1Q6UA

Crystal structure of fkpa from escherichia coli
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
213
structure length
213
Chain Sequence
AFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVKPAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional studies of FkpA from Escherichia coli, a cis/trans peptidyl-prolyl isomerase with chaperone activity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase fkpA
total genus 73
structure length 213
sequence length 213
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2003-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF01346 FKBP_N Domain amino terminal to FKBP-type peptidyl-prolyl isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.460 Mainly Alpha Orthogonal Bundle Helix Hairpins Peptidyl-prolyl cis-trans isomerase, FKBP-type, N-terminal domain 1q6uA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1q6uA02
4DRQA 2RURA 1PINA 2ZQUA 2KR7A 1D7HA 3O5QA 1J4HA 4NNRA 4W9QA 2MLXA 4DH0A 5BXJA 1A7XA 2LPVA 5DITA 2DG4A 2MNTA 2LKNA 4DRPA 2DG9A 2MPHA 1D7IA 2F2DA 2ZQTA 3LUOA 1EQ3A 1D7JA 3IKDA 2XP9A 1Q6UA 4N19A 4JFLA 1N1AA 1T11A 2Q5AA 1FAPA 4TW8A 1FJDA 2PV1A 4FN2A 5J6EA 2N87A 3GPKA 1Y0OA 1Q6IA 2DG3A 2RUCA 2Y78A 2ZQVA 3KZ7A 1YATA 3UQIA 2RQSA 4U84A 3FAPA 5HWCA 4TYOA 2F4EA 3CGNA 4DRKA 2VN1A 3NRKA 4QIBA 3UQBA 4LAXA 2MLZA 1P5QA 3O5DA 1PBKA 4MGVA 2PPOA 4IPXA 5HUAA 4ODLA 4QT3A 3MDYB 5DIVA 3KCEA 3KAFA 3O5KA 3OOBA 2LJ4A 2XPBA 3EY6A 4DIPA 2ZR4A 1NMWA 3KAGA 1JVWA 1YW5A 2RUDA 4ODQA 3O5EA 2MF9A 4ITZA 4ODMA 3RFWA 3O5PA 3JYMA 2KE0A 2XP4A 3KACA 4U85A 1ROUA 1HXVA 4JYSA 1FKGA 3B09A 1U79A 4MSPA 4C02B 3NI6A 4G2PA 2KFWA 1J4IA 2PPPA 4ODPA 3KAHA 4ODOA 4TW7A 4ODNA 2XP7A 2MLYA 1FKSA 3B7XA 2XP8A 1W26A 5HW7A 2ZR6A 4DZ3A 4GGQA 5B8IC 1M5YA 4QT2A 4J4OA 1EYMA 2VCDA 2ZQSA 3UI4A 1J4RA 4DRNA 2D9FA 1JNTA 1QZ2A 2XPAA 3PRBA 4JFIA 4LAVA 4W9PA 4G50A 1QPFA 1KT0A 2XP6A 1FKDA 5HTGA 2FKEA 2KI3A 1Q6HA 3KADA 1R9HA 3O5LA 2PV2A 4JFMA 3WH0A 3TDBA 1C9HA 1BL4A 2IF4A 3IK8A 3I6CA 3JYJA 3PA7A 4TX0A 4DRMA 3CGMA 1NMVA 4DT4A 1L1PA 4DRIA 4FAPA 3O5RA 3O5OA 4IQ2A 4J4NA 1JNSA 1QPLA 1KT1A 1Q1CA 1FKJA 1BKFA 4W9OA 2L2SA 3IKGA 5I98A 4TNSA 2ITKA 2PBCA 2RUQA 3IHZA 5D75A 1ZK6A 2KGJA 4JFKA 2AWGA 4ODKA 1TCOC 3JXVA 1FD9A 1FKHA 1ZCNA 3RGCA 3UI5A 4LAWA 3O5MA 1FKKA 4DZ2A 2OFNA 2JZVA 4R0XA 1D6OA 3KABA 4O2TA 1B6CA 2PV3A 3TC5A 3O5FA 3O5IA 2M08A 3UI6A 3NTPA 4DRJA 4DROA 3H9RB 4ODRA 2K8IA 5HT1A 1F8AB 3UQAA 2F21A 4IQCA 4BF8A 1J6YA 5HW8A 2FAPA 2XP3A 1ROTA 3TCZA 5HKGA 2PPNA 1FKFA 2XP5A 1FKBA 3KAIA 2KO7A 1F40A 3O5JA 5GPGA 3O5GA 4JFJA 1FKLA 1FKTA 2M1IA 2M2AA 1NSGA 2UZ5A 4DRHA 2LGOA 1FKIA 4LAYA 5HWBA 4GIVA 3VAWA 4TW6A 2ZR5A 2RSEA 3UF8A 3PRDA 5HW6A 3ODKA 1FKRA 5DIUA 4U86A
chains in the Genus database with same CATH superfamily
1K4CC 1JMKC 5H6RA 1PINA 2KR7A 2N05A 1IX5A 3FXYA 4FLWA 1H38A 2PI6A 2Q4PA 3EHBB 5IYDO 1OCRC 4FN2A 5J6EA 4O2BB 1FFXB 1YHQV 1GTOA 2PTMA 1NH2D 1O9GA 1K33A 5EZYB 4CS3A 4JI4O 4UCRA 1JNDA 3ABMC 3JCUZ 4DV7O 2F4EA 4DR5B 3O5DA 4FLZA 5KMGA 1NMWA 3CCMV 1YW5A 4BWAA 1Y67A 1AJQA 2YIBA 2KE0A 3ZRXA 1K34A 2EIJB 4WCEV 4B3RB 2ATKC 4YY3B 1K8AW 4JYYA 1SQFA 2R72A 1IBLB 2AGAA 4CH4A 3I55V 1N32B 1HJWA 1XL4A 2RQ6A 1R6NA 3H1HH 4X1YB 2KI3A 3KZIZ 4I7ZB 1LG1A 1KMIZ 3O5LA 4O4LA 1NH2B 3TDBA 4TX0A 2CDYA 3SJAC 4X1IA 2QM7A 5KHIA 4B3SB 2F93B 1HNXO 1I7FA 3ZN0A 1D5NA 1AP5A 2A79B 4X20B 4CS2A 4PV1B 1HP8A 1H2LA 1ORQC 3JXVA 2UXBB 2FMLA 3DXRA 4MVOA 1P84F 3FD9A 1ZCNA 1ZBCA 1XMOB 2QTSA 4CBCA 3E8GA 1SETA 3FYIB 4O2TA 1LJYA 2ZE5A 1HR0B 2XAFA 4DR3O 2Q0AA 4JI8B 5FPRA 2JGDB 5HT1A 1MA1A 1XHGA 4DV2B 4MVZA 2M7WA 5IYZA 1GRJA 3OFNG 4TQFA 5L3GA 2ILMA 5KA5A 3G67A 3QNEA 2P7TC 1RFYA 1IDSA 2AHYA 3JAKA 4CS4A 2UZ5A 4DRHA 2KG7A 1L8DA 5HW6A 1I94B 3T4ZA 1XHXA 2RURA 3AG2B 2QEXV 1NWSA 4JV5B 4DRPA 3HKEB 4X1KB 5CB4A 3CPWU 3ARZA 1L0NH 3SYOA 3D3IA 2BOCC 2CH7A 1Y0OA 2Y78A 3RYHA 3CSXA 3T1HB 4K8ZA 4CH3A 1YJNV 3DTUB 3AEIA 4X62B 2VN1A 3OT7A 3JCZA 5LA6B 4GKKO 1P5QA 2DT0A 2HHHO 1WPXA 3B77A 2IH1C 3ARRA 4U3JB 4WFGA 1UR9A 3EY6A 4LF7B 2Y69B 2BSKA 2BCCH 3W7SA 3L74H 3OTOO 3CC7V 1WNSA 3O5PA 5HFLA 4J7JA 1GO3F 2P90A 1TVKA 3CJHA 4MS2A 2KFWA 2IM9A 1M9NA 3CHEA 3K5MA 4GLXA 1GM8A 2OCCC 2DWDC 4WF9V 2DMXA 1Y74B 1XNRB 1KU9A 5C8YA 1G8MA 1R9HA 4JFMA 3PA7A 1FXVA 4DRIA 2YS8A 4ICGA 4QPJA 4DR1B 1NZ6A 3UQ8A 4LF8B 1ZL8B 4U3FH 3L72H 2A7WA 1H2GA 3N27A 5EC1C 2KGJA 2GTSA 2LO1A 2XAGA 3ARWA 2MW2B 3D3QA 3ZRWA 1HR0O 2OFNA 1B3QA 4R0XA 2WLIA 2ZIOA 2LFSA 3PN1A 3J81N 5L3FA 4JI2B 2QKCA 1MSDA 2UUAO 1YTFB 1SESA 1R3JC 2FAPA 4LBEC 4O4IA 2A9HA 1GKFA 1GAXA 3KAIA 2F43G 3ZMTA 2VQEO 2QWPB 5JH7A 4DO2A 1FKIA 1W0JG 3U0ZA 3UF8A 1FS0G 2BE3A 1JFFB 3ZCCA 4DV6B 5BXJA 1OGBA 4TV9B 1MZEA 2WSSG 1VQ5V 1VP7A 1BZKA 1HDJA 2LKNA 3BEHA 2JEXA 2ZM6B 1ZSPA 5L3DA 5LL6Y 2ZQTA 3LUOA 4F6RA 3VQXA 1EN5A 1T11A 3WD1A 2Q7HA 3L9DA 3GPKA 3CZ8A 2JJ1G 1DF4A 2RQSA 1FFQA 4JTCB 3AK2A 2W6IG 2QM8A 3WL0A 1VQLV 5E79Z 1LL4A 4WKHA 4FJCC 4DRXB 3G6BA 4E2LA 1US6A 3AG4B 2HFEC 4WKAA 5FLXN 1ROUA 4U85A 3I5DA 5HFMA 1RD6A 4NSBA 1NU1H 3K03A 5B1BC 5AG2A 5IJ0B 2DQ3A 4KP4A 4U3JA 4AQYB 3CC2V 4HNAB 3E83A 3HPLC 4X20A 3PR9A 3F7YC 3ZBHA 3P3PA 2F23A 1ZLZA 4MW3A 2R9IA 4JI7O 1G1XB 1LG2A 5FPOA 5B1OA 5IE9A 5J2UA 2EJRA 3CGMA 1NTKH 4IQ2A 2ZR3A 3SYCA 5ITZB 5LP6B 3CCUV 2ITKA 1EIBA 2Q67A 2UXDO 3UKMA 4RO2A 1I5XA 1R6TA 2WA3A 1FKKA 1ZTEA 3S3WA 3B8NA 3CMEV 2DT1A 3QVNA 5BY1A 3ICXA 3WKZA 4TSFG 1BL8A 3ABKC 1D2DA 1LUVA 5HW8A 3HKBB 3U10A 4EB6B 1IBKO 1IBMB 2UXDB 2FB5A 4IIJB 1S0VA 4P8WA 1K73W 1PKXA 2Y4UA 3CCLV 2K9PA 3IAYA 5A2QN 2LGOA 3VAWA 4G2KA 2CH7B 4LFBB 3OR6C 1ITXA 1BT8A 1M93A 1SZXA 1J4HA 1M5IA 1YSCA 4IHJB 5LHGA 1AB3A 1GN4A 1H8HG 2ARHA 1XMQO 4DR6B 2MPHA 3CHDA 1Z5WA 2ZNJA 3AK3A 2C2AA 3MD0A 3RGBA 1OJHA 4DV0O 1N0NA 4N21A 1Q6IA 5IT9N 2IW5A 5IDJA 3OEHG 4DR7O 4U84A 5HWCA 1M1KW 3SYAA 4DRKA 3K5OA 3UQBA 2MLZA 1E79G 5B3SC 2WLZA 3U11A 2BOBC 2O92A 4QT3A 2AXTZ 4DW1A 3ABLB 1S5HC 3CCJV 3HKDA 3FAVB 2YUAA 3A0RA 4I9QA 2RUDA 3IGAC 2LW1A 4DV0B 3OMAB 5DEDA 1YEWA 4FVMA 3ASOB 4JYSA 1Y74A 4K3AA 2X6CA 4NYKA 2ZDIA 2EIKB 1QBZA 4DV3O 2D3OW 4ODNA 3JAWB 4DR2O 2QE7G 1H2SB 3G80A 3ZIAG 3VQWA 1EYMA 3ZJZA 2LW7A 3CYOA 4KUMA 1Q6HA 1JA8A 1EDQA 2GUZB 1I08A 1Q3EA 3X2QB 3BHPA 4FK5C 3ETQA 3JATA 1TUBA 2IUZA 5KX5B 2WLIB 1SC5B 1QU7A 1KD1W 5LMUO 3IKGA 1AI4A 2PBCA 1HJVA 4TT3G 1VQ9V 1ZK6A 4P8UA 1XUQA 4LH7A 3ZHSA 2MK3A 2UXCO 3K3WA 1KUQA 3AG1C 4DWSB 2P06A 3UI5A 1O9HA 4K0KO 4MVSA 5J2TA 5LOVA 3T1CA 3OE7G 1BQ0A 4MSWC 3ZMZA 3FB8C 3OR7C 4HBEA 3JD1A 5LMNO 3CD6V 1V9PA 3WFVA 4DV1B 4Z2WA 5KA6A 1ROTA 5B5EZ 3ETDA 2V1DA 4FLXA 2ESCA 2ETNA 3H1IH 3T1YO 4I5SA 1SA0A 5GTHZ 1YIJV 1WLEA 4K8XA 4CC5A 3CE2A 2UXXA 4X65B 4FPPA 1UPGA 2WLHA 3G6MA 3K79A 1N1AA 5D5PA 4MT8A 4DR7B 3KZ7A 1MG1A 3R66A 2WLNA 4FFBA 4FZ1A 3LUTB 1PL0A 3NRKA 2PZSA 4I50B 3R65A 4JGSA 1GN3A 5IJ0A 3LDEA 4UDMA 5HUAA 1ZUQA 3FB6C 2YXYA 3GVMA 1YJ9V 3RYFB 4WFBV 2QGNA 4QE9A 2XPBA 2OCHA 4P30A 4WFAV 3QG5A 4DV2O 5HBFA 4ODMA 3E22A 1LNQA 3THOA 1B06A 4NTXA 4JAVA 2JS3A 3A0BZ 1DGSA 4MNLA 5J2TB 4JYAB 2CTPA 4R7CA 1QVFU 3RN4A 4G2PA 3MAQA 4MAVA 1M56C 2XP7A 2ZT9B 3SR2C 1FKSA 2E75B 3AG2C 4HAMA 1EHNA 1JVMA 1VF5B 3UT5A 3BA9A 4G28B 5EIBC 1KT0A 1D2KA 1D5AA 3VBBA 1FKDA 5CA3A 2R9AA 4L3NA 4PDVA 2A06H 3G71V 4FZ0A 1ZBKA 4XDLA 5LGNA 5LMUB 4MTGA 1KKDA 4NR1A 5I98A 2EIMB 3BXWA 4LF7O 3K0DA 1Y4MA 1W1PA 2Y69C 2LP7A 1XRVA 2QWOB 4PDMA 2ZM6O 3JATB 1W9VA 2QR4A 2W0XA 5LGUA 4I55A 4AI8A 1FKAO 3KABA 1WA8B 2UUBO 1XEQA 1GN2A 3CRQA 3O5IA 3OM3B 3NXSA 5JCOC 1AJNA 5KHGA 4J41A 3UO3A 3CRAA 1N36B 1M90W 1S5JA 1VQPV 2YI8A 2KSDA 3FB7C 4IL6Z 4ZOLA 4PA6A 1FKLA 2M1IA 3CC4V 4CH6A 2QWQB 1ZBWA 3K04A 5DIUA 2ZE7A 2ZQUA 1K4DC 2CAZC 4O2AA 4W9QA 1URFA 4UV8A 2V4DA 4AQYO 3Q4HB 4MNJA 4JFLA 4YIOA 1VIBA 2PI5A 3S3XA 4O4JB 4JI5O 2ZIMA 3DC6A 4LFCO 2OYQA 1YATA 4MVUA 3CHXA 3FAPA 3SDLA 4B3SO 5IYCO 4X89A 2UUCB 1PM9A 2VRZA 1SZTA 2OTLV 4IPXA 1Y6XA 3B8MA 1S5LZ 5KLVH 2GBOA 1NWUA 4O4HA 4F6EA 3F7VC 4OX9B 2HVJC 4LP8A 2CK3G 4JYAO 3JYMA 1YVWA 1HXVA 2NNUA 1FKGA 3QO5A 3B09A 3TK1A 4OGQB 2HLDG 4BIZA 2Z5UA 5EK0A 5F2VO 2JRIA 4PHZA 5FL7G 2ZR6A 5GPRA 3WQVA 1R3IC 1EFRG 3UI4A 3SPJA 3N2KA 1J4RA 5IYBO 3WIJA 3PRBA 1GMGA 3EXAA 2YXLA 5JH8A 3K59A 3CEIA 2PV2A 3B2EE 3FYEB 4URIA 2A3CA 2QA4V 1COWG 3O5RA 2Y48A 1OWQA 1JNSA 1KT1A 4B3TO 2JGDA 3AK1A 3BVOA 3C3TA 2IJHA 1BKFA 1V55B 1BHBA 3VQYA 1F4MA 3AS2A 5LBQA 1FKHA 3WD0A 1PNLA 5DECA 3AG4C 4O4LB 3M99B 4P9OA 3KKYA 3RBZA 3WB2A 1HW7A 5B1BB 1Q82W 3TC5A 1PL4A 5EYPA 4DV4O 1S76D 5JVDB 3LDDA 2K8IA 1KKCA 2IU0A 1J6YA 1NT2B 4UCUA 2JDIG 1FKTA 2QDOA 4QIWF 2ZQMA 4TW6A 1KP2A 3ABMB 2CTWA 1AILA 2LPVA 3QOKA 2W0FC 5KMGB 4JI1B 4DV5O 1S72V 1Q86W 1Q6UA 4B3MB 1SERA 5GQBA 2Q5AA 4ZKIA 2P6JA 2EX3A 2N87A 1XDCA 2Y4TA 1TVKB 2CUGA 4DR3B 2ZR2A 4XAKA 4DR1O 1WB7A 4WFHA 5JCOA 2UU9O 3PJSK 2B31A 1YI2V 5LXTB 1UR8A 4W5UA 1IVSA 3E8BA 2DYSC 4JI6B 3KAFA 3O5KA 4DIPA 1YCIA 3E8HA 2EILB 2DT2A 5CMUA 3BCCH 5BR8B 1E6PA 1YXBA 1WB0A 4GCZA 4JI2O 4GZRB 4ODOA 4TW7A 3SYQA 2RJZA 1GN6A 5BMVA 1VF6A 2VS0A 2ADPA 2VCDA 4XBFA 2LQTA 2RN9A 3ZRWB 1KQSU 5LOVB 2E3CA 1WP7A 1XNQB 3QF7A 3WQWA 2GTAA 1VMGA 4W4KA 2HHHB 4OPHA 3HKCB 1FJGB 3O9OA 3RVYA 1AI7A 1V54B 3AS3A 3ZEDA 1Q1CA 3JSNA 1VEWA 4I0XA 2DJVA 3ZS8C 3JD3A 1SYTA 3WD2A 1W0KG 4MVMA 4TUYA 1Q81W 2ZKOA 4P2ZA 4X8AA 2QF8A 4EFBA 3L71H 4IT4A 4UVCA 4DROA 3PRAA 1FXHA 1F51A 5CB4B 3WD3A 4JPRA 2LGWA 3AS0A 2E5LO 2YEVA 1P4RA 3WL1A 1BMFG 3GWKC 1JJOA 4FFKA 4LF8O 1KBHA 3JYCA 2RSEA 4Q6GA 1K9MW 1HNZO 4DRQA 4TV8B 3BAAA 4JI1O 1XOUA 2DG4A 2MNTA 3UO2A 4O4HB 4P9PA 3W7TA 4NXNB 4N19A 2ZE6A 2VWKA 3ZRSA 4FIPC 4LFAO 4NTWA 4TW8A 2ZQVA 3AG1B 4DWSC 2A3EA 4MW8A 2ZDIC 5KHJA 5L3CA 5B1AB 3CGNA 3AG7A 3ZX6A 4JI6O 1H0IA 4TQDA 4XDJA 4LF5B 4ODLA 2Q9LA 3ARPA 1Y76A 1G6UA 2VQEB 2QWNB 1GM9A 4KL1A 1NR1A 4I0XB 2EZOA 4F6RB 1NS1A 2MF9A 1K5SA 4Q7NA 1AR1B 2PYLA 2GDSA 3JAKB 5EZYA 3GWOA 3RYCB 4J42A 4ODPA 5B1AC 3K5LA 2L35A 1RM1B 4B3RO 2WLLA 1J95A 4Z2GA 1IBLO 3ETGA 4JI0B 4JFIA 2XPAA 2WWWA 4LNUB 2XP6A 2XNDG 1N36O 4JTAB 4ZPTR 2KB1A 1OZ0A 2ZXWB 3RYIA 1BL4A 3IK8A 2X0LA 2ZD9A 4Z2KA 2F4VO 4TV8A 2YIBD 1FKJA 4YXWG 1DF5A 5KUKA 1BHAA 3CWBH 1HNXB 1R3KC 1E15A 1TGOA 5JJEB 3HKCA 1BS3A 2Y0IA 4IGGA 1R6KA 2PY5A 2B1IA 2D2CB 5JQGB 4KFMA 3BFRA 3ZHVA 3ZHTA 1W1VA 2XUMA 5LA6A 1UJWB 1JNEA 2PI4A 1OGGA 3UM7A 1YZBA 1OCOC 1OCZB 2DT3A 4PA3A 1MABG 5LHIA 4DV3B 1J5EB 1HNWB 4DV7B 3ODKA 1GOIA 3G4SV 4N23A 2Q68A 2OCCB 4S3JA 2WA4A 3ASNB 1EQ3A 3CHFA 3IKDA 4JV5O 4YJ2A 5H2FZ 2WK2A 1AROP 3VQVA 1SA0B 3C3SA 3LSUA 5GONB 4PELA 4X88A 1WP8A 1J5EO 4YJ3B 4H37A 3T1HO 2UUBB 4LAXA 3RVZA 2ZCEA 1BQZA 1BE3H 5IY5C 4OPAA 3N2KB 3MDYB 4CC6A 1N32O 3CRRA 4GKKB 2GSMB 3TGUH 1B04A 5CA0A 3OD4A 4JYCA 5DEZA 3GTYX 2XT9A 1LR1A 3QO8A 4WBNA 2XP4A 4UVBA 5J2UB 4K0KB 5JH7B 4O2BA 4C02B 3JD0A 4RQEA 4DWSD 4JI4B 4X64B 4PDLA 3OAAG 3P3NA 5IY5B 1W26A 1H2KA 4S3KA 3K0GA 1H0GA 5B8IC 4LR3A 3T2MA 2FKEA 4EEQA 2NLJC 3KADA 5KAIZ 3E22B 4LFCB 3J7AU 2IF4A 1QHTA 1QQCA 3CMAV 2HJFC 4AILC 1T5EA 2E76B 1N34B 3O5OA 3T4DA 5JVDA 3ZHQA 3AQUA 4X64O 3E8FA 1IZ3A 1NH6A 3O65A 4GX1A 4WKFA 4BIOA 4AY1A 4MNMA 4OX9O 1TCOC 1TAEA 4X1YA 1RP3B 4DR2B 1HWYA 1K7DA 1B6CA 3IC9A 4X1IB 1ZL8A 4P8XA 3IC7A 1KP3A 3LNMB 1OV9A 2B5UA 3K57A 2HP8A 2PPNA 4LGXA 2XP5A 1SS3A 4D6TH 1ROPA 2OWOA 1FKBA 1M4UA 1FFXA 1EZJA 1TUEB 2H94A 2XAJA 2YIAA 3K9SA 5GW7A 1SQQH 1UFIA 1GH6A 4LAYA 4GIVA 1EN4A 1QVGU 1FKRA 5LXTA 3TXQA 1NI8A 4UFZA 1W9UA 2FYUH 4MTVA 2FL4A 4DV6O 3C90A 1V55C 4LF9B 4FM2A 2DN9A 4HZ3A 1F4NA 1VQ6V 2PV1A 2JK5C 2DG3A 1P7BA 3CH9A 4PA7A 3TXSA 2X6BA 4JF3A 4TV9A 3W7WA 3B9EA 1U96A 2ITCC 2EJ7A 2X6AA 3D36C 4Q22A 4ZHQA 4DV4B 1XILA 3JAMN 4PJ0Z 4UVAA 1JVWA 1NVPB 4LF9O 3OUSA 1PD3A 2GUZA 3RFWA 2YC0A 2YXHA 4Z2HA 4YJ3A 3JSLA 1HKKA 1TA8A 2DYRC 2Q73A 3KAHA 3K9AA 5FNVB 1GM7A 4L87A 1SQXH 4R6ZA 2EINB 5A9GA 2XP8A 3EVKA 4H33A 5EBLC 2DWEC 4UCSA 5IWAO 4J4OA 2Q7EA 2DSVA 4LAVA 1QPFA 3OGIB 1U97A 1WN7A 4D7TA 1OCRB 3JYJA 5J9PC 3I6CA 3W7UA 1R3LC 1ZL1A 4FLTA 1CXZB 4RWUA 4FLVA 1HNZB 1Q90D 3WB0A 1Z5VA 1JQ0A 4ZBMA 4FM0A 1MZFA 1BCCH 1DTOA 1NWTA 1JJ2U 4CZZA 4B7EA 3CCRV 1HJXA 2EILC 1KECA 4GX5A 2XASA 2XAHA 4KQZA 1S3JA 5KAFZ 1KYOF 2LFRA 4PI2A 3CCQV 3AS1A 3ZN1A 4H0LB 4ODRA 4BF8A 1LL6A 4YJ2B 3JALB 2AOSA 4DUYO 3W4RA 1N33B 3ASOC 4JFJA 4WFEA 4EKWA 3CRCA 3B9AA 3MDSA 4DUZO 2CTQA 2N74A 4U86A 3OEEG 3OGCC 3O5QA 4NTYA 1JCHB 3RYFA 3I56V 5DITA 2DE0X 5GTIZ 2DG9A 3OUFA 4W4LA 2XTAA 1VQ8V 2OIGA 4DWSA 2YIDA 3X2QC 4LH6A 3MHHC 1X4TA 3CJHB 3K08A 4Z1VA 1NWRA 2CTRA 3FX7A 1VF8A 2DSWA 3DSQA 1E6ZA 5KX5A 2H3OA 4MGVA 4ML4A 2AHZA 1YTFD 5D5QA 3Q4HA 4JI7B 1VQ4V 4TUYB 1DK1A 3RM4A 1U79A 4ZHQB 4MVQA 4MTXA 1YITV 3OW2U 1MSWD 5ITZA 5LP6A 3FAVA 5HW7A 1K97A 3F5WC 2HEPA 3HR0A 4QT2A 2EIMC 3H1JH 3ZMUA 4W9PA 5K1XA 4NXNO 3IJ4A 2HKOA 1WPBA 2UXNA 5JQGA 4Z2IA 2EIJC 3JAWA 5LGTA 2OIEA 3CS5A 5H9CA 1X6LA 1MNGA 3LNNA 3SPIA 2CGNA 1NJIW 2F1MA 3IHZA 4EB6A 3K58A 1DLBA 1IBKB 1MMMA 4UCOA 4I4TB 2F95B 3FB5C 3KCYA 3E86A 5BZBA 4DZ2A 1K3EA 5DF0A 3H01A 2N04A 1RM1C 2DOSA 3P30A 4I50A 4R8CA 3STZC 1TFVA 3NTPA 2BTQA 4TWKA 3OMNB 4UCVA 1F8AB 1PNMA 4DR5O 1N33O 2Z0AA 1H2NA 3TCZA 4FLUA 2RCVA 4K35A 1FKFA 1THZA 4A5UB 5GONA 3D8CA 5GPGA 2ODMA 2WLKA 4B3TB 1GUVA 2ZXWC 3AROA 2Z3YA 3W7XA 4J11A 2ITDC 2XHBA 2FTKA 3VOUA 2F4VB 1Q5OA 1IURA 3LSQA 4MTFA 2JGUA 1SQVH 4BIUA 4GX2A 4ZI7A 1W2BU 4QE7A 2PUSA 1XHZA 2XP9A 4B08A 1XI1A 4UV9A 1X6NA 1JPXA 2PF4E 4RAIA 3CHCA 3TETA 4LF4B 4DK0A 3JASB 2GV9A 1FJGO 3RT3C 3L75H 3P32A 1YF2A 4YHHB 2IJKA 1N0JA 1N34O 4JI3B 1WNOA 3KAGA 2P4KA 4GUNA 1ENVA 1FAFA 1VARA 2YI9A 3AG3C 1NVPD 3HB3B 4OXSA 2F66C 4LWSA 3ABUA 3N2GA 5B66Z 2WLYA 3SYPA 2MLYA 1XMOO 1M57C 4DV5B 3ZHUA 2BTQB 2DSZA 2Y0PA 4UCTA 4JI3O 2UXCB 3ARTA 3ARUA 2XOKG 4ZS6A 1SKVA 2CGOA 3WH0A 4I9WA 3M7MX 3J80N 3B8SA 1XBLA 3ZRVA 1P7GA 1QPLA 4LF6B 4RUFA 3ALGA 2BTOA 1AI5A 1QNMA 4IYIA 3JALA 3WU2Z 2P5OA 1K9TA 2AWGA 4KHPO 4UB8Z 1GPFA 2G8ZA 3HKBA 2XAQA 1QR8A 3O5MA 1D6OA 1NTMH 4GKJB 3ARSA 2Q7GA 4YY3O 3GB7C 4ZPVR 1W1YA 1QLNA 1IXMA 1VF6C 2HR3A 4X62O 3UQAA 1CTNA 4BW9A 2QKSA 3SJQC 3BPZA 5B1NA 4ABMA 5DO2A 3LDCA 3O5GA 1RSOA 3JARA 4HBOA 1KB9F 1PNKA 1FXKA 4KR0B 2K1EA 1Z2GA 1AJPA 3OTOB 2ZR5A 3BA8A 3N2GB 3SJCC 5DN6G 4GKJO 4C7UA 2V7QG 1F23A 4DH0A 3JD2A 1A7XA 1G4YB 1WAZA 5LP6C 1VQ7V 3ABTA 2G38A 3IFXA 1FAPA 4LF4O 1E6NA 2YEVB 2RUCA 2Q8VA 2IJIA 1NKDA 3UQIA 5FNVA 2AZ0A 1P49A 3CX5F 4QIBA 3D36A 1SR0A 4X66O 2PYJA 3E35A 1PPJH 2UUCO 3ABKB 4LNUA 4IIJA 2YDEA 3BABA 3CP1A 3L70H 4MSPA 1AR4A 2H8PC 3APOA 3JD4A 2VQFO 1ZX3A 1Q7YW 4DW0A 1EN6A 3K06A 1SQPH 4X66B 2QWRB 3ALFA 4DZ3A 1QLEC 2FDMA 2D9FA 1JNTA 4I4TA 4UUJC 4G50A 2LJ2A 5HTGA 4R50A 2PN0A 4NZCA 5EC2C 4G27B 2G41A 1RSOB 3JARB 4E4EA 1HNWO 4NKGB 3RYCA 2VWJA 3ARQA 4FAPA 2VQFB 4KXRA 3WG7B 2WLJA 2DPEA 4WIWA 1OHHG 4W9OA 2O57A 4HNAA 4U7OA 3SJBC 4FM1A 4XDKA 4ASUG 1YDXA 1HKJA 4QNHB 2A0LA 3M8AA 2L6LA 5EIBD 2KKWA 1A32A 2KG7B 1H2MA 5C8YB 4IT5A 5KHKA 2JEUA 4DK1A 2DYRB 3E89A 3TJTA 4DXWA 2OTJV 1ZWIC 5CN0A 3WG7C 2DYSB 5JJNB 1E44A 3O5FA 4J9ZB 5BXZA 3ARYA 3OTFA 4QZVB 1HKIA 5H5NA 1R1BA 4GYCB 1SF9A 2XP3A 4D7SA 4PA4A 4X1KA 2WM0A 3O5JA 2LGQA 2DW4A 1XNRO 3JASA 5LYJA 4HARA 5CBFA 2EULA 4R5EA 3H9VA 4DR4B 3RYHB 2EBOA 1WA8A 3RM9A 4X65O 2WLMA 4NNRA 1E9LA 2OT5A 3OA5A 4GX0A 2WPDG 4B7KA 3QO7A 4DRXA 1Q8IA 4FLYA 2F2DA 1N4CA 4WK9A 1ZB5A 4BR6A 3DGEA 3SPGA 4JZ2A 1V54C 4CH5A 2ZE8A 4DR4O 4LCUC 1EM1A 3UT5B 5KUMA 3F5TA 5IYZB 3RM8A 2Q0OC 2JJ2G 4DUYB 1XQ8A 2WAMA 3KACA 4O4JA 3FY1A 2X7RB 5BR8O 3NI6A 5JWPA 1J4IA 2PPPA 1QCEA 4J7ZA 2YSUB 2NN4A 5B3SB 3B7XA 1I0HA 1RPOA 1E6RA 3RWRD 3A0HZ 4FMTA 3ARVA 2ZQSA 1ZU8A 1QZ2A 5CA0B 3ML0A 5IJ9B 4J7KA 5TISZ 1WJZA 4I55B 3G6EV 4YIPA 4RQFA 5L3BA 1LUWA 1I94O 2IJJA 4FFBB 1Y66A 3BY6A 5H6QA 4Z2JA 3SPCA 1XL6A 4LFBO 3CRMA 4IYHA 2RUQA 4L8JA 1ZAUA 2P22C 1WAWA 4ODKA 2E74B 2A3AA 1FD9A 4DYLA 1XMQB 4LAWA 5CBHA 1PV0A 2QM4A 2YICA 1K92A 1JFFA 5DM6V 1W59A 3RFRA 4ZI7B 2B9ZA 4ZPWR 4HYOA 3UI6A 3WD4A 2HVKC 2W6JG 4O2AB 5C93A 3FFQA 4IQCA 4B3MO 1BGYH 5HKGA 3ZMVA 2Q69A 3CB2A 1F40A 4U7NA 3UCSC 1NSGA 4WFFA 1Q43A 4BAYA 1E1RG 4H44B 4QPKA 1D7HA 2P4VA 5IWAB 1AVMA 1PP9H 4JI5B 2JS5A 4NXMB 5LYJB 4J9YB 2QJ1A 1FFTB 3MHSC 2ZINA 4LFAB 3GU0A 2JIZG 1LL7A 3RMEA 5K1PA 2R70A 1PBKA 5CA1B 3OOBA 1IX9A 2DQ0A 2B1GA 3HKEA 4J10A 4ZOLB 3O5EA 3B4SA 4ITZA 4ODQA 1X59A 4NB5A 2M6YA 4BW5A 2R9RB 4H13B 4KHPB 1CEZA 3ZMSA 2A3QA 4QJFB 4QGPA 1L0LH 1AP6A 2OLHA 5EBWC 4GGQA 1OCOB 5CBGA 2YBTA 1OCZC 3DC5A 4DR6O 1SQGA 1I5YA 4JAAA 4JI0O 1SRYA 2BSKB 4MTOA 5LMNB 1XREA 1JOYA 5E1AC 2IBZH 1GK9A 2QTOA 1C9HA 1L1PA 4P8VA 4DT4A 1IXBA 1NMVA 1M56B 1E1QG 5BMVB 3T1YB 1YJWV 4YHHO 1WB8A 3ASNC 2RNBA 5EYPB 3A8TA 3ETEA 4ZIBA 5D75A 4X9QA 3ARXA 2E5LB 4JASA 3CCSV 3BRCA 3QTCA 3RGCA 3STLC 5LHHA 3APQA 2Q5ZA 3AG3B 1R73A 1XNQO 1S77D 3LSSA 3FKSG 1L1FA 3ZHRA 2M08A 1M57B 1CP9A 1HKMA 4DRJA 5CA1A 3H9RB 1AR5A 2GHYA 3H1LH 3B9DA 3DXRB 2F21A 2RDCA 3L73H 1B6QA 4UXNA 4JAUA 2ADQB 3RW0A 2KO7A 3K5NA 1H8EG 2M2AA 5HWBA 2AW9A 3H1KH 3EFFK 1SQBH 3KG2A 4EFEA 1F7YA 3CXHF 2MLXA 3E2EA 4LF6O 3HKDB 2HJDA 3CCVV 1AI6A 4NXMO 1D7IA 3WB1A 1D7JA 4Z2LA 1FJDA 1KFWA 3A2FA 1VQMV 4O4IB 3B40A 3G6LA 2UUAB 2UU9B 1NR7A 4GT1A 4TYOA 2O9OA 4NVPA 4PA9A 2EINC 2CE4A 5JJJB 2A3BA 2PPOA 5DIVA 1BSMA 2B5UB 3KCEA 1QR9A 4JZGA 2LJ4A 4UB6Z 2ZR4A 2IH3C 4DV1O 2PGGA 2RMKB 4DUZB 1FFRA 2NR5A 4RUEA 2P67A 1W1TA 3RYIB 5IJ9A 1VQOV 2IU3A 5EBMC 3SPHA 2Q6AA 4IHJA 4Q20A 4LF5O 5KHHA 3SGIA 1M5YA 3EIPA 3TCUA 4DRNA 4WBNB 1Y76B 1IBMO 2QSAA 1VQKV 2HG5C 4LWSB 2EZPA 4MPKA 1VF7A 1MOFA 1FXKB 1NTZH 4DRMA 1JR9A 3OMIB 2JVDA 4J4NA 4L72B 4WJXA 2AZ2A 4MNKA 2FKXA 2YBUA 5L3EA 2WLLB 1NBMG 1VQNV 4HBNA 2L2SA 4Z1MG 1OCCB 4TNSA 1N8RW 1W9PA 2DSUA 4JFKA 2QKAA 2KQXA 3BMBA 1CPYA 4J80A 4JYBA 4LC1A 2UXBO 1EZVH 4F4LA 3NR7A 2ZNIA 3CCEV 1FXKC 2JZVA 4AHCA 4TOIA 1KC8W 1RPRA 1EBOA 2PV3A 1JCHA 4PTMA 3CXCU 4IT6A 3ABLC 4PD4F 1FYJA 1OCCC 4JTDB 4JI8O 1QLEB 1K5QA 4PI0A 4PDRA 1JX9A 1LQ0A 1FPOA 1NQTA 2EIKC 1O6IA 3KCXA 4MVRA 1ZBVA 3PRDA 1TUBB
chains in the Genus database with same CATH topology
1GOIA 1PINA 2KR7A 4DH0A 1A7XA 1IX5A 3FXYA 4S3JA 2PI6A 3G6MA 1EQ3A 3CHFA 3IKDA 1N1AA 1FAPA 2WK2A 1E6NA 4FN2A 5J6EA 3KZ7A 2RUCA 3UQIA 1JNDA 2F4EA 4QIBA 3NRKA 1SR0A 4LAXA 3O5DA 5HUAA 3MDYB 2XPBA 1NMWA 5HBFA 1YW5A 5DEZA 4ODMA 2KE0A 2XP4A 4MSPA 4MNLA 4C02B 4G2PA 4MAVA 4DWSD 2XP7A 1FKSA 1W26A 4S3KA 4DZ3A 3ALFA 1H0GA 1EHNA 2FDMA 5B8IC 1HJWA 2D9FA 1JNTA 4G50A 1KT0A 5HTGA 1D2KA 1FKDA 2FKEA 4L3NA 2KI3A 1LG1A 3KADA 3O5LA 4NZCA 2G41A 3TDBA 4TX0A 2IF4A 4FAPA 1ZBKA 3ARQA 3O5OA 3AQUA 2DPEA 4WIWA 4W9OA 1NH6A 5I98A 1HKJA 4WKFA 3BXWA 4AY1A 4MNMA 1W1PA 3JXVA 1TCOC 1XRVA 1ZCNA 1ZBCA 1W9VA 3KABA 4O2TA 1B6CA 1LJYA 3O5FA 3O5IA 4P8XA 3ARYA 4QZVB 1HKIA 5HT1A 1XHGA 2XP3A 2PPNA 4LGXA 2XP5A 2WM0A 1FKBA 3O5JA 1FKLA 2M1IA 4HARA 2UZ5A 4DRHA 4LAYA 4GIVA 1ZBWA 4R5EA 5HW6A 1FKRA 5DIUA 3RM9A 2RURA 2ZQUA 1W9UA 4NNRA 1E9LA 4W9QA 4MTVA 3OA5A 1NWSA 4DRPA 2F2DA 4MNJA 4WK9A 4JFLA 3ARZA 1ZB5A 2PV1A 1Y0OA 2DG3A 2Y78A 3CH9A 1YATA 3FAPA 3B9EA 2VN1A 1P5QA 2DT0A 4IPXA 3ARRA 4Q22A 1UR9A 1NWUA 3EY6A 1JVWA 3RM8A 3RFWA 3O5PA 3JYMA 3KACA 1HXVA 1FKGA 4Z2HA 3FY1A 3B09A 3NI6A 1HKKA 2KFWA 1J4IA 2PPPA 3KAHA 3CHEA 3B7XA 2XP8A 2ZR6A 1E6RA 5GPRA 3WQVA 3ARVA 4J4OA 3UI4A 2ZQSA 1J4RA 1ZU8A 3WIJA 1QZ2A 3PRBA 2DSVA 4LAVA 1QPFA 5JH8A 1R9HA 2PV2A 4JFMA 3JYJA 3PA7A 3I6CA 4URIA 2A3CA 4DRIA 3O5RA 1OWQA 1ZL1A 1JNSA 1KT1A 4Z2JA 1BKFA 2RUQA 2KGJA 1NWTA 1WAWA 3AS2A 4ODKA 2A3AA 3ARWA 1FD9A 1HJXA 1FKHA 3WD0A 4KQZA 4LAWA 2OFNA 4R0XA 3TC5A 3AS1A 4ZPWR 3UI6A 3WD4A 4ODRA 2K8IA 4IQCA 4BF8A 1J6YA 1LL6A 2FAPA 2AOSA 5HKGA 3W4RA 3KAIA 1F40A 4JFJA 1FKTA 3B9AA 1NSGA 1FKIA 4TW6A 3UF8A 4U86A 1D7HA 3O5QA 5BXJA 1OGBA 2LPVA 3QOKA 5DITA 2LKNA 2DG9A 2ZQTA 3LUOA 1Q6UA 1T11A 2Q5AA 5GQBA 3WD1A 4DWSA 2N87A 3GPKA 3CZ8A 2RQSA 4XAKA 1FFQA 1LL7A 1NWRA 3RMEA 1VF8A 2DSWA 3WL0A 2B31A 1E6ZA 1PBKA 4MGVA 4ML4A 1UR8A 4W5UA 3KAFA 3O5KA 3OOBA 1LL4A 4DIPA 4WKHA 2DT2A 3O5EA 4ODQA 4ITZA 1E6PA 4WKAA 4U85A 1ROUA 1RD6A 4NSBA 3RM4A 1U79A 1WB0A 4ODOA 4TW7A 2OLHA 3PR9A 5HW7A 4GGQA 4QT2A 2YBTA 2VCDA 4W9PA 1LG2A 3WQWA 1C9HA 4Z2IA 1L1PA 4P8VA 4DT4A 3CGMA 1NMVA 1X6LA 4IQ2A 3AS3A 1Q1CA 2ITKA 3IHZA 5D75A 1EIBA 3ARXA 1SYTA 3WD2A 3RGCA 1FKKA 4DZ2A 5DF0A 2QF8A 2DT1A 2M08A 4IT4A 1TFVA 1HKMA 3NTPA 3WKZA 4DRJA 3H9RB 3PRAA 4DROA 1F8AB 3B9DA 3WD3A 2F21A 5HW8A 3AS0A 3TCZA 1FKFA 4P8WA 2KO7A 3WL1A 5GPGA 2M2AA 2LGOA 5HWBA 1GUVA 3VAWA 3AROA 2RSEA 1ITXA 4DRQA 1J4HA 2MLXA 2DG4A 2MNTA 2MPHA 1D7IA 3CHDA 1D7JA 2XP9A 4N19A 4Z2LA 1X6NA 1KFWA 4TW8A 1FJDA 1Q6IA 2ZQVA 4DWSC 3G6LA 2A3EA 3CHCA 4U84A 5HWCA 4TYOA 2O9OA 3CGNA 4DRKA 3UQBA 2MLZA 1H0IA 2PPOA 2A3BA 2WLZA 2O92A 4ODLA 4QT3A 5DIVA 3ARPA 3KCEA 2LJ4A 2ZR4A 1WNOA 3KAGA 2RUDA 2MF9A 1FFRA 4Q7NA 1W1TA 4JYSA 4ODPA 2WLYA 4ODNA 2MLYA 4Z2GA 1M5YA 2DSZA 1EYMA 4DRNA 4JFIA 2XPAA 3ARTA 3ARUA 2XP6A 4MPKA 4ZS6A 4ZPTR 1Q6HA 1EDQA 3WH0A 1BL4A 3IK8A 4DRMA 3B8SA 4Z2KA 2IUZA 4J4NA 4L72B 4WJXA 4MNKA 1QPLA 2YBUA 1FKJA 3ALGA 2L2SA 3IKGA 4TNSA 2PBCA 1HJVA 1W9PA 1ZK6A 4P8UA 2DSUA 4JFKA 1K9TA 2AWGA 1E15A 4DWSB 1GPFA 2G8ZA 3UI5A 3O5MA 2JZVA 1D6OA 3ARSA 2PV3A 4PTMA 1W1VA 4ZPVR 4HBEA 4IT6A 1JNEA 1W1YA 1OGGA 3UQAA 1CTNA 1ROTA 2DT3A 1LQ0A 5DO2A 3O5GA 4HBOA 1O6IA 2ESCA 4KR0B 2ZR5A 1ZBVA 3PRDA 3ODKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRQ A;  2RUR A;  1PIN A;  2ZQU A;  2KR7 A;  1D7H A;  3O5Q A;  1J4H A;  4NNR A;  4W9Q A;  2MLX A;  4DH0 A;  5BXJ A;  1A7X A;  2LPV A;  5DIT A;  2DG4 A;  2MNT A;  2LKN A;  4DRP A;  2DG9 A;  2MPH A;  1D7I A;  2F2D A;  2ZQT A;  3LUO A;  1EQ3 A;  1D7J A;  3IKD A;  2XP9 A;  1Q6U A;  4N19 A;  4JFL A;  1N1A A;  1T11 A;  2Q5A A;  1FAP A;  4TW8 A;  1FJD A;  2PV1 A;  4FN2 A;  5J6E A;  2N87 A;  3GPK A;  1Y0O A;  1Q6I A;  2DG3 A;  2RUC A;  2Y78 A;  2ZQV A;  3KZ7 A;  1YAT A;  3UQI A;  2RQS A;  4U84 A;  3FAP A;  5HWC A;  4TYO A;  2F4E A;  3CGN A;  4DRK A;  2VN1 A;  3NRK A;  4QIB A;  3UQB A;  4LAX A;  2MLZ A;  1P5Q A;  3O5D A;  1PBK A;  4MGV A;  2PPO A;  4IPX A;  5HUA A;  4ODL A;  4QT3 A;  3MDY B;  5DIV A;  3KCE A;  3KAF A;  3O5K A;  3OOB A;  2LJ4 A;  2XPB A;  3EY6 A;  4DIP A;  2ZR4 A;  1NMW A;  3KAG A;  1JVW A;  1YW5 A;  2RUD A;  4ODQ A;  3O5E A;  2MF9 A;  4ITZ A;  4ODM A;  3RFW A;  3O5P A;  3JYM A;  2KE0 A;  2XP4 A;  3KAC A;  4U85 A;  1ROU A;  1HXV A;  4JYS A;  1FKG A;  3B09 A;  1U79 A;  4MSP A;  4C02 B;  3NI6 A;  4G2P A;  2KFW A;  1J4I A;  2PPP A;  4ODP A;  3KAH A;  4ODO A;  4TW7 A;  4ODN A;  2XP7 A;  2MLY A;  1FKS A;  3B7X A;  2XP8 A;  1W26 A;  5HW7 A;  2ZR6 A;  4DZ3 A;  4GGQ A;  5B8I C;  1M5Y A;  4QT2 A;  4J4O A;  1EYM A;  2VCD A;  2ZQS A;  3UI4 A;  1J4R A;  4DRN A;  2D9F A;  1JNT A;  1QZ2 A;  2XPA A;  3PRB A;  4JFI A;  4LAV A;  4W9P A;  4G50 A;  1QPF A;  1KT0 A;  2XP6 A;  1FKD A;  5HTG A;  2FKE A;  2KI3 A;  1Q6H A;  3KAD A;  1R9H A;  3O5L A;  2PV2 A;  4JFM A;  3WH0 A;  3TDB A;  1C9H A;  1BL4 A;  2IF4 A;  3IK8 A;  3I6C A;  3JYJ A;  3PA7 A;  4TX0 A;  4DRM A;  3CGM A;  1NMV A;  4DT4 A;  1L1P A;  4DRI A;  4FAP A;  3O5R A;  3O5O A;  4IQ2 A;  4J4N A;  1JNS A;  1QPL A;  1KT1 A;  1Q1C A;  1FKJ A;  1BKF A;  4W9O A;  2L2S A;  3IKG A;  5I98 A;  4TNS A;  2ITK A;  2PBC A;  2RUQ A;  3IHZ A;  5D75 A;  1ZK6 A;  2KGJ A;  4JFK A;  2AWG A;  4ODK A;  1TCO C;  3JXV A;  1FD9 A;  1FKH A;  1ZCN A;  3RGC A;  3UI5 A;  4LAW A;  3O5M A;  1FKK A;  4DZ2 A;  2OFN A;  2JZV A;  4R0X A;  1D6O A;  3KAB A;  4O2T A;  1B6C A;  2PV3 A;  3TC5 A;  3O5F A;  3O5I A;  2M08 A;  3UI6 A;  3NTP A;  4DRJ A;  4DRO A;  3H9R B;  4ODR A;  2K8I A;  5HT1 A;  1F8A B;  3UQA A;  2F21 A;  4IQC A;  4BF8 A;  1J6Y A;  5HW8 A;  2FAP A;  2XP3 A;  1ROT A;  3TCZ A;  5HKG A;  2PPN A;  1FKF A;  2XP5 A;  1FKB A;  3KAI A;  2KO7 A;  1F40 A;  3O5J A;  5GPG A;  3O5G A;  4JFJ A;  1FKL A;  1FKT A;  2M1I A;  2M2A A;  1NSG A;  2UZ5 A;  4DRH A;  2LGO A;  1FKI A;  4LAY A;  5HWB A;  4GIV A;  3VAW A;  4TW6 A;  2ZR5 A;  2RSE A;  3UF8 A;  3PRD A;  5HW6 A;  3ODK A;  1FKR A;  5DIU A;  4U86 A; 
#chains in the Genus database with same CATH topology
 1K4C C;  1JMK C;  5H6R A;  1PIN A;  2KR7 A;  2N05 A;  1IX5 A;  3FXY A;  4FLW A;  1H38 A;  2PI6 A;  2Q4P A;  3EHB B;  5IYD O;  1OCR C;  4FN2 A;  5J6E A;  4O2B B;  1FFX B;  1YHQ V;  1GTO A;  2PTM A;  1NH2 D;  1O9G A;  1K33 A;  5EZY B;  4CS3 A;  4JI4 O;  4UCR A;  1JND A;  3ABM C;  3JCU Z;  4DV7 O;  2F4E A;  4DR5 B;  3O5D A;  4FLZ A;  5KMG A;  1NMW A;  3CCM V;  1YW5 A;  4BWA A;  1Y67 A;  1AJQ A;  2YIB A;  2KE0 A;  3ZRX A;  1K34 A;  2EIJ B;  4WCE V;  4B3R B;  2ATK C;  4YY3 B;  1K8A W;  4JYY A;  1SQF A;  2R72 A;  1IBL B;  2AGA A;  4CH4 A;  3I55 V;  1N32 B;  1HJW A;  1XL4 A;  2RQ6 A;  1R6N A;  3H1H H;  4X1Y B;  2KI3 A;  3KZI Z;  4I7Z B;  1LG1 A;  1KMI Z;  3O5L A;  4O4L A;  1NH2 B;  3TDB A;  4TX0 A;  2CDY A;  3SJA C;  4X1I A;  2QM7 A;  5KHI A;  4B3S B;  2F93 B;  1HNX O;  1I7F A;  3ZN0 A;  1D5N A;  1AP5 A;  2A79 B;  4X20 B;  4CS2 A;  4PV1 B;  1HP8 A;  1H2L A;  1ORQ C;  3JXV A;  2UXB B;  2FML A;  3DXR A;  4MVO A;  1P84 F;  3FD9 A;  1ZCN A;  1ZBC A;  1XMO B;  2QTS A;  4CBC A;  3E8G A;  1SET A;  3FYI B;  4O2T A;  1LJY A;  2ZE5 A;  1HR0 B;  2XAF A;  4DR3 O;  2Q0A A;  4JI8 B;  5FPR A;  2JGD B;  5HT1 A;  1MA1 A;  1XHG A;  4DV2 B;  4MVZ A;  2M7W A;  5IYZ A;  1GRJ A;  3OFN G;  4TQF A;  5L3G A;  2ILM A;  5KA5 A;  3G67 A;  3QNE A;  2P7T C;  1RFY A;  1IDS A;  2AHY A;  3JAK A;  4CS4 A;  2UZ5 A;  4DRH A;  2KG7 A;  1L8D A;  5HW6 A;  1I94 B;  3T4Z A;  1XHX A;  2RUR A;  3AG2 B;  2QEX V;  1NWS A;  4JV5 B;  4DRP A;  3HKE B;  4X1K B;  5CB4 A;  3CPW U;  3ARZ A;  1L0N H;  3SYO A;  3D3I A;  2BOC C;  2CH7 A;  1Y0O A;  2Y78 A;  3RYH A;  3CSX A;  3T1H B;  4K8Z A;  4CH3 A;  1YJN V;  3DTU B;  3AEI A;  4X62 B;  2VN1 A;  3OT7 A;  3JCZ A;  5LA6 B;  4GKK O;  1P5Q A;  2DT0 A;  2HHH O;  1WPX A;  3B77 A;  2IH1 C;  3ARR A;  4U3J B;  4WFG A;  1UR9 A;  3EY6 A;  4LF7 B;  2Y69 B;  2BSK A;  2BCC H;  3W7S A;  3L74 H;  3OTO O;  3CC7 V;  1WNS A;  3O5P A;  5HFL A;  4J7J A;  1GO3 F;  2P90 A;  1TVK A;  3CJH A;  4MS2 A;  2KFW A;  2IM9 A;  1M9N A;  3CHE A;  3K5M A;  4GLX A;  1GM8 A;  2OCC C;  2DWD C;  4WF9 V;  2DMX A;  1Y74 B;  1XNR B;  1KU9 A;  5C8Y A;  1G8M A;  1R9H A;  4JFM A;  3PA7 A;  1FXV A;  4DRI A;  2YS8 A;  4ICG A;  4QPJ A;  4DR1 B;  1NZ6 A;  3UQ8 A;  4LF8 B;  1ZL8 B;  4U3F H;  3L72 H;  2A7W A;  1H2G A;  3N27 A;  5EC1 C;  2KGJ A;  2GTS A;  2LO1 A;  2XAG A;  3ARW A;  2MW2 B;  3D3Q A;  3ZRW A;  1HR0 O;  2OFN A;  1B3Q A;  4R0X A;  2WLI A;  2ZIO A;  2LFS A;  3PN1 A;  3J81 N;  5L3F A;  4JI2 B;  2QKC A;  1MSD A;  2UUA O;  1YTF B;  1SES A;  1R3J C;  2FAP A;  4LBE C;  4O4I A;  2A9H A;  1GKF A;  1GAX A;  3KAI A;  2F43 G;  3ZMT A;  2VQE O;  2QWP B;  5JH7 A;  4DO2 A;  1FKI A;  1W0J G;  3U0Z A;  3UF8 A;  1FS0 G;  2BE3 A;  1JFF B;  3ZCC A;  4DV6 B;  5BXJ A;  1OGB A;  4TV9 B;  1MZE A;  2WSS G;  1VQ5 V;  1VP7 A;  1BZK A;  1HDJ A;  2LKN A;  3BEH A;  2JEX A;  2ZM6 B;  1ZSP A;  5L3D A;  5LL6 Y;  2ZQT A;  3LUO A;  4F6R A;  3VQX A;  1EN5 A;  1T11 A;  3WD1 A;  2Q7H A;  3L9D A;  3GPK A;  3CZ8 A;  2JJ1 G;  1DF4 A;  2RQS A;  1FFQ A;  4JTC B;  3AK2 A;  2W6I G;  2QM8 A;  3WL0 A;  1VQL V;  5E79 Z;  1LL4 A;  4WKH A;  4FJC C;  4DRX B;  3G6B A;  4E2L A;  1US6 A;  3AG4 B;  2HFE C;  4WKA A;  5FLX N;  1ROU A;  4U85 A;  3I5D A;  5HFM A;  1RD6 A;  4NSB A;  1NU1 H;  3K03 A;  5B1B C;  5AG2 A;  5IJ0 B;  2DQ3 A;  4KP4 A;  4U3J A;  4AQY B;  3CC2 V;  4HNA B;  3E83 A;  3HPL C;  4X20 A;  3PR9 A;  3F7Y C;  3ZBH A;  3P3P A;  2F23 A;  1ZLZ A;  4MW3 A;  2R9I A;  4JI7 O;  1G1X B;  1LG2 A;  5FPO A;  5B1O A;  5IE9 A;  5J2U A;  2EJR A;  3CGM A;  1NTK H;  4IQ2 A;  2ZR3 A;  3SYC A;  5ITZ B;  5LP6 B;  3CCU V;  2ITK A;  1EIB A;  2Q67 A;  2UXD O;  3UKM A;  4RO2 A;  1I5X A;  1R6T A;  2WA3 A;  1FKK A;  1ZTE A;  3S3W A;  3B8N A;  3CME V;  2DT1 A;  3QVN A;  5BY1 A;  3ICX A;  3WKZ A;  4TSF G;  1BL8 A;  3ABK C;  1D2D A;  1LUV A;  5HW8 A;  3HKB B;  3U10 A;  4EB6 B;  1IBK O;  1IBM B;  2UXD B;  2FB5 A;  4IIJ B;  1S0V A;  4P8W A;  1K73 W;  1PKX A;  2Y4U A;  3CCL V;  2K9P A;  3IAY A;  5A2Q N;  2LGO A;  3VAW A;  4G2K A;  2CH7 B;  4LFB B;  3OR6 C;  1ITX A;  1BT8 A;  1M93 A;  1SZX A;  1J4H A;  1M5I A;  1YSC A;  4IHJ B;  5LHG A;  1AB3 A;  1GN4 A;  1H8H G;  2ARH A;  1XMQ O;  4DR6 B;  2MPH A;  3CHD A;  1Z5W A;  2ZNJ A;  3AK3 A;  2C2A A;  3MD0 A;  3RGB A;  1OJH A;  4DV0 O;  1N0N A;  4N21 A;  1Q6I A;  5IT9 N;  2IW5 A;  5IDJ A;  3OEH G;  4DR7 O;  4U84 A;  5HWC A;  1M1K W;  3SYA A;  4DRK A;  3K5O A;  3UQB A;  2MLZ A;  1E79 G;  5B3S C;  2WLZ A;  3U11 A;  2BOB C;  2O92 A;  4QT3 A;  2AXT Z;  4DW1 A;  3ABL B;  1S5H C;  3CCJ V;  3HKD A;  3FAV B;  2YUA A;  3A0R A;  4I9Q A;  2RUD A;  3IGA C;  2LW1 A;  4DV0 B;  3OMA B;  5DED A;  1YEW A;  4FVM A;  3ASO B;  4JYS A;  1Y74 A;  4K3A A;  2X6C A;  4NYK A;  2ZDI A;  2EIK B;  1QBZ A;  4DV3 O;  2D3O W;  4ODN A;  3JAW B;  4DR2 O;  2QE7 G;  1H2S B;  3G80 A;  3ZIA G;  3VQW A;  1EYM A;  3ZJZ A;  2LW7 A;  3CYO A;  4KUM A;  1Q6H A;  1JA8 A;  1EDQ A;  2GUZ B;  1I08 A;  1Q3E A;  3X2Q B;  3BHP A;  4FK5 C;  3ETQ A;  3JAT A;  1TUB A;  2IUZ A;  5KX5 B;  2WLI B;  1SC5 B;  1QU7 A;  1KD1 W;  5LMU O;  3IKG A;  1AI4 A;  2PBC A;  1HJV A;  4TT3 G;  1VQ9 V;  1ZK6 A;  4P8U A;  1XUQ A;  4LH7 A;  3ZHS A;  2MK3 A;  2UXC O;  3K3W A;  1KUQ A;  3AG1 C;  4DWS B;  2P06 A;  3UI5 A;  1O9H A;  4K0K O;  4MVS A;  5J2T A;  5LOV A;  3T1C A;  3OE7 G;  1BQ0 A;  4MSW C;  3ZMZ A;  3FB8 C;  3OR7 C;  4HBE A;  3JD1 A;  5LMN O;  3CD6 V;  1V9P A;  3WFV A;  4DV1 B;  4Z2W A;  5KA6 A;  1ROT A;  5B5E Z;  3ETD A;  2V1D A;  4FLX A;  2ESC A;  2ETN A;  3H1I H;  3T1Y O;  4I5S A;  1SA0 A;  5GTH Z;  1YIJ V;  1WLE A;  4K8X A;  4CC5 A;  3CE2 A;  2UXX A;  4X65 B;  4FPP A;  1UPG A;  2WLH A;  3G6M A;  3K79 A;  1N1A A;  5D5P A;  4MT8 A;  4DR7 B;  3KZ7 A;  1MG1 A;  3R66 A;  2WLN A;  4FFB A;  4FZ1 A;  3LUT B;  1PL0 A;  3NRK A;  2PZS A;  4I50 B;  3R65 A;  4JGS A;  1GN3 A;  5IJ0 A;  3LDE A;  4UDM A;  5HUA A;  1ZUQ A;  3FB6 C;  2YXY A;  3GVM A;  1YJ9 V;  3RYF B;  4WFB V;  2QGN A;  4QE9 A;  2XPB A;  2OCH A;  4P30 A;  4WFA V;  3QG5 A;  4DV2 O;  5HBF A;  4ODM A;  3E22 A;  1LNQ A;  3THO A;  1B06 A;  4NTX A;  4JAV A;  2JS3 A;  3A0B Z;  1DGS A;  4MNL A;  5J2T B;  4JYA B;  2CTP A;  4R7C A;  1QVF U;  3RN4 A;  4G2P A;  3MAQ A;  4MAV A;  1M56 C;  2XP7 A;  2ZT9 B;  3SR2 C;  1FKS A;  2E75 B;  3AG2 C;  4HAM A;  1EHN A;  1JVM A;  1VF5 B;  3UT5 A;  3BA9 A;  4G28 B;  5EIB C;  1KT0 A;  1D2K A;  1D5A A;  3VBB A;  1FKD A;  5CA3 A;  2R9A A;  4L3N A;  4PDV A;  2A06 H;  3G71 V;  4FZ0 A;  1ZBK A;  4XDL A;  5LGN A;  5LMU B;  4MTG A;  1KKD A;  4NR1 A;  5I98 A;  2EIM B;  3BXW A;  4LF7 O;  3K0D A;  1Y4M A;  1W1P A;  2Y69 C;  2LP7 A;  1XRV A;  2QWO B;  4PDM A;  2ZM6 O;  3JAT B;  1W9V A;  2QR4 A;  2W0X A;  5LGU A;  4I55 A;  4AI8 A;  1FKA O;  3KAB A;  1WA8 B;  2UUB O;  1XEQ A;  1GN2 A;  3CRQ A;  3O5I A;  3OM3 B;  3NXS A;  5JCO C;  1AJN A;  5KHG A;  4J41 A;  3UO3 A;  3CRA A;  1N36 B;  1M90 W;  1S5J A;  1VQP V;  2YI8 A;  2KSD A;  3FB7 C;  4IL6 Z;  4ZOL A;  4PA6 A;  1FKL A;  2M1I A;  3CC4 V;  4CH6 A;  2QWQ B;  1ZBW A;  3K04 A;  5DIU A;  2ZE7 A;  2ZQU A;  1K4D C;  2CAZ C;  4O2A A;  4W9Q A;  1URF A;  4UV8 A;  2V4D A;  4AQY O;  3Q4H B;  4MNJ A;  4JFL A;  4YIO A;  1VIB A;  2PI5 A;  3S3X A;  4O4J B;  4JI5 O;  2ZIM A;  3DC6 A;  4LFC O;  2OYQ A;  1YAT A;  4MVU A;  3CHX A;  3FAP A;  3SDL A;  4B3S O;  5IYC O;  4X89 A;  2UUC B;  1PM9 A;  2VRZ A;  1SZT A;  2OTL V;  4IPX A;  1Y6X A;  3B8M A;  1S5L Z;  5KLV H;  2GBO A;  1NWU A;  4O4H A;  4F6E A;  3F7V C;  4OX9 B;  2HVJ C;  4LP8 A;  2CK3 G;  4JYA O;  3JYM A;  1YVW A;  1HXV A;  2NNU A;  1FKG A;  3QO5 A;  3B09 A;  3TK1 A;  4OGQ B;  2HLD G;  4BIZ A;  2Z5U A;  5EK0 A;  5F2V O;  2JRI A;  4PHZ A;  5FL7 G;  2ZR6 A;  5GPR A;  3WQV A;  1R3I C;  1EFR G;  3UI4 A;  3SPJ A;  3N2K A;  1J4R A;  5IYB O;  3WIJ A;  3PRB A;  1GMG A;  3EXA A;  2YXL A;  5JH8 A;  3K59 A;  3CEI A;  2PV2 A;  3B2E E;  3FYE B;  4URI A;  2A3C A;  2QA4 V;  1COW G;  3O5R A;  2Y48 A;  1OWQ A;  1JNS A;  1KT1 A;  4B3T O;  2JGD A;  3AK1 A;  3BVO A;  3C3T A;  2IJH A;  1BKF A;  1V55 B;  1BHB A;  3VQY A;  1F4M A;  3AS2 A;  5LBQ A;  1FKH A;  3WD0 A;  1PNL A;  5DEC A;  3AG4 C;  4O4L B;  3M99 B;  4P9O A;  3KKY A;  3RBZ A;  3WB2 A;  1HW7 A;  5B1B B;  1Q82 W;  3TC5 A;  1PL4 A;  5EYP A;  4DV4 O;  1S76 D;  5JVD B;  3LDD A;  2K8I A;  1KKC A;  2IU0 A;  1J6Y A;  1NT2 B;  4UCU A;  2JDI G;  1FKT A;  2QDO A;  4QIW F;  2ZQM A;  4TW6 A;  1KP2 A;  3ABM B;  2CTW A;  1AIL A;  2LPV A;  3QOK A;  2W0F C;  5KMG B;  4JI1 B;  4DV5 O;  1S72 V;  1Q86 W;  1Q6U A;  4B3M B;  1SER A;  5GQB A;  2Q5A A;  4ZKI A;  2P6J A;  2EX3 A;  2N87 A;  1XDC A;  2Y4T A;  1TVK B;  2CUG A;  4DR3 B;  2ZR2 A;  4XAK A;  4DR1 O;  1WB7 A;  4WFH A;  5JCO A;  2UU9 O;  3PJS K;  2B31 A;  1YI2 V;  5LXT B;  1UR8 A;  4W5U A;  1IVS A;  3E8B A;  2DYS C;  4JI6 B;  3KAF A;  3O5K A;  4DIP A;  1YCI A;  3E8H A;  2EIL B;  2DT2 A;  5CMU A;  3BCC H;  5BR8 B;  1E6P A;  1YXB A;  1WB0 A;  4GCZ A;  4JI2 O;  4GZR B;  4ODO A;  4TW7 A;  3SYQ A;  2RJZ A;  1GN6 A;  5BMV A;  1VF6 A;  2VS0 A;  2ADP A;  2VCD A;  4XBF A;  2LQT A;  2RN9 A;  3ZRW B;  1KQS U;  5LOV B;  2E3C A;  1WP7 A;  1XNQ B;  3QF7 A;  3WQW A;  2GTA A;  1VMG A;  4W4K A;  2HHH B;  4OPH A;  3HKC B;  1FJG B;  3O9O A;  3RVY A;  1AI7 A;  1V54 B;  3AS3 A;  3ZED A;  1Q1C A;  3JSN A;  1VEW A;  4I0X A;  2DJV A;  3ZS8 C;  3JD3 A;  1SYT A;  3WD2 A;  1W0K G;  4MVM A;  4TUY A;  1Q81 W;  2ZKO A;  4P2Z A;  4X8A A;  2QF8 A;  4EFB A;  3L71 H;  4IT4 A;  4UVC A;  4DRO A;  3PRA A;  1FXH A;  1F51 A;  5CB4 B;  3WD3 A;  4JPR A;  2LGW A;  3AS0 A;  2E5L O;  2YEV A;  1P4R A;  3WL1 A;  1BMF G;  3GWK C;  1JJO A;  4FFK A;  4LF8 O;  1KBH A;  3JYC A;  2RSE A;  4Q6G A;  1K9M W;  1HNZ O;  4DRQ A;  4TV8 B;  3BAA A;  4JI1 O;  1XOU A;  2DG4 A;  2MNT A;  3UO2 A;  4O4H B;  4P9P A;  3W7T A;  4NXN B;  4N19 A;  2ZE6 A;  2VWK A;  3ZRS A;  4FIP C;  4LFA O;  4NTW A;  4TW8 A;  2ZQV A;  3AG1 B;  4DWS C;  2A3E A;  4MW8 A;  2ZDI C;  5KHJ A;  5L3C A;  5B1A B;  3CGN A;  3AG7 A;  3ZX6 A;  4JI6 O;  1H0I A;  4TQD A;  4XDJ A;  4LF5 B;  4ODL A;  2Q9L A;  3ARP A;  1Y76 A;  1G6U A;  2VQE B;  2QWN B;  1GM9 A;  4KL1 A;  1NR1 A;  4I0X B;  2EZO A;  4F6R B;  1NS1 A;  2MF9 A;  1K5S A;  4Q7N A;  1AR1 B;  2PYL A;  2GDS A;  3JAK B;  5EZY A;  3GWO A;  3RYC B;  4J42 A;  4ODP A;  5B1A C;  3K5L A;  2L35 A;  1RM1 B;  4B3R O;  2WLL A;  1J95 A;  4Z2G A;  1IBL O;  3ETG A;  4JI0 B;  4JFI A;  2XPA A;  2WWW A;  4LNU B;  2XP6 A;  2XND G;  1N36 O;  4JTA B;  4ZPT R;  2KB1 A;  1OZ0 A;  2ZXW B;  3RYI A;  1BL4 A;  3IK8 A;  2X0L A;  2ZD9 A;  4Z2K A;  2F4V O;  4TV8 A;  2YIB D;  1FKJ A;  4YXW G;  1DF5 A;  5KUK A;  1BHA A;  3CWB H;  1HNX B;  1R3K C;  1E15 A;  1TGO A;  5JJE B;  3HKC A;  1BS3 A;  2Y0I A;  4IGG A;  1R6K A;  2PY5 A;  2B1I A;  2D2C B;  5JQG B;  4KFM A;  3BFR A;  3ZHV A;  3ZHT A;  1W1V A;  2XUM A;  5LA6 A;  1UJW B;  1JNE A;  2PI4 A;  1OGG A;  3UM7 A;  1YZB A;  1OCO C;  1OCZ B;  2DT3 A;  4PA3 A;  1MAB G;  5LHI A;  4DV3 B;  1J5E B;  1HNW B;  4DV7 B;  3ODK A;  1GOI A;  3G4S V;  4N23 A;  2Q68 A;  2OCC B;  4S3J A;  2WA4 A;  3ASN B;  1EQ3 A;  3CHF A;  3IKD A;  4JV5 O;  4YJ2 A;  5H2F Z;  2WK2 A;  1ARO P;  3VQV A;  1SA0 B;  3C3S A;  3LSU A;  5GON B;  4PEL A;  4X88 A;  1WP8 A;  1J5E O;  4YJ3 B;  4H37 A;  3T1H O;  2UUB B;  4LAX A;  3RVZ A;  2ZCE A;  1BQZ A;  1BE3 H;  5IY5 C;  4OPA A;  3N2K B;  3MDY B;  4CC6 A;  1N32 O;  3CRR A;  4GKK B;  2GSM B;  3TGU H;  1B04 A;  5CA0 A;  3OD4 A;  4JYC A;  5DEZ A;  3GTY X;  2XT9 A;  1LR1 A;  3QO8 A;  4WBN A;  2XP4 A;  4UVB A;  5J2U B;  4K0K B;  5JH7 B;  4O2B A;  4C02 B;  3JD0 A;  4RQE A;  4DWS D;  4JI4 B;  4X64 B;  4PDL A;  3OAA G;  3P3N A;  5IY5 B;  1W26 A;  1H2K A;  4S3K A;  3K0G A;  1H0G A;  5B8I C;  4LR3 A;  3T2M A;  2FKE A;  4EEQ A;  2NLJ C;  3KAD A;  5KAI Z;  3E22 B;  4LFC B;  3J7A U;  2IF4 A;  1QHT A;  1QQC A;  3CMA V;  2HJF C;  4AIL C;  1T5E A;  2E76 B;  1N34 B;  3O5O A;  3T4D A;  5JVD A;  3ZHQ A;  3AQU A;  4X64 O;  3E8F A;  1IZ3 A;  1NH6 A;  3O65 A;  4GX1 A;  4WKF A;  4BIO A;  4AY1 A;  4MNM A;  4OX9 O;  1TCO C;  1TAE A;  4X1Y A;  1RP3 B;  4DR2 B;  1HWY A;  1K7D A;  1B6C A;  3IC9 A;  4X1I B;  1ZL8 A;  4P8X A;  3IC7 A;  1KP3 A;  3LNM B;  1OV9 A;  2B5U A;  3K57 A;  2HP8 A;  2PPN A;  4LGX A;  2XP5 A;  1SS3 A;  4D6T H;  1ROP A;  2OWO A;  1FKB A;  1M4U A;  1FFX A;  1EZJ A;  1TUE B;  2H94 A;  2XAJ A;  2YIA A;  3K9S A;  5GW7 A;  1SQQ H;  1UFI A;  1GH6 A;  4LAY A;  4GIV A;  1EN4 A;  1QVG U;  1FKR A;  5LXT A;  3TXQ A;  1NI8 A;  4UFZ A;  1W9U A;  2FYU H;  4MTV A;  2FL4 A;  4DV6 O;  3C90 A;  1V55 C;  4LF9 B;  4FM2 A;  2DN9 A;  4HZ3 A;  1F4N A;  1VQ6 V;  2PV1 A;  2JK5 C;  2DG3 A;  1P7B A;  3CH9 A;  4PA7 A;  3TXS A;  2X6B A;  4JF3 A;  4TV9 A;  3W7W A;  3B9E A;  1U96 A;  2ITC C;  2EJ7 A;  2X6A A;  3D36 C;  4Q22 A;  4ZHQ A;  4DV4 B;  1XIL A;  3JAM N;  4PJ0 Z;  4UVA A;  1JVW A;  1NVP B;  4LF9 O;  3OUS A;  1PD3 A;  2GUZ A;  3RFW A;  2YC0 A;  2YXH A;  4Z2H A;  4YJ3 A;  3JSL A;  1HKK A;  1TA8 A;  2DYR C;  2Q73 A;  3KAH A;  3K9A A;  5FNV B;  1GM7 A;  4L87 A;  1SQX H;  4R6Z A;  2EIN B;  5A9G A;  2XP8 A;  3EVK A;  4H33 A;  5EBL C;  2DWE C;  4UCS A;  5IWA O;  4J4O A;  2Q7E A;  2DSV A;  4LAV A;  1QPF A;  3OGI B;  1U97 A;  1WN7 A;  4D7T A;  1OCR B;  3JYJ A;  5J9P C;  3I6C A;  3W7U A;  1R3L C;  1ZL1 A;  4FLT A;  1CXZ B;  4RWU A;  4FLV A;  1HNZ B;  1Q90 D;  3WB0 A;  1Z5V A;  1JQ0 A;  4ZBM A;  4FM0 A;  1MZF A;  1BCC H;  1DTO A;  1NWT A;  1JJ2 U;  4CZZ A;  4B7E A;  3CCR V;  1HJX A;  2EIL C;  1KEC A;  4GX5 A;  2XAS A;  2XAH A;  4KQZ A;  1S3J A;  5KAF Z;  1KYO F;  2LFR A;  4PI2 A;  3CCQ V;  3AS1 A;  3ZN1 A;  4H0L B;  4ODR A;  4BF8 A;  1LL6 A;  4YJ2 B;  3JAL B;  2AOS A;  4DUY O;  3W4R A;  1N33 B;  3ASO C;  4JFJ A;  4WFE A;  4EKW A;  3CRC A;  3B9A A;  3MDS A;  4DUZ O;  2CTQ A;  2N74 A;  4U86 A;  3OEE G;  3OGC C;  3O5Q A;  4NTY A;  1JCH B;  3RYF A;  3I56 V;  5DIT A;  2DE0 X;  5GTI Z;  2DG9 A;  3OUF A;  4W4L A;  2XTA A;  1VQ8 V;  2OIG A;  4DWS A;  2YID A;  3X2Q C;  4LH6 A;  3MHH C;  1X4T A;  3CJH B;  3K08 A;  4Z1V A;  1NWR A;  2CTR A;  3FX7 A;  1VF8 A;  2DSW A;  3DSQ A;  1E6Z A;  5KX5 A;  2H3O A;  4MGV A;  4ML4 A;  2AHZ A;  1YTF D;  5D5Q A;  3Q4H A;  4JI7 B;  1VQ4 V;  4TUY B;  1DK1 A;  3RM4 A;  1U79 A;  4ZHQ B;  4MVQ A;  4MTX A;  1YIT V;  3OW2 U;  1MSW D;  5ITZ A;  5LP6 A;  3FAV A;  5HW7 A;  1K97 A;  3F5W C;  2HEP A;  3HR0 A;  4QT2 A;  2EIM C;  3H1J H;  3ZMU A;  4W9P A;  5K1X A;  4NXN O;  3IJ4 A;  2HKO A;  1WPB A;  2UXN A;  5JQG A;  4Z2I A;  2EIJ C;  3JAW A;  5LGT A;  2OIE A;  3CS5 A;  5H9C A;  1X6L A;  1MNG A;  3LNN A;  3SPI A;  2CGN A;  1NJI W;  2F1M A;  3IHZ A;  4EB6 A;  3K58 A;  1DLB A;  1IBK B;  1MMM A;  4UCO A;  4I4T B;  2F95 B;  3FB5 C;  3KCY A;  3E86 A;  5BZB A;  4DZ2 A;  1K3E A;  5DF0 A;  3H01 A;  2N04 A;  1RM1 C;  2DOS A;  3P30 A;  4I50 A;  4R8C A;  3STZ C;  1TFV A;  3NTP A;  2BTQ A;  4TWK A;  3OMN B;  4UCV A;  1F8A B;  1PNM A;  4DR5 O;  1N33 O;  2Z0A A;  1H2N A;  3TCZ A;  4FLU A;  2RCV A;  4K35 A;  1FKF A;  1THZ A;  4A5U B;  5GON A;  3D8C A;  5GPG A;  2ODM A;  2WLK A;  4B3T B;  1GUV A;  2ZXW C;  3ARO A;  2Z3Y A;  3W7X A;  4J11 A;  2ITD C;  2XHB A;  2FTK A;  3VOU A;  2F4V B;  1Q5O A;  1IUR A;  3LSQ A;  4MTF A;  2JGU A;  1SQV H;  4BIU A;  4GX2 A;  4ZI7 A;  1W2B U;  4QE7 A;  2PUS A;  1XHZ A;  2XP9 A;  4B08 A;  1XI1 A;  4UV9 A;  1X6N A;  1JPX A;  2PF4 E;  4RAI A;  3CHC A;  3TET A;  4LF4 B;  4DK0 A;  3JAS B;  2GV9 A;  1FJG O;  3RT3 C;  3L75 H;  3P32 A;  1YF2 A;  4YHH B;  2IJK A;  1N0J A;  1N34 O;  4JI3 B;  1WNO A;  3KAG A;  2P4K A;  4GUN A;  1ENV A;  1FAF A;  1VAR A;  2YI9 A;  3AG3 C;  1NVP D;  3HB3 B;  4OXS A;  2F66 C;  4LWS A;  3ABU A;  3N2G A;  5B66 Z;  2WLY A;  3SYP A;  2MLY A;  1XMO O;  1M57 C;  4DV5 B;  3ZHU A;  2BTQ B;  2DSZ A;  2Y0P A;  4UCT A;  4JI3 O;  2UXC B;  3ART A;  3ARU A;  2XOK G;  4ZS6 A;  1SKV A;  2CGO A;  3WH0 A;  4I9W A;  3M7M X;  3J80 N;  3B8S A;  1XBL A;  3ZRV A;  1P7G A;  1QPL A;  4LF6 B;  4RUF A;  3ALG A;  2BTO A;  1AI5 A;  1QNM A;  4IYI A;  3JAL A;  3WU2 Z;  2P5O A;  1K9T A;  2AWG A;  4KHP O;  4UB8 Z;  1GPF A;  2G8Z A;  3HKB A;  2XAQ A;  1QR8 A;  3O5M A;  1D6O A;  1NTM H;  4GKJ B;  3ARS A;  2Q7G A;  4YY3 O;  3GB7 C;  4ZPV R;  1W1Y A;  1QLN A;  1IXM A;  1VF6 C;  2HR3 A;  4X62 O;  3UQA A;  1CTN A;  4BW9 A;  2QKS A;  3SJQ C;  3BPZ A;  5B1N A;  4ABM A;  5DO2 A;  3LDC A;  3O5G A;  1RSO A;  3JAR A;  4HBO A;  1KB9 F;  1PNK A;  1FXK A;  4KR0 B;  2K1E A;  1Z2G A;  1AJP A;  3OTO B;  2ZR5 A;  3BA8 A;  3N2G B;  3SJC C;  5DN6 G;  4GKJ O;  4C7U A;  2V7Q G;  1F23 A;  4DH0 A;  3JD2 A;  1A7X A;  1G4Y B;  1WAZ A;  5LP6 C;  1VQ7 V;  3ABT A;  2G38 A;  3IFX A;  1FAP A;  4LF4 O;  1E6N A;  2YEV B;  2RUC A;  2Q8V A;  2IJI A;  1NKD A;  3UQI A;  5FNV A;  2AZ0 A;  1P49 A;  3CX5 F;  4QIB A;  3D36 A;  1SR0 A;  4X66 O;  2PYJ A;  3E35 A;  1PPJ H;  2UUC O;  3ABK B;  4LNU A;  4IIJ A;  2YDE A;  3BAB A;  3CP1 A;  3L70 H;  4MSP A;  1AR4 A;  2H8P C;  3APO A;  3JD4 A;  2VQF O;  1ZX3 A;  1Q7Y W;  4DW0 A;  1EN6 A;  3K06 A;  1SQP H;  4X66 B;  2QWR B;  3ALF A;  4DZ3 A;  1QLE C;  2FDM A;  2D9F A;  1JNT A;  4I4T A;  4UUJ C;  4G50 A;  2LJ2 A;  5HTG A;  4R50 A;  2PN0 A;  4NZC A;  5EC2 C;  4G27 B;  2G41 A;  1RSO B;  3JAR B;  4E4E A;  1HNW O;  4NKG B;  3RYC A;  2VWJ A;  3ARQ A;  4FAP A;  2VQF B;  4KXR A;  3WG7 B;  2WLJ A;  2DPE A;  4WIW A;  1OHH G;  4W9O A;  2O57 A;  4HNA A;  4U7O A;  3SJB C;  4FM1 A;  4XDK A;  4ASU G;  1YDX A;  1HKJ A;  4QNH B;  2A0L A;  3M8A A;  2L6L A;  5EIB D;  2KKW A;  1A32 A;  2KG7 B;  1H2M A;  5C8Y B;  4IT5 A;  5KHK A;  2JEU A;  4DK1 A;  2DYR B;  3E89 A;  3TJT A;  4DXW A;  2OTJ V;  1ZWI C;  5CN0 A;  3WG7 C;  2DYS B;  5JJN B;  1E44 A;  3O5F A;  4J9Z B;  5BXZ A;  3ARY A;  3OTF A;  4QZV B;  1HKI A;  5H5N A;  1R1B A;  4GYC B;  1SF9 A;  2XP3 A;  4D7S A;  4PA4 A;  4X1K A;  2WM0 A;  3O5J A;  2LGQ A;  2DW4 A;  1XNR O;  3JAS A;  5LYJ A;  4HAR A;  5CBF A;  2EUL A;  4R5E A;  3H9V A;  4DR4 B;  3RYH B;  2EBO A;  1WA8 A;  3RM9 A;  4X65 O;  2WLM A;  4NNR A;  1E9L A;  2OT5 A;  3OA5 A;  4GX0 A;  2WPD G;  4B7K A;  3QO7 A;  4DRX A;  1Q8I A;  4FLY A;  2F2D A;  1N4C A;  4WK9 A;  1ZB5 A;  4BR6 A;  3DGE A;  3SPG A;  4JZ2 A;  1V54 C;  4CH5 A;  2ZE8 A;  4DR4 O;  4LCU C;  1EM1 A;  3UT5 B;  5KUM A;  3F5T A;  5IYZ B;  3RM8 A;  2Q0O C;  2JJ2 G;  4DUY B;  1XQ8 A;  2WAM A;  3KAC A;  4O4J A;  3FY1 A;  2X7R B;  5BR8 O;  3NI6 A;  5JWP A;  1J4I A;  2PPP A;  1QCE A;  4J7Z A;  2YSU B;  2NN4 A;  5B3S B;  3B7X A;  1I0H A;  1RPO A;  1E6R A;  3RWR D;  3A0H Z;  4FMT A;  3ARV A;  2ZQS A;  1ZU8 A;  1QZ2 A;  5CA0 B;  3ML0 A;  5IJ9 B;  4J7K A;  5TIS Z;  1WJZ A;  4I55 B;  3G6E V;  4YIP A;  4RQF A;  5L3B A;  1LUW A;  1I94 O;  2IJJ A;  4FFB B;  1Y66 A;  3BY6 A;  5H6Q A;  4Z2J A;  3SPC A;  1XL6 A;  4LFB O;  3CRM A;  4IYH A;  2RUQ A;  4L8J A;  1ZAU A;  2P22 C;  1WAW A;  4ODK A;  2E74 B;  2A3A A;  1FD9 A;  4DYL A;  1XMQ B;  4LAW A;  5CBH A;  1PV0 A;  2QM4 A;  2YIC A;  1K92 A;  1JFF A;  5DM6 V;  1W59 A;  3RFR A;  4ZI7 B;  2B9Z A;  4ZPW R;  4HYO A;  3UI6 A;  3WD4 A;  2HVK C;  2W6J G;  4O2A B;  5C93 A;  3FFQ A;  4IQC A;  4B3M O;  1BGY H;  5HKG A;  3ZMV A;  2Q69 A;  3CB2 A;  1F40 A;  4U7N A;  3UCS C;  1NSG A;  4WFF A;  1Q43 A;  4BAY A;  1E1R G;  4H44 B;  4QPK A;  1D7H A;  2P4V A;  5IWA B;  1AVM A;  1PP9 H;  4JI5 B;  2JS5 A;  4NXM B;  5LYJ B;  4J9Y B;  2QJ1 A;  1FFT B;  3MHS C;  2ZIN A;  4LFA B;  3GU0 A;  2JIZ G;  1LL7 A;  3RME A;  5K1P A;  2R70 A;  1PBK A;  5CA1 B;  3OOB A;  1IX9 A;  2DQ0 A;  2B1G A;  3HKE A;  4J10 A;  4ZOL B;  3O5E A;  3B4S A;  4ITZ A;  4ODQ A;  1X59 A;  4NB5 A;  2M6Y A;  4BW5 A;  2R9R B;  4H13 B;  4KHP B;  1CEZ A;  3ZMS A;  2A3Q A;  4QJF B;  4QGP A;  1L0L H;  1AP6 A;  2OLH A;  5EBW C;  4GGQ A;  1OCO B;  5CBG A;  2YBT A;  1OCZ C;  3DC5 A;  4DR6 O;  1SQG A;  1I5Y A;  4JAA A;  4JI0 O;  1SRY A;  2BSK B;  4MTO A;  5LMN B;  1XRE A;  1JOY A;  5E1A C;  2IBZ H;  1GK9 A;  2QTO A;  1C9H A;  1L1P A;  4P8V A;  4DT4 A;  1IXB A;  1NMV A;  1M56 B;  1E1Q G;  5BMV B;  3T1Y B;  1YJW V;  4YHH O;  1WB8 A;  3ASN C;  2RNB A;  5EYP B;  3A8T A;  3ETE A;  4ZIB A;  5D75 A;  4X9Q A;  3ARX A;  2E5L B;  4JAS A;  3CCS V;  3BRC A;  3QTC A;  3RGC A;  3STL C;  5LHH A;  3APQ A;  2Q5Z A;  3AG3 B;  1R73 A;  1XNQ O;  1S77 D;  3LSS A;  3FKS G;  1L1F A;  3ZHR A;  2M08 A;  1M57 B;  1CP9 A;  1HKM A;  4DRJ A;  5CA1 A;  3H9R B;  1AR5 A;  2GHY A;  3H1L H;  3B9D A;  3DXR B;  2F21 A;  2RDC A;  3L73 H;  1B6Q A;  4UXN A;  4JAU A;  2ADQ B;  3RW0 A;  2KO7 A;  3K5N A;  1H8E G;  2M2A A;  5HWB A;  2AW9 A;  3H1K H;  3EFF K;  1SQB H;  3KG2 A;  4EFE A;  1F7Y A;  3CXH F;  2MLX A;  3E2E A;  4LF6 O;  3HKD B;  2HJD A;  3CCV V;  1AI6 A;  4NXM O;  1D7I A;  3WB1 A;  1D7J A;  4Z2L A;  1FJD A;  1KFW A;  3A2F A;  1VQM V;  4O4I B;  3B40 A;  3G6L A;  2UUA B;  2UU9 B;  1NR7 A;  4GT1 A;  4TYO A;  2O9O A;  4NVP A;  4PA9 A;  2EIN C;  2CE4 A;  5JJJ B;  2A3B A;  2PPO A;  5DIV A;  1BSM A;  2B5U B;  3KCE A;  1QR9 A;  4JZG A;  2LJ4 A;  4UB6 Z;  2ZR4 A;  2IH3 C;  4DV1 O;  2PGG A;  2RMK B;  4DUZ B;  1FFR A;  2NR5 A;  4RUE A;  2P67 A;  1W1T A;  3RYI B;  5IJ9 A;  1VQO V;  2IU3 A;  5EBM C;  3SPH A;  2Q6A A;  4IHJ A;  4Q20 A;  4LF5 O;  5KHH A;  3SGI A;  1M5Y A;  3EIP A;  3TCU A;  4DRN A;  4WBN B;  1Y76 B;  1IBM O;  2QSA A;  1VQK V;  2HG5 C;  4LWS B;  2EZP A;  4MPK A;  1VF7 A;  1MOF A;  1FXK B;  1NTZ H;  4DRM A;  1JR9 A;  3OMI B;  2JVD A;  4J4N A;  4L72 B;  4WJX A;  2AZ2 A;  4MNK A;  2FKX A;  2YBU A;  5L3E A;  2WLL B;  1NBM G;  1VQN V;  4HBN A;  2L2S A;  4Z1M G;  1OCC B;  4TNS A;  1N8R W;  1W9P A;  2DSU A;  4JFK A;  2QKA A;  2KQX A;  3BMB A;  1CPY A;  4J80 A;  4JYB A;  4LC1 A;  2UXB O;  1EZV H;  4F4L A;  3NR7 A;  2ZNI A;  3CCE V;  1FXK C;  2JZV A;  4AHC A;  4TOI A;  1KC8 W;  1RPR A;  1EBO A;  2PV3 A;  1JCH A;  4PTM A;  3CXC U;  4IT6 A;  3ABL C;  4PD4 F;  1FYJ A;  1OCC C;  4JTD B;  4JI8 O;  1QLE B;  1K5Q A;  4PI0 A;  4PDR A;  1JX9 A;  1LQ0 A;  1FPO A;  1NQT A;  2EIK C;  1O6I A;  3KCX A;  4MVR A;  1ZBV A;  3PRD A;  1TUB B; 
#chains in the Genus database with same CATH homology
 1GOI A;  1PIN A;  2KR7 A;  4DH0 A;  1A7X A;  1IX5 A;  3FXY A;  4S3J A;  2PI6 A;  3G6M A;  1EQ3 A;  3CHF A;  3IKD A;  1N1A A;  1FAP A;  2WK2 A;  1E6N A;  4FN2 A;  5J6E A;  3KZ7 A;  2RUC A;  3UQI A;  1JND A;  2F4E A;  4QIB A;  3NRK A;  1SR0 A;  4LAX A;  3O5D A;  5HUA A;  3MDY B;  2XPB A;  1NMW A;  5HBF A;  1YW5 A;  5DEZ A;  4ODM A;  2KE0 A;  2XP4 A;  4MSP A;  4MNL A;  4C02 B;  4G2P A;  4MAV A;  4DWS D;  2XP7 A;  1FKS A;  1W26 A;  4S3K A;  4DZ3 A;  3ALF A;  1H0G A;  1EHN A;  2FDM A;  5B8I C;  1HJW A;  2D9F A;  1JNT A;  4G50 A;  1KT0 A;  5HTG A;  1D2K A;  1FKD A;  2FKE A;  4L3N A;  2KI3 A;  1LG1 A;  3KAD A;  3O5L A;  4NZC A;  2G41 A;  3TDB A;  4TX0 A;  2IF4 A;  4FAP A;  1ZBK A;  3ARQ A;  3O5O A;  3AQU A;  2DPE A;  4WIW A;  4W9O A;  1NH6 A;  5I98 A;  1HKJ A;  4WKF A;  3BXW A;  4AY1 A;  4MNM A;  1W1P A;  3JXV A;  1TCO C;  1XRV A;  1ZCN A;  1ZBC A;  1W9V A;  3KAB A;  4O2T A;  1B6C A;  1LJY A;  3O5F A;  3O5I A;  4P8X A;  3ARY A;  4QZV B;  1HKI A;  5HT1 A;  1XHG A;  2XP3 A;  2PPN A;  4LGX A;  2XP5 A;  2WM0 A;  1FKB A;  3O5J A;  1FKL A;  2M1I A;  4HAR A;  2UZ5 A;  4DRH A;  4LAY A;  4GIV A;  1ZBW A;  4R5E A;  5HW6 A;  1FKR A;  5DIU A;  3RM9 A;  2RUR A;  2ZQU A;  1W9U A;  4NNR A;  1E9L A;  4W9Q A;  4MTV A;  3OA5 A;  1NWS A;  4DRP A;  2F2D A;  4MNJ A;  4WK9 A;  4JFL A;  3ARZ A;  1ZB5 A;  2PV1 A;  1Y0O A;  2DG3 A;  2Y78 A;  3CH9 A;  1YAT A;  3FAP A;  3B9E A;  2VN1 A;  1P5Q A;  2DT0 A;  4IPX A;  3ARR A;  4Q22 A;  1UR9 A;  1NWU A;  3EY6 A;  1JVW A;  3RM8 A;  3RFW A;  3O5P A;  3JYM A;  3KAC A;  1HXV A;  1FKG A;  4Z2H A;  3FY1 A;  3B09 A;  3NI6 A;  1HKK A;  2KFW A;  1J4I A;  2PPP A;  3KAH A;  3CHE A;  3B7X A;  2XP8 A;  2ZR6 A;  1E6R A;  5GPR A;  3WQV A;  3ARV A;  4J4O A;  3UI4 A;  2ZQS A;  1J4R A;  1ZU8 A;  3WIJ A;  1QZ2 A;  3PRB A;  2DSV A;  4LAV A;  1QPF A;  5JH8 A;  1R9H A;  2PV2 A;  4JFM A;  3JYJ A;  3PA7 A;  3I6C A;  4URI A;  2A3C A;  4DRI A;  3O5R A;  1OWQ A;  1ZL1 A;  1JNS A;  1KT1 A;  4Z2J A;  1BKF A;  2RUQ A;  2KGJ A;  1NWT A;  1WAW A;  3AS2 A;  4ODK A;  2A3A A;  3ARW A;  1FD9 A;  1HJX A;  1FKH A;  3WD0 A;  4KQZ A;  4LAW A;  2OFN A;  4R0X A;  3TC5 A;  3AS1 A;  4ZPW R;  3UI6 A;  3WD4 A;  4ODR A;  2K8I A;  4IQC A;  4BF8 A;  1J6Y A;  1LL6 A;  2FAP A;  2AOS A;  5HKG A;  3W4R A;  3KAI A;  1F40 A;  4JFJ A;  1FKT A;  3B9A A;  1NSG A;  1FKI A;  4TW6 A;  3UF8 A;  4U86 A;  1D7H A;  3O5Q A;  5BXJ A;  1OGB A;  2LPV A;  3QOK A;  5DIT A;  2LKN A;  2DG9 A;  2ZQT A;  3LUO A;  1Q6U A;  1T11 A;  2Q5A A;  5GQB A;  3WD1 A;  4DWS A;  2N87 A;  3GPK A;  3CZ8 A;  2RQS A;  4XAK A;  1FFQ A;  1LL7 A;  1NWR A;  3RME A;  1VF8 A;  2DSW A;  3WL0 A;  2B31 A;  1E6Z A;  1PBK A;  4MGV A;  4ML4 A;  1UR8 A;  4W5U A;  3KAF A;  3O5K A;  3OOB A;  1LL4 A;  4DIP A;  4WKH A;  2DT2 A;  3O5E A;  4ODQ A;  4ITZ A;  1E6P A;  4WKA A;  4U85 A;  1ROU A;  1RD6 A;  4NSB A;  3RM4 A;  1U79 A;  1WB0 A;  4ODO A;  4TW7 A;  2OLH A;  3PR9 A;  5HW7 A;  4GGQ A;  4QT2 A;  2YBT A;  2VCD A;  4W9P A;  1LG2 A;  3WQW A;  1C9H A;  4Z2I A;  1L1P A;  4P8V A;  4DT4 A;  3CGM A;  1NMV A;  1X6L A;  4IQ2 A;  3AS3 A;  1Q1C A;  2ITK A;  3IHZ A;  5D75 A;  1EIB A;  3ARX A;  1SYT A;  3WD2 A;  3RGC A;  1FKK A;  4DZ2 A;  5DF0 A;  2QF8 A;  2DT1 A;  2M08 A;  4IT4 A;  1TFV A;  1HKM A;  3NTP A;  3WKZ A;  4DRJ A;  3H9R B;  3PRA A;  4DRO A;  1F8A B;  3B9D A;  3WD3 A;  2F21 A;  5HW8 A;  3AS0 A;  3TCZ A;  1FKF A;  4P8W A;  2KO7 A;  3WL1 A;  5GPG A;  2M2A A;  2LGO A;  5HWB A;  1GUV A;  3VAW A;  3ARO A;  2RSE A;  1ITX A;  4DRQ A;  1J4H A;  2MLX A;  2DG4 A;  2MNT A;  2MPH A;  1D7I A;  3CHD A;  1D7J A;  2XP9 A;  4N19 A;  4Z2L A;  1X6N A;  1KFW A;  4TW8 A;  1FJD A;  1Q6I A;  2ZQV A;  4DWS C;  3G6L A;  2A3E A;  3CHC A;  4U84 A;  5HWC A;  4TYO A;  2O9O A;  3CGN A;  4DRK A;  3UQB A;  2MLZ A;  1H0I A;  2PPO A;  2A3B A;  2WLZ A;  2O92 A;  4ODL A;  4QT3 A;  5DIV A;  3ARP A;  3KCE A;  2LJ4 A;  2ZR4 A;  1WNO A;  3KAG A;  2RUD A;  2MF9 A;  1FFR A;  4Q7N A;  1W1T A;  4JYS A;  4ODP A;  2WLY A;  4ODN A;  2MLY A;  4Z2G A;  1M5Y A;  2DSZ A;  1EYM A;  4DRN A;  4JFI A;  2XPA A;  3ART A;  3ARU A;  2XP6 A;  4MPK A;  4ZS6 A;  4ZPT R;  1Q6H A;  1EDQ A;  3WH0 A;  1BL4 A;  3IK8 A;  4DRM A;  3B8S A;  4Z2K A;  2IUZ A;  4J4N A;  4L72 B;  4WJX A;  4MNK A;  1QPL A;  2YBU A;  1FKJ A;  3ALG A;  2L2S A;  3IKG A;  4TNS A;  2PBC A;  1HJV A;  1W9P A;  1ZK6 A;  4P8U A;  2DSU A;  4JFK A;  1K9T A;  2AWG A;  1E15 A;  4DWS B;  1GPF A;  2G8Z A;  3UI5 A;  3O5M A;  2JZV A;  1D6O A;  3ARS A;  2PV3 A;  4PTM A;  1W1V A;  4ZPV R;  4HBE A;  4IT6 A;  1JNE A;  1W1Y A;  1OGG A;  3UQA A;  1CTN A;  1ROT A;  2DT3 A;  1LQ0 A;  5DO2 A;  3O5G A;  4HBO A;  1O6I A;  2ESC A;  4KR0 B;  2ZR5 A;  1ZBV A;  3PRD A;  3ODK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...