1Q6UA

Crystal structure of fkpa from escherichia coli
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
213
structure length
213
Chain Sequence
AFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVKPAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional studies of FkpA from Escherichia coli, a cis/trans peptidyl-prolyl isomerase with chaperone activity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase fkpA
total genus 73
structure length 213
sequence length 213
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2003-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF01346 FKBP_N Domain amino terminal to FKBP-type peptidyl-prolyl isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.460 Mainly Alpha Orthogonal Bundle Helix Hairpins Peptidyl-prolyl cis-trans isomerase, FKBP-type, N-terminal domain 1q6uA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1q6uA02
2XP5A 4MSPA 2ZQSA 4TW6A 3KAHA 1F40A 4DRPA 4W9QA 5DIUA 1Q1CA 3UQIA 1D7HA 2RSEA 2D9FA 2XP9A 3CGNA 3IK8A 4LAYA 1ZCNA 4ODPA 2JZVA 4DZ3A 4ITZA 2ZQVA 4DH0A 2OFNA 2LGOA 1BKFA 1QPFA 1FKTA 2MLYA 4GGQA 5J6EA 1FKIA 3KADA 1FKFA 3UI6A 2PV2A 2KFWA 4FN2A 1TCOC 1M5YA 2LJ4A 3WH0A 1HXVA 1YATA 1C9HA 2PV1A 2ZQUA 1D7JA 2M2AA 3KAGA 3LUOA 3JXVA 3EY6A 1J4IA 1JNTA 2RUQA 3O5EA 4TNSA 1Q6IA 4DROA 4LAVA 5HWCA 1FKHA 4TW8A 3UQBA 4U85A 4DRHA 2DG4A 2VCDA 2MNTA 3TCZA 4DRQA 2AWGA 2Y78A 2RURA 3O5KA 2MF9A 1D7IA 2Q5AA 3O5JA 3O5QA 4NNRA 4DRKA 3TDBA 2M1IA 1FKJA 1D6OA 3O5RA 2XPAA 4MGVA 1PINA 2RQSA 4ODKA 1R9HA 2ZR5A 2PPNA 1W26A 3O5LA 4U84A 5DIVA 3VAWA 1A7XA 3PRDA 2UZ5A 2KI3A 4IQCA 2KO7A 3UF8A 4BF8A 2FAPA 1J4HA 3O5FA 4C02B 2PV3A 2F4EA 3B7XA 3O5MA 1EYMA 2F21A 3O5OA 3TC5A 4DRNA 3KACA 5B8IC 2XP8A 4QIBA 4TX0A 1FKGA 3NI6A 5D75A 2KGJA 1FKLA 3KAFA 3KABA 4GIVA 4JFLA 4FAPA 4TW7A 5HUAA 2L2SA 4QT2A 2DG9A 1FKBA 1QZ2A 4J4OA 1FKRA 2PPOA 2ZR4A 1ROTA 2XP3A 1J4RA 1FKDA 3KCEA 2RUDA 4DT4A 2MPHA 4W9OA 2XP4A 3KZ7A 3PA7A 4ODNA 4LAWA 2ZQTA 2VN1A 4ODRA 5I98A 2LPVA 3OOBA 1FD9A 1FAPA 1FKKA 1QPLA 2PPPA 3UI4A 1EQ3A 5DITA 1JVWA 3B09A 1Q6UA 1NMVA 1P5QA 4J4NA 4O2TA 3H9RB 5HKGA 2XP6A 4TYOA 2F2DA 2FKEA 2M08A 4JFJA 4G50A 4IQ2A 4JYSA 3O5DA 3O5GA 2DG3A 2XPBA 4DRJA 2IF4A 1JNSA 3NRKA 1F8AB 2KR7A 3FAPA 3GPKA 4JFKA 4ODLA 5HT1A 2N87A 2RUCA 4DRIA 4JFMA 1KT1A 3RFWA 1ZK6A 3JYJA 3JYMA 2KE0A 3RGCA 2MLZA 3UQAA 4ODOA 3MDYB 1KT0A 4U86A 1Y0OA 3I6CA 4DRMA 5BXJA 3IKGA 4QT3A 1YW5A 2LKNA 3NTPA 3PRBA 4LAXA 3O5IA 4ODMA 3IKDA 3CGMA 4N19A 5HW8A 2XP7A 4DZ2A 5HTGA 5HWBA 1T11A 2K8IA 2ITKA 3IHZA 5HW7A 1FKSA 1FJDA 3KAIA 1BL4A 1B6CA 3ODKA 2MLXA 1Q6HA 1ROUA 1NSGA 5HW6A 4ODQA 1N1AA 5GPGA 1NMWA 4IPXA 1J6YA 2PBCA 1U79A 4JFIA 1L1PA 2ZR6A 3O5PA 3UI5A 4G2PA 4DIPA 4R0XA 1PBKA 4W9PA
chains in the Genus database with same CATH superfamily
4WFEA 4C7UA 1FAFA 3M7MX 3P3NA 2YIBD 3STLC 3UCSC 3HKBB 3JALB 3HKCA 4YY3B 1OWQA 2A0LA 4LWSB 3RM9A 1EN5A 2EJRA 3HKDB 3HKEB 2RQ6A 3J80N 3AG3C 4O2BB 4X20A 3LNNA 3O5EA 2BSKA 4KQZA 1Z5VA 3ZN1A 1HJVA 4YHHO 5CA0A 4CS3A 1N36O 3SYAA 3A8TA 2RQSA 1FFXA 4PDVA 1B06A 5LYJA 4U84A 3WB2A 2QA4V 4PA9A 2ZXWB 3VAWA 3K04A 4K35A 4LF4B 1HNXO 3CSXA 5LMUO 5DF0A 4NKGB 4IHJA 3TC5A 2BOBC 4I0XB 4FLUA 4EB6B 4GYCB 1U96A 4HBNA 3SPGA 1HDJA 3T2MA 2X6BA 1NH2D 3JAWB 5IE9A 1JNDA 3WL1A 1GTOA 4W9OA 1NBMG 4BIUA 1XL4A 2ZNJA 1S77D 4J9ZB 5I98A 2UXXA 5J2TA 1H2SB 3OUFA 3IC7A 5B1BB 4O2TA 1IXMA 4O4HA 2A3CA 1ZU8A 3L74H 5CBFA 4CS4A 1J95A 1WB8A 4BW5A 1E79G 3IJ4A 1WP8A 4JI3B 2N74A 2K1EA 3LSQA 1NJIW 1YI2V 1JFFB 4CC6A 1XQ8A 3RM4A 3STZC 1HP8A 3CPWU 1TA8A 1SRYA 5BMVA 5BXJA 3IKGA 2GDSA 3NTPA 4DW1A 1R6TA 3IC9A 4W4LA 3WG7B 3OT7A 2XHBA 2ZD9A 1KP3A 2M7WA 2FL4A 3ZBHA 1Y4MA 3OMNB 3WIJA 3A0RA 1NTZH 3UO2A 2LO1A 3F7VC 2HJDA 1PBKA 4W9PA 1F40A 3SPJA 1LG1A 4GCZA 3RM8A 4HNAA 3K08A 4EFBA 4IL6Z 4P9PA 2IU0A 2H94A 1GH6A 3RN4A 4YJ2B 4TUYA 1VQMV 1YIJV 1M5YA 2PUSA 1HXVA 2LW7A 3CYOA 4JASA 4ZPTR 3APQA 4XBFA 4MNKA 4U3JB 2UUAB 4DV7O 3JD2A 4MVSA 5KUKA 2R72A 4JF3A 4AY1A 5TISZ 1NTMH 3ARPA 5H2FZ 2O92A 2AWGA 5BMVB 3L75H 4WFAV 2JJ2G 4Z2IA 2HVJC 3FB6C 2AZ2A 2QM7A 2LJ2A 1RSOA 3K9AA 3E8GA 3CCUV 4I55A 1YJWV 4TQFA 1IBLO 3E22B 2UUBB 1I08A 2MW2B 2FAPA 2A3AA 2GBOA 1VQNV 4JAVA 4YIOA 4DUYB 5D75A 1NVPD 1JR9A 2YIDA 3DXRA 5LHHA 5IWAO 3RYHB 4DR4B 1X59A 4F6RB 4U3FH 3CCLV 4B7KA 4MNLA 5ITZA 1O9GA 1N33O 1XMQO 1VQOV 4I4TA 1LL6A 1D2DA 4R8CA 1H2LA 1ZL8B 4JYSA 1S5LZ 1Q43A 1M93A 3OA5A 3K3WA 1GO3F 3R66A 4K3AA 2Y69B 3DTUB 3OMIB 1UFIA 2UU9B 1UR9A 4P8WA 4HNAB 1GK9A 3LUTB 3CHEA 3ABMB 3K0DA 2X6AA 1Y76B 1TVKB 3AG3B 1X6LA 4DV2O 1JJ2U 2GTAA 2XP7A 4XAKA 3MHSC 3SJBC 1E9LA 1LQ0A 5BR8B 1V55B 2JEXA 1O6IA 2MLXA 5L3CA 4X65B 3ZHSA 5LBQA 1P49A 4ZI7B 2Y48A 2PBCA 3OUSA 4YIPA 4JFIA 4MNJA 4JI8B 4UCRA 2XP5A 1F23A 5CA1B 2D2CB 4B3RB 2RCVA 3ZCCA 1Q1CA 3ASNB 3CGNA 3WQVA 3CCRV 1KC8W 1AI7A 2R9RB 2ZR2A 1HWYA 1YTFD 1VMGA 3T1YB 2LW1A 2QWQB 4R5EA 2ZT9B 2VQEO 2ZE7A 3VBBA 2DSWA 1V54B 1DGSA 4NR1A 4BIOA 2VCDA 4ZBMA 4MTOA 1Y76A 1P7GA 2BTQA 3JCZA 2W6JG 4I7ZB 4O4JA 3R65A 4JV5O 2PYJA 4MGVA 2P4KA 5JH7B 1F51A 1R1BA 1A7XA 1PL4A 2WWWA 1K97A 1VQ6V 1RM1B 4I50B 4BWAA 3UF8A 4WKHA 3AG1B 3Q4HA 4DRXA 5IJ0A 1NR1A 4LWSA 1FKLA 3KAFA 3HB3B 4Q22A 5KUMA 5J2UB 3P30A 4JI2B 3BHPA 2DG9A 2O57A 2JVDA 4KL1A 5KHHA 4FFKA 4IIJA 2ZDIA 3ZRWB 1YVWA 4X66O 2OCCB 4WJXA 1FAPA 3I5DA 3UKMA 4K8ZA 4LF9B 1LR1A 4PDRA 3U11A 1Y66A 5B3SB 5KA5A 4IQ2A 3JARA 1MOFA 5EYPA 3TETA 2DT0A 2ITDC 1F8AB 4FFBA 1GN6A 3OM3B 4EB6A 2RUCA 3LDDA 2N04A 5LOVB 2VS0A 3JYMA 2AHYA 3GB7C 4LH6A 1ROPA 1BZKA 4CH4A 4FIPC 4TV9B 2JGDA 3OTOO 4I50A 2YIAA 4LR3A 5HWBA 3Q4HB 4DRXB 3T1HO 1FFXB 4LC1A 2CH7A 2IH3C 4L8JA 2EILB 3H1LH 3ZRXA 4K0KO 2QSAA 5E79Z 5FNVA 4L3NA 2X7RB 5L3FA 4H0LB 3CMAV 3CWBH 2MLYA 3JATA 3ARVA 1AB3A 2Q0AA 1J5EO 5LGTA 4JI5O 1CEZA 3SYQA 1BS3A 5KMGB 1M5IA 4D6TH 2DT2A 2ITCC 1XNQO 3KG2A 5B1OA 4O4IA 5F2VO 4NXNB 5HWCA 3UQBA 3CRQA 3QG5A 1XMOB 2FKXA 4MVMA 5IYDO 2L6LA 3B9AA 3CE2A 2ZR3A 3SYPA 4LFBB 3BPZA 4DR7O 4MSWC 3CXCU 4JI6O 4L87A 1J4HA 3O5MA 4DV4B 1EFRG 4DRNA 2P5OA 4QGPA 2XP8A 4FM0A 1YTFB 4F4LA 3OEEG 2A06H 3O9OA 1HNZB 3ARZA 1VQ4V 1B3QA 3OTOB 5DM6V 4TV9A 3KZ7A 2DSUA 2CTWA 4AHCA 2VN1A 3UI4A 1VF8A 3H01A 1QCEA 4JZ2A 2V1DA 4MTVA 2B5UB 4LF6O 1Y6XA 4G50A 4FK5C 3CCMV 1OHHG 4DV5B 3ZIAG 2YDEA 1AI6A 1E15A 2Q7HA 4YJ2A 2ZE5A 2YEVA 1LUWA 1Q82W 1ZK6A 2VRZA 3BAAA 2E5LO 3MDYB 1ZBVA 5KX5A 5FNVB 5CBGA 5IT9N 1WNOA 1GN2A 2KG7B 4LF4O 5JH8A 5IJ9A 1E1RG 1RSOB 1UR8A 2Q0OC 3AK1A 4HARA 4J42A 4JYBA 1LL7A 1NT2B 4EKWA 1UPGA 4NTYA 1NKDA 4X64O 2QKAA 5EBLC 4TV8A 2ESCA 5LA6A 1ZL8A 2A7WA 5LGNA 4X8AA 4K8XA 1US6A 1OJHA 2IJHA 5FL7G 4P30A 4LF9O 1EQ3A 1FKTA 3AG1C 3N2KB 2WA3A 2PV2A 1KKCA 3WH0A 1FXHA 1NI8A 2CGOA 3SPCA 4DV6B 2ADQB 2DQ3A 3LUOA 2ZXWC 2F4VO 5LHGA 1JJOA 1G4YB 5GONA 3G71V 2RURA 3CHFA 2WLHA 4MS2A 4OX9O 4MVZA 2Q5AA 1M57B 1HR0O 1N8RW 1SC5B 5IYCO 1HNWO 4HYOA 3JAWA 5DIVA 3B8MA 3OR6C 4G2KA 4JAAA 3GVMA 1OCCC 1TGOA 2E5LB 5LMUB 1PP9H 1Q8IA 3MD0A 1N32O 1W9PA 4PDLA 1SA0A 1QZ2A 1OGBA 1YZBA 1IX5A 4Q7NA 1J5EB 2HHHO 1NWRA 3N2GA 5JJNB 1UJWB 4H33A 1MSDA 1QPLA 4A5UB 4LBEC 1NVPB 2WM0A 1NS1A 2UUAO 1W1YA 3UO3A 5JCOC 3WD3A 2FKEA 1ZL1A 5B1AB 1BQ0A 1JNSA 5DEZA 4DV6O 4CH6A 1HW7A 2WLLA 2DJVA 1BGYH 3D3QA 1KT1A 2RDCA 3UQAA 4ODOA 1V54C 1KT0A 1Z5WA 1K92A 3BA9A 4MVUA 4GKKB 4H13B 1QU7A 2AW9A 3O5IA 2NNUA 4XDJA 4JI2O 1Z2GA 2WLKA 2EJ7A 1AVMA 1EN4A 3J81N 1DK1A 5LMNB 1GN3A 4Z2WA 2XT9A 5GPGA 3E8FA 3CRMA 4MVRA 3C3SA 4HBOA 3ZMVA 1FYJA 1AJPA 1S76D 4PD4F 1F4NA 1WPXA 5GTIZ 1XILA 1QPFA 1FKIA 3GU0A 4X66B 4DUZB 1FS0G 4UCVA 2YUAA 2LJ4A 4JTCB 2PF4E 3B8SA 3CCJV 4WFBV 2OCCC 1WJZA 1XUQA 4IIJB 4ZOLA 1YJ9V 2CTRA 3ALFA 4DRHA 4CS2A 2AHZA 2Q69A 2ZDIC 2Q8VA 1VF5B 3TDBA 1VQKV 1FKJA 3K58A 1SQQH 3JD4A 1R9HA 2PPNA 3JARB 3CCQV 1N33B 2DYRB 4JTDB 1MNGA 3O5FA 3FB8C 2F21A 3O5OA 3QOKA 1N34B 2IJJA 2QWRB 3NI6A 2KGJA 2G8ZA 3GWOA 3ICXA 4TW7A 4DWSA 3RYIA 4LNUB 4MW3A 2RJZA 1FFQA 2WLZA 4NVPA 4X20B 2KB1A 3E22A 2ZR4A 1F4MA 5A9GA 1FKDA 4GKKO 1WB7A 2DMXA 5IYZB 5KHGA 1BE3H 3B09A 4UV9A 4LF7O 4MTGA 4X62O 2M08A 4J7ZA 3RYHA 3FAVB 4P8XA 5KAFZ 3ASNC 2VWKA 1BSMA 3C90A 5IY5B 4YY3O 1HR0B 1HJWA 1W9UA 3FAPA 1XHXA 4JFKA 1MG1A 1L8DA 4JFMA 3U10A 2R9AA 1VEWA 1VF7A 4GT1A 3I6CA 3ARUA 4UCSA 1JPXA 4UB6Z 3DSQA 4EEQA 2LGWA 4ODMA 3CGMA 1M90W 1T11A 2WAMA 4B3SB 2QWOB 1B6CA 4B7EA 1ROUA 2PN0A 4ZS6A 3OEHG 2DE0X 2ZR6A 3FYEB 3TXQA 1VIBA 2IBZH 4KR0B 4YXWG 2YBTA 3BABA 3K03A 2QM8A 2XAQA 3B4SA 4X1YA 1ORQC 5DO2A 4NXMO 1IBMO 1G1XB 1I0HA 2X6CA 1PNKA 4FM2A 4MVQA 1KU9A 4D7TA 5E1AC 3JASA 3ARYA 1OV9A 1Q5OA 1Q6IA 3APOA 3KCYA 3LSSA 3PRAA 1ENVA 3CB2A 1D7IA 2EZPA 1URFA 4DK0A 3ML0A 1U97A 3MAQA 3OFNG 5K1PA 1D6OA 2WLNA 2ZR5A 2E74B 3AS0A 3EFFK 4GX5A 2CUGA 1EYMA 3T4DA 2WLIA 2HJFC 1RPOA 4TWKA 4TUYB 2GTSA 5JQGB 2YIBA 4X1YB 1FKRA 1SYTA 3K59A 4DV7B 4JI8O 4R7CA 3F5TA 2HR3A 1PPJH 3BCCH 3K0GA 3BFRA 1K5SA 3PA7A 1TUBB 4LAWA 3HPLC 5GONB 2ZCEA 1GOIA 3W4RA 1WA8B 1P5QA 3H9RB 4ZPWR 2OIEA 5HKGA 2F2DA 2A3QA 2P67A 4N23A 4DR1O 3KZIZ 3ZHUA 1CP9A 1W59A 3AK2A 2VQEB 3ALGA 4R6ZA 3SGIA 3NRKA 5KHKA 3K06A 1GN4A 4X1KB 1XNRO 3OR7C 5IWAB 3M8AA 4MNMA 4B3TO 1YW5A 4URIA 3X2QB 1SQFA 2ARHA 4BIZA 1GMGA 2WLIB 1PKXA 1V9PA 1FJDA 3ZX6A 2PGGA 2JIZG 1JVMA 1QLEC 3T1HB 2PYLA 3E83A 3CEIA 4YJ3A 3ARWA 3WU2Z 4F6RA 2NLJC 1SKVA 3UT5A 2RN9A 1GAXA 2DOSA 1O9HA 3X2QC 4DR6O 2LGQA 3T1CA 4ODPA 3ZJZA 1ZCNA 1GUVA 1AR4A 1NH6A 1WA8A 3W7WA 3PR9A 1FKFA 4Z1VA 1DTOA 2WA4A 1BQZA 5BZBA 4BR6A 1R3LC 4LF8B 4IT6A 4Z2HA 3FYIB 2IUZA 4B3TB 2FB5A 1XI1A 3ZRSA 3EY6A 3AG2C 1H2MA 3RGBA 2EIKB 4BAYA 2QWNB 1LL4A 1W9VA 4PI2A 4GKJO 2JS5A 1XMQB 3O5KA 5DECA 1YEWA 2AZ0A 1XHGA 1GPFA 3L71H 4NNRA 2HHHB 3HKBA 4LH7A 2UXBB 1S5JA 4DR7B 5KMGA 4Q20A 2Z0AA 3CHXA 4FLWA 2BSKB 4PV1B 2KI3A 4PA6A 1FXKB 3WKZA 2Y0IA 1TUBA 4EFEA 1E6ZA 5CA3A 4TT3G 2P22C 1M1KW 3DC6A 1LUVA 1YHQV 4FAPA 3JD0A 4P2ZA 4NTWA 2L2SA 3MHHC 1XL6A 5C8YB 3OW2U 5FPRA 1M56C 3QO8A 5AG2A 5BR8O 2PI5A 5LHIA 2RUDA 4DT4A 1BL8A 1NR7A 4S3KA 3LSUA 3RW0A 2DQ0A 4GX2A 4E4EA 2LPVA 1FJGB 4I0XA 4JI0B 2JDIG 3JAKA 1KQSU 5D5PA 4QE7A 1TFVA 4FJCC 1FXVA 4DK1A 1BT8A 1X6NA 2GUZA 2ZIMA 3SJQC 4DXWA 2QWPB 4JGSA 4IGGA 4UUJC 1THZA 3B9DA 1EBOA 1CPYA 2Q7GA 3CHDA 3PN1A 4U7OA 2UXDB 3AS1A 4CZZA 1EDQA 2LKNA 1FXKA 3PRBA 4JAUA 1FPOA 3IKDA 4N19A 1GRJA 4DZ2A 5HTGA 1WN7A 2EZOA 3RYCA 4JI7B 4X64B 4JTAB 2VWJA 5EC2C 1Q6HA 2YEVB 4RUFA 5J2UA 3FY1A 2B31A 4DV0B 2DT3A 1MZEA 3H1JH 1HKKA 4DIPA 4JYAO 3BXWA 3AK3A 4DUYO 1OZ0A 1M9NA 2BE3A 3W7UA 1JFFA 4XDKA 2HLDG 5FPOA 4JV5B 1I7FA 4ITZA 3JAKB 3SJAC 1K8AW 3E8HA 2Y4UA 4BW9A 1IZ3A 1EM1A 4PA7A 4PHZA 1TUEB 4LCUC 3UM7A 3QVNA 5LP6B 4LFCO 2HP8A 3ETEA 2XASA 4FZ0A 3KAGA 4LF6B 2JEUA 2G41A 1W0KG 1JCHB 4X1IA 3ZMUA 3CS5A 1VF6A 2ZIOA 4IT4A 1I5YA 3EXAA 3ZMZA 1KD1W 1QNMA 1H38A 5H9CA 2KO7A 2DSVA 2JGUA 2PV3A 3OAAG 3KCXA 4QIBA 4WBNA 3JD1A 1QLNA 3CCSV 1FKGA 1FJGO 5GW7A 4GIVA 4JFLA 3ZMTA 5H6RA 3KKYA 3SJCC 3BEHA 3CRCA 2B1GA 1IBKO 1ROTA 3KCEA 5C93A 2WLYA 2Q4PA 3ZHTA 1GKFA 3FD9A 3OMAB 4O2BA 3ZHVA 1WAZA 3OTFA 4QIWF 5J9PC 2X0LA 3ZHRA 2AXTZ 3ZEDA 1A32A 4LF5O 2XP6A 2F43G 4D7SA 2EIMB 4UVBA 2A79B 5LMNO 1WB0A 2JRIA 3LDCA 3DXRB 2FYUH 2L35A 2OT5A 1PNMA 2XAHA 3N2GB 5KHIA 3ARTA 1SS3A 2Y4TA 3QO5A 2O9OA 5BXZA 4DR4O 2K9PA 1QQCA 2DT1A 2QDOA 5BY1A 1QR9A 4NYKA 3D36C 1W0JG 4O4IB 4DUZO 3FB5C 3VQXA 5HW7A 4O2AB 3SR2C 3WD0A 3WB0A 2PI4A 1JA8A 1RFYA 2KQXA 4ABMA 5L3GA 4FLVA 2UXCO 1JCHA 1IBLB 2OCHA 1V55C 4JZGA 3C3TA 5D5QA 4MSPA 4Z2JA 4WKFA 3RWRD 4DR1B 4FLZA 4DZ3A 3F5WC 2DN9A 4X65O 2JS3A 4DH0A 3DC5A 3K5LA 4LFBO 2XNDG 1VQLV 5JQGA 2YSUB 4J7KA 5IDJA 1KBHA 2IJIA 1Q3EA 4DWSC 1YATA 1C9HA 2YS8A 2PV1A 1FKAO 2ZE8A 4LFAO 1GM8A 3E86A 3VQVA 3H1HH 2RUQA 1F7YA 1KUQA 1AJQA 4WIWA 4FLXA 3TCZA 4DRQA 3CX5F 3CP1A 4WBNB 1ZBCA 2OWOA 4Z2LA 1R3JC 1ZWIC 4FLYA 1PINA 1VQ9V 4LNUA 4ODKA 3ARSA 3AS2A 4LGXA 4JI1B 2W0FC 1OCOC 3ABLC 4NB5A 4UB8Z 5KHJA 1VQPV 1E6PA 4UVAA 2BTQB 2HKOA 2EIJC 5B8IC 5KX5B 1AROP 2EINB 4I9WA 1JOYA 3E89A 5HUAA 1SQPH 2XAGA 1MABG 1L0LH 2ZQMA 1SR0A 3M99B 3TK1A 4JI4B 4WK9A 3AROA 1CTNA 5EIBC 2ZQTA 1H2KA 1JMKC 1HNWB 4ZKIA 4AI8A 2DYSC 3D3IA 3NR7A 1N34O 1OGGA 1X4TA 1K34A 2YICA 3GPKA 4TV8B 5IYZA 3SYOA 1RP3B 3AG2B 1YCIA 1PD3A 2ADPA 4LAXA 4U7NA 4B3SO 2WPDG 5CBHA 3E35A 3W7XA 4DR5O 1D2KA 2GHYA 4QNHB 3IHZA 3AQUA 3ARXA 1NSGA 2W0XA 4DR2O 4Q6GA 3QO7A 2JGDB 3P3PA 1D7HA 2XP9A 1XEQA 2Y69C 2CH7B 2OFNA 2H8PC 2CE4A 2W6IG 1COWG 3ZS8C 2ATKC 1E1QG 4ZHQA 1MZFA 3CC7V 1JNTA 2CAZC 4TOIA 4DO2A 2F23A 2P90A 4JI6B 1SA0B 4DV5O 3AS3A 3S3WA 3JALA 4OX9B 2M1IA 3B9EA 3I56V 4JI0O 2DSZA 1IBMB 1K9TA 2Z5UA 2IM9A 4UFZA 1RPRA 4LFCB 4G27B 2F4EA 5JJEB 5HFLA 4PELA 3T4ZA 1LNQA 5CA1A 2E76B 1N0NA 1ITXA 5JWPA 3A0BZ 3PJSK 4J4OA 2UUBO 3WD2A 1KECA 4AQYO 2EINC 2Q6AA 2YXLA 1J4RA 1AI4A 3AG4B 1R3KC 1QLEB 1WNSA 4E2LA 4DV0O 4K0KB 1FKKA 3BRCA 5IY5C 4JYYA 1JVWA 1TVKA 3HKEA 3HKDA 1N36B 3D36A 3CH9A 3RT3C 4DRJA 3CCEV 4KXRA 3HKCB 3NXSA 2N87A 1G6UA 2ZKOA 4DRIA 2QM4A 2WK2A 2IH1C 2QKCA 3RGCA 5LP6A 2MLZA 3FFQA 4DRMA 1CXZB 2HFEC 5L3EA 5L3DA 1SESA 3G6BA 5IJ0B 2KKWA 3A2FA 3ODKA 1XHZA 1L0NH 1YSCA 1HNXB 2QTOA 2ZINA 3H1KH 5HW6A 1XDCA 1RM1C 1K33A 1S5HC 1K7DA 2NN4A 4DWSD 3ZRWA 4W9QA 2JK5C 2Z3YA 4O4JB 1RD6A 4CBCA 2D9FA 3LNMB 2UXNA 3F7YC 5A2QN 2QF8A 1YJNV 2LGOA 1NH2B 2LFRA 4YJ3B 4FN2A 5FLXN 1H2NA 1SZTA 3B8NA 4UV8A 1D7JA 4GX0A 3E2EA 4DV3B 5JJJB 1SZXA 1VQ7V 1FKHA 2MNTA 1R6NA 5GPRA 5JCOA 2Y78A 1VF6C 4DW0A 2AGAA 3BA8A 2CTPA 3T1YO 1EIBA 4MAVA 2DYSB 4GLXA 2QEXV 4B3MB 5GTHZ 1P4RA 1R3IC 1R73A 2EX3A 3WD1A 4IQCA 1QBZA 1SQGA 2OTJV 4C02B 2M6YA 4P8VA 2P7TC 1EN6A 3WQWA 2NR5A 1IVSA 2QTSA 3VQWA 1SQVH 5JVDB 4FVMA 1WP7A 2QKSA 2GUZB 1GM7A 2F93B 1OCOB 3BVOA 2Y0PA 4UCUA 2UXDO 4NSBA 4OPHA 4O2AA 5KAIZ 2UUCB 4RO2A 5B5EZ 1AR5A 4I55B 4FMTA 1EHNA 5DITA 4J4NA 1W1TA 3A0HZ 3H9VA 5CMUA 1DLBA 1XREA 4UCOA 2DG3A 4QZVB 3MDSA 5B1BC 4LP8A 4ML4A 5HT1A 1BCCH 4MTXA 1PL0A 3RMEA 4JYAB 1XNQB 5LXTB 3VQYA 2KE0A 2ETNA 4JI5B 1Y0OA 3LDEA 4UCTA 3G6LA 2DWDC 4RUEA 2P6JA 1KYOF 5CN0A 1Y74B 4KP4A 1ZSPA 2QR4A 4KHPO 2ZNIA 2XAJA 2XUMA 1BL4A 4RQEA 3I55V 4ODQA 3FKSG 1L1PA 3L70H 3WL0A 5H6QA 4I4TB 1Q81W 3CCVV 1K5QA 5DIUA 3UQIA 4QE9A 3J7AU 3U0ZA 3L72H 3TXSA 3OGIB 3ABKC 1VQ8V 4J10A 3K5OA 4X1KA 5EC1C 5B3SC 3KADA 4RAIA 2WLJA 2EIKC 4RQFA 2M2AA 3VOUA 2D3OW 4DROA 2QE7G 4TNSA 2R9IA 2PTMA 4PI0A 5LGUA 5LXTA 2H3OA 1HNZO 2PY5A 1WAWA 4IYIA 1KFWA 2MF9A 2BCCH 1ZBWA 3O5QA 2F66C 4HAMA 2CDYA 3AEIA 3O5RA 3UT5B 1N4CA 1W26A 4F6EA 1DF4A 1H8EG 2OIGA 3K79A 2EILC 1H0GA 2ODMA 4Z2GA 1KB9F 1ZTEA 2HEPA 3ETDA 4OPAA 4TX0A 4AQYB 3B2EE 2R70A 4QT2A 4ZI7A 3AG7A 3SPHA 1LG2A 2QGNA 4PJ0Z 2XP3A 4IYHA 2Q73A 4B3RO 2MPHA 2KG7A 4ODRA 2Q67A 4GUNA 5B66Z 4KHPB 3ETQA 1FD9A 4J80A 3RFRA 1Q6UA 1NMVA 3BMBA 3JSLA 2EBOA 4TYOA 3ZRVA 1AR1B 4JFJA 2IJKA 1E44A 1BHBA 4ICGA 4MTFA 3ABTA 2KR7A 4ODLA 3FX7A 3ZMSA 1N0JA 1OCCB 1ZUQA 4ZOLB 3RFWA 1YF2A 3ABLB 1ZB5A 1P7BA 3SYCA 1HKJA 1HKMA 3G67A 4J11A 2EIJB 2XAFA 4MW8A 4DV1B 4HBEA 2ITKA 2K8IA 3KAIA 2HVKC 4MPKA 2UXBO 3IFXA 2CGNA 3ARRA 1VP7A 2Q5ZA 2DWEC 2Q7EA 3WG7C 2RSEA 2XTAA 5LP6C 5EBWC 1S3JA 5EIBD 2ZQVA 2ZM6O 1BKFA 2P06A 2LFSA 4GX1A 3FXYA 5DEDA 3WFVA 4WFHA 1G8MA 2RMKB 1XMOO 5CB4A 1XRVA 2UU9O 3JCUZ 4LAVA 5K1XA 1BHAA 2DG4A 3RYCB 3FAVA 4U85A 4KFMA 5C8YA 1YXBA 3K9SA 4JI3O 3SPIA 3O5JA 2WLMA 4DV2B 1AP5A 1PV0A 1XBLA 2YXYA 1W2BU 2IU3A 1Q7YW 4QPJA 2LQTA 3K5MA 2YXHA 1XOUA 1JQ0A 4JI7O 1K9MW 1KP2A 2OYQA 4FFBB 1K4CC 3ETGA 4PA3A 2UZ5A 2AOSA 3PRDA 4ZPVR 3RBZA 4WCEV 3G80A 5KLVH 5LOVA 3B7XA 4FZ1A 2YI8A 3KACA 1W1VA 1MSWD 1IXBA 4H44B 3JATB 1ZX3A 3KABA 1Q90D 1IX9A 2XOKG 3RVZA 2PPOA 2PZSA 2XP4A 1FXKC 1K3EA 2IW5A 3CRAA 4ASUG 4X89A 1HKIA 3OOBA 1YDXA 2ILMA 1NQTA 1M57C 4FM1A 1Q86W 3O5GA 5LYJB 2IF4A 3THOA 4R50A 4DV1O 5ITZB 2LP7A 3L9DA 3G4SV 4JPRA 4TSFG 4PA4A 2JJ1G 4JI4O 1AP6A 4X88A 2A9HA 3JD3A 5DN6G 2HG5C 3TCUA 2KSDA 4QT3A 4CH3A 1I94B 5EK0A 1LJYA 3CHCA 3OE7G 3D8CA 5L3BA 1JX9A 1MMMA 1EZJA 1NWUA 2B5UA 1NWSA 1M4UA 3ABMC 2EULA 3H1IH 1J6YA 5GQBA 2DYRC 4J7JA 1NWTA 2FMLA 2GV9A 4G2PA 4TW6A 3KAHA 4S3JA 2MK3A 4H37A 3L73H 3QTCA 1FFRA 4LAYA 1GM9A 3OD4A 4IHJB 3O65A 1B04A 2ZE6A 1JNEA 5J6EA 5B1AC 1PNLA 3UI6A 4MVOA 1TCOC 4FLTA 4DV4O 4L72B 5JH7A 2ZQUA 3JXVA 2BTOA 2B1IA 4NZCA 1WPBA 1EZVH 4TW8A 4DWSB 1Y74A 3RYIB 1SERA 1H2GA 2UUCO 3E8BA 2FTKA 3CC4V 2F95B 4HZ3A 3IGAC 4DRKA 3GWKC 2BOCC 4YHHB 1QR8A 2GSMB 2N05A 3P32A 2V7QG 1BMFG 3CXHF 5LA6B 1HJXA 4X62B 4BF8A 1OCZB 4UDMA 3ASOC 1I5XA 1NZ6A 2G38A 4DR3O 5HBFA 3N2KA 3JYCA 4LFAB 4U3JA 5EYPB 3JAMN 4ODNA 1OCZC 4GKJB 3HR0A 4NTXA 3EHBB 1M56B 2PPPA 1NTKH 1E6RA 4J9YB 3JASB 4OXSA 3QF7A 1QHTA 3CJHA 3FB7C 2E75B 1WLEA 4LF5B 5LL6Y 4RWUA 2UXCB 1T5EA 1OCRB 1NU1H 3B40A 1D5NA 3RYFB 3W7TA 4NXMB 1IURA 3TJTA 3ZHQA 4B08A 2QJ1A 4WFFA 3ABUA 2EIMC 2DW4A 3BY6A 4WKAA 3B77A 1FKSA 3GTYX 2F4VB 4QJFB 2OTLV 1N1AA 3S3XA 1NMWA 2FDMA 1VARA 1ZAUA 3UI5A 1QVGU 4NXNO 4R0XA 1I94O 1H0IA 1AI5A 2CTQA 4TQDA 1AILA 5EZYB 4N21A 2Q68A 1S72V 2ZQSA 4ZIBA 4DRPA 3WD4A 4FPPA 2ZM6B 4WFGA 3IK8A 3EVKA 2JZVA 1ZLZA 3CRRA 2DPEA 1AJNA 4GGQA 4W5UA 2F1MA 2KFWA 1TAEA 4JI1O 2YI9A 3JSNA 2RNBA 1FFTB 1R6KA 4DR3B 1P84F 2VQFO 1J4IA 1N32B 3K5NA 3RYFA 3TGUH 2OLHA 4DR2B 4UXNA 4J41A 2PI6A 4G28B 5H5NA 4WF9V 3N27A 4IT5A 2WLLB 3ZN0A 1VQ5V 5B1NA 5JVDA 2XPAA 4DR5B 3UQ8A 4O4LB 3O5LA 3G6EV 3ARQA 4OGQB 4B3MO 3CZ8A 3DGEA 5IYBO 2B9ZA 1D5AA 1DF5A 1SQXH 1ZBKA 3CJHB 5HFMA 3W7SA 4DV3O 1W1PA 3OGCC 1YITV 4I9QA 3QNEA 4AILC 2CK3G 3IAYA 2P4VA 1B6QA 3ASOB 4MT8A 1E6NA 1FKBA 4X9QA 2WSSG 3SDLA 1Y67A 4ZHQB 5KA6A 1QVFU 4W4KA 2YC0A 1XNRB 4JYCA 2A3EA 3AG4C 3G6MA 4P9OA 1SF9A 4Z2KA 3O5DA 4PDMA 3CC2V 4DR6B 2XPBA 1SQBH 5IJ9B 4QPKA 3ABKB 1MA1A 2E3CA 2VQFB 5CB4B 1H8HG 1KKDA 4CH5A 4CC5A 1S0VA 3JYJA 4PTMA 4O4LA 4U86A 4X1IB 1PM9A 2A3BA 3CMEV 4O4HB 1IDSA 3RVYA 5CA0B 1OCRC 4XDLA 2C2AA 5EZYA 4LF8O 4DYLA 3CD6V 1KMIZ 1K73W 4KUMA 3EIPA 5HW8A 5J2TB 4Z1MG 5EBMC 3K57A 4LF7B 2YBUA 4I5SA 1K4DC 1L1FA 4IPXA 1SETA 3WB1A 1U79A 2V4DA 1IBKB 4P8UA 4GZRB 4UVCA 3O5PA 2Q9LA
chains in the Genus database with same CATH topology
3BXWA 2ESCA 5DIUA 3UQIA 4ITZA 1EQ3A 1FKTA 1OWQA 3KADA 3RM9A 2PV2A 3WH0A 2M2AA 3KAGA 3LUOA 4DROA 3O5EA 4TNSA 4KQZA 1HJVA 2G41A 1WAWA 1KFWA 2RURA 3CHFA 2MF9A 2Q5AA 1ZBWA 3O5QA 4IT4A 3O5RA 2RQSA 1W26A 4U84A 5DIVA 3VAWA 2KO7A 2DSVA 1H0GA 2PV3A 4Z2GA 5DF0A 3TC5A 4QIBA 4TX0A 1FKGA 4GIVA 4JFLA 1W9PA 4QT2A 1QZ2A 1LG2A 1OGBA 1ROTA 2XP3A 1JNDA 3KCEA 2WLYA 3WL1A 1IX5A 2MPHA 4Q7NA 4W9OA 1NWRA 4ODRA 5I98A 1FD9A 1QPLA 2WM0A 1Q6UA 1NMVA 1W1YA 4O2TA 2A3CA 2XP6A 1ZU8A 4TYOA 3WD3A 2FKEA 1ZL1A 4JFJA 1WB0A 1JNSA 5DEZA 2KR7A 4ODLA 3ARTA 1KT1A 3RFWA 3RM4A 2O9OA 4ODOA 3UQAA 1KT0A 1ZB5A 5BXJA 1HKJA 3IKGA 2DT1A 1HKMA 3NTPA 3O5IA 4HBEA 2ITKA 2K8IA 5HW7A 3KAIA 4MPKA 3WD0A 5GPGA 3WIJA 3ARRA 1PBKA 4W9PA 4MSPA 4HBOA 1F40A 1LG1A 3RM8A 4Z2JA 4WKFA 2RSEA 4DZ3A 2ZQVA 4DH0A 1BKFA 1QPFA 1FKIA 1M5YA 2LJ4A 3B8SA 1HXVA 4DWSC 1YATA 1C9HA 2PV1A 3FXYA 4ZPTR 4MNKA 2RUQA 1XRVA 4LAVA 3ALFA 4AY1A 3ARPA 4U85A 4WIWA 2DG4A 4DRHA 3TCZA 4DRQA 2O92A 2AWGA 4Z2IA 3O5JA 1ZBCA 4Z2LA 3TDBA 1FKJA 1PINA 4ODKA 3ARSA 1R9HA 3AS2A 2PPNA 4LGXA 3PRDA 2UZ5A 4ZPVR 2AOSA 2FAPA 2A3AA 1E6PA 3O5FA 3B7XA 2F21A 3O5OA 3QOKA 3KACA 1W1VA 5B8IC 5D75A 3NI6A 2KGJA 2G8ZA 3KABA 4TW7A 4DWSA 5HUAA 2WLZA 1FFQA 2PPOA 2ZR4A 1SR0A 1FKDA 4WK9A 3AROA 2XP4A 1CTNA 4MNLA 2ZQTA 1HKIA 3OOBA 3B09A 1LL6A 1OGGA 2M08A 4JYSA 4P8XA 3O5GA 2IF4A 3OA5A 1HJWA 3GPKA 1W9UA 3FAPA 4JFKA 4P8WA 1UR9A 4JFMA 3CHEA 3I6CA 3ARUA 1X6LA 4QT3A 4LAXA 1LJYA 4ODMA 3CHCA 3CGMA 1D2KA 2XP7A 4XAKA 1E9LA 1T11A 1LQ0A 3AQUA 3IHZA 1B6CA 1O6IA 1NWUA 2MLXA 3ARXA 1ROUA 1NWSA 1NSGA 4ZS6A 1J6YA 5GQBA 2PBCA 4JFIA 1NWTA 2ZR6A 4MNJA 4G2PA 2XP5A 4TW6A 3KAHA 4S3JA 4KR0B 2YBTA 1Q1CA 1D7HA 3CGNA 2XP9A 3WQVA 1FFRA 4LAYA 2OFNA 5DO2A 1JNEA 5J6EA 3UI6A 1TCOC 4L72B 4R5EA 2ZQUA 3JXVA 4NZCA 3ARYA 1JNTA 1Q6IA 2DSWA 4TW8A 4DWSB 2VCDA 3PRAA 3AS3A 1D7IA 4DRKA 2M1IA 1D6OA 4MGVA 3B9EA 2DSZA 1K9TA 2ZR5A 1A7XA 1HJXA 3AS0A 3UF8A 4BF8A 4WKHA 2F4EA 1EYMA 5HBFA 1FKLA 3KAFA 4Q22A 1ITXA 2DG9A 4J4OA 1FKRA 1SYTA 3WD2A 1J4RA 3PA7A 4ODNA 4LAWA 4WJXA 1GOIA 2PPPA 1FAPA 1E6RA 1FKKA 3W4RA 1JVWA 1P5QA 3H9RB 4ZPWR 5HKGA 2F2DA 3CH9A 4IQ2A 4DIPA 4DRJA 3ALGA 2DT0A 3NRKA 1F8AB 2N87A 2RUCA 4DRIA 2WK2A 4MNMA 3JYMA 3RGCA 2MLZA 4DRMA 1YW5A 4URIA 4WKAA 5HWBA 1FJDA 1FKSA 3ODKA 5HW6A 1N1AA 1NMWA 2FDMA 3ARWA 3UI5A 4R0XA 1H0IA 2ZQSA 4DWSD 4DRPA 4W9QA 3WD4A 1RD6A 2D9FA 3IK8A 4ODPA 1ZCNA 2JZVA 1GUVA 2QF8A 4L3NA 2DPEA 1NH6A 2LGOA 3PR9A 2MLYA 4GGQA 1FKFA 3ARVA 4W5UA 2KFWA 4FN2A 1D7JA 4IT6A 4Z2HA 2DT2A 2IUZA 3EY6A 1J4IA 5HWCA 1FKHA 3UQBA 1LL4A 2OLHA 1W9VA 2MNTA 5GPRA 2Y78A 2PI6A 3O5KA 1XHGA 1GPFA 4NNRA 1EIBA 3B9AA 4MAVA 2XPAA 3O5LA 3ARQA 3CZ8A 3WD1A 4IQCA 2KI3A 3WKZA 1J4HA 4C02B 4P8VA 1E6ZA 3O5MA 1ZBKA 3WQWA 1W1PA 4DRNA 2XP8A 4FAPA 2L2SA 1E6NA 1FKBA 3ARZA 4DT4A 2RUDA 3KZ7A 4NSBA 4S3KA 2DSUA 2VN1A 2LPVA 3UI4A 1VF8A 2A3EA 5DITA 1EHNA 4J4NA 3G6MA 1W1TA 4MTVA 1TFVA 4G50A 4Z2KA 3O5DA 1X6NA 2DG3A 2XPBA 4QZVB 1E15A 4ML4A 5HT1A 3RMEA 3B9DA 3CHDA 1ZK6A 3JYJA 4PTMA 2KE0A 3MDYB 1ZBVA 4U86A 2A3BA 1Y0OA 3AS1A 1EDQA 1WNOA 2LKNA 3PRBA 3G6LA 3IKDA 5HW8A 4N19A 4DZ2A 5JH8A 5HTGA 1UR8A 4HARA 2YBUA 1BL4A 1LL7A 1Q6HA 4ODQA 3FY1A 2B31A 4IPXA 2DT3A 1U79A 1L1PA 1HKKA 3WL0A 4P8UA 3O5PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XP5 A;  4MSP A;  2ZQS A;  4TW6 A;  3KAH A;  1F40 A;  4DRP A;  4W9Q A;  5DIU A;  1Q1C A;  3UQI A;  1D7H A;  2RSE A;  2D9F A;  2XP9 A;  3CGN A;  3IK8 A;  4LAY A;  1ZCN A;  4ODP A;  2JZV A;  4DZ3 A;  4ITZ A;  2ZQV A;  4DH0 A;  2OFN A;  2LGO A;  1BKF A;  1QPF A;  1FKT A;  2MLY A;  4GGQ A;  5J6E A;  1FKI A;  3KAD A;  1FKF A;  3UI6 A;  2PV2 A;  2KFW A;  4FN2 A;  1TCO C;  1M5Y A;  2LJ4 A;  3WH0 A;  1HXV A;  1YAT A;  1C9H A;  2PV1 A;  2ZQU A;  1D7J A;  2M2A A;  3KAG A;  3LUO A;  3JXV A;  3EY6 A;  1J4I A;  1JNT A;  2RUQ A;  3O5E A;  4TNS A;  1Q6I A;  4DRO A;  4LAV A;  5HWC A;  1FKH A;  4TW8 A;  3UQB A;  4U85 A;  4DRH A;  2DG4 A;  2VCD A;  2MNT A;  3TCZ A;  4DRQ A;  2AWG A;  2Y78 A;  2RUR A;  3O5K A;  2MF9 A;  1D7I A;  2Q5A A;  3O5J A;  3O5Q A;  4NNR A;  4DRK A;  3TDB A;  2M1I A;  1FKJ A;  1D6O A;  3O5R A;  2XPA A;  4MGV A;  1PIN A;  2RQS A;  4ODK A;  1R9H A;  2ZR5 A;  2PPN A;  1W26 A;  3O5L A;  4U84 A;  5DIV A;  3VAW A;  1A7X A;  3PRD A;  2UZ5 A;  2KI3 A;  4IQC A;  2KO7 A;  3UF8 A;  4BF8 A;  2FAP A;  1J4H A;  3O5F A;  4C02 B;  2PV3 A;  2F4E A;  3B7X A;  3O5M A;  1EYM A;  2F21 A;  3O5O A;  3TC5 A;  4DRN A;  3KAC A;  5B8I C;  2XP8 A;  4QIB A;  4TX0 A;  1FKG A;  3NI6 A;  5D75 A;  2KGJ A;  1FKL A;  3KAF A;  3KAB A;  4GIV A;  4JFL A;  4FAP A;  4TW7 A;  5HUA A;  2L2S A;  4QT2 A;  2DG9 A;  1FKB A;  1QZ2 A;  4J4O A;  1FKR A;  2PPO A;  2ZR4 A;  1ROT A;  2XP3 A;  1J4R A;  1FKD A;  3KCE A;  2RUD A;  4DT4 A;  2MPH A;  4W9O A;  2XP4 A;  3KZ7 A;  3PA7 A;  4ODN A;  4LAW A;  2ZQT A;  2VN1 A;  4ODR A;  5I98 A;  2LPV A;  3OOB A;  1FD9 A;  1FAP A;  1FKK A;  1QPL A;  2PPP A;  3UI4 A;  1EQ3 A;  5DIT A;  1JVW A;  3B09 A;  1Q6U A;  1NMV A;  1P5Q A;  4J4N A;  4O2T A;  3H9R B;  5HKG A;  2XP6 A;  4TYO A;  2F2D A;  2FKE A;  2M08 A;  4JFJ A;  4G50 A;  4IQ2 A;  4JYS A;  3O5D A;  3O5G A;  2DG3 A;  2XPB A;  4DRJ A;  2IF4 A;  1JNS A;  3NRK A;  1F8A B;  2KR7 A;  3FAP A;  3GPK A;  4JFK A;  4ODL A;  5HT1 A;  2N87 A;  2RUC A;  4DRI A;  4JFM A;  1KT1 A;  3RFW A;  1ZK6 A;  3JYJ A;  3JYM A;  2KE0 A;  3RGC A;  2MLZ A;  3UQA A;  4ODO A;  3MDY B;  1KT0 A;  4U86 A;  1Y0O A;  3I6C A;  4DRM A;  5BXJ A;  3IKG A;  4QT3 A;  1YW5 A;  2LKN A;  3NTP A;  3PRB A;  4LAX A;  3O5I A;  4ODM A;  3IKD A;  3CGM A;  4N19 A;  5HW8 A;  2XP7 A;  4DZ2 A;  5HTG A;  5HWB A;  1T11 A;  2K8I A;  2ITK A;  3IHZ A;  5HW7 A;  1FKS A;  1FJD A;  3KAI A;  1BL4 A;  1B6C A;  3ODK A;  2MLX A;  1Q6H A;  1ROU A;  1NSG A;  5HW6 A;  4ODQ A;  1N1A A;  5GPG A;  1NMW A;  4IPX A;  1J6Y A;  2PBC A;  1U79 A;  4JFI A;  1L1P A;  2ZR6 A;  3O5P A;  3UI5 A;  4G2P A;  4DIP A;  4R0X A;  1PBK A;  4W9P A; 
#chains in the Genus database with same CATH topology
 4WFE A;  4C7U A;  1FAF A;  3M7M X;  3P3N A;  2YIB D;  3STL C;  3UCS C;  3HKB B;  3JAL B;  3HKC A;  4YY3 B;  1OWQ A;  2A0L A;  4LWS B;  3RM9 A;  1EN5 A;  2EJR A;  3HKD B;  3HKE B;  2RQ6 A;  3J80 N;  3AG3 C;  4O2B B;  4X20 A;  3LNN A;  3O5E A;  2BSK A;  4KQZ A;  1Z5V A;  3ZN1 A;  1HJV A;  4YHH O;  5CA0 A;  4CS3 A;  1N36 O;  3SYA A;  3A8T A;  2RQS A;  1FFX A;  4PDV A;  1B06 A;  5LYJ A;  4U84 A;  3WB2 A;  2QA4 V;  4PA9 A;  2ZXW B;  3VAW A;  3K04 A;  4K35 A;  4LF4 B;  1HNX O;  3CSX A;  5LMU O;  5DF0 A;  4NKG B;  4IHJ A;  3TC5 A;  2BOB C;  4I0X B;  4FLU A;  4EB6 B;  4GYC B;  1U96 A;  4HBN A;  3SPG A;  1HDJ A;  3T2M A;  2X6B A;  1NH2 D;  3JAW B;  5IE9 A;  1JND A;  3WL1 A;  1GTO A;  4W9O A;  1NBM G;  4BIU A;  1XL4 A;  2ZNJ A;  1S77 D;  4J9Z B;  5I98 A;  2UXX A;  5J2T A;  1H2S B;  3OUF A;  3IC7 A;  5B1B B;  4O2T A;  1IXM A;  4O4H A;  2A3C A;  1ZU8 A;  3L74 H;  5CBF A;  4CS4 A;  1J95 A;  1WB8 A;  4BW5 A;  1E79 G;  3IJ4 A;  1WP8 A;  4JI3 B;  2N74 A;  2K1E A;  3LSQ A;  1NJI W;  1YI2 V;  1JFF B;  4CC6 A;  1XQ8 A;  3RM4 A;  3STZ C;  1HP8 A;  3CPW U;  1TA8 A;  1SRY A;  5BMV A;  5BXJ A;  3IKG A;  2GDS A;  3NTP A;  4DW1 A;  1R6T A;  3IC9 A;  4W4L A;  3WG7 B;  3OT7 A;  2XHB A;  2ZD9 A;  1KP3 A;  2M7W A;  2FL4 A;  3ZBH A;  1Y4M A;  3OMN B;  3WIJ A;  3A0R A;  1NTZ H;  3UO2 A;  2LO1 A;  3F7V C;  2HJD A;  1PBK A;  4W9P A;  1F40 A;  3SPJ A;  1LG1 A;  4GCZ A;  3RM8 A;  4HNA A;  3K08 A;  4EFB A;  4IL6 Z;  4P9P A;  2IU0 A;  2H94 A;  1GH6 A;  3RN4 A;  4YJ2 B;  4TUY A;  1VQM V;  1YIJ V;  1M5Y A;  2PUS A;  1HXV A;  2LW7 A;  3CYO A;  4JAS A;  4ZPT R;  3APQ A;  4XBF A;  4MNK A;  4U3J B;  2UUA B;  4DV7 O;  3JD2 A;  4MVS A;  5KUK A;  2R72 A;  4JF3 A;  4AY1 A;  5TIS Z;  1NTM H;  3ARP A;  5H2F Z;  2O92 A;  2AWG A;  5BMV B;  3L75 H;  4WFA V;  2JJ2 G;  4Z2I A;  2HVJ C;  3FB6 C;  2AZ2 A;  2QM7 A;  2LJ2 A;  1RSO A;  3K9A A;  3E8G A;  3CCU V;  4I55 A;  1YJW V;  4TQF A;  1IBL O;  3E22 B;  2UUB B;  1I08 A;  2MW2 B;  2FAP A;  2A3A A;  2GBO A;  1VQN V;  4JAV A;  4YIO A;  4DUY B;  5D75 A;  1NVP D;  1JR9 A;  2YID A;  3DXR A;  5LHH A;  5IWA O;  3RYH B;  4DR4 B;  1X59 A;  4F6R B;  4U3F H;  3CCL V;  4B7K A;  4MNL A;  5ITZ A;  1O9G A;  1N33 O;  1XMQ O;  1VQO V;  4I4T A;  1LL6 A;  1D2D A;  4R8C A;  1H2L A;  1ZL8 B;  4JYS A;  1S5L Z;  1Q43 A;  1M93 A;  3OA5 A;  3K3W A;  1GO3 F;  3R66 A;  4K3A A;  2Y69 B;  3DTU B;  3OMI B;  1UFI A;  2UU9 B;  1UR9 A;  4P8W A;  4HNA B;  1GK9 A;  3LUT B;  3CHE A;  3ABM B;  3K0D A;  2X6A A;  1Y76 B;  1TVK B;  3AG3 B;  1X6L A;  4DV2 O;  1JJ2 U;  2GTA A;  2XP7 A;  4XAK A;  3MHS C;  3SJB C;  1E9L A;  1LQ0 A;  5BR8 B;  1V55 B;  2JEX A;  1O6I A;  2MLX A;  5L3C A;  4X65 B;  3ZHS A;  5LBQ A;  1P49 A;  4ZI7 B;  2Y48 A;  2PBC A;  3OUS A;  4YIP A;  4JFI A;  4MNJ A;  4JI8 B;  4UCR A;  2XP5 A;  1F23 A;  5CA1 B;  2D2C B;  4B3R B;  2RCV A;  3ZCC A;  1Q1C A;  3ASN B;  3CGN A;  3WQV A;  3CCR V;  1KC8 W;  1AI7 A;  2R9R B;  2ZR2 A;  1HWY A;  1YTF D;  1VMG A;  3T1Y B;  2LW1 A;  2QWQ B;  4R5E A;  2ZT9 B;  2VQE O;  2ZE7 A;  3VBB A;  2DSW A;  1V54 B;  1DGS A;  4NR1 A;  4BIO A;  2VCD A;  4ZBM A;  4MTO A;  1Y76 A;  1P7G A;  2BTQ A;  3JCZ A;  2W6J G;  4I7Z B;  4O4J A;  3R65 A;  4JV5 O;  2PYJ A;  4MGV A;  2P4K A;  5JH7 B;  1F51 A;  1R1B A;  1A7X A;  1PL4 A;  2WWW A;  1K97 A;  1VQ6 V;  1RM1 B;  4I50 B;  4BWA A;  3UF8 A;  4WKH A;  3AG1 B;  3Q4H A;  4DRX A;  5IJ0 A;  1NR1 A;  4LWS A;  1FKL A;  3KAF A;  3HB3 B;  4Q22 A;  5KUM A;  5J2U B;  3P30 A;  4JI2 B;  3BHP A;  2DG9 A;  2O57 A;  2JVD A;  4KL1 A;  5KHH A;  4FFK A;  4IIJ A;  2ZDI A;  3ZRW B;  1YVW A;  4X66 O;  2OCC B;  4WJX A;  1FAP A;  3I5D A;  3UKM A;  4K8Z A;  4LF9 B;  1LR1 A;  4PDR A;  3U11 A;  1Y66 A;  5B3S B;  5KA5 A;  4IQ2 A;  3JAR A;  1MOF A;  5EYP A;  3TET A;  2DT0 A;  2ITD C;  1F8A B;  4FFB A;  1GN6 A;  3OM3 B;  4EB6 A;  2RUC A;  3LDD A;  2N04 A;  5LOV B;  2VS0 A;  3JYM A;  2AHY A;  3GB7 C;  4LH6 A;  1ROP A;  1BZK A;  4CH4 A;  4FIP C;  4TV9 B;  2JGD A;  3OTO O;  4I50 A;  2YIA A;  4LR3 A;  5HWB A;  3Q4H B;  4DRX B;  3T1H O;  1FFX B;  4LC1 A;  2CH7 A;  2IH3 C;  4L8J A;  2EIL B;  3H1L H;  3ZRX A;  4K0K O;  2QSA A;  5E79 Z;  5FNV A;  4L3N A;  2X7R B;  5L3F A;  4H0L B;  3CMA V;  3CWB H;  2MLY A;  3JAT A;  3ARV A;  1AB3 A;  2Q0A A;  1J5E O;  5LGT A;  4JI5 O;  1CEZ A;  3SYQ A;  1BS3 A;  5KMG B;  1M5I A;  4D6T H;  2DT2 A;  2ITC C;  1XNQ O;  3KG2 A;  5B1O A;  4O4I A;  5F2V O;  4NXN B;  5HWC A;  3UQB A;  3CRQ A;  3QG5 A;  1XMO B;  2FKX A;  4MVM A;  5IYD O;  2L6L A;  3B9A A;  3CE2 A;  2ZR3 A;  3SYP A;  4LFB B;  3BPZ A;  4DR7 O;  4MSW C;  3CXC U;  4JI6 O;  4L87 A;  1J4H A;  3O5M A;  4DV4 B;  1EFR G;  4DRN A;  2P5O A;  4QGP A;  2XP8 A;  4FM0 A;  1YTF B;  4F4L A;  3OEE G;  2A06 H;  3O9O A;  1HNZ B;  3ARZ A;  1VQ4 V;  1B3Q A;  3OTO B;  5DM6 V;  4TV9 A;  3KZ7 A;  2DSU A;  2CTW A;  4AHC A;  2VN1 A;  3UI4 A;  1VF8 A;  3H01 A;  1QCE A;  4JZ2 A;  2V1D A;  4MTV A;  2B5U B;  4LF6 O;  1Y6X A;  4G50 A;  4FK5 C;  3CCM V;  1OHH G;  4DV5 B;  3ZIA G;  2YDE A;  1AI6 A;  1E15 A;  2Q7H A;  4YJ2 A;  2ZE5 A;  2YEV A;  1LUW A;  1Q82 W;  1ZK6 A;  2VRZ A;  3BAA A;  2E5L O;  3MDY B;  1ZBV A;  5KX5 A;  5FNV B;  5CBG A;  5IT9 N;  1WNO A;  1GN2 A;  2KG7 B;  4LF4 O;  5JH8 A;  5IJ9 A;  1E1R G;  1RSO B;  1UR8 A;  2Q0O C;  3AK1 A;  4HAR A;  4J42 A;  4JYB A;  1LL7 A;  1NT2 B;  4EKW A;  1UPG A;  4NTY A;  1NKD A;  4X64 O;  2QKA A;  5EBL C;  4TV8 A;  2ESC A;  5LA6 A;  1ZL8 A;  2A7W A;  5LGN A;  4X8A A;  4K8X A;  1US6 A;  1OJH A;  2IJH A;  5FL7 G;  4P30 A;  4LF9 O;  1EQ3 A;  1FKT A;  3AG1 C;  3N2K B;  2WA3 A;  2PV2 A;  1KKC A;  3WH0 A;  1FXH A;  1NI8 A;  2CGO A;  3SPC A;  4DV6 B;  2ADQ B;  2DQ3 A;  3LUO A;  2ZXW C;  2F4V O;  5LHG A;  1JJO A;  1G4Y B;  5GON A;  3G71 V;  2RUR A;  3CHF A;  2WLH A;  4MS2 A;  4OX9 O;  4MVZ A;  2Q5A A;  1M57 B;  1HR0 O;  1N8R W;  1SC5 B;  5IYC O;  1HNW O;  4HYO A;  3JAW A;  5DIV A;  3B8M A;  3OR6 C;  4G2K A;  4JAA A;  3GVM A;  1OCC C;  1TGO A;  2E5L B;  5LMU B;  1PP9 H;  1Q8I A;  3MD0 A;  1N32 O;  1W9P A;  4PDL A;  1SA0 A;  1QZ2 A;  1OGB A;  1YZB A;  1IX5 A;  4Q7N A;  1J5E B;  2HHH O;  1NWR A;  3N2G A;  5JJN B;  1UJW B;  4H33 A;  1MSD A;  1QPL A;  4A5U B;  4LBE C;  1NVP B;  2WM0 A;  1NS1 A;  2UUA O;  1W1Y A;  3UO3 A;  5JCO C;  3WD3 A;  2FKE A;  1ZL1 A;  5B1A B;  1BQ0 A;  1JNS A;  5DEZ A;  4DV6 O;  4CH6 A;  1HW7 A;  2WLL A;  2DJV A;  1BGY H;  3D3Q A;  1KT1 A;  2RDC A;  3UQA A;  4ODO A;  1V54 C;  1KT0 A;  1Z5W A;  1K92 A;  3BA9 A;  4MVU A;  4GKK B;  4H13 B;  1QU7 A;  2AW9 A;  3O5I A;  2NNU A;  4XDJ A;  4JI2 O;  1Z2G A;  2WLK A;  2EJ7 A;  1AVM A;  1EN4 A;  3J81 N;  1DK1 A;  5LMN B;  1GN3 A;  4Z2W A;  2XT9 A;  5GPG A;  3E8F A;  3CRM A;  4MVR A;  3C3S A;  4HBO A;  3ZMV A;  1FYJ A;  1AJP A;  1S76 D;  4PD4 F;  1F4N A;  1WPX A;  5GTI Z;  1XIL A;  1QPF A;  1FKI A;  3GU0 A;  4X66 B;  4DUZ B;  1FS0 G;  4UCV A;  2YUA A;  2LJ4 A;  4JTC B;  2PF4 E;  3B8S A;  3CCJ V;  4WFB V;  2OCC C;  1WJZ A;  1XUQ A;  4IIJ B;  4ZOL A;  1YJ9 V;  2CTR A;  3ALF A;  4DRH A;  4CS2 A;  2AHZ A;  2Q69 A;  2ZDI C;  2Q8V A;  1VF5 B;  3TDB A;  1VQK V;  1FKJ A;  3K58 A;  1SQQ H;  3JD4 A;  1R9H A;  2PPN A;  3JAR B;  3CCQ V;  1N33 B;  2DYR B;  4JTD B;  1MNG A;  3O5F A;  3FB8 C;  2F21 A;  3O5O A;  3QOK A;  1N34 B;  2IJJ A;  2QWR B;  3NI6 A;  2KGJ A;  2G8Z A;  3GWO A;  3ICX A;  4TW7 A;  4DWS A;  3RYI A;  4LNU B;  4MW3 A;  2RJZ A;  1FFQ A;  2WLZ A;  4NVP A;  4X20 B;  2KB1 A;  3E22 A;  2ZR4 A;  1F4M A;  5A9G A;  1FKD A;  4GKK O;  1WB7 A;  2DMX A;  5IYZ B;  5KHG A;  1BE3 H;  3B09 A;  4UV9 A;  4LF7 O;  4MTG A;  4X62 O;  2M08 A;  4J7Z A;  3RYH A;  3FAV B;  4P8X A;  5KAF Z;  3ASN C;  2VWK A;  1BSM A;  3C90 A;  5IY5 B;  4YY3 O;  1HR0 B;  1HJW A;  1W9U A;  3FAP A;  1XHX A;  4JFK A;  1MG1 A;  1L8D A;  4JFM A;  3U10 A;  2R9A A;  1VEW A;  1VF7 A;  4GT1 A;  3I6C A;  3ARU A;  4UCS A;  1JPX A;  4UB6 Z;  3DSQ A;  4EEQ A;  2LGW A;  4ODM A;  3CGM A;  1M90 W;  1T11 A;  2WAM A;  4B3S B;  2QWO B;  1B6C A;  4B7E A;  1ROU A;  2PN0 A;  4ZS6 A;  3OEH G;  2DE0 X;  2ZR6 A;  3FYE B;  3TXQ A;  1VIB A;  2IBZ H;  4KR0 B;  4YXW G;  2YBT A;  3BAB A;  3K03 A;  2QM8 A;  2XAQ A;  3B4S A;  4X1Y A;  1ORQ C;  5DO2 A;  4NXM O;  1IBM O;  1G1X B;  1I0H A;  2X6C A;  1PNK A;  4FM2 A;  4MVQ A;  1KU9 A;  4D7T A;  5E1A C;  3JAS A;  3ARY A;  1OV9 A;  1Q5O A;  1Q6I A;  3APO A;  3KCY A;  3LSS A;  3PRA A;  1ENV A;  3CB2 A;  1D7I A;  2EZP A;  1URF A;  4DK0 A;  3ML0 A;  1U97 A;  3MAQ A;  3OFN G;  5K1P A;  1D6O A;  2WLN A;  2ZR5 A;  2E74 B;  3AS0 A;  3EFF K;  4GX5 A;  2CUG A;  1EYM A;  3T4D A;  2WLI A;  2HJF C;  1RPO A;  4TWK A;  4TUY B;  2GTS A;  5JQG B;  2YIB A;  4X1Y B;  1FKR A;  1SYT A;  3K59 A;  4DV7 B;  4JI8 O;  4R7C A;  3F5T A;  2HR3 A;  1PPJ H;  3BCC H;  3K0G A;  3BFR A;  1K5S A;  3PA7 A;  1TUB B;  4LAW A;  3HPL C;  5GON B;  2ZCE A;  1GOI A;  3W4R A;  1WA8 B;  1P5Q A;  3H9R B;  4ZPW R;  2OIE A;  5HKG A;  2F2D A;  2A3Q A;  2P67 A;  4N23 A;  4DR1 O;  3KZI Z;  3ZHU A;  1CP9 A;  1W59 A;  3AK2 A;  2VQE B;  3ALG A;  4R6Z A;  3SGI A;  3NRK A;  5KHK A;  3K06 A;  1GN4 A;  4X1K B;  1XNR O;  3OR7 C;  5IWA B;  3M8A A;  4MNM A;  4B3T O;  1YW5 A;  4URI A;  3X2Q B;  1SQF A;  2ARH A;  4BIZ A;  1GMG A;  2WLI B;  1PKX A;  1V9P A;  1FJD A;  3ZX6 A;  2PGG A;  2JIZ G;  1JVM A;  1QLE C;  3T1H B;  2PYL A;  3E83 A;  3CEI A;  4YJ3 A;  3ARW A;  3WU2 Z;  4F6R A;  2NLJ C;  1SKV A;  3UT5 A;  2RN9 A;  1GAX A;  2DOS A;  1O9H A;  3X2Q C;  4DR6 O;  2LGQ A;  3T1C A;  4ODP A;  3ZJZ A;  1ZCN A;  1GUV A;  1AR4 A;  1NH6 A;  1WA8 A;  3W7W A;  3PR9 A;  1FKF A;  4Z1V A;  1DTO A;  2WA4 A;  1BQZ A;  5BZB A;  4BR6 A;  1R3L C;  4LF8 B;  4IT6 A;  4Z2H A;  3FYI B;  2IUZ A;  4B3T B;  2FB5 A;  1XI1 A;  3ZRS A;  3EY6 A;  3AG2 C;  1H2M A;  3RGB A;  2EIK B;  4BAY A;  2QWN B;  1LL4 A;  1W9V A;  4PI2 A;  4GKJ O;  2JS5 A;  1XMQ B;  3O5K A;  5DEC A;  1YEW A;  2AZ0 A;  1XHG A;  1GPF A;  3L71 H;  4NNR A;  2HHH B;  3HKB A;  4LH7 A;  2UXB B;  1S5J A;  4DR7 B;  5KMG A;  4Q20 A;  2Z0A A;  3CHX A;  4FLW A;  2BSK B;  4PV1 B;  2KI3 A;  4PA6 A;  1FXK B;  3WKZ A;  2Y0I A;  1TUB A;  4EFE A;  1E6Z A;  5CA3 A;  4TT3 G;  2P22 C;  1M1K W;  3DC6 A;  1LUV A;  1YHQ V;  4FAP A;  3JD0 A;  4P2Z A;  4NTW A;  2L2S A;  3MHH C;  1XL6 A;  5C8Y B;  3OW2 U;  5FPR A;  1M56 C;  3QO8 A;  5AG2 A;  5BR8 O;  2PI5 A;  5LHI A;  2RUD A;  4DT4 A;  1BL8 A;  1NR7 A;  4S3K A;  3LSU A;  3RW0 A;  2DQ0 A;  4GX2 A;  4E4E A;  2LPV A;  1FJG B;  4I0X A;  4JI0 B;  2JDI G;  3JAK A;  1KQS U;  5D5P A;  4QE7 A;  1TFV A;  4FJC C;  1FXV A;  4DK1 A;  1BT8 A;  1X6N A;  2GUZ A;  2ZIM A;  3SJQ C;  4DXW A;  2QWP B;  4JGS A;  4IGG A;  4UUJ C;  1THZ A;  3B9D A;  1EBO A;  1CPY A;  2Q7G A;  3CHD A;  3PN1 A;  4U7O A;  2UXD B;  3AS1 A;  4CZZ A;  1EDQ A;  2LKN A;  1FXK A;  3PRB A;  4JAU A;  1FPO A;  3IKD A;  4N19 A;  1GRJ A;  4DZ2 A;  5HTG A;  1WN7 A;  2EZO A;  3RYC A;  4JI7 B;  4X64 B;  4JTA B;  2VWJ A;  5EC2 C;  1Q6H A;  2YEV B;  4RUF A;  5J2U A;  3FY1 A;  2B31 A;  4DV0 B;  2DT3 A;  1MZE A;  3H1J H;  1HKK A;  4DIP A;  4JYA O;  3BXW A;  3AK3 A;  4DUY O;  1OZ0 A;  1M9N A;  2BE3 A;  3W7U A;  1JFF A;  4XDK A;  2HLD G;  5FPO A;  4JV5 B;  1I7F A;  4ITZ A;  3JAK B;  3SJA C;  1K8A W;  3E8H A;  2Y4U A;  4BW9 A;  1IZ3 A;  1EM1 A;  4PA7 A;  4PHZ A;  1TUE B;  4LCU C;  3UM7 A;  3QVN A;  5LP6 B;  4LFC O;  2HP8 A;  3ETE A;  2XAS A;  4FZ0 A;  3KAG A;  4LF6 B;  2JEU A;  2G41 A;  1W0K G;  1JCH B;  4X1I A;  3ZMU A;  3CS5 A;  1VF6 A;  2ZIO A;  4IT4 A;  1I5Y A;  3EXA A;  3ZMZ A;  1KD1 W;  1QNM A;  1H38 A;  5H9C A;  2KO7 A;  2DSV A;  2JGU A;  2PV3 A;  3OAA G;  3KCX A;  4QIB A;  4WBN A;  3JD1 A;  1QLN A;  3CCS V;  1FKG A;  1FJG O;  5GW7 A;  4GIV A;  4JFL A;  3ZMT A;  5H6R A;  3KKY A;  3SJC C;  3BEH A;  3CRC A;  2B1G A;  1IBK O;  1ROT A;  3KCE A;  5C93 A;  2WLY A;  2Q4P A;  3ZHT A;  1GKF A;  3FD9 A;  3OMA B;  4O2B A;  3ZHV A;  1WAZ A;  3OTF A;  4QIW F;  5J9P C;  2X0L A;  3ZHR A;  2AXT Z;  3ZED A;  1A32 A;  4LF5 O;  2XP6 A;  2F43 G;  4D7S A;  2EIM B;  4UVB A;  2A79 B;  5LMN O;  1WB0 A;  2JRI A;  3LDC A;  3DXR B;  2FYU H;  2L35 A;  2OT5 A;  1PNM A;  2XAH A;  3N2G B;  5KHI A;  3ART A;  1SS3 A;  2Y4T A;  3QO5 A;  2O9O A;  5BXZ A;  4DR4 O;  2K9P A;  1QQC A;  2DT1 A;  2QDO A;  5BY1 A;  1QR9 A;  4NYK A;  3D36 C;  1W0J G;  4O4I B;  4DUZ O;  3FB5 C;  3VQX A;  5HW7 A;  4O2A B;  3SR2 C;  3WD0 A;  3WB0 A;  2PI4 A;  1JA8 A;  1RFY A;  2KQX A;  4ABM A;  5L3G A;  4FLV A;  2UXC O;  1JCH A;  1IBL B;  2OCH A;  1V55 C;  4JZG A;  3C3T A;  5D5Q A;  4MSP A;  4Z2J A;  4WKF A;  3RWR D;  4DR1 B;  4FLZ A;  4DZ3 A;  3F5W C;  2DN9 A;  4X65 O;  2JS3 A;  4DH0 A;  3DC5 A;  3K5L A;  4LFB O;  2XND G;  1VQL V;  5JQG A;  2YSU B;  4J7K A;  5IDJ A;  1KBH A;  2IJI A;  1Q3E A;  4DWS C;  1YAT A;  1C9H A;  2YS8 A;  2PV1 A;  1FKA O;  2ZE8 A;  4LFA O;  1GM8 A;  3E86 A;  3VQV A;  3H1H H;  2RUQ A;  1F7Y A;  1KUQ A;  1AJQ A;  4WIW A;  4FLX A;  3TCZ A;  4DRQ A;  3CX5 F;  3CP1 A;  4WBN B;  1ZBC A;  2OWO A;  4Z2L A;  1R3J C;  1ZWI C;  4FLY A;  1PIN A;  1VQ9 V;  4LNU A;  4ODK A;  3ARS A;  3AS2 A;  4LGX A;  4JI1 B;  2W0F C;  1OCO C;  3ABL C;  4NB5 A;  4UB8 Z;  5KHJ A;  1VQP V;  1E6P A;  4UVA A;  2BTQ B;  2HKO A;  2EIJ C;  5B8I C;  5KX5 B;  1ARO P;  2EIN B;  4I9W A;  1JOY A;  3E89 A;  5HUA A;  1SQP H;  2XAG A;  1MAB G;  1L0L H;  2ZQM A;  1SR0 A;  3M99 B;  3TK1 A;  4JI4 B;  4WK9 A;  3ARO A;  1CTN A;  5EIB C;  2ZQT A;  1H2K A;  1JMK C;  1HNW B;  4ZKI A;  4AI8 A;  2DYS C;  3D3I A;  3NR7 A;  1N34 O;  1OGG A;  1X4T A;  1K34 A;  2YIC A;  3GPK A;  4TV8 B;  5IYZ A;  3SYO A;  1RP3 B;  3AG2 B;  1YCI A;  1PD3 A;  2ADP A;  4LAX A;  4U7N A;  4B3S O;  2WPD G;  5CBH A;  3E35 A;  3W7X A;  4DR5 O;  1D2K A;  2GHY A;  4QNH B;  3IHZ A;  3AQU A;  3ARX A;  1NSG A;  2W0X A;  4DR2 O;  4Q6G A;  3QO7 A;  2JGD B;  3P3P A;  1D7H A;  2XP9 A;  1XEQ A;  2Y69 C;  2CH7 B;  2OFN A;  2H8P C;  2CE4 A;  2W6I G;  1COW G;  3ZS8 C;  2ATK C;  1E1Q G;  4ZHQ A;  1MZF A;  3CC7 V;  1JNT A;  2CAZ C;  4TOI A;  4DO2 A;  2F23 A;  2P90 A;  4JI6 B;  1SA0 B;  4DV5 O;  3AS3 A;  3S3W A;  3JAL A;  4OX9 B;  2M1I A;  3B9E A;  3I56 V;  4JI0 O;  2DSZ A;  1IBM B;  1K9T A;  2Z5U A;  2IM9 A;  4UFZ A;  1RPR A;  4LFC B;  4G27 B;  2F4E A;  5JJE B;  5HFL A;  4PEL A;  3T4Z A;  1LNQ A;  5CA1 A;  2E76 B;  1N0N A;  1ITX A;  5JWP A;  3A0B Z;  3PJS K;  4J4O A;  2UUB O;  3WD2 A;  1KEC A;  4AQY O;  2EIN C;  2Q6A A;  2YXL A;  1J4R A;  1AI4 A;  3AG4 B;  1R3K C;  1QLE B;  1WNS A;  4E2L A;  4DV0 O;  4K0K B;  1FKK A;  3BRC A;  5IY5 C;  4JYY A;  1JVW A;  1TVK A;  3HKE A;  3HKD A;  1N36 B;  3D36 A;  3CH9 A;  3RT3 C;  4DRJ A;  3CCE V;  4KXR A;  3HKC B;  3NXS A;  2N87 A;  1G6U A;  2ZKO A;  4DRI A;  2QM4 A;  2WK2 A;  2IH1 C;  2QKC A;  3RGC A;  5LP6 A;  2MLZ A;  3FFQ A;  4DRM A;  1CXZ B;  2HFE C;  5L3E A;  5L3D A;  1SES A;  3G6B A;  5IJ0 B;  2KKW A;  3A2F A;  3ODK A;  1XHZ A;  1L0N H;  1YSC A;  1HNX B;  2QTO A;  2ZIN A;  3H1K H;  5HW6 A;  1XDC A;  1RM1 C;  1K33 A;  1S5H C;  1K7D A;  2NN4 A;  4DWS D;  3ZRW A;  4W9Q A;  2JK5 C;  2Z3Y A;  4O4J B;  1RD6 A;  4CBC A;  2D9F A;  3LNM B;  2UXN A;  3F7Y C;  5A2Q N;  2QF8 A;  1YJN V;  2LGO A;  1NH2 B;  2LFR A;  4YJ3 B;  4FN2 A;  5FLX N;  1H2N A;  1SZT A;  3B8N A;  4UV8 A;  1D7J A;  4GX0 A;  3E2E A;  4DV3 B;  5JJJ B;  1SZX A;  1VQ7 V;  1FKH A;  2MNT A;  1R6N A;  5GPR A;  5JCO A;  2Y78 A;  1VF6 C;  4DW0 A;  2AGA A;  3BA8 A;  2CTP A;  3T1Y O;  1EIB A;  4MAV A;  2DYS B;  4GLX A;  2QEX V;  4B3M B;  5GTH Z;  1P4R A;  1R3I C;  1R73 A;  2EX3 A;  3WD1 A;  4IQC A;  1QBZ A;  1SQG A;  2OTJ V;  4C02 B;  2M6Y A;  4P8V A;  2P7T C;  1EN6 A;  3WQW A;  2NR5 A;  1IVS A;  2QTS A;  3VQW A;  1SQV H;  5JVD B;  4FVM A;  1WP7 A;  2QKS A;  2GUZ B;  1GM7 A;  2F93 B;  1OCO B;  3BVO A;  2Y0P A;  4UCU A;  2UXD O;  4NSB A;  4OPH A;  4O2A A;  5KAI Z;  2UUC B;  4RO2 A;  5B5E Z;  1AR5 A;  4I55 B;  4FMT A;  1EHN A;  5DIT A;  4J4N A;  1W1T A;  3A0H Z;  3H9V A;  5CMU A;  1DLB A;  1XRE A;  4UCO A;  2DG3 A;  4QZV B;  3MDS A;  5B1B C;  4LP8 A;  4ML4 A;  5HT1 A;  1BCC H;  4MTX A;  1PL0 A;  3RME A;  4JYA B;  1XNQ B;  5LXT B;  3VQY A;  2KE0 A;  2ETN A;  4JI5 B;  1Y0O A;  3LDE A;  4UCT A;  3G6L A;  2DWD C;  4RUE A;  2P6J A;  1KYO F;  5CN0 A;  1Y74 B;  4KP4 A;  1ZSP A;  2QR4 A;  4KHP O;  2ZNI A;  2XAJ A;  2XUM A;  1BL4 A;  4RQE A;  3I55 V;  4ODQ A;  3FKS G;  1L1P A;  3L70 H;  3WL0 A;  5H6Q A;  4I4T B;  1Q81 W;  3CCV V;  1K5Q A;  5DIU A;  3UQI A;  4QE9 A;  3J7A U;  3U0Z A;  3L72 H;  3TXS A;  3OGI B;  3ABK C;  1VQ8 V;  4J10 A;  3K5O A;  4X1K A;  5EC1 C;  5B3S C;  3KAD A;  4RAI A;  2WLJ A;  2EIK C;  4RQF A;  2M2A A;  3VOU A;  2D3O W;  4DRO A;  2QE7 G;  4TNS A;  2R9I A;  2PTM A;  4PI0 A;  5LGU A;  5LXT A;  2H3O A;  1HNZ O;  2PY5 A;  1WAW A;  4IYI A;  1KFW A;  2MF9 A;  2BCC H;  1ZBW A;  3O5Q A;  2F66 C;  4HAM A;  2CDY A;  3AEI A;  3O5R A;  3UT5 B;  1N4C A;  1W26 A;  4F6E A;  1DF4 A;  1H8E G;  2OIG A;  3K79 A;  2EIL C;  1H0G A;  2ODM A;  4Z2G A;  1KB9 F;  1ZTE A;  2HEP A;  3ETD A;  4OPA A;  4TX0 A;  4AQY B;  3B2E E;  2R70 A;  4QT2 A;  4ZI7 A;  3AG7 A;  3SPH A;  1LG2 A;  2QGN A;  4PJ0 Z;  2XP3 A;  4IYH A;  2Q73 A;  4B3R O;  2MPH A;  2KG7 A;  4ODR A;  2Q67 A;  4GUN A;  5B66 Z;  4KHP B;  3ETQ A;  1FD9 A;  4J80 A;  3RFR A;  1Q6U A;  1NMV A;  3BMB A;  3JSL A;  2EBO A;  4TYO A;  3ZRV A;  1AR1 B;  4JFJ A;  2IJK A;  1E44 A;  1BHB A;  4ICG A;  4MTF A;  3ABT A;  2KR7 A;  4ODL A;  3FX7 A;  3ZMS A;  1N0J A;  1OCC B;  1ZUQ A;  4ZOL B;  3RFW A;  1YF2 A;  3ABL B;  1ZB5 A;  1P7B A;  3SYC A;  1HKJ A;  1HKM A;  3G67 A;  4J11 A;  2EIJ B;  2XAF A;  4MW8 A;  4DV1 B;  4HBE A;  2ITK A;  2K8I A;  3KAI A;  2HVK C;  4MPK A;  2UXB O;  3IFX A;  2CGN A;  3ARR A;  1VP7 A;  2Q5Z A;  2DWE C;  2Q7E A;  3WG7 C;  2RSE A;  2XTA A;  5LP6 C;  5EBW C;  1S3J A;  5EIB D;  2ZQV A;  2ZM6 O;  1BKF A;  2P06 A;  2LFS A;  4GX1 A;  3FXY A;  5DED A;  3WFV A;  4WFH A;  1G8M A;  2RMK B;  1XMO O;  5CB4 A;  1XRV A;  2UU9 O;  3JCU Z;  4LAV A;  5K1X A;  1BHA A;  2DG4 A;  3RYC B;  3FAV A;  4U85 A;  4KFM A;  5C8Y A;  1YXB A;  3K9S A;  4JI3 O;  3SPI A;  3O5J A;  2WLM A;  4DV2 B;  1AP5 A;  1PV0 A;  1XBL A;  2YXY A;  1W2B U;  2IU3 A;  1Q7Y W;  4QPJ A;  2LQT A;  3K5M A;  2YXH A;  1XOU A;  1JQ0 A;  4JI7 O;  1K9M W;  1KP2 A;  2OYQ A;  4FFB B;  1K4C C;  3ETG A;  4PA3 A;  2UZ5 A;  2AOS A;  3PRD A;  4ZPV R;  3RBZ A;  4WCE V;  3G80 A;  5KLV H;  5LOV A;  3B7X A;  4FZ1 A;  2YI8 A;  3KAC A;  1W1V A;  1MSW D;  1IXB A;  4H44 B;  3JAT B;  1ZX3 A;  3KAB A;  1Q90 D;  1IX9 A;  2XOK G;  3RVZ A;  2PPO A;  2PZS A;  2XP4 A;  1FXK C;  1K3E A;  2IW5 A;  3CRA A;  4ASU G;  4X89 A;  1HKI A;  3OOB A;  1YDX A;  2ILM A;  1NQT A;  1M57 C;  4FM1 A;  1Q86 W;  3O5G A;  5LYJ B;  2IF4 A;  3THO A;  4R50 A;  4DV1 O;  5ITZ B;  2LP7 A;  3L9D A;  3G4S V;  4JPR A;  4TSF G;  4PA4 A;  2JJ1 G;  4JI4 O;  1AP6 A;  4X88 A;  2A9H A;  3JD3 A;  5DN6 G;  2HG5 C;  3TCU A;  2KSD A;  4QT3 A;  4CH3 A;  1I94 B;  5EK0 A;  1LJY A;  3CHC A;  3OE7 G;  3D8C A;  5L3B A;  1JX9 A;  1MMM A;  1EZJ A;  1NWU A;  2B5U A;  1NWS A;  1M4U A;  3ABM C;  2EUL A;  3H1I H;  1J6Y A;  5GQB A;  2DYR C;  4J7J A;  1NWT A;  2FML A;  2GV9 A;  4G2P A;  4TW6 A;  3KAH A;  4S3J A;  2MK3 A;  4H37 A;  3L73 H;  3QTC A;  1FFR A;  4LAY A;  1GM9 A;  3OD4 A;  4IHJ B;  3O65 A;  1B04 A;  2ZE6 A;  1JNE A;  5J6E A;  5B1A C;  1PNL A;  3UI6 A;  4MVO A;  1TCO C;  4FLT A;  4DV4 O;  4L72 B;  5JH7 A;  2ZQU A;  3JXV A;  2BTO A;  2B1I A;  4NZC A;  1WPB A;  1EZV H;  4TW8 A;  4DWS B;  1Y74 A;  3RYI B;  1SER A;  1H2G A;  2UUC O;  3E8B A;  2FTK A;  3CC4 V;  2F95 B;  4HZ3 A;  3IGA C;  4DRK A;  3GWK C;  2BOC C;  4YHH B;  1QR8 A;  2GSM B;  2N05 A;  3P32 A;  2V7Q G;  1BMF G;  3CXH F;  5LA6 B;  1HJX A;  4X62 B;  4BF8 A;  1OCZ B;  4UDM A;  3ASO C;  1I5X A;  1NZ6 A;  2G38 A;  4DR3 O;  5HBF A;  3N2K A;  3JYC A;  4LFA B;  4U3J A;  5EYP B;  3JAM N;  4ODN A;  1OCZ C;  4GKJ B;  3HR0 A;  4NTX A;  3EHB B;  1M56 B;  2PPP A;  1NTK H;  1E6R A;  4J9Y B;  3JAS B;  4OXS A;  3QF7 A;  1QHT A;  3CJH A;  3FB7 C;  2E75 B;  1WLE A;  4LF5 B;  5LL6 Y;  4RWU A;  2UXC B;  1T5E A;  1OCR B;  1NU1 H;  3B40 A;  1D5N A;  3RYF B;  3W7T A;  4NXM B;  1IUR A;  3TJT A;  3ZHQ A;  4B08 A;  2QJ1 A;  4WFF A;  3ABU A;  2EIM C;  2DW4 A;  3BY6 A;  4WKA A;  3B77 A;  1FKS A;  3GTY X;  2F4V B;  4QJF B;  2OTL V;  1N1A A;  3S3X A;  1NMW A;  2FDM A;  1VAR A;  1ZAU A;  3UI5 A;  1QVG U;  4NXN O;  4R0X A;  1I94 O;  1H0I A;  1AI5 A;  2CTQ A;  4TQD A;  1AIL A;  5EZY B;  4N21 A;  2Q68 A;  1S72 V;  2ZQS A;  4ZIB A;  4DRP A;  3WD4 A;  4FPP A;  2ZM6 B;  4WFG A;  3IK8 A;  3EVK A;  2JZV A;  1ZLZ A;  3CRR A;  2DPE A;  1AJN A;  4GGQ A;  4W5U A;  2F1M A;  2KFW A;  1TAE A;  4JI1 O;  2YI9 A;  3JSN A;  2RNB A;  1FFT B;  1R6K A;  4DR3 B;  1P84 F;  2VQF O;  1J4I A;  1N32 B;  3K5N A;  3RYF A;  3TGU H;  2OLH A;  4DR2 B;  4UXN A;  4J41 A;  2PI6 A;  4G28 B;  5H5N A;  4WF9 V;  3N27 A;  4IT5 A;  2WLL B;  3ZN0 A;  1VQ5 V;  5B1N A;  5JVD A;  2XPA A;  4DR5 B;  3UQ8 A;  4O4L B;  3O5L A;  3G6E V;  3ARQ A;  4OGQ B;  4B3M O;  3CZ8 A;  3DGE A;  5IYB O;  2B9Z A;  1D5A A;  1DF5 A;  1SQX H;  1ZBK A;  3CJH B;  5HFM A;  3W7S A;  4DV3 O;  1W1P A;  3OGC C;  1YIT V;  4I9Q A;  3QNE A;  4AIL C;  2CK3 G;  3IAY A;  2P4V A;  1B6Q A;  3ASO B;  4MT8 A;  1E6N A;  1FKB A;  4X9Q A;  2WSS G;  3SDL A;  1Y67 A;  4ZHQ B;  5KA6 A;  1QVF U;  4W4K A;  2YC0 A;  1XNR B;  4JYC A;  2A3E A;  3AG4 C;  3G6M A;  4P9O A;  1SF9 A;  4Z2K A;  3O5D A;  4PDM A;  3CC2 V;  4DR6 B;  2XPB A;  1SQB H;  5IJ9 B;  4QPK A;  3ABK B;  1MA1 A;  2E3C A;  2VQF B;  5CB4 B;  1H8H G;  1KKD A;  4CH5 A;  4CC5 A;  1S0V A;  3JYJ A;  4PTM A;  4O4L A;  4U86 A;  4X1I B;  1PM9 A;  2A3B A;  3CME V;  4O4H B;  1IDS A;  3RVY A;  5CA0 B;  1OCR C;  4XDL A;  2C2A A;  5EZY A;  4LF8 O;  4DYL A;  3CD6 V;  1KMI Z;  1K73 W;  4KUM A;  3EIP A;  5HW8 A;  5J2T B;  4Z1M G;  5EBM C;  3K57 A;  4LF7 B;  2YBU A;  4I5S A;  1K4D C;  1L1F A;  4IPX A;  1SET A;  3WB1 A;  1U79 A;  2V4D A;  1IBK B;  4P8U A;  4GZR B;  4UVC A;  3O5P A;  2Q9L A; 
#chains in the Genus database with same CATH homology
 3BXW A;  2ESC A;  5DIU A;  3UQI A;  4ITZ A;  1EQ3 A;  1FKT A;  1OWQ A;  3KAD A;  3RM9 A;  2PV2 A;  3WH0 A;  2M2A A;  3KAG A;  3LUO A;  4DRO A;  3O5E A;  4TNS A;  4KQZ A;  1HJV A;  2G41 A;  1WAW A;  1KFW A;  2RUR A;  3CHF A;  2MF9 A;  2Q5A A;  1ZBW A;  3O5Q A;  4IT4 A;  3O5R A;  2RQS A;  1W26 A;  4U84 A;  5DIV A;  3VAW A;  2KO7 A;  2DSV A;  1H0G A;  2PV3 A;  4Z2G A;  5DF0 A;  3TC5 A;  4QIB A;  4TX0 A;  1FKG A;  4GIV A;  4JFL A;  1W9P A;  4QT2 A;  1QZ2 A;  1LG2 A;  1OGB A;  1ROT A;  2XP3 A;  1JND A;  3KCE A;  2WLY A;  3WL1 A;  1IX5 A;  2MPH A;  4Q7N A;  4W9O A;  1NWR A;  4ODR A;  5I98 A;  1FD9 A;  1QPL A;  2WM0 A;  1Q6U A;  1NMV A;  1W1Y A;  4O2T A;  2A3C A;  2XP6 A;  1ZU8 A;  4TYO A;  3WD3 A;  2FKE A;  1ZL1 A;  4JFJ A;  1WB0 A;  1JNS A;  5DEZ A;  2KR7 A;  4ODL A;  3ART A;  1KT1 A;  3RFW A;  3RM4 A;  2O9O A;  4ODO A;  3UQA A;  1KT0 A;  1ZB5 A;  5BXJ A;  1HKJ A;  3IKG A;  2DT1 A;  1HKM A;  3NTP A;  3O5I A;  4HBE A;  2ITK A;  2K8I A;  5HW7 A;  3KAI A;  4MPK A;  3WD0 A;  5GPG A;  3WIJ A;  3ARR A;  1PBK A;  4W9P A;  4MSP A;  4HBO A;  1F40 A;  1LG1 A;  3RM8 A;  4Z2J A;  4WKF A;  2RSE A;  4DZ3 A;  2ZQV A;  4DH0 A;  1BKF A;  1QPF A;  1FKI A;  1M5Y A;  2LJ4 A;  3B8S A;  1HXV A;  4DWS C;  1YAT A;  1C9H A;  2PV1 A;  3FXY A;  4ZPT R;  4MNK A;  2RUQ A;  1XRV A;  4LAV A;  3ALF A;  4AY1 A;  3ARP A;  4U85 A;  4WIW A;  2DG4 A;  4DRH A;  3TCZ A;  4DRQ A;  2O92 A;  2AWG A;  4Z2I A;  3O5J A;  1ZBC A;  4Z2L A;  3TDB A;  1FKJ A;  1PIN A;  4ODK A;  3ARS A;  1R9H A;  3AS2 A;  2PPN A;  4LGX A;  3PRD A;  2UZ5 A;  4ZPV R;  2AOS A;  2FAP A;  2A3A A;  1E6P A;  3O5F A;  3B7X A;  2F21 A;  3O5O A;  3QOK A;  3KAC A;  1W1V A;  5B8I C;  5D75 A;  3NI6 A;  2KGJ A;  2G8Z A;  3KAB A;  4TW7 A;  4DWS A;  5HUA A;  2WLZ A;  1FFQ A;  2PPO A;  2ZR4 A;  1SR0 A;  1FKD A;  4WK9 A;  3ARO A;  2XP4 A;  1CTN A;  4MNL A;  2ZQT A;  1HKI A;  3OOB A;  3B09 A;  1LL6 A;  1OGG A;  2M08 A;  4JYS A;  4P8X A;  3O5G A;  2IF4 A;  3OA5 A;  1HJW A;  3GPK A;  1W9U A;  3FAP A;  4JFK A;  4P8W A;  1UR9 A;  4JFM A;  3CHE A;  3I6C A;  3ARU A;  1X6L A;  4QT3 A;  4LAX A;  1LJY A;  4ODM A;  3CHC A;  3CGM A;  1D2K A;  2XP7 A;  4XAK A;  1E9L A;  1T11 A;  1LQ0 A;  3AQU A;  3IHZ A;  1B6C A;  1O6I A;  1NWU A;  2MLX A;  3ARX A;  1ROU A;  1NWS A;  1NSG A;  4ZS6 A;  1J6Y A;  5GQB A;  2PBC A;  4JFI A;  1NWT A;  2ZR6 A;  4MNJ A;  4G2P A;  2XP5 A;  4TW6 A;  3KAH A;  4S3J A;  4KR0 B;  2YBT A;  1Q1C A;  1D7H A;  3CGN A;  2XP9 A;  3WQV A;  1FFR A;  4LAY A;  2OFN A;  5DO2 A;  1JNE A;  5J6E A;  3UI6 A;  1TCO C;  4L72 B;  4R5E A;  2ZQU A;  3JXV A;  4NZC A;  3ARY A;  1JNT A;  1Q6I A;  2DSW A;  4TW8 A;  4DWS B;  2VCD A;  3PRA A;  3AS3 A;  1D7I A;  4DRK A;  2M1I A;  1D6O A;  4MGV A;  3B9E A;  2DSZ A;  1K9T A;  2ZR5 A;  1A7X A;  1HJX A;  3AS0 A;  3UF8 A;  4BF8 A;  4WKH A;  2F4E A;  1EYM A;  5HBF A;  1FKL A;  3KAF A;  4Q22 A;  1ITX A;  2DG9 A;  4J4O A;  1FKR A;  1SYT A;  3WD2 A;  1J4R A;  3PA7 A;  4ODN A;  4LAW A;  4WJX A;  1GOI A;  2PPP A;  1FAP A;  1E6R A;  1FKK A;  3W4R A;  1JVW A;  1P5Q A;  3H9R B;  4ZPW R;  5HKG A;  2F2D A;  3CH9 A;  4IQ2 A;  4DIP A;  4DRJ A;  3ALG A;  2DT0 A;  3NRK A;  1F8A B;  2N87 A;  2RUC A;  4DRI A;  2WK2 A;  4MNM A;  3JYM A;  3RGC A;  2MLZ A;  4DRM A;  1YW5 A;  4URI A;  4WKA A;  5HWB A;  1FJD A;  1FKS A;  3ODK A;  5HW6 A;  1N1A A;  1NMW A;  2FDM A;  3ARW A;  3UI5 A;  4R0X A;  1H0I A;  2ZQS A;  4DWS D;  4DRP A;  4W9Q A;  3WD4 A;  1RD6 A;  2D9F A;  3IK8 A;  4ODP A;  1ZCN A;  2JZV A;  1GUV A;  2QF8 A;  4L3N A;  2DPE A;  1NH6 A;  2LGO A;  3PR9 A;  2MLY A;  4GGQ A;  1FKF A;  3ARV A;  4W5U A;  2KFW A;  4FN2 A;  1D7J A;  4IT6 A;  4Z2H A;  2DT2 A;  2IUZ A;  3EY6 A;  1J4I A;  5HWC A;  1FKH A;  3UQB A;  1LL4 A;  2OLH A;  1W9V A;  2MNT A;  5GPR A;  2Y78 A;  2PI6 A;  3O5K A;  1XHG A;  1GPF A;  4NNR A;  1EIB A;  3B9A A;  4MAV A;  2XPA A;  3O5L A;  3ARQ A;  3CZ8 A;  3WD1 A;  4IQC A;  2KI3 A;  3WKZ A;  1J4H A;  4C02 B;  4P8V A;  1E6Z A;  3O5M A;  1ZBK A;  3WQW A;  1W1P A;  4DRN A;  2XP8 A;  4FAP A;  2L2S A;  1E6N A;  1FKB A;  3ARZ A;  4DT4 A;  2RUD A;  3KZ7 A;  4NSB A;  4S3K A;  2DSU A;  2VN1 A;  2LPV A;  3UI4 A;  1VF8 A;  2A3E A;  5DIT A;  1EHN A;  4J4N A;  3G6M A;  1W1T A;  4MTV A;  1TFV A;  4G50 A;  4Z2K A;  3O5D A;  1X6N A;  2DG3 A;  2XPB A;  4QZV B;  1E15 A;  4ML4 A;  5HT1 A;  3RME A;  3B9D A;  3CHD A;  1ZK6 A;  3JYJ A;  4PTM A;  2KE0 A;  3MDY B;  1ZBV A;  4U86 A;  2A3B A;  1Y0O A;  3AS1 A;  1EDQ A;  1WNO A;  2LKN A;  3PRB A;  3G6L A;  3IKD A;  5HW8 A;  4N19 A;  4DZ2 A;  5JH8 A;  5HTG A;  1UR8 A;  4HAR A;  2YBU A;  1BL4 A;  1LL7 A;  1Q6H A;  4ODQ A;  3FY1 A;  2B31 A;  4IPX A;  2DT3 A;  1U79 A;  1L1P A;  1HKK A;  3WL0 A;  4P8U A;  3O5P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...