2YBUA

Crystal structure of human acidic chitinase in complex with bisdionin f
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
376
structure length
376
Chain Sequence
AYQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACIDIC MAMMALIAN CHITINASE
publication title Analyzing airway inflammation with chemical biology: dissection of acidic mammalian chitinase function with a selective drug-like inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 129
structure length 376
sequence length 376
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2011-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ybuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2ybuA01
4LYPA 4M29A 3GNRA 3FHAA 3VDHA 2BFGA 1E6SM 1CEOA 4D6IA 2VZUA 2ZUWA 3WF3A 3W53A 3W24A 1HJXA 2GJRA 2X2YA 3ZJ7A 1B30A 3ZR6A 4UFJA 1RH9A 1GW1A 1LG1A 4UQEA 3VOCA 4FLQA 1XRVA 3AMLA 1AVAA 3MMUA 1GOIA 1JI2A 4XUYA 1QHOA 1BTCA 2XFRA 2YL9A 2FHFA 2J4GA 3KL0A 1NM9A 4PMNA 2EQDA 1W2PA 3PZQA 4LYRA 5BYWA 5CQ1A 3WL0A 1EOKA 3M07A 4PMUA 1ITCA 3AYRA 3CMGA 4MNJA 3BXWA 1C7SA 1U2YA 3BAKA 1OIFA 2X0YA 1X6NA 1Q6DA 5GPRA 1S46A 3AS3A 3WQVA 5CGTA 4F66A 3TP4A 1JDDA 5A94A 2VX6A 5CLWA 2YA1A 2DH2A 4CD5A 4JHOA 3WMSA 4AD4A 4GIAA 1E0XA 2ZE0A 4J3UA 2XG9A 3IAPA 3WNMA 3W38A 2QMJA 3L4YA 2G3JA 4BF7A 1PZ3A 2W67A 3CZEA 3VUPA 3AIUA 5C8BB 5KEZA 1E0VA 4AD2A 1V0KA 2QPSA 2IXUA 2ZUSA 4UQBA 4JZ5A 5FIPA 1CGWA 3CZKA 1JAKA 1GOWA 4OBSA 4ACYA 4DM2A 1D2KA 4XX6A 5IHRA 1GOMA 1W3KA 4X0NA 4U31A 4E8CA 2EPKX 2J7FA 4PMZA 3LMYA 1DTUA 5IFTA 1HKIA 3AS0A 1FP8A 1JZ8A 1AQ0A 1GNXA 3VIJA 1HXJA 3RPMA 2CKRA 3WDIA 1OCQA 3VIPA 3CBWA 1E4IA 1CECA 4LX4A 4L4PA 2VCBA 3SCTA 4P8XA 2WMJA 1Y7VA 2CETA 5E6ZA 1UWQA 1B3YA 5D8ZA 1ODUA 2WW5A 3WH7A 5JH8A 2EBNA 4W5ZA 2GDVA 1F4AA 2DSUA 3WNOA 1HL9A 4EE9A 1B9ZA 4RE4A 1UR1A 1BSIA 1C8XA 4GKLA 1WDPA 4ATDA 2WMIA 4CCCA 1J10A 5CPSA 3N11A 1UZ4A 1E73M 4D6FA 4P8VA 3AZTA 3GXIA 1WZMA 1GQLA 3FHQA 1B3ZA 1W32A 2GFTA 1CGVA 3WDHA 2DDXA 3ALGA 4WJXA 2NSXA 3ZJKA 1CGUA 2A3HA 2J7CA 1LWJA 2ZXBA 2ZUVA 4W7VA 1FH7A 4PCTA 2WM0A 3VIMA 3CO4A 2GVYA 2BVTA 2X8RA 1WAWA 4GI8A 1CYGA 2W61A 4UFMA 2F61A 3MUZ1 1BYCA 1TA3A 9CGTA 3ZT5A 1CGTA 3LPGA 2VX5A 1H4PA 2ZX6A 3OLDA 1SMAA 1TMQA 2D24A 1C8YA 3WH5A 4JCMA 1CENA 1GHSA 1Q6GA 3MUY1 1M7XA 2D0GA 3K4AA 3KE0A 3OIHA 5HNNA 3SURA 4AC1X 3PZUA 2ZXAA 1E40A 2CERA 2WC3A 4AYSA 3UG3A 2CBIA 1SMDA 2DGAA 4CU6A 1V6VA 4W84A 1QW8A 2J8FA 3PZOA 1B0IA 1CGXA 1JFXA 3AIWA 1UH2A 2PWDA 3GXFA 2WZHA 3TTOA 2ZXQA 4TVCA 4HA1A 5LA1A 1H0IA 5BXRA 1H0GA 3RILA 1WE5A 2A3BA 2VR5A 2UY5A 2ESCA 3W28A 2PF0A 3A47A 1JZ3A 2YDQA 4PUEA 5A6SA 5CGMA 1K6AA 2BXYA 1JI1A 2YLLA 3AQUA 5IDIA 1RD6A 2WMIB 1H5VA 2JIEA 2D1ZA 2E9MA 2BHUA 1GONA 4TX6A 3VGHA 4NI3A 3AXIA 3WEZA 4CN6A 2Z1KA 2ZX9A 4MNMA 5CSUA 1TVPA 4WLCA 2A3CA 1W3HA 1JXJA 2D0FA 4MB4A 5M5DA 3WENA 5E6YA 5A6JA 1UWTA 3WQ4A 1UA7A 1B2YA 4DWSA 1JNEA 3WQ6A 4J28A 4JKLA 3WD1A 1VIWA 5ABFB 1LJYA 2ZUTA 1PX3A 1GJUA 2TAAA 2WBKA 4M1RA 4B3KA 3WD2A 4OJYA 1TA3B 1V3KA 4Y7EA 1B3WA 1DEDA 4UQCA 1XYZA 2GJXB 3SCNA 5D9PA 3IK2A 1AQHA 8A3HA 5ABEA 1FFQA 2Z1SA 3W82A 1J0KA 5JBFA 4J3WA 3ALFA 1QNSA 4GQRA 1MFUA 3MO4A 1UZ1A 1MQPA 3WQ5A 1UKQA 1KQYA 1JL8A 3VGBA 3ZOAA 2PWHA 5LYRA 1NQ6A 4URIA 4E4PA 2JF6A 3L4UA 1KCLA 3FNDA 3WDQA 5A8QA 1CPUA 1CIUA 2V38A 1BFNA 4BCEA 1V3JA 3BLPX 2GK1B 4ZEPA 1V0MA 4B15A 5FD0A 2WC4A 4ZXLA 5HPCA 2AOSA 3VNYA 3NSXA 1NARA 4HMDA 4JAWA 5A6LA 1SFSA 5AYIA 4W85A 4UOJA 2VRKA 5HBFA 2D3NA 1GOQA 3PZMA 1V02A 1VAHA 2PC8A 3W6LA 1WDQA 5IHSA 3FW6A 5DT5A 1WO2A 3ZO9A 3AFBA 1NWRA 2WHMA 1ZS2A 5E09A 1J01A 4U2ZA 3WD0A 2ZWZA 4XZBA 3VILA 3MV01 3THCA 5A2BA 1KB3A 1EHNA 1BG9A 4ATWA 3IJ9A 2UY3A 4UQDA 3WH6A 1W1PA 2C0HA 4H8VA 3RM9A 3BMWA 3PZVA 4BQ2A 1G01A 1DWGM 3DYPA 1C3FA 2OWWA 5F7UA 4GINA 1HJQA 5EBAA 4GO8A 5A6AA 1QHPA 3CHCA 1HVQA 2BY2A 1E71M 1UD6A 4UR9A 4XV0A 4AMCA 5ABHA 1VFOA 4AZ5A 1PBGA 4RE2A 1NP0A 3QGVA 4CU8A 4H2CA 1P6WA 2ZIDA 5BROA 3ZMRA 1UR8A 2XWEA 1HT6A 2DSKA 3ZSSA 5DF0A 1E6NA 4QLKA 2CITA 3N13A 3L4WA 3HJEA 2X0HA 5IFPA 1EDTA 3II1A 1E6RA 5BWFA 1BYAA 4J3SA 2VL4A 2VUYA 4PTWA 1E70M 3WNPA 4MAVA 3FN9A 1J12A 1I75A 3AS2A 2A3EA 4H7VA 3GYCA 3AIQA 3M46A 4AZHA 2DIJA 4OIFA 4MB5A 4UOQA 4K68A 2B31A 1JDAA 4LQ1A 3ZIZA 3QOKA 4MNKA 2Q8XA 2ZUNA 3HN3A 2CHOA 2E0PA 1BYBA 1TUXA 1GVIA 2VO5A 3OLIA 4PMVA 5E0CA 1FH8A 2YL5A 3W4RA 1EA9C 1QI3A 4UQAA 3UG5A 1D7FA 5DFAA 1DWHM 1KBKA 2CCRA 1GVYA 4MB1A 3GM8A 4JFVA 3SIMA 4UCFA 2XVNA 5D9MA 1US3A 4W5UA 3WUBA 1W9VA 4GO9A 4QDMA 3ARSA 3A3HA 5DMYA 2GSJA 4FK9A 3A4XA 3BAWA 4WSKA 3AHZA 1W9DM 2VURA 4NRRA 4PSPA 1UD4A 3KZSA 4MNLA 2O9PA 1U30A 3T0BA 1Q6FA 3WMBA 3MSDA 3FAWA 4A3YA 4HOXA 1MW3A 4LXFA 5A8MA 3GZAA 5BXPA 5I0DA 3ARVA 1E6XM 1CLXA 3TONA 4ZXOA 3ARZA 1J9YA 1E15A 4D6CA 4KH2A 5IXEA 1IV8A 3CZ8A 1ZB5A 1I1WA 3BH4A 3F5LA 1NOWA 3L2MA 1J0YA 1W1TA 1NWSA 3SEPA 1MFVA 1HF6A 1E5NA 2E40A 2VMFA 1HNYA 3SUWA 2BXZA 4W8AA 5EFFA 1BG4A 1E6ZA 4PYSA 3W0KA 1XSIA 1A47A 2WBGA 1LL4A 5D4YA 3QOMA 1C91A 3LPFA 4YHEA 3RM4A 1E56A 4YPJA 1JYVA 1EH9A 3WUEA 2WB5A 2XGBA 2IXVA 4UTFA 1V3MA 1HKJA 3B9DA 3AHTA 1GPFA 3KEHA 3WKZA 4XB3A 5BXSA 4JFUA 1OSEA 2DIEA 3GH4A 1HP4A 1XV8A 3W26A 1VEOA 1MQRA 3K8MA 4DWSC 1HKMA 1VJSA 3BGAA 2WC7A 4AD0A 2OSYA 1Q6CA 1OB0A 1QBBA 3F5JA 2BS9A 2WCSA 2NT1A 4D6HA 3DECA 1XHGA 5CG0A 1BVZA 4HMEA 1KGUA 1U33A 2J74A 3GTNA 3AROA 1EOMA 2ZOXA 3L4VA 5CSYA 4PUDA 2WHJA 2NT0A 2QLYA 1W9PA 2G8ZA 2EPOA 2OSWA 2VCCA 1UQZA 3T08A 2J77A 3WDPP 2W63A 2X09A 2J7EA 2FDMA 3ZT7A 1OD8A 1LQ0A 1UG6A 3WBEA 4MPKA 4AISA 3PN8A 3PZIA 2YJQA 4W88A 3ECQA 1NOUA 4A4AA 1JF5A 2YLAA 4AW7A 1PEZA 2WANA 1TE1A 1LL6A 3G6LA 2WVVB 3RCNA 3N15A 3WF1A 4PMXA 2CESA 4LYQA 1V3IA 1WZAA 4J3TA 1GZJA 4DWSD 3WEMA 3FAXA 1RP8A 1QNQA 1H3GA 3WL1A 5TD4A 3WUGA 3N17A 5A1AA 4AXNA 1JZ6A 2FH8A 1PIFA 4EKJA 4ZFMA 2Y2WA 3VMPA 1XCWA 3UG4A 1CDGA 1QPKA 3CHEA 2CIPA 3GNPA 1M53A 4FLOA 4MDPA 2YA0A 2O92A 5HOSA 1HVXA 1G0CA 4HZ6A 3BSHA 1UKPA 2UY2A 3T2OA 1H09A 3T09A 4MTVA 5GQBA 3EDFA 2AAAA 2VVNA 3WH9A 6CGTA 2WAGA 3SCWA 3ZT6A 2BY3A 1BGAA 4UZUA 3CUFA 2XFYA 3BC9A 2QMKA 4P7RA 2EJ1A 4H04A 4OOZA 3VVGA 1QNPA 1KR1A 3W37A 4GZIA 3MSGA 4RE3A 4JFTA 4JFWA 4AD1A 1GHRA 5A8PA 2RGLA 1JYXA 4J27A 2XYLA 2EEXA 1WP6A 1VFMA 3VPLA 1E3XA 3BCDA 4PTMA 1WZLA 2VCAA 4M8UA 3ZJ6A 2A3AA 3SCPA 5I6SA 1JAEA 3GH5A 3WFZA 1Z32X 2W4XA 1O7AA 4W7WA 1C92A 3CTTA 1TR1A 1WCGA 3JUGA 4GZJA 3O2LA 3VKKA 2JF7A 1CBGA 3VDAA 3MMDA 4FMVA 2VC9A 4QCEA 2JEPA 2VZOA 2W91A 4DUVA 4Z2JA 4M56A 5C70A 1WKYA 2GUYA 5A95A 1EGZA 1K9TA 2CKSA 3OZOA 4P7OA 3AOFA 4P8WA 1E4NA 3AHXA 1JNDA 4AIEA 1O6IA 3OLGA 2XGIA 3PZGA 3MMWA 3VO0A 3VIOA 4AEFA 3RO8A 4CCEA 2GDUA 2WKGA 2DT1A 3I3BA 4AY1A 2XSAA 3WF4A 3KWXA 1PJ9A 2J47A 4CD8A 2X05A 1JZ4A 1CXIA 3AICA 2ZX5A 3AMKA 2DH3A 3T2PA 4JFSA 3K8KA 5I24A 4KRTA 5HPOA 5I79A 1GOKA 2G41A 2YDSA 4P7QA 1ISYA 3SCQA 3OG2A 1SYTA 3S2CA 4U3CA 3ARPA 1JFHA 3EDEA 4JHZA 3MS8A 2ZICA 1Q4NX 3FXYA 1B1YA 3BLKA 4TOQA 1KR0A 2WMHA 3WNLA 5BRPA 3TOPA 3LPPA 1XD0A 3VD4A 4IUGA 4M80A 4DUXA 4HOWA 4KWUA 3AHVA 3A4WA 2G3IA 4BA0A 3TTSA 2CBVA 3W29A 5I78A 1HP5A 4IM4A 3WUFA 4PEEA 2QPUA 4JKKA 4HPHA 2DT3A 3AS1A 2WMFA 4AZIA 4W87A 4CD6A 1CWYA 2J79A 1VF8A 3MV11 6TAAA 4S3JA 1X6LA 1OBAA 2XHYA 2XFFA 2WWCA 2ZX8A 4UQ9A 3L4XA 3QHNA 1CTNA 3CUGA 4C7GA 4U33A 4PMQA 1LL7A 2E9LA 2VRQA 3MU7A 3GXDA 2OSXA 2D23A 1W9BM 1W91A 2VJXA 2WVTA 1TVNA 2EPMX 4IPNB 2HVMA 1QI0A 4PRWA 4HPGA 2EPNA 4B3LA 2Y8VA 3L4TA 2YDRA 4PMOA 2BY0A 2V3GA 3AZSA 4F79A 1UD5A 2ZX7A 3OBAA 4TXEA 2BVDA 5A2CA 4OOUA 2OYKA 2V3FA 4NRSA 4BQ5A 1XH2A 3BSGA 4W86A 1CZ1A 1WDSA 3W27A 2CEQA 1PPIA 2WKLA 4OUEA 1NP2A 1FOBA 5GNYA 4F9JA 5A6KA 1W9UA 1X1NA 1XYFA 5A8OA 4QCFA 1KFWA 1NWTA 2PB1A 4CN4A 4MAZA 1JZ5A 1EDQA 1QI2A 2D0HA 1KXVA 4V27A 2DQXA 1QOXA 2WK2A 5AC5A 3ZJ8A 4DWSB 3MUAA 3T2QA 1UD8A 2WVUA 1HKKA 1IT0A 1R86A 2J7GA 4HTYA 3RDKA 4U2YA 3L2LA 3TA9A 1HJVA 1OIMA 4CD7A 2VNCA 4JKMA 4YHGA 3W25A 3QR3A 4J3VA 2F8QA 2OYLA 2WCGA 3WD4A 4Q7NA 6A3HA 4PN2A 1MVYA 4B16A 3UR7A 1MW2A 1KBBA 5M17A 2NW0A 1V0NA 2FGZA 5BXTA 3VGDA 1CLVA 3UETA 1UD3A 4AZCA 4HZ7A 1E4MM 1E1EA 4A3HA 2W66A 5D9NA 2DSWA 1AQMA 3ARXA 2VT0A 3NDZA 1EIBA 5JIWA 5GNXA 2PI6A 3I3EA 1MYRA 2W62A 3NYDA 1US2A 3NCOA 2ZUUA 2XJ7A 1OM0A 1V6XA 3WD3A 1E5JA 2EO7A 3ARYA 4Z2LA 3CHFA 3UR8A 2WVSA 3CLWA 5CLTA 2VZSA 2CHNA 5E9AA 5A69A 4HZ8A 1IZKA 3GDBA 1ISVA 1R8LA 1UKTA 3BAJA 2J78A 3U5YA 3RIKA 1KWKA 2ZXDA 1TG7A 2E9BA 1NWUA 3VGFA 4M81A 4AD3A 1WPCA 1HIZA 5E0FA 2D22A 3DYMA 1H2JA 1M01A 1LG2A 4MJ2A 3AI0A 3BMVA 2FH6A 1B31A 1W1VA 4EANA 3SCSA 3SUTA 2V3EA 1LLOA 3ZM8A 1CXFA 3KL3A 4WIWA 1E3ZA 1FA2A 2WSKA 1K9FA 1CXLA 2FHCA 4JCLA 2V3DA 3CMJA 4ACZA 1XCXA 3VM7A 1E9LA 4PSRA 3HU7A 2VR4A 3UCQA 3K1DA 1WDRA 3B9AA 1XGZA 1B3XA 1GOOA 4AZBA 1PX8A 3MKKA 4KGLA 4MJ4A 1H1NA 3M7SA 4D1JA 5FCZA 3CZLA 4Z2IA 2PWEA 4NSBA 3CH9A 4W8BA 1W9XA 3WF2A 2BNJA 2YA2A 3TTQA 4QLLA 1GQJA 1UWIA 3OGSA 3AZRA 4AZ7A 3VIGA 3OLEA 5AYBA 2WPGA 1BYDA 2C8NA 2IUZA 4B9YA 2D20A 3N18A 3PZTA 2WLYA 2WSPA 3WSUA 2XM1A 4HU0A 1N82A 5I23A 4KMQA 2WYSA 3L4ZA 1UQYA 1UWRA 4W8LA 4UFLA 1JD9A 2Y4SA 1PZ2A 1QVBA 3PZNA 3A4AA 4H8UA 1L0PA 3AHYA 3PTKA 3NSMA 4BQ3A 4WKAA 1CGYA 4NZCA 1OD0A 1WNOA 2YL8A 1V3LA 3AMDA 4P7NA 1ODZA 2J8GA 1KGWA 4GI9A 3VD3A 2PBGA 4AWEA 3VGEA 3GNOA 2VZVA 3WDRA 4HMCA 1E55A 8CGTA 1E6QM 5CPTA 3VD5A 1CXEA 4BS0A 1FFRA 3M6DA 3AJ7A 4PMDA 1XC6A 2O9RA 1HJUA 2BV9A 3SUSA 3VD7A 1UYQA 2XTKA 1D3CA 3WNKA 1HX0A 3BAYA 4U5IA 4FLRA 1LF1A 3S6TA 2WMGA 3PBGA 3ARTA 7TAAA 1ZJAA 5FKYA 2Y24A 3N12A 3CGTA 4ACZB 1JF6A 3VIKA 1GORA 2G3MA 4BQ4A 2J7BA 1ISWA 2G3NA 1E4LA 4OZOA 1VFUA 1MWOA 2G4FA 3N04A 5ABGA 4U5KA 5I5RA 1H11A 2XVLA 1J11A 5A8NA 1OGSA 4J7RA 3ARQA 2CBJA 3ARUA 3VX1A 3ARRA 1HJWA 1PIGA 1W3JA 4D6GA 4RL3A 1QNOA 4HA3A 1R7AA 4IPLA 1MW1A 3PTQA 4KRUA 1UD2A 1H41A 3GH7A 2Y5EA 1EQPA 2D2OA 3OGRA 1BHGA 1K9DA 1G5AA 1H49A 4N42A 1WB0A 3U57A 3WIJA 1G9HA 3EMZA 3WNNA 5CJ5A 1W2VA 5JUVA 1UH3A 3AMGA 2E8ZA 3WELA 2Y8KA 4D71A 3IAQA 4W7UA 3POHA 3K46A 1E43A 3UERA 4M24A 2BHYA 5FL0A 3J7HA 1G1YA 3GXMA 1ECEA 4GZEA 2UWFA 4AIOA 2GJPA 3I3DA 3CUJA 4P7LA 1JYNA 1MXGA 4OBRA 2DT2A 2XUCA 2WLZA 3U5UA 1C7TA 1BF2A 3OZPA 2VX7A 1JXKA 1BAGA 2E8YA 3N1AA 4UNIA 4QLJA 5DO8A 3SCVA 5A6BA 3GBDA 4W89A 2VQUA 2WZEA 3O6AA 4JL2A 2XSBA 2J7HA 4GXPA 1GCYA 1GUVA 1V6UA 1DWIM 4PTXA 1JZ2A 5EFDA 2YIHA 5FL1A 1Q6EA 2VQTA 3IJ7A 4PMYA 1XH1A 1CXHA 1V6WA 1V02E 4E2OA 4R5EA 3UEQA 3VIIA 3NSNA 2V5DA 1XSJA 2J62A 1EO7A 5JBDA 4JIEA 1XSKA 4CD4A 5ABFA 1UWSA 1ZJBA 4J3XA 1J0IA 2XM2A 3VNZA 3QHOA 3AYSA 4D6EA 4DUWA 3SCOA 1G94A 2XWDA 3MUIA 3WN6A 4P8UA 1TFVA 2W92A 1R85A 2FHBA 4TX8A 2DEPA 5I3DA 3E1F1 2J75A 1ZBKA 4N0RA 5CPQA 2GJXA 4AEEA 5GNZA 4QP0A 3DYOA 3QHMA 1AMYA 1V3HA 2EXOA 3RJXA 1BPLB 3VINA 1J0HA 1MW0A 2E4TA 1L8NA 3UESA 5AY7A 4TVUA 5LA0A 4WKFA 3IANA 1B90A 3N9KA 3VU2A 5AC4A 1QI4A 4WKHA 1OT2A 3G6MA 3U7VA 2VI0A 1FH9A 1C8QA 2PBOA 3VTRA 1FP9A 3LPOA 3AXHA 1V08A 3DHUA 4DM1A 1VJZA 1YHTA 4HA4A 1KWGA 1HL8A 3NJ3A 2GK1A 3KL5A 1KXQA 2JFEX 3EYPA 3TTYA 1RPKA 1JG9A 3ZQ9A 1SR0A 3CUHA 3WQWA 3DC0A 2XIBA 1ISXA 1J18A 4H41A 2DSVA 1VBRA 1VEMA 4TTGA 1OT1A 5D9OA 2WWDA 4CVWA 2OWCA 1XH0A 2QV4A 5DT7A 4BZYA 4Q22A 4L4OA 3EMQA 1JGIA 4IISA 3VD9A 1M03A 4EAMA 1YQ2A 1ISZA 1K9EA 5DEZA 1QNRA 2XVPA 3APGA 4EK7A 2AMGA 1QHZA 1ESWA 3RM8A 1C90A 2YBTA 4XZWA 5HDRA 1CNVA 1UKSA 2XVKA 3IJ8A 1E0WA 3NDYA 1A3HA 3EMCA 4TTUA 2WMKA 3VIHA 2JEQA 1ZBCA 3AISA 2BHZA 1ITXA 2QF8A 2CPUA 4YN5A 1JZ7A 5JBEA 3CZJA 1GQKA 4GQQA 2XIIA 3VX0A 1GQIA 3VDCA 4CVUA 2YKKA 1R7OA 4M82A 4C7FA 3T0AA 3OGVA 1DWAM 4ML4A 1E72M 2HISA 2VOTA 3VMOA 1OINA 2YL6A 3ZR5A 4NF7A 1BQCA 2X1IA 3DHPA 5C71A 5EMYA 4D6DA 4CU7A 1ZL1A 5LA2A 5EB8A 3PHAA 5M03A 3OB8A 2WXDM 3F5KA 3AIEA 4U3AA 2VRJA 4CUCA 4WSJA 3O9NA 4AD5A 4QAWA 3AMCA 3WMCA 3WEOA 2YBUA 2ZUMA 2DSZA 3CUIA 3T0DA 2DT0A 3FY1A 2WNWA 3BAIA 2O9TA 3CIVA 4TVDA 4UFIA 4ZENA 1J0JA 2WHLA 1FHLA 5D8WA 5E70A 4CN1A 2XPKA 1UR9A 1EO5A 4D72A 1C93A 4UFKA 4WK9A 3WBAA 2WHKA 2VVSA 1VBUA 1W1YA 4E8DA 1UR4A 3NUKA 1UR0A 3D5HA 1B3VA 4ZE5A 3AIBA 1ZU8A 1EXPA 3THDA 4WF7A 3SUVA 1KCKA 3WFLA 4Z2GA 1VRXA 4AIUA 1VEPA 4UFHA 4TUFA 1E1FA 3VIFA 1UR2A 3EDJA 4KGJA 3AXXA 2E3ZA 4CKQA 4UOZA 2V5CA 1XD1A 3OA5A 1EQCA 1UUQA 5CXPA 4B9ZA 3GBEA 1OWQA 4LGXA 4W93A 2DPEA 5M3WA 1VB9A 4CGTA 4V2XA 1JDCA 1F4HA 1HJSA 1NOFA 2ZWYA 4V28A 2EPLX 1UH4A 3WY1A 1UA3A 1DWFM 3WQ8A 2CBUA 2JALA 1OGBA 5CZKA 2CYGA 1R87A 2PWFA 2YOCA 4PMRA 2OWXA 5ECUA 3ARWA 4AZ6A 1VENA 4H8HA 4F8XA 1BVNP 1KXTA 1DP0A 2O9OA 1I1XA 1M04A 1UHVA 3W81A 4HP5A 1PX4A 3K4DA 3ZSTA 4D1IA 5A2AA 4C7DA 2FGLA 2BVYA 5BRQA 4LPCA 1JD7A 2VZTA 5JIPA 1EHAA 3RMEA 1PAMA 1W3LA 2UY4A 4FLSA 3AIVA 3AIRA 4JL1A 1CXKA 1ZBWA 1GJWA 3CZGA 1DWJM 1OGGA 2W5FA 3SUUA 4PTVA 1V0LA 2PWGA 2VTFA 2XVGA 3K8LA 3RJYA 1EDGA 1QW9A 1E6PA 2CNCA 2WCAA 3PZ9A 5A6MA 5HXMA 4OKDA 1MQQA 1TCMA 5I77A 1V03A 1DHKA 4X9YA 3WH8A 1FHDA 3BCFA 4AZGA 4Z2KA 2OYMA 4CCDA 1TZ7A 3CPUA 1JYWA 1WZKA 2JE8A 3D3AA 1ZBVA 3VMNA 4D6JA 2QHAA 3VDBA 3B8SA 2F2HA 1V6YA 3EDKA 4FF5A 1QI5A 2J25A 2BY1A 2OLHA 3MANA 2VX4A 3U7BA 3A6OA 1MXDA 3CHDA 2WZIA 2JIWA 5A3HA 7A3HA 4HU8A 1UOKA 2MANA 4PCSA 3VM5A 4UZSA 3SCUA 2RGMA 4HOZA 4MADA 1QBAA 4QFUA 4X0VA 1BGGA 1UWUA 3WF0A 5A6BD 4GI6A 1RP9A 2CXGA 1UKOA 3VGGA 4Z2HA 1NH6A 2J7DA 4AZCB 4ZE4A 1LWHA 4MB3A 5I2UA 2D3LA 3EDDA 3B9EA 1KXHA 1VFFA 4S3KA 3NIYA 4F9DA 3WDJA 1HN1A 3POCA 3HMCA 5FOOA 1KGXA 2WVVA 4GPNA 1IZJA 1J0ZA 3F4VA 4PBGA 3SCRA 4R27A 1BLIA 2C7FA 1KQZA 5BCAA 4ATLA 3W6MA 4MDOA 3EBVA 5KZ6A 7CGTA 3BAXA 3PTMA 1JIBA
chains in the Genus database with same CATH superfamily
4GVGA 2DZWA 4HQVA 3WQOA 1GG1A 4CQBA 4D6IA 3KBVA 3MDUA 4DI9A 4RZ5A 2YR1A 4UFJA 1RH9A 5JVLA 3E96A 1LG1A 3AMLA 3MMUA 3N3MA 4CQCA 4NIRA 3LRKA 1BTCA 2V81A 2YL9A 3KL0A 3HPFA 2DUXA 1WUFA 3H2NA 3FEQA 1W2PA 1FJDA 1EBGA 4NT0A 1KTBA 3BURA 3S1XA 1AA1B 3WL0A 2A3LA 4L65A 3M07A 2F4EA 3GK0A 1CLKA 3UI6A 4MNJA 1C7SA 3OG3A 3R0KA 4Q8WA 3UF8A 3L65A 4Q8QA 1AODA 1XS2A 3WQVA 2QCGA 3GR4A 2Z27A 5E5CA 2YB1A 1OC6A 1TR9A 3LGDA 3OTRA 5CLWA 4H3DA 4HNVA 2DH2A 4DBEA 3WMSA 2ZA3A 2IKHA 2IQ0A 3IAPA 2I5IA 1Z7AA 5HMDA 1NELA 5C8BB 3NZRA 1E0VA 4AD2A 1GKRA 3KAGA 1KBIA 1V0KA 3Q2DA 4L4MA 3O5JA 4JZ5A 3CZKA 1D2KA 3H24A 5IHRA 1GOMA 4X0NA 3LCFA 3IK8A 3LUOA 2J7FA 1DTUA 1HKIA 5LIYX 1D3GA 2KR7A 1H61A 1GNXA 3CQJA 3G1AA 1HXJA 4KFNA 1Z3NA 4LB3A 3WDIA 3QY7A 2MUCA 1CECA 4GY0A 2VCBA 4P8XA 1RXOB 3P3BA 1YW1A 2C71A 3S1UA 1RK6A 2DSUA 1HL9A 1B9ZA 4RE4A 1QJWA 1T96A 3VKCA 4GKLA 3ICJA 1F3TA 1J10A 3L5AA 2NV1A 4JDYA 4D6FA 4DZHA 1NSJA 1GQLA 4V33A 4L9ZA 3GQYA 1R2RA 3NNTA 1DQUA 5EMLA 2PDPA 2AQVA 3IIPA 2OZ8A 1PXGA 5MF5A 2NSXA 4KERA 3SRFA 1S2UA 4ALDA 1RLCL 4KT2A 3SDOA 2ZXBA 4PCTA 4KPLA 4DJDC 2WM0A 3W7OA 1GYLA 4Y8FA 3TC7A 3TROA 1IT7A 4PMJA 2R1MA 1RA5A 2QDEA 1Q6HA 4UUIA 1QPFA 1BYCA 5J8LA 3F4CA 1PYFA 9CGTA 3ZT5A 1CGTA 3LPGA 4FR6A 4NG3A 1P6CA 5JMUA 1LBMA 1Q7MA 4DZAA 1SMAA 2BG5A 2D24A 2VDHA 1BQGA 1YKWA 4JCMA 1CENA 3KOZA 1GHSA 1IXOA 1Q6GA 1X1ZA 3FS2A 4I8YA 3K4AA 5BZAA 1X97A 3W7EA 4ODPA 3F2DA 1D6OA 4L9XA 4UTJA 1KFCA 5I00A 1E9IA 3PZOA 1B0IA 3RCMA 2G37A 2FTPA 3UZWA 1NF7A 1V4YA 2WZHA 1OX4B 4TVCA 1QK0A 2ZRZA 1H0IA 1NTHA 5KMYA 2V0TA 2PP3A 1FKRA 1MRAA 3GS6A 2ESCA 5KZEA 1FX6A 3EGJA 2PF0A 1JZ3A 3S6OA 1S3TC 4ES4A 1MI3A 3OA3A 3BG9A 4WDTA 1L6YA 2ALDA 3QR1A 4EPDC 2EGZA 1W3TA 1PTGA 3PRDA 1EJTC 5FESA 1HW6A 4A22A 4WJ8A 2PA6A 2O4QA 2PDCA 2E9MA 2BHUA 2FVMA 2MLYA 1YPFA 4TX6A 3VGHA 3N2CA 4DELA 5FI8A 3WEZA 4B5UA 1EJXC 3LNPA 1EX1A 2YCEA 1UP2A 1TVPA 1JXJA 1BSLA 1Q2RA 3WENA 3OJGA 3SI9A 1RLDA 3WQ4A 4K7VA 3QFWA 4DWSA 3SBFA 1JNEA 3N9RA 1MNZA 4HZMA 4J28A 4JKLA 4DI8A 1LJYA 3BLEA 2OXNA 2WBKA 2OJPA 3GDMA 4HCHA 4X63A 3G8EA 4OJYA 3EPOA 1ROTA 1S5WA 1V3KA 1WAUA 4F0HA 4Y90A 5HMSA 4F0KA 2WJDA 4CNNA 3I65A 4IPIA 1IGWA 3SCNA 1YDOA 3ES8A 1PKLA 3IK2A 4J35A 2PDQA 2Y62A 4O15A 1D8CA 4GQRA 3NPVA 3MO4A 1UZ1A 4ADTA 2RDTA 1FWFC 2PWHA 3MPGA 3UZYA 4K2SA 5HWCA 1QO5A 3FNDA 2G0WA 3LG3A 4R33A 2KGJA 2V38A 2FGBA 5HQLA 4G8TA 1PVNA 3FJLA 3W1PA 3UCDA 5FD0A 3W07A 1N7KA 3P7YA 3CO8A 3NSXA 1NARA 4JAWA 4AC7C 5A6LA 5AYIA 5IOBA 5HJLA 3RRAA 4MWAC 1OABA 1V02A 3PBMA 1GYMA 3T07A 2ETNA 2PC8A 5F2LA 1UIOA 4KFPA 3W6LA 9XIAA 4L61A 5IHSA 3FW6A 5CBBA 4ERAA 4NY2A 4R7WA 3WD0A 3GHRA 2P10A 1VS1A 1ZCNA 4S23A 2HMCA 1IT8A 2QT3A 4Y96A 3DOPA 1PCKA 1W1PA 2C0HA 4H8VA 4Q6XA 3DG3A 1POJA 3PZVA 1KV5A 3V7PA 4N2YA 3DYPA 4P2VA 4H2HA 1NFBA 4GINA 1HJQA 5HWNA 3TCEA 4GO8A 2PPPA 1HVQA 4PCPA 3T40A 1XLJA 4H00A 4QEEA 1UD6A 4XV0A 3WLIA 2FYMA 1VFOA 4AFYA 1WOBA 1TPFA 3FOKA 3W7GA 3UR5A 2C18A 5BROA 3ZMRA 4CCZA 2DSKA 3ZSSA 1S2AA 3COTA 2MNRA 3HJEA 1O12A 1BYAA 3GC5A 4J3SA 3C8FA 2V9DA 2VL4A 3GXNA 1QNVA 2Q3OA 3U2CA 2HROA 1E70M 2QR6A 3I6EA 3AIQA 3LHZA 3E6EA 2DIJA 2XPBA 4MB5A 3TR2A 4BWLC 3IJ6A 1F76A 4DN1A 1UJQA 3C3UA 4S39A 2CLEA 2C6QA 3B0YA 3HN3A 4ZQRA 2CHOA 4XD3A 4GJJA 3GPKA 1BYBA 5BU6A 1GVIA 1Y5VA 3OLIA 4PMVA 5E0CA 5AOUA 4H9YA 1FH8A 2YL5A 1IWAA 5AHIA 4DIAA 2OT1A 1EA9C 4GUHA 4FALA 3H2MA 4IP7A 1D7FA 4S1FA 3MQTA 3UVIA 3EKGA 2WJFA 1KBKA 1GVYA 2FTYA 4MB1A 3F2BA 3SIMA 1RCXB 1JJKA 1TPUA 1ZRQA 4UCFA 1R47A 3G18A 1G7UA 2XP8A 4BR1A 4QEHA 1Z48A 2OVLA 3C4UA 4PULA 2Z2BA 4WSKA 1HFBA 2Y7GA 3IV3A 1EC7A 4TW6A 4PSPA 3TLLA 2O9PA 3GTFA 3EEGA 1EL3A 1M7OA 4HKPA 4A3YA 4AHQA 2DUZA 1LROA 3GZAA 5I0DA 3ARVA 1PV8A 3TZFA 1ICPA 1CLXA 4H9TA 3QY6A 4ZXOA 1LLWA 4UR7A 1ZJHA 4IQCA 2Y1HA 1TPH1 1IV8A 2DZUA 3IRSA 2Y0FA 4JQ4A 4PODA 3BL3A 3EA1A 1Z89A 4Z1DA 1JVWA 1W1TA 1MFVA 2CLHA 4Y8EA 3EB3A 1I2NA 4OUIA 1RD5A 2BODX 1HNYA 2BXZA 1G69A 2ACRA 3CAKA 4HBKA 4IFOA 2GVLA 4ORIA 5BW6A 3LTSA 3W0KA 1XSIA 1A47A 1LL4A 1I6NA 4GISA 4JD4A 3PUGA 4YHEA 3GFXA 1FWTA 4QG8A 1JYVA 1EH9A 2IXVA 1V3MA 1A80A 5KINA 1IIHA 4R88A 3MKCA 3RF9A 8XIAA 3KEHA 2VC6A 4F0RA 3W1AA 5BXSA 3VCRA 3GH4A 1HP4A 3I4KA 4I8DA 2RSEA 4N19A 3QMTA 3KXQA 1XW8A 4FHAA 5G2HA 4FI4A 3KTXA 3GHSA 2OSYA 3NPUA 4E8GA 2OR2A 4WZHA 3F5JA 2CZEA 2BS9A 2WCSA 4D6HA 2FZ8A 3DECA 1LRQA 1FKIA 4HMEA 1ALDA 2BB0A 4XBJA 3AU6A 2KO7A 2J74A 4KEVA 1EOMA 2PODA 2ZOXA 5CSYA 4B5XA 1EQ3A 4LEQA 1DL3A 2OSWA 1J5TA 4ZVJA 2OFNA 2FDMA 2VUNA 3O5OA 1H7PA 4LWWA 1UG6A 3PZIA 3BZGA 1UB3A 3CB8A 2BXVA 4GLEA 1JDFA 4PL2A 3G0SA 1TX2A 4O19A 4A4AA 1FKDA 3CJPA 3UWWA 2B7PA 5T91A 4AW7A 4J9JA 5C54A 5DIVA 4RNFA 1NMVA 4XISA 1PEZA 1LL6A 3E0VA 4IT4A 4BJHA 1O66A 3RCNA 2PMQA 3PWAA 3TJXA 5LGZA 1RP8A 1QNQA 3ZWSA 3WUGA 1R3SA 1OJXA 4A8RA 1OFAA 3G1HA 3NL6A 2NLIA 3BMBA 5BOFA 3PFMA 4ZFMA 3CUZA 4FX7A 4X9SA 4DWDA 4JDBA 1M53A 3A22A 1XRTA 4MDPA 1TTPA 1GYNA 5HOSA 3S42A 1NF0A 2V8ZA 5I06A 3FV9A 1VIZA 3CWNA 3BSHA 4J4OA 3B9NA 5GJNA 2POZA 3V36A 2Y6ZA 5GQBA 3BICA 2VVNA 2D73A 1QK2A 4O53A 4EIVA 3SCWA 3ZT6A 4AQLA 3M9YA 1BGAA 3RLHA 4NX0A 1XKJA 1QPRA 2FB3A 4LT9A 1OYAA 3TE9A 1QNPA 1KR1A 5G5IA 1ZLPA 5H6HA 4H7ZA 1JCNA 4JFWA 3OQ8A 2GVGA 2ONEA 4YNGA 3APTA 1JYXA 2RGLA 2YCLB 3ATZA 2RDXA 1E3XA 3W7NA 2Z0IA 2NQLA 1ONWA 4RX0A 1WZLA 3PBVA 3ZJ6A 1PYMA 4N4QA 3GKAA 1KRMA 2FTWA 3ITXA 3W75A 2J9YA 4O8RA 3G24A 4NQ1A 1Z32X 2P0IA 2W4XA 1O7AA 1FRBA 1C92A 1TR1A 2XN0A 2RFGA 1OK4A 3DEQA 3O2LA 3VDAA 1V77A 2NVCA 4W9PA 2GGIA 3WLJA 2HTMA 1VYRA 2W91A 1RY8A 2E5CA 3LXAA 4HHMA 1EYMA 2GUYA 2YYUA 1PDYA 3M0YA 1EGZA 1QWKA 3OZOA 4CNSA 3AOFA 4P8WA 5K9CA 1O6IA 2NUWA 4FAPA 1KM6A 1DQXA 3VO0A 3VIOA 3T05A 4TX0A 4TNSA 4CCEA 2GDUA 2WKGA 1B5TA 3KRBA 3O3RA 2PPNA 1PCWA 2XSAA 3BQ5A 3KWXA 2J47A 1FKLA 2X05A 3MYPA 3AMKA 5HUAA 2DH3A 3KDOA 3AXMA 3K8KA 3S46A 5I24A 3WJSA 4KRTA 5HPOA 4RLIA 2M1IA 3NQAA 2YCKX 1W54A 1JCHB 3TC6A 2ISFA 2PDXA 1Z9AA 1T40A 1P43A 4JHZA 3O5GA 4BF9A 3EY6A 1X8CA 2ZICA 4NZ5A 2ACUA 3BLKA 2WMHA 3Q45A 3UXKA 4V15A 3VD4A 4IUGA 3TMLA 1SZEA 4HOWA 3OYZA 2INEA 2AKMA 1TX0A 3FGCB 4ADUA 3TN6A 4BA0A 2IKJA 3TYEA 3CQKA 3WUFA 2J6VA 4Q8PA 4X61A 2QPUA 4JKKA 4A6GA 5HNUA 4PGLA 4PCNA 2V2CA 2J79A 1VF8A 1TJ0A 3CL7A 1VPYA 3EOUA 2JKEA 4OQVA 1ITUA 2XFFA 3GKFA 3H6OA 1F74A 1U5HA 3S1VA 1LRTA 1RZMA 4K39A 5EMKA 3VA8A 4HMNA 1UPPA 3GIPA 1FWWA 4N9CA 3FKRA 4U33A 4PMQA 2PDNA 4RJEA 4EP8C 3GXDA 4IIEA 1KFKA 2ZRWA 3STPA 3TIMA 1W91A 2VJXA 2WVTA 3L67A 5DANA 1QI0A 2BZNA 4PRWA 3V5OA 4XKYA 3DFQA 3P80A 1KFJA 1NQKA 3L4TA 4Q4MA 3UJFA 5HMFA 1H7WA 4XVEA 4TXEA 3K1GA 2OQHA 2Z1BA 3UZXA 4FNRA 2V3FA 3GYEA 1P6BA 1CZ1A 1WDSA 2CEQA 4FR1A 4J1OA 1K4HA 3ITYA 3LA4A 2XFWA 2OZTA 4JICA 4BF8A 2YXOA 5GNYA 5CC6A 3E2VA 4NASA 2FB2A 1QPOA 1MEWA 4QTGA 4HCDA 5A8OA 4DAIA 1VPQA 3OVPA 1OEPA 2OT0A 1GVEA 1J6YA 1F3XA 3WJWA 4ZQCA 1WX0A 4A3RA 1KO0A 1O60A 1PTDA 4H19A 4BF5A 3SIZA 4DRJA 3OYXA 4WVXA 2QQ6A 2WVUA 1IT0A 1R86A 2J7GA 2CW6A 1LT7A 2VEGA 3BTNA 1DYSA 5KETA 3FKKA 2VNCA 4ZMGA 4LAXA 4LY4A 1PS9A 2F2DA 2LJ4A 4O0KA 4J3VA 1V79A 3NURA 2NQZA 4KKXA 3RX4A 3P93A 1MVYA 3GDRA 4A8NA 4FXRA 2OX1A 2NW0A 1YEYA 2ZCGA 4DBWA 1CLVA 1FHUA 3CGMA 4ODMA 1GVFA 2P3EA 4YCOA 4C6JA 3AJXA 5D9NA 1AQMA 1DE6A 1KA9F 3ARXA 3NDZA 4ZOBA 5GNXA 3NYDA 2ZQVA 2ZUUA 1XP3A 4HNCA 3LQLA 1OM0A 2Q71A 3W74A 4AHPA 3EWXA 2EO7A 2WVSA 3FJ4A 1DPMA 2VZSA 2KE0A 3P81A 1A7XA 5FEXA 4A2RA 3S5SA 1XIIA 2H9AB 1ZNNA 1W37A 3WZ0E 3U5YA 3RIKA 2OFJA 4FXJA 2ZXDA 2FJKA 4IICA 2E9BA 1NWUA 4CQDA 2W9MA 4IQDA 1REQB 4M81A 5HJXA 2PEVA 1Y0OA 4PCFA 2QW5A 4MJ2A 3AI0A 3QLDA 2NVAA 2CHRA 3SUTA 1JRBA 5H2ZA 3SQSA 2G50A 4UIOA 4M6QA 3KL3A 4ZQPA 1J6OA 4LVBA 5DBTA 3MO7A 4RZBA 4JCLA 2V3DA 5DCDA 5DX7A 1UASA 3S9YA 1OYCA 3IIXA 2V82A 4ACZA 4L1WA 1E9LA 1AG1O 3P0XA 2CZDA 4GIVA 2HNHA 1XGZA 3IIZA 3SQLA 1GOOA 4P61A 1PX8A 4MJ4A 3M7SA 4N4PA 2P8CA 4MIMA 3NAVA 4WXYA 1LUCA 3LGGA 1ADSA 4ZCWA 4W8BA 1WUEA 1GT8A 3QGAC 2VGIA 4XBSA 2OGYA 3VIGA 4ENLA 2PWUA 1BYDA 1FTXA 4M19A 2IUZA 4Q6JA 2ITKA 2D20A 2GVEA 3AWOA 2PGRA 3PZTA 5FACA 1R9XA 2XM1A 1FWIC 1N82A 5I23A 3VYLA 3ANYA 3LOTA 2WYSA 3L4ZA 1UQYA 2PPOA 4W8LA 1JD9A 3UGVA 3KRUA 2QDDA 1QVBA 3G3DA 3IK4A 4HIBA 4ERGA 3AHYA 4BQ3A 3RHGA 3OBEA 1SU5A 5FA5A 5TAOA 3O6CA 4NZCA 1PE1A 4MFEA 1XL9A 3W7CA 3MMTA 5I3GA 3SJ3A 2L2SA 2FFIA 3M43A 2F6XA 4DH0A 1ODZA 4B4FA 5AKQA 4XD6A 1SJCA 4GA8A 1B4EA 8CGTA 1XKYA 1E6QM 3KX6A 3KAOA 1JNSA 1LBFA 1FFRA 1FWNA 4CEUC 2O9RA 4UTHA 2BWGA 3VD7A 4NNBA 3DFNA 1D3CA 4Q4OA 5DLCA 4WCJA 5HR6A 4PUMA 4EACA 3W7DA 4U5IA 5BOOA 4FLRA 1YLVA 2BMBA 1GVRA 4ZBCA 3S6TA 4O12A 3ARTA 7TAAA 2CXEA 4R9OA 4ROPA 3CGTA 4ACZB 2I5QA 1JF6A 2G3MA 1XJBA 1DXIA 3GTIA 2J7BA 2Q09A 1H1YA 1ISWA 4ICMA 2PBCA 1E4LA 3JZEA 2FFCA 3R6IA 3FIGA 4U5KA 3PR9A 2PDBA 4C6QA 4J7RA 3ARQA 4Q32A 2CBJA 3C6CA 3VX1A 4DRSA 2WJEA 1PIGA 2Y7FA 2CZVA 4I6KA 3RLGA 3FA3A 1QNOA 3SRDA 3TK7A 3DFSA 4FX8A 4UBPC 4JEJA 3GH7A 4PTDA 3N6QA 1MO0A 2D2OA 3OGRA 1BHGA 3R58A 4HNUA 1K9DA 3LDVA 1PBKA 4N42A 3MCNA 5CJ5A 1W2VA 1UH3A 3AMGA 3WELA 3QXBA 4D71A 4QIBA 7XIMA 3D46A 3M0JA 4DRMA 3LHWA 5HNRA 4K1GA 4LVGA 5FL0A 3PTDA 1XDMA 3GXMA 3GNNA 1J4RA 1N2VA 2XDFA 5C2GA 1SFLA 2ZDRA 2ZKMX 5BMWA 1W3IA 2RH9A 3MJMA 4AVOA 4NL1A 4P7LA 4N9BA 1J96A 3L68A 1MXGA 3OOBA 3UJ2A 1C7TA 1ICSA 3EOSA 2F21A 2X7VA 3VZYA 3N1AA 1PKYA 4PBEA 3ISIX 2AL1A 4MY9A 3SCVA 1EGVA 1A5NC 4MF4A 2W27A 2DW7A 4REQA 1DWIM 4PTXA 1JZ2A 1A5CA 1K8CA 3KZ7A 4CNOA 4PMYA 1E0TA 3KVKA 3TDFA 1CXHA 1V6WA 2A21A 2QUUA 5D37A 4R5EA 2QPXA 2V5DA 1ZP3A 4KIEA 1RBOB 2J62A 1EO7A 3OO2A 4JIEA 3RPDA 4BEUA 5I3JA 1YYAA 2XM2A 4QROA 4D6EA 3WN6A 2FHBA 1F3WA 2DEPA 2GQ3A 1A5KC 1A50A 2GJXA 1QOQA 7TIMA 1VZWA 4ODOA 3RPTA 3S4TA 4G7EA 1V3HA 2ADAA 1E1CA 1M5YA 1TREA 4AWTA 5HQEA 3EIPA 3UESA 4DHGA 4TVUA 3W22A 3IANA 1B90A 4B5TA 1OT2A 4F0LA 3G6MA 3U7VA 1V5XA 4E2VA 2DG9A 2BP1A 2PBOA 5M2FX 4ZB0A 3LI1A 4DZ2A 1RQEA 3P8JA 4QQ3A 1GVQA 2R9RA 3L66A 3NJ3A 1KXQA 3LI0A 5LZLA 1YTEA 3DI0A 3WQWA 2XIBA 3WFAA 4IGSA 5D9OA 3WJZA 5DT7A 3JU2A 4Q22A 1UUMA 3CH0A 3CPGA 3GAKA 4C1LA 2B5UB 3O5EA 3REQA 3VD9A 5DEZA 2XVPA 3APGA 2EHHA 3LENA 2AMGA 3E12A 5J5RA 1QHZA 1XRSA 1ESWA 3RM8A 3MUXA 1UROA 4XZWA 1CNVA 1XIJA 4M6PA 3NDYA 3V0UA 3NYZA 4N6EA 5HA7A 1LCOA 2MNTA 6XIMA 4NJHA 3AISA 1ITXA 1YE6A 2CPUA 4TIMA 1FXQA 1JZ7A 2XH7A 1SW7A 3CZJA 1R3YA 2B0MA 4YVPA 1NDWA 2XIIA 3VX0A 3WG6A 2YKKA 4C7FA 1HGWA 2HISA 4ML4A 1E72M 1ZGDA 1OINA 5G1MA 4F2TA 1IXQA 3S6DA 2QIIA 4JIRA 1O94A 4ITZA 1ZL1A 1T8QA 4ADSA 3NL3A 4LUTA 5EB8A 5M03A 2RUDA 4DJED 2DZAA 4MOZA 2C19A 3QVQA 2X16A 3RR4A 3MVTA 3UG8A 2HXUA 2QXWA 4AD5A 2QJJA 1RCQA 3WLSA 2YBUA 2ZUMA 1KCZA 4HSNA 3B8WA 3SFKA 5G2IA 3U2ZA 3N19B 3FY1A 4RXFA 1H62A 4UFIA 3FVDA 3H8AA 4LUSA 1UR9A 3GXPA 3SN0A 3WBAA 5BOEA 1U1JA 5FAJA 2VVSA 1W1YA 1O1ZA 1UR4A 2AGTA 2J24A 3NZ1A 1VBGA 1B3VA 3LD5A 4ZE5A 1DQWA 1EXPA 2HBVA 3NPXA 3REQB 3THDA 3SUVA 3V75A 4AIUA 4TUFA 4UTTA 1E1FA 4H01A 1UIPA 4DJFC 1XYLA 1E44A 3PUOA 3AXXA 4GWEA 1EQCA 1TSIA 2P76A 2WSQA 2DY3A 4FNTA 2DPEA 3VC5A 4CGTA 1RR2A 4LSBA 1KM1A 1EJWC 4LUIA 1S39A 1UH4A 3WY1A 4LAZA 1XQKA 1S2VA 2CBUA 2PWFA 4MWAE 1W17A 1TB3A 2OWXA 3E2SA 5ECUA 3ARWA 3UNDA 2PN0A 3WLQA 1J4EA 4DBUA 3H2CA 6PTDA 3UBPC 1W5OA 5C0QA 3G77A 4C7DA 2FGLA 1TWWA 4YWSA 1UBPC 1XR2A 4EVZA 2VZTA 4RW5A 1OC5A 4GRSA 1W3LA 3M0XA 4KW2A 4JL1A 1ZBWA 1N8WA 4NAEA 1XBZA 2PWGA 2VTFA 3WMLA 5CEWA 5K9XA 2P88A 3B0UX 3F2CA 1QW9A 3NQ6A 5CC7A 2YGYA 3KTCA 5HNTA 5L9FA 1Z8AA 3HPZA 2R1LA 3I68A 5C9WA 3I4EA 1FHDA 3M7WA 4AZGA 2JKPA 4Z2KA 2PTWA 4CQ9A 3CPUA 3D3AA 2XISA 1OHLA 4GY7A 1PINA 3MHGA 1KRBC 3B8SA 4IMAA 3VDBA 1V6YA 3O5QA 1IEWA 2I14A 1RBAA 4O1DA 4FP1A 2OLHA 3MANA 3KOXA 4I9AA 2NV9A 2MANA 2ZBTA 3HTWA 1LDCA 3QPEA 1QBAA 3C2VA 3MSRA 4S2BA 4NX5A 2BBFA 3WBYA 1BGGA 3WF0A 1RP9A 3FK4A 1UKOA 2G95A 4W4QA 5DY3A 4M7TA 5I2UA 4AZCB 4ZE4A 1LWHA 4IIDA 3B9EA 3L9CA 3OP2A 1FXPA 1EEXA 3H2AA 3VCCA 3QH2A 4GPNA 2PDUA 4AX6A 4JR5A 1VLWA 2ODOA 3RK8A 4GX9A 4PBGA 1NSGA 5BCAA 3PR2A 5KZ6A 4G9PA 2PE4A 4PL1A 4PTNA 3B06A 5DBUA 4JBRA 1ZAJA 4V1XA 3GO2A 3RMJA 4ZZ9A 1CEOA 2VZUA 3KBWA 4HTBA 3HZ3A 3W24A 3A64A 3CT7A 1R46A 3E02A 4DF0A 1GW1A 4FLQA 1XRVA 3SY1A 3LY0A 1JNTA 1J5SA 3SY8A 4GIRA 3LYEA 5CBJA 2ZFAA 4OWGA 3FXGA 1QPNA 1GW9A 3KVMA 1SW0A 1FWRA 4UMCA 1DJHA 3HFYA 3PZQA 4FIRA 4PFHA 4BKNA 3G3MA 2DG3A 5BYWA 4JTQA 2FKPA 2MPHA 4HHLA 1RSCA 4PMUA 4ERIA 3UI5A 3UQIA 1SZNA 5LKYA 5C9XA 2ZZ2A 3CMGA 2X0YA 3TMQA 4DRHA 1JCYA 3P62A 3AS3A 2HPMA 2Y5JA 4O1BA 3H26A 4B5NA 3TP4A 5E9XA 3GVRA 1TWSA 2ZA2A 4I9JA 3TQPA 1RJPA 2YA1A 1R38A 2O56A 1GKQA 3TN4A 3HG5A 1Y5XA 1E0XA 3F03K 2QCHA 3B4UA 3R5EA 3W38A 2QMJA 2PGEA 4BF7A 4H6QA 3VUPA 1H1ZA 3L7RA 3AIUA 3UT0A 1R3TA 1AL8A 3LHVA 4UQBA 1SUXA 3TA6A 3S5ZA 1JAKA 4LNYA 1W3KA 4GX8A 3I7RA 2PF8A 4G2PA 4KEUA 4E8CA 3UWVA 4PMZA 1JZ8A 1LZOA 4GXMA 2PV3A 4R3UA 4F3HA 5KTLA 3VIJA 5CZTA 1XIEA 4RNJA 2PDYA 1KM2A 1V7YA 3RPMA 3GB6A 3EX1A 4J2MA 1R9HA 2F6UA 4D9PA 1OCQA 3LTYA 3CBWA 3H2EA 1E4IA 3KADA 4JYFA 4LX4A 5FJUA 1YXYA 5E6ZA 1ODUA 2WW5A 4PUUA 4W5ZA 1F4AA 3O15A 2ON3A 4JTUA 4EE9A 1SJBA 3VXGA 1N1AA 3MTWA 5B8IC 5EMMA 1JRCA 1WDPA 3P84A 1VRDA 2WMIA 3E9AA 1B3OA 2E25A 3EX6A 3T8QA 5K9DA 3PUDA 5AHNA 1CT5A 3AZTA 3C3NA 2E1DA 4JN8A 4XZIA 1S3HA 2WZTA 3BGJA 4I9TA 1W32A 3EWDA 3F4DA 2C79A 4LAYA 4IJRA 1VYSX 3G2GA 1WYIA 5C7HA 1LWJA 1FH7A 5AZ1A 2F7FA 4C6LA 3EPMA 3CO4A 1MDLA 3TKFA 2BVTA 3I7QA 1WAWA 4GI8A 4EXQA 2Q3RA 4UFMA 2VD8A 3MUZ1 1PKMA 1TA3A 2VX5A 1H4PA 2ZX6A 3IS4A 1OZMA 1NFPA 2HVOA 3JZUA 3IGHX 1OC7A 3G22A 7ENLA 4Q8OA 1Q6OA 2HSAA 2ZVRA 2XH4A 4NI8A 1M7XA 5HNNA 2OCZA 3KE0A 4AC1X 3HURA 1LP6A 1E40A 1YXCA 1X98A 5I07A 4L72B 1SMDA 1S1PA 2DGAA 1S38A 3IWPA 4CU6A 1F8MA 2J8FA 3M16A 1P0KA 1CGXA 1UH2A 2ZZ4A 5LNVA 2J66A 3RG6A 1MRQA 3KLLA 1BRLA 5BXRA 1H0GA 1FWSA 2Y78A 2A3BA 4B2DD 4DJDD 1AH3A 3LBCA 1G67A 4PUEA 3KP0A 1J8VA 4I5RA 5DELA 1HXVA 2BXYA 4GYPC 5MKGA 3S5OA 1L2QA 4CQAA 2YLLA 3IKGA 3ITTA 1A5OC 4E5TA 2WMIB 5DCEA 1TWDA 1H5VA 3ZLGA 2D1ZA 4LCRA 4GCXA 3QQ0A 1DOSA 2DZPA 1GONA 1EPVA 3SN4A 1H7RA 3W00A 3RRXA 4KCWA 3VFCA 2ZX9A 2GJNA 3H4GA 2A3CA 4MB4A 4GH3A 1EB3A 3QPYA 5A6JA 1EC9A 3CL6A 3TWAA 3WQ6A 4FIQA 2EG7A 3WD1A 5C9UA 1PX3A 3C86A 4DLMA 1TA3B 1TWIA 4Y9OA 2R1KA 4LAKA 4GC4A 4YMZA 3JR2A 4UQCA 5I7GA 2QVHA 2FZMA 3E5BA 3B04A 1GVOA 3DCPA 1AQHA 4J5NA 2E67A 1EJUC 2Z1SA 3W82A 2ABAA 2GQ9A 4ZSTA 3LBOA 3EB4A 4I9MA 3JRKA 3U9IA 2EKGA 2HBXA 5LIKX 3QV8A 3OPSA 5HANA 3ZOAA 4URIA 3L4UA 2BLEA 4LC6A 3MHFA 3WDQA 4HNOA 5A8QA 4XBKA 1CIUA 1BFNA 4GY1A 4ZEPA 1V0MA 2WC4A 3VNLA 4MGVA 3BANA 5HPCA 1K3UA 4HMDA 4WEVX 5DMNA 4JNZA 3CHVA 3LXCA 3CC1A 4GGHA 4DRKA 1YXDA 1VAHA 3WBWA 2EG8A 2FJUB 2YCIX 4ECLA 1WO2A 4N02A 1NWRA 2WHMA 1FKWA 3QSTA 4LALA 4XZBA 1VP5A 2ZWZA 3THCA 3SRKA 3VNMA 1BVWA 1FCUA 1KB3A 1R6WA 1B9BA 2G5WA 1BG9A 4IF2A 5C2CA 4L1XA 3BMWA 2TODA 1TMHA 1DIKA 1OCBA 4BQ2A 4FNQA 3WBXA 1G01A 1EP1A 2OWWA 4R9XA 3KS6A 3TXZA 5A6AA 3PJWA 3CHCA 3TN5A 4B2DA 3IGXA 4DJDA 1U22A 5D02A 3GLCA 4RE2A 5FEPA 5HATA 3QGVA 4CU8A 1XDLA 2QJMA 4QLKA 5EYWA 2KX9A 2X0HA 1P5BA 3D3FA 4XD4A 1L1PA 5IFPA 3II1A 1E6RA 3VOGA 4O14A 1Q1CA 3UWUA 1FDYA 3FN9A 2PLCA 1I75A 2IMRA 4MHBA 3V3WA 4OIFA 1XG4A 4LQ1A 3GVQA 3ZIZA 4YYCA 4MUPA 1XDJA 1US0A 3DC8A 4O8AA 4NAFB 2Q8LA 3ZR4A 3JVAA 1Q4WA 3AYVA 5HTGA 4HHPA 4F2BA 1I60A 1QI3A 2ZZ6A 3DAQA 4OGZA 1PO9A 4UQAA 3UG5A 2ZQTA 4DO4A 3GM8A 1Z69A 1X8FA 1QRQA 4YVXA 4W5UA 2GL5A 4YTRA 1L6WA 5BNKA 3ARSA 5DMYA 3IARA 2GSJA 3A4XA 3LCIA 3BAWA 4FSAA 4WGHA 4HBOA 3ZYZA 2P8BA 3AHZA 2VURA 5A5WA 3UXDA 3CQHA 3TH6A 3BLIA 3HFTA 3UFYA 5D38A 3T0BA 4JTRA 4W9QA 4Q4SA 2H8ZA 2OMAA 3WMBA 2VDIA 3FAWA 4O28A 2IQDA 4JTAA 4HOXA 1A3XA 3WO8A 5A8MA 5FF0A 1I0BA 4Z17A 4INFA 2VM8A 3TONA 5IXEA 1GZGA 4U28A 1ZB5A 1I1WA 3BH4A 4L1GA 4JIPA 5ENLA 1J0YA 3AAMA 2V68A 2REQA 6XIAA 1F6PA 2E40A 3CMFA 4O1EA 3R43A 5EFFA 1KLYA 1TJRA 2ATSA 1E6ZA 1I2PA 7ODCA 4H8NA 3VOHA 3GTHA 4MKNA 3QOMA 4MJMA 2HCVA 5AHFA 3QN3A 3U2EA 4UTFA 2R1NA 1XF0A 3B9DA 5D33A 5KSWA 3BJFA 4DNHA 4XB3A 3DU0A 1TRDA 2RDUA 4LNCA 4LBRA 3CK5A 2Z2AA 1XICA 1XV8A 3CIWA 4O16A 1BKFA 4JY9A 2OZ0A 2HS8A 3K8MA 4DWSC 1F5ZA 5DMLA 4XWUA 2NT1A 3GE7A 4JFKA 1XHGA 3M0IA 4IIBA 4XG1A 3H9RB 1JDEA 2Q02A 3DERA 3GTNA 3AROA 1M65A 5F1VA 3L4VA 4PUDA 4MWAA 1SSGA 4JQ2A 1W9PA 1PKNA 2EPOA 2FPTA 2NQJA 1UQZA 3T08A 2J77A 3ZT7A 1OD8A 2ALRA 1TJPA 4MPKA 2OLAA 2AL2A 3ECQA 1NOUA 1Q8JA 2R14A 1W8SA 3HQPA 3W73A 1TE1A 5A8GA 1DTNA 5EPDA 4LYQA 1V3IA 4J3TA 1BL4A 3M0HA 3S2JA 4A3UA 1H3GA 4ZFCA 1DIDA 5TD4A 2GWNA 4XIAA 1VBHA 5HWBA 3RNDA 4AXNA 1SFTA 2XN1A 3VMPA 1XCWA 3IVSA 1CDGA 2CIPA 4C6BA 3UA4A 4O1FA 2YA0A 4GBUA 4YTUA 1HVXA 1G0CA 1X7FA 4QIUA 4WY0B 3OU8A 1FKGA 3T2OA 3UNTA 1OFBA 5T9CE 1ZK6A 3WH9A 2FZDA 6CGTA 2WAGA 9XIMA 3IV8A 3CV1A 1N8FA 1H50A 4MSPA 4Q7IA 2H90A 2VFEA 1XIGA 1RJQA 3MWAA 5MHBA 1DBTA 2QMKA 2G3FA 4PUNA 4OOZA 3VVGA 3W72A 3MY9A 3GC2A 5EL1A 1WBJA 1JUEA 3LLDA 3O6DA 2ZDSA 1SPQA 3MUCA 3UY8A 5A8PA 4J27A 1H51A 4IOTA 4Y9MA 2XYLA 1VFMA 3VPLA 4QDPA 4JNMA 4DYEA 3BCDA 1W8GA 1X96A 4M8UA 3PG8A 3ONCA 2J8TA 5I6SA 3ELFA 1F73A 3GH5A 3WFZA 4ONVA 1WDWA 3R0UA 4W7WA 2PV2A 3CTTA 1WCGA 4GZJA 3JUGA 3URAA 3SM0A 2GOKA 3GX9A 4MYXA 5ECVA 2JEPA 2DU2A 4DO5A 5D2XA 1VD6A 3WK1A 4Z2JA 5C70A 5LXEA 1VJIA 3PUEA 1D7KA 1MEHA 5D30A 3BMXA 4QBXA 4PUWA 4P7OA 4AIEA 3UQBA 3AHXA 2QS8A 1JNDA 2GSEA 2Z4GA 3PZGA 2PP1A 1XLLA 3RO8A 4ZQOA 3FX4A 5C9RA 5REQB 4RCXA 3I3BA 3LM7A 4IP5A 1OY0A 3WF4A 4IL0A 4QJ3B 3FFSA 3IJLA 4LAOA 1THFD 5BMXA 2PPGA 2ZQUA 1EP3A 1XX1A 2CFFA 4TO8A 4M3PA 4Y2WA 2RAGA 2VEIA 2DV0A 2OG9A 3ARPA 1JFHA 4JTDA 5AYZA 3N2BA 3FXYA 3SAZA 4TOQA 4C1NB 1Q45A 5IDZA 5BRPA 3CYVA 2DZBA 4TX9A 4WDUA 4F4RA 5J6EA 3B0XA 1DIEA 1FKKA 1C9WA 3E0IA 3IGSA 4DJEC 4UWMA 2VN1A 3A4WA 3ZLHA 4CQ8A 3TTSA 1QPLA 2DVXA 3M41A 2WQPA 4KCUA 1HP5A 4ZA0A 3CAWA 5DXXA 3BARA 4HPHA 4AH7A 1D7JA 2DT3A 3WK0A 4CD6A 2VFFA 1CWYA 3GR8A 4GHRA 4ORMA 4R53A 2CC0A 1XLMA 4MUZA 6TAAA 3USZA 4S3JA 1OBAA 3NEVA 4R34A 2XHYA 2QULA 3FYYA 2PZNA 4AX7A 4UQ9A 3HBLA 3QHNA 2QGHA 2Q5AA 4QT3A 4C6IA 2RURA 4C6KA 3C0SA 2D23A 3ZVHB 1W9BM 3AYTA 4LUJA 4HPGA 2A2IA 2EPNA 3M5XA 3M47A 1UD5A 1QU4A 4AY8A 1AJZA 5XINA 2BVDA 4OOUA 1IXNA 4NRSA 1G4PA 1XH2A 3BSGA 1EFZA 4ROQA 1JEZA 1EKOA 3W27A 5AVNA 4OUEA 4JXCA 4A3QA 2Y8UA 3ITVA 5K7JA 3OEXA 3ONBA 1W9UA 1LOQA 2E5DA 4KQZA 3K13A 1X1NA 4CNTA 4Q8VA 1YNPA 3SZ8A 1K1DA 2QV5A 3EOOA 3MKVA 4MAZA 1EDQA 2VR2A 2D0HA 1I9CB 3L12A 4V27A 3EOEA 1QOXA 4OU1A 5AC5A 3ZJ8A 4LFYA 3T2QA 1HKKA 3RITA 1O95A 1OCJA 4XVDA 3L2LA 4LYKA 4JKMA 3NQFA 3DN5A 3QGKC 1FWBC 4LVFA 2WCGA 2HEJA 3UR7A 5M17A 3VC6A 1HG3A 5BXTA 4ZPVR 1UD3A 1EJRC 3NGFA 1E1EA 3QJAA 4A3HA 5C7VA 4ZO7A 2DSWA 1B57A 4HK5A 2VT0A 1IZCA 5JIWA 2PI6A 3I3EA 3N34A 1IEVA 4HN4A 2W62A 3M5VA 5DIUA 3T0TA 1V6XA 4GCAA 1I8JA 1E5JA 4Z2LA 2HK1A 4GD0A 3CLWA 2CHNA 3N4FA 1GJPA 4JEQA 1IZKA 1ZPTA 3WX7A 1R8LA 3BAJA 1TV3A 5F4XA 1KWKA 3LXBA 4DPQA 4E6MA 1XBYA 3W02A 2PRMA 1VFLA 3H70A 1HIZA 2R1PA 4DAFA 4IPXA 1NIUA 2OTDA 1AMKA 2PTXA 1LG2A 1KNWA 3BMVA 3PAOA 3PWIA 4EANA 2PSNA 3SCSA 2V3EA 1TE6A 3WLOA 5FJPA 1VQTA 4AEOA 2V5KA 3SGZA 4A2SA 1YNQA 1MZHA 4PSRA 4L3NA 2VR4A 3K1DA 3ANUA 1D3HA 4H1ZA 4EF8A 3TJLA 1Q6QA 2CWXA 1KBLA 1AD1A 1PWLA 5FCZA 8TIMA 4QHRA 2HV5A 3VNKA 4NSBA 3LRLA 4JTHA 2XIMA 3HG3A 2RQSA 1EZ2A 4GH1A 2BNJA 3PBYA 1GQJA 1UWIA 3OGSA 4C6EA 5LNWA 2N87A 2A5HA 5AYBA 1KFLA 5I09A 3N18A 2WSPA 3WSUA 1EX5A 4HU0A 2VFHA 3UVAA 1DJGA 3AO0A 3RLVA 1UWRA 4UNLA 4G1KA 3TX9A 3V18A 1R9YA 4LTSA 4BY3A 1OF6A 3STEA 1LLZA 3EAUA 4MGGA 4H8UA 3MCOA 3VNIA 1UJPA 2QGYA 3PTKA 3MZNA 3NSMA 4IQEA 2VFDA 4WKAA 1YDVA 3ABOA 3PA7A 3R12A 3WLMA 3DKJA 4WX2A 4XAFA 3L2IA 2HRWA 2Y63A 1KGWA 3VD3A 5H91A 1M68A 3BZJA 3WDRA 4HMCA 1QT1A 2FLIA 1ZJIA 5CPTA 3C2YA 3XIMA 4ZODA 3IGUA 4NZFA 2WKJA 2Y7EA 1C9HA 3QKEA 1XC6A 4JN7A 3CNYA 2ZYFA 2ZZ3A 1GWJA 3GWQA 4HYRA 1XI3A 5LHFA 3UU0A 1R0MA 3QKZA 4NXKA 1AL7A 2WMGA 3WLKX 3PBGA 2ZZ1A 4DXVA 1KTNA 2ZR4A 3VIKA 1GORA 1UPMB 2G3NA 2NX1A 3A21A 3EWUA 1UW9A 1VFUA 2G4FA 3WLRA 1TIWA 3N04A 5ABGA 3CUXA 1JUBA 1H11A 1E9ZB 1OGSA 1M9HA 3FSUA 3ARUA 3ARRA 1NFGA 5IBXA 3CQ0A 1W3JA 2MLXA 3C2RA 2OZ3A 4D6GA 2DG4A 4RL3A 2GYIA 4HA3A 1FCQA 3Q4DA 3PTQA 3NQDA 4IFKB 1WXJA 1YX1A 1NDVA 2X1RA 3NTPA 2ABBA 1H7NA 3DX5A 1DJNA 3P60A 5JQ9A 3U57A 3WIJA 1G9HA 1ZP4A 2PTZA 2QCCA 2Y8KA 4KFOA 1F2JA 2QCMA 3NQVA 3STFA 3K46A 3MHUA 4MZ8A 2DZTA 2AKZA 3BGGA 1ECEA 2Z28A 2Z2UA 1BKHA 1YMYA 1JPHA 3KBMA 1OX4A 4EPKA 5FEWA 5AYYA 3B8IA 1SO4A 4DXXA 4FAMA 4NZJA 4Q4PA 3R13A 5J5DA 3HO8A 3CLMA 4OBRA 2DT2A 2WLZA 1QW7A 3U5UA 3B8VA 1KT0A 1BF2A 2PS2A 1BAGA 3L5LA 1ZCOA 3WYZA 1A5UA 3CL8A 1MUMA 2PDMA 4JTSA 5FJOA 1OX6A 1RVGA 5A6BA 3QMRA 2ICSA 1C9DA 4NJJA 2VQUA 2J6XA 1VFHA 4TQTA 4JL2A 3VI2A 2XSBA 2J7HA 4CNUA 1NJJA 4FX6M 1JVNA 5AC6A 1V6UA 4QXIA 1BTMA 1XUZA 2VQTA 3IJ7A 1XH1A 4TV6A 4E2OA 4NUWA 3UEQA 3VIIA 4QQUA 1RBLA 1XSJA 4HPJA 2E68A 1Q8AA 2L5HA 1Q3NA 1ZJBA 2W79A 3ABSA 3AYSA 1EGMA 2OPJA 3EWZA 3TW9A 4P8UA 1W1ZA 1TFVA 2QJHA 4IPJA 3E2RA 4UTUA 1M7PA 1Q7QA 2E1WA 4N0RA 4LV4A 3AU2A 3LHYA 2EXOA 1M6JA 5LA0A 3TU9A 2J13A 3N9KA 3VU2A 1QI4A 2VHLA 1LT8A 3G5EA 3VTRA 3AXHA 1V08A 4DM1A 4OHQA 3EEZA 2NQHA 2P1FA 3BW2A 3EYPA 1S2CA 4QAIA 2QCLA 1SR0A 1VBRA 4DYJA 4CVWA 2OWCA 1EF2A 1V8EA 3H53A 4IISA 4PR4A 1M03A 1ROUA 3K5XA 1YDNA 4JTIA 2DZXA 3VABA 1PWMA 3RFWA 2YBTA 3W7PA 3LEPA 3RX3A 4XZLX 3IJ8A 3BO9A 1A3HA 4TTUA 3DZ1A 3A24A 4O2TA 2QF8A 3KVLA 1GQKA 1P7TB 4I3GA 1EUAA 1GQIA 3NQMA 3CEUA 4CVUA 2NXGA 1R7OA 4M82A 1DWAM 3E2QA 3WQFA 1BQCA 4I7WA 4HU3A 3GY1A 3NRKA 3DHPA 4FNUA 3OOQA 3VAWA 2KZHA 1U79A 4G50A 4HCLA 4HVXA 1XXXA 4DRIA 4MKSA 4ODLA 4D2JA 4LAMA 1FKXA 3OB8A 5FJTA 3PPCA 4NZ3A 2GSHA 2VWSA 4U3AA 2KI3A 3DXIA 4LCSA 4C6DA 2IS7A 4HNNA 4QAWA 2B7QA 2HNEA 3RU8X 3UA3A 2WO5A 2PV1A 2DT0A 4C91A 2WNWA 3BAIA 5D2YA 3WQGA 1SGJA 3VAVA 5GPGA 1J0JA 5E70A 4D72A 1C93A 4UFKA 3R2GA 3GDKA 1D7HA 4JTTA 3BW3A 4MZYA 3TFCA 3BV4A 4L5ZA 5F2MA 4WXZA 1TJ2A 5K2ZA 1W31A 1YE4A 4LUYA 4UFHA 2Q8ZA 1UR2A 5TBOA 4N7QA 3DFPA 3S9ZA 3HG4A 4CKQA 4UOZA 2QYGA 1UUQA 3W88A 4QG6A 2D2JA 3O05A 1OWQA 4ICNA 4W93A 1XLDA 1VB9A 4V2XA 4N9DA 1HJSA 3HPSA 3TW7A 1RHCA 3A5VA 1UA3A 2V5JA 3A23A 5LSMA 1DJQA 1OADA 1E51A 5HULA 5CZKA 3ZS4A 4MJZA 1R87A 2YOCA 4PMRA 4AZ6A 2GGEA 1OQFA 1KXTA 2O9OA 3P61A 1DJXA 4IMDA 3NA8A 3W81A 1GTHA 4HP5A 1PX4A 3K4DA 4D1IA 3IUIA 1MSSA 4PZVA 5BRQA 4DZ5A 3ZWTA 2O7QA 4DJFD 4QJ1A 1IHIA 3RMEA 4FLSA 3ABRA 1S2WA 4S2CA 1GJWA 1KCXA 3E0LA 3SUUA 1V0LA 2VCDA 3RJYA 3GW0A 1EDGA 2CNCA 5A6MA 1P48A 2R91A 2YFOA 1LQAA 5I77A 1QTWA 1TZ7A 4TR9A 2HDJA 5G4WA 1XLCA 5AB3A 1ZBVA 3W7QA 3R79A 2TSYA 4HD5A 4A21A 1QI5A 2J25A 1IE7C 4MM1A 2NQ9A 3GUWA 3O5FA 3OBKA 5D03A 2OELA 4HU8A 3THAA 3TZNA 3V1PA 4LB4A 3ITLA 4UZSA 4HOZA 6ALDA 4ZO8A 4UTWA 3KHJA 3W1UA 2B4GA 3Q67A 1UWUA 4TU1A 3PJUA 1OCNA 5C55A 4S3KA 3KAIA 1KRAC 2UBPC 2IW0A 4F9DA 2Y61A 3QC3A 1IQ8A 5HW7A 2BSLA 1OX5A 1EJSC 1TZZA 2F38A 1KGXA 3EXSA 3V5FA 3AC0A 3SCRA 2D9FA 4M7SA 4MDOA 3ZLFA 2WPBA 3PTMA 1Q6RA 4LYPA 3ES7A 3W7IA 3VDHA 5KZMA 1PUDA 1LBLA 2P3ZA 1CB7B 3W2MA 2ZUWA 3WF3A 3W53A 3ZJ7A 3PBUA 1F07A 1B30A 2OGJA 1WKFA 4I90A 1JI2A 3TC3A 5T26A 1QHOA 2XFRA 1TZ9A 3ANVA 2J4GA 3TQVA 4PMNA 1FWDC 1YIXA 5CQ1A 4E2DA 4Q4KA 1ITCA 3B0PA 3AYRA 1QXLA 1XLHA 3BXWA 2Y7DA 1EIXA 3BAKA 3R11A 1OIFA 4DNMA 4H9MA 5GPRA 5DQPA 3B7XA 1LORA 4E2BA 4LH8A 2WSYA 1G6CA 3U6WA 2NXIA 1EF3A 2YCLA 1NEYA 3PY2A 1YDYA 4CD5A 4JHOA 2XP6A 4HPNA 3PULA 1H63A 5SWUA 1J4IA 1JGMA 3L4YA 1I45A 2W67A 3BVJA 1S1RA 1P1MA 1VR6A 3QBUA 4E38A 5AHLA 2X0SA 4ZO6A 3UWEA 1KTCA 8XIMA 2IXUA 1F3EA 5FIPA 2TRSA 1CGWA 4YTSA 2GUUA 3NOEA 4OBSA 4ACYA 4DM2A 5T9BG 2VP8A 3CS2A 3HGOA 1F6KA 4PH6A 2BGSA 2I7GA 3UQNA 2FZNA 3O0FA 1TVLA 3O63A 1FP8A 1LQ2A 4UTKA 2OOGA 1M3UA 4US5D 3FA5A 3NVDA 1DORA 4IJCA 3GDTA 4DZ3A 1K7EA 3W70A 3LZ3A 1BF6A 2WMJA 4GXWA 5D8ZA 4AF0B 2M08A 3WLLA 3WNOA 1YBQA 1UR1A 2PTDA 3AALA 2Z25A 3W87A 5CPSA 3N11A 3Q65A 1E73M 4IT6A 4JIIX 5F2GA 3GXIA 1FDZA 3FHQA 3HIJA 1L8PA 2J9XA 4EX4A 4Z1CA 3LGEA 3QSRA 2GFTA 3M64A 3L0NA 4S38A 3WDHA 1O5KA 2DDXA 1HO1A 3BE7A 3ZJKA 4M1BA 1CGUA 4GACA 5FSEC 4XSLA 3T44A 5T8GA 3GG1A 2X1UA 1J93A 1EWEA 3VIMA 4WOZA 1MMFA 2GVYA 3FGCA 3LX9A 2X8RA 1T99A 1V7AA 1CYGA 3LTPA 5I3KA 1Q13A 3NWRA 4GVIA 1FAPA 2GJLA 5KZDA 3GG7A 5LIXX 1KFEA 3EXRA 3NZPA 2XP3A 2GZXA 1EJ7L 1XGEA 3MUY1 1CB2A 1SO5A 1JQXA 3PZUA 1J2BA 3IVUA 3TCSA 2CERA 2WC3A 3M0VA 4AYSA 3VK5A 1V6VA 3RFAA 3UZJA 3LBMA 1QW8A 2C14A 2I57A 1J6PA 3AIWA 2PWDA 3PWGA 4K6AA 3GXFA 3TTOA 2ZXQA 3GRIA 4GIEA 1A4MA 1FWCC 3APYA 2QUTA 2ZA1A 1A5MC 3LHUA 2VR5A 4RXGA 2UY5A 3W28A 2YDQA 7PTDA 5A6SA 2Z7GA 1K6AA 3QR0A 1YBQB 1JI1A 2PRHA 4Y9AA 1PZ1A 4LEFA 2JIEA 1W1IE 1QR7A 1XLGA 3CV7A 4S3EA 4FEZA 2GWGA 3U4AA 4KWSA 5D05A 4JTJA 3AXIA 2H8XA 3LUTA 1GVSA 1EJVC 2Z1KA 3C8NA 4U86A 3QW4B 3UWYA 1W3HA 5M5DA 1L6FA 5HWMA 1UWTA 4ML9A 2RUSA 1JCXA 1UA7A 3JS3A 3VE7A 5C6MA 5ABFB 1VIWA 2ZUTA 2LPVA 4GNVA 1GJUA 4O0ZA 2JQXA 1ADDA 4M1RA 3WD2A 2H3BA 3C52A 3GNXA 3UQAA 3OZYA 1JPMA 4B90A 4Y7EA 1B3WA 3OHMB 1DEDA 3DHDA 3C2OA 3HGSA 4OT7A 1XYZA 1EYWA 1FKFA 2HE8A 1A5AA 5D9PA 3ABXA 4L4LA 4F40A 1UP0A 3V16A 4O1AA 3VDGA 9RUBA 4XIMA 4XTDA 4O1CA 3ALFA 4U85A 4X3ZA 1ZSXA 1VFSA 3KWSA 1A53A 5D04C 5DMMA 3WQ5A 4JTCA 1UKQA 4IG2B 4OECA 1JL8A 1BWKA 4E4PA 1R30A 3TW6A 5CAHA 3IACA 1KCLA 1H7XA 3HF3A 3O5RA 1CPUA 4NP7A 2IKIA 3V4BA 3BG3A 3BLPX 3M0KA 2GK1B 2J27A 4B15A 1KM4A 3PF3A 2IPGA 3MB9A 4GBDA 4JTEA 1EXBA 2AOSA 1GOXA 2H9AA 3H2OA 3EWWA 3QM3A 1SFSA 1VLIA 4JFJA 1REQA 2VRKA 3CASA 4F0MA 2D3NA 3S5YA 1GOQA 3KM8A 2NX9A 3GTXA 1AZ2A 3GAYA 3W1LA 3ZO9A 1YPXA 3AFBA 1ZS2A 5E09A 5HKGA 4U2ZA 3MV01 1BXNA 1EUNA 4UR8A 1EHNA 4ATWA 3IJ9A 2IPJA 3PSVA 3L21A 3DGRA 1MXSA 3RM9A 2HPIA 4NNRA 5GJMA 4CEXC 3BV7A 4WDWA 5D75A 3GTYX 5EBAA 3MCMA 1QHPA 1TV5A 4GFIA 4NILA 4AMCA 4UR9A 5ABHA 3GD6A 4AZ5A 1PBGA 1NP0A 1SO3A 2ZIDA 4ZTYA 2QJNA 6REQB 3NQCA 2IQTA 1E6NA 7REQB 3N13A 3L4WA 3UYIA 5LIWX 2AWGA 1EDTA 2J88A 3EXTA 1WOAA 2W3ZA 4QR6A 2VUYA 4YVVA 3VNDA 4HGXA 5EY5A 3WNPA 1J12A 3QV9A 3AS2A 4QSFA 1BD0A 3WJXA 4K68A 5GVJA 1JDAA 3QOKA 4MNKA 3A13A 1PB0A 2Q8XA 2E0PA 4OV4A 1DJIA 1ELSA 1HKWA 3VOFA 3FVMA 4EXAA 1KC7A 1ZZMA 1TIMA 2RJGA 3W4RA 3H23A 5HW6A 1G4EA 1J79A 1GQNA 4O10A 4DF2A 4IWWA 1DWHM 1VCGA 3TEVA 1VCFA 3HPXA 1F05A 1AUSL 4L9YA 3LCLA 1EC8A 2GGJA 4FK9A 4TW7A 3DGBA 1W9DM 4NRRA 3KZSA 4MNLA 2HS6A 3KVJA 1RALA 1XLIA 3GVGA 8RUCA 2A0NA 3GXTA 4DF1A 3PBWA 1MW3A 4H6RA 5AN7A 2I9UA 3IPWA 4JOMA 3LCXA 4JIQA 1J9YA 1E15A 4D6CA 3G1RA 5HT1A 4G5DA 1NOWA 2NWSA 2OKOA 3L2MA 4C60A 5FSDC 1NWSA 1PZ0A 3SEPA 4WQ6A 4M6VA 2DIKA 4YTQA 3SUWA 1R2SA 2W6RA 5LNRA 1A4LA 1ME7A 3NXLA 1KKRA 1U5VA 2WBGA 1Q6LA 5D4YA 3IIVA 4KETA 1C91A 1W5QA 4H9XA 3LPFA 3CEPA 3RM4A 5AHMA 2PUZA 3I7SA 3S1GA 2WB5A 3ZXWA 2XGBA 1QPQA 1HKJA 1MEIA 4A35A 3K4WA 3SGGA 4IMFA 4P5UA 4JFUA 1DXFA 4H83A 1VEOA 1MQRA 4JX5A 4ZGYA 5IM51 1VJSA 3Q58A 4JHMA 4MLJA 3NVTA 3EKZA 3DG6A 1Q6CA 4GQBA 1F40A 1OB0A 3N4EA 4DB7A 3W1RA 4KS0A 2HZGA 5CG0A 1BVZA 1KGUA 2X1TA 3EWCA 1U33A 3S2MA 4L64A 4F48A 3STCA 3GFZA 2WHJA 2NT0A 2QLYA 1XBXA 3PM6A 2E6YA 2G8ZA 2A7PA 2VCCA 3LHTA 5PTDA 3WDPP 2HVNA 2X09A 2DQWA 1FD9A 2J7EA 2W63A 5EMUA 5CPNA 3C61A 3N2XA 3WBEA 4AISA 1UUOA 2YJQA 3KBSA 3TYDA 2YLAA 4XO6A 2WANA 2I9EA 1RPXA 3G6LA 1QFEA 2WVVB 3WF1A 3PPGA 4PMXA 2CESA 1WZAA 3PFRA 4DWSD 3WEMA 4TV5A 3UJEA 4DXKA 4MSSA 2FPYA 5CPLA 1MUCA 2C1IA 2YZ5A 5A1AA 2FH8A 1PIFA 3GR7A 1RVKA 2Y2WA 4FNPA 3LLFA 3CHEA 2QF7A 4FLOA 2GPTA 3TSMA 1TQJA 4N6FA 2R6OA 1FQ0A 3S1WA 1WXZA 4HZ6A 3WLPA 2UY2A 4JPGA 2EG6A 2LGOA 3WLTA 3EOLA 2QIWA 3W86A 3GC4A 4OV9A 1F61A 3DHFA 4UZUA 4OFCA 1ZAIA 4P7RA 2EJ1A 3DDMA 3BOFA 3KAFA 4GZIA 2RUCA 4IIGA 4GYKA 4MVAA 3M5ZA 5DY2A 2JKAA 2D2GA 4RE3A 4DPPA 4YU1A 2YB4A 1YW5A 3OW1A 3ENLA 3R0DA 3PP7A 2EEXA 1WP6A 4LF1A 2P5NA 2PDHA 3B3DA 3KFTA 4PTMA 2YYTA 1GTEA 1RQBA 1SJDA 3W6YA 5DRIA 3V5CA 1A3WA 3URNA 1HUVA 4RZ6A 2QNEA 4PA8A 1P1XA 1FDJA 2PGWA 2CWNA 1ONEA 3M1ZA 2EF9A 5AZ0A 3GIQA 4S3AA 2JF7A 2AAMA 3MMDA 4FMVA 2VC9A 3G1FA 4QCEA 2VZOA 3THQA 4Q33A 4DUVA 2GQ8A 5DO2A 1FVPA 4AWSA 1FKTA 4F0SA 1C8VA 3QTGA 1EEPA 4GIYA 1K7XA 4AAJA 1H7