2YBUA

Crystal structure of human acidic chitinase in complex with bisdionin f
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
376
structure length
376
Chain Sequence
b'AYQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACIDIC MAMMALIAN CHITINASE
publication title Analyzing airway inflammation with chemical biology: dissection of acidic mammalian chitinase function with a selective drug-like inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 129
structure length 376
sequence length 376
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2011-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ybuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2ybuA01
2HISA 3OLEA 3LPPA 2YL5A 3LMYA 2J7DA 2CITA 3WNMA 2J77A 4WKFA 1CIUA 2Y2WA 1RP8A 3SURA 4Z2HA 4AD3A 5A8OA 5I78A 2O9OA 5EBAA 2W61A 3WD1A 3N13A 1NH6A 1E43A 4OOZA 5CJ5A 3TTQA 5CPTA 1HP4A 3SCVA 5DF0A 2E9LA 1QVBA 3VIIA 1TUXA 4ACZB 4CGTA 2WC4A 1R85A 4Y7EA 4ZXLA 3TTOA 5LYRA 1GHRA 3VMNA 4AD4A 3D3AA 2BXYA 3EMQA 3K4AA 2BVTA 5D9NA 4FLQA 3VM5A 4W7WA 5LA1A 3BLPX 4MB5A 4Z2IA 1IZJA 1OGSA 4L4OA 1CXLA 4CVUA 2BY3A 3PTKA 3RDKA 2D1ZA 3W37A 4GINA 1MXDA 2EXOA 1TFVA 3PN8A 2O9PA 5A6SA 1BYBA 1KQYA 4XX6A 2XFFA 1KFWA 1UR0A 1ZJBA 1GORA 4IUGA 1W9DM 1XSKA 2VZSA 4KMQA 4AZHA 1LL4A 3OLIA 4JHZA 1WDRA 6CGTA 4UQEA 4BS0A 3APGA 3W24A 3PZQA 7TAAA 1A47A 3BH4A 3BSHA 4J28A 3ARZA 1UWRA 4HA3A 3WEZA 2PWFA 2ESCA 1QHPA 3RILA 3IJ9A 4AY1A 4GI8A 2CHNA 1CXHA 3ARQA 5GNZA 4ATWA 4W85A 3VD3A 4C7GA 4DWSC 4OBRA 1WAWA 1PAMA 1E0WA 3WBEA 4AZ5A 1E72M 1C8YA 4W5ZA 2O9RA 3AISA 2WMKA 1CXIA 4PCSA 2D24A 2WMIB 3UR8A 3IAPA 1V3MA 1C3FA 3SUWA 4PUDA 4R5EA 4PMDA 1Q6FA 3ECQA 3BGAA 2OYMA 1Q4NX 2JEPA 2WPGA 2DEPA 3SCOA 3W38A 3WEMA 1UKPA 3PTQA 4LX4A 1W9VA 1O7AA 1GQKA 4AD5A 3GNRA 4Q7NA 1DWJM 4PMOA 1CTNA 3EDEA 1XHGA 3VIFA 1LG1A 1R8LA 4V27A 1BGAA 4JCLA 4M81A 1VBRA 1MVYA 3CHEA 4ZFMA 3E1F1 3VIMA 3T2QA 1ESWA 2XVLA 4W89A 3MV01 3WQ4A 3ZR5A 5JBEA 1UWIA 1HN1A 1OT2A 2VX7A 5A8NA 1D7FA 4ZE4A 2WMHA 3ZIZA 2XHYA 4RE2A 1KXHA 1CWYA 4QLJA 1DWGM 1JYWA 4W88A 2C0HA 1ZBKA 1E70M 4ATLA 4CD7A 3PZTA 3VIHA 5M03A 2ZWZA 8A3HA 5JIWA 1DWIM 1BHGA 4UNIA 1J0KA 3TONA 1TVNA 3RM4A 3AIRA 3VGGA 1QBAA 3CMJA 1E4NA 1E5NA 2WC3A 3NIYA 3WNOA 2ZUNA 3K4DA 3RJXA 4HOXA 4GKLA 3RO8A 1SMAA 4W7UA 1EHAA 2XVPA 4MNJA 1W9BM 4D6DA 1DP0A 3AJ7A 2ZXAA 3SIMA 2FH8A 1SFSA 1Q6EA 3PZOA 2XVKA 2XSAA 5D9PA 3SUUA 1B30A 3NJ3A 2AOSA 4B3LA 3AMDA 2NT0A 2EJ1A 3CTTA 2XJ7A 3W53A 1JYXA 3AICA 4JFSA 3M7SA 2FGZA 4H8VA 4WLCA 5DO8A 5IXEA 3IANA 1UR8A 1XYZA 3AHVA 3POCA 2WC7A 2PB1A 5IFTA 3UEQA 1BYDA 1K9FA 4D1JA 5CSUA 5CPQA 4NZCA 4KGJA 3WDQA 2ZX7A 3O6AA 4B9YA 2J79A 2VR4A 4DUWA 4GI6A 3ALFA 4IPLA 4J3SA 2JEQA 4UFIA 5M3WA 1V0NA 5I2UA 3N12A 3EMZA 4BQ2A 1JAKA 1JZ2A 4D1IA 3WDPP 4F66A 2YBUA 3WDRA 1KR1A 2VCCA 1UZ4A 1TG7A 1DWFM 4CCDA 4E2OA 1GOMA 3W29A 1GONA 1W9UA 1QW8A 2Y4SA 1F4HA 1NM9A 4GO9A 1UD2A 3W6LA 1A3HA 1ECEA 3ZR6A 3BAXA 2VR5A 1BVNP 2V38A 3W28A 5BXSA 2VC9A 3BAWA 3CHDA 1W1TA 1ODUA 4CN4A 3RM8A 3ZT7A 2VT0A 4GO8A 2EBNA 1F4AA 3RCNA 1H5VA 2W63A 2JFEX 1Q6GA 5LA0A 4W5UA 1SYTA 4U2YA 3MMWA 3VGFA 1U33A 3WIJA 5A3HA 2VOTA 2VQTA 4Z2JA 4JCMA 1CGVA 5BWFA 1MW1A 4P7LA 2CIPA 2PF0A 3DYPA 4QP0A 1OD0A 2ZICA 2YL8A 2Y5EA 3QR3A 1HL8A 2VTFA 3QGVA 5BXPA 4MPKA 1YQ2A 3K8KA 1CEOA 3OGSA 1E0VA 2FGLA 5ABGA 1W32A 2XVGA 4H7VA 5AYBA 1LG2A 2ZXDA 4RE3A 4JFTA 2JIEA 3B9DA 1NP2A 4GQQA 4FLSA 2DDXA 2AAAA 2W67A 1M04A 1JXJA 4H8UA 1C90A 3CUHA 2CBVA 5I24A 3WY1A 1NP0A 4WJXA 4P7RA 1BQCA 1MQQA 5E9AA 3ZSTA 4CUCA 3GH4A 5BXRA 3MSGA 3SCPA 1CGYA 3FNDA 2WBGA 2CHOA 2YL6A 2GJXB 1OIMA 2PWGA 1VFMA 1E3XA 2WCAA 2YBTA 4AD2A 4OUEA 1DWAM 4LXFA 4M56A 3VGHA 1UA3A 4LYPA 1DWHM 2PWEA 1ISXA 1EO7A 1UH4A 1CPUA 2VQUA 2WBKA 1N82A 3ZT5A 2DT2A 2O92A 3OZOA 1R87A 2XGBA 1J11A 1JFXA 1W1YA 2A3HA 3VDCA 3WL0A 1BYCA 3BMVA 3AIVA 4ZEPA 3VX1A 1FP9A 4CN1A 1JF6A 2IXUA 5BCAA 3U7BA 3WDIA 6A3HA 4MB4A 3ZSSA 4UQAA 3OGVA 2ZX6A 3VOCA 2X1IA 4OIFA 4LYRA 3DC0A 2PC8A 1VBUA 4AZCB 1ZL1A 1KGXA 1WKYA 4EKJA 5HBFA 3BXWA 2E0PA 3GXDA 3ARXA 2YKKA 4YN5A 3IJ8A 4CD8A 3WUEA 4KRTA 3J7HA 2G4FA 3VIJA 3WF3A 2PWHA 3A3HA 5AC5A 2YOCA 4UQCA 4P8WA 1WP6A 1D2KA 5DMYA 4J27A 3AQUA 3AMGA 2ZUVA 1XGZA 3A47A 4TTGA 5BRPA 4FLOA 1CLVA 4JKKA 2WWDA 3D5HA 4AD0A 3VD4A 2WVSA 4F9DA 2YA2A 2DGAA 1I75A 2GK1B 1H2JA 3MSDA 3VNZA 4U3CA 3AYRA 1O6IA 1QHOA 2JE8A 3PHAA 3I3DA 4J3WA 3CIVA 5HXMA 4DM2A 3UERA 2VMFA 2WYSA 4AC1X 3EDKA 2GSJA 1J9YA 1G94A 4Z2KA 2D0FA 3A6OA 1HT6A 3CH9A 5M5DA 1QBBA 4UR9A 3WUBA 3U57A 3HN3A 1ZJAA 4EAMA 1LWHA 1FA2A 2XM2A 3W26A 2VZVA 5KZ6A 2RGMA 4WIWA 4A3HA 3VMOA 1DTUA 2DIEA 5D8ZA 1ISVA 1LL6A 1ISWA 2OWXA 4WSJA 2D0GA 3CUGA 5GNYA 5CLWA 2IXVA 2ZUUA 4EANA 1LF1A 1JNDA 5AC4A 3VO0A 1B0IA 1X6LA 3AHYA 4GZJA 1H09A 4JAWA 4TX6A 3B9AA 1IZKA 1PZ2A 3N17A 3WH6A 1KCLA 2CESA 4HTYA 3KL5A 1PZ3A 5D9OA 3MUY1 3KL3A 2ZUWA 1AQMA 3KWXA 2WLYA 1EDQA 3KZSA 2ZXBA 4MADA 2VURA 3GYCA 3NCOA 2BS9A 2WHJA 4U3AA 3WSUA 2QF8A 3II1A 4KH2A 5A8QA 3F4VA 2Z1KA 3W81A 4P8UA 2ZOXA 1JFHA 1KQZA 5ABHA 3OG2A 1V6XA 4W7VA 1QI2A 2X2YA 4HZ7A 4B15A 1ZBVA 2XVNA 3AIBA 1GOWA 1LJYA 2D23A 1ITCA 2G3MA 4OKDA 1MW2A 5CLTA 2VVSA 3NDYA 3SUVA 4DM1A 2WNWA 1E6SM 1MWOA 1UWQA 1RD6A 1VF8A 2GVYA 4GXPA 4R27A 1UA7A 2YDSA 4XV0A 4B3KA 4CN6A 2WANA 1J0HA 1C8QA 1E4MM 1VENA 1C92A 3AS2A 2QLYA 3EDJA 4MJ4A 1QOXA 1EHNA 1CECA 1WZMA 1B2YA 1EXPA 1VEPA 2UWFA 2EPNA 4JFUA 2WVVA 4UTFA 3L4YA 3BMWA 1HJUA 3DYOA 2G8ZA 2D20A 3PZUA 3K8MA 2OSYA 4WK9A 4HU8A 2GFTA 3K8LA 1LL7A 4YPJA 2WKGA 4QLLA 3M07A 4OZOA 1JNEA 1SMDA 4ZXOA 1KR0A 3MMUA 1EA9C 1TMQA 5HOSA 2XSBA 4AEEA 2DQXA 2J7BA 3L4ZA 3VU2A 5A6LA 4DWSA 5FL0A 1UQYA 1GHSA 3L4XA 1US2A 1HX0A 3GH5A 2WWCA 5A1AA 3EMCA 5CGTA 1V08A 1X1NA 1EIBA 4KWUA 1QHZA 5A6BD 1TA3A 1KGWA 3AXHA 4W8BA 3AOFA 1JIBA 2F8QA 2ZUSA 3AHZA 1GUVA 2BY2A 1SR0A 3QHNA 2BHZA 4MB1A 1WDQA 4B9ZA 2XGIA 5DFAA 3RJYA 3L4TA 1UYQA 1CLXA 1H0GA 2OLHA 1XCXA 1UHVA 4PMNA 3WUGA 2JF6A 1PIGA 2OSWA 4J3XA 3MUIA 2WZEA 1XSJA 1UWUA 3CHCA 1W3HA 4UOZA 5A69A 2VO5A 2J7EA 1VJZA 3FY1A 3KL0A 2W62A 3WMSA 1QI0A 3K1DA 1Q6CA 2D2OA 4PTXA 4CU6A 4FLRA 4TTUA 2WZHA 1R86A 1VFUA 1V0KA 1OM0A 3CZLA 5AYIA 4D6IA 1MFVA 3WD0A 2XFRA 3CBWA 2VZOA 4KRUA 1BGGA 4IISA 2ZE0A 2E9MA 2V3FA 3VMPA 1Z32X 1CNVA 4NSBA 1OIFA 4AIUA 1MW3A 1XH2A 2EEXA 3PBGA 1ZBWA 2NT1A 4UQDA 2CNCA 2G3NA 3GXFA 3GM8A 2VUYA 3WH5A 1GJWA 1U2YA 2X0HA 1W3LA 5JUVA 2YIHA 3FN9A 3WF2A 1AVAA 5HPCA 1JD9A 2VX4A 1JZ3A 3VPLA 1PIFA 1UR9A 3CUIA 4MNKA 2B31A 2WCGA 2OYKA 4CCEA 1JZ5A 5E09A 4HZ6A 2XIBA 4UFKA 2FDMA 5CPSA 3W25A 3CZGA 1BAGA 5A6MA 4MDPA 2BY0A 1KXTA 2QMKA 2Z1SA 4TVUA 2CERA 3WQWA 1C8XA 4H2CA 3WL1A 3SUSA 4NRSA 3FHQA 1V3JA 1HJSA 3BCDA 2PWDA 3BC9A 4PUEA 2EPKX 2J75A 3VVGA 4HMCA 3A4WA 3OLDA 1Y7VA 3T0BA 1V3HA 1KB3A 3VD7A 5A8MA 3LPGA 3L4WA 5DT7A 3TTSA 5BRQA 4U5KA 3PZNA 5CQ1A 3RIKA 3UG3A 2XIIA 3ARSA 3WNLA 4HOWA 5A6JA 2YL9A 2VCAA 2XUCA 4J3VA 5A94A 2QPSA 1OBAA 4DUVA 4YHGA 1QI4A 2YDQA 4Z2LA 3ARYA 1FH7A 1FFQA 5I3DA 5IHSA 3I3EA 2J4GA 1YHTA 5FD0A 5LA2A 4XZWA 2XM1A 1E9LA 1L8NA 4IM4A 2CXGA 4JKMA 4B16A 3MS8A 4ATDA 4TVCA 3ZJ8A 5C70A 2XFYA 3FW6A 4AZ6A 4J3TA 1WCGA 4TVDA 3CO4A 1E6NA 1E3ZA 5ECUA 3OLGA 3PTMA 3N9KA 2DPEA 1EQCA 8CGTA 2CEQA 2WVTA 3WH9A 3CUJA 5JIPA 2ZWYA 1E73M 4U2ZA 3N15A 1BYAA 1WZLA 1GNXA 4D6JA 2G3JA 4ZE5A 2D22A 1VFFA 2DIJA 3M46A 5EFDA 4WKHA 4OOUA 4BQ4A 4F79A 2EPLX 4LQ1A 3TA9A 4CD6A 2BY1A 3M6DA 3ZT6A 1UWSA 2J74A 4EE9A 3AZSA 1OWQA 1CXFA 3GBEA 1JG9A 3ZO9A 4JL1A 2FHBA 2J7HA 4S3JA 4QLKA 1UKTA 2FHCA 5E0FA 1TVPA 3WD3A 3WF4A 3SCTA 1BSIA 5E70A 4C7DA 5D8WA 2YLLA 3PZIA 5HDRA 4C7FA 5DEZA 1H1NA 2Y8VA 1HP5A 3ARUA 2DT3A 5D4YA 3ALGA 1BF2A 1FOBA 4CU7A 4QAWA 4BZYA 3VNYA 2W5FA 5CXPA 1NWUA 4PSPA 1UQZA 1XH0A 3I3BA 3WN6A 3N11A 3AHTA 2OWCA 3CHFA 4OBSA 3U5YA 1GQJA 4P7OA 1ZU8A 3B8SA 2V3GA 2WMFA 1HJQA 1JZ4A 4AZCA 3WMBA 1CGTA 1MW0A 4D6HA 2VCBA 3GZAA 2FHFA 1UR4A 1J0ZA 1UZ1A 4N42A 1VIWA 1XYFA 2WVUA 3BAJA 2E9BA 2VX5A 5ABFA 1PPIA 2WKLA 4U5IA 3ZOAA 4LGXA 4NF7A 2J47A 3IK2A 5JBFA 1K9TA 1I1XA 2WSKA 3L2LA 1HJWA 4NI3A 4P8VA 3HJEA 4UZSA 2V5DA 1V03A 3W82A 3KE0A 1M53A 2WMGA 1B9ZA 3F5LA 3MANA 3ARVA 4HOZA 2J8FA 3DHUA 4DWSD 1H4PA 1JGIA 3WF0A 1XH1A 2BFGA 3UG5A 2DSKA 3NSNA 1C91A 1K6AA 2X8RA 3CZEA 3T2PA 1E0XA 2CPUA 4MB3A 4WF7A 5CSYA 2CKRA 1NWTA 2NSXA 5EB8A 1V6UA 2XG9A 1FHDA 3SUTA 3AMKA 3TTYA 1UH3A 1UG6A 3EDFA 4UFHA 2G41A 1JL8A 1V0MA 2O9TA 1QNQA 4F8XA 3CZJA 3KEHA 1GCYA 1E40A 3GXIA 1E6XM 2XWDA 4HA1A 5CZKA 3G6LA 1UKOA 1GVIA 1H49A 4W87A 2GJRA 1E5JA 3VDBA 4E4PA 3UETA 2VRJA 3AROA 4D6CA 1V6YA 5A6KA 5AY7A 3WF1A 1E4LA 3RPMA 3A4AA 2F2HA 3BSGA 3OA5A 1X6NA 4MTVA 4OJYA 4AWEA 3SCUA 2D3LA 1DEDA 1GPFA 1JI1A 2TAAA 3VIKA 1UD8A 4TXEA 4V2XA 3MV11 5A2AA 3VUPA 3VTRA 3T0AA 3WBAA 3O9NA 1GVYA 4AZIA 1QNPA 4ACZA 2W66A 1NOUA 3T09A 3K46A 3N1AA 1WO2A 2BNJA 1WDSA 3PZGA 1I1WA 1ISZA 5BXTA 1KBKA 2ZX9A 3W0KA 2BVDA 1VFOA 4LYQA 1VB9A 4ZENA 2DT1A 3FHAA 2V3EA 2GUYA 2WMJA 2UY2A 1BFNA 5A8PA 3WD4A 2WXDM 1HJVA 1UKSA 2CCRA 1ZB5A 1GOQA 4GZEA 2OYLA 4XZBA 1VEOA 4W8AA 4WSKA 2A3CA 1C7TA 1V02E 4A3YA 5E6YA 2VVNA 1J0JA 1W3KA 5F7UA 1JDDA 4D71A 3WFLA 2W91A 4A4AA 1XRVA 1E56A 1V02A 4HMDA 1MFUA 4M1RA 3VD5A 3WENA 4P7QA 4D6FA 4RE4A 5A6AA 4PMXA 3CZKA 1CGWA 4UQ9A 1E6PA 1HKIA 1EQPA 1ZBCA 3W4RA 1V0LA 1VEMA 4D6GA 1HNYA 1D3CA 2MANA 3FXYA 1E15A 3IJ7A 1HKJA 3OGRA 4KGLA 2XTKA 3AXIA 1XSIA 1S46A 1UD6A 4CKQA 4Z2GA 1H41A 3ARRA 4HPGA 2ZXQA 4X0VA 1CENA 1K9DA 2WMIA 3MUAA 1M01A 2EPOA 3AZRA 2OSXA 3WQ5A 5I79A 2XPKA 3NUKA 5FOOA 2YDRA 1OSEA 3GXMA 1G9HA 4UOJA 3WNPA 2DSUA 1VJSA 3AI0A 1JYVA 2AMGA 1AQ0A 1GQIA 4GZIA 5IDIA 5I5RA 4DUXA 1QNSA 4BCEA 1H3GA 3AZTA 4L4PA 3FAWA 4ML4A 1GOKA 5GPRA 1FP8A 5HNNA 1CZ1A 5HPOA 1C7SA 2JF7A 3AS1A 3CLWA 1IV8A 3U7VA 3ZQ9A 2DSVA 1JZ6A 4JIEA 2ZIDA 3TOPA 2E3ZA 3DYMA 5FL1A 1VAHA 4GPNA 2DT0A 3HU7A 1XCWA 1MXGA 3WQ8A 1KCKA 3VINA 4P7NA 3EYPA 1RP9A 2DSWA 2BHYA 3N04A 5FCZA 1C93A 4QFUA 3F5JA 2ZUMA 3WD2A 1BVZA 1P6WA 1RH9A 3MUZ1 3ZMRA 1CYGA 4EK7A 2WSPA 4PN2A 2XYLA 5CGMA 3S2CA 3UR7A 4AIEA 1KBBA 2WHMA 1EDTA 2WCSA 2J62A 4N0RA 2Y8KA 1W3JA 4AIOA 1NARA 4HZ8A 4BQ3A 4PTVA 1CDGA 3MU7A 3ZM8A 1B3VA 1QI5A 4BA0A 1JZ8A 4RL3A 2WVVB 1PX4A 5E0CA 4E8CA 1EO5A 3DHPA 4S3KA 1Q6DA 1B1YA 4W84A 1J18A 2PI6A 3BAKA 4UOQA 2C8NA 3WDJA 3L4VA 3ARWA 1AMYA 3GDBA 1V3IA 3WDHA 4HU0A 4PEEA 2CKSA 1V6VA 1QW9A 1HKMA 4BQ5A 1HKKA 3TP4A 4DWSB 2F61A 1OD8A 4JFVA 3UCQA 4PTMA 4AXNA 1WZKA 2E4TA 3POHA 2CETA 2Y24A 2WK2A 2YJQA 3A4XA 1UD5A 4JKLA 3BCFA 2EO7A 1QNRA 1TA3B 1ZS2A 3MMDA 1UWTA 1QI3A 2ZUTA 2BHUA 2PBOA 1QNOA 2J78A 4UZUA 4HP5A 4PTWA 1MYRA 4X0NA 1PJ9A 1TCMA 4AZBA 1UD3A 2E40A 1LQ0A 3VM7A 7CGTA 3QHMA 1JAEA 3WFZA 1CXKA 2JIWA 3MKKA 1XD0A 2J7GA 4FF5A 2IUZA 3SCSA 4AYSA 1TZ7A 1B90A 4CCCA 4FMVA 4AZGA 1GQLA 1U30A 1UUQA 3VGBA 1GW1A 3VILA 2XWEA 3UG4A 4D72A 3VX0A 3THDA 3AXXA 4TX8A 1V3LA 1US3A 2NW0A 5CG0A 2ZX5A 3WMCA 4J3UA 3U5UA 4TOQA 4PRWA 1BLIA 5D9MA 4ACYA 3NDZA 5I0DA 3B9EA 4V28A 4IPNB 1KXVA 3ZJKA 4AW7A 1RPKA 1IT0A 5DT5A 1OINA 1LLOA 1W1VA 4GI9A 2QPUA 3VDHA 4AZ7A 2UY3A 3JUGA 5EFFA 4E8DA 1W1PA 4TUFA 4U33A 1BG4A 2J25A 3EDDA 4PBGA 3SCNA 4PSRA 2E8ZA 2J7CA 1E71M 4BF7A 5A2BA 2VX6A 4PMZA 2RGLA 4CD4A 1E4IA 4W93A 5C71A 2W4XA 4QCFA 1GOOA 2D0HA 4MDOA 4F9JA 2YA1A 2VZTA 2E8YA 3AHXA 4HMEA 1FH9A 2VI0A 2DH2A 4YHEA 2VL4A 1BG9A 1OCQA 3HMCA 4CD5A 2FH6A 1HXJA 3AMCA 4M80A 4UCFA 1OT1A 1UR2A 1ITXA 3WNKA 3FAXA 4WKAA 2WZIA 4PMVA 1PEZA 2QMJA 2J7FA 3NYDA 3VGEA 4JHOA 3OB8A 2YA0A 1E55A 4M24A 2D3NA 2CYGA 3PZMA 1LWJA 1K9EA 1KWKA 3S6TA 1CGUA 3AIQA 2PBGA 1M7XA 4M82A 2Q8XA 3VKKA 1JF5A 4P8XA 5I77A 1EOMA 4U31A 2ZX8A 2W92A 4M29A 3OBAA 3CGTA 4Q22A 1MQPA 2DH3A 2VJXA 5IFPA 2GJXA 2WHKA 1OGGA 4MJ2A 3AIUA 1UR1A 3AFBA 2EPMX 4AMCA 4X9YA 5C8BB 1XC6A 3IAQA 5I6SA 1NWRA 7A3HA 1W9PA 2V5CA 4GIAA 1ISYA 5A6BA 3GTNA 3LPOA 1JDAA 2CBUA 1BTCA 2BVYA 4JFWA 1UD4A 1H11A 1W91A 2JALA 1V6WA 1W2VA 2QV4A 5BYWA 2CBIA 3QHOA 1HF6A 1EGZA 4K68A 3BLKA 1WPCA 2A3EA 3EBVA 3AS3A 2VZUA 3VIOA 1E1EA 3CPUA 4CVWA 5A95A 5E6ZA 3O2LA 4MNLA 1R7AA 4FK9A 3N18A 1PX3A 1E6RA 4AISA 2HVMA 2OWWA 1GOIA 3BAYA 4H41A 4J7RA 2WAGA 3GNPA 5IHRA 1B31A 1JD7A 3AIEA 1TE1A 6TAAA 1NOFA 1FH8A 3WNNA 5BROA 1XD1A 1FHLA 3NSMA 3DECA 3AMLA 5I23A 1UOKA 2BXZA 1OB0A 1J0IA 4UFJA 2VRQA 1WE5A 1EH9A 3G6MA 4LPCA 1JZ7A 2GJPA 2WHLA 5A2CA 4HPHA 3MO4A 1E6ZA 1NQ6A 1NOWA 1NWSA 1ODZA 3PZ9A 9CGTA 1HL9A 1WZAA 2DSZA 1R7OA 4W86A 1TR1A 1DHKA 3WKZA 2A3AA 4PMRA 3WQ6A 1G1YA 4H04A 2GK1A 3T2OA 1OGBA 2YLAA 5GNXA 1HJXA 5FKYA 2WW5A 1PBGA 4UQBA 3CMGA 5M17A 3VDAA 1H0IA 2WB5A 1CXEA 1J0YA 4JZ5A 1HIZA 1VRXA 3F5KA 4HA4A 1GZJA 3T08A 5ABEA 3L2MA 3VIPA 3WQVA 1QPKA 3VGDA 3SCWA 3SEPA 2A3BA 4PMYA 3WH7A 1KGUA 2X0YA 1E6QM 3GBDA 3WUFA 4H8HA 1W2PA 1FFRA 4PMUA 1KWGA 5GQBA 3SCQA 1E1FA 3ZJ6A 1HVXA 3ZJ7A 3LPFA 2VNCA 3RM9A 2C7FA 3NSXA 2V3DA 1UKQA 3PZVA 4UFLA 4NRRA 3WEOA 1HVQA 3W6MA 1GJUA 2UY5A 5ABFB 1EDGA 5KEZA 1JYNA 1J10A 1JDCA 4PCTA 3OZPA 4MNMA 3AYSA 1JXKA 1CBGA 2G3IA 3L4UA 2QHAA 5JBDA 1UH2A 4XB3A 3ARTA 2WM0A 4D6EA 4M8UA 3OIHA 3RMEA 3WELA 4UFMA 5TD4A 2BV9A 4MAVA 4JL2A 3CZ8A 1V3KA 3SCRA 3UESA 4QCEA 4W8LA 2X05A 1B3WA 2X09A 3VD9A 1G0CA 4GQRA 1KXQA 4URIA 1J01A 4PYSA 3W27A 1XV8A 4MAZA 3CUFA 4AEFA 3QOKA 3T0DA 3VIGA 4QDMA 5EMYA 4PMQA 3WH8A 1BPLB 1W9XA 1M03A 3ARPA 5FIPA 1L0PA 5JH8A 1PX8A 1AQHA 2VRKA 2UY4A 4CU8A 2J8GA 3THCA 2CBJA 1J12A 3GNOA 1B3ZA 1G01A 4XUYA 1B3YA 1MQRA 3AIWA 1WDPA 3AS0A 2GDVA 3QOMA 3GH7A 2WLZA 1G5AA 1CGXA 1JI2A 3BAIA 1WB0A 2GDUA 1WNOA 1B3XA 1EOKA 4AD1A 2EQDA
chains in the Genus database with same CATH superfamily
4QDPA 4NZ3A 2HISA 3OLEA 3P5YA 3LPPA 1Q85A 4HYRA 4MSPA 3V1HA 2J77A 4DXXA 4S3BA 1CIUA 3VZYA 3BQ5A 2I57A 2NQ5A 2LGOA 5CH9A 1NH6A 3W74A 4OOZA 2QQ6A 2QJHA 4O12A 1QVBA 1TUXA 2NV2A 3PANA 1R85A 2ZR6A 1DE6A 3GW0A 3DGBA 3WQPA 1VC4A 2HZGA 3OOQA 1OFPA 3EMQA 2VWSA 4NI8A 4IMDA 4W7WA 2DZBA 3V0TA 1OGSA 3TNOA 1US0A 3O6DA 4RPPA 5H8UA 3W37A 2D1ZA 4ERIA 2J9ZA 3PPHA 1TFVA 3PN8A 1DTNA 4M6VA 1I2OA 4GCAA 1JCLA 1DXIA 3HO8A 1GORA 4IUGA 3W85A 4DH0A 2VZSA 4X2PA 3HA1A 3BJTA 3RAOA 1N1AA 4B2DD 2R1PA 3OLIA 5D2YA 1WDRA 2NV1A 2LLEA 5LIXX 4A3RA 3MI6A 4GYPA 3URAA 2WKJA 1XUZA 2WQPA 3KLLA 1BKHA 3CEPA 4IT4A 3WYZA 2ZZ7A 1QHPA 3SGZA 1FJDA 4AY1A 4HD5A 3U2EA 1QAPA 1TPC1 2RUSA 4F0SA 2OLAA 2X16A 3IWPA 4C7GA 1PAMA 1E0WA 4A2SA 1E72M 4J9JA 1PCWA 4W5ZA 2HVOA 2NXIA 5HTGA 5TQLA 3VCCA 3ERPA 1V3MA 1C3FA 4KWWA 4R5EA 2HE8A 2PCQA 5BOFA 1Q6FA 3O5KA 4EPKA 3RR1A 1G4EA 3B0XA 2JEPA 2WPGA 1A4LA 3IV8A 1H61A 2DEPA 3TIMA 2GDQA 4NJKA 5K4XA 3KVKA 4IOTA 3SCOA 1W9VA 3GNRA 1CTNA 2H8XA 3EDEA 1XHGA 1BGAA 3NA8A 3CHEA 3E1F1 3T2QA 4LEQA 4YJ5A 4W89A 2PDXA 1XIBA 3ZR5A 5JBEA 1HN1A 2VX7A 2XZ9A 3EOSA 2HXTA 2ABAA 1UIOA 2AL1A 1DKWA 3LOTA 4I9MA 5I02A 1WUEA 4L72B 4R33A 3GO2A 2M1IA 4RE2A 4DRHA 2CFFA 3OBKA 4W88A 1ZBKA 4ATLA 3B97A 4U4MA 1EZWA 3WQGA 2C71A 1DWIM 3RGTA 3C2OA 1BHGA 2PP0A 4UNIA 3TONA 5FSEC 2PURA 4PGLA 1J4EA 3QV6A 1E5NA 3NIYA 2ZUNA 4X22A 5C55A 1XYCA 3LV6A 4HOXA 3VOJA 1M7PA 4FNSA 1FKFA 1EHAA 2Z7GA 3W2LA 1ZAJA 3AJ7A 4S3CA 1OCBA 1SFSA 1Q6EA 2BG5A 4D9PA 2TPSA 2IKJA 4B3LA 4QZVB 2YCIX 3AMDA 3B05A 5AKQA 3HG3A 1WKFA 4PCNA 4TNSA 3FLUA 4REQA 1OFBA 4JFSA 3NVTA 2FGZA 5DO8A 2PDFA 3LLXA 5IXEA 4HTBA 3AHVA 3POCA 2BGSA 5DRIA 3H21A 3NEHA 4M6UA 5CSUA 5CPQA 1Y0OA 1R38A 1U5JA 2X1RA 1IWBA 3BVJA 3O5LA 2VR4A 4DUWA 3T0TA 1UBPC 4UFIA 1E9YB 1V0NA 3N12A 3EMZA 2P8BA 1JAKA 3T07A 3ABOA 1SSDA 4GZ7A 4H9XA 4IMCA 1NAL1 2AWGA 4JN6A 1TG7A 4HHLA 4WD0A 2XIMA 4R34A 3B8WA 5HWJA 3T4WA 4GY1A 1P1MA 3EA1A 4RLIA 1VCVA 1F4HA 3RXZA 1A3HA 1F8IA 3SFKA 1ECEA 3GVGA 4OTKA 4IF2A 1MNSA 3C3UA 4H9UA 3W28A 4AG0A 1O5RA 1TV8A 3B8DA 1TYGA 4CN4A 1DJGA 5D2TA 3ZT7A 2EBNA 1VS1A 1W37A 4HKPA 3RCNA 4M3PA 2W63A 3W1AA 4LAKA 5LXXA 3UJEA 4W5UA 2BBFA 3URBA 3I65A 4K1WA 4DAIA 4BKNA 2BTMA 4WDTA 3FXGA 1W1IE 5HANA 2VQTA 4JTUA 2CIPA 1AJ2A 3DYPA 1VFSA 4IFRA 4LT9A 3UQAA 2GJLA 2FTWA 2VTFA 2QUVA 4NAFA 3V5FA 1CEOA 5CSRA 3CNYA 1VJIA 1XG3A 1W32A 2XVGA 4ZB0A 3U8GA 1QOQA 3C61A 1LUCB 4K39A 3UU0A 3C0QA 5MKGB 3FK4A 4L56A 3MWCA 1C90A 1N8FA 4LTSA 3OP2A 5HAOA 6XIAA 2VYOA 3S0CA 3QKEA 3MSGA 3S83A 3SCPA 3GG7A 3OOBA 1CGYA 2GSEA 4LV9A 2POZA 1RALA 3NG3A 3FNDA 1LORA 2CHOA 2PDCA 4DJDC 4W9PA 2GJXB 2PTYA 3QFEA 1TPVA 2WCAA 3LENA 2RKXA 3DFOA 3RN6A 1TIWA 2I14A 3AWNA 3TYDA 4M56A 3W7KA 2ZQTA 3VGHA 1OC5A 3UF8A 4ODQA 3DAQA 1ADSA 1XFCA 4PUKA 2OU4A 1FWJC 2R8WA 2PE4A 2PWEA 3RG6A 4DZ3A 3P8JA 3V5CA 3GB6A 3E2QA 2QCFA 2KFWA 3ITOA 1NDVA 1R87A 4PULA 1SO3A 4E3VA 3WL0A 3KDNA 3NZPA 4PC8A 4ZEPA 2XSXA 1UUOA 1A80A 5CCZA 2E67A 4CN1A 3VE9A 3U7BA 3DCPA 1NFGA 3STPA 6A3HA 5L6UA 3T05A 3GSMA 1QWKA 3SQSA 3NQ2A 5HWCA 1MUCA 4J4OA 1LQAA 1XWYA 1ZL1A 1T0OA 1KGXA 3MT1A 1WKYA 1XIGA 3W2MA 3RNDA 1XLIA 4EKJA 6REQB 4FX7A 1PIIA 3ZFHA 3DN5A 1BTMA 1JUEA 3CQ0A 3UGRA 4HYWA 3UVAA 4PL1A 1UZHA 4US5D 1WBJA 3V1PA 4F0RA 5DMYA 2TMDA 3R1ZA 3W22A 2YPIA 1PDYA 3A47A 1D3GA 4TTGA 3GFXA 5BRPA 4FLOA 3GTXA 1L9WA 2FQIA 1Q3NA 4JKKA 2I5QA 2WWDA 4ICCX 3GQYA 4ZFCA 2WVSA 2GK1B 2PC4A 5B8IC 3VNZA 1H1ZA 1A5NC 2ISSA 3PHAA 4MWAB 2AQOA 4LUYA 1GW9A 3UERA 2D2HA 2HK1A 2GSJA 5TF0A 4H6RA 3EPMA 3CPGA 4MGVA 5AC8A 3WUBA 1NU5A 2C91A 4EAMA 1LWHA 1DQUA 1SZFA 5HK4A 2FPVA 3OW1A 4O0ZA 1H1YA 2VWTA 3E5PA 1ISVA 1KO0A 4NQ1A 5AHEA 2OWXA 3CUGA 3ORWA 4GUFA 1LF1A 1SSGA 3RLVA 3EOEA 4O18A 3VO0A 4F0MA 3LA4A 4GZJA 3O5MA 1H09A 3OBEA 3EWZA 2XPAA 3DG3A 1FBAA 5D32A 4JAWA 1PZ2A 3N17A 3WH6A 1VCFA 1KCLA 1WXZA 2CESA 3KL5A 5CPNA 1PZ3A 3UZJA 3TN6A 3MUY1 2FGBA 2ZUWA 1LP6A 2EF9A 4QSHA 1E0TA 3NO5A 2ZXBA 3GYCA 1JCXA 2QF8A 4KH2A 3GKFA 2PDKA 4W7VA 1IXNA 1QNVA 1QI2A 1VH7A 2E1WA 1XL9A 1EB3A 1ZBVA 2QDGA 1GOWA 3W2UA 3VYLA 1LJYA 3WLOA 4HNCA 1H7PA 2G3MA 1A5KC 3SRDA 2VVSA 4JTJA 3NDYA 3SUVA 2QNEA 2WNWA 3TVAA 1X98A 2LJ4A 2VEKA 1UWQA 1OFDA 4GD0A 4LVBA 2YDSA 4XV0A 1XKJA 4AWUA 4CN6A 5HULA 1C8QA 4B5TA 1E4MM 3KHDA 1OZMA 3IV3A 1EHNA 5I09A 1D3HA 3BSMA 1CECA 1P48A 1LBMA 2EPNA 3L4YA 2QUUA 3GIYA 1S2VA 5AECA 3KCEA 2D20A 3PZUA 3I4KA 2EAWA 3AWOA 5DO2A 3HOJA 4YPJA 2VC7A 3GUWA 3GG0A 3M07A 1JNEA 3SRKA 3OU8A 2ZZ1A 1UPPA 1SW7A 3ZVHA 5HOSA 2XSBA 1IWPA 1FKXA 4TW6A 2Y89A 3QV7A 1ZZMA 3OJGA 2P5NA 5FL0A 1UQYA 3L4XA 1O66A 5A1AA 4BR1A 2R1MA 5A6BD 1TA3A 1KGWA 1XLKA 3AXHA 4W8BA 3MBFA 1H62A 4EF8A 3INPA 1NFBA 2PPPA 4XVEA 3EWWA 3QW4B 3QHNA 4GX9A 3M1ZA 1WDQA 2G4JA 2XGIA 4GVFA 2GGEA 5DFAA 3RJYA 3HBLA 1O94A 4RXGA 5T9BG 3L65A 4FX8A 1G69A 3AUJA 2A21A 3H4XA 4O52A 1CLXA 1R3WA 1T41A 2Z1XA 3LXAA 3WUGA 3BZJA 1TJRA 3MUIA 2WZEA 3N2TA 1R3RA 4GUJA 4CQ9A 2HMCA 3LX9A 1QRQA 3CHCA 1W3HA 4UOZA 2VO5A 4S2BA 3FY1A 1RHCA 5AVNA 1Q6CA 1GEQA 3W87A 2YW3A 4JEJA 1OM0A 3QN3A 5AYIA 1K4HA 1MFVA 3WD0A 2Y78A 4XISA 4LUIA 1C9DA 4XAFA 3GKAA 4TX0A 1F2JA 4Z1AA 1CNVA 2OB3A 2C3ZA 4AIUA 4DRNA 3ITTA 3PBGA 1XI3A 3UW6A 4FNQA 4IFOA 3FKKA 4MFEA 2CNCA 4UQDA 4GQGA 5HWBA 3UG8A 3WH5A 2Q8LA 1GJWA 2OELA 2VGFA 1W3LA 5JUVA 1VPQA 1HO4A 5D38A 4KQNA 3W71A 2DZVA 3CUIA 1Z69A 4AVNA 4JX5A 2QCEA 4CCEA 4X2RA 5H2ZA 4YVXA 1REQB 4CNPA 2XIBA 4WRHA 2ZBTA 3B9OA 2QF7A 1FWNA 4UFKA 4MY9A 2FDMA 3N2MA 4YMZA 3W25A 1BAGA 1GKRA 3TMQA 3N2OA 3GC2A 1KA9F 3CAVA 2YCKX 2KI3A 3A21A 4JOMA 4K36A 2QMKA 2Z1SA 3LU2A 4J40A 4C1KA 5F2MA 5HJXA 3SUSA 4NRSA 3DGRA 3FHQA 3C52A 3P6LA 1O4UA 3BANA 4PUEA 4PE8A 3A4WA 3EA3A 3G0SA 3NQAA 3VD7A 4F0KA 3LPGA 1FHUA 1W1B1 5BRQA 1XPGA 1W1ZA 3MI3A 3WK1A 1YRRA 5BRBA 3KAHA 1RZMA 2QUMA 3UG3A 3SECA 4NYYA 2XIIA 4M5PA 3WLKX 4HOWA 5A6JA 3NVDA 3VA8A 4OGZA 1PKNA 1UC4A 1IE7C 3LK6A 3A5VA 3H2EA 2QPSA 4YHGA 1QI4A 2YDQA 3PK7A 3W75A 3U4AA 4A35A 1QU4A 3ZR4A 2JKPA 3NYZA 1YHTA 2RAGA 2V0TA 4I7WA 1D7JA 1E9LA 3E9AA 3BLLA 3HQ1A 4JKMA 2XN1A 1S2AA 3L0GA 5DCDA 2FPYA 5T9CE 4ATDA 5F2GA 3ZJ8A 5C70A 1EYWA 2XFYA 1QJWA 3F7JA 5ABTA 4IMEA 4TVDA 4MM1A 3CO4A 3U48A 2Y88A 2P0OA 1J4RA 2GQ9A 3OLGA 4DAFA 3NWRA 2DPEA 8CGTA 3U0HA 5JIPA 3M0XA 4OWGA 3N15A 1BYAA 1XLDA 2G3JA 2BZNA 4RZBA 3M46A 4WKHA 4A05A 4IX0A 4RR4A 4QQ3A 2A1YA 3IK8A 3TU9A 1Q7MA 2QR6A 4EE9A 3A5FA 1OWQA 3GFZA 5DMLA 5JH2A 1UASA 2YGYA 3FDGA 4GMEA 3MO7A 4C6DA 3NTPA 5HMFA 1GVEA 3BJFA 2QCNA 3MJMA 4L6OA 1TJ0A 1H63A 3VKBA 4ONVA 3SCTA 3M4HA 3CO8A 5E70A 5D8WA 1LYXA 3MYPA 1NSGA 8TIMA 3SAZA 2R14A 2Y8VA 3W76A 3R0UA 3IIPA 1EEPA 5HR6A 4QAWA 4LW7A 4JEQA 1YNYA 4BZYA 3VNYA 3KM8A 1F05A 2W5FA 5CXPA 3C0JA 3B0UX 3I3BA 3N11A 1KM3A 3AC0A 2H90A 4M6QA 2PCEA 3H8AA 3TQ0A 1JPIA 1CX9A 3KXQA 3U5YA 4DBSA 2WMFA 4FOUA 4DRJA 3O15A 1TPB1 4D6HA 6REQA 4IIEA 4XSLA 2J27A 1VIWA 3BAJA 4RXFA 2VX5A 1PPIA 4U5IA 1HGYA 4LGXA 1A0CA 4C6PA 1PDZA 3N4AA 1K9TA 3MP4A 3L2LA 4NI3A 1P6CA 4GLEA 2XP4A 2RQSA 1A5OC 4XWUA 2Q3RA 3QZAA 1FDJA 5JU6A 3ARVA 4KBXA 3DHUA 1VYRA 4KIEA 1XLLA 1XH1A 3UG5A 3BGJA 3V7PA 3EX4A 1K6AA 2PDMA 3CZEA 4R3UA 3HPZA 2HBXA 3T2PA 3W6YA 4MB3A 5CSYA 2CKRA 3D0CA 3ZLGA 2XP9A 3VC6A 3W1QA 3EWDA 2XG9A 4MWAC 3UPWA 3IGHX 4JHMA 3CASA 2HXUA 2O9TA 5DMMA 3CZJA 1SPQA 2AQWA 2EJAA 1E6XM 3BURA 1FXQA 1O5XA 5CZKA 3G6LA 1GVIA 4W87A 3M0LA 1YE6A 2GJRA 4ZQNA 4RE0A 1J5SA 4L1XA 2NLYA 4WGHA 3RX4A 2PU1A 3WF1A 4AF0A 3V5OA 3E0IA 1S5WA 5F4SA 1A50A 3TZFA 1X6NA 3UP8A 2OZ3A 3SCUA 1AL8A 5C2XA 4QISA 1GPFA 1TJ2A 3CL6A 4KEVA 4HU3A 4TXEA 2XP3A 4V2XA 1W3IA 3VOIA 1B57A 4ZQPA 1IHIA 4GVGA 3V0UA 3VOHA 3WBAA 5L9FA 4AZIA 1QPQA 4DZAA 4NNCA 1XYAA 4MKVA 3GTIA 1WO2A 3H2OA 4KFNA 1ZENA 3A3XA 1C9WA 3GNXA 1R3SA 1WDSA 1I1WA 3O07A 1MUMA 2V68A 3TCZA 2ZX9A 3W0KA 2BVDA 4LCQA 1VFOA 4RNIA 4HN4A 3R8GA 4WR3A 1FKKA 4H7CA 3WJSA 4KPLA 5ECVA 1B3OA 2CCRA 1ZB5A 2YB1A 3VDGA 2OYLA 4XZBA 1C7TA 1V02E 1RSCA 3T1GA 4O19A 5E6YA 1J0JA 1Q5MA 3S2MA 2NXHA 3O63A 4DNMA 5HA7A 1W3NA 1U5VA 1V02A 5J5RA 2C1IA 3C56A 1MFUA 2WJEA 4CQAA 1TTPA 5BW6A 4JICA 1R9YA 3OEXA 1B54A 4JQ1A 3OG3A 1V0LA 3SADA 4C6LA 4G7EB 1EA0A 3IJ7A 1HKJA 4GACA 3BOFA 2XTKA 3AXIA 3IK4A 1XSIA 1J4HA 1UWAA 4EOUA 3CQKA 4RNHA 3TH6A 2PDLA 1QPRA 4CKQA 1IIHA 5CC6A 4WX2A 3ONBA 2C1HA 2ITKA 3GG8A 4LCSA 4X0VA 1XBYA 2JGQA 4O57A 4C1NB 3NUKA 3JW7A 3NZGA 4UOJA 1BQGA 2DSUA 1VJSA 3AI0A 1FWRA 4LVAA 4DUXA 2Y63A 1H3GA 5BOOA 4LS1A 1DIOA 4L4PA 4E6MA 4PB3A 1RJRA 1ITUA 1C7SA 5LNVA 2DSVA 2OPJA 3A12A 4G2PA 1GKPA 3TOPA 2E3ZA 3UZZA 4IXHA 5J6EA 3K2GA 3UZYA 2DT0A 3HU7A 3R94A 4PBEA 3R10A 2XU2A 4QT3A 4Q6JA 3T0CA 3G1XA 2BHYA 4R9OA 3N04A 4WY0B 1C93A 1TV2A 5KTLA 1JEZA 3WD2A 1BVZA 1P6WA 3OYZA 3WH0A 2OTDA 4WDUA 4EK7A 4DYEA 2HNEA 3S2CA 3HQNA 3G1DA 3KS6A 4AC7C 2WHMA 1RQHA 4AUBA 4HZ8A 4PTVA 1ECQA 1CDGA 1VR6A 4HNNA 3GIPA 1MRQA 2VCDA 4RL3A 1PZ0A 4ES4A 1A53A 4L5ZA 3N3MA 2I7GA 5E0CA 4QROA 1B1YA 4RDZA 2PI6A 1RJPA 4UOQA 3WDJA 1WAUA 5KMYA 4C6EA 4O10A 1ZP3A 1REQA 4F3HA 2QGYA 2FVMA 3I7QA 1QW9A 5CEWA 2JQXA 3B0VC 1K8XA 1HKKA 3DIPA 4AVOA 1XLAA 4DWSB 2F61A 4JFVA 3UCQA 2LKNA 2PDGA 4DXKA 4O4WA 1UMLA 2CETA 2A2IA 2YJQA 2EO7A 1QNRA 3APTA 3MMDA 1UWTA 3R5EA 1K7EA 4DLFA 5CJMA 2J78A 4LEFA 1LLZA 3NM1A 3WLNA 1TTIA 2CZDA 3LM3A 1P5QA 4MZYA 3QPYA 4AZBA 3MZ2A 1LROA 1TQJA 1UD3A 1LQ0A 1P0EA 3SSJA 2I5GA 1CXKA 2Q6ZA 1XBVA 4FALA 4Y9NA 3SCSA 1U30A 1UUQA 3L12A 1GW1A 2PUZA 3VILA 3W7QA 2XWEA 4F2TA 1T7LA 5CG0A 3SQMA 4DUOA 3U5UA 1KM5A 4NU7A 4AQLA 3NDZA 4V28A 3ES7A 4AW7A 1RPKA 5DT5A 4ZOEA 3P82A 1W1VA 3RR4A 4BEQA 2QPUA 3K1GA 4HNUA 3R11A 1XIDA 3CAWA 4WJ8A 2VFEA 1OG6A 3K13A 4F0LA 2AGTA 4YNGA 2E8ZA 3R7MA 2J7CA 1A5MC 3BPWA 3OVGA 4BF7A 2B0MA 4PMZA 4H6QA 3FJNA 1E4IA 1F3TA 3FDKA 1SO5A 1GOOA 4GI4A 3BG9A 2X1TA 2D69A 4HMEA 1FH9A 4H9VA 5B80A 1AA1B 2VI0A 4YHEA 1EJTC 3KOYA 1BG9A 3W7GA 5I3HA 4B90A 2DV0A 2DZSA 1TJ1A 3TE9A 3DENA 4PMVA 3DI0A 2QMJA 3NYDA 3OB8A 1PTDA 2PV2A 3R58A 1LWJA 3HGJA 4IHCA 1CGUA 1M7XA 4O0QA 1TV3A 3RX3A 3VKKA 5I77A 2QCLA 1JQVA 3OBAA 3CGTA 3W72A 2ZRWA 3DBPA 3T55A 2DH3A 4QHRA 3AALA 2HK0A 4ALDA 3AYTA 6XIMA 3GYEA 1NMWA 2R6OA 2PGFA 1POKA 4J2MA 2OEKA 4CQDA 3O5EA 1UR1A 3AUOA 5H91A 4AMCA 2N87A 2CZFA 4X9YA 1XC6A 3IAQA 5C8BB 5I6SA 1RD5A 3TSMA 4GIAA 3LTSA 3M0VA 3G1SA 2B5UB 3LSBA 4OQVA 1BTCA 5H8PA 4Y96A 4FOJA 4GWEA 4UBPC 5PTDA 3LXCA 2JALA 5DX7A 2BX7A 3M5VA 1FWGC 2BXVA 2X7VA 5EA9A 2AGKA 5JVLA 1DJZA 2A3EA 3EBVA 3AS3A 3VKDA 4YTTA 2QXWA 2CZEA 5A95A 5LNSA 3LCLA 5E6ZA 3MP3A 4FK9A 3N18A 1E6RA 1GOIA 4J7RA 5IHRA 1WXYA 3ATZA 1JD7A 3AIEA 1FH8A 2V81A 5BROA 4RZ4A 3ITCA 2Z29A 4H9TA 1WDDA 3AMLA 4KCWA 4MSSA 5G2HA 1AJ0A 1HL2A 2GYIA 2PRLA 2BXZA 4LF1A 1J0IA 4OFCA 5AZ0A 4C6CA 5A2CA 4HPHA 2QDEA 1XPYA 1KD0A 3G3DA 2OEJA 1NWSA 3LHUA 9CGTA 3UPBA 1JPKA 1GG1A 1HL9A 1NTHA 1A0EA 1XLGA 4K7YA 5CC3A 1VBGA 1TR1A 4RZ5A 3NQEA 4W9QA 1EX1A 1OFOA 1L6GA 2A3AA 3M43A 1WX0A 2R91A 1T8QA 1XLHA 4DB7A 2OO0A 4O1DA 4H04A 4GH1A 3ENLA 1ZJHA 3KBJA 1WQ5A 2DVUA 2C6QA 3LUOA 1CXEA 5F1VA 4V33A 5BNKA 1EXBA 1RBLA 2E68A 3R8HA 5ABEA 3L2MA 2Y1HA 1QPKA 3VGDA 3SCWA 4PMYA 1QCWA 2GQ3A 4HCLA 3EKGA 3GBDA 3PUOA 3WUFA 4XK2A 3EXTA 3O5IA 3UCCA 5GQBA 3SCQA 3F2BA 4UTJA 2ACRA 1HVXA 2VDIA 3ZJ7A 3RM9A 3EWUA 2V3DA 4LAVA 1TCDA 3CT2A 4UFLA 5DY2A 1DIKA 5KEZA 2GGIA 4MNMA 4EX4A 1EC9A 1UP3A 1DIEA 1CBGA 1O12A 3L4UA 2GGGA 4LUTB 5FEWA 1H7RA 3OIHA 2FVKA 3RMEA 3WX7A 1XRSA 4GIYA 3QMRA 2PGRA 2Y5SA 2BV9A 4MAVA 3OVPA 3KBNA 3EX3A 1V3KA 3SCRA 5EU9A 2OVLA 4MKNA 1KXQA 4URIA 2F21A 4R53A 4POCA 1PYFA 1K03A 1SW3A 4LOCA 3VIGA 5EMYA 5D02A 1MO0A 3IIZA 1PZ1A 2PP3A 4BI7A 4X3ZA 2UY4A 1XYBA 2PLKA 2CZ5A 2BMBA 2HVNA 1M6JA 4JFIA 1DE5A 3RCMA 4JIHA 2PDNA 1G01A 1PUDA 1W54A 3QLLA 1KW1A 4DX3A 4S3DA 1ZFJA 3SN4A 2A79A 3AIWA 4TU1A 1SFLA 1WDPA 2PLMA 4Y2WA 3PF3A 3AS0A 1L2QA 3LRKA 1Z44A 4M1BA 2WSRA 1G5AA 2FJKA 3HMJG 4Q8MA 1JI2A 2REQB 1WB0A 3TR2A 1EOKA 2Z6JA 2JZVA 1Z41A 1BSLA 3LERA 3LMYA 4QG9A 2CITA 1RCQA 1EYEA 2GVJA 5IOBA 1S5VA 3TYUA 5I78A 3Q37A 1EJSC 1I2RA 2BASA 2V6AA 1E43A 2VXNA 1GVQA 5CPTA 2EPHA 1HP4A 2P88A 1H7XA 3SCVA 1YTDA 4CGTA 2WC4A 3MPGA 1CB7B 3E96A 3M47A 4ZXLA 3TTOA 2XIOA 1WA3A 5M1TA 3D3AA 2BXYA 3K4AA 2BVTA 5LA1A 4DWDA 2B7PA 1NF0A 4BF8A 1VFHA 2IKIA 4ZODA 4QS5A 4GX8A 3RDKA 2Z28A 5DLCA 2O9PA 3P2VA 4XX6A 2XFFA 1UR0A 3GDKA 1G67A 1JCNA 4ZQOA 1F8MA 3TSDA 1V51A 4O15A 3NL2A 4IFKA 4EPBC 1E1CA 2XISA 4ODRA 2VEIA 1VFTA 5KZMA 2ZA2A 5D2WA 3IKGA 3W24A 3PZQA 7TAAA 4UTKA 3GWQA 2HRWA 4J28A 2DUZA 2CXEA 4HA3A 1EJXC 3PR2A 2ESCA 3RFAA 4O4VA 1BXCA 2OT1A 3UBPC 1QFEA 3IJ9A 4GI8A 4Q4SA 3L23A 2ATMA 4N02A 3VD3A 4DWSC 4OBRA 1P7TA 3WBEA 2QJNA 2WMKA 5DQPA 3R0KA 1G4PA 4PCSA 4HNTA 3UR8A 3SUWA 4PUDA 1YX1A 4PMDA 3AU2A 3S9IA 1Q4NX 5DMNA 4TMCA 1QWGA 2YX0A 5F2IA 1FKTA 2HEJA 2ZR5A 2ISWA 3EWXA 3K4WA 3O5DA 1WBHA 4DJDD 2V69A 2H8ZA 4PA8A 4JCLA 4M81A 1X97A 5DY3A 4LB4A 2ZADA 4NAEA 3ANUA 2NZLA 3LRMA 1FD9A 4ODOA 2XVLA 2DW6A 1K6WA 2PLCA 4NYUA 4KF1A 3WQ4A 3QR1A 3P0XA 2G37A 3MZNA 5G5IA 4ZE4A 3ZIZA 3EAUA 3DG7A 3G8RA 2C0HA 1E70M 2Z2BA 5M03A 3XINA 5E0KA 4H2HA 4ITZA 9XIAA 2OJPA 1ZTVA 1J0KA 4I8DA 3MQTA 3RM4A 3AIRA 3CMJA 3B8VA 1E4NA 2WC3A 4L1WA 3PNZA 3WNOA 3M0KA 3GU1A 2K8IA 4GKLA 1SMAA 4W7UA 2XVPA 2ZRZA 1W9BM 3R8RA 1TZZA 5IBXC 2B7NA 2CHRA 5HKGA 3SUUA 1UB3A 2XSAA 3V75A 2GSHA 3LNMA 2OZTA 2AOSA 3STFA 5DIUA 2EJ1A 1ICPA 2XJ7A 3LTYA 4E8GA 3NNTA 3HF3A 1JYXA 1JJKA 3HQPA 7ENLA 4UWMA 4QJ3B 2OZ0A 3PBUA 4J35A 3LQGA 1K9FA 4D1JA 2QPXA 2G5WA 2ZX7A 4O2TA 2DZXA 2OQLA 4B9YA 2J79A 4GI6A 3ALFA 2JEQA 5M3WA 1J8VA 3N9RA 1VGAA 4DO6A 4GNJA 4DVOA 3OHIA 2RFGA 4DJFC 3M41A 2ZQ0A 1JZ2A 2V8ZA 1OF6A 4GXWA 3TC3A 3WDPP 1X96A 3PA7A 3WDRA 2VCCA 1UZ4A 4E2OA 3CQIA 3A13A 5CKSA 1W9UA 1QW8A 1JPMA 3BL3A 1UD2A 1L6YA 3IGSA 4Y9AA 3ZR6A 3N34A 2FIQA 4XZMX 1N2VA 1G4TA 1YIXA 5BWAA 3WLRA 2V38A 5HUPA 1P6BA 4OBTA 5CPMA 2VC9A 1W1TA 4JN7A 2A7RA 3RM8A 5FA5A 1ZRQA 2RUCA 2DZWA 4F2BA 2QIWA 1FKIA 5GJMA 4KRZA 4JX6A 1H5VA 2JFEX 4YXGA 2XIJA 3EX2A 2ADAA 2KGJA 1XLMA 4JY9A 2KZHA 3U2ZA 3GZ3A 4U2YA 3TLLA 3G1FA 3MMWA 3VGFA 1LOSA 2VOTA 2E1DA 4NZFA 4Z2JA 4JCMA 1MW1A 1Z48A 4HBOA 1OD0A 4A6GA 1XCFA 2ZZ3A 3QR3A 4G5DA 2QCHA 3QGVA 3UWEA 4NZ5A 3RPDA 1TPFA 1YQ2A 3PG9A 1DQWA 1E0VA 5JQ9A 5HMDA 2IPGA 5ABGA 4RE3A 2JIEA 1AMKA 3UQNA 1H60A 3EA2A 2PD5A 2AAAA 1JXJA 2ZYFA 4TO8A 1Q6IA 2DFAA 1IZCA 2WNZA 3CUHA 5I24A 3VK5A 1W8SA 1NP0A 3C0SA 4P7RA 1BQCA 3T8QA 1MQQA 4CUCA 5BXRA 2OR2A 3FV9A 1W5OA 4XAGA 3M0HA 2YL6A 2V2CA 4HQVA 3NQMA 4W9OA 1JGMA 1DWAM 3SDOA 1OX4B 5EMMA 1UA3A 4K37A 1IF2A 2DZPA 3UY8A 1DWHM 4BJHA 4L9YA 2IS7A 3NZ1A 4S38A 5FI8A 3BQ6A 4MWAE 3QZEA 2KO7A 1J79A 1UH4A 3CV7A 4QEHA 1NQKA 1QW7A 2WBKA 3S5OA 1N82A 2OKTA 3ZT5A 5C0QA 3HJZA 3DFSA 3P60A 5CC7A 1CLKA 1AQFA 5DIVA 7REQB 3CC1A 3DC8A 1W1YA 3BMVA 3W7OA 3AIVA 4DYJA 1ZAHA 3PTDA 3EXSA 1FP9A 4C6BA 5BCAA 3F4DA 3VNKA 2ZX6A 3MDYB 3DC0A 2PC8A 3B8TA 4AZCB 5C54A 3BXWA 2E0PA 3RF9A 3BLEA 3IACA 4KEZA 2YKKA 4XO7A 4YN5A 1MEWA 2OQHA 2I1OA 3WUEA 3GPKA 2G4FA 3VIJA 4HSOA 3GHUA 4GG9A 1IR2A 3GXTA 2PWHA 1I60A 3AQUA 3VZXA 3W00A 1F07A 3LYEA 4NHVA 4E2DA 1NMVA 1XGZA 1NEYA 3UJFA 4JIPA 4L3NA 3WQDA 3TA6A 2REQA 3G2GA 3D5HA 4AD0A 1RR2A 3VD4A 1EBHA 4F9DA 4NXKA 2DGAA 4I5XA 1I75A 2P3ZA 3MDWA 1YW5A 2KR7A 3NQFA 1O6IA 2OEMA 1QHOA 2JE8A 4Q32A 3VC5A 2WZTA 4J3WA 3ZWTA 2Y8UA 3W3OA 4G8TA 1W5QA 4XZIA 3MC5A 1QK2A 5FF7A 4Z2KA 2D0FA 3TYZA 1YE4A 1HT6A 2PLJA 4WGXA 1Q66A 3GRIA 3HN3A 4DBEA 4GUGA 1D7KA 2V82A 2XM2A 2VZVA 1C8VA 4WIWA 4BF5A 2DY3A 3QMSA 2DIEA 3IIVA 1RPXA 2V5BA 4XIAA 4L9ZA 1ISWA 2D0GA 1BRLB 5GNYA 2IXVA 2ZUUA 5H8MA 4J3ZA 1B0IA 1VZWA 4ERGA 2J9YA 2IMRA 4CCZA 4PR4A 4TX6A 3B9AA 1IZKA 2DU2A 2I17A 2O0TA 1JQXA 2GWNA 4MY8A 3NEVA 4B4FA 3KWXA 2WLYA 4N9BA 3MCMA 5FF0A 1EDQA 4UTWA 4OV4A 4IWWA 3TROA 1EF3A 4L1GA 1OF8A 2WHJA 3W81A 2P76A 4JDBA 3IPWA 3ZLHA 3U9IA 3UWYA 2PDIA 1Q2RA 2MF9A 4XKYA 5EL1A 4LVGA 1EP1A 4OKDA 3ATYA 4BK9A 3QGKC 8XIMA 1OFRA 5G1YA 3T7VA 4NG3A 4V1YA 2IQ0A 1GKQA 3E3HA 3LG3A 1UA7A 1XYMA 3M0YA 2FB3A 3H9RB 2WANA 3QTGA 3M5XA 2VD9A 3LI0A 5FAJA 5LIUX 1POJA 1GGOA 1TRDA 1WZMA 1EWDA 1VEPA 4JFUA 1O1HA 2WVVA 4JFKA 4UTFA 1R2SA 3BMWA 2YXOA 2GQ8A 4ZB2A 3NQ8A 2OSYA 4WK9A 3O6YX 4ZQMA 4AWSA 1SMDA 5F2LA 4DPQA 4PTNA 3MMUA 1JNSA 4NJIA 3L4ZA 3A23A 4HK6A 2O56A 1EJWC 4H9MA 1JUKA 1GHSA 1OC7A 3KZ7A 4Q4QA 1OADA 1A3XA 5CGTA 4DRPA 1X1NA 2PTDA 3KVLA 4WXYA 4DRKA 4QG6A 3SI9A 1JIBA 2F8QA 3T9PA 1JCMP 4DBWA 3G5EA 3SSZA 1DVJA 3LGEA 2BHZA 2Z6IA 4MB1A 3QSTA 3NM3A 3VFCA 3PWIA 3L4TA 1R47A 1JPHA 3LHZA 2AKZA 2YZ5A 1UYQA 3JXVA 5C7VA 4AB4A 1G6CA 2JF6A 5FJJA 3VNMA 2QULA 1FWHC 4AU0A 3EOOA 1DBTA 1PO9A 3GU0A 1KFLA 1UWUA 4KWOA 1JDEA 4E5TA 4E38A 1EC7A 1KFBA 2J7EA 3MW7A 1H7NA 4QE5A 3KL0A 4XZLX 3WMSA 4O8RA 2D2OA 3TLQA 1IT7A 3SY1A 1VFUA 3TC6A 4ODNA 1V0KA 3CZLA 1LTDA 4ZO8A 3CBWA 5FF2A 2ZKMX 1K77A 4JTIA 1JPDX 4S3GA 2RURA 4GQ0A 1F7BA 1GJPA 3E0LA 3VMPA 3N6QA 2OLSA 3WZ0E 4DJEC 4NSBA 2ZRUA 1MW3A 1XH2A 2FZ9A 4D8AA 2BOGX 3IUDA 3RK8A 2R82A 1L6FA 2G3NA 3GXFA 4O0KA 3RGCA 4IJRA 1K8YA 2PAJA 3OVQA 1U2YA 2GPTA 2X0HA 3JZUA 3BOLA 4QSFA 1ZALA 3WF2A 4LVDA 5HPCA 1JD9A 4EIVA 4MWAD 3VPLA 2YFOA 4JNYA 4HIBA 5K9CA 1ZSXA 2FMNA 4JYSA 3PPFA 4MNKA 1JZ5A 2FZNA 5FACA 4FS9A 1TCOC 3CZGA 5A6MA 1QK0A 5I3GA 4IGHA 3USBA 4AY7A 5HQLA 5I3KA 1KXTA 3UXIA 1C8XA 1F6KA 4G9PA 2POTA 1HFBA 3NOEA 4AEOA 3QGAC 3BC9A 3UNTA 4FPSA 3MUCA 4MGGA 1Y7VA 2WSQA 2PMQA 2M2AA 2DG9A 1IR1A 3TYCA 3S2LA 1KB3A 5A8MA 3LCGA 3TTSA 5U4NA 5KSWA 1L2UA 3PZNA 5CQ1A 3ANYA 1R3QA 3ARSA 3UI5A 1TTQA 4B91A 2YL9A 1JRCA 1DOSA 1TWSA 4J3VA 9XIMA 1PHWA 2H6RA 4F0HA 3ARYA 1FH7A 1Q8AA 3T44A 4C6NA 1FFQA 5DXYA 5IHSA 3I3EA 4FR1A 3ANVA 2J4GA 5FD0A 5HQMA 4XZWA 1XIFA 2QS8A 2CXGA 3SN1A 4GUIA 4REQB 4ROQA 3FW6A 3MKCA 2FYMA 3LBMA 4B2DA 4IIHA 3H2FA 4HZMA 3NQBA 3N9KA 5J8LA 1EQCA 2CEQA 4U2ZA 3HIJA 2D22A 4YWSA 4F79A 1R46A 3P5ZA 4NZ1A 4IT6A 3ZT6A 1UWSA 1VBJA 2J74A 3WLMA 3WJYA 3NQGA 3TN3A 3E12A 1PWMA 1ONEA 2KX9A 2FHBA 3KTXA 4YTRA 2J7HA 1UKTA 3WD3A 5SWUA 3GU2A 4C7FA 1S2UA 1H1NA 4OVXA 4WDWA 3EB3A 4YTQA 3ALGA 1I6NA 1BF2A 2PEVA 3DBNA 4Q6XA 4C1LA 1Z7AA 1UQZA 1X8CA 3OHMB 3WN6A 4KW2A 4IP4A 3CHFA 3C2FA 1VLWA 3E49A 3AJXA 2V3GA 3THUA 5IM51 2Z1WA 4AZCA 1V4YA 3GDRA 2IPWA 4DF1A 4DEFA 1MW0A 3GVVA 5HJYA 5HW7A 2VCBA 3GZAA 1J0ZA 3IJ6A 4FEZA 1Y65A 5CPLA 2PV3A 3URQA 1QOPA 2E9BA 3STGA 5ABFA 2VELA 2WKLA 1Z42A 4HK7A 4NF7A 1F3XA 4YLWA 3TDBA 2QJIA 1UROA 4KFOA 1I1XA 2VFHA 2WSKA 3C5QA 1V5XA 1M1BA 1KM6A 4NAFB 4U85A 4UZSA 1Q6HA 2V5DA 3W82A 4GIVA 2ICSA 3SRHA 1UMYA 4XAZA 1H4PA 1JGIA 5FJOA 2BFGA 5HMSA 3UA4A 3NSNA 3UWQA 4K6AA 2X8RA 2CPUA 3XISA 3S9YA 4E0CA 1NWTA 2XZ7A 5EB8A 3WLTA 3S4TA 1QPNA 1S3TC 5BU6A 1I0BA 4UMAA 4GCXA 2FMOA 3EDFA 5DCEA 4S39A 4G6CA 1JL8A 3G1RA 2QJMA 3KEHA 1GCYA 1E40A 2OQYA 4HA1A 1IEWA 1UKOA 4JTFA 2PF8A 4LJ3A 3AROA 4D6CA 5AY7A 3SRFA 1W26A 2ZRXA 4CNSA 3OA5A 2Y0FA 4AWEA 1EJVC 4IUOA 1DEDA 3BMXA 2QDHA 4TX9A 1UD8A 2B4GA 2ALDA 3VTRA 1TMHA 2P8CA 2CLOA 2IKGA 3KADA 1GVYA 1QNPA 4ACZA 3KDOA 3DHDA 3HB9A 1YTKA 3HPAA 3W73A 3FGCA 3N1AA 4P5UA 4Q3MA 2DJXA 1VB9A 3B8IA 5F4WA 4IGSA 5AHFA 3JR2A 3HPFA 1WV2A 5A8PA 1FWWA 4QEEA 2WXDM 1XUUA 1GOQA 4GZEA 5E93A 1VEOA 4W8AA 4LUJA 4H01A 4R7JA 4L9XA 1KTCA 2IW0A 2A3CA 4M51A 5F1UA 4I90A 1UP0A 5D04C 1XBXA 4A4AA 3L67A 1XRVA 1UBSA 1MRAA 3VD5A 3TNBA 4RE4A 2C18A 5A6AA 4PMXA 4ZGYA 3CZKA 4R0XA 3MJYA 1CGWA 1XS2A 4IG2A 2ZZ6A 2UZ9A 2ZDSA 3E38A 3PVFA 4D6GA 4GJIA 5I3FA 3MVTA 3UZXA 4PTDA 1VHCA 2HNHA 1V79A 4D8LA 3UT0A 3GVRA 1PINA 1XXXA 1IQ8A 2FLIA 1LLWA 1UD6A 2PRMA 4ADTA 1FKBA 4ZPTR 1BF6A 2ASHA 4FIQA 4K2SA 1DPMA 1BEUA 3ARRA 2ZXQA 2WMIA 3KW3A 2EPOA 3FYOA 2OSXA 3WQ5A 2EG8A 4G1KA 5M2FX 2IF4A 2XPKA 2YDRA 1OSEA 5HUOA 2JK2A 2QYGA 1JYVA 4GGBA 2Y85A 2SFPA 4RV8A 3WO8A 1AQ0A 3DERA 1GQIA 5I00A 4QNEA 5IDIA 4HNVA 1BXNA 1B6CA 3UPMA 3QMTA 1GOKA 5GPRA 1FP8A 4JTDA 4WVXA 1PXGA 1CT5A 3ABRA 1VCGA 3CLWA 5EGRA 1IV8A 3U7VA 4JTRA 4LS0A 3WLLA 2Z24A 1KKRA 5FL1A 5B7YA 3H24A 3UJSA 7XIMA 3B3DA 1XCWA 4CLMA 1TWZA 2OXNA 1KCKA 4XAYA 2V30A 3W7IA 2DUXA 2ZR4A 4L6DA 3FVMA 4UTMA 5FCZA 1MDRA 4QFUA 3F5JA 3THQA 4PN2A 2QUNA 1CW2A 5C9RA 4OHQA 2WCSA 1XDJA 1W3JA 2R1LA 1NARA 5LIKX 4FXJA 3K5XA 3ZM8A 1XW8A 4BA0A 3H4WA 3LSCA 4ZO6A 3DHPA 2B7QA 4S3KA 3V0SA 2YXXA 4US5A 4FP1A 4W84A 2NUYA 1J18A 3BAKA 2C8NA 3DOPA 1ZPTA 3QF0A 4UTTA 4S23A 1YXYA 4RDYA 3ZVHB 2J66A 2I56A 3KWSA 3TP4A 2VEMA 1OD8A 1GVRA 2WQDA 3SQLA 5KITA 4LC8A 1Z89A 4DELA 4UTUA 2E4TA 3FAPA 3S1WA 4HA0A 4JKLA 1A5SA 2DZAA 4Z08A 2OOGA 3S6OA 1TA3B 4I7UA 3M5YA 4BF9A 2M08A 3NZRA 2BP1A 5IBXA 1TCMA 4YCOA 2PZ0A 4QM1A 4AHQA 3VM7A 4NXSA 3VAVA 3QHMA 3QY7A 3QY6A 2Y62A 3CIWA 1XGDA 4IXXA 4I5UA 3QV9A 3N29A 3CAKA 2RDTA 1XD0A 3S42A 4FF5A 2R94A 1RV8A 1TZ7A 4AYSA 1B90A 3O5OA 4AZGA 4CCCA 3O5RA 1IT8A 1K4GA 4KCUA 2HROA 4L7ZA 4TX8A 4NZJA 4PH6A 4AFYA 3UXAA 2ZX5A 5BU9A 1X38A 4PRWA 3F03K 4JFMA 4O11A 3LGDA 4YVPA 1PBKA 1LBLA 4LF2A 1LLOA 3O6CA 1KFEA 4GI9A 3VDHA 4AZ7A 2X1UA 3BW4A 4Y9OA 1U5HA 4E8DA 3E0VA 4TUFA 2J25A 4PBGA 3GR8A 3PJWA 3SCNA 3WLSA 1E71M 2VX6A 4KT2A 6PTDA 1TELA 1XRFA 3LRLA 3TQPA 1UZDA 3PB0A 3O0KA 2W4XA 3C2RA 2INFA 5G4WA 5LIWX 3GX9A 5K9DA 4RK8A 2E8YA 2GGJA 1RCOB 1SJDA 2VL4A 3U4FA 1F40A 1YNQA 3HMCA 3B04A 4CD5A 3SW6A 3BLDA 1FKHA 1HXJA 1EL3A 4M80A 4UCFA 1GK8A 3VNIA 1YATA 2E25A 3FAXA 2E28A 3IJLA 2J7FA 4XZNX 4HPNA 1VYSX 2YA0A 3IARA 4Y8FA 1KCXA 3TYAA 3BGGA 3IVTA 2YZRA 1HGWA 3KOZA 4M82A 2EKCA 2Q8XA 1JF5A 1YBQB 4Y6GA 2P4VA 1EOMA 4U31A 2XP6A 2HJPA 3S5ZA 2W92A 1N8IA 4Q22A 1MQPA 1TPH1 1TIMA 1PKLA 1F61A 4KEUA 4NX5A 3PUDA 3M0IA 1OGGA 2V63A 2GLKA 1OQFA 4NT0A 4GGHA 3VNLA 4XAKA 1LQ2A 2EPMX 5F4XA 5FF4A 7A3HA 1RK5A 2NQHA 2YFNA 4ZA0A 1D8CA 5A6BA 4FAMA 2QCDA 3LPOA 4EXAA 2RDXA 1J4IA 4L80A 4ZMGA 1EX5A 1XJBA 1UD4A 3ELFA 2CBIA 1FAPA 1HF6A 1EGZA 4K68A 3ES8A 4Q8VA 1WPCA 1UIPA 4O1EA 1TUFA 3TTEA 4CVWA 3A3WA 4JY8A 5AHMA 2VFIA 4HBEA 3LCHA 3C2EA 3LCXA 4GBUA 3NAVA 2HVMA 3F2CA 2HS8A 3BAYA 3GNPA 1J6PA 4QX4A 6TAAA 3UQIA 4ZS6A 4BWLC 4GA8A 3T4CA 3G0UA 5AHNA 1LDCA 3DECA 4Q7IA 5LNWA 1XGEA 3P8IA 5I23A 1EBGA 1SQ7A 2PTZA 2ZZ2A 4UFJA 4Z1BA 3QPEA 1WE5A 1EH9A 2E6FA 4LH8A 2WHLA 3WBWA 1OY0A 3MO4A 3O3RA 3HGSA 2RDWA 4I8YA 1UJQA 1R7OA 1T5AA 1DHKA 2FZMA 4PMRA 1E0UA 3WQ6A 2P3EA 1V7YA 2ZC8A 1HJXA 2Z0IA 1LRNA 5FKYA 2Z25A 1PBGA 3EZ4A 5M17A 1H0IA 1J0YA 5LZLA 2CW6A 2OCZA 1OJXA 1GZ1A 3WQVA 4PCPA 5AHLA 3SEPA 3P7YA 3A9IA 3TN4A 1W2PA 1FFRA 1KWGA 3CXOA 4JDYA 3ABSA 1XLEA 4HN8A 5D03A 1XLBA 1VBHA 1NDZA 3WEOA 1YADA 3TQVA 4FXFA 2UY5A 3CM4A 3T6CA 4B3ZA 2HWGA 3DFHA 3UFYA 3IGUA 2XP5A 2QHAA 4G1NA 1MI3A 3ARTA 3G18A 1KFCA 1MUWA 4IGMA 3TX9A 3WELA 2H9AA 5TD4A 4JL2A 4TV6A 1J2BA 3QV8A 4NX0A 2IQDA 2EG7A 4MZ8A 3UESA 1ADDA 4W8LA 1S1PA 1AL7A 2X09A 3PP7A 3VD9A 1G0CA 1EWEA 5D2VA 1J01A 2PDPA 1K7FA 5T26A 4A8LA 2F23A 4AEFA 3CUFA 3KBWA 4PMQA 4NILA 4JTGA 4IP7A 1BPLB 1P0DA 2E6DA 1M03A 5FIPA 4OE7A 4MZ1A 1AD1A 2BWGA 2ZA1A 1AH4A 2C14A 4DIPA 3SN0A 3THCA 2CBJA 3IGXA 1J12A 1MQRA 2IPFA 3KAFA 5CJNA 1FWIC 3QXBA 4NL1A 3KTCA 3GH7A 4ZOBA 4AF0B 2PTXA 4JFJA 1YW1A 2WOQA 4AD1A 3I68A 4DQWA 1TZ9A 5HR7A 1Q65A 1O95A 1XDLA 2J7DA 2PRHA 4WKFA 1OX6A 3QYQA 2QVHA 4LWWA 3P61A 2E7FA 1DJWA 2Z1BA 4Z2HA 2DW7A 3FA5A 4DJFD 2W61A 3N13A 4ASTA 2X40A 2VEGA 5CJ5A 3TTQA 5LKYA 3WJWA 3FA4A 5B7ZA 2E9LA 2WJDA 3VIIA 2F6XA 2HTMA 4N4PA 5LYRA 4K8GA 1PTAA 1A5CA 1GHRA 1U79A 3VMNA 8RUCA 4AD4A 5HW6A 4N6EA 3S1XA 3BLPX 1W8GA 4L4OA 3NL3A 4E4UA 3PTKA 1LCOA 5IRPA 3S1GA 4DHGA 1BYBA 1KQYA 3NGJA 1KFWA 3CL8A 4D8ZA 4X9SA 3IEBA 1W9DM 2GUUA 4KMQA 4XZHA 1M41A 1ALDA 3EPOA 4LAYA 4AZHA 1LL4A 4I9JA 4ML9A 4Q4OA 4HCHA 3DFYA 4BS0A 2ZVRA 3APGA 2W3ZA 1A47A 3ARZA 1UWRA 2XN0A 1XF0A 4GVHA 4C60A 3WEZA 1XDMA 1HKWA 3QKZA 3EWBX 3R6IA 2GL5A 1XKYA 3W1RA 4QJ5B 4ADUA 3LHVA 3I7SA 2PDHA 4FNTA 4M7TA 3BTNA 2UZ5A 4EPDC 4ZZ9A 1C8YA 1HTIA 3BW3A 3OVRA 3AISA 1CXIA 1QMLA 2D24A 1I2NA 5ENLA 1P0NA 3IAPA 4UNLA 3ECQA 4GYFA 6ALDA 2OYMA 1DJYA 5FF3A 4XD3A 2XDFA 4IJBA 3NQDA 4WQ6A 3W38A 1UKPA 3PTQA 1GQKA 4I7VA 3A64A 1DWJM 4PMOA 4AY8A 3HURA 5AVHA 3ITLA 1R6WA 3VIFA 3FYYA 4N9EA 1LG1A 3V18A 4V27A 5AHIA 2MNTA 1VBRA 1MVYA 1GVFA 4HVXA 1EFZA 1R9XA 4N2YA 1ESWA 4LU0A 2XH0A 3CIXA 4H3DA 1OT2A 5A8NA 1D7FA 3GAKA 3E02A 1P5BA 2XHYA 4HMNA 3H23A 1KV8A 3RPTA 4C5YA 4CD7A 1OZQA 2A5HA 3PZTA 3GVWA 3VIHA 1DYSA 3KLKA 5JIWA 5BZAA 2DVTA 3KUMA 4P61A 3S8HA 3QFWA 1TVNA 3W7DA 4NJGA 3VGGA 4XD4A 4TW7A 2V5KA 2BLEA 1MZHA 3RJXA 3QJAA 2ACQA 3RO8A 2R1NA 4ZB5A 1FKJA 5EY5A 1DP0A 4GNVA 3LNPA 2ZXAA 1Q6OA 3SIMA 2FH8A 2XH7A 5D9PA 1B30A 1PE1A 2BGNE 3NJ3A 4DF2A 4DZ2A 2NT0A 3CK5A 3CTTA 3FIGA 2MLXA 4JXCA 1FWDC 3ME3A 4H8VA 3TOYA 3QW3A 3I6TA 5JH1A 3HV8A 3IANA 1UR8A 1UW9A 1ZJIA 2WC7A 1YBQA 4R9XA 3H7VA 1WOAA 3CJPA 3UEQA 1BYDA 4O13A 4NZCA 4E4FA 3WDQA 4LFYA 1IXQA 3O6AA 3KX6A 2CLPA 2VENA 5I2UA 5LHEA 4BQ2A 4FNPA 4C65A 3DX5A 4ROPA 3STCA 1LOQA 4Z0SA 3PSVA 4D1IA 5JMUA 3RCYA 4F66A 4H8NA 1DWFM 1P4CA 1ZK6A 1FWBC 1UPMB 3L2IA 1GOMA 3W29A 7PTDA 3LCFA 3WFAA 5CAKA 1QPLA 1UOZA 2Y4SA 5XIMA 1KRCC 3EX1A 2VN1A 3C2VA 4B5WA 1W5MA 3PY2A 1AODA 2VR5A 3CYJA 2QAFA 4LAXA 3HG5A 1ONRA 3CHDA 1F3WA 1ODUA 3G8EA 5TIMA 2TYSA 4KESA 4IZGA 2VT0A 1R3VA 4TQTA 1F4AA 1K8CA 1E9IA 3P14A 2R24A 3M0ZA 3CLMA 3W7JA 3GUGA 1V6TA 1IYXA 1WKEA 3TWAA 4JTCA 3ZWSA 3UYIA 3PBYA 4DI9A 1SGJA 3WIJA 3LY0A 1RA5A 3TK7A 3BW2A 1X39A 1CGVA 5BWFA 4P7LA 4ORIA 1BWLA 2W79A 3B7XA 2YL8A 2ZICA 4XBJA 4A29A 2Y5EA 4HHMA 3ZXWA 5BXPA 4MPKA 3OGSA 1B9BA 4AAJA 4FB7A 2FGLA 2P50A 2VGIA 4S3AA 2PWUA 4H7VA 3GR7A 5KETA 1LG2A 1FWTA 3UGVA 2PODA 2ZXDA 3NQVA 4XZ9A 3IIXA 3QBUA 3B9DA 3CS2A 1TB3A 3QQ0A 5XIAA 2W67A 1M04A 3KCJA 2Q09A 4NIRA 5HQEA 4JTLA 3W86A 4O8AA 4MPQA 2PPOA 4WJXA 2X1SA 2YW4A 3GH4A 4S1FA 3UD6A 2ZQUA 2NWSA 2MPHA 2NVCA 3B0YA 1O5QA 1OIMA 5FJRA 1E3XA 1KFJA 3CEUA 4AD2A 3L68A 3OPSA 4A8RA 2O4QA 5GVJA 4LXFA 4N9DA 1HG3A 1X1ZA 5A5WA 1PCKA 1KM4A 1K70A 3OZMA 1EGMA 3HGOA 2YSWA 2O92A 4IIGA 2A4AA 1R9HA 4UTHA 3W9ZA 3Q67A 2A3HA 4R7OA 1OABA 2ZFAA 3WDIA 1JCYA 4IX2A 1BWKA 1HUVA 3VI2A 1S2WA 2DORA 4C6QA 4KEMA 4W4QA 5HWNA 4RZ6A 1VBUA 1P0BA 3GNDA 3QC3A 5C2GA 3SO7A 2YYUA 5HBFA 4H1ZA 1EP3A 3GXDA 2A7PA 4ZQCA 3ARXA 3IS4A 2NQJA 3IJ8A 2CWNA 3VKJA 4KRTA 5H6HA 1EJ7L 4WJEA 3WF3A 3A3HA 3W7NA 3PAOA 5AC5A 2YOCA 4RDVA 4P8WA 1WP6A 4DPPA 4J27A 3AMGA 5D05A 2PU0A 5K9XA 3FCPA 3IHZA 1CLVA 3H2NA 4C6IA 1XIMA 3O7UA 1SZNA 3NDOA 5CSSA 3AO0A 1PVNA 4Z17A 4FA3A 3GFYA 1H2JA 4DJED 4U3CA 4ZTXA 1A7XA 3AYRA 4P2VA 3SJNA 5LSMA 1Q4WA 2HBVA 3Q2DA 4MUPA 4DM2A 2WYSA 3QM3A 3MB9A 4AC1X 3R2GA 1M65A 3EDKA 1J9YA 4LY8A 4PFMA 4A8NA 1QBBA 3AAMA 5D37A 1PB0A 2F38A 1ZJAA 2I5IA 1FA2A 3NR0A 4EXBA 4JPGA 1Q45A 5D33A 2A7NA 3VMOA 1DTUA 1TV7A 2Y6ZA 5D8ZA 4KFPA 4ZCWA 4NUWA 4UIOA 4FOKA 1LL6A 3LS9A 2P1FA 5CLWA 3OO2A 1JNDA 4JYFA 2PGWA 1X6LA 3AHYA 2KE0A 4I6KA 4MUZA 3PUEA 2FFCA 1KKOA 3PBMA 2XFWA 2O7QA 3N2CA 1JCTA 2JKAA 4HTYA 4JNZA 4JTQA 4IQJA 3WK3A 3JYMA 4DROA 1HQTA 1JVNA 4EP8C 4DZ5A 4M7SA 4FN2A 3W7EA 4S3EA 4US6A 1U1HA 4WXZA 2BS9A 2J6XA 3DUGA 4ZR8A 5A8QA 3F4VA 2PTWA 5DN1A 4L65A 3EB2A 1JFHA 1RAKA 4HZ7A 3DG6A 5C9WA 2XVNA 3AIBA 2J88A 3PNUA 1KLZA 1UR3M 4FAPA 3OZYA 2RJHA 4GYKA 3UXLA 1MW2A 1E6SM 1MWOA 1RD6A 1VKFA 2W9MA 4RJEA 2GVYA 4R27A 3LGGA 1RQEA 1XRTA 4R88A 4PB5A 5TNVA 3V4BA 4B3KA 3CWHA 5REQA 1VENA 5T91A 1YNPA 3EDJA 4UB9A 1EXPA 3C3NA 1HJUA 3DYOA 2X7WA 4MKSA 3MKVA 3DXIA 3WJZA 3K8MA 3GY1A 2GFTA 4J4KA 3K8LA 4JNMA 3SR7A 3VCNA 2C79A 4Q4RA 2RUDA 4OZOA 1G4SA 5AOUA 1SM9A 1LBFA 2YCLB 3CH0A 4AEEA 1RLDA 4WEVX 3NXFA 1YDNA 3VU2A 3IUIA 5A6LA 3E2SA 2Z00A 2INEA 3GH5A 4KWVA 2WWCA 5T8GA 3EMCA 4J5NA 2HDJA 1TREA 4KCTA 1V08A 4JIRA 4GK8A 1KBIA 1F8AB 1QZ2A 1LWIA 3AHZA 1KLYA 1AZ2A 1SR0A 2A3LA 3TCSA 5LGXA 4L61A 3C6CA 3QTPA 4GIEA 4ODKA 4B9ZA 3T8LA 2YBVA 2ALRA 3UWZA 4ZPVR 1TVLA 1H0GA 2OLHA 1XCXA 2VDHA 1UHVA 3FYPA 4HCDA 3REQA 1CI1A 1E51A 3KBSA 1TV4A 4K8EA 1PIGA 2OSWA 4J3XA 4FR6A 1XSJA 1SJBA 4IFKB 4HSHA 3R89A 1EKOA 1C9HA 4CQBA 1VJZA 1E1CB 5TAOA 3BARA 1TR9A 1QI0A 3K1DA 5EMKA 3FVDA 4CU6A 3OQ8A 1GYMA 1Y5XA 4TTUA 3W1MA 2WZHA 1R86A 4IQCA 4LALA 3ONCA 4MFDA 5A6TC 2VZOA 4KRUA 1XFBA 3VKAA 4QIBA 2ZE0A 1H5YA