1Q6UA

Crystal structure of fkpa from escherichia coli
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
213
structure length
213
Chain Sequence
b'AFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVKPAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase fkpA
publication title Structural and functional studies of FkpA from Escherichia coli, a cis/trans peptidyl-prolyl isomerase with chaperone activity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 73
structure length 213
sequence length 213
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2003-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF01346 FKBP_N Domain amino terminal to FKBP-type peptidyl-prolyl isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.460 Mainly Alpha Orthogonal Bundle Helix Hairpins Peptidyl-prolyl cis-trans isomerase, FKBP-type, N-terminal domain 1q6uA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1q6uA02
5DITA 2RUCA 5HWBA 1W26A 4N19A 1NMWA 4DRPA 1QPLA 2RURA 2ZQTA 3O5GA 4ODOA 3UF8A 4TW7A 2MLZA 1PBKA 4JFJA 3NTPA 3NI6A 1EYMA 3OOBA 3UQIA 2ITKA 5HW6A 1PINA 5J6EA 1L1PA 5DIVA 4DRHA 3B7XA 3JYMA 4R0XA 3RGCA 2K8IA 3O5DA 5HT1A 2VN1A 1NSGA 2ZR6A 1R9HA 1Q6HA 4G2PA 5HW8A 4TW8A 2FAPA 3FAPA 3O5RA 4DIPA 4DT4A 2PBCA 4BF8A 4ODPA 1F40A 2DG3A 5HW7A 2FKEA 1JNTA 2RUQA 2OFNA 2XP3A 1FJDA 5HTGA 2DG4A 2RUDA 4GGQA 2MPHA 2PPNA 2ZQUA 3IKDA 4W9PA 1YATA 3UI6A 4DRKA 1FKRA 2KI3A 3TC5A 4DRJA 3I6CA 2XPBA 3LUOA 2LJ4A 3O5QA 3KAHA 5HWCA 3KADA 1P5QA 1FAPA 1ZCNA 2D9FA 4ODNA 3O5MA 1D7IA 3CGNA 1JVWA 1Q6UA 2KR7A 4TX0A 3UQBA 4DH0A 2F2DA 2MF9A 4ODKA 4G50A 2LKNA 1N1AA 3KAFA 4IQ2A 1FD9A 1FKKA 3TDBA 4J4OA 1YW5A 4LAXA 3EY6A 5GPGA 4IPXA 4W9QA 2KE0A 2ZQVA 4JFLA 2RSEA 1J4IA 2MLYA 2PPPA 4ODQA 1QZ2A 2XP8A 1FKIA 1BL4A 3PRDA 3NRKA 4JFMA 1A7XA 1FKHA 1ZK6A 5DIUA 1ROTA 5B8IC 1U79A 2XP6A 3KACA 1B6CA 3O5LA 4LAWA 4JFKA 5HKGA 2PV3A 3O5KA 4U86A 3ODKA 1D7JA 2KFWA 1FKTA 1FKBA 2F21A 2XP4A 4U85A 4DZ2A 2LPVA 1FKJA 2KGJA 4ITZA 4DROA 1FKGA 1QPFA 4FN2A 1KT1A 2DG9A 1Y0OA 4MGVA 3KABA 1BKFA 2M2AA 3WH0A 5HUAA 4LAVA 1FKFA 1FKDA 4QT2A 2XPAA 4W9OA 2MLXA 4JYSA 2UZ5A 3O5JA 1FKSA 2Y78A 4J4NA 3TCZA 3KAGA 4NNRA 1D6OA 4DRIA 4TNSA 1EQ3A 3O5FA 2XP7A 4IQCA 3O5IA 5I98A 1KT0A 3H9RB 1Q1CA 4C02B 3GPKA 4U84A 4FAPA 4QT3A 1ROUA 3UI5A 4ODLA 4MSPA 1FKLA 1M5YA 2IF4A 1NMVA 3O5EA 1F8AB 4ODMA 5D75A 3VAWA 2LGOA 4DRQA 2M1IA 3CGMA 4O2TA 3MDYB 5BXJA 1J6YA 3UQAA 2XP5A 3PRBA 4TW6A 3PA7A 3IKGA 2ZR4A 2RQSA 2AWGA 2PV2A 4GIVA 4JFIA 1J4RA 3O5OA 4QIBA 4DZ3A 1HXVA 3KZ7A 3KAIA 3IHZA 4ODRA 2ZQSA 2ZR5A 2JZVA 3UI4A 2VCDA 1JNSA 1D7HA 2L2SA 3IK8A 2XP9A 3JXVA 1C9HA 3B09A 2MNTA 1TCOC 2M08A 4TYOA 3JYJA 2KO7A 3KCEA 4LAYA 1Q6IA 2N87A 2PV1A 1J4HA 3O5PA 4DRMA 2Q5AA 2F4EA 1T11A 2PPOA 4DRNA 3RFWA
chains in the Genus database with same CATH superfamily
3W7UA 3SPJA 2D3OW 3T1HO 4DRPA 1X59A 5CA1A 1XREA 4QJFB 2EZPA 3G4SV 5B1BC 1BHBA 3WIJA 1EYMA 1YTFD 5KMGB 3E8BA 2CK3G 1K4CC 2EINC 1MMMA 4WKHA 2PTMA 2BSKA 3RVZA 2Q67A 4P2ZA 1IBMO 2EINB 2W6IG 1GM8A 4WBNB 2RUQA 3B2EE 4EB6A 5LL6Y 4X20B 3ZRWB 4Z1MG 5LMUB 4LGXA 1BCCH 1DF5A 2P7TC 4N21A 1PNMA 1D7IA 3CGNA 2ZE8A 3D3IA 4KUMA 1HDJA 2KR7A 1NR7A 1H2NA 2LKNA 1AP6A 3BMBA 4I55A 2WSSG 3TDBA 1YW5A 2DPEA 4PA9A 1FJGB 2AGAA 2R9IA 1EFRG 2BOBC 1E1QG 2ZT9B 3AG4C 3WG7C 3CXCU 2UUCO 3K5OA 1PKXA 3SYQA 1M5IA 1VF6A 3ML0A 2YI8A 3GB7C 4K3AA 3BAAA 4O4LB 4P8VA 1S72V 5DF0A 1V55B 2VQEB 4DV4O 1XI1A 4MGVA 2CTRA 1N0JA 5CB4B 1BKFA 2YIBD 2AZ0A 3APOA 4UCVA 5LGUA 4D6TH 4U84A 1NWTA 1OZ0A 1EN5A 1EN4A 1M57B 1NWSA 1J6YA 2DE0X 2V4DA 3H1IH 3QO8A 2LQTA 2JJ2G 1D5AA 2DN9A 2HEPA 2CH7B 2VCDA 1JNSA 3JXVA 3RGBA 3JYJA 2BCCH 3K58A 3JD3A 1SQBH 2W6JG 1Q3EA 4NB5A 3OW2U 3CC2V 1OWQA 4K8ZA 3SDLA 5HWBA 5EZYB 4H37A 1F4NA 4MVQA 3G6LA 3JATA 3A0BZ 3G6BA 5BR8B 3JAWA 3RM9A 2Z5UA 2QWOB 5DIVA 4HBOA 5IYCO 4R0XA 1UR8A 2VN1A 1BT8A 1VARA 4DR1B 4DV7B 4PA7A 2WLZA 2Q68A 1CP9A 4NTWA 2QA4V 3WQWA 4ZPWR 1NTKH 4NVPA 1I0HA 1FKRA 1I5XA 3F7VC 3ABLB 4UXNA 2G41A 4OX9O 2AW9A 2OTLV 3P3PA 3T1CA 4ODNA 3G6MA 1HJVA 1K73W 4DH0A 4O4JB 3CRQA 1F51A 5BZBA 3F5TA 4DW0A 1SC5B 5J2TA 4IQ2A 1FD9A 2XAJA 3HKCA 1R1BA 2WLLA 1AR5A 4MVMA 2QWPB 3SYOA 4WFGA 2MLYA 4G2KA 4CC5A 1FKIA 2LW1A 3WB1A 3FB5C 5BXZA 2A3BA 5EIBC 2W0FC 1H8EG 1QR9A 3CCVV 4LH7A 3OMAB 3JASA 1M56C 4J10A 1W1TA 3LNMB 2WK2A 4I9WA 2YDEA 4J41A 3CX5F 4AY1A 2AHZA 5FNVB 4I4TB 4R5EA 3D36C 1B3QA 4CZZA 4LFAO 3H1KH 4I50B 1FKLA 3L75H 3FX7A 3O65A 2M1IA 4Z2IA 3EIPA 3OTFA 5JVDA 1TUBB 2CGNA 4IIJA 3CYOA 3ZJZA 2XT9A 1VF8A 3KZ7A 3KAIA 2YIAA 1IXBA 2ODMA 2Y4UA 2YC0A 2ZNJA 4WCEV 3TJTA 3CMEV 2OCHA 1GPFA 5GQBA 4QGPA 4P9PA 3KCEA 1IXMA 4XBFA 4FMTA 4DUYO 4B7EA 1RPOA 4GX5A 5GONA 2F66C 1YJ9V 5CN0A 4GLXA 4OPAA 3ASOB 1HKJA 1SA0B 4JI4B 3SPCA 4P8UA 5KA5A 5C8YB 3HR0A 3SJBC 3U10A 2ADQB 3JCUZ 1NSGA 4H33A 2ETNA 4LF8O 2FYUH 3FAPA 1J5EB 3ETGA 4FPPA 4JI5B 1I7FA 1B04A 4IHJB 2AOSA 4WFHA 3B8NA 1XBLA 2HKOA 4JV5O 3AK2A 2HLDG 4MTXA 4GKJO 3LUTB 3MDSA 1K33A 1P5QA 4O2BA 1AJPA 2XUMA 4X66B 4PTMA 2DT2A 1Y4MA 1YXBA 1W0JG 1E6ZA 1OJHA 3P3NA 1SS3A 3CCRV 1COWG 2JVDA 4JFLA 2RSEA 4JI1O 2YUAA 2P4VA 3OGCC 1PM9A 1BL4A 4GUNA 1Q7YW 1IBKB 1HNWB 1K92A 4FLUA 3H1HH 3I55V 4JFKA 4B3MB 3ZHQA 3O5KA 1R3LC 4X1KA 3E8FA 2YXYA 2BSKB 2QKCA 4U85A 4HAMA 4DXWA 1HNXB 3WD0A 4DROA 2UXCB 1XMOB 2JIZG 1OCOC 3K9AA 4E4EA 4Z2HA 3OUFA 1OCOB 5DEZA 1Q1CA 3CWBH 5H6RA 2UUBB 1BS3A 4KQZA 3CRCA 3RYFA 4JAAA 4TV9A 2OCCC 3PA7A 3QOKA 4P30A 2B1IA 2ITDC 2DJVA 1NH2D 3IHZA 2ZM6O 1W1VA 5H6QA 1AI6A 1YSCA 4Z2WA 3TETA 4X1IB 2Q8VA 4TV8B 3ARYA 1S5LZ 3ABKB 1J95A 3CCLV 2CUGA 1J4HA 2P67A 2Q5AA 2B5UB 1WLEA 1NBMG 1NMWA 1Y74B 5EBMC 1PBKA 4MW3A 3OOBA 5DO2A 5LP6A 3ALGA 3U0ZA 3RGCA 3O5DA 3L71H 2ZR6A 4JZGA 1OHHG 2Q0AA 5KHJA 1TFVA 3LDEA 2X6AA 4ZPTR 3R66A 4W5UA 2E76B 1AROP 1FJDA 4DR6O 4P8XA 4MAVA 2PF4E 4LCUC 4DRKA 2JS3A 4JYYA 4DR7O 4OGQB 4YJ3A 2Q73A 5LMNO 1FAPA 2EBOA 4MNLA 4WKFA 4N23A 4L87A 2JGUA 2CE4A 1FXKB 4J4OA 3CHDA 3FB6C 4X89A 2ZQVA 4ZOLB 3ARXA 1TUEB 5J9PC 1P7BA 3JAWB 1FPOA 3VQVA 1H0IA 2UUAB 4O4IB 3K57A 1U97A 3KG2A 4DR2O 2FDMA 4U86A 4UCSA 2ESCA 2KKWA 4CH5A 4CH6A 4JYBA 5KHIA 5L3BA 2LPVA 4AILC 2Q4PA 4R6ZA 4MS2A 4G27B 5BMVA 5HUAA 2R9RB 3JYCA 3OUSA 1ZBCA 4QT2A 3AS1A 3CS5A 2UZ5A 4J4NA 5HW6A 4NNRA 5FPOA 1K5SA 5D5PA 3K0GA 3UM7A 1XNRB 2QTSA 1WP7A 4JZ2A 2KSDA 3ZRVA 4BIOA 1JX9A 2ADPA 1RPRA 3FAVA 1UFIA 1FFXB 2JRIA 2JEXA 4TW6A 2IJHA 4JFIA 1TVKA 2H8PC 1KKCA 4I9QA 3GWKC 3SJAC 2WAMA 3KKYA 3OEEG 4TYOA 1LUVA 2QKSA 1IBMB 1D2DA 3PN1A 1V54C 3BFRA 2GTSA 4FLTA 3ARSA 4L72B 3BPZA 1ORQC 1K3EA 1V54B 3G71V 2YI9A 3HKDA 4BWAA 4H13B 3CHCA 4UUJC 2GHYA 4XDJA 5IJ0A 4GX0A 2WLMA 4CS2A 1SZXA 3K08A 5HW8A 4X1YA 3FKSG 1AR1B 1VQ9V 3C90A 1SKVA 3P30A 2DYRB 2IM9A 4LFBO 1UJWB 2ITCC 3SPHA 2ZINA 4ZI7B 2RUDA 3GU0A 3RWRD 3K5MA 3IKDA 3UI6A 3L73H 4YIOA 5JH8A 1MABG 3N2GA 1OGGA 1K7DA 3O5QA 3ARUA 4KL1A 3JSLA 4ZBMA 3IJ4A 1EZVH 5H2FZ 3BCCH 5JQGA 1YJWV 3CCMV 1SR0A 2GBOA 2QM8A 5H9CA 2MF9A 4ODKA 5GONB 1ZWIC 3OGIB 4MTVA 4O4HA 2QR4A 2Q0OC 4LF4O 2CDYA 1WP8A 3H1JH 2E5LB 1NTMH 4FK5C 3RW0A 1XHZA 2XP6A 1EM1A 5TISZ 3ZRXA 2Q5ZA 2UXDB 1NH6A 3QO5A 1YHQV 1SETA 4LNUB 3I56V 2JK5C 2WLKA 1QLNA 5KAIZ 3KABA 1XNQO 1OCCB 1NH2B 3HKBA 3DC6A 1LG1A 2XPAA 5KHHA 1IZ3A 3N2KA 4BW9A 5LOVB 1YIJV 5I98A 4DV3O 1KT0A 3H9RB 1KQSU 3H9VA 2RJZA 5IY5B 2ZE7A 1SRYA 4ODLA 1JFFB 1M5YA 3BXWA 3WQVA 4DWSD 1GN2A 2UXNA 5KX5A 5LHHA 3CGMA 3D36A 4S3JA 5BXJA 3N27A 1LL4A 2PV2A 2DWDC 4JYCA 1ZL8A 5KAFZ 4X64O 1WB8A 3PR9A 1HR0B 3THOA 1YJNV 4DV0O 1N8RW 3KCXA 1HKIA 2M08A 3T4DA 4KXRA 1E1RG 4MNJA 1BHAA 1IBLO 4N19A 1LQ0A 4JASA 2O57A 1IVSA 3UF8A 3UQIA 3WFVA 1NQTA 1YITV 2QJ1A 4H0LB 1Z5WA 2JGDB 1F23A 1WA8A 4WFBV 2EX3A 2Q7GA 1KECA 1Y67A 3CP1A 3ZHRA 3ASNC 1SESA 4DT4A 2VWKA 3T1YO 1VQ8V 4ODPA 2HVJC 4LF9O 5HW7A 5J2UA 3K06A 3ASNB 4H44B 2EIJC 5CA0A 3B4SA 4I5SA 5DECA 4GKKB 5IT9N 1S3JA 1E44A 2VQFO 2EIJB 3EXAA 4YJ2A 2WLIA 3DXRB 2LW7A 2RNBA 4Q20A 2ZD9A 4DRXB 2GTAA 2ILMA 4UVAA 1ZCNA 5LGNA 1S77D 3O5MA 2LGWA 3UQBA 1HKMA 1MZEA 5LBQA 2A0LA 4Q22A 2A7WA 3UQ8A 5JH7B 2A3EA 3FYEB 5B1NA 3DGEA 4MT8A 3ALFA 2RN9A 4Q6GA 4DO2A 3SJCC 2X7RB 4UDMA 1DGSA 1ROTA 4GX1A 1PP9H 1QCEA 2YEVB 2PY5A 1W1PA 2EJRA 1FKBA 3LSQA 3M8AA 4DZ2A 4MTGA 1SF9A 1UR9A 1PNKA 1N4CA 4UVBA 3MHHC 1TAEA 3WH0A 1LJYA 2LO1A 4TQDA 3DC5A 1KBHA 4HBEA 4K8XA 1N33O 2BTQA 1XRVA 3SPIA 2JS5A 1F8AB 3VAWA 3CEIA 4JYAB 4TT3G 3MDYB 2O9OA 3UT5A 4MW8A 1N34O 3CCUV 1HNZO 1V55C 5JCOA 1ZAUA 3O5OA 4RQEA 4ODRA 3LSUA 3WL0A 1SZTA 2FL4A 2WLNA 4YHHO 1GUVA 1VEWA 4DK1A 1TCOC 4MVSA 4B3RO 4WKAA 5K1XA 1R6KA 2OWOA 2Q6AA 3RYCA 1LL6A 4X62B 1SQPH 1M57C 5KUMA 1H2MA 3BRCA 3W4RA 4JV5B 3OTOO 3HPLC 3K03A 1Q86W 4GKJB 4NXMB 4NZCA 1M9NA 4ABMA 1W9PA 1WNOA 2EULA 4GCZA 5BMVB 1ENVA 5HT1A 4LF5O 2KG7A 2E3CA 4DR3B 2UXXA 5L3GA 5FLXN 5E1AC 1KP2A 1JVMA 1N36B 1ZUQA 4JI1B 1YATA 3BABA 1QR8A 1YF2A 1GKFA 4MVZA 4RUFA 2F23A 2P6JA 4I7ZB 4RWUA 4BIZA 2Q69A 2D9FA 4NXNO 1Q6UA 3CHEA 3DSQA 3JARA 3RYIA 1AI7A 4QE7A 1N1AA 1R3JC 1FKKA 3JALA 5B3SB 4O2AA 3CCEV 4FLXA 1I94B 2ZE6A 4DV5O 2QM4A 1Y76A 2V7QG 2F95B 3ABLC 1RP3B 2WLJA 3ABMB 5IJ0B 1E6PA 4UFZA 2RCVA 2PGGA 4DWSC 3AK3A 4KHPO 2KFWA 1GN3A 2PYJA 4DWSB 1YVWA 5C93A 5KHGA 3CC4V 1SQQH 3CJHA 1MNGA 2ZCEA 4IT6A 4NTYA 5GTHZ 3ARQA 1Q5OA 1ZBVA 1QHTA 3F5WC 5B1AB 4JI8B 4FFBB 4FFKA 3KAGA 2OTJV 4UV9A 1GRJA 3CCJV 3MHSC 4RUEA 4JI7O 1XQ8A 3AQUA 1S5JA 1EDQA 3E22A 4JI2B 1H38A 5IJ9A 4F4LA 4FIPC 3WU2Z 2DT3A 4B3SO 1GM9A 1JCHA 3LDDA 1HXVA 4JTDB 3H1LH 4D7TA 4DV6O 5HBFA 2ZR5A 1D5NA 2MK3A 3MD0A 3C3TA 1PNLA 2PUSA 5DITA 5EC1C 4F6EA 1W26A 2QWRB 4LFCB 2M7WA 1M90W 4ODOA 2VS0A 3AG3B 3P32A 4DR7B 3NI6A 3JAKB 1L1PA 4J42A 3HKBB 2K8IA 1WB7A 2ZR2A 1R9HA 3ARTA 4U3JA 5GPRA 3RM4A 1EZJA 2OYQA 2DWEC 5LMUO 2OFNA 5KX5B 5EBWC 1WB0A 3WD4A 2P90A 5HTGA 3ASOC 4LWSB 1K34A 1MSDA 1KU9A 4HNAB 5GTIZ 3TC5A 1QU7A 1ZL8B 3ZHVA 3WKZA 4U3FH 1AILA 4FZ1A 5LXTA 1P84F 1KC8W 1SQXH 5EYPB 4P9OA 3BEHA 1HP8A 1FYJA 3ZEDA 2ARHA 4K0KB 4LF6O 3S3XA 4LF7B 4ZPVR 3BA9A 1M93A 1FJGO 1RD6A 4W9QA 3RFRA 3E86A 1FFTB 5A2QN 3UCSC 2ZIOA 2UU9B 1A7XA 1FKHA 4PI2A 4LAWA 1E6RA 2GUZB 3ODKA 1D7JA 1PPJH 2DT1A 1JPXA 2VQEO 1M1KW 4ZHQB 1FKJA 5J2UB 1FKGA 5ITZA 4BAYA 2A3QA 3CXHF 5CA0B 2M2AA 3JCZA 4GT1A 2G38A 1NWRA 3SPGA 4TNSA 1EQ3A 4YJ2B 5CA1B 2WLIB 2LP7A 5L3EA 2Q7EA 2N04A 5CBFA 1VMGA 1ZBKA 4R8CA 3GWOA 3JD4A 3K04A 1H0GA 1V9PA 1GMGA 4ZKIA 3IKGA 2RQSA 2N74A 4QIBA 4U7OA 5IYDO 4URIA 1ZB5A 2ZQSA 5HFLA 2ZXWB 3O9OA 4EB6B 1E6NA 1JMKC 2DQ3A 2L2SA 4UVCA 2Q9LA 1QBZA 1WN7A 2PI4A 1QVFU 1LL7A 4LAYA 4FM0A 3ARVA 2HP8A 3ZMSA 4JI0B 1KYOF 1N0NA 2IJIA 1N32B 4MPKA 5BR8O 4GYCB 4QZVB 1XMQB 3ZIAG 4DRHA 3ZHSA 4I0XA 4I55B 1VQ7V 1O9HA 1QLEC 3SYAA 3FD9A 4DV7O 2Z0AA 2UXBB 4TW8A 1GM7A 4RQFA 3E89A 1QLEB 1Q90D 3ABKC 4DV1B 4L3NA 4BF8A 1VF6C 1JNTA 4WFFA 1PL4A 3CCSV 4LF4B 1QQCA 3UT5B 4RO2A 3ETQA 4FM2A 4W9PA 2Y0PA 5JJJB 4J9YB 3OA5A 1PD3A 1E9LA 3NR7A 4PDVA 3KCYA 4DUZO 2DMXA 5HWCA 1QVGU 4HBNA 5B66Z 2E74B 2DYSB 2H3OA 5CBGA 1FFRA 4XAKA 5KMGA 3KAFA 4JI3O 4FM1A 3EY6A 4WJXA 5IYZA 1XOUA 4DR4O 2PPPA 4ODQA 2OIGA 3PRDA 2DSVA 5DIUA 3OMIB 1U79A 2PV3A 2KG7B 4PA6A 1XEQA 4X20A 5EK0A 3ZRWA 2B1GA 3F7YC 3L72H 4C7UA 2XAQA 4X8AA 3U11A 1KT1A 1ITXA 1FXKC 3J80N 4KR0B 4JI6B 3ZX6A 1L0LH 2IBZH 1FKSA 5LA6A 3CE2A 1KB9F 3OMNB 4IQCA 4JTAB 3JATB 1G1XB 2Y0IA 2JEUA 3K0DA 3FB7C 4J9ZB 3CRMA 1X6LA 3B40A 2XAGA 1P7GA 2F4VB 2LGOA 1MG1A 4Z2GA 4IYIA 2EILB 2HHHO 1R73A 4DZ3A 3G80A 1I5YA 3IAYA 4B3TB 4B08A 1SQFA 3UI4A 1DK1A 2YSUB 3EFFK 3ARWA 3M99B 2QGNA 2ZQMA 1CTNA 1FS0G 3VQXA 2N87A 5CB4A 3AG7A 3A0HZ 4JI4O 4PDMA 4QE9A 1VQ4V 3CHXA 3O5GA 2CTQA 3T1HB 5J2TB 2B9ZA 2EIMB 1GTOA 2HG5C 3HKCB 4J11A 2WLLB 1J5EO 2IU0A 4JI5O 4TSFG 4MNKA 2P22C 2QE7G 3QO7A 2CH7A 2IJJA 1W2BU 2RDCA 4RAIA 5JJEB 2EIKB 3JASB 2GDSA 5KA6A 2KI3A 3I6CA 1S0VA 4X66O 2IJKA 4NSBA 1QNMA 4MTFA 4D7SA 5FL7G 5EZYA 2P5OA 2JDIG 2XTAA 3ZMTA 3CH9A 4TX0A 2BE3A 3WD1A 2DYRC 5LYJA 2WA3A 4R50A 3B8SA 1LG2A 2KE0A 1KFWA 2HR3A 1IBKO 1HNWO 1X6NA 1PL0A 3VBBA 4JFMA 5LHIA 2WWWA 5JVDB 1P49A 3WB2A 5B8IC 4IIJB 3O5LA 1Q82W 2UUCB 1HNXO 5BY1A 2UXCO 4L8JA 1AB3A 1XMOO 2N05A 4BIUA 1N34B 3LSSA 1HNZB 3AROA 1Y0OA 2X6BA 1ZBWA 1FKFA 4TWKA 4DV4B 3TCZA 4O4JA 3Q4HA 5KUKA 2XAHA 3OEHG 3H01A 4X9QA 2A79B 2UUBO 3X2QB 4QT3A 3CC7V 2AZ2A 1NTZH 1YI2V 1ZTEA 3HKEA 3JD1A 4O2TA 4FVMA 4PA4A 4OPHA 4QNHB 2QTOA 2ZDIC 4MVRA 2G8ZA 3W7SA 3OR6C 1OCCC 3OE7G 2ZE5A 3RT3C 1RSOA 5L3FA 3OAAG 5IY5C 1SERA 4YXWG 3STZC 5FNVA 4I4TA 2F4EA 3SYCA 4ASUG 4DRNA 5IE9A 4O2BB 3AS2A 4DW1A 2IW5A 4BR6A 3NTPA 3CRRA 1Z5VA 5J6EA 4I50A 1ZX3A 1DLBA 2HVKC 3WB0A 1XL4A 1TUBA 1FXVA 1NZ6A 3TXQA 1KKDA 2FAPA 3AK1A 3C3SA 1VF7A 2EZOA 2FTKA 2YXLA 1F40A 1DTOA 3L70H 3NXSA 1MZFA 4FJCC 2R70A 1FXHA 3ZCCA 5LGTA 1JOYA 2ZQUA 4X1KB 4JPRA 3GVMA 5EBLC 2LJ4A 3G6EV 1WAWA 4ICGA 4EKWA 3CPWU 4FZ0A 3ICXA 3ABUA 4OX9B 1SA0A 2F1MA 2PI6A 2CTPA 4J7KA 3UO3A 2DQ0A 1L8DA 2L6LA 2YBTA 5GPGA 3QNEA 1RM1C 5JJNB 2UUAO 1OCZB 2XP8A 3RYFB 4TV9B 5CMUA 4IHJA 1RM1B 3UO2A 4A5UB 4NR1A 1O6IA 3JD0A 3SJQC 4KP4A 1JNDA 5HKGA 1Y6XA 1K4DC 2A06H 2PI5A 4F6RA 2MW2B 1F7YA 2LFSA 1XHXA 5L3DA 1NS1A 4JYSA 3JAMN 2Y78A 2IH1C 1XNRO 2Y69B 2YBUA 5LP6B 4CS4A 3TCUA 2CGOA 4DYLA 4ODMA 2YIBA 2M6YA 4LFAB 2HJFC 1BZKA 1AJQA 4XDLA 1AI5A 3RYHA 1MOFA 4GIVA 5B1BB 4WIWA 4MVOA 2CAZC 1JJOA 4G28B 5IYZB 1CXZB 2BTOA 3IFXA 2XOKG 4UCTA 4NTXA 1VIBA 3IK8A 2EJ7A 5IYBO 5CA3A 1IURA 2KO7A 2X0LA 1Y66A 4YJ3B 4DRMA 3VQYA 4AQYO 1T11A 1TA8A 2RUCA 4DUYB 3STLC 1BSMA 3A0RA 3LNNA 2ZQTA 1VQ6V 4UB8Z 4TW7A 5KLVH 1NT2B 3BA8A 3RVYA 3BY6A 5L3CA 2YS8A 1K9MW 3SR2C 5LA6B 1OV9A 4DIPA 4LF6B 2PBCA 4LF8B 3FYIB 1LR1A 2FKEA 4X65O 1KD1W 4DR5O 2DT0A 4X1IA 5IWAO 4TV8A 2LFRA 4GGQA 4EFBA 2PPNA 4ZIBA 3E8HA 1JJ2U 4W4KA 1ROPA 2XPBA 3OR7C 5DN6G 2B5UA 1AP5A 3AG4B 3WG7B 2YXHA 2BOCC 3ETDA 1JA8A 4OXSA 3VOUA 3ZHTA 1Y74A 4CBCA 1JVWA 2XHBA 1AVMA 3T4ZA 3QG5A 3AG2C 2FB5A 4JAVA 1OCRC 1R3KC 2E5LO 2DW4A 1R3IC 4UCUA 4PELA 3FAVB 5F2VO 4WK9A 3AG2B 4YY3O 1OCRB 2F93B 1ZU8A 4J80A 2UXDO 1B6CA 1TVKB 1CEZA 1HKKA 1NI8A 3FB8C 1W0KG 4DV2O 1NWUA 3K5LA 4ITZA 1GH6A 5B3SC 1JNEA 1QPFA 3APQA 1BE3H 2OIEA 3UKMA 1SQGA 2Q7HA 3TXSA 4W9OA 1RFYA 3AEIA 3ABMC 2XP7A 1W1YA 3O5FA 3O5IA 3QF7A 3ZHUA 3HKDB 1FXKA 3O5EA 4TQFA 4ZOLA 3IGAC 1THZA 5LYJB 5DM6V 1FAFA 2WPDG 4X1YB 4O4IA 1GN6A 1VQLV 2ZR4A 1K5QA 1HR0O 2O92A 1BGYH 5IDJA 5B1AC 5E79Z 2ZM6B 1A32A 5LHGA 2MNTA 3N2GB 4X88A 3L9DA 1IX5A 3LUOA 1BL8A 3IC7A 3B9AA 4WF9V 1PV0A 5JQGB 5D5QA 1S5HC 2P06A 3PRAA 2WLYA 2MLZA 4JFJA 3TGUH 4DUZB 3B9EA 3AS3A 2VWJA 3JYMA 3Q4HB 4O4HB 3AG1C 3CHFA 1ZL1A 1FFXA 4G2PA 1Q8IA 2LGQA 1EIBA 3AG1B 1TGOA 1O9GA 3HKEB 4JI3B 4GKKO 4Z2LA 2OT5A 4DR4B 1WPXA 3ARPA 2NNUA 3G67A 3K79A 3AG3C 1FFQA 4DR6B 4DRJA 4E2LA 1EN6A 1HJXA 2R9AA 1H2KA 1RSOB 3FXYA 2GV9A 1M56B 5LMNB 3ZMVA 1NVPD 2PZSA 3N2KB 2A3CA 3J81N 2PYLA 1R6TA 4LAXA 1H2LA 1W9VA 2AXTZ 3M7MX 1U96A 2ZKOA 3JD2A 2ZNIA 1VQMV 3NRKA 4BW5A 4U7NA 5DEDA 4ZI7A 3CRAA 5B5EZ 1VQ5V 3CD6V 4DR2B 1X4TA 4HZ3A 2HHHB 1YTFB 2DG9A 3PJSK 4TUYA 1FKDA 2MLXA 3O5JA 4DRIA 4PA3A 3KZIZ 2K1EA 4PJ0Z 4FLWA 4IT5A 3GPKA 4AI8A 1ROUA 4JYAO 4MSPA 2OLHA 1AJNA 2IF4A 3DTUB 4DRQA 1Q81W 1WA8B 2QKAA 2RQ6A 1GN4A 1JR9A 1K9TA 3MAQA 3J7AU 1J4RA 1HJWA 1VQPV 2ATKC 1VF5B 4LNUA 2AHYA 2XP9A 1Z2GA 4X62O 3B77A 3K9SA 4JAUA 2KB1A 4JGSA 1E15A 1AI4A 2ZDIA 1Q6IA 4W4LA 2PV1A 5KHKA 1WAZA 4F6RB 4NXMO 4J7JA 4J7ZA 1XL6A 5H5NA 5LOVA 1QPLA 1CPYA 3CSXA 2RURA 4NKGB 2WM0A 4EFEA 4Q7NA 3B9DA 4DR3O 1JFFA 2ZXWC 1SYTA 1GK9A 3W7WA 1GAXA 3B8MA 4PHZA 1YCIA 4CH4A 2B31A 3OM3B 1L1FA 3CZ8A 4EEQA 1N36O 2XP3A 1P4RA 1H2SB 4LFBB 2QWNB 2YICA 3RYHB 1YDXA 1VQOV 4ZS6A 1D2KA 3BHPA 5FPRA 4MVUA 4FLVA 3KADA 4DR1O 1SQVH 4HARA 2F2DA 1G8MA 3AS0A 4G50A 1EHNA 1I94O 2JGDA 3ZS8C 3EHBB 5A9GA 2BTQB 4R7CA 4ML4A 5JCOC 4MTOA 3LDCA 1KMIZ 3CCQV 4CH3A 1XUQA 3A2FA 1MA1A 4CC6A 1NU1H 2GSMB 2DYSC 1FKTA 4LR3A 3WL1A 3VQWA 4WFEA 2DSWA 3DXRA 2OCCB 3CB2A 4DRXA 1T5EA 1YEWA 3RYCB 3W7XA 2C2AA 4JI8O 1R6NA 2HJDA 4LAVA 1KUQA 1XNQB 5JH7A 4JI2O 3ARRA 1K8AW 4HYOA 4DV3B 3OFNG 4WBNA 1NMVA 2YIDA 4P8WA 3UQAA 3SGIA 3PRBA 4LBEC 3JSNA 5B1OA 1NJIW 5GW7A 2F43G 2ZIMA 2PN0A 2YEVA 4PI0A 2DOSA 1L0NH 1XILA 4UB6Z 4AHCA 3T2MA 3R65A 4X64B 2ZR3A 1W9UA 3B09A 1BQZA 3ZN1A 4DV0B 3O5PA 4CS3A 4XDKA 4LFCO 2IU3A 2NLJC 3RFWA 3ABTA 1W59A 2CTWA 4IT4A 1LNQA 2EILC 3OD4A 1IBLB 1EBOA 3JARB 3RYIB 1GOIA 1PINA 3K3WA 3FY1A 3E2EA 3JALB 4PDRA 4FLYA 4O2AB 3SYPA 1LUWA 3IC9A 1H8HG 2LJ2A 1Y76B 1OGBA 4QPJA 1NVPB 3I5DA 4O4LA 1NKDA 3T1YB 1YZBA 2Z3YA 3OT7A 5JWPA 4LF9B 2IH3C 2V1DA 2MPHA 4UV8A 2EIMC 3CJHB 3E8GA 4PD4F 4LC1A 2VQFB 4PV1B 3K5NA 4K0KO 4LF7O 3S3WA 4K35A 4NYKA 1IDSA 4IPXA 3E22B 2EIKC 2R72A 2UU9O 3BVOA 5IJ9B 3RMEA 5EC2C 3ZMUA 1G4YB 3RN4A 4B7KA 2DSUA 1ZK6A 4LH6A 1JCHB 1B06A 1AR4A 2NN4A 3K59A 1WNSA 5CBHA 1VQNV 2F21A 4DK0A 1GO3F 1HWYA 2W0XA 4GZRB 2VRZA 2KGJA 2KQXA 2Y48A 4FN2A 3RBZA 4Z1VA 3W7TA 2QM7A 3CMAV 1D6OA 3FFQA 4QPKA 1I08A 5K1PA 2Y4TA 4C02B 1WPBA 4FAPA 3D3QA 1XDCA 2H94A 4MSWC 3UI5A 4AQYB 3WD2A 2QWQB 2XNDG 5AG2A 2QEXV 4B3MO 3QVNA 1N33B 1UPGA 4U3JB 2FMLA 2AWGA 2RMKB 2D2CB 1E79G 2JZVA 4Z2JA 1F4MA 3WD3A 4QIWF 3RM8A 4DWSA 3ZN0A 4YHHB 4JI0O 4KFMA 1ZSPA 2IUZA 3X2QC 1N32O 3ZBHA 4JF3A 4B3RB 2NR5A 3ZRSA 4X65B 4GX2A 2QSAA 4DR5B 1BMFG 5IWAB 5LXTB 4FFBA 2L35A 1DF4A 3E35A 1XMQO 2XAFA 1G6UA 2X6CA 3OTOB 2ITKA 2QF8A 4TUYB 2DSZA 2UXBO 3B7XA 1ZLZA 4DV1O 1Q6HA 2WLHA 5HFMA 3ZMZA 3O5RA 4IGGA 4LF5B 1URFA 3A8TA 4TOIA 2DG3A 1H2GA 2DG4A 2HFEC 2P4KA 1B6QA 4YY3B 2XASA 5ITZB 4IYHA 3KAHA 4MNMA 2E75B 2JJ1G 3GTYX 3D8CA 1IX9A 3JAKA 4DV2B 4NXNB 3TK1A 4YIPA 3HB3B 1J4IA 1QZ2A 4DV5B 4LP8A 1JQ0A 4WFAV 3KACA 2K9PA 4LWSA 3ETEA 1MSWD 4HNAA 2XP4A 1S76D 4PDLA 4KHPB 4JI6O 1KP3A 4FLZA 2WA4A 5EYPA 1XHGA 5C8YA 1FKAO 2QDOA 1OCZC 1NR1A 4UCRA 3L74H 4Z2KA 2F4VO 1VP7A 4IL6Z 5EIBD 4I0XB 1US6A 5D75A 4JI7B 2XP5A 2A9HA 4B3TO 3QTCA 4JTCB 1BQ0A 1K97A 4B3SB 2GUZA 2FKXA 1D7HA 1HW7A 4ZHQA 4DV6B 1C9HA 3ARZA 3EVKA 3E83A 2A3AA 1WJZA 2Y69C 4UCOA 1Q43A 5LP6C 4S3KA 1M4UA 2PPOA 1VQKV
chains in the Genus database with same CATH topology
3ARSA 4L72B 3B9AA 4MPKA 4DRPA 3PRAA 2WLYA 2MLZA 4JFJA 3WIJA 1EYMA 4QZVB 3CHCA 3B9EA 4DRHA 3AS3A 3JYMA 3CHFA 1ZL1A 4G2PA 5HW8A 4TW8A 4WKHA 1EIBA 4L3NA 4BF8A 1JNTA 2RUQA 4Z2LA 2RUDA 3IKDA 3ARPA 4W9PA 4LGXA 1FFQA 3UI6A 3OA5A 4DRJA 5JH8A 1E9LA 1OGGA 3O5QA 1HJXA 3ARUA 5HWCA 3FXYA 1D7IA 3CGNA 1SR0A 2KR7A 1FFRA 4XAKA 2MF9A 4ODKA 2LKNA 3KAFA 2A3CA 4MTVA 3TDBA 1YW5A 2DPEA 3EY6A 1W9VA 4LAXA 4WJXA 2PPPA 4ODQA 3PRDA 2DSVA 3NRKA 5DIUA 1U79A 2XP6A 2PV3A 1NH6A 4P8VA 1KT1A 1ITXA 2DG9A 5DF0A 4MGVA 3KABA 1BKFA 4KR0B 1FKDA 2XPAA 1LG1A 2MLXA 3O5JA 1FKSA 4DRIA 4IQCA 5I98A 1KT0A 3H9RB 3GPKA 4U84A 1ROUA 1NWTA 1X6LA 4ODLA 4MSPA 2OLHA 1M5YA 2IF4A 1NWSA 3BXWA 3WQVA 4DRQA 4DWSD 2LGOA 3CGMA 4S3JA 4Z2GA 5BXJA 1J6YA 1LL4A 1K9TA 4DZ3A 2PV2A 1J4RA 1HJWA 3PR9A 3UI4A 2VCDA 1JNSA 3JXVA 2XP9A 3ARWA 1HKIA 2M08A 3JYJA 1E15A 1CTNA 1Q6IA 2N87A 2PV1A 1OWQA 4MNJA 5HWBA 4N19A 1LQ0A 1QPLA 2RURA 3G6LA 3O5GA 3UF8A 3UQIA 2WM0A 4Q7NA 3RM9A 5DIVA 3B9DA 4HBOA 4R0XA 1SYTA 1UR8A 2VN1A 2B31A 4MNKA 4DT4A 2WLZA 3CZ8A 4ODPA 5HW7A 2XP3A 3WQWA 4ZPWR 4ZS6A 1D2KA 1FKRA 2KI3A 3I6CA 2G41A 4NSBA 3KADA 1ZCNA 4ODNA 3O5MA 3G6MA 1HJVA 3CH9A 4HARA 4TX0A 3UQBA 1HKMA 4DH0A 2F2DA 3WD1A 3AS0A 4G50A 4Q22A 1EHNA 4IQ2A 2A3EA 1FD9A 3B8SA 1LG2A 2KE0A 3ALFA 1KFWA 4ML4A 2MLYA 1FKIA 1X6NA 4JFMA 5B8IC 1ROTA 2A3BA 3O5LA 1W1PA 1FKTA 1FKBA 1W1TA 2WK2A 4DZ2A 3WL1A 2DSWA 1UR9A 3AROA 1Y0OA 4AY1A 3WH0A 1ZBWA 1FKFA 4LAVA 1LJYA 4R5EA 3TCZA 3ARRA 4HBEA 4QT3A 1XRVA 1FKLA 1NMVA 1F8AB 3VAWA 2M1IA 4Z2IA 4O2TA 3MDYB 2O9OA 4P8WA 3UQAA 3PRBA 3O5OA 2G8ZA 1VF8A 3KZ7A 3KAIA 4ODRA 3WL0A 1GUVA 1GPFA 1W9UA 3B09A 5GQBA 1TCOC 4WKAA 3KCEA 1LL6A 3O5PA 2F4EA 4DRNA 3RFWA 3W4RA 3AS2A 4IT4A 1HKJA 4NZCA 3NTPA 1W9PA 1GOIA 1PINA 1WNOA 5J6EA 4P8UA 3FY1A 5HT1A 1NSGA 2FAPA 3FAPA 1OGBA 1F40A 2AOSA 2MPHA 2ZQUA 1YATA 2LJ4A 1WAWA 1P5QA 2D9FA 4PTMA 2DT2A 1Q6UA 3CHEA 2PI6A 1N1AA 1E6ZA 1FKKA 2YBTA 5GPGA 4IPXA 4JFLA 2RSEA 3RMEA 2XP8A 1BL4A 2DSUA 1ZK6A 1O6IA 1E6PA 4DWSC 1JNDA 4JFKA 5HKGA 3O5KA 2KFWA 2F21A 4U85A 4DWSB 3WD0A 2KGJA 4DROA 4FN2A 4IT6A 3ARQA 1ZBVA 4JYSA 4Z2HA 2Y78A 3KAGA 1D6OA 5DEZA 4C02B 1Q1CA 4FAPA 3WD2A 3UI5A 3AQUA 1EDQA 2YBUA 4KQZA 4ODMA 2DT3A 3QOKA 3PA7A 2AWGA 4GIVA 4WIWA 1HXVA 3IHZA 1W1VA 5HBFA 2ZR5A 2JZVA 4Z2JA 3WD3A 3IK8A 3RM8A 4DWSA 3ARYA 2IUZA 2KO7A 1J4HA 4DRMA 2Q5AA 1T11A 5DITA 2RUCA 1W26A 1NMWA 2ZQTA 4ODOA 4TW7A 1PBKA 3NI6A 3OOBA 2ITKA 5DO2A 1L1PA 2QF8A 2DSZA 3ALGA 3B7XA 3RGCA 2K8IA 3O5DA 2ZR6A 1R9HA 1Q6HA 3ARTA 3O5RA 1TFVA 5GPRA 3RM4A 4DIPA 2PBCA 4ZPTR 2DG3A 2FKEA 2OFNA 4W5UA 1WB0A 3WD4A 1FJDA 5HTGA 2DT0A 2DG4A 4P8XA 4GGQA 2PPNA 4MAVA 4DRKA 3TC5A 2XPBA 3WKZA 3KAHA 4MNMA 1FAPA 4MNLA 1JVWA 4WKFA 4ZPVR 4J4OA 1RD6A 3CHDA 4W9QA 2ZQVA 1J4IA 3ARXA 4WK9A 1QZ2A 1ZU8A 1H0IA 1A7XA 1FKHA 3KACA 1B6CA 2FDMA 1HKKA 1E6RA 4LAWA 4U86A 3ODKA 2ESCA 1D7JA 2DT1A 2XP4A 2LPVA 1FKJA 1NWUA 4ITZA 1FKGA 1JNEA 1QPFA 2M2AA 5HUAA 1XHGA 1ZBCA 4QT2A 1NWRA 3AS1A 4W9OA 5HW6A 2UZ5A 4J4NA 4NNRA 4TNSA 1EQ3A 3O5FA 2XP7A 1W1YA 3O5IA 4Z2KA 3O5EA 1ZBKA 5D75A 1H0GA 2XP5A 4TW6A 3IKGA 2ZR4A 2RQSA 4JFIA 4QIBA 2O92A 4URIA 1ZB5A 2ZQSA 1E6NA 1D7HA 2L2SA 1C9HA 3ARZA 2MNTA 4TYOA 2A3AA 1LL7A 4LAYA 3ARVA 1IX5A 4S3KA 3LUOA 2PPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DIT A;  2RUC A;  5HWB A;  1W26 A;  4N19 A;  1NMW A;  4DRP A;  1QPL A;  2RUR A;  2ZQT A;  3O5G A;  4ODO A;  3UF8 A;  4TW7 A;  2MLZ A;  1PBK A;  4JFJ A;  3NTP A;  3NI6 A;  1EYM A;  3OOB A;  3UQI A;  2ITK A;  5HW6 A;  1PIN A;  5J6E A;  1L1P A;  5DIV A;  4DRH A;  3B7X A;  3JYM A;  4R0X A;  3RGC A;  2K8I A;  3O5D A;  5HT1 A;  2VN1 A;  1NSG A;  2ZR6 A;  1R9H A;  1Q6H A;  4G2P A;  5HW8 A;  4TW8 A;  2FAP A;  3FAP A;  3O5R A;  4DIP A;  4DT4 A;  2PBC A;  4BF8 A;  4ODP A;  1F40 A;  2DG3 A;  5HW7 A;  2FKE A;  1JNT A;  2RUQ A;  2OFN A;  2XP3 A;  1FJD A;  5HTG A;  2DG4 A;  2RUD A;  4GGQ A;  2MPH A;  2PPN A;  2ZQU A;  3IKD A;  4W9P A;  1YAT A;  3UI6 A;  4DRK A;  1FKR A;  2KI3 A;  3TC5 A;  4DRJ A;  3I6C A;  2XPB A;  3LUO A;  2LJ4 A;  3O5Q A;  3KAH A;  5HWC A;  3KAD A;  1P5Q A;  1FAP A;  1ZCN A;  2D9F A;  4ODN A;  3O5M A;  1D7I A;  3CGN A;  1JVW A;  1Q6U A;  2KR7 A;  4TX0 A;  3UQB A;  4DH0 A;  2F2D A;  2MF9 A;  4ODK A;  4G50 A;  2LKN A;  1N1A A;  3KAF A;  4IQ2 A;  1FD9 A;  1FKK A;  3TDB A;  4J4O A;  1YW5 A;  4LAX A;  3EY6 A;  5GPG A;  4IPX A;  4W9Q A;  2KE0 A;  2ZQV A;  4JFL A;  2RSE A;  1J4I A;  2MLY A;  2PPP A;  4ODQ A;  1QZ2 A;  2XP8 A;  1FKI A;  1BL4 A;  3PRD A;  3NRK A;  4JFM A;  1A7X A;  1FKH A;  1ZK6 A;  5DIU A;  1ROT A;  5B8I C;  1U79 A;  2XP6 A;  3KAC A;  1B6C A;  3O5L A;  4LAW A;  4JFK A;  5HKG A;  2PV3 A;  3O5K A;  4U86 A;  3ODK A;  1D7J A;  2KFW A;  1FKT A;  1FKB A;  2F21 A;  2XP4 A;  4U85 A;  4DZ2 A;  2LPV A;  1FKJ A;  2KGJ A;  4ITZ A;  4DRO A;  1FKG A;  1QPF A;  4FN2 A;  1KT1 A;  2DG9 A;  1Y0O A;  4MGV A;  3KAB A;  1BKF A;  2M2A A;  3WH0 A;  5HUA A;  4LAV A;  1FKF A;  1FKD A;  4QT2 A;  2XPA A;  4W9O A;  2MLX A;  4JYS A;  2UZ5 A;  3O5J A;  1FKS A;  2Y78 A;  4J4N A;  3TCZ A;  3KAG A;  4NNR A;  1D6O A;  4DRI A;  4TNS A;  1EQ3 A;  3O5F A;  2XP7 A;  4IQC A;  3O5I A;  5I98 A;  1KT0 A;  3H9R B;  1Q1C A;  4C02 B;  3GPK A;  4U84 A;  4FAP A;  4QT3 A;  1ROU A;  3UI5 A;  4ODL A;  4MSP A;  1FKL A;  1M5Y A;  2IF4 A;  1NMV A;  3O5E A;  1F8A B;  4ODM A;  5D75 A;  3VAW A;  2LGO A;  4DRQ A;  2M1I A;  3CGM A;  4O2T A;  3MDY B;  5BXJ A;  1J6Y A;  3UQA A;  2XP5 A;  3PRB A;  4TW6 A;  3PA7 A;  3IKG A;  2ZR4 A;  2RQS A;  2AWG A;  2PV2 A;  4GIV A;  4JFI A;  1J4R A;  3O5O A;  4QIB A;  4DZ3 A;  1HXV A;  3KZ7 A;  3KAI A;  3IHZ A;  4ODR A;  2ZQS A;  2ZR5 A;  2JZV A;  3UI4 A;  2VCD A;  1JNS A;  1D7H A;  2L2S A;  3IK8 A;  2XP9 A;  3JXV A;  1C9H A;  3B09 A;  2MNT A;  1TCO C;  2M08 A;  4TYO A;  3JYJ A;  2KO7 A;  3KCE A;  4LAY A;  1Q6I A;  2N87 A;  2PV1 A;  1J4H A;  3O5P A;  4DRM A;  2Q5A A;  2F4E A;  1T11 A;  2PPO A;  4DRN A;  3RFW A; 
#chains in the Genus database with same CATH topology
 3W7U A;  3SPJ A;  2D3O W;  3T1H O;  4DRP A;  1X59 A;  5CA1 A;  1XRE A;  4QJF B;  2EZP A;  3G4S V;  5B1B C;  1BHB A;  3WIJ A;  1EYM A;  1YTF D;  5KMG B;  3E8B A;  2CK3 G;  1K4C C;  2EIN C;  1MMM A;  4WKH A;  2PTM A;  2BSK A;  3RVZ A;  2Q67 A;  4P2Z A;  1IBM O;  2EIN B;  2W6I G;  1GM8 A;  4WBN B;  2RUQ A;  3B2E E;  4EB6 A;  5LL6 Y;  4X20 B;  3ZRW B;  4Z1M G;  5LMU B;  4LGX A;  1BCC H;  1DF5 A;  2P7T C;  4N21 A;  1PNM A;  1D7I A;  3CGN A;  2ZE8 A;  3D3I A;  4KUM A;  1HDJ A;  2KR7 A;  1NR7 A;  1H2N A;  2LKN A;  1AP6 A;  3BMB A;  4I55 A;  2WSS G;  3TDB A;  1YW5 A;  2DPE A;  4PA9 A;  1FJG B;  2AGA A;  2R9I A;  1EFR G;  2BOB C;  1E1Q G;  2ZT9 B;  3AG4 C;  3WG7 C;  3CXC U;  2UUC O;  3K5O A;  1PKX A;  3SYQ A;  1M5I A;  1VF6 A;  3ML0 A;  2YI8 A;  3GB7 C;  4K3A A;  3BAA A;  4O4L B;  4P8V A;  1S72 V;  5DF0 A;  1V55 B;  2VQE B;  4DV4 O;  1XI1 A;  4MGV A;  2CTR A;  1N0J A;  5CB4 B;  1BKF A;  2YIB D;  2AZ0 A;  3APO A;  4UCV A;  5LGU A;  4D6T H;  4U84 A;  1NWT A;  1OZ0 A;  1EN5 A;  1EN4 A;  1M57 B;  1NWS A;  1J6Y A;  2DE0 X;  2V4D A;  3H1I H;  3QO8 A;  2LQT A;  2JJ2 G;  1D5A A;  2DN9 A;  2HEP A;  2CH7 B;  2VCD A;  1JNS A;  3JXV A;  3RGB A;  3JYJ A;  2BCC H;  3K58 A;  3JD3 A;  1SQB H;  2W6J G;  1Q3E A;  4NB5 A;  3OW2 U;  3CC2 V;  1OWQ A;  4K8Z A;  3SDL A;  5HWB A;  5EZY B;  4H37 A;  1F4N A;  4MVQ A;  3G6L A;  3JAT A;  3A0B Z;  3G6B A;  5BR8 B;  3JAW A;  3RM9 A;  2Z5U A;  2QWO B;  5DIV A;  4HBO A;  5IYC O;  4R0X A;  1UR8 A;  2VN1 A;  1BT8 A;  1VAR A;  4DR1 B;  4DV7 B;  4PA7 A;  2WLZ A;  2Q68 A;  1CP9 A;  4NTW A;  2QA4 V;  3WQW A;  4ZPW R;  1NTK H;  4NVP A;  1I0H A;  1FKR A;  1I5X A;  3F7V C;  3ABL B;  4UXN A;  2G41 A;  4OX9 O;  2AW9 A;  2OTL V;  3P3P A;  3T1C A;  4ODN A;  3G6M A;  1HJV A;  1K73 W;  4DH0 A;  4O4J B;  3CRQ A;  1F51 A;  5BZB A;  3F5T A;  4DW0 A;  1SC5 B;  5J2T A;  4IQ2 A;  1FD9 A;  2XAJ A;  3HKC A;  1R1B A;  2WLL A;  1AR5 A;  4MVM A;  2QWP B;  3SYO A;  4WFG A;  2MLY A;  4G2K A;  4CC5 A;  1FKI A;  2LW1 A;  3WB1 A;  3FB5 C;  5BXZ A;  2A3B A;  5EIB C;  2W0F C;  1H8E G;  1QR9 A;  3CCV V;  4LH7 A;  3OMA B;  3JAS A;  1M56 C;  4J10 A;  1W1T A;  3LNM B;  2WK2 A;  4I9W A;  2YDE A;  4J41 A;  3CX5 F;  4AY1 A;  2AHZ A;  5FNV B;  4I4T B;  4R5E A;  3D36 C;  1B3Q A;  4CZZ A;  4LFA O;  3H1K H;  4I50 B;  1FKL A;  3L75 H;  3FX7 A;  3O65 A;  2M1I A;  4Z2I A;  3EIP A;  3OTF A;  5JVD A;  1TUB B;  2CGN A;  4IIJ A;  3CYO A;  3ZJZ A;  2XT9 A;  1VF8 A;  3KZ7 A;  3KAI A;  2YIA A;  1IXB A;  2ODM A;  2Y4U A;  2YC0 A;  2ZNJ A;  4WCE V;  3TJT A;  3CME V;  2OCH A;  1GPF A;  5GQB A;  4QGP A;  4P9P A;  3KCE A;  1IXM A;  4XBF A;  4FMT A;  4DUY O;  4B7E A;  1RPO A;  4GX5 A;  5GON A;  2F66 C;  1YJ9 V;  5CN0 A;  4GLX A;  4OPA A;  3ASO B;  1HKJ A;  1SA0 B;  4JI4 B;  3SPC A;  4P8U A;  5KA5 A;  5C8Y B;  3HR0 A;  3SJB C;  3U10 A;  2ADQ B;  3JCU Z;  1NSG A;  4H33 A;  2ETN A;  4LF8 O;  2FYU H;  3FAP A;  1J5E B;  3ETG A;  4FPP A;  4JI5 B;  1I7F A;  1B04 A;  4IHJ B;  2AOS A;  4WFH A;  3B8N A;  1XBL A;  2HKO A;  4JV5 O;  3AK2 A;  2HLD G;  4MTX A;  4GKJ O;  3LUT B;  3MDS A;  1K33 A;  1P5Q A;  4O2B A;  1AJP A;  2XUM A;  4X66 B;  4PTM A;  2DT2 A;  1Y4M A;  1YXB A;  1W0J G;  1E6Z A;  1OJH A;  3P3N A;  1SS3 A;  3CCR V;  1COW G;  2JVD A;  4JFL A;  2RSE A;  4JI1 O;  2YUA A;  2P4V A;  3OGC C;  1PM9 A;  1BL4 A;  4GUN A;  1Q7Y W;  1IBK B;  1HNW B;  1K92 A;  4FLU A;  3H1H H;  3I55 V;  4JFK A;  4B3M B;  3ZHQ A;  3O5K A;  1R3L C;  4X1K A;  3E8F A;  2YXY A;  2BSK B;  2QKC A;  4U85 A;  4HAM A;  4DXW A;  1HNX B;  3WD0 A;  4DRO A;  2UXC B;  1XMO B;  2JIZ G;  1OCO C;  3K9A A;  4E4E A;  4Z2H A;  3OUF A;  1OCO B;  5DEZ A;  1Q1C A;  3CWB H;  5H6R A;  2UUB B;  1BS3 A;  4KQZ A;  3CRC A;  3RYF A;  4JAA A;  4TV9 A;  2OCC C;  3PA7 A;  3QOK A;  4P30 A;  2B1I A;  2ITD C;  2DJV A;  1NH2 D;  3IHZ A;  2ZM6 O;  1W1V A;  5H6Q A;  1AI6 A;  1YSC A;  4Z2W A;  3TET A;  4X1I B;  2Q8V A;  4TV8 B;  3ARY A;  1S5L Z;  3ABK B;  1J95 A;  3CCL V;  2CUG A;  1J4H A;  2P67 A;  2Q5A A;  2B5U B;  1WLE A;  1NBM G;  1NMW A;  1Y74 B;  5EBM C;  1PBK A;  4MW3 A;  3OOB A;  5DO2 A;  5LP6 A;  3ALG A;  3U0Z A;  3RGC A;  3O5D A;  3L71 H;  2ZR6 A;  4JZG A;  1OHH G;  2Q0A A;  5KHJ A;  1TFV A;  3LDE A;  2X6A A;  4ZPT R;  3R66 A;  4W5U A;  2E76 B;  1ARO P;  1FJD A;  4DR6 O;  4P8X A;  4MAV A;  2PF4 E;  4LCU C;  4DRK A;  2JS3 A;  4JYY A;  4DR7 O;  4OGQ B;  4YJ3 A;  2Q73 A;  5LMN O;  1FAP A;  2EBO A;  4MNL A;  4WKF A;  4N23 A;  4L87 A;  2JGU A;  2CE4 A;  1FXK B;  4J4O A;  3CHD A;  3FB6 C;  4X89 A;  2ZQV A;  4ZOL B;  3ARX A;  1TUE B;  5J9P C;  1P7B A;  3JAW B;  1FPO A;  3VQV A;  1H0I A;  2UUA B;  4O4I B;  3K57 A;  1U97 A;  3KG2 A;  4DR2 O;  2FDM A;  4U86 A;  4UCS A;  2ESC A;  2KKW A;  4CH5 A;  4CH6 A;  4JYB A;  5KHI A;  5L3B A;  2LPV A;  4AIL C;  2Q4P A;  4R6Z A;  4MS2 A;  4G27 B;  5BMV A;  5HUA A;  2R9R B;  3JYC A;  3OUS A;  1ZBC A;  4QT2 A;  3AS1 A;  3CS5 A;  2UZ5 A;  4J4N A;  5HW6 A;  4NNR A;  5FPO A;  1K5S A;  5D5P A;  3K0G A;  3UM7 A;  1XNR B;  2QTS A;  1WP7 A;  4JZ2 A;  2KSD A;  3ZRV A;  4BIO A;  1JX9 A;  2ADP A;  1RPR A;  3FAV A;  1UFI A;  1FFX B;  2JRI A;  2JEX A;  4TW6 A;  2IJH A;  4JFI A;  1TVK A;  2H8P C;  1KKC A;  4I9Q A;  3GWK C;  3SJA C;  2WAM A;  3KKY A;  3OEE G;  4TYO A;  1LUV A;  2QKS A;  1IBM B;  1D2D A;  3PN1 A;  1V54 C;  3BFR A;  2GTS A;  4FLT A;  3ARS A;  4L72 B;  3BPZ A;  1ORQ C;  1K3E A;  1V54 B;  3G71 V;  2YI9 A;  3HKD A;  4BWA A;  4H13 B;  3CHC A;  4UUJ C;  2GHY A;  4XDJ A;  5IJ0 A;  4GX0 A;  2WLM A;  4CS2 A;  1SZX A;  3K08 A;  5HW8 A;  4X1Y A;  3FKS G;  1AR1 B;  1VQ9 V;  3C90 A;  1SKV A;  3P30 A;  2DYR B;  2IM9 A;  4LFB O;  1UJW B;  2ITC C;  3SPH A;  2ZIN A;  4ZI7 B;  2RUD A;  3GU0 A;  3RWR D;  3K5M A;  3IKD A;  3UI6 A;  3L73 H;  4YIO A;  5JH8 A;  1MAB G;  3N2G A;  1OGG A;  1K7D A;  3O5Q A;  3ARU A;  4KL1 A;  3JSL A;  4ZBM A;  3IJ4 A;  1EZV H;  5H2F Z;  3BCC H;  5JQG A;  1YJW V;  3CCM V;  1SR0 A;  2GBO A;  2QM8 A;  5H9C A;  2MF9 A;  4ODK A;  5GON B;  1ZWI C;  3OGI B;  4MTV A;  4O4H A;  2QR4 A;  2Q0O C;  4LF4 O;  2CDY A;  1WP8 A;  3H1J H;  2E5L B;  1NTM H;  4FK5 C;  3RW0 A;  1XHZ A;  2XP6 A;  1EM1 A;  5TIS Z;  3ZRX A;  2Q5Z A;  2UXD B;  1NH6 A;  3QO5 A;  1YHQ V;  1SET A;  4LNU B;  3I56 V;  2JK5 C;  2WLK A;  1QLN A;  5KAI Z;  3KAB A;  1XNQ O;  1OCC B;  1NH2 B;  3HKB A;  3DC6 A;  1LG1 A;  2XPA A;  5KHH A;  1IZ3 A;  3N2K A;  4BW9 A;  5LOV B;  1YIJ V;  5I98 A;  4DV3 O;  1KT0 A;  3H9R B;  1KQS U;  3H9V A;  2RJZ A;  5IY5 B;  2ZE7 A;  1SRY A;  4ODL A;  1JFF B;  1M5Y A;  3BXW A;  3WQV A;  4DWS D;  1GN2 A;  2UXN A;  5KX5 A;  5LHH A;  3CGM A;  3D36 A;  4S3J A;  5BXJ A;  3N27 A;  1LL4 A;  2PV2 A;  2DWD C;  4JYC A;  1ZL8 A;  5KAF Z;  4X64 O;  1WB8 A;  3PR9 A;  1HR0 B;  3THO A;  1YJN V;  4DV0 O;  1N8R W;  3KCX A;  1HKI A;  2M08 A;  3T4D A;  4KXR A;  1E1R G;  4MNJ A;  1BHA A;  1IBL O;  4N19 A;  1LQ0 A;  4JAS A;  2O57 A;  1IVS A;  3UF8 A;  3UQI A;  3WFV A;  1NQT A;  1YIT V;  2QJ1 A;  4H0L B;  1Z5W A;  2JGD B;  1F23 A;  1WA8 A;  4WFB V;  2EX3 A;  2Q7G A;  1KEC A;  1Y67 A;  3CP1 A;  3ZHR A;  3ASN C;  1SES A;  4DT4 A;  2VWK A;  3T1Y O;  1VQ8 V;  4ODP A;  2HVJ C;  4LF9 O;  5HW7 A;  5J2U A;  3K06 A;  3ASN B;  4H44 B;  2EIJ C;  5CA0 A;  3B4S A;  4I5S A;  5DEC A;  4GKK B;  5IT9 N;  1S3J A;  1E44 A;  2VQF O;  2EIJ B;  3EXA A;  4YJ2 A;  2WLI A;  3DXR B;  2LW7 A;  2RNB A;  4Q20 A;  2ZD9 A;  4DRX B;  2GTA A;  2ILM A;  4UVA A;  1ZCN A;  5LGN A;  1S77 D;  3O5M A;  2LGW A;  3UQB A;  1HKM A;  1MZE A;  5LBQ A;  2A0L A;  4Q22 A;  2A7W A;  3UQ8 A;  5JH7 B;  2A3E A;  3FYE B;  5B1N A;  3DGE A;  4MT8 A;  3ALF A;  2RN9 A;  4Q6G A;  4DO2 A;  3SJC C;  2X7R B;  4UDM A;  1DGS A;  1ROT A;  4GX1 A;  1PP9 H;  1QCE A;  2YEV B;  2PY5 A;  1W1P A;  2EJR A;  1FKB A;  3LSQ A;  3M8A A;  4DZ2 A;  4MTG A;  1SF9 A;  1UR9 A;  1PNK A;  1N4C A;  4UVB A;  3MHH C;  1TAE A;  3WH0 A;  1LJY A;  2LO1 A;  4TQD A;  3DC5 A;  1KBH A;  4HBE A;  4K8X A;  1N33 O;  2BTQ A;  1XRV A;  3SPI A;  2JS5 A;  1F8A B;  3VAW A;  3CEI A;  4JYA B;  4TT3 G;  3MDY B;  2O9O A;  3UT5 A;  4MW8 A;  1N34 O;  3CCU V;  1HNZ O;  1V55 C;  5JCO A;  1ZAU A;  3O5O A;  4RQE A;  4ODR A;  3LSU A;  3WL0 A;  1SZT A;  2FL4 A;  2WLN A;  4YHH O;  1GUV A;  1VEW A;  4DK1 A;  1TCO C;  4MVS A;  4B3R O;  4WKA A;  5K1X A;  1R6K A;  2OWO A;  2Q6A A;  3RYC A;  1LL6 A;  4X62 B;  1SQP H;  1M57 C;  5KUM A;  1H2M A;  3BRC A;  3W4R A;  4JV5 B;  3OTO O;  3HPL C;  3K03 A;  1Q86 W;  4GKJ B;  4NXM B;  4NZC A;  1M9N A;  4ABM A;  1W9P A;  1WNO A;  2EUL A;  4GCZ A;  5BMV B;  1ENV A;  5HT1 A;  4LF5 O;  2KG7 A;  2E3C A;  4DR3 B;  2UXX A;  5L3G A;  5FLX N;  5E1A C;  1KP2 A;  1JVM A;  1N36 B;  1ZUQ A;  4JI1 B;  1YAT A;  3BAB A;  1QR8 A;  1YF2 A;  1GKF A;  4MVZ A;  4RUF A;  2F23 A;  2P6J A;  4I7Z B;  4RWU A;  4BIZ A;  2Q69 A;  2D9F A;  4NXN O;  1Q6U A;  3CHE A;  3DSQ A;  3JAR A;  3RYI A;  1AI7 A;  4QE7 A;  1N1A A;  1R3J C;  1FKK A;  3JAL A;  5B3S B;  4O2A A;  3CCE V;  4FLX A;  1I94 B;  2ZE6 A;  4DV5 O;  2QM4 A;  1Y76 A;  2V7Q G;  2F95 B;  3ABL C;  1RP3 B;  2WLJ A;  3ABM B;  5IJ0 B;  1E6P A;  4UFZ A;  2RCV A;  2PGG A;  4DWS C;  3AK3 A;  4KHP O;  2KFW A;  1GN3 A;  2PYJ A;  4DWS B;  1YVW A;  5C93 A;  5KHG A;  3CC4 V;  1SQQ H;  3CJH A;  1MNG A;  2ZCE A;  4IT6 A;  4NTY A;  5GTH Z;  3ARQ A;  1Q5O A;  1ZBV A;  1QHT A;  3F5W C;  5B1A B;  4JI8 B;  4FFB B;  4FFK A;  3KAG A;  2OTJ V;  4UV9 A;  1GRJ A;  3CCJ V;  3MHS C;  4RUE A;  4JI7 O;  1XQ8 A;  3AQU A;  1S5J A;  1EDQ A;  3E22 A;  4JI2 B;  1H38 A;  5IJ9 A;  4F4L A;  4FIP C;  3WU2 Z;  2DT3 A;  4B3S O;  1GM9 A;  1JCH A;  3LDD A;  1HXV A;  4JTD B;  3H1L H;  4D7T A;  4DV6 O;  5HBF A;  2ZR5 A;  1D5N A;  2MK3 A;  3MD0 A;  3C3T A;  1PNL A;  2PUS A;  5DIT A;  5EC1 C;  4F6E A;  1W26 A;  2QWR B;  4LFC B;  2M7W A;  1M90 W;  4ODO A;  2VS0 A;  3AG3 B;  3P32 A;  4DR7 B;  3NI6 A;  3JAK B;  1L1P A;  4J42 A;  3HKB B;  2K8I A;  1WB7 A;  2ZR2 A;  1R9H A;  3ART A;  4U3J A;  5GPR A;  3RM4 A;  1EZJ A;  2OYQ A;  2DWE C;  5LMU O;  2OFN A;  5KX5 B;  5EBW C;  1WB0 A;  3WD4 A;  2P90 A;  5HTG A;  3ASO C;  4LWS B;  1K34 A;  1MSD A;  1KU9 A;  4HNA B;  5GTI Z;  3TC5 A;  1QU7 A;  1ZL8 B;  3ZHV A;  3WKZ A;  4U3F H;  1AIL A;  4FZ1 A;  5LXT A;  1P84 F;  1KC8 W;  1SQX H;  5EYP B;  4P9O A;  3BEH A;  1HP8 A;  1FYJ A;  3ZED A;  2ARH A;  4K0K B;  4LF6 O;  3S3X A;  4LF7 B;  4ZPV R;  3BA9 A;  1M93 A;  1FJG O;  1RD6 A;  4W9Q A;  3RFR A;  3E86 A;  1FFT B;  5A2Q N;  3UCS C;  2ZIO A;  2UU9 B;  1A7X A;  1FKH A;  4PI2 A;  4LAW A;  1E6R A;  2GUZ B;  3ODK A;  1D7J A;  1PPJ H;  2DT1 A;  1JPX A;  2VQE O;  1M1K W;  4ZHQ B;  1FKJ A;  5J2U B;  1FKG A;  5ITZ A;  4BAY A;  2A3Q A;  3CXH F;  5CA0 B;  2M2A A;  3JCZ A;  4GT1 A;  2G38 A;  1NWR A;  3SPG A;  4TNS A;  1EQ3 A;  4YJ2 B;  5CA1 B;  2WLI B;  2LP7 A;  5L3E A;  2Q7E A;  2N04 A;  5CBF A;  1VMG A;  1ZBK A;  4R8C A;  3GWO A;  3JD4 A;  3K04 A;  1H0G A;  1V9P A;  1GMG A;  4ZKI A;  3IKG A;  2RQS A;  2N74 A;  4QIB A;  4U7O A;  5IYD O;  4URI A;  1ZB5 A;  2ZQS A;  5HFL A;  2ZXW B;  3O9O A;  4EB6 B;  1E6N A;  1JMK C;  2DQ3 A;  2L2S A;  4UVC A;  2Q9L A;  1QBZ A;  1WN7 A;  2PI4 A;  1QVF U;  1LL7 A;  4LAY A;  4FM0 A;  3ARV A;  2HP8 A;  3ZMS A;  4JI0 B;  1KYO F;  1N0N A;  2IJI A;  1N32 B;  4MPK A;  5BR8 O;  4GYC B;  4QZV B;  1XMQ B;  3ZIA G;  4DRH A;  3ZHS A;  4I0X A;  4I55 B;  1VQ7 V;  1O9H A;  1QLE C;  3SYA A;  3FD9 A;  4DV7 O;  2Z0A A;  2UXB B;  4TW8 A;  1GM7 A;  4RQF A;  3E89 A;  1QLE B;  1Q90 D;  3ABK C;  4DV1 B;  4L3N A;  4BF8 A;  1VF6 C;  1JNT A;  4WFF A;  1PL4 A;  3CCS V;  4LF4 B;  1QQC A;  3UT5 B;  4RO2 A;  3ETQ A;  4FM2 A;  4W9P A;  2Y0P A;  5JJJ B;  4J9Y B;  3OA5 A;  1PD3 A;  1E9L A;  3NR7 A;  4PDV A;  3KCY A;  4DUZ O;  2DMX A;  5HWC A;  1QVG U;  4HBN A;  5B66 Z;  2E74 B;  2DYS B;  2H3O A;  5CBG A;  1FFR A;  4XAK A;  5KMG A;  3KAF A;  4JI3 O;  4FM1 A;  3EY6 A;  4WJX A;  5IYZ A;  1XOU A;  4DR4 O;  2PPP A;  4ODQ A;  2OIG A;  3PRD A;  2DSV A;  5DIU A;  3OMI B;  1U79 A;  2PV3 A;  2KG7 B;  4PA6 A;  1XEQ A;  4X20 A;  5EK0 A;  3ZRW A;  2B1G A;  3F7Y C;  3L72 H;  4C7U A;  2XAQ A;  4X8A A;  3U11 A;  1KT1 A;  1ITX A;  1FXK C;  3J80 N;  4KR0 B;  4JI6 B;  3ZX6 A;  1L0L H;  2IBZ H;  1FKS A;  5LA6 A;  3CE2 A;  1KB9 F;  3OMN B;  4IQC A;  4JTA B;  3JAT B;  1G1X B;  2Y0I A;  2JEU A;  3K0D A;  3FB7 C;  4J9Z B;  3CRM A;  1X6L A;  3B40 A;  2XAG A;  1P7G A;  2F4V B;  2LGO A;  1MG1 A;  4Z2G A;  4IYI A;  2EIL B;  2HHH O;  1R73 A;  4DZ3 A;  3G80 A;  1I5Y A;  3IAY A;  4B3T B;  4B08 A;  1SQF A;  3UI4 A;  1DK1 A;  2YSU B;  3EFF K;  3ARW A;  3M99 B;  2QGN A;  2ZQM A;  1CTN A;  1FS0 G;  3VQX A;  2N87 A;  5CB4 A;  3AG7 A;  3A0H Z;  4JI4 O;  4PDM A;  4QE9 A;  1VQ4 V;  3CHX A;  3O5G A;  2CTQ A;  3T1H B;  5J2T B;  2B9Z A;  2EIM B;  1GTO A;  2HG5 C;  3HKC B;  4J11 A;  2WLL B;  1J5E O;  2IU0 A;  4JI5 O;  4TSF G;  4MNK A;  2P22 C;  2QE7 G;  3QO7 A;  2CH7 A;  2IJJ A;  1W2B U;  2RDC A;  4RAI A;  5JJE B;  2EIK B;  3JAS B;  2GDS A;  5KA6 A;  2KI3 A;  3I6C A;  1S0V A;  4X66 O;  2IJK A;  4NSB A;  1QNM A;  4MTF A;  4D7S A;  5FL7 G;  5EZY A;  2P5O A;  2JDI G;  2XTA A;  3ZMT A;  3CH9 A;  4TX0 A;  2BE3 A;  3WD1 A;  2DYR C;  5LYJ A;  2WA3 A;  4R50 A;  3B8S A;  1LG2 A;  2KE0 A;  1KFW A;  2HR3 A;  1IBK O;  1HNW O;  1X6N A;  1PL0 A;  3VBB A;  4JFM A;  5LHI A;  2WWW A;  5JVD B;  1P49 A;  3WB2 A;  5B8I C;  4IIJ B;  3O5L A;  1Q82 W;  2UUC B;  1HNX O;  5BY1 A;  2UXC O;  4L8J A;  1AB3 A;  1XMO O;  2N05 A;  4BIU A;  1N34 B;  3LSS A;  1HNZ B;  3ARO A;  1Y0O A;  2X6B A;  1ZBW A;  1FKF A;  4TWK A;  4DV4 B;  3TCZ A;  4O4J A;  3Q4H A;  5KUK A;  2XAH A;  3OEH G;  3H01 A;  4X9Q A;  2A79 B;  2UUB O;  3X2Q B;  4QT3 A;  3CC7 V;  2AZ2 A;  1NTZ H;  1YI2 V;  1ZTE A;  3HKE A;  3JD1 A;  4O2T A;  4FVM A;  4PA4 A;  4OPH A;  4QNH B;  2QTO A;  2ZDI C;  4MVR A;  2G8Z A;  3W7S A;  3OR6 C;  1OCC C;  3OE7 G;  2ZE5 A;  3RT3 C;  1RSO A;  5L3F A;  3OAA G;  5IY5 C;  1SER A;  4YXW G;  3STZ C;  5FNV A;  4I4T A;  2F4E A;  3SYC A;  4ASU G;  4DRN A;  5IE9 A;  4O2B B;  3AS2 A;  4DW1 A;  2IW5 A;  4BR6 A;  3NTP A;  3CRR A;  1Z5V A;  5J6E A;  4I50 A;  1ZX3 A;  1DLB A;  2HVK C;  3WB0 A;  1XL4 A;  1TUB A;  1FXV A;  1NZ6 A;  3TXQ A;  1KKD A;  2FAP A;  3AK1 A;  3C3S A;  1VF7 A;  2EZO A;  2FTK A;  2YXL A;  1F40 A;  1DTO A;  3L70 H;  3NXS A;  1MZF A;  4FJC C;  2R70 A;  1FXH A;  3ZCC A;  5LGT A;  1JOY A;  2ZQU A;  4X1K B;  4JPR A;  3GVM A;  5EBL C;  2LJ4 A;  3G6E V;  1WAW A;  4ICG A;  4EKW A;  3CPW U;  4FZ0 A;  3ICX A;  3ABU A;  4OX9 B;  1SA0 A;  2F1M A;  2PI6 A;  2CTP A;  4J7K A;  3UO3 A;  2DQ0 A;  1L8D A;  2L6L A;  2YBT A;  5GPG A;  3QNE A;  1RM1 C;  5JJN B;  2UUA O;  1OCZ B;  2XP8 A;  3RYF B;  4TV9 B;  5CMU A;  4IHJ A;  1RM1 B;  3UO2 A;  4A5U B;  4NR1 A;  1O6I A;  3JD0 A;  3SJQ C;  4KP4 A;  1JND A;  5HKG A;  1Y6X A;  1K4D C;  2A06 H;  2PI5 A;  4F6R A;  2MW2 B;  1F7Y A;  2LFS A;  1XHX A;  5L3D A;  1NS1 A;  4JYS A;  3JAM N;  2Y78 A;  2IH1 C;  1XNR O;  2Y69 B;  2YBU A;  5LP6 B;  4CS4 A;  3TCU A;  2CGO A;  4DYL A;  4ODM A;  2YIB A;  2M6Y A;  4LFA B;  2HJF C;  1BZK A;  1AJQ A;  4XDL A;  1AI5 A;  3RYH A;  1MOF A;  4GIV A;  5B1B B;  4WIW A;  4MVO A;  2CAZ C;  1JJO A;  4G28 B;  5IYZ B;  1CXZ B;  2BTO A;  3IFX A;  2XOK G;  4UCT A;  4NTX A;  1VIB A;  3IK8 A;  2EJ7 A;  5IYB O;  5CA3 A;  1IUR A;  2KO7 A;  2X0L A;  1Y66 A;  4YJ3 B;  4DRM A;  3VQY A;  4AQY O;  1T11 A;  1TA8 A;  2RUC A;  4DUY B;  3STL C;  1BSM A;  3A0R A;  3LNN A;  2ZQT A;  1VQ6 V;  4UB8 Z;  4TW7 A;  5KLV H;  1NT2 B;  3BA8 A;  3RVY A;  3BY6 A;  5L3C A;  2YS8 A;  1K9M W;  3SR2 C;  5LA6 B;  1OV9 A;  4DIP A;  4LF6 B;  2PBC A;  4LF8 B;  3FYI B;  1LR1 A;  2FKE A;  4X65 O;  1KD1 W;  4DR5 O;  2DT0 A;  4X1I A;  5IWA O;  4TV8 A;  2LFR A;  4GGQ A;  4EFB A;  2PPN A;  4ZIB A;  3E8H A;  1JJ2 U;  4W4K A;  1ROP A;  2XPB A;  3OR7 C;  5DN6 G;  2B5U A;  1AP5 A;  3AG4 B;  3WG7 B;  2YXH A;  2BOC C;  3ETD A;  1JA8 A;  4OXS A;  3VOU A;  3ZHT A;  1Y74 A;  4CBC A;  1JVW A;  2XHB A;  1AVM A;  3T4Z A;  3QG5 A;  3AG2 C;  2FB5 A;  4JAV A;  1OCR C;  1R3K C;  2E5L O;  2DW4 A;  1R3I C;  4UCU A;  4PEL A;  3FAV B;  5F2V O;  4WK9 A;  3AG2 B;  4YY3 O;  1OCR B;  2F93 B;  1ZU8 A;  4J80 A;  2UXD O;  1B6C A;  1TVK B;  1CEZ A;  1HKK A;  1NI8 A;  3FB8 C;  1W0K G;  4DV2 O;  1NWU A;  3K5L A;  4ITZ A;  1GH6 A;  5B3S C;  1JNE A;  1QPF A;  3APQ A;  1BE3 H;  2OIE A;  3UKM A;  1SQG A;  2Q7H A;  3TXS A;  4W9O A;  1RFY A;  3AEI A;  3ABM C;  2XP7 A;  1W1Y A;  3O5F A;  3O5I A;  3QF7 A;  3ZHU A;  3HKD B;  1FXK A;  3O5E A;  4TQF A;  4ZOL A;  3IGA C;  1THZ A;  5LYJ B;  5DM6 V;  1FAF A;  2WPD G;  4X1Y B;  4O4I A;  1GN6 A;  1VQL V;  2ZR4 A;  1K5Q A;  1HR0 O;  2O92 A;  1BGY H;  5IDJ A;  5B1A C;  5E79 Z;  2ZM6 B;  1A32 A;  5LHG A;  2MNT A;  3N2G B;  4X88 A;  3L9D A;  1IX5 A;  3LUO A;  1BL8 A;  3IC7 A;  3B9A A;  4WF9 V;  1PV0 A;  5JQG B;  5D5Q A;  1S5H C;  2P06 A;  3PRA A;  2WLY A;  2MLZ A;  4JFJ A;  3TGU H;  4DUZ B;  3B9E A;  3AS3 A;  2VWJ A;  3JYM A;  3Q4H B;  4O4H B;  3AG1 C;  3CHF A;  1ZL1 A;  1FFX A;  4G2P A;  1Q8I A;  2LGQ A;  1EIB A;  3AG1 B;  1TGO A;  1O9G A;  3HKE B;  4JI3 B;  4GKK O;  4Z2L A;  2OT5 A;  4DR4 B;  1WPX A;  3ARP A;  2NNU A;  3G67 A;  3K79 A;  3AG3 C;  1FFQ A;  4DR6 B;  4DRJ A;  4E2L A;  1EN6 A;  1HJX A;  2R9A A;  1H2K A;  1RSO B;  3FXY A;  2GV9 A;  1M56 B;  5LMN B;  3ZMV A;  1NVP D;  2PZS A;  3N2K B;  2A3C A;  3J81 N;  2PYL A;  1R6T A;  4LAX A;  1H2L A;  1W9V A;  2AXT Z;  3M7M X;  1U96 A;  2ZKO A;  3JD2 A;  2ZNI A;  1VQM V;  3NRK A;  4BW5 A;  4U7N A;  5DED A;  4ZI7 A;  3CRA A;  5B5E Z;  1VQ5 V;  3CD6 V;  4DR2 B;  1X4T A;  4HZ3 A;  2HHH B;  1YTF B;  2DG9 A;  3PJS K;  4TUY A;  1FKD A;  2MLX A;  3O5J A;  4DRI A;  4PA3 A;  3KZI Z;  2K1E A;  4PJ0 Z;  4FLW A;  4IT5 A;  3GPK A;  4AI8 A;  1ROU A;  4JYA O;  4MSP A;  2OLH A;  1AJN A;  2IF4 A;  3DTU B;  4DRQ A;  1Q81 W;  1WA8 B;  2QKA A;  2RQ6 A;  1GN4 A;  1JR9 A;  1K9T A;  3MAQ A;  3J7A U;  1J4R A;  1HJW A;  1VQP V;  2ATK C;  1VF5 B;  4LNU A;  2AHY A;  2XP9 A;  1Z2G A;  4X62 O;  3B77 A;  3K9S A;  4JAU A;  2KB1 A;  4JGS A;  1E15 A;  1AI4 A;  2ZDI A;  1Q6I A;  4W4L A;  2PV1 A;  5KHK A;  1WAZ A;  4F6R B;  4NXM O;  4J7J A;  4J7Z A;  1XL6 A;  5H5N A;  5LOV A;  1QPL A;  1CPY A;  3CSX A;  2RUR A;  4NKG B;  2WM0 A;  4EFE A;  4Q7N A;  3B9D A;  4DR3 O;  1JFF A;  2ZXW C;  1SYT A;  1GK9 A;  3W7W A;  1GAX A;  3B8M A;  4PHZ A;  1YCI A;  4CH4 A;  2B31 A;  3OM3 B;  1L1F A;  3CZ8 A;  4EEQ A;  1N36 O;  2XP3 A;  1P4R A;  1H2S B;  4LFB B;  2QWN B;  2YIC A;  3RYH B;  1YDX A;  1VQO V;  4ZS6 A;  1D2K A;  3BHP A;  5FPR A;  4MVU A;  4FLV A;  3KAD A;  4DR1 O;  1SQV H;  4HAR A;  2F2D A;  1G8M A;  3AS0 A;  4G50 A;  1EHN A;  1I94 O;  2JGD A;  3ZS8 C;  3EHB B;  5A9G A;  2BTQ B;  4R7C A;  4ML4 A;  5JCO C;  4MTO A;  3LDC A;  1KMI Z;  3CCQ V;  4CH3 A;  1XUQ A;  3A2F A;  1MA1 A;  4CC6 A;  1NU1 H;  2GSM B;  2DYS C;  1FKT A;  4LR3 A;  3WL1 A;  3VQW A;  4WFE A;  2DSW A;  3DXR A;  2OCC B;  3CB2 A;  4DRX A;  1T5E A;  1YEW A;  3RYC B;  3W7X A;  2C2A A;  4JI8 O;  1R6N A;  2HJD A;  4LAV A;  1KUQ A;  1XNQ B;  5JH7 A;  4JI2 O;  3ARR A;  1K8A W;  4HYO A;  4DV3 B;  3OFN G;  4WBN A;  1NMV A;  2YID A;  4P8W A;  3UQA A;  3SGI A;  3PRB A;  4LBE C;  3JSN A;  5B1O A;  1NJI W;  5GW7 A;  2F43 G;  2ZIM A;  2PN0 A;  2YEV A;  4PI0 A;  2DOS A;  1L0N H;  1XIL A;  4UB6 Z;  4AHC A;  3T2M A;  3R65 A;  4X64 B;  2ZR3 A;  1W9U A;  3B09 A;  1BQZ A;  3ZN1 A;  4DV0 B;  3O5P A;  4CS3 A;  4XDK A;  4LFC O;  2IU3 A;  2NLJ C;  3RFW A;  3ABT A;  1W59 A;  2CTW A;  4IT4 A;  1LNQ A;  2EIL C;  3OD4 A;  1IBL B;  1EBO A;  3JAR B;  3RYI B;  1GOI A;  1PIN A;  3K3W A;  3FY1 A;  3E2E A;  3JAL B;  4PDR A;  4FLY A;  4O2A B;  3SYP A;  1LUW A;  3IC9 A;  1H8H G;  2LJ2 A;  1Y76 B;  1OGB A;  4QPJ A;  1NVP B;  3I5D A;  4O4L A;  1NKD A;  3T1Y B;  1YZB A;  2Z3Y A;  3OT7 A;  5JWP A;  4LF9 B;  2IH3 C;  2V1D A;  2MPH A;  4UV8 A;  2EIM C;  3CJH B;  3E8G A;  4PD4 F;  4LC1 A;  2VQF B;  4PV1 B;  3K5N A;  4K0K O;  4LF7 O;  3S3W A;  4K35 A;  4NYK A;  1IDS A;  4IPX A;  3E22 B;  2EIK C;  2R72 A;  2UU9 O;  3BVO A;  5IJ9 B;  3RME A;  5EC2 C;  3ZMU A;  1G4Y B;  3RN4 A;  4B7K A;  2DSU A;  1ZK6 A;  4LH6 A;  1JCH B;  1B06 A;  1AR4 A;  2NN4 A;  3K59 A;  1WNS A;  5CBH A;  1VQN V;  2F21 A;  4DK0 A;  1GO3 F;  1HWY A;  2W0X A;  4GZR B;  2VRZ A;  2KGJ A;  2KQX A;  2Y48 A;  4FN2 A;  3RBZ A;  4Z1V A;  3W7T A;  2QM7 A;  3CMA V;  1D6O A;  3FFQ A;  4QPK A;  1I08 A;  5K1P A;  2Y4T A;  4C02 B;  1WPB A;  4FAP A;  3D3Q A;  1XDC A;  2H94 A;  4MSW C;  3UI5 A;  4AQY B;  3WD2 A;  2QWQ B;  2XND G;  5AG2 A;  2QEX V;  4B3M O;  3QVN A;  1N33 B;  1UPG A;  4U3J B;  2FML A;  2AWG A;  2RMK B;  2D2C B;  1E79 G;  2JZV A;  4Z2J A;  1F4M A;  3WD3 A;  4QIW F;  3RM8 A;  4DWS A;  3ZN0 A;  4YHH B;  4JI0 O;  4KFM A;  1ZSP A;  2IUZ A;  3X2Q C;  1N32 O;  3ZBH A;  4JF3 A;  4B3R B;  2NR5 A;  3ZRS A;  4X65 B;  4GX2 A;  2QSA A;  4DR5 B;  1BMF G;  5IWA B;  5LXT B;  4FFB A;  2L35 A;  1DF4 A;  3E35 A;  1XMQ O;  2XAF A;  1G6U A;  2X6C A;  3OTO B;  2ITK A;  2QF8 A;  4TUY B;  2DSZ A;  2UXB O;  3B7X A;  1ZLZ A;  4DV1 O;  1Q6H A;  2WLH A;  5HFM A;  3ZMZ A;  3O5R A;  4IGG A;  4LF5 B;  1URF A;  3A8T A;  4TOI A;  2DG3 A;  1H2G A;  2DG4 A;  2HFE C;  2P4K A;  1B6Q A;  4YY3 B;  2XAS A;  5ITZ B;  4IYH A;  3KAH A;  4MNM A;  2E75 B;  2JJ1 G;  3GTY X;  3D8C A;  1IX9 A;  3JAK A;  4DV2 B;  4NXN B;  3TK1 A;  4YIP A;  3HB3 B;  1J4I A;  1QZ2 A;  4DV5 B;  4LP8 A;  1JQ0 A;  4WFA V;  3KAC A;  2K9P A;  4LWS A;  3ETE A;  1MSW D;  4HNA A;  2XP4 A;  1S76 D;  4PDL A;  4KHP B;  4JI6 O;  1KP3 A;  4FLZ A;  2WA4 A;  5EYP A;  1XHG A;  5C8Y A;  1FKA O;  2QDO A;  1OCZ C;  1NR1 A;  4UCR A;  3L74 H;  4Z2K A;  2F4V O;  1VP7 A;  4IL6 Z;  5EIB D;  4I0X B;  1US6 A;  5D75 A;  4JI7 B;  2XP5 A;  2A9H A;  4B3T O;  3QTC A;  4JTC B;  1BQ0 A;  1K97 A;  4B3S B;  2GUZ A;  2FKX A;  1D7H A;  1HW7 A;  4ZHQ A;  4DV6 B;  1C9H A;  3ARZ A;  3EVK A;  3E83 A;  2A3A A;  1WJZ A;  2Y69 C;  4UCO A;  1Q43 A;  5LP6 C;  4S3K A;  1M4U A;  2PPO A;  1VQK V; 
#chains in the Genus database with same CATH homology
 3ARS A;  4L72 B;  3B9A A;  4MPK A;  4DRP A;  3PRA A;  2WLY A;  2MLZ A;  4JFJ A;  3WIJ A;  1EYM A;  4QZV B;  3CHC A;  3B9E A;  4DRH A;  3AS3 A;  3JYM A;  3CHF A;  1ZL1 A;  4G2P A;  5HW8 A;  4TW8 A;  4WKH A;  1EIB A;  4L3N A;  4BF8 A;  1JNT A;  2RUQ A;  4Z2L A;  2RUD A;  3IKD A;  3ARP A;  4W9P A;  4LGX A;  1FFQ A;  3UI6 A;  3OA5 A;  4DRJ A;  5JH8 A;  1E9L A;  1OGG A;  3O5Q A;  1HJX A;  3ARU A;  5HWC A;  3FXY A;  1D7I A;  3CGN A;  1SR0 A;  2KR7 A;  1FFR A;  4XAK A;  2MF9 A;  4ODK A;  2LKN A;  3KAF A;  2A3C A;  4MTV A;  3TDB A;  1YW5 A;  2DPE A;  3EY6 A;  1W9V A;  4LAX A;  4WJX A;  2PPP A;  4ODQ A;  3PRD A;  2DSV A;  3NRK A;  5DIU A;  1U79 A;  2XP6 A;  2PV3 A;  1NH6 A;  4P8V A;  1KT1 A;  1ITX A;  2DG9 A;  5DF0 A;  4MGV A;  3KAB A;  1BKF A;  4KR0 B;  1FKD A;  2XPA A;  1LG1 A;  2MLX A;  3O5J A;  1FKS A;  4DRI A;  4IQC A;  5I98 A;  1KT0 A;  3H9R B;  3GPK A;  4U84 A;  1ROU A;  1NWT A;  1X6L A;  4ODL A;  4MSP A;  2OLH A;  1M5Y A;  2IF4 A;  1NWS A;  3BXW A;  3WQV A;  4DRQ A;  4DWS D;  2LGO A;  3CGM A;  4S3J A;  4Z2G A;  5BXJ A;  1J6Y A;  1LL4 A;  1K9T A;  4DZ3 A;  2PV2 A;  1J4R A;  1HJW A;  3PR9 A;  3UI4 A;  2VCD A;  1JNS A;  3JXV A;  2XP9 A;  3ARW A;  1HKI A;  2M08 A;  3JYJ A;  1E15 A;  1CTN A;  1Q6I A;  2N87 A;  2PV1 A;  1OWQ A;  4MNJ A;  5HWB A;  4N19 A;  1LQ0 A;  1QPL A;  2RUR A;  3G6L A;  3O5G A;  3UF8 A;  3UQI A;  2WM0 A;  4Q7N A;  3RM9 A;  5DIV A;  3B9D A;  4HBO A;  4R0X A;  1SYT A;  1UR8 A;  2VN1 A;  2B31 A;  4MNK A;  4DT4 A;  2WLZ A;  3CZ8 A;  4ODP A;  5HW7 A;  2XP3 A;  3WQW A;  4ZPW R;  4ZS6 A;  1D2K A;  1FKR A;  2KI3 A;  3I6C A;  2G41 A;  4NSB A;  3KAD A;  1ZCN A;  4ODN A;  3O5M A;  3G6M A;  1HJV A;  3CH9 A;  4HAR A;  4TX0 A;  3UQB A;  1HKM A;  4DH0 A;  2F2D A;  3WD1 A;  3AS0 A;  4G50 A;  4Q22 A;  1EHN A;  4IQ2 A;  2A3E A;  1FD9 A;  3B8S A;  1LG2 A;  2KE0 A;  3ALF A;  1KFW A;  4ML4 A;  2MLY A;  1FKI A;  1X6N A;  4JFM A;  5B8I C;  1ROT A;  2A3B A;  3O5L A;  1W1P A;  1FKT A;  1FKB A;  1W1T A;  2WK2 A;  4DZ2 A;  3WL1 A;  2DSW A;  1UR9 A;  3ARO A;  1Y0O A;  4AY1 A;  3WH0 A;  1ZBW A;  1FKF A;  4LAV A;  1LJY A;  4R5E A;  3TCZ A;  3ARR A;  4HBE A;  4QT3 A;  1XRV A;  1FKL A;  1NMV A;  1F8A B;  3VAW A;  2M1I A;  4Z2I A;  4O2T A;  3MDY B;  2O9O A;  4P8W A;  3UQA A;  3PRB A;  3O5O A;  2G8Z A;  1VF8 A;  3KZ7 A;  3KAI A;  4ODR A;  3WL0 A;  1GUV A;  1GPF A;  1W9U A;  3B09 A;  5GQB A;  1TCO C;  4WKA A;  3KCE A;  1LL6 A;  3O5P A;  2F4E A;  4DRN A;  3RFW A;  3W4R A;  3AS2 A;  4IT4 A;  1HKJ A;  4NZC A;  3NTP A;  1W9P A;  1GOI A;  1PIN A;  1WNO A;  5J6E A;  4P8U A;  3FY1 A;  5HT1 A;  1NSG A;  2FAP A;  3FAP A;  1OGB A;  1F40 A;  2AOS A;  2MPH A;  2ZQU A;  1YAT A;  2LJ4 A;  1WAW A;  1P5Q A;  2D9F A;  4PTM A;  2DT2 A;  1Q6U A;  3CHE A;  2PI6 A;  1N1A A;  1E6Z A;  1FKK A;  2YBT A;  5GPG A;  4IPX A;  4JFL A;  2RSE A;  3RME A;  2XP8 A;  1BL4 A;  2DSU A;  1ZK6 A;  1O6I A;  1E6P A;  4DWS C;  1JND A;  4JFK A;  5HKG A;  3O5K A;  2KFW A;  2F21 A;  4U85 A;  4DWS B;  3WD0 A;  2KGJ A;  4DRO A;  4FN2 A;  4IT6 A;  3ARQ A;  1ZBV A;  4JYS A;  4Z2H A;  2Y78 A;  3KAG A;  1D6O A;  5DEZ A;  4C02 B;  1Q1C A;  4FAP A;  3WD2 A;  3UI5 A;  3AQU A;  1EDQ A;  2YBU A;  4KQZ A;  4ODM A;  2DT3 A;  3QOK A;  3PA7 A;  2AWG A;  4GIV A;  4WIW A;  1HXV A;  3IHZ A;  1W1V A;  5HBF A;  2ZR5 A;  2JZV A;  4Z2J A;  3WD3 A;  3IK8 A;  3RM8 A;  4DWS A;  3ARY A;  2IUZ A;  2KO7 A;  1J4H A;  4DRM A;  2Q5A A;  1T11 A;  5DIT A;  2RUC A;  1W26 A;  1NMW A;  2ZQT A;  4ODO A;  4TW7 A;  1PBK A;  3NI6 A;  3OOB A;  2ITK A;  5DO2 A;  1L1P A;  2QF8 A;  2DSZ A;  3ALG A;  3B7X A;  3RGC A;  2K8I A;  3O5D A;  2ZR6 A;  1R9H A;  1Q6H A;  3ART A;  3O5R A;  1TFV A;  5GPR A;  3RM4 A;  4DIP A;  2PBC A;  4ZPT R;  2DG3 A;  2FKE A;  2OFN A;  4W5U A;  1WB0 A;  3WD4 A;  1FJD A;  5HTG A;  2DT0 A;  2DG4 A;  4P8X A;  4GGQ A;  2PPN A;  4MAV A;  4DRK A;  3TC5 A;  2XPB A;  3WKZ A;  3KAH A;  4MNM A;  1FAP A;  4MNL A;  1JVW A;  4WKF A;  4ZPV R;  4J4O A;  1RD6 A;  3CHD A;  4W9Q A;  2ZQV A;  1J4I A;  3ARX A;  4WK9 A;  1QZ2 A;  1ZU8 A;  1H0I A;  1A7X A;  1FKH A;  3KAC A;  1B6C A;  2FDM A;  1HKK A;  1E6R A;  4LAW A;  4U86 A;  3ODK A;  2ESC A;  1D7J A;  2DT1 A;  2XP4 A;  2LPV A;  1FKJ A;  1NWU A;  4ITZ A;  1FKG A;  1JNE A;  1QPF A;  2M2A A;  5HUA A;  1XHG A;  1ZBC A;  4QT2 A;  1NWR A;  3AS1 A;  4W9O A;  5HW6 A;  2UZ5 A;  4J4N A;  4NNR A;  4TNS A;  1EQ3 A;  3O5F A;  2XP7 A;  1W1Y A;  3O5I A;  4Z2K A;  3O5E A;  1ZBK A;  5D75 A;  1H0G A;  2XP5 A;  4TW6 A;  3IKG A;  2ZR4 A;  2RQS A;  4JFI A;  4QIB A;  2O92 A;  4URI A;  1ZB5 A;  2ZQS A;  1E6N A;  1D7H A;  2L2S A;  1C9H A;  3ARZ A;  2MNT A;  4TYO A;  2A3A A;  1LL7 A;  4LAY A;  3ARV A;  1IX5 A;  4S3K A;  3LUO A;  2PPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...