1Q6UA

Crystal structure of fkpa from escherichia coli
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
213
structure length
213
Chain Sequence
b'AFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVKPAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase fkpA
molecule tags Isomerase
source organism Escherichia coli
publication title Structural and functional studies of FkpA from Escherichia coli, a cis/trans peptidyl-prolyl isomerase with chaperone activity.
pubmed doi rcsb
total genus 73
structure length 213
sequence length 213
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2003-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF01346 FKBP_N Domain amino terminal to FKBP-type peptidyl-prolyl isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.460 Mainly Alpha Orthogonal Bundle Helix Hairpins Peptidyl-prolyl cis-trans isomerase, FKBP-type, N-terminal domain 1q6uA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1q6uA02
2XP7A 1F8AB 1M5YA 2RSEA 3O5GA 2DG4A 2M08A 2XP9A 4JFMA 1FKSA 4ODNA 2N87A 2PBCA 5DIVA 3UF8A 4W9QA 3KAFA 5HTGA 2F2DA 3ODKA 2RQSA 3O5OA 3IHZA 2KI3A 4DRIA 4DRHA 3FAPA 3JYMA 1B6CA 3B09A 2M1IA 2Y78A 3KADA 4JFIA 4JYSA 1J6YA 1J4HA 2XPBA 1FKJA 4LAWA 4BF8A 2IF4A 3CGNA 1JNSA 4DRQA 4IQCA 2JZVA 2MLZA 3NRKA 3PRBA 4ODKA 4R0XA 4W9PA 4C02B 1Q6HA 5HW8A 2MPHA 3O5PA 2XPAA 1QZ2A 2LGOA 1YATA 3JYJA 1NSGA 3GPKA 1F40A 2ZR6A 5DITA 3KAGA 3NTPA 2PPNA 4TW8A 1Q1CA 4TYOA 3TCZA 2MLXA 2ZQVA 1ROUA 1J4RA 2Q5AA 4DZ3A 1NMVA 1NMWA 2XP3A 3H9RB 1J4IA 1D7IA 1W26A 1FKIA 1R9HA 3KABA 4JFLA 2MNTA 5HW7A 1Q6UA 4DRJA 2ZQTA 4TW7A 4DRMA 5I98A 1D7HA 4ODPA 4QIBA 1FKKA 3O5DA 1JVWA 4DROA 4N19A 3O5MA 3KAIA 4G50A 4MGVA 2D9FA 1FAPA 2UZ5A 4ODOA 2PPPA 3KZ7A 5HWCA 3TC5A 2FKEA 4JFJA 2VCDA 2XP4A 3O5LA 4DZ2A 3RFWA 4IPXA 3IKDA 3UI4A 2MF9A 3KCEA 3UQBA 4J4OA 1TCOC 5HKGA 5D75A 5B8IC 4GIVA 1KT0A 1T11A 2XP5A 3UI6A 4DH0A 4DRKA 1FD9A 3IKGA 1FKGA 3B7XA 4DRPA 2M2AA 1Y0OA 5J6EA 2PV1A 2RUDA 1PBKA 1ZCNA 2F21A 1N1AA 2PV3A 4MSPA 1Q6IA 1FKLA 4O2TA 3PRDA 3UQIA 3O5JA 2LKNA 2MLYA 3O5EA 1FJDA 2F4EA 4DT4A 1P5QA 3IK8A 5DIUA 2ZQSA 4DIPA 1FKTA 1PINA 4U84A 3KAHA 3KACA 1D6OA 1FKHA 2PPOA 3TDBA 4IQ2A 2LJ4A 1JNTA 3UQAA 2XP6A 4FN2A 1L1PA 3MDYB 2RUQA 3CGMA 3JXVA 3NI6A 4W9OA 2OFNA 3LUOA 3O5IA 4DRNA 2KE0A 2KO7A 3EY6A 4LAXA 1ROTA 3OOBA 3I6CA 4ODLA 1A7XA 1YW5A 4FAPA 4TW6A 5HWBA 4ODQA 4LAYA 4TX0A 2ZQUA 1HXVA 3O5KA 3O5QA 2KGJA 2ITKA 2DG3A 2ZR5A 1QPLA 1FKDA 4ODMA 4U86A 1ZK6A 1BKFA 2RUCA 4NNRA 3VAWA 3WH0A 5HT1A 5HUAA 5HW6A 4ITZA 1C9HA 4U85A 3RGCA 2KR7A 3O5FA 1FKRA 3O5RA 4QT3A 2VN1A 2RURA 2K8IA 4J4NA 4G2PA 2FAPA 4GGQA 4QT2A 1QPFA 1FKBA 2ZR4A 2XP8A 5BXJA 1KT1A 2DG9A 4TNSA 1D7JA 4ODRA 1EYMA 2KFWA 1BL4A 2L2SA 5GPGA 2LPVA 3UI5A 1FKFA 4LAVA 1EQ3A 1U79A 3PA7A 4JFKA 2AWGA 2PV2A
chains in the Genus database with same CATH superfamily
3U10A 3O5GA 1LG1A 4ODNA 2N87A 1SQXH 4DR7O 5KX5B 2VS0A 3ZBHA 4GKJB 4DV7O 1H2SB 3WQWA 2D2CB 2GV9A 1S0VA 1K73W 1QVFU 5JH7B 1K97A 2LO1A 4L8JA 4QE7A 1ZL8A 4CC6A 5LGTA 2JRIA 3E35A 4NZCA 2E5LB 3JYJA 1KP2A 2Z0AA 1G6UA 2JGDA 4UDMA 2PPNA 2DYSB 3ABLC 5EYPB 3E22A 1JCHB 1R9HA 4KXRA 3WQVA 2WLYA 1GN2A 1RP3B 1H2GA 1QR9A 3O65A 1HWYA 1Z2GA 1E9LA 4PDLA 3N2KA 2P7TC 4FM0A 3E89A 1QBZA 3ABUA 1Q86W 1QQCA 3MHHC 1S5HC 5DECA 3K58A 1ZSPA 3D36C 2DOSA 4UCUA 3Q4HA 1BMFG 1XMOO 4JI4O 2WA3A 2XTAA 2QR4A 4J42A 2DT0A 1UJWB 1Y76A 2V4DA 4NTXA 4X62B 2A9HA 4RAIA 2ZQSA 1QHTA 1PM9A 1M56B 1JOYA 3SJBC 2RUQA 3FKSG 1YCIA 4OGQB 3B4SA 4LR3A 3CWBH 4PJ0Z 4TWKA 3K5NA 1FFXA 2ITDC 2QKAA 4DV6B 5K1XA 5EBMC 3WH0A 4NTWA 5CBHA 2P90A 3DXRA 1Y6XA 4ITZA 4BIZA 1AP5A 3ZN1A 4ZI7A 5KUMA 4GGQA 4LWSB 4CH4A 5JJJB 1IBMB 4IHJB 5JH8A 2IJJA 2EX3A 2DE0X 3R66A 1EYMA 5EC1C 4JFMA 4W9QA 4K0KO 3GTYX 1K7DA 4JI8B 3FD9A 3H1IH 1AI7A 1YSCA 2QWPB 5F2VO 5EZYB 4BIOA 4XDJA 2WSSG 4J9YB 4B3RB 3RYFB 1URFA 1V55C 3BRCA 4X66O 2LGOA 2WLZA 2EINC 3K06A 1HNXB 1NJIW 4I0XB 3CD6V 2OT5A 4WFAV 2D3OW 1W1YA 3QF7A 2YICA 1D7HA 3O5DA 2OCCC 4DROA 2HP8A 4Z2JA 5ITZB 5GQBA 3AG1C 4JPRA 1FXVA 2Z3YA 3L9DA 4X88A 5K1PA 2EINB 1WPBA 4X1YA 4R7CA 5H2FZ 2DQ0A 3HKBB 3CPWU 4NR1A 4X65O 4DH0A 2XP5A 3UI6A 3IFXA 1FD9A 4X64O 4DRPA 2BCCH 3CCUV 4LF9B 2EIMC 3G6MA 5A9GA 3RYIA 5L3CA 3PRDA 3EHBB 3SPGA 5KHGA 3ZMVA 3ARWA 1FJDA 1GO3F 3QOKA 2GUZB 3ABMB 3UT5B 4MTXA 2WM0A 4DV4B 1IBLB 1VMGA 5KA6A 2P67A 4HARA 5BMVB 3DC5A 4FN2A 1KECA 1LNQA 3JXVA 2GHYA 3ZHSA 5IJ9B 1TUEB 4B3SB 5BY1A 1MOFA 2YIBA 1LQ0A 2P4VA 1S77D 2ATKC 1U97A 3CP1A 4KL1A 3J81N 4JASA 3FAVA 2JS5A 3ETEA 5HT1A 2DSVA 1AI6A 1XL4A 2F43G 4J80A 5E79Z 2AZ0A 4IYIA 4DV5B 1VIBA 3D3IA 1QPFA 2WLIA 1YI2V 4FFBA 1JVMA 2QWQB 3JCUZ 3BHPA 5LXTA 4EFBA 1FKFA 2AXTZ 1DF4A 2ZNIA 1QCEA 1F8AB 1UFIA 5CA1A 1SC5B 1FFTB 2V7QG 1GUVA 3SJCC 3O5OA 3JYMA 2Y78A 3KADA 4ZOLA 2XPBA 2VQFO 4P8XA 4QE9A 3U0ZA 3C90A 3CSXA 4QPJA 3G67A 3JD3A 1AP6A 5CB4A 4MTGA 3L71H 3H1LH 4W5UA 4HYOA 1W9VA 2IBZH 2R9RB 2YEVB 1N33O 2ZQVA 1HNZO 1NMWA 3H9RB 4NVPA 2PI5A 1K5QA 1O9HA 4O4LB 3W4RA 3FB6C 4DRJA 4TW7A 1OHHG 4X1YB 1E6PA 3WD0A 3WD2A 2Y4TA 4GKKO 3G71V 4F6RB 4LNUB 5C8YA 4I55B 4S3JA 2LP7A 2BOBC 4AILC 1R3IC 2UUAO 4FLYA 4NTYA 2P5OA 4FZ1A 1QVGU 1N1AA 3UQIA 4PHZA 4DWSA 3AG4B 4WFHA 4JI3O 3WFVA 2Q69A 5A2QN 3AG3B 2AHZA 2WAMA 1XHGA 4K8ZA 2EILB 2ZQMA 3BVOA 2UUCB 3ZEDA 1TUBB 1JFFB 4KHPB 1R3LC 1MSWD 2HHHB 2ZD9A 3I6CA 3DTUB 3JD4A 3T2MA 1BQZA 4LAYA 2AZ2A 2QJ1A 3O5KA 2O57A 4E2LA 1MABG 2K9PA 4DR6B 2N74A 4FVMA 1ZBKA 5HUAA 1ZB5A 1O6IA 4D6TH 4UVAA 3B8MA 2UUBO 4RQFA 1E1QG 3FY1A 2KSDA 1ZL8B 4X64B 1BHBA 4OX9B 1GK9A 1X59A 1WAWA 2JGDB 3B9AA 1OZ0A 1TA8A 2RQ6A 2BTQB 4B3MO 1KC8W 4DK1A 2AWGA 1M57C 3ZRVA 3ZMZA 2M08A 3JAWA 4QPKA 1K9TA 1X4TA 5IYZA 1NWSA 4DRIA 5LP6C 4BWAA 1VQ5V 1YZBA 3K9AA 4NXNO 1Z5VA 4JGSA 4PA4A 2QDOA 3CJHB 1M1KW 4X20A 2WK2A 2Y69C 4PDRA 3TXSA 3CCRV 2DMXA 3H1KH 4FM1A 1H8EG 1L1FA 1YTFB 5HW7A 1VF5B 4XAKA 2QKCA 2W6JG 4WKAA 2UU9B 3S3WA 1VF6A 3CRRA 1I7FA 3UM7A 2OCHA 4G27B 1IVSA 3ARTA 2MF9A 3RT3C 2JJ2G 4JAAA 5LA6A 4F4LA 2FDMA 5HKGA 3B9DA 1PKXA 4PI0A 2UXBB 3JD2A 1KT0A 5H9CA 4JI2O 5B3SC 2IUZA 4WCEV 2AOSA 2DSZA 1KMIZ 3FYEB 3JATA 1KP3A 1FKTA 5B1OA 1PINA 1JFFA 4LGXA 4JI1B 3JASB 2ZM6O 1KQSU 3CHXA 3BXWA 1XNQB 4B7EA 1OGGA 3CGMA 4WBNB 4DRXA 1Q81W 2DT1A 1SESA 2ADQB 4PA9A 5LHIA 2JIZG 3QO8A 4LAXA 4KQZA 5CMUA 1A7XA 2EILC 5IYDO 2X6CA 2OWOA 2KGJA 1W1VA 2DG3A 1NR1A 4O2BA 2BOCC 4O4IB 4YXWG 4JI6O 3L73H 2ZE7A 3D3QA 5IWAO 3BEHA 1SQVH 5H5NA 3AG4C 2MW2B 1GMGA 1WAZA 3BA9A 4JI7O 4G2KA 2KQXA 3QO7A 2UXXA 1W59A 4GLXA 1YHQV 2PI4A 4G2PA 4QT2A 5CA3A 2HLDG 3AS0A 1F51A 1WJZA 2XP8A 2Q73A 4DR7B 1H38A 1KT1A 1L0NH 5GTIZ 3F7YC 2K1EA 3UI5A 4LF6B 5KHHA 4MVMA 1UPGA 2VQEB 3TCUA 3LNNA 1N36B 2DSWA 2PBCA 5JVDB 1H0IA 1WLEA 1SRYA 2KI3A 2M1IA 4K3AA 2EIMB 1O9GA 3K08A 4LBEC 2MLZA 2MPHA 1V9PA 1QZ2A 1M5IA 4MNLA 1NSGA 1OJHA 4HNAB 3NTPA 3E22B 2JS3A 4P30A 1Y67A 3DGEA 5LOVB 1J4IA 3E86A 1W26A 3CHDA 4UCOA 3W7WA 4LF8B 2W6IG 4MGVA 1FAPA 4FLZA 4LFBO 1E1RG 4YHHB 1GN3A 1QNMA 4F6RA 4I50A 5C8YB 4WK9A 4JZGA 4IPXA 1VQ9V 4LF7O 1N0JA 4F6EA 2H8PC 3F5WC 4P9PA 4DR1O 1NWRA 2EIJC 3HR0A 3B7XA 4L72B 1NH6A 1P7BA 4DV4O 4O2TA 2EIKB 3ARQA 5IE9A 4I50B 5DIUA 5TISZ 4DIPA 4Q20A 2HR3A 4RUEA 3ZRWA 2W0FC 4LH6A 2RJZA 4DV6O 1H2KA 3P30A 1VQMV 4HBNA 1Z5WA 1N0NA 1HXVA 1NVPD 1KFWA 2YIBD 2XOKG 2R9IA 1ZK6A 3ARPA 2PY5A 5LL6Y 1HKKA 4DWSD 4TV8B 2R70A 3ABKB 2F4VO 3LUTB 2G38A 2PYJA 5B3SB 3J7AU 1FKBA 1GKFA 1NTKH 2WLHA 3HKEA 1YXBA 4JI4B 1G8MA 1TFVA 1NH2B 4DR4O 3I5DA 1NR7A 5KA5A 2F93B 4LFCO 2NN4A 4LFAO 1I94O 1D2KA 2FTKA 3K79A 1S72V 1YTFD 3QVNA 3CMEV 2XP7A 4TUYA 3K59A 2E76B 3ARRA 2M6YA 3CRAA 1J95A 3IHZA 1IXMA 1SR0A 4JYSA 4CH5A 2KG7A 1JQ0A 4UCSA 4ODKA 3PRBA 1PV0A 1N33B 1YATA 4RQEA 5CA0B 3CH9A 5GTHZ 4TYOA 2ZE5A 2ZT9B 1BQ0A 3WKZA 4DUZB 1Q3EA 2QWRB 2ZDIA 3N2GA 3H01A 2MNTA 2UXNA 1N32B 5IYCO 4DRMA 4UV9A 1FJGO 4X1KB 4R50A 3O5MA 3VQYA 3KAIA 4DW1A 1BT8A 1UR9A 3RN4A 3E8FA 3CCEV 1TCOC 1R1BA 5D75A 4JI8O 1AI5A 1S5JA 4MNJA 2DW4A 2XAJA 4AQYB 3JD0A 2ZE6A 4W4LA 4MSPA 1XBLA 1QLNA 1K34A 4QZVB 2QA4V 2GUZA 4O4HA 3DSQA 2GTSA 2WLNA 3D36A 4LF4B 2Q67A 3MDYB 2L6LA 1MZFA 1UR8A 1ROPA 4I55A 1XREA 4J7JA 1P4RA 4DXWA 5IY5C 2KO7A 1ROTA 1JX9A 1NT2B 2P22C 3OOBA 3STZC 2ZDIC 1DLBA 4DR3B 1LL7A 2ITKA 4PTMA 2QSAA 5L3EA 4OXSA 3AG3C 4JZ2A 1AI4A 2YS8A 4NB5A 1E6ZA 4JTAB 4E4EA 4JI0O 4PV1B 5LMNO 3OTFA 4QT3A 2QM4A 1GAXA 2K8IA 1YJ9V 3JD1A 1DK1A 4O4JB 3W7TA 4ZI7B 4Z2LA 4X62O 3G4SV 3CC4V 1CPYA 3JAWB 2BE3A 1JA8A 4LP8A 1XNRB 4KR0B 1GN6A 2A3EA 2EZPA 3FB5C 2LQTA 3HPLC 4B08A 3CCQV 4L3NA 3B2EE 4MVUA 5KMGB 3W7XA 2FL4A 1ZBWA 3OFNG 4UB8Z 1E6NA 4LAWA 4Q7NA 3OTOO 1WA8B 2DYSC 3ABLB 4EFEA 5EC2C 2Q6AA 2N04A 4FM2A 3OT7A 3ALFA 3TCZA 3FXYA 3CRMA 2L35A 2Q5AA 4GCZA 3RYIB 4NXMB 4KUMA 1FKIA 3ZMSA 1FXKA 4BR6A 4UVCA 4GT1A 1HR0O 3HKDB 1LJYA 1WA8A 3ALGA 1Q8IA 4JYYA 1JVWA 2ETNA 2ZR2A 1NWUA 4N19A 1OCOC 1CEZA 4CS3A 5C93A 2FKEA 1LL6A 4LFCB 4LH7A 4Z2WA 3RFWA 3IKDA 2FMLA 4AI8A 1IDSA 5B8IC 4GIVA 1EIBA 3WD4A 3IKGA 1WB0A 4J11A 3OMNB 1Y0OA 1NZ6A 1B04A 4CBCA 2F21A 3O9OA 1VF8A 2LKNA 2DQ3A 3RM8A 4HAMA 4MW8A 2UXCO 1FXKC 4NKGB 3VQWA 1PNKA 4QGPA 4IQ2A 3UQAA 2PN0A 4X1IB 2OIGA 3LUOA 1OCCB 4WF9V 1GOIA 5LMUB 4FAPA 1AJPA 4U3FH 1OCRC 1EZVH 3OMAB 2IM9A 1K4CC 1SA0B 5J2TB 2WLLB 1BKFA 4GX0A 2O92A 3BA8A 4ZOLB 4XDLA 4DR2B 2XT9A 4JYCA 5B66Z 4YY3B 3B8SA 3OM3B 4KFMA 3RWRD 3G80A 2DG9A 3OGIB 4K0KB 1D7JA 2BTQA 5EBWC 1Y74A 1JMKC 1HNWB 1SYTA 1N8RW 2WWWA 1EQ3A 4O4LA 2DG4A 4GX1A 3T1HB 1VQ6V 1VF6C 3BCCH 3AG7A 4WFFA 4CH6A 1B06A 3EXAA 3TK1A 1YDXA 2JZVA 1FXHA 4DR3O 1Q6HA 1XUQA 3RYFA 1WB8A 5CA0A 4DV2O 3KCYA 4I9WA 4UUJC 1J4RA 2YDEA 4J10A 4C7UA 2QM8A 2JK5C 1SQBH 2KG7B 2B9ZA 5CA1B 3APQA 1Q82W 3HKCB 4FLTA 2LW1A 1YJWV 1PPJH 4ODOA 4IIJB 2PPPA 2AHYA 2HVJC 2A06H 4JFJA 2XP4A 4GX2A 1XRVA 3OA5A 2LJ2A 4B3MB 1PP9H 3KCEA 2ZIMA 2CUGA 3ML0A 3JAMN 1T11A 3STLC 3RYCA 1SZXA 5KUKA 3F7VC 3AQUA 2NLJC 2A0LA 1IBLO 3WB0A 5EBLC 2HJFC 4UCRA 4B7KA 3WL0A 4JAVA 4MVSA 1P5QA 1RSOB 3OUFA 3L70H 3ABTA 1Q5OA 1ZAUA 4Z1VA 2LJ4A 3RYCB 3E8HA 3AROA 5BMVA 2XAFA 4DRNA 2VWKA 2BTOA 4YJ2A 4X89A 3EVKA 1PL0A 4JI7B 2DWEC 2ZR5A 3SJAC 3BFRA 1VQPV 4DV5O 2RNBA 2YI8A 3FAVB 1IBMO 3K5OA 4BW9A 3ASOC 1NKDA 1NBMG 5FPRA 1XMQO 3H1HH 3CC7V 4IL6Z 3VBBA 4JI2B 4PA7A 1ZUQA 3CJHA 4ZS6A 4URIA 1X6LA 2GDSA 4J9ZB 5JH7A 2P4KA 4FFKA 1FYJA 1NTMH 4JFLA 4IHJA 1QR8A 5JVDA 2XP9A 4YJ3A 4TV9A 4DUYB 3I56V 1BS3A 3RMEA 1OCOB 4DR5B 3ASNC 2ZXWB 2YUAA 4MS2A 1ZTEA 5IJ0B 1Y66A 2YXYA 5L3FA 1THZA 3MD0A 2CTWA 4BF8A 4DRQA 4IQCA 1N4CA 1M4UA 4JV5B 2XAGA 1MZEA 3O5PA 5EZYA 3HKEB 4DR6O 2LFRA 3SPHA 4S3KA 2ZR6A 3ZJZA 1CXZB 1VEWA 1XHZA 3ZHRA 4TW8A 1XEQA 4X1KA 1S76D 3B8NA 1FXKB 5L3GA 3G6EV 2JEUA 3Q4HB 2QEXV 2OLHA 5CBGA 3OR7C 5IYZB 2LW7A 1VQ8V 2ZIOA 1SQQH 5LYJA 4TT3G 4JYAO 3IJ4A 2DN9A 3UQBA 1WN7A 3WD1A 3KG2A 2Q7HA 3U11A 1RSOA 2DPEA 5EIBC 3GU0A 1RM1C 1EBOA 3WG7C 4RWUA 2CE4A 1VQ4V 2GSMB 4CH3A 3BPZA 1W2BU 1X6NA 4U84A 4WKFA 2QTSA 1D6OA 4N21A 2GTAA 1SKVA 1U96A 4H13B 1DF5A 3K3WA 3ARSA 3SYOA 3X2QC 4QJFB 1NS1A 2Y0PA 1NU1H 1TAEA 2RUCA 2CGOA 1M9NA 3K9SA 1C9HA 3JATB 4D7SA 1YIJV 4DV1O 1XMOB 2BSKA 2FAPA 1PD3A 2ZR4A 5B1AB 2CK3G 2RN9A 5DEDA 4WBNA 4PA6A 2V1DA 4TNSA 3E83A 3ZHTA 2LPVA 2PZSA 4LAVA 4UCTA 2CTRA 4ZHQB 3HB3B 1CTNA 1K5SA 3CCSV 4X65B 4U7OA 1V54C 1FAFA 4NXNB 2KKWA 1HKMA 2YXLA 4JTDB 1FKJA 1T5EA 1NI8A 2DJVA 1ITXA 4AY1A 2XUMA 5HFMA 3LSQA 4I7ZB 1WNOA 3ZMTA 2F66C 5DITA 1Q1CA 4FZ0A 2EIKC 2F4VB 3N2GB 2IU0A 4P8VA 4FJCC 3ZRXA 2WLJA 4B3SO 1VP7A 2UUAB 5LOVA 1G4YB 3WL1A 2H3OA 2RCVA 3RVYA 1BGYH 4QIWF 3PRAA 2VCDA 3RM9A 4X1IA 4LFAB 2ILMA 1Q43A 1KUQA 3CRQA 4WKHA 1KB9F 1IX9A 3TJTA 3G6LA 1DTOA 3L72H 3CC2V 4H33A 5J2UB 1PNLA 5KHJA 1EHNA 3JSNA 3UO3A 3T1CA 5EK0A 3CZ8A 3IK8A 4FMTA 4G28B 4O4HB 3WD3A 3CRCA 2PPOA 3TDBA 2NR5A 5BXZA 1OCRB 2DSUA 3JASA 2DT2A 1R73A 4U7NA 2OFNA 2QGNA 3PN1A 5L3BA 2A79B 2R72A 4ODQA 3JALA 4FLXA 1LUWA 2CGNA 4ZIBA 1VF7A 3ASOB 4MPKA 3G6BA 4JYBA 1FKDA 1QPLA 2X6BA 2OYQA 3CX5F 5HW6A 3EIPA 2LGWA 3H1JH 3O5RA 2VN1A 4MVZA 3AK2A 2Y48A 1XNRO 3JARA 3N27A 2ZCEA 3A8TA 2PF4E 1M56C 1EM1A 1IBKB 1HJVA 1HP8A 3RBZA 3K0GA 1M5YA 2RSEA 1GTOA 1FKSA 1K9MW 1G1XB 5DIVA 3UF8A 4H0LB 2F2DA 4I4TB 4MAVA 5IJ0A 1VQLV 2JGUA 5D5PA 1SQGA 5LXTB 3AS1A 3NRKA 4W9PA 5HW8A 3ABKC 1KD1W 2JEXA 5CN0A 3CXHF 2YC0A 5AG2A 1VQ7V 2EBOA 4L87A 3NXSA 3ETGA 5FNVB 1EN5A 2IW5A 3P32A 1Y74B 1J5EB 2MLXA 4DZ3A 4EEQA 4JI0B 3KABA 1TVKB 1JNDA 1D2DA 1L0LH 2ZQTA 4ODPA 3HKDA 4J7KA 4DWSC 4G50A 2NNUA 1TGOA 4U3JB 4MVRA 3P3NA 3M7MX 4GX5A 3RVZA 2Y4UA 3OAAG 1JR9A 1B6QA 3BMBA 1JPXA 4ZPVR 3CXCU 1HJWA 1SZTA 1US6A 2UXCB 3S3XA 4Z2GA 1YJNV 3T1YB 3ARZA 2M2AA 3PJSK 3B9EA 5LA6B 4K8XA 2PV3A 1ZCNA 4FLVA 4MTOA 3FFQA 4FLWA 1P84F 3N2KB 4JAUA 1F7YA 4HZ3A 1KKDA 3ZRSA 4DK0A 1SF9A 3AS3A 4A5UB 1PL4A 2GBOA 4DV0O 3ARYA 1ORQC 4Z2HA 4LF9O 1B3QA 5JQGB 2HFEC 1QU7A 1L1PA 5H6QA 1MG1A 1HKJA 4MW3A 5DF0A 4K35A 2DYRB 1IZ3A 1N32O 2A3AA 4DV3B 2HJDA 5FPOA 2LFSA 3WIJA 3QG5A 1HR0B 3IC7A 1FFXB 3SGIA 3ZN0A 3GWOA 1Q7YW 3SYCA 2YBTA 4GUNA 2IJIA 4P8WA 3LSUA 1SA0A 4ICGA 3K57A 4ODMA 1Q90D 4FLUA 2E5LO 3VAWA 5J2TA 3JARB 1AR5A 4JTCB 1XQ8A 2Y0IA 4O2BB 1E6RA 1NWTA 1KBHA 4HBEA 3GVMA 5B5EZ 4EB6A 3OR6C 1NVPB 4JI3B 1K4DC 2B1GA 3OGCC 3CEIA 4AHCA 1BL4A 2L2SA 4B3TO 1AJQA 5KHIA 1PNMA 1H2MA 2X0LA 3M8AA 3KAFA 4ML4A 3ODKA 4TUYB 4GYCB 1RFYA 4EB6B 3FAPA 2ZNJA 2Q8VA 4JFIA 2W0XA 4BAYA 2IF4A 4IT6A 2EIJB 3L74H 4R0XA 5KMGA 2KB1A 1GRJA 5EYPA 1OV9A 2C2AA 2XPAA 2H94A 5JJEB 1MNGA 3ARUA 3OD4A 4MNKA 4X66B 4LFBB 2UUBB 2ZM6B 4R8CA 3KZIZ 1IXBA 3ZHQA 3ZIAG 1HNXO 1Q6UA 2UXDB 5I98A 2IH3C 4ZPWR 3ARXA 5H6RA 3KZ7A 5BR8O 1HNZB 3CHCA 4TOIA 5GONB 3TC5A 4ZPTR 3ZS8C 3UQ8A 1SETA 4J7ZA 4PDMA 4PD4F 1EDQA 1E79G 5IWAB 4QNHB 4LF5B 3APOA 1IX5A 3AK1A 4FIPC 2G41A 5J6EA 2ADPA 4DRXB 3OTOB 3THOA 2RUDA 4MT8A 1NQTA 1FPOA 1Q6IA 1S5LZ 1JNEA 1N34B 1ZLZA 5JWPA 3KAHA 3FB7C 2QF8A 2BSKB 3PR9A 2VQEO 1LL4A 2E3CA 4CC5A 3X2QB 2DWDC 1M93A 3JCZA 3AG1B 4DV7B 4W9OA 3EY6A 1QLEB 2FYUH 5B1NA 3ZX6A 1AR1B 2AW9A 4I5SA 1JJ2U 2RDCA 1XMQB 3QTCA 4DYLA 5DO2A 3IC9A 1SS3A 1WNSA 4DV1B 2AGAA 3GB7C 2HHHO 4DO2A 3LDCA 4LWSA 2VWJA 1BHAA 2UXBO 2A7WA 2M7WA 1OCCC 5IY5B 3OEEG 4TV8A 1GPFA 2OIEA 4LF8O 4O4IA 4ODRA 2YIDA 1KU9A 5IT9N 1U79A 2ZKOA 2OCCB 1AROP 1LUVA 3E8GA 5LHHA 4JI5O 2A3BA 5HTGA 5KX5A 4D7TA 5E1AC 4DR1B 4PELA 1YVWA 4XBFA 4X9QA 1MA1A 5B1AC 5B1BC 3KKYA 1FFRA 3RGBA 1K3EA 4W4KA 3ZHUA 5JJNB 5LGNA 2PGGA 4GKJO 3GPKA 4ZBMA 3EFFK 4H37A 4I4TA 4WFEA 4IT4A 2EULA 1RPRA 5ITZA 1BZKA 1RD6A 1ZBCA 4JYAB 3FYIB 1GM7A 5GONA 2JDIG 4NSBA 4QIBA 3UT5A 4BIUA 2WPDG 1XILA 3CCLV 2UZ5A 1WP8A 3NR7A 1HNWO 5HWCA 3K0DA 4LF6O 2OTLV 1YEWA 1R6NA 4IGGA 3CB2A 4IIJA 3ZRWB 3CYOA 1DGSA 3L75H 1JJOA 4DUYO 2ITCC 1XDCA 4I0XA 1GH6A 3UO2A 3SDLA 2PV1A 3TETA 1AVMA 2YI9A 4P8UA 4DWSB 2HG5C 2MLYA 3BY6A 1COWG 1OCZC 3O5EA 1Y76B 4IT5A 2ESCA 4Z1MG 4JV5O 1LR1A 2R9AA 5FLXN 1ZU8A 1RPOA 3CHEA 3KACA 1FKHA 2XAHA 4GZRB 3CCVV 2QWOB 1IURA 3F5TA 4BW5A 2ODMA 3I55V 2UUCO 2CTQA 2ZR3A 4TX0A 5L3DA 3CE2A 4JI1O 2YSUB 4YHHO 5JCOA 1I5YA 1F4MA 1I0HA 3RFRA 4UV8A 5DM6V 1ZWIC 5JQGA 1R6KA 4YY3O 4CS2A 1YF2A 1H2LA 2F95B 2Q5ZA 4DUZO 2XAQA 1MMMA 1LG2A 4LF5O 2E75B 3MAQA 2XNDG 4LC1A 5GW7A 4NYKA 1VQOV 1ZL1A 4LCUC 2KFWA 4J41A 2YEVA 3T1HO 4ZHQA 2XASA 4JFKA 4WJXA 1E15A 4ZKIA 2CH7B 2RQSA 4DRHA 2EZOA 1B6CA 3QO5A 4U3JA 1SQFA 3CMAV 3ARVA 3ETQA 2QWNB 2CAZC 1J4HA 1QLEC 3K5LA 1JNSA 4DV2B 1W9PA 1P49A 3T4DA 1EN6A 2WLIB 3KCXA 2QM7A 3SJQC 2HVKC 5DN6G 3A0RA 1EFRG 2CH7A 3MHSC 4FK5C 1D7IA 1V54B 2PYLA 3ZMUA 4YJ3B 4KHPO 4TV9B 3LNMB 4OPAA 2D9FA 1EZJA 2PI6A 1P7GA 5J9PC 1L8DA 4UCVA 3T1YO 3OUSA 3UI4A 3W7SA 3AG2B 3SYQA 4J4OA 4MVQA 4PDVA 2Q0AA 3SYAA 4JI5B 5FNVA 4KP4A 3WB1A 1W1PA 1KYOF 1YITV 3SYPA 1XI1A 4YJ2B 1A32A 1FKLA 1ZBVA 2YIAA 2XHBA 2F1MA 3E8BA 3ZHVA 2DYRC 1AB3A 3K5MA 2FB5A 3B77A 5HFLA 1ZX3A 1XHXA 3NI6A 4LNUA 1FJGB 4JF3A 4TW6A 1W9UA 2ZQUA 3SPIA 4DW0A 1GM9A 2QE7G 3JALB 2WA4A 5IYBO 5LP6B 3ICXA 2P6JA 1E44A 4U86A 3BABA 1K33A 3JAKA 2Q9LA 3A0HZ 4Z2KA 5HBFA 1H0GA 4WIWA 3RGCA 2KR7A 4JI6B 1R6TA 2WLLA 3WB2A 5FL7G 3CCMV 3WU2Z 2QTOA 4TQDA 4CS4A 1K92A 1VQNV 2ZE8A 1WPXA 2UU9O 3K04A 4MTVA 1V55B 3C3TA 3JAKB 4TSFG 3VQXA 4DR5O 4RUFA 2WLMA 5IDJA 1R3JC 4CZZA 1KKCA 3TXQA 2FKXA 3A2FA 3LSSA 4DR4B 4MVOA 2CTPA 2WLKA 1J5EO 2EJRA 1ENVA 2E74B 1CP9A 3BAAA 3RYHB 3AEIA 3ETDA 1D5NA 3SR2C 4H44B 2ARHA 3RM4A 4UVBA 5JCOC 3KAGA 2VQFB 5LMNB 1EN4A 2MK3A 1NMVA 2XP3A 4EKWA 3LDDA 1BCCH 3ASNB 1JCHA 5BR8B 1XL6A 2ZXWC 3UKMA 5CBFA 1FKKA 2Q7GA 4XDKA 1W1TA 5LMUO 3K03A 4MSWC 4R5EA 2G8ZA 1Y4MA 2OTJV 4UXNA 1BL8A 1IBKO 2N05A 4DZ2A 1H2NA 5LYJB 3C3SA 3QNEA 3UCSC 4DRKA 5GPRA 3VOUA 3WG7B 1I08A 2EJ7A 2LGQA 3T4ZA 1H8HG 2RMKB 4X20B 3OE7G 2HEPA 4DR2O 4I9QA 4GKKB 1FFQA 5KLVH 1PBKA 4R6ZA 1VARA 2F4EA 5KAFZ 4DV3O 4HBOA 3IGAC 4YIPA 5J2UA 3AS2A 4AQYO 1JNTA 3CCJV 1NTZH 1I5XA 4IYHA 2XP6A 2CDYA 4P2ZA 1TUBA 5LP6A 3HKBA 2PTMA 2KE0A 5B1BB 3FX7A 2A3CA 3P3PA 2IU3A 4O2AB 5HWBA 2IJKA 3R65A 3A0BZ 3O5QA 4Z2IA 1NH2D 4MTFA 4LF4O 4WFBV 3OEHG 1OGBA 4TQFA 4NNRA 2QKSA 2Y69B 4U85A 3AK3A 3H9VA 1BSMA 3O5FA 4O4JA 4ABMA 3CHFA 2YXHA 4Q6GA 2B5UB 2RURA 1AILA 4J4NA 3ZCCA 2Z5UA 4O2AA 1W0KG 3JSLA 1GN4A 4UB6Z 3RW0A 5BXJA 1XOUA 5GPGA 5LBQA 4FFBB 4PI2A 4FPPA 4UFZA 1AJNA 2PV2A 1M90W 2Q7EA 4DV0B 2B5UA 3SPCA 4OX9O 1I94B 3MDSA 2B1IA 3B09A 3RYHA 1HKIA 1J6YA 2Q4PA 3AG2C 5BZBA 3CGNA 3IAYA 1MSDA 3OMIB 1D5AA 3FB8C 4C02B 4YIOA 2HKOA 1OWQA 1WB7A 1WP7A 2A3QA 2ZINA 1F40A 1SQPH 1XNQO 1W0JG 2DT3A 1OCZB 1ROUA 3ABMC 4PA3A 3GWKC 4WFGA 1HJXA 5LGUA 5KHKA 2Q68A 1K8AW 3J80N 3TGUH 2IJHA 5EIBD 4NXMO 3SPJA 2X6AA 3O5LA 4B3TB 1R3KC 1HW7A 3B40A 2X7RB 4ASUG 2B31A 1N34O 5CB4B 3VQVA 5DEZA 3HKCA 1FKGA 1S3JA 4HNAA 1FS0G 1GM8A 4OPHA 3LDEA 5D5QA 5IJ9A 2Q0OC 3O5JA 4P9OA 1TVKA 4DT4A 1HDJA 3D8CA 3E2EA 3DC6A 1N36O 1F4NA 1FKAO 2P06A 4MNMA 2PUSA 5KAIZ 3O5IA 4ODLA 1YW5A 1SERA 2UXDO 2JVDA 1RM1B 4B3RO 2O9OA 2IH1C 2YBUA 1BE3H 5LHGA 4X8AA 1F23A 1VQKV 2VRZA 1M57B 4N23A 1FKRA 3JYCA 3DXRB 3W7UA 3OW2U 2JJ1G 3M99B 4Q22A 1AR4A 2F23A 3CS5A 4LF7B 4RO2A 3PA7A
chains in the Genus database with same CATH topology
4JFLA 3O5GA 1LG1A 2XP9A 4ODNA 2DSWA 2N87A 2PBCA 1H0IA 2A3BA 3RMEA 5HTGA 2KI3A 2M1IA 3WQWA 4BF8A 1FFRA 4DRQA 4IQCA 2MLZA 2MPHA 3O5PA 1QZ2A 4NZCA 4MNLA 3JYJA 1NSGA 3GPKA 4S3KA 2ZR6A 3NTPA 4IT4A 2PPNA 4TW8A 1RD6A 1J4IA 1ZBCA 1W26A 1R9HA 3CHDA 3WQVA 2WLYA 2OLHA 4NSBA 4QIBA 4MGVA 1FAPA 2UZ5A 5HWCA 1E9LA 4WK9A 4IPXA 3UQBA 3WD1A 1NWRA 3B7XA 4L72B 1NH6A 2DPEA 2PV1A 4O2TA 4P8UA 4DWSB 2DT0A 2MLYA 3O5EA 3ARQA 5DIUA 2ZQSA 1X6NA 2ESCA 4DIPA 4U84A 1ZU8A 4WKFA 3CHEA 3KACA 1D6OA 1FKHA 2RUQA 3ARSA 1HXVA 4TX0A 1KFWA 1ZK6A 3ARPA 2RUCA 3WH0A 1HKKA 4DWSD 4ITZA 1C9HA 2FAPA 1LG2A 4GGQA 1FKBA 2ZR4A 5JH8A 1TFVA 1ZL1A 4TNSA 1EYMA 2KFWA 2LPVA 1D2KA 4LAVA 4JFKA 2XP7A 4JFMA 4W9QA 4WJXA 1CTNA 1E15A 3ARRA 2RQSA 4DRHA 3IHZA 1B6CA 3ARVA 1SR0A 4JYSA 1HKMA 1J4HA 1FKJA 1JNSA 1W9PA 4ODKA 1ITXA 3PRBA 4AY1A 2LGOA 2WLZA 1WNOA 1YATA 5DITA 3CH9A 4TYOA 1Q1CA 3WKZA 1D7IA 2MNTA 1W1YA 4P8VA 4DRMA 1D7HA 3O5DA 4DROA 3O5MA 3KAIA 4Z2JA 3WL1A 5GQBA 2D9FA 3PRAA 2PI6A 2VCDA 3RM9A 1UR9A 3UI4A 4J4OA 1TCOC 4WKHA 5D75A 4DH0A 2XP5A 3UI6A 1FD9A 4MNJA 3G6LA 4DRPA 1W1PA 4MSPA 3G6MA 1EHNA 1FKLA 1ZBVA 3PRDA 3ARWA 1FJDA 3CZ8A 3IK8A 3QOKA 4QZVB 2WM0A 3WD3A 2PPOA 3TDBA 4HARA 2DSUA 4FN2A 2DT2A 3MDYB 3JXVA 1UR8A 3NI6A 2OFNA 2KO7A 1ROTA 3OOBA 4TW6A 1LQ0A 1W9UA 4ODQA 2ZQUA 1LL7A 2ITKA 4MPKA 4PTMA 1QPLA 1FKDA 4U86A 5HT1A 4Z2KA 5HBFA 1E6ZA 1H0GA 2DSVA 4WIWA 5HW6A 3RGCA 2KR7A 3O5RA 4QT3A 2VN1A 2K8IA 1QPFA 4Z2LA 4MTVA 1HJVA 1FKFA 4KR0B 1F8AB 1M5YA 2RSEA 1FKSA 2A3EA 5DIVA 3UF8A 2F2DA 4L3NA 4MAVA 3O5OA 1GUVA 3JYMA 1ZBWA 2Y78A 1E6NA 3KADA 2XPBA 4LAWA 4Q7NA 4P8XA 3AS1A 3NRKA 4W9PA 5HW8A 3RM4A 4W5UA 3KAGA 1W9VA 3ALFA 3TCZA 2MLXA 2ZQVA 3FXYA 2Q5AA 4DZ3A 1NMVA 1NMWA 2XP3A 3H9RB 3KABA 1FKIA 1JNDA 3W4RA 4DRJA 1LJYA 2ZQTA 4TW7A 3ALGA 4ODPA 1FKKA 4DWSC 1W1TA 1JVWA 1NWUA 4N19A 4G50A 4R5EA 1E6PA 2G8ZA 3WD0A 3WD2A 2FKEA 1LL6A 4DZ2A 3RFWA 3IKDA 4S3JA 4ZPVR 1HJWA 5B8IC 4GIVA 4DRKA 5GPRA 4Z2GA 1EIBA 3WD4A 3IKGA 1WB0A 3ARZA 2M2AA 1Y0OA 1FFQA 3B9EA 1PBKA 1ZCNA 2F21A 1N1AA 2PV3A 3UQIA 1VF8A 2LKNA 4DWSA 2F4EA 3RM8A 4HBOA 3AS3A 3ARYA 1XHGA 3AS2A 4Z2HA 4IQ2A 1JNTA 3UQAA 2XP6A 1L1PA 1HKJA 5DF0A 2A3AA 3LUOA 2KE0A 1GOIA 3WIJA 2A3CA 3I6CA 4FAPA 5HWBA 4LAYA 3O5KA 3O5QA 4Z2IA 2YBTA 4P8WA 1OGBA 4ODMA 1BKFA 4NNRA 3VAWA 1ZBKA 5HUAA 2O92A 1ZB5A 4U85A 1O6IA 1E6RA 1NWTA 3O5FA 3CHFA 2RURA 4J4NA 4HBEA 3FY1A 3B8SA 5BXJA 1WAWA 2DG9A 1D7JA 3B9AA 1BL4A 2L2SA 5GPGA 1SYTA 1EQ3A 2AWGA 2PV2A 2DG4A 2M08A 3KAFA 4ML4A 3ODKA 1K9TA 1NWSA 4DRIA 3FAPA 3B09A 1HKIA 4JFIA 1J6YA 2IF4A 3CGNA 4IT6A 2JZVA 4R0XA 4C02B 1Q6HA 2XPAA 1OWQA 1F40A 3ARUA 4MNKA 2DT3A 2WK2A 1J4RA 1ROUA 5HW7A 1Q6UA 1HJXA 4XAKA 5I98A 4WKAA 4ZPWR 3ARXA 4ODOA 2PPPA 3KZ7A 3TC5A 3CHCA 4JFJA 4ZPTR 2XP4A 3O5LA 1XRVA 1EDQA 3OA5A 3ARTA 2MF9A 3KCEA 2FDMA 5HKGA 3B9DA 1KT0A 1T11A 2B31A 5DEZA 1FKGA 1IX5A 3AQUA 2G41A 2IUZA 5J6EA 2AOSA 2DSZA 2RUDA 1Q6IA 3O5JA 3WL0A 4DT4A 1P5QA 1JNEA 1FKTA 1PINA 3KAHA 4LGXA 2QF8A 2LJ4A 3PR9A 1LL4A 3AROA 4MNMA 3BXWA 1OGGA 3CGMA 2DT1A 4W9OA 4DRNA 3O5IA 3EY6A 4LAXA 4KQZA 4ODLA 1A7XA 1YW5A 2O9OA 2KGJA 1W1VA 2ZR5A 2DG3A 2YBUA 5DO2A 1FKRA 4G2PA 4QT2A 1GPFA 3AS0A 2XP8A 4Q22A 4ZS6A 1KT1A 4ODRA 4URIA 1X6LA 3UI5A 1U79A 3PA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XP7 A;  1F8A B;  1M5Y A;  2RSE A;  3O5G A;  2DG4 A;  2M08 A;  2XP9 A;  4JFM A;  1FKS A;  4ODN A;  2N87 A;  2PBC A;  5DIV A;  3UF8 A;  4W9Q A;  3KAF A;  5HTG A;  2F2D A;  3ODK A;  2RQS A;  3O5O A;  3IHZ A;  2KI3 A;  4DRI A;  4DRH A;  3FAP A;  3JYM A;  1B6C A;  3B09 A;  2M1I A;  2Y78 A;  3KAD A;  4JFI A;  4JYS A;  1J6Y A;  1J4H A;  2XPB A;  1FKJ A;  4LAW A;  4BF8 A;  2IF4 A;  3CGN A;  1JNS A;  4DRQ A;  4IQC A;  2JZV A;  2MLZ A;  3NRK A;  3PRB A;  4ODK A;  4R0X A;  4W9P A;  4C02 B;  1Q6H A;  5HW8 A;  2MPH A;  3O5P A;  2XPA A;  1QZ2 A;  2LGO A;  1YAT A;  3JYJ A;  1NSG A;  3GPK A;  1F40 A;  2ZR6 A;  5DIT A;  3KAG A;  3NTP A;  2PPN A;  4TW8 A;  1Q1C A;  4TYO A;  3TCZ A;  2MLX A;  2ZQV A;  1ROU A;  1J4R A;  2Q5A A;  4DZ3 A;  1NMV A;  1NMW A;  2XP3 A;  3H9R B;  1J4I A;  1D7I A;  1W26 A;  1FKI A;  1R9H A;  3KAB A;  4JFL A;  2MNT A;  5HW7 A;  1Q6U A;  4DRJ A;  2ZQT A;  4TW7 A;  4DRM A;  5I98 A;  1D7H A;  4ODP A;  4QIB A;  1FKK A;  3O5D A;  1JVW A;  4DRO A;  4N19 A;  3O5M A;  3KAI A;  4G50 A;  4MGV A;  2D9F A;  1FAP A;  2UZ5 A;  4ODO A;  2PPP A;  3KZ7 A;  5HWC A;  3TC5 A;  2FKE A;  4JFJ A;  2VCD A;  2XP4 A;  3O5L A;  4DZ2 A;  3RFW A;  4IPX A;  3IKD A;  3UI4 A;  2MF9 A;  3KCE A;  3UQB A;  4J4O A;  1TCO C;  5HKG A;  5D75 A;  5B8I C;  4GIV A;  1KT0 A;  1T11 A;  2XP5 A;  3UI6 A;  4DH0 A;  4DRK A;  1FD9 A;  3IKG A;  1FKG A;  3B7X A;  4DRP A;  2M2A A;  1Y0O A;  5J6E A;  2PV1 A;  2RUD A;  1PBK A;  1ZCN A;  2F21 A;  1N1A A;  2PV3 A;  4MSP A;  1Q6I A;  1FKL A;  4O2T A;  3PRD A;  3UQI A;  3O5J A;  2LKN A;  2MLY A;  3O5E A;  1FJD A;  2F4E A;  4DT4 A;  1P5Q A;  3IK8 A;  5DIU A;  2ZQS A;  4DIP A;  1FKT A;  1PIN A;  4U84 A;  3KAH A;  3KAC A;  1D6O A;  1FKH A;  2PPO A;  3TDB A;  4IQ2 A;  2LJ4 A;  1JNT A;  3UQA A;  2XP6 A;  4FN2 A;  1L1P A;  3MDY B;  2RUQ A;  3CGM A;  3JXV A;  3NI6 A;  4W9O A;  2OFN A;  3LUO A;  3O5I A;  4DRN A;  2KE0 A;  2KO7 A;  3EY6 A;  4LAX A;  1ROT A;  3OOB A;  3I6C A;  4ODL A;  1A7X A;  1YW5 A;  4FAP A;  4TW6 A;  5HWB A;  4ODQ A;  4LAY A;  4TX0 A;  2ZQU A;  1HXV A;  3O5K A;  3O5Q A;  2KGJ A;  2ITK A;  2DG3 A;  2ZR5 A;  1QPL A;  1FKD A;  4ODM A;  4U86 A;  1ZK6 A;  1BKF A;  2RUC A;  4NNR A;  3VAW A;  3WH0 A;  5HT1 A;  5HUA A;  5HW6 A;  4ITZ A;  1C9H A;  4U85 A;  3RGC A;  2KR7 A;  3O5F A;  1FKR A;  3O5R A;  4QT3 A;  2VN1 A;  2RUR A;  2K8I A;  4J4N A;  4G2P A;  2FAP A;  4GGQ A;  4QT2 A;  1QPF A;  1FKB A;  2ZR4 A;  2XP8 A;  5BXJ A;  1KT1 A;  2DG9 A;  4TNS A;  1D7J A;  4ODR A;  1EYM A;  2KFW A;  1BL4 A;  2L2S A;  5GPG A;  2LPV A;  3UI5 A;  1FKF A;  4LAV A;  1EQ3 A;  1U79 A;  3PA7 A;  4JFK A;  2AWG A;  2PV2 A; 
#chains in the Genus database with same CATH topology
 3U10 A;  3O5G A;  1LG1 A;  4ODN A;  2N87 A;  1SQX H;  4DR7 O;  5KX5 B;  2VS0 A;  3ZBH A;  4GKJ B;  4DV7 O;  1H2S B;  3WQW A;  2D2C B;  2GV9 A;  1S0V A;  1K73 W;  1QVF U;  5JH7 B;  1K97 A;  2LO1 A;  4L8J A;  4QE7 A;  1ZL8 A;  4CC6 A;  5LGT A;  2JRI A;  3E35 A;  4NZC A;  2E5L B;  3JYJ A;  1KP2 A;  2Z0A A;  1G6U A;  2JGD A;  4UDM A;  2PPN A;  2DYS B;  3ABL C;  5EYP B;  3E22 A;  1JCH B;  1R9H A;  4KXR A;  3WQV A;  2WLY A;  1GN2 A;  1RP3 B;  1H2G A;  1QR9 A;  3O65 A;  1HWY A;  1Z2G A;  1E9L A;  4PDL A;  3N2K A;  2P7T C;  4FM0 A;  3E89 A;  1QBZ A;  3ABU A;  1Q86 W;  1QQC A;  3MHH C;  1S5H C;  5DEC A;  3K58 A;  1ZSP A;  3D36 C;  2DOS A;  4UCU A;  3Q4H A;  1BMF G;  1XMO O;  4JI4 O;  2WA3 A;  2XTA A;  2QR4 A;  4J42 A;  2DT0 A;  1UJW B;  1Y76 A;  2V4D A;  4NTX A;  4X62 B;  2A9H A;  4RAI A;  2ZQS A;  1QHT A;  1PM9 A;  1M56 B;  1JOY A;  3SJB C;  2RUQ A;  3FKS G;  1YCI A;  4OGQ B;  3B4S A;  4LR3 A;  3CWB H;  4PJ0 Z;  4TWK A;  3K5N A;  1FFX A;  2ITD C;  2QKA A;  4DV6 B;  5K1X A;  5EBM C;  3WH0 A;  4NTW A;  5CBH A;  2P90 A;  3DXR A;  1Y6X A;  4ITZ A;  4BIZ A;  1AP5 A;  3ZN1 A;  4ZI7 A;  5KUM A;  4GGQ A;  4LWS B;  4CH4 A;  5JJJ B;  1IBM B;  4IHJ B;  5JH8 A;  2IJJ A;  2EX3 A;  2DE0 X;  3R66 A;  1EYM A;  5EC1 C;  4JFM A;  4W9Q A;  4K0K O;  3GTY X;  1K7D A;  4JI8 B;  3FD9 A;  3H1I H;  1AI7 A;  1YSC A;  2QWP B;  5F2V O;  5EZY B;  4BIO A;  4XDJ A;  2WSS G;  4J9Y B;  4B3R B;  3RYF B;  1URF A;  1V55 C;  3BRC A;  4X66 O;  2LGO A;  2WLZ A;  2EIN C;  3K06 A;  1HNX B;  1NJI W;  4I0X B;  3CD6 V;  2OT5 A;  4WFA V;  2D3O W;  1W1Y A;  3QF7 A;  2YIC A;  1D7H A;  3O5D A;  2OCC C;  4DRO A;  2HP8 A;  4Z2J A;  5ITZ B;  5GQB A;  3AG1 C;  4JPR A;  1FXV A;  2Z3Y A;  3L9D A;  4X88 A;  5K1P A;  2EIN B;  1WPB A;  4X1Y A;  4R7C A;  5H2F Z;  2DQ0 A;  3HKB B;  3CPW U;  4NR1 A;  4X65 O;  4DH0 A;  2XP5 A;  3UI6 A;  3IFX A;  1FD9 A;  4X64 O;  4DRP A;  2BCC H;  3CCU V;  4LF9 B;  2EIM C;  3G6M A;  5A9G A;  3RYI A;  5L3C A;  3PRD A;  3EHB B;  3SPG A;  5KHG A;  3ZMV A;  3ARW A;  1FJD A;  1GO3 F;  3QOK A;  2GUZ B;  3ABM B;  3UT5 B;  4MTX A;  2WM0 A;  4DV4 B;  1IBL B;  1VMG A;  5KA6 A;  2P67 A;  4HAR A;  5BMV B;  3DC5 A;  4FN2 A;  1KEC A;  1LNQ A;  3JXV A;  2GHY A;  3ZHS A;  5IJ9 B;  1TUE B;  4B3S B;  5BY1 A;  1MOF A;  2YIB A;  1LQ0 A;  2P4V A;  1S77 D;  2ATK C;  1U97 A;  3CP1 A;  4KL1 A;  3J81 N;  4JAS A;  3FAV A;  2JS5 A;  3ETE A;  5HT1 A;  2DSV A;  1AI6 A;  1XL4 A;  2F43 G;  4J80 A;  5E79 Z;  2AZ0 A;  4IYI A;  4DV5 B;  1VIB A;  3D3I A;  1QPF A;  2WLI A;  1YI2 V;  4FFB A;  1JVM A;  2QWQ B;  3JCU Z;  3BHP A;  5LXT A;  4EFB A;  1FKF A;  2AXT Z;  1DF4 A;  2ZNI A;  1QCE A;  1F8A B;  1UFI A;  5CA1 A;  1SC5 B;  1FFT B;  2V7Q G;  1GUV A;  3SJC C;  3O5O A;  3JYM A;  2Y78 A;  3KAD A;  4ZOL A;  2XPB A;  2VQF O;  4P8X A;  4QE9 A;  3U0Z A;  3C90 A;  3CSX A;  4QPJ A;  3G67 A;  3JD3 A;  1AP6 A;  5CB4 A;  4MTG A;  3L71 H;  3H1L H;  4W5U A;  4HYO A;  1W9V A;  2IBZ H;  2R9R B;  2YEV B;  1N33 O;  2ZQV A;  1HNZ O;  1NMW A;  3H9R B;  4NVP A;  2PI5 A;  1K5Q A;  1O9H A;  4O4L B;  3W4R A;  3FB6 C;  4DRJ A;  4TW7 A;  1OHH G;  4X1Y B;  1E6P A;  3WD0 A;  3WD2 A;  2Y4T A;  4GKK O;  3G71 V;  4F6R B;  4LNU B;  5C8Y A;  4I55 B;  4S3J A;  2LP7 A;  2BOB C;  4AIL C;  1R3I C;  2UUA O;  4FLY A;  4NTY A;  2P5O A;  4FZ1 A;  1QVG U;  1N1A A;  3UQI A;  4PHZ A;  4DWS A;  3AG4 B;  4WFH A;  4JI3 O;  3WFV A;  2Q69 A;  5A2Q N;  3AG3 B;  2AHZ A;  2WAM A;  1XHG A;  4K8Z A;  2EIL B;  2ZQM A;  3BVO A;  2UUC B;  3ZED A;  1TUB B;  1JFF B;  4KHP B;  1R3L C;  1MSW D;  2HHH B;  2ZD9 A;  3I6C A;  3DTU B;  3JD4 A;  3T2M A;  1BQZ A;  4LAY A;  2AZ2 A;  2QJ1 A;  3O5K A;  2O57 A;  4E2L A;  1MAB G;  2K9P A;  4DR6 B;  2N74 A;  4FVM A;  1ZBK A;  5HUA A;  1ZB5 A;  1O6I A;  4D6T H;  4UVA A;  3B8M A;  2UUB O;  4RQF A;  1E1Q G;  3FY1 A;  2KSD A;  1ZL8 B;  4X64 B;  1BHB A;  4OX9 B;  1GK9 A;  1X59 A;  1WAW A;  2JGD B;  3B9A A;  1OZ0 A;  1TA8 A;  2RQ6 A;  2BTQ B;  4B3M O;  1KC8 W;  4DK1 A;  2AWG A;  1M57 C;  3ZRV A;  3ZMZ A;  2M08 A;  3JAW A;  4QPK A;  1K9T A;  1X4T A;  5IYZ A;  1NWS A;  4DRI A;  5LP6 C;  4BWA A;  1VQ5 V;  1YZB A;  3K9A A;  4NXN O;  1Z5V A;  4JGS A;  4PA4 A;  2QDO A;  3CJH B;  1M1K W;  4X20 A;  2WK2 A;  2Y69 C;  4PDR A;  3TXS A;  3CCR V;  2DMX A;  3H1K H;  4FM1 A;  1H8E G;  1L1F A;  1YTF B;  5HW7 A;  1VF5 B;  4XAK A;  2QKC A;  2W6J G;  4WKA A;  2UU9 B;  3S3W A;  1VF6 A;  3CRR A;  1I7F A;  3UM7 A;  2OCH A;  4G27 B;  1IVS A;  3ART A;  2MF9 A;  3RT3 C;  2JJ2 G;  4JAA A;  5LA6 A;  4F4L A;  2FDM A;  5HKG A;  3B9D A;  1PKX A;  4PI0 A;  2UXB B;  3JD2 A;  1KT0 A;  5H9C A;  4JI2 O;  5B3S C;  2IUZ A;  4WCE V;  2AOS A;  2DSZ A;  1KMI Z;  3FYE B;  3JAT A;  1KP3 A;  1FKT A;  5B1O A;  1PIN A;  1JFF A;  4LGX A;  4JI1 B;  3JAS B;  2ZM6 O;  1KQS U;  3CHX A;  3BXW A;  1XNQ B;  4B7E A;  1OGG A;  3CGM A;  4WBN B;  4DRX A;  1Q81 W;  2DT1 A;  1SES A;  2ADQ B;  4PA9 A;  5LHI A;  2JIZ G;  3QO8 A;  4LAX A;  4KQZ A;  5CMU A;  1A7X A;  2EIL C;  5IYD O;  2X6C A;  2OWO A;  2KGJ A;  1W1V A;  2DG3 A;  1NR1 A;  4O2B A;  2BOC C;  4O4I B;  4YXW G;  4JI6 O;  3L73 H;  2ZE7 A;  3D3Q A;  5IWA O;  3BEH A;  1SQV H;  5H5N A;  3AG4 C;  2MW2 B;  1GMG A;  1WAZ A;  3BA9 A;  4JI7 O;  4G2K A;  2KQX A;  3QO7 A;  2UXX A;  1W59 A;  4GLX A;  1YHQ V;  2PI4 A;  4G2P A;  4QT2 A;  5CA3 A;  2HLD G;  3AS0 A;  1F51 A;  1WJZ A;  2XP8 A;  2Q73 A;  4DR7 B;  1H38 A;  1KT1 A;  1L0N H;  5GTI Z;  3F7Y C;  2K1E A;  3UI5 A;  4LF6 B;  5KHH A;  4MVM A;  1UPG A;  2VQE B;  3TCU A;  3LNN A;  1N36 B;  2DSW A;  2PBC A;  5JVD B;  1H0I A;  1WLE A;  1SRY A;  2KI3 A;  2M1I A;  4K3A A;  2EIM B;  1O9G A;  3K08 A;  4LBE C;  2MLZ A;  2MPH A;  1V9P A;  1QZ2 A;  1M5I A;  4MNL A;  1NSG A;  1OJH A;  4HNA B;  3NTP A;  3E22 B;  2JS3 A;  4P30 A;  1Y67 A;  3DGE A;  5LOV B;  1J4I A;  3E86 A;  1W26 A;  3CHD A;  4UCO A;  3W7W A;  4LF8 B;  2W6I G;  4MGV A;  1FAP A;  4FLZ A;  4LFB O;  1E1R G;  4YHH B;  1GN3 A;  1QNM A;  4F6R A;  4I50 A;  5C8Y B;  4WK9 A;  4JZG A;  4IPX A;  1VQ9 V;  4LF7 O;  1N0J A;  4F6E A;  2H8P C;  3F5W C;  4P9P A;  4DR1 O;  1NWR A;  2EIJ C;  3HR0 A;  3B7X A;  4L72 B;  1NH6 A;  1P7B A;  4DV4 O;  4O2T A;  2EIK B;  3ARQ A;  5IE9 A;  4I50 B;  5DIU A;  5TIS Z;  4DIP A;  4Q20 A;  2HR3 A;  4RUE A;  3ZRW A;  2W0F C;  4LH6 A;  2RJZ A;  4DV6 O;  1H2K A;  3P30 A;  1VQM V;  4HBN A;  1Z5W A;  1N0N A;  1HXV A;  1NVP D;  1KFW A;  2YIB D;  2XOK G;  2R9I A;  1ZK6 A;  3ARP A;  2PY5 A;  5LL6 Y;  1HKK A;  4DWS D;  4TV8 B;  2R70 A;  3ABK B;  2F4V O;  3LUT B;  2G38 A;  2PYJ A;  5B3S B;  3J7A U;  1FKB A;  1GKF A;  1NTK H;  2WLH A;  3HKE A;  1YXB A;  4JI4 B;  1G8M A;  1TFV A;  1NH2 B;  4DR4 O;  3I5D A;  1NR7 A;  5KA5 A;  2F93 B;  4LFC O;  2NN4 A;  4LFA O;  1I94 O;  1D2K A;  2FTK A;  3K79 A;  1S72 V;  1YTF D;  3QVN A;  3CME V;  2XP7 A;  4TUY A;  3K59 A;  2E76 B;  3ARR A;  2M6Y A;  3CRA A;  1J95 A;  3IHZ A;  1IXM A;  1SR0 A;  4JYS A;  4CH5 A;  2KG7 A;  1JQ0 A;  4UCS A;  4ODK A;  3PRB A;  1PV0 A;  1N33 B;  1YAT A;  4RQE A;  5CA0 B;  3CH9 A;  5GTH Z;  4TYO A;  2ZE5 A;  2ZT9 B;  1BQ0 A;  3WKZ A;  4DUZ B;  1Q3E A;  2QWR B;  2ZDI A;  3N2G A;  3H01 A;  2MNT A;  2UXN A;  1N32 B;  5IYC O;  4DRM A;  4UV9 A;  1FJG O;  4X1K B;  4R50 A;  3O5M A;  3VQY A;  3KAI A;  4DW1 A;  1BT8 A;  1UR9 A;  3RN4 A;  3E8F A;  3CCE V;  1TCO C;  1R1B A;  5D75 A;  4JI8 O;  1AI5 A;  1S5J A;  4MNJ A;  2DW4 A;  2XAJ A;  4AQY B;  3JD0 A;  2ZE6 A;  4W4L A;  4MSP A;  1XBL A;  1QLN A;  1K34 A;  4QZV B;  2QA4 V;  2GUZ A;  4O4H A;  3DSQ A;  2GTS A;  2WLN A;  3D36 A;  4LF4 B;  2Q67 A;  3MDY B;  2L6L A;  1MZF A;  1UR8 A;  1ROP A;  4I55 A;  1XRE A;  4J7J A;  1P4R A;  4DXW A;  5IY5 C;  2KO7 A;  1ROT A;  1JX9 A;  1NT2 B;  2P22 C;  3OOB A;  3STZ C;  2ZDI C;  1DLB A;  4DR3 B;  1LL7 A;  2ITK A;  4PTM A;  2QSA A;  5L3E A;  4OXS A;  3AG3 C;  4JZ2 A;  1AI4 A;  2YS8 A;  4NB5 A;  1E6Z A;  4JTA B;  4E4E A;  4JI0 O;  4PV1 B;  5LMN O;  3OTF A;  4QT3 A;  2QM4 A;  1GAX A;  2K8I A;  1YJ9 V;  3JD1 A;  1DK1 A;  4O4J B;  3W7T A;  4ZI7 B;  4Z2L A;  4X62 O;  3G4S V;  3CC4 V;  1CPY A;  3JAW B;  2BE3 A;  1JA8 A;  4LP8 A;  1XNR B;  4KR0 B;  1GN6 A;  2A3E A;  2EZP A;  3FB5 C;  2LQT A;  3HPL C;  4B08 A;  3CCQ V;  4L3N A;  3B2E E;  4MVU A;  5KMG B;  3W7X A;  2FL4 A;  1ZBW A;  3OFN G;  4UB8 Z;  1E6N A;  4LAW A;  4Q7N A;  3OTO O;  1WA8 B;  2DYS C;  3ABL B;  4EFE A;  5EC2 C;  2Q6A A;  2N04 A;  4FM2 A;  3OT7 A;  3ALF A;  3TCZ A;  3FXY A;  3CRM A;  2L35 A;  2Q5A A;  4GCZ A;  3RYI B;  4NXM B;  4KUM A;  1FKI A;  3ZMS A;  1FXK A;  4BR6 A;  4UVC A;  4GT1 A;  1HR0 O;  3HKD B;  1LJY A;  1WA8 A;  3ALG A;  1Q8I A;  4JYY A;  1JVW A;  2ETN A;  2ZR2 A;  1NWU A;  4N19 A;  1OCO C;  1CEZ A;  4CS3 A;  5C93 A;  2FKE A;  1LL6 A;  4LFC B;  4LH7 A;  4Z2W A;  3RFW A;  3IKD A;  2FML A;  4AI8 A;  1IDS A;  5B8I C;  4GIV A;  1EIB A;  3WD4 A;  3IKG A;  1WB0 A;  4J11 A;  3OMN B;  1Y0O A;  1NZ6 A;  1B04 A;  4CBC A;  2F21 A;  3O9O A;  1VF8 A;  2LKN A;  2DQ3 A;  3RM8 A;  4HAM A;  4MW8 A;  2UXC O;  1FXK C;  4NKG B;  3VQW A;  1PNK A;  4QGP A;  4IQ2 A;  3UQA A;  2PN0 A;  4X1I B;  2OIG A;  3LUO A;  1OCC B;  4WF9 V;  1GOI A;  5LMU B;  4FAP A;  1AJP A;  4U3F H;  1OCR C;  1EZV H;  3OMA B;  2IM9 A;  1K4C C;  1SA0 B;  5J2T B;  2WLL B;  1BKF A;  4GX0 A;  2O92 A;  3BA8 A;  4ZOL B;  4XDL A;  4DR2 B;  2XT9 A;  4JYC A;  5B66 Z;  4YY3 B;  3B8S A;  3OM3 B;  4KFM A;  3RWR D;  3G80 A;  2DG9 A;  3OGI B;  4K0K B;  1D7J A;  2BTQ A;  5EBW C;  1Y74 A;  1JMK C;  1HNW B;  1SYT A;  1N8R W;  2WWW A;  1EQ3 A;  4O4L A;  2DG4 A;  4GX1 A;  3T1H B;  1VQ6 V;  1VF6 C;  3BCC H;  3AG7 A;  4WFF A;  4CH6 A;  1B06 A;  3EXA A;  3TK1 A;  1YDX A;  2JZV A;  1FXH A;  4DR3 O;  1Q6H A;  1XUQ A;  3RYF A;  1WB8 A;  5CA0 A;  4DV2 O;  3KCY A;  4I9W A;  4UUJ C;  1J4R A;  2YDE A;  4J10 A;  4C7U A;  2QM8 A;  2JK5 C;  1SQB H;  2KG7 B;  2B9Z A;  5CA1 B;  3APQ A;  1Q82 W;  3HKC B;  4FLT A;  2LW1 A;  1YJW V;  1PPJ H;  4ODO A;  4IIJ B;  2PPP A;  2AHY A;  2HVJ C;  2A06 H;  4JFJ A;  2XP4 A;  4GX2 A;  1XRV A;  3OA5 A;  2LJ2 A;  4B3M B;  1PP9 H;  3KCE A;  2ZIM A;  2CUG A;  3ML0 A;  3JAM N;  1T11 A;  3STL C;  3RYC A;  1SZX A;  5KUK A;  3F7V C;  3AQU A;  2NLJ C;  2A0L A;  1IBL O;  3WB0 A;  5EBL C;  2HJF C;  4UCR A;  4B7K A;  3WL0 A;  4JAV A;  4MVS A;  1P5Q A;  1RSO B;  3OUF A;  3L70 H;  3ABT A;  1Q5O A;  1ZAU A;  4Z1V A;  2LJ4 A;  3RYC B;  3E8H A;  3ARO A;  5BMV A;  2XAF A;  4DRN A;  2VWK A;  2BTO A;  4YJ2 A;  4X89 A;  3EVK A;  1PL0 A;  4JI7 B;  2DWE C;  2ZR5 A;  3SJA C;  3BFR A;  1VQP V;  4DV5 O;  2RNB A;  2YI8 A;  3FAV B;  1IBM O;  3K5O A;  4BW9 A;  3ASO C;  1NKD A;  1NBM G;  5FPR A;  1XMQ O;  3H1H H;  3CC7 V;  4IL6 Z;  3VBB A;  4JI2 B;  4PA7 A;  1ZUQ A;  3CJH A;  4ZS6 A;  4URI A;  1X6L A;  2GDS A;  4J9Z B;  5JH7 A;  2P4K A;  4FFK A;  1FYJ A;  1NTM H;  4JFL A;  4IHJ A;  1QR8 A;  5JVD A;  2XP9 A;  4YJ3 A;  4TV9 A;  4DUY B;  3I56 V;  1BS3 A;  3RME A;  1OCO B;  4DR5 B;  3ASN C;  2ZXW B;  2YUA A;  4MS2 A;  1ZTE A;  5IJ0 B;  1Y66 A;  2YXY A;  5L3F A;  1THZ A;  3MD0 A;  2CTW A;  4BF8 A;  4DRQ A;  4IQC A;  1N4C A;  1M4U A;  4JV5 B;  2XAG A;  1MZE A;  3O5P A;  5EZY A;  3HKE B;  4DR6 O;  2LFR A;  3SPH A;  4S3K A;  2ZR6 A;  3ZJZ A;  1CXZ B;  1VEW A;  1XHZ A;  3ZHR A;  4TW8 A;  1XEQ A;  4X1K A;  1S76 D;  3B8N A;  1FXK B;  5L3G A;  3G6E V;  2JEU A;  3Q4H B;  2QEX V;  2OLH A;  5CBG A;  3OR7 C;  5IYZ B;  2LW7 A;  1VQ8 V;  2ZIO A;  1SQQ H;  5LYJ A;  4TT3 G;  4JYA O;  3IJ4 A;  2DN9 A;  3UQB A;  1WN7 A;  3WD1 A;  3KG2 A;  2Q7H A;  3U11 A;  1RSO A;  2DPE A;  5EIB C;  3GU0 A;  1RM1 C;  1EBO A;  3WG7 C;  4RWU A;  2CE4 A;  1VQ4 V;  2GSM B;  4CH3 A;  3BPZ A;  1W2B U;  1X6N A;  4U84 A;  4WKF A;  2QTS A;  1D6O A;  4N21 A;  2GTA A;  1SKV A;  1U96 A;  4H13 B;  1DF5 A;  3K3W A;  3ARS A;  3SYO A;  3X2Q C;  4QJF B;  1NS1 A;  2Y0P A;  1NU1 H;  1TAE A;  2RUC A;  2CGO A;  1M9N A;  3K9S A;  1C9H A;  3JAT B;  4D7S A;  1YIJ V;  4DV1 O;  1XMO B;  2BSK A;  2FAP A;  1PD3 A;  2ZR4 A;  5B1A B;  2CK3 G;  2RN9 A;  5DED A;  4WBN A;  4PA6 A;  2V1D A;  4TNS A;  3E83 A;  3ZHT A;  2LPV A;  2PZS A;  4LAV A;  4UCT A;  2CTR A;  4ZHQ B;  3HB3 B;  1CTN A;  1K5S A;  3CCS V;  4X65 B;  4U7O A;  1V54 C;  1FAF A;  4NXN B;  2KKW A;  1HKM A;  2YXL A;  4JTD B;  1FKJ A;  1T5E A;  1NI8 A;  2DJV A;  1ITX A;  4AY1 A;  2XUM A;  5HFM A;  3LSQ A;  4I7Z B;  1WNO A;  3ZMT A;  2F66 C;  5DIT A;  1Q1C A;  4FZ0 A;  2EIK C;  2F4V B;  3N2G B;  2IU0 A;  4P8V A;  4FJC C;  3ZRX A;  2WLJ A;  4B3S O;  1VP7 A;  2UUA B;  5LOV A;  1G4Y B;  3WL1 A;  2H3O A;  2RCV A;  3RVY A;  1BGY H;  4QIW F;  3PRA A;  2VCD A;  3RM9 A;  4X1I A;  4LFA B;  2ILM A;  1Q43 A;  1KUQ A;  3CRQ A;  4WKH A;  1KB9 F;  1IX9 A;  3TJT A;  3G6L A;  1DTO A;  3L72 H;  3CC2 V;  4H33 A;  5J2U B;  1PNL A;  5KHJ A;  1EHN A;  3JSN A;  3UO3 A;  3T1C A;  5EK0 A;  3CZ8 A;  3IK8 A;  4FMT A;  4G28 B;  4O4H B;  3WD3 A;  3CRC A;  2PPO A;  3TDB A;  2NR5 A;  5BXZ A;  1OCR B;  2DSU A;  3JAS A;  2DT2 A;  1R73 A;  4U7N A;  2OFN A;  2QGN A;  3PN1 A;  5L3B A;  2A79 B;  2R72 A;  4ODQ A;  3JAL A;  4FLX A;  1LUW A;  2CGN A;  4ZIB A;  1VF7 A;  3ASO B;  4MPK A;  3G6B A;  4JYB A;  1FKD A;  1QPL A;  2X6B A;  2OYQ A;  3CX5 F;  5HW6 A;  3EIP A;  2LGW A;  3H1J H;  3O5R A;  2VN1 A;  4MVZ A;  3AK2 A;  2Y48 A;  1XNR O;  3JAR A;  3N27 A;  2ZCE A;  3A8T A;  2PF4 E;  1M56 C;  1EM1 A;  1IBK B;  1HJV A;  1HP8 A;  3RBZ A;  3K0G A;  1M5Y A;  2RSE A;  1GTO A;  1FKS A;  1K9M W;  1G1X B;  5DIV A;  3UF8 A;  4H0L B;  2F2D A;  4I4T B;  4MAV A;  5IJ0 A;  1VQL V;  2JGU A;  5D5P A;  1SQG A;  5LXT B;  3AS1 A;  3NRK A;  4W9P A;  5HW8 A;  3ABK C;  1KD1 W;  2JEX A;  5CN0 A;  3CXH F;  2YC0 A;  5AG2 A;  1VQ7 V;  2EBO A;  4L87 A;  3NXS A;  3ETG A;  5FNV B;  1EN5 A;  2IW5 A;  3P32 A;  1Y74 B;  1J5E B;  2MLX A;  4DZ3 A;  4EEQ A;  4JI0 B;  3KAB A;  1TVK B;  1JND A;  1D2D A;  1L0L H;  2ZQT A;  4ODP A;  3HKD A;  4J7K A;  4DWS C;  4G50 A;  2NNU A;  1TGO A;  4U3J B;  4MVR A;  3P3N A;  3M7M X;  4GX5 A;  3RVZ A;  2Y4U A;  3OAA G;  1JR9 A;  1B6Q A;  3BMB A;  1JPX A;  4ZPV R;  3CXC U;  1HJW A;  1SZT A;  1US6 A;  2UXC B;  3S3X A;  4Z2G A;  1YJN V;  3T1Y B;  3ARZ A;  2M2A A;  3PJS K;  3B9E A;  5LA6 B;  4K8X A;  2PV3 A;  1ZCN A;  4FLV A;  4MTO A;  3FFQ A;  4FLW A;  1P84 F;  3N2K B;  4JAU A;  1F7Y A;  4HZ3 A;  1KKD A;  3ZRS A;  4DK0 A;  1SF9 A;  3AS3 A;  4A5U B;  1PL4 A;  2GBO A;  4DV0 O;  3ARY A;  1ORQ C;  4Z2H A;  4LF9 O;  1B3Q A;  5JQG B;  2HFE C;  1QU7 A;  1L1P A;  5H6Q A;  1MG1 A;  1HKJ A;  4MW3 A;  5DF0 A;  4K35 A;  2DYR B;  1IZ3 A;  1N32 O;  2A3A A;  4DV3 B;  2HJD A;  5FPO A;  2LFS A;  3WIJ A;  3QG5 A;  1HR0 B;  3IC7 A;  1FFX B;  3SGI A;  3ZN0 A;  3GWO A;  1Q7Y W;  3SYC A;  2YBT A;  4GUN A;  2IJI A;  4P8W A;  3LSU A;  1SA0 A;  4ICG A;  3K57 A;  4ODM A;  1Q90 D;  4FLU A;  2E5L O;  3VAW A;  5J2T A;  3JAR B;  1AR5 A;  4JTC B;  1XQ8 A;  2Y0I A;  4O2B B;  1E6R A;  1NWT A;  1KBH A;  4HBE A;  3GVM A;  5B5E Z;  4EB6 A;  3OR6 C;  1NVP B;  4JI3 B;  1K4D C;  2B1G A;  3OGC C;  3CEI A;  4AHC A;  1BL4 A;  2L2S A;  4B3T O;  1AJQ A;  5KHI A;  1PNM A;  1H2M A;  2X0L A;  3M8A A;  3KAF A;  4ML4 A;  3ODK A;  4TUY B;  4GYC B;  1RFY A;  4EB6 B;  3FAP A;  2ZNJ A;  2Q8V A;  4JFI A;  2W0X A;  4BAY A;  2IF4 A;  4IT6 A;  2EIJ B;  3L74 H;  4R0X A;  5KMG A;  2KB1 A;  1GRJ A;  5EYP A;  1OV9 A;  2C2A A;  2XPA A;  2H94 A;  5JJE B;  1MNG A;  3ARU A;  3OD4 A;  4MNK A;  4X66 B;  4LFB B;  2UUB B;  2ZM6 B;  4R8C A;  3KZI Z;  1IXB A;  3ZHQ A;  3ZIA G;  1HNX O;  1Q6U A;  2UXD B;  5I98 A;  2IH3 C;  4ZPW R;  3ARX A;  5H6R A;  3KZ7 A;  5BR8 O;  1HNZ B;  3CHC A;  4TOI A;  5GON B;  3TC5 A;  4ZPT R;  3ZS8 C;  3UQ8 A;  1SET A;  4J7Z A;  4PDM A;  4PD4 F;  1EDQ A;  1E79 G;  5IWA B;  4QNH B;  4LF5 B;  3APO A;  1IX5 A;  3AK1 A;  4FIP C;  2G41 A;  5J6E A;  2ADP A;  4DRX B;  3OTO B;  3THO A;  2RUD A;  4MT8 A;  1NQT A;  1FPO A;  1Q6I A;  1S5L Z;  1JNE A;  1N34 B;  1ZLZ A;  5JWP A;  3KAH A;  3FB7 C;  2QF8 A;  2BSK B;  3PR9 A;  2VQE O;  1LL4 A;  2E3C A;  4CC5 A;  3X2Q B;  2DWD C;  1M93 A;  3JCZ A;  3AG1 B;  4DV7 B;  4W9O A;  3EY6 A;  1QLE B;  2FYU H;  5B1N A;  3ZX6 A;  1AR1 B;  2AW9 A;  4I5S A;  1JJ2 U;  2RDC A;  1XMQ B;  3QTC A;  4DYL A;  5DO2 A;  3IC9 A;  1SS3 A;  1WNS A;  4DV1 B;  2AGA A;  3GB7 C;  2HHH O;  4DO2 A;  3LDC A;  4LWS A;  2VWJ A;  1BHA A;  2UXB O;  2A7W A;  2M7W A;  1OCC C;  5IY5 B;  3OEE G;  4TV8 A;  1GPF A;  2OIE A;  4LF8 O;  4O4I A;  4ODR A;  2YID A;  1KU9 A;  5IT9 N;  1U79 A;  2ZKO A;  2OCC B;  1ARO P;  1LUV A;  3E8G A;  5LHH A;  4JI5 O;  2A3B A;  5HTG A;  5KX5 A;  4D7T A;  5E1A C;  4DR1 B;  4PEL A;  1YVW A;  4XBF A;  4X9Q A;  1MA1 A;  5B1A C;  5B1B C;  3KKY A;  1FFR A;  3RGB A;  1K3E A;  4W4K A;  3ZHU A;  5JJN B;  5LGN A;  2PGG A;  4GKJ O;  3GPK A;  4ZBM A;  3EFF K;  4H37 A;  4I4T A;  4WFE A;  4IT4 A;  2EUL A;  1RPR A;  5ITZ A;  1BZK A;  1RD6 A;  1ZBC A;  4JYA B;  3FYI B;  1GM7 A;  5GON A;  2JDI G;  4NSB A;  4QIB A;  3UT5 A;  4BIU A;  2WPD G;  1XIL A;  3CCL V;  2UZ5 A;  1WP8 A;  3NR7 A;  1HNW O;  5HWC A;  3K0D A;  4LF6 O;  2OTL V;  1YEW A;  1R6N A;  4IGG A;  3CB2 A;  4IIJ A;  3ZRW B;  3CYO A;  1DGS A;  3L75 H;  1JJO A;  4DUY O;  2ITC C;  1XDC A;  4I0X A;  1GH6 A;  3UO2 A;  3SDL A;  2PV1 A;  3TET A;  1AVM A;  2YI9 A;  4P8U A;  4DWS B;  2HG5 C;  2MLY A;  3BY6 A;  1COW G;  1OCZ C;  3O5E A;  1Y76 B;  4IT5 A;  2ESC A;  4Z1M G;  4JV5 O;  1LR1 A;  2R9A A;  5FLX N;  1ZU8 A;  1RPO A;  3CHE A;  3KAC A;  1FKH A;  2XAH A;  4GZR B;  3CCV V;  2QWO B;  1IUR A;  3F5T A;  4BW5 A;  2ODM A;  3I55 V;  2UUC O;  2CTQ A;  2ZR3 A;  4TX0 A;  5L3D A;  3CE2 A;  4JI1 O;  2YSU B;  4YHH O;  5JCO A;  1I5Y A;  1F4M A;  1I0H A;  3RFR A;  4UV8 A;  5DM6 V;  1ZWI C;  5JQG A;  1R6K A;  4YY3 O;  4CS2 A;  1YF2 A;  1H2L A;  2F95 B;  2Q5Z A;  4DUZ O;  2XAQ A;  1MMM A;  1LG2 A;  4LF5 O;  2E75 B;  3MAQ A;  2XND G;  4LC1 A;  5GW7 A;  4NYK A;  1VQO V;  1ZL1 A;  4LCU C;  2KFW A;  4J41 A;  2YEV A;  3T1H O;  4ZHQ A;  2XAS A;  4JFK A;  4WJX A;  1E15 A;  4ZKI A;  2CH7 B;  2RQS A;  4DRH A;  2EZO A;  1B6C A;  3QO5 A;  4U3J A;  1SQF A;  3CMA V;  3ARV A;  3ETQ A;  2QWN B;  2CAZ C;  1J4H A;  1QLE C;  3K5L A;  1JNS A;  4DV2 B;  1W9P A;  1P49 A;  3T4D A;  1EN6 A;  2WLI B;  3KCX A;  2QM7 A;  3SJQ C;  2HVK C;  5DN6 G;  3A0R A;  1EFR G;  2CH7 A;  3MHS C;  4FK5 C;  1D7I A;  1V54 B;  2PYL A;  3ZMU A;  4YJ3 B;  4KHP O;  4TV9 B;  3LNM B;  4OPA A;  2D9F A;  1EZJ A;  2PI6 A;  1P7G A;  5J9P C;  1L8D A;  4UCV A;  3T1Y O;  3OUS A;  3UI4 A;  3W7S A;  3AG2 B;  3SYQ A;  4J4O A;  4MVQ A;  4PDV A;  2Q0A A;  3SYA A;  4JI5 B;  5FNV A;  4KP4 A;  3WB1 A;  1W1P A;  1KYO F;  1YIT V;  3SYP A;  1XI1 A;  4YJ2 B;  1A32 A;  1FKL A;  1ZBV A;  2YIA A;  2XHB A;  2F1M A;  3E8B A;  3ZHV A;  2DYR C;  1AB3 A;  3K5M A;  2FB5 A;  3B77 A;  5HFL A;  1ZX3 A;  1XHX A;  3NI6 A;  4LNU A;  1FJG B;  4JF3 A;  4TW6 A;  1W9U A;  2ZQU A;  3SPI A;  4DW0 A;  1GM9 A;  2QE7 G;  3JAL B;  2WA4 A;  5IYB O;  5LP6 B;  3ICX A;  2P6J A;  1E44 A;  4U86 A;  3BAB A;  1K33 A;  3JAK A;  2Q9L A;  3A0H Z;  4Z2K A;  5HBF A;  1H0G A;  4WIW A;  3RGC A;  2KR7 A;  4JI6 B;  1R6T A;  2WLL A;  3WB2 A;  5FL7 G;  3CCM V;  3WU2 Z;  2QTO A;  4TQD A;  4CS4 A;  1K92 A;  1VQN V;  2ZE8 A;  1WPX A;  2UU9 O;  3K04 A;  4MTV A;  1V55 B;  3C3T A;  3JAK B;  4TSF G;  3VQX A;  4DR5 O;  4RUF A;  2WLM A;  5IDJ A;  1R3J C;  4CZZ A;  1KKC A;  3TXQ A;  2FKX A;  3A2F A;  3LSS A;  4DR4 B;  4MVO A;  2CTP A;  2WLK A;  1J5E O;  2EJR A;  1ENV A;  2E74 B;  1CP9 A;  3BAA A;  3RYH B;  3AEI A;  3ETD A;  1D5N A;  3SR2 C;  4H44 B;  2ARH A;  3RM4 A;  4UVB A;  5JCO C;  3KAG A;  2VQF B;  5LMN B;  1EN4 A;  2MK3 A;  1NMV A;  2XP3 A;  4EKW A;  3LDD A;  1BCC H;  3ASN B;  1JCH A;  5BR8 B;  1XL6 A;  2ZXW C;  3UKM A;  5CBF A;  1FKK A;  2Q7G A;  4XDK A;  1W1T A;  5LMU O;  3K03 A;  4MSW C;  4R5E A;  2G8Z A;  1Y4M A;  2OTJ V;  4UXN A;  1BL8 A;  1IBK O;  2N05 A;  4DZ2 A;  1H2N A;  5LYJ B;  3C3S A;  3QNE A;  3UCS C;  4DRK A;  5GPR A;  3VOU A;  3WG7 B;  1I08 A;  2EJ7 A;  2LGQ A;  3T4Z A;  1H8H G;  2RMK B;  4X20 B;  3OE7 G;  2HEP A;  4DR2 O;  4I9Q A;  4GKK B;  1FFQ A;  5KLV H;  1PBK A;  4R6Z A;  1VAR A;  2F4E A;  5KAF Z;  4DV3 O;  4HBO A;  3IGA C;  4YIP A;  5J2U A;  3AS2 A;  4AQY O;  1JNT A;  3CCJ V;  1NTZ H;  1I5X A;  4IYH A;  2XP6 A;  2CDY A;  4P2Z A;  1TUB A;  5LP6 A;  3HKB A;  2PTM A;  2KE0 A;  5B1B B;  3FX7 A;  2A3C A;  3P3P A;  2IU3 A;  4O2A B;  5HWB A;  2IJK A;  3R65 A;  3A0B Z;  3O5Q A;  4Z2I A;  1NH2 D;  4MTF A;  4LF4 O;  4WFB V;  3OEH G;  1OGB A;  4TQF A;  4NNR A;  2QKS A;  2Y69 B;  4U85 A;  3AK3 A;  3H9V A;  1BSM A;  3O5F A;  4O4J A;  4ABM A;  3CHF A;  2YXH A;  4Q6G A;  2B5U B;  2RUR A;  1AIL A;  4J4N A;  3ZCC A;  2Z5U A;  4O2A A;  1W0K G;  3JSL A;  1GN4 A;  4UB6 Z;  3RW0 A;  5BXJ A;  1XOU A;  5GPG A;  5LBQ A;  4FFB B;  4PI2 A;  4FPP A;  4UFZ A;  1AJN A;  2PV2 A;  1M90 W;  2Q7E A;  4DV0 B;  2B5U A;  3SPC A;  4OX9 O;  1I94 B;  3MDS A;  2B1I A;  3B09 A;  3RYH A;  1HKI A;  1J6Y A;  2Q4P A;  3AG2 C;  5BZB A;  3CGN A;  3IAY A;  1MSD A;  3OMI B;  1D5A A;  3FB8 C;  4C02 B;  4YIO A;  2HKO A;  1OWQ A;  1WB7 A;  1WP7 A;  2A3Q A;  2ZIN A;  1F40 A;  1SQP H;  1XNQ O;  1W0J G;  2DT3 A;  1OCZ B;  1ROU A;  3ABM C;  4PA3 A;  3GWK C;  4WFG A;  1HJX A;  5LGU A;  5KHK A;  2Q68 A;  1K8A W;  3J80 N;  3TGU H;  2IJH A;  5EIB D;  4NXM O;  3SPJ A;  2X6A A;  3O5L A;  4B3T B;  1R3K C;  1HW7 A;  3B40 A;  2X7R B;  4ASU G;  2B31 A;  1N34 O;  5CB4 B;  3VQV A;  5DEZ A;  3HKC A;  1FKG A;  1S3J A;  4HNA A;  1FS0 G;  1GM8 A;  4OPH A;  3LDE A;  5D5Q A;  5IJ9 A;  2Q0O C;  3O5J A;  4P9O A;  1TVK A;  4DT4 A;  1HDJ A;  3D8C A;  3E2E A;  3DC6 A;  1N36 O;  1F4N A;  1FKA O;  2P06 A;  4MNM A;  2PUS A;  5KAI Z;  3O5I A;  4ODL A;  1YW5 A;  1SER A;  2UXD O;  2JVD A;  1RM1 B;  4B3R O;  2O9O A;  2IH1 C;  2YBU A;  1BE3 H;  5LHG A;  4X8A A;  1F23 A;  1VQK V;  2VRZ A;  1M57 B;  4N23 A;  1FKR A;  3JYC A;  3DXR B;  3W7U A;  3OW2 U;  2JJ1 G;  3M99 B;  4Q22 A;  1AR4 A;  2F23 A;  3CS5 A;  4LF7 B;  4RO2 A;  3PA7 A; 
#chains in the Genus database with same CATH homology
 4JFL A;  3O5G A;  1LG1 A;  2XP9 A;  4ODN A;  2DSW A;  2N87 A;  2PBC A;  1H0I A;  2A3B A;  3RME A;  5HTG A;  2KI3 A;  2M1I A;  3WQW A;  4BF8 A;  1FFR A;  4DRQ A;  4IQC A;  2MLZ A;  2MPH A;  3O5P A;  1QZ2 A;  4NZC A;  4MNL A;  3JYJ A;  1NSG A;  3GPK A;  4S3K A;  2ZR6 A;  3NTP A;  4IT4 A;  2PPN A;  4TW8 A;  1RD6 A;  1J4I A;  1ZBC A;  1W26 A;  1R9H A;  3CHD A;  3WQV A;  2WLY A;  2OLH A;  4NSB A;  4QIB A;  4MGV A;  1FAP A;  2UZ5 A;  5HWC A;  1E9L A;  4WK9 A;  4IPX A;  3UQB A;  3WD1 A;  1NWR A;  3B7X A;  4L72 B;  1NH6 A;  2DPE A;  2PV1 A;  4O2T A;  4P8U A;  4DWS B;  2DT0 A;  2MLY A;  3O5E A;  3ARQ A;  5DIU A;  2ZQS A;  1X6N A;  2ESC A;  4DIP A;  4U84 A;  1ZU8 A;  4WKF A;  3CHE A;  3KAC A;  1D6O A;  1FKH A;  2RUQ A;  3ARS A;  1HXV A;  4TX0 A;  1KFW A;  1ZK6 A;  3ARP A;  2RUC A;  3WH0 A;  1HKK A;  4DWS D;  4ITZ A;  1C9H A;  2FAP A;  1LG2 A;  4GGQ A;  1FKB A;  2ZR4 A;  5JH8 A;  1TFV A;  1ZL1 A;  4TNS A;  1EYM A;  2KFW A;  2LPV A;  1D2K A;  4LAV A;  4JFK A;  2XP7 A;  4JFM A;  4W9Q A;  4WJX A;  1CTN A;  1E15 A;  3ARR A;  2RQS A;  4DRH A;  3IHZ A;  1B6C A;  3ARV A;  1SR0 A;  4JYS A;  1HKM A;  1J4H A;  1FKJ A;  1JNS A;  1W9P A;  4ODK A;  1ITX A;  3PRB A;  4AY1 A;  2LGO A;  2WLZ A;  1WNO A;  1YAT A;  5DIT A;  3CH9 A;  4TYO A;  1Q1C A;  3WKZ A;  1D7I A;  2MNT A;  1W1Y A;  4P8V A;  4DRM A;  1D7H A;  3O5D A;  4DRO A;  3O5M A;  3KAI A;  4Z2J A;  3WL1 A;  5GQB A;  2D9F A;  3PRA A;  2PI6 A;  2VCD A;  3RM9 A;  1UR9 A;  3UI4 A;  4J4O A;  1TCO C;  4WKH A;  5D75 A;  4DH0 A;  2XP5 A;  3UI6 A;  1FD9 A;  4MNJ A;  3G6L A;  4DRP A;  1W1P A;  4MSP A;  3G6M A;  1EHN A;  1FKL A;  1ZBV A;  3PRD A;  3ARW A;  1FJD A;  3CZ8 A;  3IK8 A;  3QOK A;  4QZV B;  2WM0 A;  3WD3 A;  2PPO A;  3TDB A;  4HAR A;  2DSU A;  4FN2 A;  2DT2 A;  3MDY B;  3JXV A;  1UR8 A;  3NI6 A;  2OFN A;  2KO7 A;  1ROT A;  3OOB A;  4TW6 A;  1LQ0 A;  1W9U A;  4ODQ A;  2ZQU A;  1LL7 A;  2ITK A;  4MPK A;  4PTM A;  1QPL A;  1FKD A;  4U86 A;  5HT1 A;  4Z2K A;  5HBF A;  1E6Z A;  1H0G A;  2DSV A;  4WIW A;  5HW6 A;  3RGC A;  2KR7 A;  3O5R A;  4QT3 A;  2VN1 A;  2K8I A;  1QPF A;  4Z2L A;  4MTV A;  1HJV A;  1FKF A;  4KR0 B;  1F8A B;  1M5Y A;  2RSE A;  1FKS A;  2A3E A;  5DIV A;  3UF8 A;  2F2D A;  4L3N A;  4MAV A;  3O5O A;  1GUV A;  3JYM A;  1ZBW A;  2Y78 A;  1E6N A;  3KAD A;  2XPB A;  4LAW A;  4Q7N A;  4P8X A;  3AS1 A;  3NRK A;  4W9P A;  5HW8 A;  3RM4 A;  4W5U A;  3KAG A;  1W9V A;  3ALF A;  3TCZ A;  2MLX A;  2ZQV A;  3FXY A;  2Q5A A;  4DZ3 A;  1NMV A;  1NMW A;  2XP3 A;  3H9R B;  3KAB A;  1FKI A;  1JND A;  3W4R A;  4DRJ A;  1LJY A;  2ZQT A;  4TW7 A;  3ALG A;  4ODP A;  1FKK A;  4DWS C;  1W1T A;  1JVW A;  1NWU A;  4N19 A;  4G50 A;  4R5E A;  1E6P A;  2G8Z A;  3WD0 A;  3WD2 A;  2FKE A;  1LL6 A;  4DZ2 A;  3RFW A;  3IKD A;  4S3J A;  4ZPV R;  1HJW A;  5B8I C;  4GIV A;  4DRK A;  5GPR A;  4Z2G A;  1EIB A;  3WD4 A;  3IKG A;  1WB0 A;  3ARZ A;  2M2A A;  1Y0O A;  1FFQ A;  3B9E A;  1PBK A;  1ZCN A;  2F21 A;  1N1A A;  2PV3 A;  3UQI A;  1VF8 A;  2LKN A;  4DWS A;  2F4E A;  3RM8 A;  4HBO A;  3AS3 A;  3ARY A;  1XHG A;  3AS2 A;  4Z2H A;  4IQ2 A;  1JNT A;  3UQA A;  2XP6 A;  1L1P A;  1HKJ A;  5DF0 A;  2A3A A;  3LUO A;  2KE0 A;  1GOI A;  3WIJ A;  2A3C A;  3I6C A;  4FAP A;  5HWB A;  4LAY A;  3O5K A;  3O5Q A;  4Z2I A;  2YBT A;  4P8W A;  1OGB A;  4ODM A;  1BKF A;  4NNR A;  3VAW A;  1ZBK A;  5HUA A;  2O92 A;  1ZB5 A;  4U85 A;  1O6I A;  1E6R A;  1NWT A;  3O5F A;  3CHF A;  2RUR A;  4J4N A;  4HBE A;  3FY1 A;  3B8S A;  5BXJ A;  1WAW A;  2DG9 A;  1D7J A;  3B9A A;  1BL4 A;  2L2S A;  5GPG A;  1SYT A;  1EQ3 A;  2AWG A;  2PV2 A;  2DG4 A;  2M08 A;  3KAF A;  4ML4 A;  3ODK A;  1K9T A;  1NWS A;  4DRI A;  3FAP A;  3B09 A;  1HKI A;  4JFI A;  1J6Y A;  2IF4 A;  3CGN A;  4IT6 A;  2JZV A;  4R0X A;  4C02 B;  1Q6H A;  2XPA A;  1OWQ A;  1F40 A;  3ARU A;  4MNK A;  2DT3 A;  2WK2 A;  1J4R A;  1ROU A;  5HW7 A;  1Q6U A;  1HJX A;  4XAK A;  5I98 A;  4WKA A;  4ZPW R;  3ARX A;  4ODO A;  2PPP A;  3KZ7 A;  3TC5 A;  3CHC A;  4JFJ A;  4ZPT R;  2XP4 A;  3O5L A;  1XRV A;  1EDQ A;  3OA5 A;  3ART A;  2MF9 A;  3KCE A;  2FDM A;  5HKG A;  3B9D A;  1KT0 A;  1T11 A;  2B31 A;  5DEZ A;  1FKG A;  1IX5 A;  3AQU A;  2G41 A;  2IUZ A;  5J6E A;  2AOS A;  2DSZ A;  2RUD A;  1Q6I A;  3O5J A;  3WL0 A;  4DT4 A;  1P5Q A;  1JNE A;  1FKT A;  1PIN A;  3KAH A;  4LGX A;  2QF8 A;  2LJ4 A;  3PR9 A;  1LL4 A;  3ARO A;  4MNM A;  3BXW A;  1OGG A;  3CGM A;  2DT1 A;  4W9O A;  4DRN A;  3O5I A;  3EY6 A;  4LAX A;  4KQZ A;  4ODL A;  1A7X A;  1YW5 A;  2O9O A;  2KGJ A;  1W1V A;  2ZR5 A;  2DG3 A;  2YBU A;  5DO2 A;  1FKR A;  4G2P A;  4QT2 A;  1GPF A;  3AS0 A;  2XP8 A;  4Q22 A;  4ZS6 A;  1KT1 A;  4ODR A;  4URI A;  1X6L A;  3UI5 A;  1U79 A;  3PA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...