2YBUA

Crystal structure of human acidic chitinase in complex with bisdionin f
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
376
structure length
376
Chain Sequence
AYQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ACIDIC MAMMALIAN CHITINASE
publication title Analyzing airway inflammation with chemical biology: dissection of acidic mammalian chitinase function with a selective drug-like inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 129
structure length 376
sequence length 376
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2011-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ybuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2ybuA01
1UZ4A 1ZJAA 1NH6A 3PTQA 1VFMA 1V6WA 1WO2A 4UQDA 3GXDA 2VI0A 4FLOA 4UFHA 1FFQA 1G1YA 3UG3A 4DWSA 2CBUA 4OKDA 5EBAA 1BF2A 6CGTA 1J10A 2GSJA 2VQUA 4JFVA 4C7GA 1AQ0A 3OLIA 4WKHA 4ML4A 1I1XA 4CU8A 1HL9A 2E3ZA 3HN3A 2QPUA 3UCQA 5FL0A 2XSAA 1E4LA 2XGIA 1EOMA 1FA2A 3THDA 2A3BA 4PTVA 4BF7A 2CESA 3FN9A 1Q6DA 4HTYA 2BY3A 4MPKA 3T2OA 2BHZA 4UQAA 2FHFA 3W25A 1V6XA 4HPHA 1E4MM 3WDIA 1XHGA 3AZTA 4MTVA 4F79A 4D1JA 2XVNA 4PYSA 2RGMA 3WUFA 2J7DA 1E3XA 4GO8A 3VINA 3U7BA 3AS1A 2XFRA 3VM7A 5LA1A 2GJRA 1CXEA 2GUYA 4P7LA 1M03A 1JFXA 4PMOA 3WDJA 2UY4A 3VM5A 2X1IA 2ZUMA 2Z1SA 2E9LA 3SCQA 2EEXA 4QP0A 5ABEA 2Z1KA 1UKQA 2XFFA 2X09A 3NSMA 5D8ZA 3AFBA 4V27A 3L4XA 2DIJA 1XCXA 7CGTA 2QV4A 2JF7A 2DQXA 3EDFA 1PBGA 1Y7VA 2CYGA 3CHEA 3KL3A 2J7EA 2W66A 3WUBA 1DWIM 1KGXA 3UG5A 4U3AA 1MW3A 4U5KA 3ZOAA 2BV9A 3FAWA 2ZIDA 1PZ3A 3WMSA 3ARSA 5CLWA 2DH3A 1H1NA 1VEOA 5A1AA 4K68A 1AVAA 4BS0A 1ZL1A 3VIPA 2WHLA 1C7TA 3SUTA 3VGFA 1XH0A 3OB8A 4MB4A 4M29A 5EB8A 1NOWA 1HJXA 3AMCA 2FDMA 1HKJA 3BH4A 3W24A 3SUUA 4U3CA 2VX5A 2ZXDA 1CXLA 3KL0A 2WBGA 3AHVA 3CZ8A 2WMJA 1DEDA 2O9OA 1CGXA 3IJ8A 3PZVA 1E1FA 4HMDA 3CHCA 1C7SA 2W63A 1W2VA 1ODZA 1EO7A 5HPCA 1BAGA 1DP0A 4AYSA 1CXIA 2WMFA 2WYSA 1V3MA 4ACYA 4W85A 1NQ6A 3ARUA 4DWSD 2TAAA 1HL8A 2NW0A 4F9JA 1E0VA 3PZNA 4FLQA 1V0NA 4AIOA 2D20A 4DUWA 2VZTA 4U5IA 1SMDA 4J3TA 1TFVA 4PMRA 2FGZA 3L4VA 1UR1A 1C8YA 1H5VA 2VCAA 3OGSA 1GCYA 1HJQA 4H2CA 1LL6A 4Z2IA 3TA9A 2A3HA 1EOKA 3VDAA 1SMAA 5E0FA 1GOWA 1JFHA 1G5AA 3WF2A 3AHTA 2DGAA 1GQLA 1G01A 3WNKA 2XM1A 3BCFA 4PUEA 1DTUA 5A6KA 4ZE5A 1XD0A 1J11A 2GK1A 4TX8A 3IAPA 4HA3A 3VILA 3GDBA 1E6ZA 4XZWA 1NWSA 1BVZA 3WD1A 1PIGA 1L8NA 4UOQA 4JFUA 3ARYA 4F9DA 3BMVA 1NM9A 4B3LA 5BXTA 4IPNB 1QI0A 2VR5A 3PZMA 1QVBA 1VAHA 2E8ZA 3ECQA 2WLZA 3BC9A 2ZX5A 1CGUA 2C7FA 1CGVA 1MQQA 3EDDA 5A8PA 2RGLA 4FF5A 3WUGA 4P8WA 3B9DA 2BVYA 1MW1A 3G6LA 5BYWA 1MXGA 2J25A 3PZUA 3EDJA 2CEQA 1C91A 3CBWA 3WQVA 3WQ5A 1H09A 4J3WA 1JIBA 4AD5A 4X0VA 3WY1A 4NRSA 4B3KA 3A4WA 4PBGA 1CLXA 4HU0A 5A95A 1DWHM 1ZBWA 3U5UA 4PCSA 4P8UA 1MW2A 3BGAA 1DHKA 2YDRA 3N18A 4UFIA 4CD8A 1SFSA 1JL8A 2OYKA 1P6WA 4QCFA 3AYSA 1FFRA 5BCAA 5M17A 4X0NA 3CHFA 2GJXB 4FMVA 3I3BA 4KGJA 1B9ZA 2W61A 1JF6A 5A6LA 2G41A 3PZOA 3ZO9A 3THCA 3ZR6A 4AZCB 1W1TA 3MANA 3OLDA 1KBBA 4F66A 1PPIA 1GOIA 3CIVA 2WKGA 4Q7NA 2O92A 3ZT7A 4LPCA 4URIA 3AOFA 1PX4A 3BMWA 3TTYA 1WDRA 1UKTA 2WSPA 1B3VA 1XYFA 5CG0A 1BTCA 1W1VA 2WVVA 2CHNA 1GOMA 3W37A 1J0IA 3WMBA 2YJQA 2VO5A 3OLEA 3AJ7A 4J3VA 3EMCA 5IXEA 2WKLA 3VUPA 4GINA 1NWRA 1WKYA 2WMIA 3CTTA 3EMQA 3SCNA 4PTMA 2WLYA 2WC3A 2WBKA 4PSRA 3L2LA 1C93A 1HJWA 2ZXQA 3ZSTA 3VDCA 2X0HA 4PMVA 1VFUA 1E6RA 4JIEA 4P7OA 1B3YA 3ZJKA 1JG9A 1EQPA 1RH9A 1W3HA 2D0FA 1KWGA 5DMYA 2C8NA 3VTRA 3AISA 4HZ7A 3QGVA 3TTOA 6TAAA 2YKKA 1RP9A 2UY2A 4M56A 1F4AA 1Q6FA 2QMJA 5KZ6A 3VPLA 4CN1A 2PC8A 3VD9A 2MANA 2EPOA 4PMZA 2V3EA 4R27A 1PEZA 4HOWA 4MAVA 4FK9A 1OIFA 4MB1A 5E9AA 5TD4A 2ZUVA 7A3HA 3A47A 1WPCA 1EH9A 1PJ9A 1KXHA 1JZ2A 3W0KA 4CD6A 3ZJ7A 2XFYA 1V6VA 4PUDA 1JXJA 4LYPA 5CSYA 5A69A 3RM9A 1J0HA 1AQHA 3DECA 1J0JA 5DFAA 1R87A 4MB3A 5GQBA 1CIUA 3WQ6A 1UH2A 1OGSA 1QHZA 4YPJA 4QCEA 3VIIA 2DT3A 5F7UA 2E40A 4RE3A 3AICA 4AD3A 1NOFA 4BQ5A 4WSKA 3ALFA 4JHOA 3F5JA 2A3CA 4Z2JA 2BY0A 1NP0A 3IANA 3VD4A 3NJ3A 1CECA 4UR9A 1BGAA 4M1RA 1UD5A 3N12A 1BPLB 2XTKA 4DWSB 1VJZA 2EPNA 2ZX8A 3NCOA 1HJUA 5HNNA 3KWXA 5ABFA 4D6IA 1OBAA 2WC7A 3T0BA 3NDYA 2VUYA 1GPFA 4D6FA 4F8XA 1UR8A 5JH8A 1UA7A 4PMYA 4TOQA 4KWUA 2ESCA 4Z2LA 1EQCA 4AMCA 3AROA 1BYBA 1UZ1A 3F5KA 4XB3A 4EKJA 1PAMA 1KXTA 3LPFA 2XVPA 2Y8VA 1JD9A 4GI6A 1QNOA 1NOUA 4WLCA 5ECUA 1QHPA 4L4PA 4QDMA 3WNMA 1W32A 4GQRA 3DHUA 1LQ0A 3T08A 1N82A 1R7AA 5KEZA 4JFSA 1OD8A 3W29A 1HKMA 1B2YA 3GXMA 2OSWA 1OWQA 1X1NA 3T0AA 1UWSA 3N17A 5M5DA 2VJXA 2OYLA 4PSPA 1VF8A 3L2MA 1JYVA 1KR0A 4PN2A 2OWXA 5DT7A 2G3IA 4TTUA 4YHEA 3W28A 1KQYA 3GXFA 4D6DA 5CGMA 5A2AA 4W8LA 3CLWA 3EBVA 3MUZ1 3MU7A 3VIKA 3KL5A 2WCSA 1VBRA 3WEMA 4WK9A 3I3EA 4ZXLA 3WQ4A 4A3HA 4CCEA 3SCPA 2A3EA 4UOJA 1E6NA 5IFPA 4S3KA 4TVDA 3GH7A 2VVNA 3BCDA 2WHKA 4M8UA 4CD4A 4KMQA 1XV8A 2J8GA 3AHZA 1HJVA 3A4AA 3QOKA 1UD3A 2PBGA 2W4XA 2HVMA 2VZVA 1W91A 1FHLA 2VZUA 1S46A 1M01A 1HJSA 4W87A 5A6JA 3QHOA 1GOKA 4Y7EA 1QNSA 5E70A 1E5NA 1LJYA 1UYQA 1CGTA 5DF0A 1E6PA 3CH9A 3PTKA 1R85A 3T2PA 1H11A 3MV11 4XV0A 1MYRA 1TR1A 3WF4A 1KCKA 4M81A 3VIMA 3GYCA 2CPUA 3CZLA 1V6YA 1WNOA 5I6SA 1TE1A 1MWOA 4WSJA 4DM2A 4UQCA 2ZICA 2JF6A 3ZT6A 4MDPA 2ZWZA 3SUWA 4AWEA 1PZ2A 1X6NA 4CU7A 1V3HA 1QI2A 5FIPA 4IUGA 1HKIA 3T09A 3WD3A 2PB1A 2YL9A 3KZSA 1UKPA 1J0YA 1OD0A 2IXUA 3T2QA 1UWRA 2UY5A 3U57A 1G0CA 2CBVA 1F4HA 2Y5EA 4W8BA 4D1IA 2YL5A 1U30A 2NT0A 4TX6A 2J7GA 2GK1B 3BAKA 4D71A 1QW9A 3DHPA 2CHOA 3AMGA 3WD4A 5A6SA 5I3DA 4GQQA 4OIFA 3WF0A 1WZMA 4D6CA 2VOTA 2XWEA 1GQIA 2VT0A 4U2ZA 4LQ1A 1M53A 3QOMA 3POHA 3SUSA 5CJ5A 3CO4A 1TZ7A 3B9AA 1LLOA 2DSZA 5GNZA 1CNVA 1R8LA 5CLTA 4DM1A 4BZYA 3WIJA 2BFGA 2VVSA 2OWWA 1HP4A 4LYQA 4RE2A 3WEOA 4W5UA 4PMDA 1JDCA 5I24A 1SR0A 4D72A 3WD2A 3ALGA 1QOXA 4E4PA 4AD4A 1V03A 4AZ5A 1GZJA 3SCRA 1BFNA 2YDSA 4GZEA 2DDXA 1CPUA 1E0WA 3BSHA 1CLVA 3WL1A 1UKSA 4AZ6A 3N11A 4LGXA 3WBEA 2BHYA 3TTSA 3HU7A 5DT5A 3WSUA 2BHUA 2XPKA 3M7SA 1IV8A 5BWFA 2WK2A 1J01A 3LMYA 1E9LA 4P8XA 1V0MA 4DUVA 4WKAA 6A3HA 4YHGA 5M3WA 4FLSA 1KFWA 2XWDA 3WDQA 1H4PA 1KQZA 5DO8A 4IM4A 1KR1A 3L4WA 1NWTA 2CKSA 3IK2A 1Q4NX 4AY1A 2G8ZA 4JCMA 1I1WA 1W9UA 1UKOA 1PIFA 1WZAA 2W91A 1UWIA 3TP4A 3EMZA 1TA3A 4NRRA 1Q6CA 3WUEA 1JZ7A 3POCA 3VKKA 1HP5A 2WVVB 2DT0A 1CTNA 1J12A 5E6ZA 4UFJA 3LPOA 1KCLA 4MB5A 2WMIB 4PMQA 5AC4A 2BXYA 4J3UA 5AYIA 4UCFA 1W9VA 3CZKA 3QHMA 1ZJBA 2V38A 4GXPA 2VRKA 1OM0A 1XSJA 4PRWA 1HVXA 3ZSSA 5FKYA 3GTNA 3CMGA 1UD2A 2VTFA 1UD8A 1JDAA 3HMCA 4WJXA 1C3FA 1CBGA 4CN4A 3WEZA 1AQMA 1B3WA 1L0PA 2ZX7A 4MADA 4B15A 2XIIA 3OGVA 3OZPA 1UR4A 2XYLA 2QPSA 2D2OA 4ZFMA 5ABHA 4EE9A 4MNLA 2DT1A 5C71A 5A6BA 3PZGA 3M6DA 1C8XA 3MKKA 2V3FA 1WB0A 3N04A 4JFWA 5A8MA 2VURA 5D8WA 2AMGA 3S6TA 3UESA 1UQZA 1W9DM 3VX0A 4W7WA 3DC0A 2BVDA 1RD6A 3AXHA 2ZXBA 1GVIA 1TMQA 3RMEA 1GHSA 4JKKA 2Y2WA 4JL2A 4XZBA 3LPGA 5LA0A 4CD7A 4OOZA 3AMDA 3BLKA 8A3HA 1GJUA 2XSBA 4GZIA 1BYCA 4W8AA 4ZEPA 5BRPA 2XJ7A 2GVYA 2V3DA 2CERA 4GI9A 2CXGA 2DPEA 3MS8A 5I23A 2OWCA 3AIUA 3GNPA 1CYGA 1UQYA 2PBOA 4W88A 3NYDA 2WZEA 1UD6A 2JE8A 4AIEA 1H41A 1WCGA 1GONA 2CITA 5HDRA 3D3AA 1E6QM 4JKMA 4UZUA 3ZIZA 2G4FA 2FH6A 3W4RA 3AIWA 1WE5A 4AZIA 4PMUA 2YL6A 2PWFA 9CGTA 5ABFB 1KGWA 1QW8A 1C90A 1XYZA 4J28A 1W1PA 3CMJA 1CEOA 3AQUA 1D7FA 1H2JA 4H41A 1FP9A 3ARXA 2F2HA 3OLGA 4BCEA 1C8QA 3VIHA 3A3HA 1TVNA 3PZTA 1GNXA 2HISA 4L4OA 3RILA 1E56A 1HN1A 3BAWA 2C0HA 3BAYA 2QHAA 1CGWA 3ZR5A 3ZJ8A 1H0GA 1HKKA 3HJEA 4ZE4A 1GUVA 4AISA 4OBRA 3O6AA 1QNRA 4RL3A 2F61A 5I0DA 3CZEA 4OBSA 4DWSC 2CNCA 2VMFA 1RPKA 2XIBA 1RP8A 3GNRA 2VX7A 4AD2A 4P8VA 1QHOA 3NIYA 1V3LA 4N42A 1XSIA 5D9OA 3APGA 4B9ZA 5A2BA 3NDZA 8CGTA 3AIQA 4ACZA 3WELA 1OIMA 4HA1A 2DSVA 1A47A 2XVLA 1E4NA 1VFOA 3BSGA 1U2YA 4PTWA 5ABGA 5A6MA 5HBFA 2VL4A 2WAGA 1JD7A 4UFKA 3WFLA 3KEHA 3OZOA 1BG9A 1MW0A 3WH9A 5HXMA 1GORA 4J27A 3PZIA 5A6BD 1JF5A 3OBAA 4J7RA 1OCQA 1B1YA 1KXQA 1V6UA 3VD5A 3MUIA 4HZ8A 1B0IA 3SCSA 4D6GA 2J7HA 3NSXA 3VGEA 2PWDA 1EO5A 3CHDA 2DSKA 2E8YA 3UEQA 1OT2A 5D4YA 3N9KA 3AMKA 1VENA 2G3NA 4GO9A 2YDQA 5JBEA 4HOZA 2WVUA 5HPOA 3E1F1 1V3KA 2D3NA 2FHCA 7TAAA 4DUXA 3WQ8A 1JZ8A 3VMOA 4D6HA 3IJ9A 3BAXA 4LX4A 3SCWA 1VFFA 1CXHA 2WZIA 3U7VA 3MSGA 2ZUSA 3MMDA 1BG4A 3RM8A 4KRUA 5A8QA 2D22A 2J8FA 2B31A 1EDTA 1XC6A 1UUQA 5FCZA 4E2OA 2W5FA 3SCTA 3MMUA 1XGZA 1QNQA 3WN6A 2GDUA 1XH2A 1UH4A 1H0IA 1TCMA 3BLPX 1CZ1A 1E71M 3VOCA 2QF8A 4EANA 4AZCA 1K6AA 1ITCA 1CGYA 1XCWA 1KB3A 4N0RA 3ARZA 4LXFA 4ZENA 3K8LA 4MAZA 1MFUA 3K8MA 4KH2A 4M82A 3AS0A 4TXEA 4OOUA 1VB9A 2X2YA 1ODUA 2JIEA 3CZGA 4AW7A 3BXWA 1BHGA 4UTFA 3WF3A 3W53A 3VGBA 1EA9C 1E6XM 3ARVA 4W89A 4D6JA 1V3IA 1CXFA 4KRTA 3CPUA 3VO0A 2D23A 1WDQA 1W2PA 1LWJA 1OGGA 3DYMA 1HXJA 4UQEA 3AZRA 3D5HA 3CUJA 2ZXAA 2NSXA 1PX3A 2J7CA 1HIZA 3VMPA 4AZBA 4MJ2A 3ARPA 2BXZA 2YLLA 3DYPA 4H04A 3WH5A 4WKFA 4U31A 3VIOA 3WFZA 1W1YA 4W93A 1E5JA 4GI8A 4ZXOA 5AY7A 4QLKA 4XX6A 1W9PA 2EQDA 4AIUA 2PI6A 3W26A 3SCOA 4CU6A 3WQWA 3GM8A 1E43A 5A94A 3M46A 5I5RA 2X8RA 4RE4A 4W86A 2OSYA 1O6IA 3VNZA 2ZOXA 1MQRA 3WF1A 1HF6A 1V0LA 3WH8A 4P7RA 2QLYA 3PTMA 1IT0A 1UWUA 5JIPA 1JYXA 1UWTA 4UZSA 3VIGA 5GPRA 2O9PA 2WCGA 5FD0A 1A3HA 1UR0A 4Q22A 4JAWA 3FAXA 4S3JA 1OB0A 3MUAA 3OA5A 1DWFM 2YLAA 5I77A 4W7VA 2WB5A 4WF7A 5A8OA 1JGIA 3WNPA 3F5LA 3J7HA 1WDSA 5BXSA 1ISYA 3W6MA 4HZ6A 3DYOA 1BQCA 1XD1A 1TA3B 4HA4A 2NT1A 4W7UA 3EYPA 1B31A 1QBAA 2AAAA 3VU2A 3JUGA 1BSIA 5IHSA 4MDOA 3T0DA 1CDGA 1QI4A 3W6LA 5JIWA 4TTGA 5E09A 5A6AA 1TVPA 4CD5A 5I79A 2WHJA 1YHTA 3W38A 3CZJA 4B16A 1J9YA 1K9TA 2JEPA 1GQKA 2GFTA 2G3JA 3VD3A 1JNEA 2WNWA 5A8NA 5AC5A 4E8CA 2YL8A 4UFMA 2V5DA 3CUGA 1FP8A 1V0KA 4BQ2A 1W9XA 3KE0A 4PMXA 1QNPA 2A3AA 1UR2A 1VEPA 2WC4A 1HNYA 4A3YA 2Y8KA 1E72M 2E0PA 2WMKA 1EIBA 4ATWA 4C7DA 3AYRA 3AMLA 1V08A 2W92A 3UETA 1XH1A 1CWYA 2WSKA 2CKRA 3QHNA 3ZMRA 3N15A 3WDPP 3RPMA 1R86A 1LL4A 1CENA 1BYAA 3RCNA 1DWGM 5I78A 1MVYA 2W62A 5LA2A 5I2UA 2E9MA 1EDGA 4H8UA 4H8HA 4CVUA 1XSKA 2E9BA 3WKZA 4U2YA 1JXKA 1OSEA 1VRXA 1WDPA 1G94A 1E1EA 3VGHA 1JDDA 2D24A 1BGGA 3OIHA 4A4AA 1K9EA 1C92A 5EFDA 1WZLA 2ZX6A 3SIMA 2DH2A 1B30A 3QR3A 4UFLA 3AIBA 1M04A 1CXKA 4FLRA 3WNLA 2D0GA 4UNIA 5C8BB 2AOSA 3AIRA 5A2CA 1V02A 1E4IA 1ZS2A 2YA0A 3IJ7A 1QI5A 3FXYA 5BRQA 4IISA 4AZHA 1UWQA 4M24A 3UR8A 4V2XA 3K4AA 3W82A 4X9YA 2EJ1A 3RJYA 5IFTA 2WCAA 1OINA 2VZOA 4R5EA 1U33A 4PTXA 4BA0A 4NF7A 2JIWA 3UERA 2D3LA 2WPGA 5CZKA 3OG2A 3B9EA 3AXIA 5FL1A 2WMGA 2VX6A 3VIJA 2WWDA 3RM4A 1TUXA 2YA1A 2VR4A 3PN8A 5EMYA 1OGBA 4WIWA 2Y24A 5M03A 4QFUA 1UH3A 1D3CA 2DIEA 2UWFA 2VRQA 4TVUA 5IDIA 3ZM8A 1GHRA 2WANA 3VX1A 1IZKA 3W81A 4AEEA 1J18A 3PHAA 4MNKA 3SCUA 3UG4A 3AHXA 1K9DA 2XGBA 4CCDA 4E8DA 1GJWA 3MV01 1ESWA 3NUKA 4KGLA 1JAKA 5E6YA 2JEQA 1US2A 3TTQA 5JBFA 2J78A 1J0KA 3GH5A 1AMYA 3WD0A 1HX0A 1QPKA 4TVCA 4ACZB 1GVYA 1YQ2A 4CKQA 3PZQA 1VIWA 3ZJ6A 1UR9A 1WAWA 1G9HA 4Z2KA 3VGDA 4B9YA 4PMNA 4IPLA 1FOBA 2V3GA 5AYBA 2VZSA 3ZT5A 3ARQA 3ARWA 2EPMX 4JCLA 3CUFA 3FHAA 2WMHA 4AZ7A 5CSUA 2FGLA 1MQPA 2OYMA 4CCCA 3K46A 4HP5A 4PCTA 4C7FA 5JBDA 1IZJA 1B3XA 3M07A 1PX8A 2EO7A 1E15A 4P7NA 3WDRA 1ZU8A 5C70A 1LL7A 4JFTA 1ZBCA 2CBIA 2UY3A 1QI3A 3ARRA 1US3A 4AXNA 2YOCA 3RIKA 3PZ9A 3MMWA 1TG7A 3A4XA 4TUFA 4JZ5A 1V3JA 4BQ3A 3G6MA 2CBJA 3RJXA 2PWHA 1W3KA 4AEFA 1EXPA 1ISXA 1ZBKA 1JZ3A 4JKLA 1JI1A 2CCRA 1EHAA 2J4GA 3FNDA 1MFVA 3GZAA 3AS3A 1Q6GA 4QAWA 1KGUA 2DSWA 1K9FA 3CGTA 2FHBA 3PBGA 3RO8A 4V28A 4W84A 3SUVA 1OT1A 2YBTA 4MNJA 3TOPA 4HOXA 3K8KA 1E3ZA 3N13A 2OLHA 5E0CA 4JHZA 1HT6A 4MJ4A 3TONA 2XM2A 4GKLA 2G3MA 2XG9A 2J47A 2BY1A 3FY1A 2EPLX 3SCVA 2BNJA 1JYNA 1JAEA 2X05A 5A3HA 3U5YA 3WDHA 3LPPA 2WXDM 1E6SM 4QLLA 2VCCA 2ZUWA 3L4YA 2DSUA 2WHMA 2J74A 2XUCA 2BY2A 1QBBA 2DT2A 4YN5A 2ZUNA 4HMEA 4Z2GA 1M7XA 3VGGA 1DWJM 3VMNA 3VD7A 1H49A 4UQBA 5IHRA 3WBAA 2IUZA 1FHDA 4OZOA 1Z32X 5GNXA 3MO4A 4J3XA 2VX4A 2J79A 5CPQA 3VDHA 3RDKA 4P7QA 2OSXA 2J62A 3AXXA 3SEPA 2EXOA 4UOZA 3VVGA 5BXRA 3NSNA 4CVWA 4EK7A 2F8QA 3II1A 1W3JA 5CXPA 4AD1A 1W9BM 1O7AA 1WZKA 2D1ZA 2Q8XA 1E73M 1E55A 1VJSA 3WENA 4D6EA 2YA2A 1J0ZA 3AZSA 5D9NA 1KXVA 2ZWYA 3EDEA 2CIPA 4PEEA 1W3LA 3CUHA 1ITXA 1EGZA 3AIEA 3CUIA 3OGRA 2J77A 1NP2A 3FHQA 2J75A 1JZ4A 1UOKA 2FH8A 4XUYA 5BROA 3MUY1 1KWKA 1Q6EA 3AI0A 1LWHA 1JZ5A 2ZE0A 1JI2A 1SYTA 2XVGA 4NI3A 2GJPA 1JYWA 2PWEA 4LYRA 3SURA 3K1DA 3AS2A 1ZBVA 3WNOA 5DEZA 4HPGA 5D9PA 1GOQA 1H3GA 2WM0A 3F4VA 1E0XA 1E40A 5CPSA 1EDQA 3S2CA 1DWAM 1B90A 2WWCA 2VNCA 3MSDA 1KBKA 2ZX9A 5HOSA 1XRVA 2VQTA 2GJXA 5CQ1A 3FW6A 2W67A 2BS9A 1WP6A 1LF1A 1V02E 2DEPA 3BAJA 2J7BA 1EHNA 1ZB5A 1UD4A 4ATLA 2WVTA 4CUCA 3L4UA 3GXIA 3L4TA 1E70M 5JUVA 5EFFA 1VBUA 1BYDA 3O2LA 4HU8A 2V5CA 1JNDA 2J7FA 1BVNP 2VRJA 1ISZA 3A6OA 3VIFA 3AIVA 2YIHA 1B3ZA 3UR7A 4AZGA 4CGTA 4JL1A 3VDBA 2VC9A 4M80A 4HMCA 3WH6A 1FH7A 3VNYA 2WVSA 3O9NA 1GOOA 2EPKX 4AC1X 3WL0A 2XHYA 1UG6A 3L4ZA 4GIAA 4H7VA 4H8VA 3I3DA 1UA3A 5LYRA 3ARTA 2PF0A 2IXVA 4QLJA 2CETA 2ZUUA 2BVTA 5D9MA 1GQJA 3B8SA 2GDVA 1I75A 2WW5A 4J3SA 4EAMA 2X0YA 2WZHA 4Z2HA 3N1AA 1LG1A 3W27A 1GW1A 2YBUA 4NZCA 4MNMA 1VEMA 3GBDA 1ECEA 1FH8A 2XVKA 4OJYA 3IAQA 4CN6A 1LG2A 2O9TA 4BQ4A 3BAIA 1MXDA 2E4TA 1JZ6A 1ISWA 5FOOA 2JFEX 1ISVA 4NSBA 2ZUTA 3K4DA 4UQ9A 3WH7A 1UHVA 3ZQ9A 1NARA 3GBEA 4W5ZA 4GZJA 4GPNA 3AHYA 3EDKA 4AD0A 4OUEA 2QMKA 5GNYA 1FH9A 2EBNA 2PWGA 2Y4SA 3GH4A 3GNOA 3WNNA 2JALA 1X6LA 2O9RA 2VCBA 5CGTA 1NWUA 2D0HA 1D2KA 1HVQA 1R7OA 4U33A 3WMCA 5BXPA 5CPTA 1BLIA 4ATDA
chains in the Genus database with same CATH superfamily
3MB9A 3H8AA 1ZJAA 5AHEA 1NH6A 2QCMA 3PTQA 2J6XA 1TJ2A 2G5WA 1EKOA 2XIOA 1H61A 1G1YA 3W7HA 3SIZA 1FWTA 5EBAA 2C91A 1HO4A 2OELA 2VQUA 3QTPA 4XKYB 2HCVA 4DJFD 2X7VA 1V93A 1HKWA 4NNCA 2QPUA 1TVLA 5FL0A 2PDCA 1D8CA 4GUJA 2GGHA 2PLKA 1Q6LA 3ZLGA 3ICJA 4GBUA 1OJXA 1O5QA 2QAPA 2XPAA 2CESA 1Q6DA 2ZQUA 5HNUA 3NQ8A 3L65A 3STEA 3T2OA 2BHZA 3ATYA 1JRBA 3JYMA 1S2CA 4NYYA 3PNUA 4TIMA 5H1WA 3MY9A 4HIBA 3WJWA 1LP6A 1H1ZA 2GQAA 4PYSA 1ZPTA 5LKYA 5TQLA 3WUFA 1D7HA 2GJRA 2I5QA 3K4WA 5ECVA 2MLZA 1M03A 4C1NA 4C6EA 2INZA 2INFA 3WDJA 1Z6KA 3P6LA 1NDVA 4IMAA 5U4NA 3VM5A 3BLOA 2E9LA 4R85A 2Z1KA 3NSMA 4V27A 3L4XA 4KCWA 1HFBA 1XCXA 7CGTA 4IXHA 2QV4A 3RN6A 2JF7A 4Z1BA 4O2TA 4IXXA 3SQMA 3O5OA 1FD9A 4EPDC 3KL3A 1XIFA 2W66A 4I3GA 5LZLA 2DU2A 2Z2BA 5HR6A 1MW3A 4IPPA 2BV9A 2ZIDA 2A6NA 3WMSA 3W84A 1W0MA 3OQ8A 4L9YA 2ZTKA 4BS0A 3P0WA 1N8IA 4JTUA 2XISA 1C7TA 1OF8A 2PA6A 3COTA 1XH0A 1QNVA 4DT4A 3IWPA 2NQJA 4MB4A 1OCNA 1LT8A 2FDMA 3WJXA 3W24A 4U3CA 1XX1A 1X1OA 4J4KA 4E4UA 3BCJA 4JXCA 1XICA 2ZZ3A 1NU5A 4JTTA 2O9OA 1POKA 3S1XA 5HQLA 2GVJA 1IQ8A 3PZVA 4IQ2A 2W63A 1SO4A 3O5DA 4XZNX 3KUMA 4TW6A 5CPMA 1YTKA 4FA3A 4W85A 3TC6A 1NQ6A 3ARUA 1ROUA 3TJXA 1EXBA 1YYAA 3PZNA 2CLOA 3PPHA 4JEQA 2R91A 4J3TA 3ZR4A 3CNYA 5FEXA 3LS9A 1VS1A 2FB2A 1WOAA 3ABXA 1HTIA 4X22A 4Z2IA 2A3HA 4UWMA 1SMAA 4XAKA 4AFYA 2VEGA 1ROTA 3E49A 3TTEA 3V18A 3JVAA 2F23A 4TX8A 1W31A 2I16A 2HS6A 3EGJA 4XZWA 2POTA 1NWSA 1FWGC 1W17A 1VBJA 2X16A 4AHOA 3WD1A 4L1WA 3W88A 1L8NA 2BMBA 4JFUA 4F9DA 4H9XA 1NM9A 1GVQA 3FVDA 4LH8A 1F7BA 4QS6A 4EWND 5LSMA 1MQQA 3EDDA 1K4HA 2RGLA 3GC5A 3WUGA 3B9DA 3QQWA 2BVYA 3JS3A 1DIKA 5BYWA 3KAGA 3MCOA 3WQVA 1H09A 1ZJHA 4J3WA 4AD5A 3PSWA 4ZO6A 4DIAA 4IMCA 3A4WA 4IIBA 4JYSA 1DWHM 3N25A 4FIRA 4P8UA 4GIVA 2YDRA 1E44A 4CD8A 4DJDC 1SFSA 4WD0A 5CAKA 3OVQA 2Z1BA 4QCFA 1TREA 3AYSA 4MM1A 4O19A 1FFRA 1XYLA 5M17A 3WMLA 4X0NA 3P8JA 4XAPA 4KGJA 2KGJA 3P3BA 5A6LA 2G41A 1WX0A 3ZO9A 1AW5A 4AZCB 4HSHA 3OLDA 4MWAB 1PPIA 1GOIA 1FKJA 1YNPA 1XBVA 4IT1A 4Q7NA 2OZTA 3M5VA 3W1UA 3ZT7A 1IYXA 1DYSA 4ADTA 3S1WA 4NUWA 3H2AA 3CAVA 3ZVHA 1W1VA 4HHLA 2WVVA 3B9NA 2WV8A 1IZCA 4ZPVR 1J0IA 3WMBA 1MEWA 2Z29A 4XISA 3AJ7A 1R30A 2J24A 5IXEA 1W56A 3F2BA 5H2ZA 3RLHA 4GINA 3SCNA 4IIEA 4PTMA 2WLYA 4AUBA 4JD4A 1FAPA 3L2LA 1HJWA 4LY8A 2ZXQA 4DJEA 3L7RA 4PMVA 3EA3A 1VFUA 1FWSA 3TQKA 1P0EA 4JIEA 3W7EA 1TWSA 4MPQA 4GGQA 3H55A 3LGGA 1JG9A 3VKBA 3GIYA 5K7JA 4BWLA 2C8NA 3VTRA 1R9HA 6TAAA 1RP9A 4UTJA 3TJIA 4QDPA 3VD9A 4ADUA 3I6EA 2VENA 3UZ5A 3CWOX 4XTDA 4PMZA 4QDWA 2ZA3A 4MAVA 5E9AA 4MB1A 1F2JA 3P7YA 2Y78A 4K7YA 4F48A 1ICSA 3CEUA 3B7XA 3IUHA 1WPCA 4ICMA 1I2NA 3NQ6A 2GLKA 4BHYA 5CSYA 3CEPA 2DIKA 3RM9A 1OY0A 1AQHA 2VDHA 1R87A 1FKXA 2XP4A 3AO0A 6TIMA 1OGSA 4YPJA 4JFIA 5HT1A 4AD3A 1HGWA 4LAYA 3KDOA 2RHGA 3RLUA 4JHOA 4ODKA 4LEQA 3IANA 3VD4A 1YDNA 3PF3A 1BGAA 1ZY9A 2NXGA 3M9YA 4FOJA 3SN0A 2MLXA 2H8ZA 2ZX8A 3R13A 3GFXA 2PU1A 1P0DA 2WC7A 4GOAA 1VBGA 2VUYA 5G4EA 4D6FA 3LBOA 5CC5A 4DI9A 1UR8A 2W6RA 3A24A 1UA7A 4HNTA 1EQCA 1ONRA 4HN8A 1XIGA 1BYBA 3MP3A 3MJYA 4PRTA 5LNSA 3BOFA 1S5VA 1OFDA 5L9FA 2YYTA 4ZO9A 5FEWA 4KEZA 2PGFA 1QNOA 4S23A 2ZC1A 4WLCA 5ECUA 1TV5A 4QDMA 3WNMA 4C6IA 5AYXA 2QV5A 3LRKA 1R7AA 3A13A 3H54A 1OD8A 2HNEA 3R1ZA 2I17A 3S1VA 1HKMA 1Q63A 5IOBA 3N17A 4AVNA 5EGRA 1QASA 4P5UA 4PSPA 1VF8A 4PL1A 3L2IA 5G1TA 3SJ3A 3EOUA 4ZZ9A 1NDYA 3S5SA 1L9WA 3GVWA 3W28A 1KQYA 2QIWA 2PZNA 4D6DA 2ABBA 4ZO8A 3CQJA 2KO7A 1G7VA 3NZQA 4GGBA 2NQZA 4OBTA 4ZB2A 3VIKA 2O4QA 3KL5A 5DANA 3WEMA 4A3HA 3I3EA 5HWCA 1LYXA 3BDKA 1ZP3A 4RKAA 3VNIA 1TTPA 3M1ZA 3N6QA 4BI5A 1TCOC 2PFHA 3GLCA 3MKVA 3URQA 1HZYA 4XG1A 2VVNA 4KMQA 4FP1A 4MUPA 1VPQA 1HJVA 4DO6A 3A4AA 4MIMA 4O1FA 3IJDA 4ZODA 4I6VA 3LZ3A 5CZ0A 1E1CA 2HVMA 1W91A 3M5XA 3HG2A 2V67A 1BXNA 1TTIA 2VZUA 2ZR6A 4G2PA 1S46A 2A21A 3W75A 5A6JA 1PE1A 2SFPA 3QHOA 2E6FA 3I6CA 3C8NA 1XYMA 2VC6A 3GHTA 4A8LA 2VCDA 2V5KA 4S3BA 1R85A 4XV0A 4DAFA 3NQEA 4M81A 3GKAA 2CPUA 3CV1A 3FK4A 2ZICA 2JF6A 3CK5A 1W1ZA 3SUWA 3LV6A 3PPFA 3U4AA 4KESA 3UXAA 1V3HA 4C6OA 2OZ8A 1U1JA 4IUGA 4GISA 5FJRA 3LYEA 5I3GA 4NAFB 4IJBA 1UKPA 2IXUA 3TWBA 3QQ1A 4FN2A 2UY5A 1FWJC 3U57A 4LUYA 2CBVA 1F4HA 2MLYA 1X1ZA 3QTGA 2PTZA 4Z1DA 2EF9A 1C29A 3FDKA 3TN4A 1VCFA 2J7GA 4KWVA 1QW9A 3IKGA 4M19A 3DHPA 4KT2A 2B5UB 5EYWA 5I3DA 4WGXA 2XPBA 3QSTA 2Y5JA 3WF0A 3W6YA 4D6CA 4N02A 3XIMA 2EAWA 2XWEA 4XAYA 3BW4A 1TPUA 3POHA 3CO4A 5LNWA 4GC4A 1UUOA 2B81A 2P0IA 4L72B 3B9AA 2J6VA 5C9XA 4BF9A 3EPMA 4ODRA 3S8HA 4LFYA 4PB5A 3WIJA 2GDQA 2PDUA 3DFSA 3I68A 1HP4A 3NPXA 4RE2A 3WEOA 3BANA 4GVFA 4PMDA 4D72A 3WD2A 4A35A 1ZNNA 1CB7B 3APTA 1V03A 2OGYA 1SZGA 3LENA 4GZEA 2VD9A 3C0SA 4MUZA 1UCWA 1CPUA 3PJUA 1UKSA 1IWAA 4YNGA 3KOFA 3APYA 1JUKA 4HJFA 3TTSA 5MKGA 3UA4A 1B54A 1SZRA 2XPKA 3M7SA 1X7IA 2WK2A 2ZRUA 1J01A 3PJTA 6ALDA 2GVLA 1SZEA 3C3UA 4DUVA 4Q6XA 3LQGA 4R7WA 1TSIA 1KFWA 2XWDA 4MJMA 3A5FA 3WDQA 3WZ0E 4IM4A 5LIUX 3N6JA 3PAOA 2PGWA 2MNTA 1F73A 4JCMA 1Q6OA 1LRQA 4XD3A 2PV2A 4NRRA 1O5XA 2EKCA 3TAKA 2X42A 3VKAA 1P43A 1JZ7A 3VKKA 2F2DA 4XD5A 4GH3A 4UFJA 4YVXA 3UXIA 2WMIB 1RK6A 4HU3A 4EF9A 4PMQA 4J3UA 1KM2A 1L6YA 1W9VA 1Z8AA 1PSCA 4BI6A 4ZSUA 1HVXA 2FZDA 3ABQA 2VTFA 3QSRA 4L1XA 1W37A 1BSLA 3PANA 2IQDA 3FJ4A 2XIIA 3OGVA 3S2LA 2HS8A 1UR4A 2RDUA 2D2OA 4DPQA 2E25A 3OA3A 5AHNA 5I00A 4EE9A 5DCEA 5C71A 1XUUA 2V3FA 1EUNA 1WB0A 4DIPA 4JFWA 1WDDA 3HURA 4E2DA 3W74A 2VURA 4GIRA 5DELA 6REQA 4GY0A 3GTFA 4QQ3A 5HWBA 5KITA 2BVDA 2WJZA 4DPPA 1RD6A 4Q4MA 2P4VA 3RMEA 1REQA 1LCOA 2Y2WA 4DRMA 1QOPA 4DI8A 4LBUA 4G8TA 4FXSA 1YBQB 2F6UA 1EJ7L 2CERA 2CXGA 5I23A 3AIUA 3PS7A 1CYGA 1UQYA 2HWGA 1FY6A 3ITVA 1UD6A 3MI2A 2JE8A 4KIRA 3L9CA 2G0WA 1E6QM 4YWIA 4YCOA 4ICNA 2G4FA 1XQLA 2FH6A 3W4RA 4A8IA 5FA5A 1QUMA 2YL6A 4FR6A 4J28A 1C90A 1XYZA 1ONXA 1D7FA 3ARXA 2F2HA 1LORA 4WOZA 2VKZG 3A3HA 3B4YA 1GNXA 2HISA 2Q02A 1EPVA 4AY7A 3YPIA 4GACA 3ZFHA 1XINA 2ASHA 2C0HA 4LF1A 4ROQA 1CGWA 4UTTA 1F76A 1H0GA 4KIEA 4QT3A 1GUVA 3UF8A 4OBRA 3B0YA 4RL3A 3VFLA 2VXNA 1RQBA 4DWSC 2CNCA 2QCHA 1Y5WA 4NHVA 1SPQA 3UWVA 4AD2A 1GKQA 4JN8A 4MVAA 3T0CA 4EPKA 1UZDA 3DGRA 5KETA 5A2BA 4EOUA 2DSVA 1A47A 3V4BA 1E4NA 1A80A 2IF4A 4QJ3B 5ABGA 1DE5A 5F2GA 5HBFA 2VL4A 3N14A 1UBSA 4NX0A 3WFLA 2VEPA 4GMEA 2Q8ZA 3WH9A 4AB4A 4Z1CA 1XXXA 3WG6A 5HXMA 1GORA 3C6CA 2PPGA 4J1OA 4S3DA 1FKDA 1TPFA 1V6UA 3VAVA 3R7MA 3VD5A 2FFCA 3SCSA 2I14A 4N6FA 5CPLA 1L2UA 3QLLA 1UMLA 3NSXA 3EWXA 3OP2A 3UPBA 2PWDA 1EO5A 2E8YA 3UEQA 1ZHAA 3N9KA 3TDBA 2G3NA 4XUGA 5XIAA 4GO9A 3ODKA 2YX0A 3SRDA 4JFJA 1U83A 3F2DA 1VYRA 4F0MA 1I8JA 3WQ8A 4MJZA 4ITZA 4E5TA 3B4UA 1VFFA 2XN2A 3DENA 1GZGA 3UJEA 1O60A 1QOQA 3LSCA 4U86A 3WQFA 2YZRA 4CCZA 2PDXA 4UUIA 4KRUA 3GG8A 3VNKA 3LBCA 3IIZA 2W5FA 4RZ4A 1S3HA 4HN4A 3SCTA 3VFCA 3N3TA 1FXPA 1XGZA 4FAMA 4JQ1A 3BLPX 1H0IA 4WY0A 2QF8A 4JGDA 2VC5A 3W87A 1KB3A 5CZTA 3RHGA 1CT5A 2CLIA 1YPXA 2XINA 3EPOA 4NNBA 4M82A 3P60A 4TXEA 4OOUA 4DVOA 3CZGA 2VEIA 1XIHA 4ERIA 2BTMA 3TQPA 3GAKA 4KWWA 2RFGA 3BG3A 1FJDA 2Y63A 4W89A 4GIYA 4GC3A 4D6JA 5BU6A 1H51A 3P5YA 3DHDA 1QZ2A 4O18A 4PC8A 4KFPA 1OGGA 3QXBA 1IIGA 3W9ZA 4S3AA 2NSXA 4I9JA 3EWZA 1HIZA 3LU2A 3VMPA 4AZBA 3B06A 4MJ2A 3ARPA 4PULA 2BXZA 2YLLA 4XKMA 3B97A 4H04A 3L5MA 4WKFA 5CC7A 3KZPA 1W1YA 1F6KA 1GVSA 5T26A 4LV4A 1T41A 1XIDA 2EQDA 3SGGA 2W0UA 1DOSA 3W1QA 5F2MA 1E43A 3IARA 4GVGA 2H90A 5A94A 4YTUA 2X8RA 4Q8OA 2J27A 3UNTA 2OSYA 4K38A 3GDLA 1HF6A 3WH8A 3VUSA 1TTJA 1UWTA 4TV5A 4LTSA 2H8XA 2XIQA 4RR4A 4DRKA 1YW1A 4DZHA 2Q5AA 4REQB 1A3HA 3LRLA 1BF6A 3M64A 3N9SA 1T8QA 2C3ZA 4HK5A 1X98A 2YFOA 3AXKA 4IMGA 4HCLA 4ZFCA 3OHIA 5I77A 5K4ZA 3J7HA 2B7NA 2UV8G 5BXSA 3LB0A 4B90A 5AFDA 1GQNA 1XD1A 2C1GA 1TA3B 2Y8UA 4S39A 2NT1A 2QJGA 3VU2A 4ODPA 3PM6A 1V79A 1CDGA 3W6LA 4TTGA 4FXRA 5JIWA 1YXDA 2X40A 5A6AA 1YTEA 4ODQA 4CD5A 3WK3A 1QPLA 5I79A 2WHJA 5F4SA 3RG6A 1K9TA 2PGRA 5A5WA 2ZRWA 3CAKA 3VD3A 4RPPA 2OG9A 3IIOA 2WNWA 1K4GA 3GNNA 2YL8A 1SFLA 4JQAA 4US6A 5A8GA 3VZZA 3UFYA 3BWWA 2IKHA 5MHBA 1QNPA 1TIWA 4HGXA 2A1YA 2WMKA 3DG3A 2ZKMX 4R34A 4L65A 1RALA 3TYDA 1JCMP 1J4HA 4AG0A 1CWYA 3WBWA 2E1DA 1B57A 1ITQA 3WDPP 3RPMA 4DB7A 3TR2A 5FJJA 2FPYA 3PY2A 3DI1A 4CQCA 3CV7A 1BYAA 2OEKA 1U5JA 1I2OA 2IS7A 5I78A 4R0XA 5I2UA 4H8UA 5C9ZA 4UTLA 4XVDA 3TW9A 2WO5A 4CVUA 3DU0A 1B6CA 2IKGA 4C6MA 1DORA 3SFKA 3UVIA 2CXEA 1OABA 3SN4A 4EP8C 4Q8TA 1VRXA 1WDPA 1U22A 3T7VA 1NMVA 2Z6IA 1NDZA 3OIHA 4A4AA 3QPYA 1WZLA 3WLPA 2OTDA 4MKVA 3SIMA 3QR3A 1P0BA 4UFLA 3W1MA 3AIBA 1K6WA 4FLRA 3WNLA 3PAJA 4DN1A 3TKFA 1IT8A 4QX4A 3OYXA 2YA0A 1QI5A 4IISA 2P3ZA 2P53A 2I1OA 4HTBA 1XDLA 4M24A 2PTYA 4UTIA 3NZ1A 1XPYA 4BF5A 2YBVA 2RUQA 8RUCA 2WPGA 4O54A 3B9EA 5JH1A 4POCA 3VIJA 3DI0A 4ZOBA 1PVNA 1TUXA 5HANA 3PWGA 5FF3A 4WIWA 1NELA 3CAQA 3QZ6A 1D3CA 5BOEA 2UWFA 1L6WA 1JQXA 2V2DA 2DZPA 4GXMA 1IZKA 3W81A 1J18A 2IQ0A 4A05A 3PBVA 4M6VA 2PPNA 3TQVA 3SCUA 3NQBA 1K9DA 2CU0A 1GJWA 3W2LA 1E9YB 3IIVA 4INFA 3U2CA 1JAKA 5E6YA 4GNVA 1US2A 1J0KA 2HK1A 1HX0A 1P4CA 4ACZB 1YQ2A 4LBRA 2BASA 4AQLA 1G9HA 1AH3A 2QCDA 3VGDA 4PMJA 3E0LA 1ADDA 4U84A 3STPA 5FAJA 1D9EA 1S5MA 2RDTA 3O7UA 3S9ZA 4BEUA 1MQPA 1JCXA 4HP5A 2PTDA 2Y7EA 1PIIA 2WZMA 3DCPA 3M0ZA 5MF5A 4O53A 4LRTA 3EB3A 3HQOA 5C70A 1LL7A 4JFTA 4KFOA 4QR6A 1QI3A 4LJ3A 3S5ZA 3FV9A 1AMKA 2CLMA 3RIKA 2IQTA 3PZ9A 4ADSA 3OZYA 4G2DA 4TUFA 1UPMB 4BQ3A 3RJXA 4L3NA 3O5QA 1ISXA 1FWNA 3GFYA 4JKLA 3EWWA 2AKZA 3GR8A 1MFVA 4ZPWR 5H6HA 3AAMA 1GVFA 1FKLA 1GJPA 1K9FA 3CGTA 3W01A 3RO8A 4V28A 3G3MA 3UZXA 4JDYA 4OWGA 3G1AA 4MNJA 2G4JA 4DQWA 3TOPA 3N13A 3LUOA 1K8YA 2Z00A 1Q8AA 4I9MA 3TONA 2XM2A 1RLDA 1ONWA 3MTWA 2DG3A 3MJMA 3U0HA 4LWWA 5XINA 4IT4A 4HARA 2NQHA 3U5YA 4XTIA 2WXDM 3UXLA 3E3HA 1Z41A 1R2SA 2PCQA 4NQ1A 1DPMA 1QBBA 3NQ7A 1MDLA 3C2FA 1R3YA 1M7XA 1DWJM 1QPOA 1H49A 3NVDA 2VP8A 2WQDA 4UQBA 5IHRA 2JKAA 4KERA 5CPQA 3QFEA 3AXXA 2F6KA 2NUWA 1XP3A 1GVOA 4M7TA 1P6CA 4UOZA 3CQIA 3RR1A 4GNKB 5F1UA 3MZ2A 3NSNA 2IKJA 5CXPA 2HSAA 1SJCA 4JS3A 1WZKA 4DLMA 4DBWA 2OXNA 2XP9A 3AUOA 2YA2A 3EDEA 3SRHA 2CIPA 1EGZA 3OGRA 3UPMA 1BVWA 2A5HA 5C9WA 2XH0A 2ZBTA 4HHMA 3BJSA 1GVEA 3MVTA 1JZ5A 3JU2A 5D38A 1PXGA 1JI2A 4O1CA 1SZFA 1M5YA 4N9DA 4PCNA 2GJPA 1FWCC 3B8TA 3SURA 2IPWA 1DJHA 3AS2A 3EWYA 3LN3A 1VCGA 1EYWA 1S5NA 3SB0A 2WM0A 1E40A 4TQTA 3EX6A 4BKNA 1QATA 1A5CA 2AL2A 3LLFA 2GOUA 1G67A 1DWAM 3EX1A 1B90A 1RBAA 2L5HA 2CLEA 3MSDA 3G1HA 1FKRA 1SW3A 3LCIA 5KSWA 4O52A 4Y8EA 2GJXA 5CQ1A 3NZPA 3W2JA 5BMWA 3PB0A 1WP6A 7REQB 4Q8MA 4KPLA 2YB4A 2V9DA 2PCEA 3BGJA 1D7IA 4Y90A 3C56A 1RSCA 5H8UA 8XIAA 1VBUA 1BYDA 2V5CA 4YU1A 3KVMA 1CW2A 2INEA 2PLJA 5AHLA 1LWIA 1B3ZA 1TTQA 4AZGA 2PLMA 4O17A 3VYLA 4M80A 4GWEA 3WH6A 1FH7A 1A4LA 2RSEA 1FHVA 1GOOA 4AC1X 4C91A 2R94A 1JEZA 4H8VA 1QR7A 5HKGA 3SI9A 1U1UA 3LY0A 3CLMA 4LNYA 3DFNA 1R46A 1SO6A 3IJIA 3TYZA 3LM7A 4NKCA 3B8SA 4J3SA 2R82A 1C8VA 3V1PA 3N1AA 3G2GA 4GFSA 3W27A 2YBUA 4FNTA 4MNMA 1TJRA 4DYEA 4MKSA 3NEVA 4OJYA 2E67A 3JZUA 3IAQA 4YWSA 2CC0A 2FPVA 3GTXA 1KRCC 4N4QA 2E4TA 2NX1A 3K30A 2RJHA 3CC1A 2Y85A 3K4DA 4UQ9A 4ZVJA 2NX3A 1NARA 3QZEA 5HNRA 4FNQA 3EDKA 3RCYA 1XYBA 5C5YA 3GNOA 1BL4A 1PKMA 4GQ0A 3TX9A 3TXZA 3M0IA 3QN3A 3BARA 5CGTA 1NWUA 3UW6A 3LSBA 1DKWA 1D2KA 1R7OA 3SECA 5BXPA 5CPTA 1BLIA 1QK0A 3NQCA 4ATDA 4LV9A 1CX9A 3NOYA 1FTXA 2OEMA 4A3UA 3GS6A 1A5MC 4BI7A 3FDGA 2VI0A 4CQAA 3TJLA 3U2EA 1IWBA 1SUXA 1ZALA 2A79A 4OKDA 3WBYA 4JFVA 3EB4A 4C7GA 3HJZA 1G7UA 4RX0A 2PU0A 4ML4A 1A0DA 1I1XA 4RNIA 5CC3A 3GU9A 5JH2A 2XSAA 2P5NA 1S2WA 2XGIA 1EOMA 2NUYA 1FA2A 3DC8A 4M7SA 4GQGA 1OADA 3P93A 1D3GA 4AIBA 4MPKA 4DAIA 2FHFA 2DW6A 1EA0A 4WJ8A 3W25A 4LRSA 1I6NA 3FSTA 3WDIA 4HNNA 4F79A 5GPGA 2NLIA 5G1MA 1PTGA 2XVNA 3KBNA 3M47A 2J7DA 4F2BA 1E3XA 4GO8A 6REQB 3AS1A 2XFRA 3VM7A 2PMQA 5LA1A 3F7JA 4GYPC 1NF7A 1JFXA 5G2IA 2UY4A 2X1IA 4UTKA 4IGMA 4IPXA 2Z1SA 1SM9A 2PRHA 4QP0A 5ABEA 4L9XA 1REQB 3DAQA 2X09A 4V15A 3M6YA 3D6NA 4HNCA 4H9VA 3UZJA 3THQA 4JHMA 2KX9A 3QGKC 3EDFA 1Y7VA 2HZGA 2PC4A 3IV3A 3UR2A 3UG5A 1KFEA 4U5KA 2XGZA 1AD1A 1XIJA 4XZLX 4FNPA 1PZ3A 3KM8A 5CLWA 1EYMA 2DH3A 1XDMA 1KM5A 1VEOA 4DO4A 3BZJA 4K68A 2AKMA 1ZL1A 3DIPA 4OVXA 1Z7AA 3OB8A 3LGDA 4C6DA 5EB8A 2E6AA 1HKJA 3BH4A 4HCHA 2YXXA 3SUUA 2YGYA 3AHVA 3CZ8A 5DXXA 2WMJA 2LKNA 2DG4A 1RJPA 4WZHA 1Q8JA 4NJGA 4PEKA 2YXOA 4HMDA 5LNUA 4GNJA 3BZGA 1WKDA 5HPCA 4HT3A 2C6QA 2WMFA 3EKLA 4Z42C 1UP3A 4Q32A 3U48A 4ACYA 1L6GA 1UP0A 3RGCA 2UBPC 1HL8A 4FLQA 4YVVA 1QAPA 4DUWA 1TR9A 1ZTVA 3I6RA 3OO2A 4U5IA 1SMDA 3GZ3A 4PCFA 3KHDA 5LHEA 1TFVA 3L4VA 1H5VA 2VCAA 1FCQA 4GK8A 1NY1A 3I7SA 4H2CA 2VOMA 3R8RA 3TA9A 3TUUA 1EOKA 3VDAA 4N4PA 4Y9OA 5E0FA 1GOWA 1G5AA 4ERAA 3L5LA 2NV2A 1G01A 2H3BA 3BCFA 5E0KA 1DTUA 2B7PA 4LVDA 3QEZA 2GK1A 3IAPA 4HA3A 3ME3A 3GDBA 2DZBA 2QGHA 3RXZA 3MUCA 1QPFA 3D46A 3BMVA 4S2BA 4B3LA 5BXTA 2VR5A 4HZMA 3RUBL 1VAHA 2E8ZA 2WLZA 5J5DA 1EWDA 1WXJA 4AWUA 1YDOA 2C7FA 1IEXA 2Q8LA 4IP4A 3GU1A 2PDQA 2PPPA 2Y1HA 3RAOA 2ACUA 3BICA 4S3EA 4WRHA 3B0PA 3VE9A 1M41A 3SM0A 2EGZA 1CLKA 2J25A 2C79A 3PZUA 3I4KA 1LDCA 1KCXA 3HPXA 3G22A 1C91A 3Q45A 3CBWA 3UCCA 3OHMB 3WQ5A 1JIBA 4OTKA 4NRSA 2ZZ4A 4B3KA 2DZUA 4C6BA 4HU0A 2GQ9A 4PCSA 3FGCB 3BGAA 3N34A 1JL8A 5DBUA 2JBMA 3R0UA 1P6WA 3VI2A 3GC2A 3KLKA 3UJRA 1DQWA 3CB3A 3I3BA 3KRSA 4RDYA 4MZ1A 1B9ZA 1PDYA 2YFNA 1KFLA 3NO1A 1IEWA 5FI8A 5GJNA 4GUHA 1TWWA 3FIGA 3MANA 3H9RB 1GEHA 2H9AA 2REQA 4F66A 4XAZA 4LUJA 2CZ5A 3CIVA 1ZFJA 1D7JA 4TNSA 3LCHA 1PX4A 1KT1A 1J4EA 3CPGA 4FF7A 3RPDA 1WDRA 5DQPA 1B3VA 1XYFA 4IJCA 3C5QA 1BTCA 5CG0A 6XIMA 5I3KA 2XP5A 3W37A 3CHVA 3MI3A 4IZGA 4J3VA 3JW7A 3VUPA 6ENLA 3BLLA 3CQKA 1WKYA 1I0BA 3V3WA 2DZWA 3ONBA 1OFRA 3C61A 3LG3A 1D3HA 4PSRA 3BLFA 2HBXA 3W7JA 3KWSA 5HJXA 4L56A 4JTLA 4JYDA 3F4WA 4O16A 5FF2A 2X0HA 2FYMA 2J88A 1JCHB 4ODNA 1RH9A 1W3HA 2D0FA 5DMYA 1WDWA 1KA9F 3IGHX 1NIUA 4HZ7A 2YKKA 3FA4A 3A3WA 3O5RA 4C6FA 2UY2A 1IGSA 2QMJA 1XRFA 3VPLA 2DVXA 2P8CA 3G0UA 2PC8A 5EMKA 1FWWA 2MANA 2QCNA 2XIJA 3TH6A 5LHFA 2EPOA 3MO7A 4R27A 4HOWA 5TD4A 3C3NA 4AF0B 2ZFAA 1A7XA 4D8LA 2DZSA 3A47A 1C9WA 1G4TA 3VKCA 1PJ9A 4AX6A 1JZ2A 3W0KA 3R6IA 2XFYA 4R9OA 4PUDA 5A69A 4H9ZA 4QE1A 4C02B 4I7WA 3PWIA 5GQBA 4MB3A 3WQ6A 3L68A 5FJUA 3IJLA 4WSHA 2TYSA 4PTNA 3VIIA 2DT3A 4RE3A 3AICA 3LRMA 4WSKA 3ALFA 1RJRA 2Y6ZA 4Z2JA 4QIBA 1T0OA 2ZZ7A 3NJ3A 1CECA 3UA3A 1ONEA 4IL0A 1UD5A 5B7YA 3HB9A 2PDGA 2XTKA 4DWSB 1VJZA 3NCOA 1HJUA 3GUWA 3KWXA 2BOGX 1OBAA 2A4AA 3H12A 3T0BA 3G3DA 1GPFA 3VKDA 5LXEA 4OFCA 1A5KC 3CIXA 3REQA 3KTCA 4PMYA 4TOQA 4IP5A 2ESCA 4Z2LA 1A53A 4Z1AA 4IFRA 1DJIA 3EKGA 3F5KA 2EKGA 1DIEA 1PAMA 2VEFA 1LQAA 4JN7A 1VBHA 2XVPA 3FJLA 4JNYA 1P5BA 1WUEA 1KLZA 3V5CA 3DEQA 1QHPA 4L4PA 2PPOA 3B8IA 5C9UA 1W32A 3VOFA 3DHUA 3T08A 1N8FA 4S38A 3MHFA 4GYKA 1OCBA 4JBRA 3GXMA 1B2YA 1GK8A 3GVRA 3UVAA 1X1NA 3TCSA 4E2BA 1FWEC 5HJLA 5M5DA 2OYLA 4O4WA 4XD4A 4A8NA 1KR0A 2I7GA 5DY2A 1BKHA 4F0LA 1O5RA 1MUWA 4YHEA 4LAMA 5CGMA 3OBEA 2VEMA 1A3XA 1EWEA 3IK4A 5A2AA 4W8LA 3MUZ1 3DESA 2FAPA 1RQEA 3G77A 2A3EA 4EX4A 5IFPA 1Q7MA 1VH7A 3GH7A 4FR1A 3R5EA 4BFAA 3BCDA 4CD4A 1PDZA 3KAOA 5D02A 1MEHA 3QOKA 4OUIA 2GUBA 2PBGA 2W4XA 1EJSC 4H7CA 4JY8A 3G1FA 1M01A 1HJSA 4RNJA 5E70A 4JX6A 5FF0A 1Y5XA 3TW6A 1XLEA 3S4TA 3T2PA 1GT8A 1RD5A 4EWJA 3KABA 4J4NA 1TR1A 1RV8A 5C2GA 3WF4A 4ZQOA 1EFZA 2TMDA 3GYCA 2HVOA 1EBHA 3AYVA 4LUSA 1WNOA 1MRQA 1MWOA 4DM2A 4UQCA 2AGKA 4O0KA 2LPVA 5CBJA 1KM1A 2V63A 4AWEA 3GIPA 3RRAA 4CU7A 4X3ZA 1XRSA 2CHRA 3WK0A 1HKIA 4D9PA 3F03K 4EXQA 2LJ4A 3WD3A 3LHTA 2YL9A 4DYJA 1UWRA 4ZTYA 4FXJA 3LI1A 5CGQA 3O6YX 1Q3NA 4W8BA 2Y62A 4Y9MA 3C2VA 2NT0A 3W7PA 3BAKA 3WLIA 3R2GA 1R3QA 1GVRA 1KTNA 1WZMA 2VOTA 2VWSA 2VT0A 1Q7QA 1DJQA 4YYFA 4GI4A 3SUSA 5F2LA 5D2TA 2HROA 3W1TA 3H7UA 4NP7A 3AU6A 2Q71A 3U4FA 4H3DA 5GNZA 1GW9A 3GHSA 1FUYA 5FSDC 2Q01A 1J5TA 4DM1A 2HE8A 2VVSA 1OFPA 2Z7GA 4YTSA 1NF0A 1KRAC 3B40A 2ICSA 5I24A 5HINA 2X1RA 2YDSA 4QNEA 2DDXA 1E0WA 3WL1A 3LGEA 3N11A 2QULA 2BHYA 3H24A 1ML1A 1IV8A 2Y7FA 2HPIA 3HG5A 3ZYZA 3C4UA 1KM3A 3LMYA 1UBPC 1GYNA 4P8XA 3UJFA 4WKAA 3UNDA 3D0CA 4FLSA 5T9CE 3GXTA 4ILSA 1KQZA 1TX0A 5EY5A 5ENLA 1Q4NX 4AY1A 2G8ZA 3WK2A 2W91A 1UWIA 1K8ZA 4LW7A 4Y9NA 1KV5A 4HPXA 1HP5A 2M2AA 4DXXA 2DT0A 1CTNA 2XP3A 1XLFA 3KZ7A 5J8LA 4DELA 2QVNA 1BKSA 3M4HA 5AC4A 5FF4A 5AYIA 3L23A 4HNLA 3V36A 3VE7A 1FWBC 2VRKA 4PRWA 3IJ6A 5LGZA 3P8IA 3GTNA 1UD2A 1JDAA 3P80A 4DJFC 3IACA 2DUAA 4L64A 1L0PA 3TSBA 2OQHA 3CTLA 2P88A 2XU2A 2XYLA 4X2PA 2D69A 1A5NC 5LIYX 5C9RA 2DT1A 3W00A 3A64A 5A6BA 1LM1A 3H2MA 1C8XA 3MKKA 5H91A 3KS5A 4HJWA 3M0YA 3S6TA 5D8WA 2AMGA 2VC7A 1UQZA 4IG2B 3VX0A 5I3JA 3S6OA 1RAKA 1JJKA 4W7WA 4JTDA 4KBXA 1QPRA 1A5AA 3JXVA 3AXHA 1LBMA 5BOFA 5T9BG 4JKKA 4XZBA 5LA0A 4Q8VA 1DXEA 8A3HA 4W8AA 3NZRA 5BRPA 3QKZA 1BWLA 1OYCA 5FJOA 4R33A 1Z9AA 4WR3A 3TJ4A 1ICPA 2PDKA 3WLNA 3LXAA 3T42A 4FAPA 3W02A 4HB7A 1H41A 2G96A 1WCGA 1U5HA 1UJQA 3VK5A 3A4JA 2ON3A 3B8WA 4JKMA 1MDRA 3O6DA 3AIWA 3H23A 1WE5A 3UCDA 3MYPA 4PMUA 1NVMA 9CGTA 4PH6A 1KGWA 5ABFB 3BV4A 4L61A 3CMJA 4HYRA 4IICA 4E3VA 1LLWA 3AQUA 4XBSA 2YCLB 3CQHA 4C60A 2XN0A 3OLGA 1C8QA 3VIHA 2OFNA 4JIIX 3MMTA 3PZTA 1SO3A 3BJFA 4P61A 5AZ0A 3BAWA 3QYSA 2XZ7A 1E0UA 5CJNA 5TF0A 3F1QA 3ZR5A 1FKIA 1HKKA 5CC6A 1YPIA 3UF9A 4LS0A 4AISA 1S38A 4GUIA 2F61A 5I0DA 5AHMA 4OBSA 3KP0A 2VMFA 4OE7A 1PBKA 1K8CA 2XIBA 3GNRA 2GGIA 1XI3A 4P8VA 2D9FA 1GGOA 4NILA 8CGTA 2A7NA 3APGA 5DIUA 2BODX 3WELA 3MVIA 4HPJA 1S39A 3T1GA 2FTPA 1F6YA 3CMFA 3KEHA 1ZENA 1BQGA 4AWTA 4L7ZA 3RU6A 5A6BD 3QM3A 3OBAA 1FWFC 5BOOA 1X38A 1SR9A 3WLLA 4MSPA 1B0IA 4AH7A 4D6GA 3O5KA 4R53A 5CAHA 2EG8A 3S42A 1KC7A 3G5EA 2M08A 5HWJA 2DSKA 1OT2A 3AMKA 2ALDA 2ZR5A 4WGHA 2YDQA 4AVFA 1GZ1A 3OTRA 4HOZA 5DCDA 4GIEA 1AH4A 4O15A 5HPOA 3E1F1 3W85A 2D3NA 5I3FA 7TAAA 2ZZ1A 1OHLA 4GD0A 3VMOA 4A29A 3IJ9A 3SCWA 1Q45A 5LIXX 1CXHA 3R89A 3U7VA 3MSGA 1XDJA 3MMDA 3E02A 3RM8A 2RH9A 3QMTA 3P74A 1UUQA 3L0KA 5FCZA 1RA5A 3A23A 3RLVA 5KZEA 3DN5A 1EP1A 3HPFA 5D2XA 1XLBA 2QDHA 3WN6A 2GDUA 1MI3A 1UH4A 1TCMA 3KVLA 3GQYA 3PWAA 1CZ1A 1DQXA 1E71M 2QYGA 3UWWA 4TR9A 1K6AA 2DQWA 3WQEA 3ZWTA 1XCWA 2O7SA 2F38A 4RV3A 3GD6A 4ZENA 4MAZA 1ALDA 4KH2A 3TLQA 3I7RA 1VB9A 2X2YA 2IW0A 5I3IA 2JIEA 3PRDA 4AW7A 4JICA 4UTFA 1EP3A 1TRIA 1VC4A 1KM0A 3NQMA 3VGBA 1EA9C 3PK7A 2HPMA 1RLCL 2Y61A 3UY8A 3KAIA 1EEXA 1V3IA 1CXFA 3IVSA 3CPUA 4XZMX 3KBJA 1ZUAX 2DUZA 4G7EB 3DYMA 4LS1A 3KBMA 2HE5A 3CUJA 2ZXAA 4FO4A 2C16A 3NGJA 3RPTA 1PX3A 2NZLA 3U2ZA 1SFTA 3EOOA 3DYPA 5BWAA 3PJXA 4U31A 3B0UX 1EUAA 2MF9A 4GI8A 5AY7A 4QLKA 4LAWA 1R2TA 3IJQA 2FZ9A 5CPNA 3M0HA 3W26A 4MF4A 3SCOA 4DZ5A 3FFSA 4N6EA 3GM8A 1RVGA 3A3XA 3M46A 4HPNA 1KM6A 1O6IA 2ZOXA 3CASA 1V0LA 4XBKA 2QLYA 3RR4A 3ABOA 5DIVA 1IT0A 4UZSA 3VIGA 5C7HA 3GNDA 1UWAA 1O1ZA 1XC4A 1U5VA 4NAEA 5FD0A 2NLYA 1RXOB 2R9RA 5BNKA 1DIOA 4JAWA 4LAVA 4EPEC 2NWSA 4XBJA 1DWFM 4MHBA 1YRRA 2YLAA 4W7VA 2PE4A 2WB5A 4WF7A 5A8OA 3R10A 1P6BA 3BLDA 5HNTA 1KRBC 4ODMA 1FKTA 1JNTA 1XCFA 4HA4A 4Q8QA 3EYPA 2I56A 4C6NA 2V68A 1BSIA 4Q8UA 5IHSA 2JKPA 4MDOA 3V16A 2F21A 5E09A 3BMXA 1TVPA 1UB3A 5DMLA 2XFWA 1PB0A 4B16A 1J9YA 3O5EA 2JEPA 1FKBA 3E0FA 4XZHA 1TX2A 4DX3A 4B3ZA 5A8NA 1O5KA 5AC5A 4KEUA 4UFMA 5AYZA 1FP8A 3WLSA 1XBYA 5U7SA 1QDSA 2DUXA 3M0LA 1VEPA 2WC4A 1NAL1 3AC0A 2Y8KA 1E72M 4MFDA 1EIBA 3PP7A 2PP1A 3AYRA 4U28A 4C7DA 3LHYA 4R9XA 5XIMA 4G56A 1XH1A 2WSKA 2CKRA 4FXFA 1WYIA 3TW7A 1YIXA 1K1DA 3L66A 1XPGA 1DWGM 3C0LA 3HQ1A 1MVYA 1BKFA 2Z25A 1WUFA 3DX5A 2RAGA 1XSKA 3NQAA 1F8IA 3WKZA 4DJEC 4U2YA 4GZ7A 2ZR4A 4MYAA 1A5UA 2Z28A 1OSEA 1E1EA 3VGHA 1MEIA 1JDDA 1OQFA 3BUVA 1AK5A 2D24A 1BGGA 1LRTA 1B30A 4BWLC 1UPPA 2MUCA 4IMFA 4I8DA 2PDHA 1Y65A 1T11A 1G4SA 5C8BB 3C0JA 2AOSA 2B0MA 4PZVA 5A2CA 1V02A 3FOKA 3FXYA 4NNAA 1W1IE 5BRQA 1JR1A 4H6QA 2PDIA 1UWQA 4AZHA 2H9AB 2REQB 4XZ9A 2PLCA 4V2XA 3K4AA 3K13A 1V77A 3WLMA 1Q2SA 4X9YA 2WSRA 2P1FA 3GTYX 3U3HA 4NF7A 2VGGA 3UERA 2D3LA 1DE6A 1ME7A 4WHBA 2WMGA 4HK7A 5FL1A 3FKRA 4IJRA 3G18A 3WJZA 2VR4A 3PN8A 4AHQA 3PR2A 5HUPA 1Q7ZA 1S2UA 2C13A 2Y24A 5M03A 3S1UA 4TVUA 2GVEA 3FEQA 3ZM8A 1GHRA 4XKYA 2ZRXA 1YTDA 3A21A 4FALA 3NA8A 3E12A 3FX4A 3H4XA 5HMDA 1RBOB 3CV2A 3G0SA 3MCMA 3UG4A 2F4EA 3AHXA 3FVMA 3GG7A 1OYBA 2D2GA 3O5FA 1ESWA 4RXFA 3LHWA 1HQTA 4LUTA 3RLGA 2C18A 3NL6A 3WD0A 4KCTA 1QPKA 4WDWA 1GVYA 3GSMA 3UZWA 5AECA 2ZZ5A 4HMNA 2OX4A 1O68A 4QG6A 1MRAA 2ZRZA 2WJFA 2GGJA 4UR8A 1FDZA 5HUOA 2VZSA 1K02A 3ARQA 2EPMX 4JCLA 2AGTA 2NWRA 3CUFA 3TCEA 4GG9A 2NUXA 2WMHA 2HTMA 3M41A 2OYMA 4ZOEA 4CCCA 4XO7A 3HG4A 1IZJA 5JBDA 4DEFA 1PX8A 1E15A 4P7NA 4DRQA 1XGDA 3R8HA 4ES4A 3E96A 4JYFA 3NI6A 4JTAA 3ARRA 2VGBA 4AXNA 1XLCA 1T7LA 2YOCA 4NZJA 4LY4A 3P14A 1YE6A 3MMWA 2LLEA 3A4XA 1T8XA 1QPQA 3HBLA 4GJJA 4JTGA 2PWHA 1ADOA 1F3TA 2NXHA 3DH7A 4AEFA 4XZIA 5AVHA 3EX3A 1EXPA 1ZBKA 3QVQA 4GY1A 1JI1A 4XAFA 3NXLA 2WZTA 1TPH1 3UQAA 3DFQA 2OVLA 2DSWA 2FHBA 3M5ZA 5CPOA 4W84A 1VLWA 3B9OA 3W22A 4HOXA 2QCCA 3K8KA 1E3ZA 2BWGA 1F61A 5T91A 1AJ0A 4MJ4A 2JKEA 1Y5VA 4GKLA 3REQB 1IEQA 3HOJA 4KS0A 2FMOA 3HPAA 2EPLX 1FWDC 3SY5A 1OFQA 3CJPA 3N3MA 4IFKA 4E4FA 1LOQA 3R8GA 3W7GA 3WDHA 2A0NA 4AWSA 1XKYA 1WAUA 3HA1A 4J9JA 5LIWX 1Q13A 2XUCA 3T55A 1YLVA 2XP7A 4UNLA 4V1YA 2DT2A 1KBJA 5KZMA 2IPGA 4QSHA 4YN5A 3LXBA 4Z2GA 5CCZA 4O57A 3VD7A 2E7FA 3ID7A 1YNYA 4AHPA 3FLUA 4IGNA 4OZOA 2P3EA 1R3SA 1Z32X 3MO4A 4J3XA 3ZWSA 4C6JA 1ITUA 2ZA2A 4P7QA 3V0SA 1Y0OA 1KO0A 3SEPA 4PUWA 3UPWA 4GGHA 1OC7A 5BXRA 3GR4A 1NQKA 4CVWA 1W3JA 4S2CA 2VN1A 4LAXA 4AD1A 3O5JA 1Y8BA 1E73M 1E55A 3WENA 3H4WA 1EYEA 6XIAA 4DZ3A 4F40A 1VFTA 1J0ZA 4QQUA 3NPVA 4O28A 2ZWYA 4PEEA 1W3LA 1US0A 1NP2A 3LBMA 3KTSA 2ODOA 3B05A 3L0NA 5CSSA 3URBA 2ZE0A 4KQZA 3B04A 3UI5A 3PULA 4UTWA 3VCNA 1JYWA 2G97A 4LYRA 2R1LA 3MSYA 4QIUA 1WQ5A 3TQ0A 2CWNA 1YXCA 5A6TC 2MPHA 1FRBA 2XH7A 1FHUA 3F4VA 1EDQA 3S2CA 2QF7A 1I2QA 1TPB1 3NQ2A 3WH0A 3THUA 1D7KA 3W7IA 2X41A 3NRKA 1DTNA 4LUSB 1M68A 2X1SA 1KBKA 4Q4RA 3G1RA 1I0DA 3W7DA 3GTHA 1LBLA 2ZTJA 1TZ9A 3W3OA 4DBEA 3PTDA 4C65A 2W67A 4M0XA 2BS9A 3UWUA 4G1KA 5AHFA 4IQJA 1OFBA 3MP5A 1UOZA 2J7BA 4MWAA 1J2WA 1ZB5A 1N8WA 1R6WA 3CWNA 2WVTA 4CUCA 3URNA 3KFTA 1E70M 4Q8PA 2QR6A 2J7FA 1BVNP 1ISZA 2GSEA 4Y8FA 3VIFA 3AIVA 2YIHA 1XYCA 2VC9A 3U6WA 4RDWA 5DY3A 1I60A 1KFCA 4B4FA 2WVSA 2Z24A 1WBHA 3V7PA 3L4ZA 3IGSA 3TWAA 4C1LA 1ME8A 1G6CA 5DRIA 3I3DA 1UA3A 4YLWA 3ARTA 2PF0A 5LYRA 2IXVA 2CETA 1T96A 1FCVA 1NSJA 2BVTA 3PC0A 3CL8A 5TAOA 3DHFA 1NEYA 1A0CA 4QZVB 2WZHA 3QRHA 4HKPA 4DJED 2OPJA 1GW1A 1R3VA 1GKPA 1ECEA 4WXYA 2XVKA 1QWGA 4JNZA 4TU1A 1LG2A 4BQ4A 1KFBA 3NVTA 4JFKA 5FEZA 2DORA 4XIAA 2ZUTA 3UZZA 3PNZA 3ABZA 2OQLA 4DRNA 1UHVA 5D03A 3ZQ9A 3GBEA 4W5ZA 3NZGA 1IR1A 3HFTA 1LUCB 1Q5MA 4YYCA 2F9RA 2O0TA 4OUEA 4NJKA 4AD0A 2J9ZA 1W3IA 2Y4SA 4HYWA 2YW4A 4Z08A 2X30A 5J5RA 5HW7A 2JALA 2O9RA 4WDUA 3I65A 4DNHA 1EF2A 1JPHA 4N2YA 1UZ4A 2FZMA 3WQGA 2KR7A 5D09A 1VFMA 3DERA 1V6WA 1WO2A 2PDLA 5E9XA 1EB3A 3MQTA 4FLOA 1FQ0A 1SSGA 2V8ZA 2YSWA 3SY1A 1XBZA 1BF2A 1GKRA 3MW7A 6CGTA 1J10A 2QEZA 3ITYA 1M5WA 2PDYA 4MWAD 1AQ0A 4K7VA 1JPIA 3MKCA 4A2RA 4CU8A 1X7FA 4OV9A 3NPUA 4ZR8A 3EY6A 3P2VA 3GTIA 1E4LA 3IIXA 1OF6A 3K1GA 5JXQA 2NX9A 5D2YA 2A3BA 3KXQA 3GG1A 4PTVA 4YTTA 4JEJA 5G2WA 3FN9A 1I45A 2C71A 2BY3A 4HD5A 3O05A 4LB3A 5D04C 4E3TA 1XLJA 1V6XA 4QEEA 4HPHA 1Q65A 1O95A 4O1EA 3AZTA 4MTVA 4D1JA 3W2NA 1PYMA 4Z1YA 4UTTC 2CZVA 3VINA 3U7BA 4PTDA 5D33A 4B2DA 2IPJA 1H60A 1A5OC 2ABAA 2XFFA 1NFBA 3RCMA 3SDOA 5D8ZA 2CWXA 3AFBA 3R11A 3M0XA 4OECA 2CYGA 3CHEA 3TC5A 2J7EA 3W1AA 4I7VA 3VA8A 1BWVA 3ZOAA 1K70A 3IUDA 7PTDA 3QV8A 3ARSA 1KRMA 1O4UA 1J5SA 4IQLA 3ZVIA 1AVAA 3VIPA 2RURA 4RCXA 3SUTA 3VGFA 4ZQCA 1HJXA 3EWCA 1HKVA 3V0TA 3VCRA 2VX5A 2WBGA 3H53A 3O16A 2I57A 2KZHA 1PCKA 1E0TA 1E1FA 2FVMA 1R9YA 4NYUA 3CHCA 1C7SA 1DBTA 1QO2A 1W2VA 1ODZA 2OT1A 3OW1A 1EO7A 1BAGA 2VFDA 3E2RA 1CXIA 4GJ1A 4O50A 5K9XA 1MMFA 4X2RA 5DN1A 2TAAA 1P7TA 3CUXA 3NO5A 4LAUA 2VZTA 1A5SA 2PTXA 4DRIA 3MYOA 4NAFA 4PMRA 2FGZA 4G9PA 1UR1A 1IEVA 3OGSA 1F3WA 5I3HA 4GJIA 4JQ3A 1TJPA 1JFHA 3WF2A 3D3FA 4F0RA 4FZIA 1SFJA 1FDYA 5A6KA 2OX1A 3BL3A 3DBNA 4I8YA 4MGVA 3TN6A 3P62A 1XLDA 1BVZA 1TPEA 2AAMA 4ZB0A 1VJIA 4H6RA 4IPNB 1QXLA 4IGHA 3PZMA 4JIHA 4UB9A 3BC9A 4KKXA 3AYTA 4Q8NA 2PDPA 1CGUA 3R0DA 2PDFA 4Y9PA 3LCLA 1IWPA 3O3RA 3G8EA 4B2DD 1DHPA 1Q6HA 3NYZA 3IEBA 3TSDA 3QF0A 4JFMA 2NVCA 4UMBA 4RE0A 1HXVA 2CEQA 3Q58A 5JQ9A 4U4MA 3KS6A 2AQOA 3NURA 4B5UA 3WY1A 2GGEA 2FQIA 1CLXA 3SRFA 3CQ0A 3U5UA 3QH2A 4B5XA 1MW2A 3JRKA 3N18A 3SAZA 4UFIA 3WO8A 1TWIA 2OYKA 1F8AB 5FEPA 1JF6A 1BTMA 2I5GA 1A0EA 3THCA 4K8GA 3ZR6A 1IT7A 1W1TA 2BOFX 4XD6A 4F4RA 2E6YA 1KBBA 4WVXA 3LTYA 1FWRA 1TMHA 4EVZA 2CZEA 3AOFA 2WNQA 2EPHA 3F4DA 2N87A 4NZ5A 1VYSX 4CQ8A 2XP8A 1UKTA 4TYOA 4G50A 1QT1A 2J9YA 4DYKA 2YJQA 3OLEA 3EMCA 3MDYB 3IS4A 2BZNA 3DKJA 2WKLA 1JDFA 1JVWA 2WMIA 3EMQA 3VZYA 2R1NA 3SN1A 2WC3A 3O06A 4ECLA 3ZSTA 3VDCA 2DG9A 3ERPA 1PINA 2Z27A 1XW8A 4P7OA 3ZLFA 3ZJKA 4ONVA 4XWUA 3SFWA 1RR2A 3TFXA 4QJ5B 4JIQA 3AISA 2ISFA 5B80A 3ANVA 2GWGA 4UBPC 4TV6A 1Q6FA 5KZ6A 1B9BA 4CN1A 3KTXA 1M6JA 4AY8A 2FIQA 4G7FA 1OIFA 3P82A 1VFSA 2BGQA 3ZZ1A 7A3HA 4NAEB 1RQHA 1PV8A 1EH9A 1I2PA 3T44A 2X2GA 5EL1A 2ZQ0A 3E0IA 1V6VA 1I9CB 2R1KA 3TE9A 4X60A 1JXJA 2QNEA 4LYPA 2VFGA 4DZAA 3O5IA 1KD0A 3TR9A 1EC9A 3F2CA 5AN7A 1CIUA 2DZAA 2HV5A 2IMRA 3KCOA 1XLKA 4H9TA 4QROA 2E40A 3MWCA 3RITA 4BQ5A 4U10A 2BY0A 4ZB5A 1LT7A 1NP0A 2BGSA 4V33A 4UR9A 4LC6A 2FKEA 5I07A 3ORWA 1BPLB 2A3LA 3BPWA 3P61A 4B4HA 1FKWA 4QTGA 4BEQA 4S1FA 4XAGA 2UZ5A 2PAJA 3EZ4A 5FJIA 2VD8A 2QT3A 3AWNA 5JH8A 4QG9A 3GPKA 1J4RA 3KCJA 4KWUA 3BQ5A 2NVDA 3AROA 2HXTA 4PL2A 3W2KA 3WX7A 1UZ1A 4O11A 1KXTA 3LPFA 2A2IA 1Q6RA 3LV5A 1S1PA 2Y8VA 1JD9A 4GI6A 2BB0A 2FJUB 5C55A 4EPBC 2TRSA 1QFEA 4OGZA 1N82A 2Q6ZA 1XM3A 4ZTXA 1RZMA 5KEZA 2GQ3A 4RPQA 2Y7GA 5B8IC 1UWSA 1XJBA 2E5CA 3RNDA 3NG3A 2WKJA 1T99A 5KTLA 3VOJA 1JYVA 1EZWA 2FDSA 4TTUA 4C1NB 2QDDA 4HBEA 3T8LA 1HW6A 4C90A 1MNSA 4CNNA 1ELSA 4LCSA 3EBVA 1AL8A 1GG1A 2WCSA 1TPC1 4A6GA 4CCEA 3SCPA 1IHIA 1TV8A 4IOTA 4UOJA 2BP1A 4ZMGA 2R1PA 1J8VA 4M8UA 3IPWA 1KKRA 1XIBA 1XV8A 3S5NA 4ERGA 2J8GA 3AHZA 1DJWA 1UD3A 3FKKA 4LYKA 4IIGA 1BXBA 2VZVA 1GPWA 2XZ9A 3P81A 1J6YA 5EMLA 3S83A 2PN0A 4NL1A 1FHLA 1AW2A 1ZJIA 2E09A 1PS9A 9XIAA 4PBFA 1QNSA 1E6PA 3IK8A 3CH9A 4O13A 3E9AA 3XINA 1MYRA 3C2YA 1KCKA 2O56A 2VHLA 4H01A 2Y0FA 3CZLA 1DJYA 5G4HC 5I6SA 1TE1A 2WM1A 3ZT6A 1XIEA 4CNSA 2ZWZA 2P50A 3PA7A 3MP4A 5AZ1A 1PZ2A 1O94A 1F3EA 3WLOA 3OG3A 3T09A 2IPFA 2PB1A 3KZSA 1J0YA 3FAPA 2ZE3A 5DX7A 2ZQTA 2PF8A 2O4MA 1G0CA 1VKFA 4K36A 3W1XA 4LUTB 2QCGA 1C9DA 2YL5A 3ES8A 4F2TA 3EEZA 2VYOA 2CHOA 4Q4PA 5A6SA 3O15A 4ORMA 3JZEA 1SSDA 4GQQA 4OIFA 4KETA 1JDEA 4B5SA 3HPZA 3LERA 4U2ZA 3QW3A 4LQ1A 4C6LA 3FSUA 3RRXA 2Y70A 5CJ5A 4C6CA 3P5ZA 1J6OA 2UZ9A 2OFJA 1TZ7A 1LLOA 2DSZA 3UXDA 2I5IA 4F0HA 3EOLA 2BFGA 2OWWA 4MKNA 3KADA 3HMJG 4W5UA 3GR7A 1JDCA 5REQA 3ENLA 4KW2A 1QOXA 3S2JA 2LGOA 3UD6A 3M0KA 3GUGA 3W23A 4AD4A 4AZ5A 3N2XA 1GZJA 3KRUA 5K3VA 2PRLA 1BFNA 5CH9A 3GRIA 5D2WA 2KAUC 3BSHA 4K8HA 4AZ6A 3WJYA 3UQNA 1AZ2A 3CAWA 3HU7A 5DT5A 3WSUA 2BHUA 3NR0A 3QZAA 4REQA 1ZAHA 3MDWA 2JGYA 5C7VA 3WQPA 4JTSA 4V1XA 2QXWA 3MBFA 6A3HA 5C2CA 5M3WA 1JPDX 5AC7A 3JYJA 4IFKB 1H4PA 3KOXA 5DO8A 1KR1A 3GK0A 1NWTA 3V75A 3HF3A 3IGXA 3KP1A 4HHHA 1Q1CA 1PIFA 2PD9A 1TA3A 1Q6CA 1RK5A 2DJLA 4LU0A 3POCA 3ZVHB 1PL9A 2WVVB 2PURA 1J12A 3T78A 3LPOA 3BURA 4MWAE 1NMWA 1KCLA 3T05A 4MB5A 4YJ5A 2PBCA 3S9YA 4UCFA 3QHMA 1ZJBA 4QSFA 2WJDA 4JQ2A 3PVFA 4RXGA 5FKYA 3CMGA 3R25A 5JU6A 4WJXA 2PTWA 2QJMA 1C3FA 1TV4A 1TKKA 1YX1A 4NZ3A 1CBGA 2C1IA 4HCDA 2R24A 1QJWA 5HWMA 3WEZA 2XIMA 4ZOCA 1AQMA 1B3WA 4KWOA 3URAA 2ZX7A 4MADA 2ISDA 4B15A 3LTSA 3OZPA 4UXDA 1XLLA 2QPSA 5EU9A 1MO0A 1OK6A 2QCFA 3XISA 2Y89A 4AVOA 4OV4A 4Q7IA 2QW5A 4MNLA 3W7CA 1H7NA 1I4NA 1X96A 3W2UA 3M6DA 2ZYFA 3N04A 3FS2A 3OU8A 3ANUA 3M43A 1W9DM 4I6KA 4YIWA 2IKIA