OLEA 1E1EA 4AZCB 4OIFA 1WZAA 1D7FA 3ZQ9A 1V6XA 3PZ9A 4HOWA 5ABFB 4M1RA 1C90A 1V3MA 1SFSA 3GH4A 1E72M 1C7SA 3W53A 3CH9A 3EMQA 2F2HA 1ZBWA 2IXUA 5A6JA 1KBBA 3SUUA 3W82A 2ZXQA 3BH4A 1QI4A 1XYFA 1EDGA 4D6EA 2VZUA 2ZICA 1V3JA 1J10A 3AHXA 3VIFA 1G1YA 4BCEA 2PI6A 4P8UA 1UWSA 5I79A 4UOZA 3ZT6A 3VMNA 5EFDA 4D6HA 3SCUA 4AZIA 1EQCA 1W32A 4HZ7A 4UFJA 3VNYA 4J3UA 4LYPA 3SCOA 2DSZA 4BQ5A 1LLOA 4MB3A 2ZUMA 3BGAA 4P7LA 3N11A 5E6YA 2QF8A 1H1NA 3K8LA 5A8PA 4D71A 1GOMA 4LYQA 2AAAA 1CGUA 2XGBA 3AIEA 1JL8A 4J3TA 1JI1A 1JNEA 1GONA 1HX0A 1TMQA 2PBOA 3IJ8A 4E2OA 1EDTA 3VMPA 3PTQA 3QHOA 2O9RA 3PTMA 1QI0A 1OSEA 3VM5A 4P7NA 3MV11 4P7OA 2G3IA 1ZS2A 1LL6A 4FLOA 2WMIA 5BCAA 3EYPA 5IDIA 1XD1A 1XH1A 3MUAA 4D6IA 1KR0A 1EA9C 3VU2A 1W9PA 3J7HA 1KXQA 2YJQA 4CD5A 4KH2A 5A6KA 3LMYA 1QNSA 4E8CA 2J7DA 4NF7A 1PIGA 2D23A 4PN2A 3VM7A 3ARZA 4URIA 2BY2A 1CXFA 2W67A 5A8MA 3PZGA 3E1F1 1KQYA 2G3MA 4TVUA 2J4GA 3VX1A 2CBUA 4W8LA 4CD6A 1PZ2A 2V38A 2V5CA 4H2CA 1CEOA 1QW8A 5A6MA 1CIUA 1UG6A 6CGTA 2WMKA 4MB1A 3AZTA 3U57A 1EXPA 3OB8A 2WMJA 1NOUA 3NSNA 5CLTA 2WAGA 2VQUA 4MB5A 4ZENA 4UTFA 2WVVB 1HKIA 2WZHA 1WCGA 5FL1A 3RM8A 4C7GA 2GJPA 1HKJA 1ODZA 3WDQA 5I78A 3WNMA 4PMUA 3WQ4A 3VGDA 4X0VA 3FXYA 2VNCA 4W7UA 1JXKA 2VRJA 3CBWA 1WPCA 5DFAA 1OIMA 2OWCA 2J79A 2GK1A 3RM4A 3WDHA 3WH6A 1JGIA 2WKLA 3HU7A 2PBGA 3VGEA 1OM0A 4W84A 2DDXA 3BAXA 1RPKA 5D9NA 3WD4A 1GJUA 5C71A 3NIYA 3MMWA 1KQZA 5D9PA 2XVPA 3GBEA 2BY3A 3FW6A 5A8NA 4OBSA 3N1AA 7CGTA 4U3CA 4Q7NA 4UQ9A 4UZSA 2CBJA 3UG5A 1TZ7A 2OSXA 3MO4A 1WZMA 4ATLA 4H8UA 1TVNA 4D6DA 2VZSA 1ZBVA 3POHA 3W24A 2A3EA 4MDPA 4E8DA 1OB0A 5CLWA 2FGZA 4J28A 1B1YA 3ZSSA 4HZ6A 1CENA 1W9VA 3W37A 1FHLA 3BCFA 2EEXA 3LPPA 1XV8A 5AYIA 2VL4A 1GORA 3BC9A 1M03A 3MKKA 3WL1A 4XZWA 1DWGM 1V0LA 3PZIA 1IZJA 4AD1A 1US3A 1JZ4A 1QBAA 1BFNA 3KZSA 4W85A 5FIPA 4BQ2A 4IISA 4J3VA 3VIMA 3W6LA 3O9NA 4P8WA 4PMOA 2WMFA 3VVGA 1ITCA 5JBFA 2VVNA 4U31A 1DWIM 1G0CA 4UQBA 4JFTA 4GI6A 3PZTA 1C3FA 4D6JA 1HXJA 4DUXA 4TOQA 4WF7A 3VD9A 1K6AA 1FHDA 1P6WA 4WKAA 1CXIA 2G4FA 4V27A 3AQUA 4QFUA 5I3DA 1W3KA 2QMKA 1I1WA 2PF0A 3K4AA 2WMGA 4CN1A 1DTUA 4L4PA 4JKLA 4LPCA 3ZR5A 4WJXA 1JZ8A 3ARVA 1OCQA 4AZHA 3BSHA 1ISZA 1E9LA 5CG0A 2XTKA 2D20A 2X0HA 1W1TA 1HT6A 4CVUA 1UD8A 4AISA 3ARSA 1BLIA 1R87A 2EPLX 2VR5A 4NRSA 3ARQA 3NSMA 3WUFA 1PEZA 3BLKA 1UR0A 1G9HA 3GXDA 4KGLA 4NI3A 1I75A 3MMUA 3TTQA 4Z2JA 1B9ZA 5CZKA 1SMAA 1J9YA 1MW0A 1CTNA 2NSXA 3WUEA 1RP8A 4E4PA 1E6XM 1JI2A 2O9OA 1WDPA 1GOWA 2CPUA 2J25A 3GXFA 3MMDA 2ZUUA 5A6SA 2WNWA 4M56A 4JKMA 5IHSA 3SCVA 1VIWA 3CTTA 3ARPA 1KB3A 4GINA 1UWQA 2J7BA 2G3NA 4S3KA 2E8YA 3CZKA 4GXPA 4M8UA 3B9EA 4FMVA 2WYSA 3NYDA 2J7CA 1JZ6A 2G41A 1G94A 1OT1A 1QI2A 2X05A 1B90A 3ZOAA 3WMBA 4PTWA 3KEHA 3W6MA 4JIEA 3WFZA 2WPGA 4FLSA 4BZYA 4PSPA 4MAZA 2YLAA 3IK2A 3A4XA 3L4VA 3N04A 1UA3A 1VRXA 3OGSA 2J47A 1GQJA 1H41A 2XHYA 1TUXA 1V6VA 2XWEA 4UQCA 3IJ9A 4PBGA 2ESCA 3DC0A 2DT3A 2DH2A 5HBFA 3TP4A 3MU7A 2JIEA 5M17A 2J7HA 3VIPA 4AZ5A 2YA0A 3AROA 2CEQA 1J0YA 2VX7A 3SCSA 5FCZA 4AD3A 2EPNA 2V3GA 3WH9A 2D1ZA 3BCDA 3CZEA 1J0JA 1BHGA 2WMHA 1UUQA 2AMGA 3T09A 2GJXA 2GSJA 2WZIA 4HU0A 4TVDA 1WP6A 1NARA 2DQXA 1W9XA 3WD2A 2EJ1A 4DM2A 4MNMA 1K9FA 3WH7A 5DEZA 1AQMA 4HU8A 3RJXA 1EH9A 1H0GA 4AZ7A 1JYVA 1CXHA 2Z1SA 3W4RA 1LL7A 2ZX8A 2DH3A 2OYMA 3AFBA 3CZLA 3SUVA 2D0GA 2V3EA 1K9TA 1E5NA 1V6UA 3SIMA 3GH7A 1TVPA 1GVYA 2YLLA 3KE0A 2BXYA 1HJXA 2WHKA 1E6SM 1CECA 3L4ZA 2J7FA 3CPUA 1SR0A 3MSDA 2YIHA 4MTVA 1TG7A 3BMVA 3N13A 3GDBA
chains in the Genus database with same CATH superfamily
3FSTA 3HFYA 2XYLA 2VZOA 1X39A 3CQHA 3OGVA 1DBTA 2R91A 4KRTA 1AA1B 1XQKA 4N7QA 1SO3A 1BKFA 4K37A 2W0UA 3G1SA 2YBUA 5KZ6A 5IBXC 3OYXA 3M7SA 1R3VA 1B3XA 1H3GA 4GYKA 2GL5A 3TYBA 1K1DA 3SURA 4HPNA 4CUCA 4LY8A 3VD7A 1R9YA 5CJ5A 5B8IC 3UG4A 1JFXA 3WBXA 4ENLA 4FX8A 2OOFA 3C56A 3CYVA 1LUCB 3XINA 2FDMA 2PDHA 2YOCA 3NUKA 4X9YA 4U4MA 5XINA 1QFEA 3DAQA 3WD0A 3M16A 4FNSA 2XH7A 2PDPA 3N2TA 4W4QA 1XCFA 4GA8A 1T0OA 3OVQA 4H8HA 1SZFA 4PMDA 6TIMA 1LQ0A 1V0MA 3AHYA 3CZ8A 4IQLA 3R11A 1XLEA 1G67A 4MYXA 3H8AA 3M5YA 3PZQA 1EF2A 1GHSA 4JTUA 1F6KA 4O52A 4NHVA 2W61A 2C8NA 2CKRA 5A1AA 3IJ6A 4O17A 1F2JA 4GZ7A 3WDJA 3QKZA 1P0EA 2QGHA 4HCDA 2VC9A 4Q22A 3SY8A 3ZJ7A 2JK2A 3QV7A 4Q33A 5HATA 4BY3A 5FEPA 5FJUA 4ICCX 2ZA1A 1VFMA 1AL7A 4H9ZA 4CN6A 1CLKA 1QW9A 4EP8C 4CU6A 1XG4A 3PG8A 3UNDA 4CD4A 3FSUA 5EMMA 1WYIA 1BYBA 4AYGA 5FL0A 3NPVA 3FX4A 1O94A 1GVSA 3QY6A 5DX7A 4J27A 2CZFA 3IV8A 2OT0A 2UY4A 1H11A 1KCKA 3DG6A 4YXGA 3HF3A 2PCQA 2VQTA 4ZA0A 1GEQA 3SJNA 2EKCA 3SZ8A 2EULA 5BU9A 4ZO6A 4QQUA 3THDA 1V3IA 1KFEA 1AW2A 3CUXA 4F66A 4QG9A 1OBAA 3GXNA 2ONEA 5I00A 1VKFA 1UZ4A 2XIJA 4J35A 3TA6A 2DW6A 1W0MA 3LCLA 1XR2A 1QNOA 3ZT7A 5JBDA 2WM1A 3R25A 1LUCA 2F38A 1H7XA 4REQA 4OKDA 1XHGA 1Q6CA 1VEPA 2GOUA 2G97A 3ZT5A 5CC7A 5AHEA 6A3HA 4CD7A 3QLDA 1ZBKA 3VIKA 1EHAA 1I0BA 2HRWA 1W54A 1X38A 3AHZA 1Q4NX 3NA8A 5HNNA 1IIHA 5I07A 3I4EA 4S3JA 3URBA 4DX3A 3U48A 3BARA 4GD0A 4GQRA 1J6YA 4RNJA 3MUY1 5K7JA 4W9PA 3WEZA 4HNLA 4PTMA 4CQBA 2CU0A 3FYOA 3CUZA 3UY8A 4POCA 4DUWA 3IJ7A 3L0KA 1L6SA 1NDVA 4XKMA 3NPWA 2QHAA 4A29A 2H9AA 4GGBA 1TPB1 1IEIA 1E0VA 3UWZA 2E09A 4LQ1A 2B7OA 2Z00A 3VMOA 4NAEB 2PURA 1VAHA 4S23A 4U28A 2BOEX 1DIOA 5EBAA 2NUYA 1XC6A 2O4QA 2A3AA 4MDOA 1JD7A 4L7ZA 4Q8MA 3LN3A 3WENA 4RDYA 4QP0A 1ZAIA 4C6JA 1IXQA 3GYEA 1EP3A 2CHOA 3WUBA 3ZJ8A 4IWWA 2PU1A 3HPZA 2JKEA 3UG8A 4M7TA 1OADA 3HJZA 5FJRA 2D3LA 1UP0A 1E51A 1UASA 1N1AA 2F21A 3H4WA 3A4WA 1XYLA 3B9OA 4K39A 4R9XA 2PWHA 3B8IA 4LS1A 3KAOA 2VEFA 2XP4A 2R82A 3NO1A 5M2FX 4NNRA 4UCGA 1E5JA 2ABBA 4XAGA 1JAEA 1QK2A 4DNHA 5BRPA 3BGJA 1OGGA 3U8GA 1AJZA 3ANUA 2QCCA 5TNVA 1PBGA 1XLGA 4OV4A 2PDGA 2EGZA 4HSOA 5AECA 1PHQA 1C8XA 5BNKA 3OP2A 5AHLA 3NQBA 2V9DA 2E1WA 2I5GA 3GDLA 2JE8A 2F2DA 4J2MA 3W85A 2M1IA 3II1A 4M6UA 4FF5A 2HMCA 1XSIA 5HW8A 1R3SA 3LDVA 4H7ZA 3B0VC 1C8QA 4PCNA 2O9PA 4JCMA 1YIXA 3S4TA 1SGJA 3RMJA 3PBYA 4JHOA 3WBYA 3C61A 3SCPA 1W3NA 1OVDA 1V3KA 3K2GA 2W27A 4MWAA 4LAUA 4IGNA 1MSSA 4DB7A 2IF4A 4L1WA 1KCXA 4MHBA 2NT0A 5A6BA 4I7VA 2UY5A 3IVUA 4W88A 3WBEA 3WJZA 3LY0A 4QM1A 1QATA 2XFRA 1TCOC 3HIJA 2EG7A 5HA7A 2VHLA 3NOEA 4JZ5A 4RCXA 1UZ1A 4MPKA 5T91A 4FNQA 2G0WA 4L9XA 2XWDA 1UUOA 1X6LA 1B4EA 2RGLA 1SZGA 3N2MA 1XQLA 4B92A 1FOBA 3BOXA 4PODA 2O9TA 5DY2A 4W93A 2Y8VA 2QUNA 4XAZA 2JEPA 3IIXA 1A4LA 3F4WA 4EF9A 3S3GA 3TC6A 2ZXAA 5AVHA 4A3YA 1EKOA 1W17A 4JTIA 1QPFA 2ZRVA 3O8AA 1OC6A 2VX4A 1PTAA 4LS0A 4ZB5A 2X1TA 4YMZA 1RA5A 2E9BA 2CHRA 2VWSA 3QZEA 1OFAA 3R4IA 1NM9A 3QR1A 1I2RA 1YLVA 1J0IA 3IV3A 1AJ2A 1JZ2A 1CB7B 3DX5A 3I3EA 3UD6A 2JALA 3W7LA 1RUSA 1Z3NA 4DF0A 4C6QA 4YHGA 5EMYA 3ZIZA 2Y88A 2J13A 2PLKA 3A3WA 4DM1A 4HMCA 4PEEA 1MFVA 4CU8A 1WA3A 3ITTA 2DPEA 5D33A 4FNTA 4AWUA 3LM7A 2GQ9A 5F1UA 3AMLA 3A4JA 2X1RA 1QT1A 3W2MA 5BZAA 3AXXA 5AC4A 3U5YA 1HF6A 1WQ5A 3L2LA 4U5KA 3RK8A 5LHEA 3KL5A 3L4TA 4PA8A 3WBWA 3R0KA 2H3BA 2PP0A 5EB8A 5GJMA 5M03A 2FHFA 2POTA 3UJRA 1EYWA 4ORIA 3THAA 1HKMA 1FWCC 1AG1O 1KC7A 3NCOA 3QTPA 2INZA 1IIGA 1VIZA 1W5QA 2IMRA 1Z7AA 4R88A 2FTWA 4F0RA 1ZY9A 4Z1CA 4RX0A 3IACA 4RNHA 3TYAA 4QJ1A 4DJFD 1V6WA 2XN1A 3TN3A 2XPBA 4IGMA 5HQMA 2F6XA 2HZGA 4BR1A 4CNPA 4HA1A 1BAGA 4MM1A 2N87A 1HJSA 2YA2A 1TZZA 5HNTA 3NTYA 1TPH1 2Q09A 3G0XA 3F4VA 1JDAA 2ETNA 2ZXDA 2UY2A 2BTMA 5HNUA 4FXJA 2WC3A 1QWKA 1MUMA 1XGDA 2WSKA 5F4SA 1UKQA 5GNXA 4I7UA 2NV1A 3G1HA 3BAIA 3PZVA 4C6OA 4B2DA 5DANA 4LYRA 1GTHA 3DBNA 1RD6A 5LHFA 3BK0A 3GBDA 5HPCA 4Z17A 5CAHA 1V02A 4CQCA 1KFWA 1EUAA 1L6FA 2MLYA 3T42A 4KRUA 1O95A 3DKJA 2PLMA 1OGBA 3I3BA 3NEHA 1HKWA 1H4PA 4ODOA 3LCGA 3FK4A 3PHAA 4PB5A 4QEEA 3UZWA 1Q2SA 3KS6A 4HHMA 2OSYA 4HARA 3EY6A 3ZVHB 3EEGA 3LCHA 1C29A 4PSRA 3AIUA 2LKNA 1K70A 1A5UA 4WXZA 1KFKA 5C6MA 5CGTA 3H26A 4PB3A 1VCGA 2PUZA 1GZJA 2M08A 1RH9A 4AEEA 2VRKA 2ZZ5A 4ODPA 3ABXA 4E2BA 1AJ0A 3W84A 1THFD 4B5VA 3PNUA 2VRQA 3OW1A 2XJ7A 1HJQA 3CZGA 2C14A 1OCBA 3RNDA 3BANA 2V63A 4IGSA 1ZAJA 4MB4A 2WVSA 1BG9A 3UR5A 1L2UA 3H4XA 3LZ3A 3HFTA 1KR1A 3H4GA 1FKKA 1LT7A 1IGWA 3G1VA 2DJLA 4QDMA 4G2DA 2OWXA 1IT8A 2A3BA 3B8SA 1ECQA 1QHZA 1X7FA 3E9AA 3EMZA 2R1MA 1V77A 2WNZA 3IAPA 1H5YA 2EHHA 4LFYA 2G8ZA 3OBAA 4ZXOA 1EF3A 3EIPA 1PO9A 2IPJA 4F40A 3GSMA 1CGTA 3AMKA 1K7EA 2ZX9A 2E6FA 1E6ZA 2WWDA 4QNEA 4ONVA 4PMJA 5D2TA 3LG3A 4NI8A 3TCSA 3NO3A 4LSBA 2CWXA 5G4WA 2H3DA 1JYWA 3WMSA 4N6FA 4TW8A 4Z1AA 1HZYA 4XIMA 4JDYA 4PCSA 4DYEA 3JYMA 5I24A 1KBLA 5DMYA 3WL0A 3P0XA 4B5TA 5GPGA 1WE5A 3CMGA 4CNTA 5C9ZA 4JTRA 1Q1CA 4A6GA 1C92A 2E7FA 2I17A 3B0XA 1F7BA 2OLHA 3WLSA 4FX6M 3JW7A 4HJFA 4NJJA 3Q2DA 4DLMA 4PUUA 3RDKA 1ZGDA 2F84A 2UWFA 4N42A 3F5JA 2GGHA 1VJSA 4RZ6A 2J75A 2J7EA 4JFWA 3L67A 4H8NA 3VPLA 1TJPA 3AS3A 3CJPA 3KWSA 4UTIA 2WZEA 2G3FA 3L21A 3PF3A 3KADA 1XISA 1IT7A 1RJQA 1NWUA 1GQKA 4JTGA 4KKXA 3QQWA 1I2QA 3LS9A 3S5YA 1QWGA 1ZAHA 2NLYA 4A8IA 4LRSA 4HP5A 4MG4A 3POCA 1MQQA 3OODA 2XIBA 1N8FA 3H2NA 4OE7A 3KUMA 4IFKA 3RYSA 3HN3A 2FPYA 3WIJA 2P76A 4AZBA 1H50A 4I5UA 1C8YA 1VHCA 4FB7A 3P7YA 3TJIA 3LNMA 3F5LA 4D1IA 1JFHA 1DWAM 1TMLA 2VURA 1M53A 3O5OA 1YDOA 3EA2A 2G3JA 1RY0A 4DJFC 3MJMA 2A79A 4U84A 4Y8EA 3SUTA 1MQRA 3DKLA 4LANA 1KM2A 1PS9A 1TE1A 1IV8A 3S83A 2C91A 4M6PA 4YJ5A 3RFWA 2XP9A 4DRPA 2OGJA 3FAXA 3R79A 3W7JA 3TQ0A 4C7DA 1EEXA 1S5TA 3W86A 1KT1A 2Y5SA 3GFZA 3G0SA 3R0UA 3PS7A 1F61A 1R3YA 3QR0A 4R53A 2YB1A 5HPOA 4UXDA 1GZ1A 3O0FA 4AF0B 1SW3A 3IARA 2WSQA 1Q7MA 5C9XA 5K2ZA 3O15A 2XIMA 2QCDB 5A8GA 1A4MA 1NP0A 5GPRA 1NP2A 4FK9A 1JNDA 3VCCA 3FVDA 2WQDA 2W6RA 3D3FA 4MNLA 5DN1A 3ARRA 5DCBA 4UTLA 2GZXA 1O66A 2WLZA 1AVAA 1RLCL 3N3TA 5KINA 3NDZA 2ZQVA 3W2LA 4JFKA 1QOXA 3W7RA 1T99A 3QR3A 4WHBA 5FEZA 2EPKX 1LROA 4WIWA 2BODX 4RR4A 4KEZA 2VVSA 3HURA 2WVTA 1W91A 3CHVA 2Y6ZA 4PUNA 1VFTA 2PS2A 3SY5A 4GFSA 1R46A 3H22A 4IOTA 2Z1VA 1HW6A 2DP3A 3WLLA 3BG3A 1ZJAA 5D03A 4O16A 4M0XA 3AC0A 4DBUA 2CETA 3CASA 3I3DA 3STPA 1UWRA 4S3CA 4AZ6A 2TSYA 3VFLA 3BQ6A 1NOFA 1F8MA 3W72A 3KBVA 1X1OA 5H6HA 5A8OA 3SCNA 1JZ7A 2BNJA 5KEZA 5A69A 3IJLA 3TNBA 1WZLA 4HOZA 2O92A 1EO5A 2V0TA 8A3HA 1ZU8A 2PWVA 4YPJA 2YXOA 4F9JA 1Q7QA 4W5UA 5AKQA 1EUNA 3MDYB 4GH3A 1K03A 3EOOA 1GGOA 3MV01 4QCEA 2L5HA 3MDWA 3MUIA 1W9UA 1NWRA 4D8LA 3CUJA 1TV7A 1IF2A 2DZWA 4ATDA 1SQ7A 4IQEA 4AD0A 3AMDA 4O54A 4WKFA 1MUWA 4PUWA 1AMYA 3WD3A 4N9EA 1WBHA 3TR9A 1FQ0A 2AL1A 3CQJA 1WUFA 3VABA 2AGKA 1TELA 1YKWA 3GVWA 3GTYX 3IGUA 3W81A 3UESA 4HK7A 1XSJA 5I23A 1KGWA 3AJ7A 4MF4A 1PDYA 5LIYX 3T0CA 3NSXA 1DWJM 3W7EA 1LF1A 1BG4A 4HVXA 1VFHA 4INFA 1C9WA 3GB6A 4R7WA 1K77A 1GQLA 2ZQTA 2IPWA 3MMTA 4M24A 3LBCA 2AOSA 3WLOA 5D8WA 3OA5A 1E9IA 4KCVA 5LYRA 4U2ZA 2FGLA 3CWOX 1FWIC 1TPVA 2BFGA 3U7VA 1MNZA 1EBHA 2XSXA 1ZCCA 1LYXA 3BAYA 3VIGA 3Q65A 3KBNA 3DYPA 5D37A 4DBEA 1GG0A 1UD6A 3VOHA 1MEHA 5CPLA 1UH4A 1LBLA 1PIFA 2WM0A 4ZZ9A 4JYEA 1I2NA 3AYTA 1KBIA 2VCAA 3LQLA 5GJNA 3QQ0A 4I6KA 1QMLA 1K8ZA 3OA3A 3PNZA 4H9TA 4OZOA 3WQEA 4DHGA 3MZNA 4UFKA 3TQPA 4I9TA 3NQ8A 1E55A 2ISFA 1H1ZA 3KBWA 2VCDA 2BP1A 4FIRA 1F74A 5I77A 2Z26A 1UR3M 3KLLA 3R58A 1GZGA 5D32A 1Q6LA 3LI1A 3ECQA 4UTTC 4C1NB 5D05A 2X8RA 2V2CA 1J6PA 3OTRA 1KM6A 4ZFMA 4I7WA 1XRSA 4J4NA 1NJJA 2GJXB 3DFTA 3MPGA 1ITXA 2ZR4A 2BVTA 4GHRA 3N9SA 1HNYA 4CCDA 1H63A 4J40A 2XUCA 3JYJA 2VENA 4LVDA 3GC4A 1J4HA 4BJHA 4KWSA 2A2IA 5CQ1A 3M0LA 4GQ0A 4G1KA 5FOOA 1U2YA 2XFWA 4AB4A 3RXZA 2E28A 3LX9A 2DUXA 1SUXA 4O1CA 3ZVIA 2C0AA 1ISWA 2VFGA 4W7VA 1XUUA 3JXVA 4GWEA 1ROUA 4JS3A 1FWEC 1WAUA 3TMQA 3ZR4A 4PUEA 2Z2BA 4PZVA 3W1UA 5XIMA 1PIIA 4BI7A 4J2PA 2QUTA 1MRAA 1Z32X 4AIEA 2PTDA 4C1KA 4D6CA 1O7AA 3LTPA 4FXFA 3VZXA 3VZZA 1EWEA 5A2AA 4MADA 5F7UA 3ITVA 4M6QA 3TN5A 1RVGA 3BLFA 2EXOA 2ZXBA 3WH5A 3SCRA 1SW0A 4G2PA 4MSSA 4GUHA 4C6NA 4IFKB 4IPLA 4ZE5A 4BQ4A 4IMFA 1E0WA 2JGQA 3P61A 1FA2A 4KQZA 4L4LA 3W2JA 3LA4A 5IHRA 1EBGA 2RDWA 1OY0A 1QO2A 3H2FA 4XSLA 2R94A 3GHSA 4WZHA 3I65A 2HBVA 1EGVA 3OQEA 2KZHA 5AB3A 1I0DA 1B31A 1FH7A 2CXEA 4MLJA 1DQXA 4O1FA 4A22A 3QZAA 4EAMA 4AY1A 1H7NA 4AZCB 1E1EA 3THUA 2V81A 3WJXA 3FS2A 4AVNA 3LENA 3ZQ9A 3F7JA 3KBJA 2L2SA 2FJKA 4DZ5A 3QN3A 2ZDSA 2VC6A 4WDUA 1V3MA 2ZQSA 2RUDA 1C7SA 3W53A 3EMQA 1FUYA 1ZBWA 2IXUA 4IX0A 4O1BA 1KBBA 1VFLA 3ANVA 3BH4A 1XYFA 4RZ5A 4NNAA 4K36A 3DFQA 1RAKA 3AHXA 4BCEA 2PI6A 1UWSA 1TV4A 3NXLA 4UOZA 3ZT6A 4LW7A 3VC5A 5EFDA 3SRKA 3QEZA 1W32A 3BWWA 2PRLA 3VNYA 3SCOA 4Y9PA 4BQ5A 4FNPA 2V2HA 3BJFA 2QIWA 4AHQA 3EOEA 3WZ0E 5E6YA 2QF8A 4ZQRA 3P67A 1ONEA 5I3FA 1H1NA 3K8LA 4DRQA 4KWOA 4QJ3B 2ZRYA 4J3TA 4HHLA 2C71A 3UVIA 4F0LA 3VMPA 4MFDA 3PTMA 3KP0A 3MUCA 1ZS2A 1LL6A 2PTXA 4WRHA 5BMWA 4H9YA 4DRHA 1P5BA 4MLRA 1A5NC 4ODKA 2VEGA 3VU2A 1W9PA 4LNYA 1YYAA 3VA8A 3QV8A 3C0LA 1QNSA 3S2JA 1PIGA 3L2IA 2BY2A 1N8WA 2OJPA 2W67A 5A8MA 2RUCA 4UUIA 3E1F1 4F0MA 1KQYA 1F8IA 4TVUA 5CCZA 4B4HA 4X63A 1TMHA 5A6MA 1CIUA 4HN8A 4M1BA 4MB1A 3EGJA 3AZTA 4WY0F 5H8UA 2WMJA 5CC5A 5FAGA 1NOUA 1M7PA 1UBPC 4ZENA 2VDGA 4FOUA 4IL0A 4UTFA 3PJUA 4C7GA 1VH7A 1IEQA 3S5SA 2WNQA 4AAJA 1OFPA 1ODZA 3SB0A 4PMUA 1HXVA 1JDEA 4FR6A 1WKEA 2VNCA 3KM8A 3WLQA 3NQ6A 1XW8A 3SADA 2VRJA 4CCZA 1WPCA 1OIMA 4AY7A 1GVEA 3B8TA 1JGIA 2WKLA 1XGEA 4Q8TA 3VGEA 1OM0A 3H7UA 1U1UA 2DDXA 1RPKA 5D9NA 4GGQA 1UIOA 3WD4A 1SO4A 5DMMA 1S2AA 4QBXA 3GBEA 3FW6A 5A8NA 1SFLA 4MYAA 3N1AA 4U3CA 1BWLA 2YSWA 3PM6A 4O8AA 2PN0A 1A50A 1XM3A 3ITXA 1G7VA 3KLKA 1LZOA 1FVPA 5G2IA 1TZ7A 3M0XA 1HKVA 4ATLA 4V15A 1QU4A 1XDJA 5HULA 3HB9A 5A5WA 2FGZA 3PUDA 3TVAA 1B1YA 3ZSSA 4HZ6A 4DPQA 5DMLA 4DJDA 3W37A 1J6OA 2DORA 4O1EA 1Z42A 3S9ZA 4ZOEA 2VL4A 1ZLPA 5FIPA 3UI5A 5CZSA 4ZR8A 1LRTA 3UZZA 1ITCA 3U4FA 2VVNA 3W6YA 3JRKA 1XBXA 1SPQA 4GI6A 4RZBA 3LK6A 4JX4A 4HQVA 3VD9A 1FHDA 4WKAA 1Q6UA 2G4FA 3AQUA 3DFOA 2QMKA 3IIVA 2BLEA 4W9QA 3OO2A 4CN1A 4O28A 3DIPA 3ZR5A 1JZ8A 5A6TC 1OCQA 3IEBA 3KZPA 1BTMA 3BSHA 4GY1A 4PUMA 3CWHA 1QPLA 2XTKA 3GQYA 3T05A 2D20A 1HT6A 4GI4A 3GU0A 1LOSA 1R87A 2EPLX 1K8XA 3UWQA 3ARQA 3WUFA 1D3GA 1FDZA 4QE4A 4DEFA 4EPDC 1Z89A 4KGLA 1XLDA 3LERA 1KFLA 1I75A 3MMUA 3JZEA 4RLIA 1J9YA 2NSXA 1KTNA 1JI2A 1JQXA 4S3EA 1WDPA 1GOWA 3R13A 2J25A 3GXFA 2Y70A 3P74A 3SCVA 1ZRQA 4DPPA 3ARPA 1KB3A 4US6A 3TN6A 1UWQA 4S3KA 3OVGA 4GXPA 4IJRA 4FMVA 7XIMA 2WYSA 4LH8A 1G94A 3QGKC 4LB4A 1QI2A 2X05A 2QYGA 1B90A 1VD6A 3EX3A 3WMBA 4PTWA 3T0TA 3W6MA 4DRSA 3WFZA 2WPGA 4FLSA 1UMLA 1F40A 2NQ9A 3TMLA 4NL1A 3SSZA 2VFEA 1XL9A 1FKBA 2AWGA 5H8PA 4ZPWR 2ODOA 2YZ5A 3L4VA 3EPMA 3N04A 1UA3A 1VRXA 3C3UA 2GGEA 1UC5A 1H41A 3RGTA 2W3ZA 3S1XA 2IKGA 2ISVA 4IP4A 4UQCA 3IJ9A 4PBGA 3QVQA 3IK8A 1AW5A 4LALA 2W79A 3TW6A 3DC0A 4A2RA 1YNPA 4GIYA 1NQKA 3W1RA 1V7AA 5M17A 3O5IA 2RAGA 3AROA 3O5RA 2JQXA 4JEJA 3PANA 2EPNA 4KFPA 4HCLA 3WH0A 3WH9A 2O7QA 3BCDA 3CZEA 3CEUA 2WMHA 1UUQA 3Q67A 5FF4A 1QW7A 1G4SA 6PTDA 1NARA 4IT1A 3EB2A 1W9XA 1K9FA 1YPIA 4HU8A 5DEZA 3RJXA 4ZO8A 3G0UA 4X22A 4FF7A 5HR6A 1JYVA 6XIAA 2OFNA 1CXHA 2PDKA 2Z1SA 3W4RA 3B0PA 3N25A 1OFOA 1WX0A 2V67A 1E5NA 1W3IA 1UZHA 1S2TA 1I4NA 1XG3A 2DZVA 1GVYA 4U10A 4IQCA 2WHKA 3WQCA 1E6SM 1XXXA 3DXIA 3L4ZA 1FKTA 3GAYA 4OFCA 1G4PA 4UTKA 4MTVA 4LCSA 3NPUA 3N13A 3W2NA 3GDBA 3VZYA 2PD5A 1G4EA 2WB5A 3KOFA 4WXYA 3UU0A 7ENLA 1OYBA 1PPIA 5JQ9A 2INEA 3ITLA 3DDMA 3T08A 5J5RA 1MO0A 1W8SA 2D24A 1ZK6A 1E6NA 2YDSA 3GU1A 5CPMA 3O5MA 1V7YA 2OSWA 2P3EA 1XLMA 3F03K 3O6YX 2UY3A 1JAKA 1CXKA 2QW5A 1FWWA 2NVCA 3RPTA 3MQTA 1J0KA 4UIOA 4LAVA 3L4XA 1QPQA 1W1A1 3NL2A 1Q45A 3RHGA 3WDRA 2WC7A 1JIBA 1X6NA 2BHYA 3CO8A 2A4AA 1CI1A 5CJNA 3OYZA 3SGGA 4WLCA 3AMCA 2XDFA 2SFPA 2UZ9A 2NLIA 1VCVA 4ECLA 1JCHB 3H54A 1PTGA 2G96A 1XC4A 5HT1A 1JZ5A 1LOLA 3REQB 5AYBA 5CC3A 2F6KA 4JXCA 5FESA 3QOKA 2HDJA 2CWNA 5CKSA 1ISYA 4GUFA 3E49A 5K9CA 4DIPA 4DQWA 5HW7A 1SSGA 3BICA 2A3LA 3WYZA 5E93A 3OOQA 1M04A 3HMJG 2E68A 4V1XA 4NAFA 3B7XA 1JCTA 1W3JA 4QLJA 2YA1A 1WXJA 3DI0A 3LGGA 2WW5A 1LJYA 3NM1A 4XBSA 1KCZA 1FH8A 5BRQA 1EP2A 3U4AA 2BVWA 1LOQA 3PUEA 3VIIA 1UWAA 2HS6A 3RCYA 1TA3B 4QT2A 1U30A 3H6OA 4NYUA 4LBRA 4LTSA 4QIBA 3F2DA 2Y8UA 3T7VA 3R89A 2YCLB 2XG9A 4XAPA 1J11A 1TSIA 7TAAA 3GUWA 1QVBA 4HTYA 4BQ3A 1B3WA 3WQDA 3VK5A 4TX8A 3A23A 3AYVA 4RE2A 1B3VA 4KFOA 1X8CA 1I45A 2XP8A 2RFGA 2W91A 4IX2A 2PDBA 5JIWA 3SN1A 1O12A 1DWHM 4R3UA 3UWEA 2WV8A 4HSHA 3H12A 2DG4A 3E0VA 4UMBA 3T44A 1V0NA 4LEQA 2YB4A 4ZXLA 1FWGC 1PBKA 2E6YA 2W5FA 1OINA 2Q3OA 3INPA 1XH0A 1AW1A 4DAIA 3QY8A 2NWSA 1I8JA 1NOWA 5HAOA 1FKFA 4N9BA 3LEPA 3XISA 2ALRA 2IS7A 1CLXA 3DESA 2VTFA 1XBZA 5A2BA 2R1LA 3IAQA 4MY1A 4Q4SA 4S38A 3R1ZA 2WANA 5HR7A 1HP4A 2HVNA 3VNZA 1N8IA 1OWQA 4GLEA 1EZ2A 3AIBA 5T8GA 1MVYA 2PRHA 2MLZA 3VD3A 1KXTA 4L80A 4I9AA 4C90A 3AZRA 4EXBA 3ITOA 5HQLA 1GHRA 5BOFA 1V5XA 3CHEA 3KCLA 1KFJA 1RSCA 4XZHA 1JGMA 2POZA 7PTDA 3TJXA 2VC5A 4ZB2A 2KI3A 4CCEA 5EMLA 3AZSA 2DG9A 1S2CA 4C7FA 2D0HA 4K3ZA 2DIKA 4UB9A 4PRWA 3BLLA 4JTLA 1R8LA 4JN7A 1A5OC 1GJWA 4B5XA 1PHWA 5D02A 5C2XA 1WO2A 1K4GA 3BE7A 1A5AA 1JVWA 1JDDA 4C02B 2RURA 1V08A 3W1QA 2VMFA 3DENA 2PF8A 2VZTA 3R7MA 2ADAA 2XH4A 3WELA 1XPGA 2V5JA 1M3UA 2PTYA 3E0FA 1Z44A 1T5AA 5LKYA 5T9CE 3O2LA 2O0TA 4F2UA 3VDHA 1SU5A 1O5XA 3S6OA 1OIFA 3I68A 3PRAA 1Y7VA 3W1TA 1US0A 3UERA 1GVRA 3GNNA 1MW3A 3ARYA 3WNLA 4EWJA 1PUDA 1XLBA 3WCZA 1FTXA 3N18A 4EANA 2ZZ3A 5DQPA 1DHKA 1DPMA 5U4NA 5HJLA 1Q6DA 5J6EA 3LOTA 1PKYA 1O6IA 5HQEA 9XIMA 3PRBA 3B0UX 2EAWA 2ZR5A 1ZBCA 1AQ0A 3BW2A 4UOJA 1IT0A 4I5RA 4LC6A 2EJAA 3EDEA 4W87A 3FLUA 4JTKA 3THCA 3LLXA 1E4IA 4KBXA 1LQ2A 4JEQA 5HMSA 3QBUA 1DORA 1E4MM 4JFLA 3EX4A 3M64A 5AZ1A 1W56A 3PZMA 2Y7EA 3GTHA 4NRRA 1V6YA 4YTUA 3GPKA 5HWCA 2OEKA 9RUBA 5I6SA 1X98A 4X61A 1W1ZA 2ZTJA 4QHRA 2Z28A 4QT3A 3UYCA 5G5IA 1HIZA 4AZGA 1QNQA 1T96A 4GIAA 3B9AA 1YE4A 4YL2A 3HG2A 4D1JA 4RK8A 4JQ4A 1MXSA 4UQEA 1WOAA 1H7PA 1PKLA 2X16A 4NUWA 3OLDA 3D0CA 3W88A 4HBOA 2Z24A 2GUBA 3G5EA 4H7CA 2BDQA 3I7QA 4RV3A 1XCWA 3W70A 1YEYA 1SYTA 1XFBA 2D2GA 4KCUA 3P84A 4C6IA 1NF7A 3L5MA 1HO4A 3AXHA 1Q8AA 1XH2A 3CLMA 3GUGA 4S3BA 3TXZA 1YW1A 3FA4A 3ABZA 1W37A 3M0KA 4KGJA 3TYEA 2BG5A 3UCDA 3WLIA 4ML9A 1EPVA 2ZUWA 1EB3A 1KKOA 1RVKA 1R7AA 1VLWA 3LB0A 3B3DA 3LSCA 1IR2A 3V16A 1XLKA 3CH0A 2ZR6A 2QJNA 4MMWA 3C5QA 3N6QA 4L1XA 3R94A 1MI3A 2VP8A 3STEA 1Y5VA 2HE5A 3TOYA 2KX9A 5MHBA 3TC3A 2X1SA 4UTHA 4CQ8A 4PB4A 3JUGA 3LU2A 5JVLA 2XGZA 4JOMA 1UKPA 4NAFB 3T9PA 3BAJA 1VBGA 1CDGA 4L4MA 4PBFA 4KFNA 2ZIDA 4ILSA 3NFUA 3BAWA 5CSYA 3I7SA 1OK4A 1LM1A 2OO0A 1P5QA 3G1RA 1YW5A 5F4WA 4S3AA 4ADUA 3GNOA 3KTCA 1OEPA 1IGSA 3CIXA 1B5TA 3TH6A 4G1NA 5DXYA 2OLSA 5KETA 2CIPA 3WQ8A 1HQTA 1TE6A 1HVXA 3IUIA 1FWNA 2QJHA 2LGOA 3UCQA 4UFMA 4O12A 3GVRA 3EOSA 3EXTA 5A6LA 4YLWA 1XBYA 5D9OA 1ZL1A 3HQOA 1DTNA 3GDTA 3JU2A 1DOSA 3IPWA 3TA9A 1F05A 1S5VA 4EAYA 4JQ2A 3DYOA 1U33A 3DFPA 4HYRA 1OG0A 1GQIA 1B30A 1MEIA 2R24A 4MZYA 4ZB0A 1QPNA 3H70A 4LAYA 3QHNA 3O63A 3OZYA 3OU8A 3V0SA 4M7SA 2GVEA 4B5WA 3B06A 4C1NA 3AIQA 5B7YA 1GJPA 3QXBA 1E71M 4D6GA 1A5BA 2DSWA 3SECA 4XZLX 3WJYA 2FIQA 4EXQA 1DE5A 4GJ1A 1CLVA 4JQ3A 1KRCC 2GLKA 4O13A 3ANYA 3MANA 3BMXA 5FI8A 4YTTA 4LC8A 1XFCA 2DZSA 3KL3A 4LUTA 2ZX7A 4C6CA 1UR8A 1FFQA 1K7XA 3NQAA 1OABA 1F3XA 4W8AA 4M3PA 1FAPA 1VF8A 1AH0A 5CBJA 3KRUA 5EMJA 2FVKA 3LXBA 4J5NA 4JIIX 4XVDA 3CV6A 3G6LA 1Q6GA 4DF2A 4B9YA 1VBJA 1HFBA 1KNWA 1TPC1 2QNEA 1KGXA 3V75A 3SM0A 1XYCA 4NJHA 4AD5A 4JYSA 2J62A 3MWCA 3BQ5A 4L6HA 3K1DA 3SI9A 2CLPA 1PSCA 1X1NA 1R3QA 4J3ZA 2RDXA 1EC8A 4HNTA 5AY7A 4GIRA 3DH7A 2BVDA 4ORMA 3E12A 5CPNA 1XS2A 3W25A 2QLYA 1Q3NA 3N6JA 4IM4A 4YCOA 3IRSA 4CKQA 4R33A 4Z2LA 3SCTA 2DUAA 4WSJA 4JFUA 1A5LC 1IWAA 1B9BA 3MP3A 3C2FA 4U3AA 5LIUX 3E0IA 3LV6A 3FN9A 3T40A 5AN7A 3R2GA 5LGZA 2PFHA 1AODA 3M0VA 3NZGA 3LHTA 4KESA 4K38A 1YNQA 2QJMA 2QPUA 3LV5A 4Q8VA 3B9DA 4PR4A 1F3WA 1MDRA 4RPQA 3C0SA 2C7FA 3SCQA 5A94A 1E6RA 2QKFA 4XD3A 3I10A 4H3DA 5D4YA 3WQPA 3WLRA 3UZ5A 1TPEA 1F3EA 3TLQA 4PYSA 5C0QA 4W9TA 1QAPA 3U2ZA 4N9DA 1CCWB 1M9HA 1J2BA 2XN2A 4Q4OA 1RZMA 1J93A 4O4WA 1G4TA 1OT2A 1Q85A 2NXIA 1FWJC 1Z69A 2DZUA 4TIMA 3H53A 1AMKA 2BWGA 3WK2A 3P14A 5DO8A 3KW3A 3M9YA 2OWWA 1IZKA 4GC4A 5HUAA 2WOQA 1E1FA 4H83A 3VIOA 2XINA 4HJWA 4FO4A 3GHTA 1R47A 3CUFA 5C5YA 1P0KA 1C91A 1O5RA 3BLEA 5B7ZA 1XCXA 3K8KA 5I3GA 3EWYA 3W1AA 3VD5A 1V02E 1RP9A 2ACUA 1DWFM 2TODA 3NXFA 1AFSA 3GNPA 4A3QA 2QV4A 2Z6IA 3GG7A 1UH2A 2GOKA 1HJWA 2BS9A 3W7DA 5JIPA 3LTYA 4H7VA 2PC8A 1D2KA 3RILA 4XZ9A 1UYQA 1DYSA 3E2VA 1L6WA 3Q4DA 5CGMA 4MGGA 1OGSA 1ZCNA 4M82A 3VKBA 4UZUA 3KAHA 1CGYA 2BHZA 1UWTA 1UR2A 1ROTA 3WLMA 1SR9A 1GPFA 2ZQUA 5G1MA 1XIHA 3LYEA 3BSGA 4LOCA 1FDYA 1W1B1 1A0DA 2YFOA 3W7PA 2BGNE 1DXIA 1MXDA 3UA4A 1W2PA 2QDGA 3CV7A 1NTHA 1A3XA 1AZ1A 4HPHA 1GKRA 4DT4A 4FAPA 3EWBX 2ZC8A 4YWIA 2Y63A 3CHCA 5CG7A 2E40A 3U2OA 2Y1HA 5I5RA 1D7IA 3C0QA 5CPQA 5FJPA 1F6PA 4P7QA 3E5BA 3HJEA 4R0XA 4BKNA 2J78A 1D3HA 4NKCA 5PTDA 4J9JA 4NJGA 3U0HA 3LLFA 5FAJA 2Y89A 5IM51 3DGBA 3RU8X 1ZJHA 3L12A 1QZ2A 2P53A 4TV6A 3VE7A 3BLDA 4FR1A 3JVAA 4ML4A 2HISA 1FHVA 3CLWA 2R1PA 1HJUA 1JPMA 2IXVA 5IFPA 4S39A 5IFTA 2DGAA 4JDBA 3PZNA 1PCKA 3PJTA 3GR4A 3KVJA 3U5UA 4R7OA 3VOCA 3W1NA 3TFCA 2V6AA 4X9SA 1JJKA 3CB8A 4E3VA 1IE7C 2XVLA 2HBXA 4UNIA 3VCRA 2OELA 3IJQA 4LB3A 4EVZA 1TJ1A 2V30A 1FKIA 3UG3A 5JMUA 1RHCA 3G1FA 4GY7A 2Z7GA 2Y2WA 4AU0A 1B0IA 2YYTA 4Q8WA 7REQB 2IKJA 4ZPTR 3WSUA 3RR1A 3CHFA 3H9RB 2ZWYA 4AMCA 3DFYA 1DJXA 4H9XA 3TYCA 3QGVA 4MJ4A 5U7SA 2PD9A 2ZUVA 4DWSD 3WQ6A 3EWUA 3NR0A 3O07A 2ZE0A 3NTPA 1KM1A 3CMJA 4OHQA 5K3VA 2VI0A 5MKGB 3A13A 2XP7A 5BXSA 1UD5A 2PDJA 4BF5A 3UZXA 4ZTXA 1GTEA 4UMCA 3MKVA 4QS5A 3SUSA 3HPXA 1G5AA 2REQA 3AWOA 5EMKA 3SQSA 1EDQA 2RGMA 4GABA 1E70M 5FJTA 2V5DA 3VDCA 3WD1A 2R14A 4ZEPA 3OOBA 5BXRA 1EC7A 2E5CA 1K8YA 3W87A 2AKMA 3T0BA 4NU7A 3TAOA 2H90A 4P2VA 4L56A 2J7GA 4GKTA 3WF4A 4H8VA 4UNKA 2X40A 5AHFA 2VX6A 3CGMA 5D30A 2FJUB 4E3TA 3CO4A 2ISSA 3QSRA 3TTEA 4JGDA 1GPWA 3R6IA 2WCAA 2RUQA 2VUNA 3NQ2A 3TTSA 1XICA 1VYSX 5C2CA 3FAWA 1JCYA 4XBKA 1EWDA 1L8NA 5CPSA 2QS8A 3NZPA 3L5AA 2E0PA 3CAKA 1L0PA 5FD0A 3URAA 1DXFA 3W71A 1UC4A 5AYYA 3WLTA 4X60A 3AALA 3R0DA 2F8QA 1WUEA 4GFIA 1IR1A 1FCQA 5CGQA 1FWTA 2CBVA 4E8GA 2X30A 3NO5A 4JIQA 3O6CA 2EBNA 3M46A 4Q7IA 1M5WA 5M5DA 4ERGA 2ATSA 1XLCA 4C6LA 3C3NA 1YDVA 1NIUA 4MJ2A 1NWSA 1UH3A 3E74A 3VDBA 1S39A 3RLGA 2ZZ2A 1WKDA 5EA9A 4BHYA 4EPBC 3TC7A 2QIIA 3R8RA 4LUYA 4HPGA 1BKHA 4PUDA 4DRKA 5L6UA 3ES8A 4XD6A 5D38A 4ZTYA 4YWSA 1XLFA 2RJHA 4MJMA 1GVFA 3H23A 4GNKB 1UKTA 2DQWA 4NJIA 4Y9AA 2X1IA 4IIHA 1LG1A 1H1YA 1MW1A 3JS3A 5T9BG 1IHIA 1IQ8A 5G1TA 5DRIA 2XH2A 3K5XA 3QMTA 3QY7A 2OYKA 3UQBA 4LXFA 2CNCA 2HV5A 4Y6GA 4D8ZA 3W7CA 4K1GA 1FKSA 1VGAA 1R7OA 2X0SA 3VGFA 3QPEA 1A5MC 3TX9A 2QXWA 3HQNA 4A4AA 3CL8A 3W1MA 2Z1KA 4IGHA 1JF6A 4WK9A 3MI3A 1LWHA 3RAOA 3FXGA 1KCLA 4Q8UA 3M1ZA 3ZFHA 3UJSA 4W9OA 3OZOA 3B8WA 1W5MA 2RQSA 3CL7A 4QCFA 4DWSA 1T11A 1VQTA 4W8BA 4CCCA 1JZ3A 5LZLA 2OXNA 2NT1A 4PE8A 4FI4A 5E0CA 4NVTA 1E40A 1DXEA 2JFEX 3PJXA 2CHNA 3S2NA 4LRTA 1QTWA 4JL1A 3N2OA 4HMEA 3KX6A 4XTDA 4H9VA 4KS0A 3MP4A 1M41A 1VP5A 2FZBA 2E9MA 2IUZA 1OJXA 1SJBA 4ZGYA 2VD8A 2JIWA 5AC8A 3OIHA 3S2CA 4R27A 3GDKA 4X2RA 3QW4B 3M5VA 3T2QA 3O05A 3V36A 4BF8A 2VEMA 4GCAA 2A85A 4AC7C 5J5DA 3ATZA 4H4IA 3EZ4A 3BVJA 2BY1A 5DMNA 3DERA 3UETA 1E6PA 3VOJA 1DJIA 3WKZA 1UZDA 3LBMA 2GJLA 4EX4A 3AXMA 3TCEA 4AD4A 5JBEA 4TUFA 1ICSA 3NQVA 4G7EA 2BASA 1R2RA 2Q6ZA 3QFEA 2WSPA 4PTVA 2GDUA 4XZIA 2PWGA 3SY1A 3TUUA 2BY0A 3KDNA 4CLMA 2QPSA 4XO7A 4W89A 4L3NA 3OLEA 3Q58A 4E38A 4OIFA 1ADOA 4E5TA 3DHDA 5EMUA 4KERA 4C65A 4M1RA 4RZ4A 4QE5A 1UPPA 1FX6A 2FDSA 2QAPA 3GH4A 5REQB 5CJMA 3CH9A 3U6WA 4WEVX 4Q8PA 3SUUA 1KRAC 2KFWA 1FXPA 1V3JA 4XD4A 3SO7A 4IUOA 3CXOA 3VIFA 4LUTB 2LPVA 1FWHC 5I79A 4LNCA 4ZCWA 2ISDA 4D6HA 4QITA 3VNJA 5HANA 4F2BA 5BXJA 3DBPA 1EQ3A 1R9ZA 1OG6A 3E02A 4UFJA 1B6CA 2DSZA 5I3HA 1EJVC 2ZUMA 3BGAA 1JPKA 2PMQA 2X2GA 1O5QA 4HHPA 3W7QA 2PAJA 3GXTA 1TTQA 2ZYFA 4IJBA 3UPMA 5LNRA 4PC8A 1OK6A 1JNEA 1GONA 2IW0A 5ECVA 1TMQA 4E2OA 1XLHA 1GKQA 1QI0A 4LAWA 3ZLGA 4P7NA 2FVLA 3LI0A 3MI6A 2B5UB 4P7OA 5HJXA 2G3IA 3SRDA 4GBUA 5F2IA 4EIVA 5BCAA 3EYPA 3ABQA 3ENLA 4L61A 4AMAA 4QJ5B 2HWGA 1KR0A 1RALA 5K4ZA 1KXQA 4HPXA 2PLJA 2REQB 4LAMA 4YVPA 2XZ7A 5F2GA 4C6DA 3LMYA 5H91A 4LV9A 1OQFA 2D23A 5CZ0A 3VM7A 4URIA 1CXFA 3PZGA 1LCOA 2G3MA 1T40A 2ZDRA 3VX1A 2CBUA 4CD6A 3QM3A 1PZ2A 2V5CA 1QW8A 1UG6A 5MF5A 4F0KA 2FFIA 1EXPA 2PPPA 3N4AA 5CLTA 5I09A 3IVSA 2DZBA 3DOPA 4F0SA 3QFWA 4NZ3A 5FL1A 4DXVA 3ABRA 4A3RA 2GJPA 1PV8A 3G1YA 2QZRA 3RO6A 1U79A 3PR2A 3WNMA 4C6PA 3T6CA 3N3MA 2ISWA 4JX6A 4X0VA 3UFYA 4O53A 5AZ0A 3CBWA 1J4EA 2OWCA 3GS6A 2J79A 1WDWA 2GK1A 1IEVA 3WDHA 3PAJA 2ZZ1A 3WH6A 3PFMA 1WDDA 2PGWA 3BOLA 4W84A 2QCGA 3BAXA 3UA3A 2K8IA 3NIYA 2PP3A 2Q02A 3GKAA 1KQZA 5D9PA 3VC6A 1P0NA 2BY3A 3NQEA 1Q65A 2D2HA 1LRNA 3QZ6A 4UZSA 1M7JA 3QMRA 3CQKA 2OSXA 1H7OA 3MO4A 4KT2A 3QMSA 1FBAA 4LYKA 4FZIA 1FKRA 1TVNA 1XLLA 1L6YA 4ZFCA 1L6GA 3V18A 2A7RA 2A3EA 2P1FA 4E8DA 2A5HA 5ENLA 3HG3A 4DXKA 5HW6A 4L9ZA 3LGDA 1CENA 5EY5A 3BMBA 5TF0A 1T7LA 3BCFA 2EEXA 3VNIA 1YTKA 4H19A 1XV8A 4RNFA 1GORA 3BC9A 1M03A 3WL1A 4XZWA 3E2SA 3PZIA 1IZJA 2GVJA 2OX4A 1JZ4A 3KZSA 2FPVA 3C2OA 1YRRA 3P8IA 4J3VA 3W6LA 4PMOA 4GCXA 1QASA 5JBFA 4LAXA 4ZOBA 1XF0A 5I3IA 1IXNA 4B3ZA 2GSEA 3GFYA 4XG1A 3GU9A 4JFTA 4ICMA 3K13A 3E0LA 4Y9OA 1C3FA 4MFEA 4PFHA 4DUXA 4Q7BA 1WBJA 4TOQA 4Z1DA 4WF7A 1X8FA 3EOUA 4LVFA 3NL5A 4WOZA 3OHMB 3F4DA 4QFUA 3T07A 1ZENA 1F8AB 1W3KA 4H9UA 2PF0A 3S5NA 2VD9A 2WMGA 1DTUA 1Q5MA 1U5VA 1POKA 3ARVA 3GO2A 5GVJA 5C9WA 4AZHA 2Q71A 4QAIA 4A2SA 1ISZA 1Y5XA 4GIEA 2X0HA 1W1TA 3GG8A 3BW3A 4AISA 4ALDA 3WO8A 3ARSA 5F4XA 3TR2A 2BXVA 5AHMA 2VR5A 1ELSA 3BLKA 1UR0A 1ZZMA 4NI3A 2QDEA 3TN4A 1B9ZA 5CZKA 4WD0A 4G50A 3B03A 1MW0A 4IJCA 1RP8A 4E4PA 4Y8FA 2VYOA 1YPFA 2ZUUA 2X7WA 5A6SA 3W3OA 4JKMA 4O0ZA 4L6DA 3W23A 3CTTA 5TQLA 2E8YA 4GX8A 4M8UA 3B9EA 4GE8A 2NUWA 2J7CA 2G41A 3TYUA 4JQAA 4BI5A 2B0MA 3NZRA 5LXEA 3A9IA 3TV8A 2V69A 3O7UA 4JIEA 4Q4KA 3UP8A 4PEKA 2WSYA 3QPZA 2RUSA 1UW9A 3A4XA 3UGVA 3TCZA 3NQ7A 2OZTA 3IGXA 3ONBA 4YS1A 3B0YA 2XHYA 4AVOA 5AFDA 1AQFA 2CLEA 4FS9A 4M5PA 3NZ1A 2IQDA 3MU7A 4E4UA 2JIEA 1WXYA 3VIPA 2YW3A 4Q4RA 4O0QA 3TSDA 4HNUA 4ZQCA 4I9MA 4PH6A 4B5NA 2FVMA 1EJXC 3D6NA 2Z0IA 1BHGA 2NQ5A 3T09A 2GJXA 2GSJA 4TVDA 1WP6A 4I90A 3N2CA 1OC7A 3WD2A 4C60A 4UBPC 3G3MA 3WH7A 1AQMA 1WV2A 1F9CA 1LL7A 3L0GA 1Q63A 3VNMA 3CZLA 4HBKA 2V3EA 3W7GA 3TQVA 4BWLA 1JULA 4GUGA 3GH7A 1TVPA 4H01A 3QGAC 2CZVA 1CECA 1L8PA 2J7FA 1VBHA 1SR0A 3MSDA 2YIHA 4IFRA 1QXLA 3S5ZA 1EJRC 5CPTA 4JFSA 4UQAA 3FYPA 1V0KA 4WJEA 2I57A 1OD8A 3BOFA 1UP2A 3CNYA 3OGRA 5A3HA 1WKYA 4ZQPA 2D69A 1E6QM 4O2TA 1SSDA 3GWQA 3WMLA 3RJYA 1TPUA 1A3WA 1I2PA 2WVUA 1NQ6A 3LM3A 1AH4A 2PZ0A 2G37A 3WX7A 1BEUA 2H9AB 4YU1A 1TZ9A 3VTRA 4Q8OA 1B2YA 1GW9A 4AXKA 3N9KA 2MANA 2QV5A 3EWDA 3A3HA 3UW6A 3FVMA 4IMDA 3TSBA 5BROA 3GC5A 3UXIA 4P8VA 1RPXA 1XP3A 4JQ1A 5CEWA 1ECEA 1F4HA 1TJ0A 4DF1A 3UQAA 3FEMA 2Z1XA 1ZUAX 2E77A 4R85A 4LVAA 2AKZA 3E96A 1NSGA 2WC4A 4JFMA 3OG2A 3REQA 2C79A 3P6LA 1PWLA 3MHUA 1REQB 1XYMA 2MLXA 4Z2HA 2Y5JA 4OOUA 5FKYA 2VM8A 5C9RA 4RDWA 4U85A 4DO6A 3BMWA 3NQGA 1TPFA 1QI3A 2XGIA 1EX1A 3G6MA 3AI0A 3TYZA 2G95A 2QJGA 1OZQA 5B80A 2ZUSA 1XDMA 2ZUNA 5ECUA 1YTEA 3QLLA 4GGHA 4DNMA 4GPNA 3ERPA 5FEXA 3LCIA 4RNIA 3LHZA 4DH0A 3M6YA 3RCNA 3DFHA 3L23A 4GI8A 4N4QA 1KV8A 5IBXA 4F9DA 3T0DA 2VZVA 2ZBTA 5D04C 1J5TA 4IP7A 2Q5AA 3RCMA 2AGTA 4IXHA 3ATYA 5JUVA 1M01A 3M0IA 4LWWA 1S1PA 3DU0A 4KIEA 2PWEA 4DY1A 4B90A 2DSKA 1K02A 3QPYA 5HMDA 1XYZA 4AYSA 4PMYA 3MT1A 3FJ6A 4JR5A 1UD3A 3DFSA 3TOPA 4IQDA 1JYXA 3CGNA 1JQVA 4H9MA 2AQWA 4ZS6A 1VFFA 4IH3A 3AHTA 4DO4A 3RG6A 1RCXB 3FHQA 3N15A 3CIWA 4UOQA 2CBIA 1M6JA 2PDWA 1Z41A 4HN4A 3FEQA 2CLOA 2E6AA 5H1WA 2HK0A 2ZRWA 4CQAA 3M5ZA 1J8VA 1FH9A 4YTQA 3ZYZA 1W1VA 4W7WA 2D22A 4KEUA 3ARUA 1VZWA 2WBGA 2VOMA 3KWXA 2EPMX 5DXXA 3HPAA 3W7IA 4Z42C 3VIJA 4Y2WA 3GDMA 4ODRA 5LIWX 3MHGA 1UD2A 3CQIA 3I7RA 1O1ZA 5C70A 1D3CA 4IPIA 4S2BA 2E25A 1UPMB 3CK5A 3OVPA 1PL9A 5E9AA 2CYGA 5HTGA 2NW0A 3K30A 4K1WA 1ZTVA 3LPFA 3MZ2A 4QEHA 3N14A 2QUUA 2DSUA 1AH3A 4GXMA 5I02A 3W26A 2CITA 3WN6A 1S2VA 3RX2A 2XIQA 1BD0A 4NSBA 2C15A 3RLUA 3WY1A 5REQA 5AC5A 4M81A 4NJKA 3UWYA 2XSAA 2JEQA 2VXNA 3NQDA 2Z2AA 3CT7A 2NVAA 4MWAE 2E4TA 1ODUA 1RV8A 3NDYA 2CKSA 1UJQA 3CAVA 1JCJA 5F2MA 1P1MA 5D2VA 4O11A 2UV8G 2WXDM 3N2BA 1ZB5A 1LWJA 2OB3A 2AL2B 3B4YA 4Q8QA 4ZOAA 8CGTA 4A21A 1TV3A 2BGQA 2GYIA 2EQDA 4AIBA 3N19B 3EPOA 3G1DA 2I9EA 2F7FA 1JG9A 3AU6A 4W5ZA 3EX6A 3NNTA 4WQ6A 4XX6A 1DJYA 4BEQA 3KVLA 3ZLFA 7TIMA 1CNVA 3M44A 1CZ1A 2NX1A 4JTCA 2IQ0A 3GH5A 4B3LA 4BI6A 2W66A 2J8GA 3EMCA 2H6RA 2QEZA 1PX3A 3VDGA 4XVEA 4O19A 4XUYA 3RIKA 3AMGA 2PV1A 2D9FA 5CSSA 2YL5A 1RK6A 3IGSA 4FSAA 1MMFA 3UGRA 1W1IE 1Q6OA 3EWWA 6TAAA 3CEPA 3ZWTA 4HSNA 1VJZA 1FCBA 2EG6A 3HGRA 1NFBA 3B97A 4QROA 1DQWA 3AIVA 3QHMA 4GYFA 1PX4A 3K4DA 4GZIA 4JKKA 5D2XA 3FAPA 5LNUA 4WDXA 7A3HA 2C1GA 2XU2A 1J01A 4TMBA 2CLKA 3W7MA 2DEPA 2YCJA 3PZOA 1GQNA 5AYXA 2F2KA 4GZEA 3SRFA 1ONRA 2HNEA 2JKPA 4PMNA 2FHCA 2WLYA 4DUOA 4J3XA 2VT0A 2X7VA 2FZ9A 4H41A 4N4PA 1UWIA 4GO9A 4JL2A 4DWDA 1ADDA 4PMXA 5FA5A 4WX2A 4Z2KA 3PN8A 1I1XA 3EEZA 2C1HA 4LAOA 1SJDA 3L0NA 4XTIA 3AISA 3GKFA 2HJPA 3STFA 4CU7A 1G7UA 1MZRA 3WUGA 3G8RA 3CPGA 2WMIB 3RX4A 4EF8A 4QSFA 3VINA 3STGA 3E5PA 5CBBA 3V7PA 1JCXA 1A0EA 4HPJA 1W9BM 1R86A 5MKGA 3TZFA 2FZ8A 3HOJA 3SN0A 1RCOB 4UCFA 3PY2A 4IP5A 2YZRA 1LQAA 4XISA 1HL9A 2KGJA 1P4CA 3CV1A 3KZ7A 2YYUA 1XRTA 2V82A 1A5SA 3KOYA 1QO5A 1DKWA 1QPRA 1TV2A 1R3RA 2BMBA 4L9YA 2R9RA 2QAFA 1H0IA 1P1XA 1ONXA 2J27A 1U22A 3S9IA 4AHPA 3S5OA 3GFXA 2ZA3A 2BSLA 3M0JA 3O5GA 3UPBA 1XIDA 1A80A 3BLPX 3AIWA 2WSRA 5BXPA 1VPYA 2PTWA 4UFLA 5FACA 2V3FA 3GAKA 3AICA 3VNDA 3APGA 2R1KA 3G2GA 1NDWA 1X96A 3DECA 1UD4A 3R8GA 3ISIX 4JTDA 1E3XA 4Z0SA 3EWCA 1A0CA 1VB9A 2W63A 1C9HA 4U2YA 3DFNA 3WK0A 3CPRA 2J6VA 4FOJA 1FWRA 4YNGA 3EXRA 4GO8A 1IXPA 1GVIA 3GZAA 1ISXA 3S46A 3G1AA 2QUVA 5HK4A 3S9YA 2HXUA 1RQEA 2PDMA 4JIHA 2OZ0A 2GVYA 3O6AA 3LNPA 4DYKA 3B04A 5HWNA 3WF2A 4K7YA 3BZGA 3C2YA 4MWAB 2D0FA 3VGGA 3MCMA 1TX2A 3BGGA 3ELFA 1HTIA 4EOUA 2VDHA 4TR9A 2YBTA 5H8MA 1JPDX 3WLPA 4RW5A 4MNJA 4LUSB 3P5ZA 3WDPP 4ICNA 4DJDD 2ASHA 1I6NA 3F4NA 3NL6A 4G5DA 2WQPA 3H2EA 1R6WA 3FA5A 3M4HA 2P0IA 4MOZA 4QZVB 1IZCA 4ZE4A 1TV8A 3PULA 1NWTA 1JDFA 1FWBC 3A24A 4L65A 3UXKA 3W74A 4X0NA 1V3HA 3P82A 4Q4QA 1ISVA 3CIVA 8RUCA 4F3HA 4P5UA 5HWBA 3VUPA 3GXIA 1RQBA 4ES4A 1OFEA 1VPXA 2GFTA 2QCEA 1YDYA 3SBFA 4PGLA 1ZQ5A 3WK1A 1N82A 3W7NA 1PZ1A 2OQLA 3GNXA 4UMAA 3LZ5A 3EKGA 3TWBA 4FNRA 3A3XA 3H7RA 4KWWA 4D9PA 8TIMA 1D7JA 4DAFA 2MPHA 3F5KA 4H6RA 4WOQA 6REQA 2XM1A 5LA2A 1E4LA 3S6TA 3PSVA 3PBMA 2XM2A 4ERIA 4EE9A 2I16A 5A8QA 4DO7A 4NASA 3UZYA 5ABEA 2PWDA 2P8BA 1ZCOA 4XAFA 2Y5EA 3R12A 5C7VA 2EPOA 2YL8A 3IJDA 4OUIA 2Y7GA 3GDRA 2EF9A 2DJXA 3S2LA 1P43A 3OEXA 1G69A 3SN4A 2VR2A 4I5XA 4DZAA 4EWND 3PBUA 1TWSA 3P60A 3TTYA 4FEZA 4JNMA 5I0DA 1BQCA 5E0KA 2JF6A 1P0BA 1QUMA 3N73A 3PTDA 4P7RA 2ZA2A 4GVFA 2ZTKA 3V5CA 4JTAA 1UKOA 3L4UA 3RLVA 5LXXA 2OKOA 2QGYA 2J66A 3TYDA 1JXJA 3ITCA 3WG6A 2VELA 1D7KA 4ATWA 2YCEA 2VFHA 3G77A 3USZA 4HK5A 1KFBA 1U1HA 1D7HA 4JD4A 3CHDA 3MVIA 4UFHA 3ZO9A 1H09A 1YATA 4YHEA 3MSYA 5EU9A 2YCIX 1E1CB 3C4UA 4GXWA 2CZEA 1BXNA 4Z08A 5E0FA 2FZDA 4YCPA 5A95A 4JYFA 1N7KA 1XLJA 3VKAA 1KFCA 2C16A 3UF8A 4R7JA 3MBFA 2O4MA 3C6CA 3GE7A 3E38A 3RM9A 1HUVA 3WF0A 2R8WA 2HCVA 3IJIA 3K4WA 5LGXA 1ENUA 2EKGA 4XKYB 3MB9A 5DLCA 3A22A 4YYFA 2Y24A 3ARWA 1S3TC 3WNNA 1EGMA 4HA0A 4TX6A 4HZ8A 3SEPA 2FTYA <