1Q6UA

Crystal structure of fkpa from escherichia coli
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
213
structure length
213
Chain Sequence
AFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVKPAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase fkpA
publication title Structural and functional studies of FkpA from Escherichia coli, a cis/trans peptidyl-prolyl isomerase with chaperone activity.
pubmed doi rcsb
source organism Escherichia coli
total genus 73
structure length 213
sequence length 213
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2003-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF01346 FKBP_N Domain amino terminal to FKBP-type peptidyl-prolyl isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.460 Mainly Alpha Orthogonal Bundle Helix Hairpins Peptidyl-prolyl cis-trans isomerase, FKBP-type, N-terminal domain 1q6uA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1q6uA02
1QPLA 3PRDA 4GIVA 4FAPA 1HXVA 2OFNA 3WH0A 1EQ3A 1J4IA 1NMVA 2MLXA 4DRIA 2RURA 2F2DA 1D7JA 1FKGA 2MNTA 2FAPA 3KCEA 2DG4A 2KGJA 1J4RA 3B7XA 3O5RA 2XP4A 3UI5A 2ITKA 4DRHA 5HW7A 2UZ5A 2KR7A 2F21A 2XP9A 4QT3A 5DIVA 4G50A 4TX0A 5HW8A 1BL4A 1U79A 2XPAA 1F8AB 3TC5A 2XP7A 4NNRA 2ZR4A 4ODQA 2KI3A 1D6OA 2RSEA 2Y78A 1Q6IA 2MF9A 3PA7A 3TDBA 4DRNA 1Q6UA 1F40A 1FKTA 1NSGA 1QZ2A 4DRQA 1BKFA 5HW6A 4LAXA 3JXVA 2MLZA 1PINA 2LKNA 4JFIA 4QIBA 3RGCA 3UF8A 1D7IA 2PPNA 3IHZA 4U86A 2RQSA 1FKDA 3IKGA 3PRBA 3O5QA 4JFLA 1QPFA 4ODMA 4W9QA 3VAWA 5HUAA 4W9OA 4LAWA 4ODNA 3O5IA 1M5YA 1Q1CA 2RUCA 1JNTA 3H9RB 4ITZA 3O5EA 1FJDA 4ODLA 1R9HA 3I6CA 3KAGA 3O5JA 3IK8A 3JYJA 1P5QA 1YW5A 1W26A 2PV2A 2XP3A 5GPGA 2XP6A 2PV1A 3UI4A 5HWCA 3ODKA 3TCZA 2IF4A 2L2SA 2JZVA 1C9HA 2PPOA 1Q6HA 5B8IC 5DITA 2XP5A 1ROTA 4JFJA 2M2AA 4DRJA 2XP8A 2PBCA 1PBKA 4MGVA 2LJ4A 2ZQVA 3KADA 1FKBA 2ZR6A 3O5MA 3O5LA 3O5OA 3OOBA 4IPXA 4IQCA 4TW7A 1T11A 2DG3A 4DRKA 4JYSA 4DRPA 1FD9A 4W9PA 3MDYB 3O5PA 4DT4A 4DZ2A 1FKHA 4ODKA 5BXJA 3O5KA 1ZK6A 4ODOA 4TNSA 2M08A 4U85A 4TYOA 5DIUA 2D9FA 4DZ3A 5J6EA 2PV3A 2LGOA 2ZQUA 3KAHA 3FAPA 2LPVA 2AWGA 4G2PA 4TW6A 5D75A 3KACA 1A7XA 3IKDA 2FKEA 3B09A 2RUDA 1FAPA 2PPPA 2ZR5A 3EY6A 3KAFA 2VCDA 4O2TA 2MPHA 3NTPA 4LAYA 5HKGA 1JNSA 3RFWA 1D7HA 4U84A 5HTGA 3CGNA 3LUOA 3UI6A 1FKRA 4J4OA 5I98A 4DROA 3O5GA 4ODPA 4DRMA 3JYMA 3O5DA 1EYMA 1ROUA 4C02B 4N19A 4GGQA 1JVWA 4ODRA 3UQIA 3GPKA 1ZCNA 2MLYA 1TCOC 1FKJA 2ZQSA 4JFKA 5HWBA 3KZ7A 1NMWA 4R0XA 3UQAA 2ZQTA 3UQBA 1FKFA 1FKIA 1FKKA 1L1PA 1FKSA 4DH0A 2RUQA 2N87A 3O5FA 2KE0A 4DIPA 1KT0A 1N1AA 2Q5AA 4QT2A 3KABA 1FKLA 3KAIA 3NI6A 2XPBA 4FN2A 1YATA 4BF8A 4MSPA 2DG9A 1Y0OA 2F4EA 4J4NA 4LAVA 4TW8A 2KO7A 2KFWA 4IQ2A 2K8IA 3NRKA 1KT1A 2M1IA 3CGMA 5HT1A 2VN1A 1B6CA 1J6YA 4JFMA 1J4HA
chains in the Genus database with same CATH superfamily
3H1IH 4NTXA 5K1PA 2G41A 1VQPV 1FKGA 1EN6A 3L74H 4DR3B 1FFQA 5LOVB 5IWAO 3JATB 1T5EA 3RMEA 3W7XA 3HKCB 2V4DA 2KG7A 5B3SB 3TC5A 1VMGA 2RMKB 1D6OA 1I5YA 1AP6A 4QJFB 4DV7O 4UCSA 4YY3O 2F43G 4JZ2A 1E6PA 4X1IA 2BE3A 2E5LO 1NWSA 3RM9A 2LFSA 2XAGA 1VF5B 1J5EO 3CPWU 1B04A 2XAHA 4K35A 1E9LA 1SS3A 5B1BC 1YCIA 4RO2A 3W7SA 2YIBA 1E6RA 4DR1O 4GCZA 1BGYH 3I6CA 3ZMSA 3KAGA 1SF9A 2OCCB 4ZKIA 4B3SO 2ADQB 1K9TA 1H2KA 5IYBO 4HARA 2AOSA 2A3BA 4YJ2A 2VQEB 2M2AA 1K92A 1RPRA 3ABLC 1FXKC 4IPXA 3K08A 3U11A 1FKHA 3OR7C 1JQ0A 1RSOB 1WJZA 1IZ3A 1KU9A 1AI5A 5IDJA 1NH2D 3FYIB 5LXTA 3E35A 4MNLA 3HB3B 2FKEA 3B09A 4NXNO 2IUZA 1N0JA 3BA9A 5CBGA 1ORQC 4ZOLA 5CMUA 3TCUA 4P8WA 2M7WA 3JCUZ 1VF7A 3CHFA 2A06H 3S3XA 1Q43A 4FZ0A 3JAWA 4UUJC 3RWRD 4A5UB 1CP9A 5CA1A 4KHPB 1QLEC 1QQCA 4KFMA 2DYRC 1IBMB 4IT6A 3UQIA 4EFEA 2R9IA 3KZ7A 4JI8B 1X4TA 1GN4A 3CEIA 4X88A 1K7DA 4XAKA 2Q6AA 2V7QG 2A3EA 4UVCA 4LCUC 5B1BB 5CA0B 1MA1A 3EVKA 1NWUA 4YIOA 5GTHZ 4UCRA 4J4NA 3K03A 3HPLC 1XRVA 4Z2HA 3N2GB 2ZKOA 5D5QA 2YIAA 2E3CA 1GPFA 3JAKB 1AJQA 2FMLA 3K0GA 3JARA 1HXVA 1IBLB 1EQ3A 3ZX6A 2MNTA 3JD4A 4NTYA 2QEXV 3E8HA 2L6LA 4F6EA 1QR8A 2CTQA 3T1CA 5LA6B 2ZIOA 4NB5A 4PDLA 1JR9A 3BY6A 4MVQA 3QF7A 3AROA 5H6QA 1GM8A 3ETGA 1Y67A 3FY1A 1QLEB 4H37A 2DYRB 4JI6B 1NTZH 2NLJC 3CRRA 4ICGA 4WCEV 1WB7A 2DOSA 3CCSV 5KMGA 4F6RB 4DV1B 1HW7A 5C8YA 3CHDA 1XILA 2QWPB 5BY1A 2XP3A 5HBFA 1Q8IA 4LR3A 4IT4A 5KX5B 2Q0OC 1W1YA 2ZIMA 4DV6O 5LGUA 3CYOA 3AG1B 4PELA 2P90A 5IYCO 1FD9A 1GRJA 1RM1C 1F4NA 1WA8B 3CCJV 2PN0A 2QKAA 2PV3A 2WA4A 4DR2O 1A32A 2XTAA 2GTAA 4TW6A 2EZPA 4PJ0Z 4JI4O 1WNOA 3KACA 1R3JC 2UXDO 3U0ZA 1EZVH 2WLLA 1KYOF 1Z5VA 1S0VA 3B8NA 3OD4A 2B5UB 2BOCC 1N33O 1HNZO 4GGQA 3MHHC 1W1TA 1MZEA 3K0DA 3OFNG 3PN1A 1AJNA 2QSAA 1L1PA 2DE0X 3A0RA 3WL0A 4DIPA 1N1AA 2KB1A 3JSLA 4QT2A 2ILMA 2Y4UA 2E74B 2CTRA 4LNUA 1OCOC 1U96A 3ZRWB 2QF8A 2FTKA 4KQZA 4PI2A 2YI9A 4WBNA 1J4HA 5BMVB 3AS0A 4L87A 1NWTA 4LF7O 1J4IA 1NMVA 4DRIA 2F2DA 1SR0A 4G28B 2P4KA 4R50A 2DG4A 5LGTA 1CEZA 1XHXA 1BL4A 1HKJA 1CXZB 1WAZA 5JJEB 4DV3B 3CRAA 1QLNA 2Q0AA 4DRNA 1YHQV 3G80A 3WFVA 3K5LA 4NKGB 3HKEB 3K59A 3PRBA 1ZL1A 2NN4A 4B3RB 4O4IB 3VAWA 1D5NA 1XUQA 1ZAUA 1SETA 2WLKA 5GPRA 3K9AA 3OAAG 3O5EA 3CJHA 3X2QC 3APOA 3L71H 4R7CA 2BSKB 1MSWD 2XOKG 2A79B 1NT2B 4MSWC 5EBMC 5BXZA 2P6JA 5DITA 1OCCB 2QR4A 2XP5A 1IBKO 1OCOB 2JEUA 2PZSA 4MW3A 1AI4A 3TK1A 2RJZA 1XI1A 2DT1A 2DYSC 2DQ0A 3O5KA 2M6YA 4HBEA 3CC4V 4PDVA 3CC2V 2FDMA 2QM4A 4TV9A 4ABMA 3P30A 3N27A 2JJ1G 1N4CA 4W4LA 5D5PA 5IJ0A 4ZPVR 4MTOA 1WPXA 3NR7A 4O2TA 4DWSA 3ARSA 1U97A 4LGXA 1NJIW 3ZJZA 5LOVA 4DR7O 5KHGA 2E75B 2ZQSA 2GDSA 3JATA 1GKFA 4RQEA 3GVMA 3PRAA 3HKCA 1H8HG 3A0HZ 2YXHA 1FKSA 2JS5A 1H0GA 3SJQC 4QE9A 3P3PA 3C3SA 4TW8A 2IJHA 2Y0PA 4P2ZA 2H94A 3K58A 3OUFA 4XBFA 4JFMA 5FNVA 3OEEG 1YI2V 4PDMA 1YTFD 1E1QG 2UXNA 2KSDA 4MVMA 3EXAA 3QNEA 4D7TA 4P8VA 1LL7A 3CRQA 2AZ0A 4P8XA 1Q5OA 2ATKC 3H1LH 4B3MO 1QVGU 2ITKA 4DRHA 5HW7A 1R1BA 2BCCH 2JDIG 2WLHA 2RNBA 1U79A 2XPAA 4JTAB 2Q9LA 1FFRA 1JA8A 2WLZA 2QJ1A 4MT8A 2LKNA 1RSOA 4QIBA 3ARUA 4HYOA 5CB4A 3K04A 3IHZA 1BE3H 5L3DA 2UXCO 2A3AA 2ZXWC 2PTMA 3JAWB 4W9OA 4DUYB 2O57A 1DF5A 4JYYA 1WN7A 3GB7C 4OPHA 3I55V 3OUSA 3IK8A 1DK1A 1P5QA 3TETA 4N21A 5FPRA 3JD2A 5HWCA 3FAVA 5EC1C 1C9HA 5EYPA 1ROTA 1GM9A 4DYLA 1ITXA 4GLXA 4MGVA 5EK0A 2ZQVA 2HHHO 3LNMB 2Q7GA 3OOBA 1OV9A 4DRPA 2IBZH 4W9PA 1OWQA 5EBLC 5IY5C 2CK3G 2ZD9A 3UKMA 2M08A 4FLZA 2DN9A 5CA0A 4DZ3A 4AHCA 2ZQUA 4JF3A 4NZCA 2LPVA 4AQYO 4JI5O 4G2PA 3L9DA 1G4YB 1BSMA 3ZHSA 4JYCA 3N2GA 1QCEA 1NQTA 5JH7A 3JAKA 5CBFA 1SA0A 2CGNA 2DQ3A 4TT3G 1N34B 3UI6A 4BW5A 4P9PA 3FB6C 2QA4V 1I94B 1FXKA 3O5GA 3AG4C 3AK1A 3OM3B 1YZBA 1L0NH 2VQFB 3UQBA 1YITV 2QM7A 2UUBO 1R3IC 2WPDG 4WK9A 1M1KW 2ZXWB 4X66O 5LA6A 1LG1A 2A9HA 4O4LB 2KO7A 4I55B 5C8YB 1LJYA 3Q4HB 4JV5O 1MOFA 2Q4PA 4MNJA 4IIJA 1ZLZA 4LFBO 4F6RA 5IY5B 3RBZA 2UUCO 1R3LC 3QTCA 4ZBMA 5KX5A 1H38A 1UR8A 1Q6IA 1US6A 3SYQA 1HNWO 3CWBH 2WLLB 1WA8A 4R8CA 4Z2LA 4LAXA 3ASNC 3RYHB 1ZTEA 3ARVA 2XASA 3BFRA 5L3GA 1TGOA 1X6NA 4QZVB 2AHZA 4JI7O 1FKDA 3PJSK 1B06A 3AG4B 2JS3A 1NVPB 5L3BA 2PF4E 1RD6A 2YIDA 3CD6V 4LF5B 1Q1CA 2RUCA 1FJDA 3OEHG 4JI2O 4JI3O 4DV0B 4Z2WA 2YBUA 3ZRXA 2PI5A 2A7WA 4JPRA 1XNRO 3ODKA 3N2KA 4TQFA 1QBZA 5C93A 4LNUB 5HFLA 3RM4A 4X62B 4GUNA 1PNLA 5L3EA 4DZ2A 3MDYB 1GN3A 1O9GA 1HKMA 5DIUA 2HJFC 4KR0B 2VWKA 1NZ6A 1Q3EA 1YVWA 2K1EA 2WLNA 1AI6A 1G8MA 3STLC 2YS8A 1PV0A 3UT5B 3EY6A 5BMVA 1I5XA 4U84A 3OTOO 5ITZB 2YEVB 2Y48A 1NS1A 4DRMA 4NVPA 1EYMA 4DR4B 4B7EA 3THOA 1W2BU 4JFKA 1FKJA 3ASNB 1LUWA 2QWOB 2HVKC 1FKIA 2MK3A 1UFIA 5KA6A 3F7YC 1FKLA 1QU7A 4TV8B 5IWAB 2H3OA 3HKEA 1NTMH 3ZMUA 3G6MA 1OCRC 3JALA 3W7WA 3TJTA 1GN2A 4O4IA 3G71V 4FLWA 2O92A 2FYUH 1AR5A 4BR6A 1Q82W 2E5LB 2FB5A 2BSKA 2P67A 3J7AU 4RWUA 2JJ2G 3ABMC 4B3TB 1CPYA 1YJWV 2LW1A 2OTLV 2ZE8A 2ZR4A 1VF6C 4N23A 2W6IG 2BTOA 4DR1B 5IJ0B 4WFGA 4B3SB 4ASUG 2NR5A 5HW6A 3ALGA 1IXMA 4DWSB 4IYIA 2ZE7A 3CMEV 1LL4A 2QWRB 4X1KB 1HWYA 4JYAO 5KUMA 3CCUV 3O5IA 4Z1VA 4U7NA 3RT3C 3O5JA 3JAMN 5GPGA 4FLTA 4J80A 4CC5A 4D6TH 3BVOA 2DSVA 4CS4A 3E83A 2P06A 2PBCA 5GTIZ 1XEQA 1ENVA 2MW2B 3ZHVA 3E8FA 3T1HO 2Z5UA 1Q7YW 4ODOA 4TNSA 1W1PA 5FNVB 3K06A 1HDJA 3H1HH 4JTDB 3B77A 1AI7A 4MNKA 5D75A 3C3TA 3CCRV 4IHJB 2RUDA 4XDKA 4LFAB 1OHHG 3DGEA 3ABMB 1P7GA 3CP1A 4DV5O 3CGNA 1TA8A 1NI8A 1OZ0A 1KKCA 4LFCO 4MVRA 4AILC 2LP7A 4DK1A 1ZCNA 1TCOC 1IX5A 4FPPA 4R0XA 2ZQTA 1MABG 2Q68A 3WD1A 2HG5C 3FX7A 1YIJV 1E44A 5CB4B 3ETQA 1NWRA 2HR3A 2QWNB 3OTFA 4IL6Z 1M5IA 1JJ2U 2WA3A 4X65B 1ZB5A 3EIPA 3BA8A 2K8IA 4P30A 3AQUA 2DW4A 1PNMA 5KLVH 5K1XA 3MHSC 4FAPA 3FAVB 4FLUA 5EYPB 4FLVA 5LHGA 2W0XA 1D2DA 5LMUB 1WNSA 4X89A 2CH7B 4KUMA 1LR1A 4DR5O 3KCEA 3ARRA 4DW0A 3SPCA 1X59A 4QGPA 1GH6A 5CN0A 1D2KA 4I9WA 4QE7A 3VOUA 2RSEA 1F23A 1KQSU 1WB0A 4L72B 1TUEB 3ETDA 4NR1A 1PP9H 5JH7B 1SA0B 1YSCA 1D7IA 1KP2A 2JGDB 4CS2A 3ABLB 4DV6B 1QPFA 4PA3A 1FXKB 5HUAA 4FFBB 4U3FH 4XDLA 2GSMB 1EN5A 3H9RB 2VQEO 5JWPA 5HFMA 3S3WA 1AP5A 3JYJA 3TXQA 1GTOA 4DR2B 1HJVA 4BWAA 2F1MA 3B8MA 3R66A 4JI4B 2X6AA 4CH3A 4JZGA 3SYPA 3VQVA 2RDCA 4X9QA 3KADA 4PTMA 1S3JA 3O5MA 3ZEDA 2JEXA 2DG3A 1RPOA 5BXJA 2YXYA 1XBLA 3SDLA 4IYHA 3K9SA 1NR1A 4WIWA 2D9FA 2D2CB 5IYZB 4UV9A 2ITCC 3IJ4A 3ARTA 4IIJB 4E2LA 1Y6XA 4O4LA 2AWGA 1VARA 4WFFA 1V55C 3UO3A 2X7RB 2QM8A 1S5LZ 2QTSA 3B9AA 4I55A 3SPJA 3FB8C 1JNSA 2QWQB 3Q4HA 4DV2O 3ABUA 3RFRA 5HTGA 1FKRA 1VEWA 3CCLV 3WD2A 1SERA 1FAFA 2Y69C 1IX9A 2W6JG 3JYMA 2DMXA 4GX2A 1ROUA 1JVWA 1O9HA 4GKJO 2MLYA 4G27B 1JNDA 3QO7A 2ARHA 4DR6B 3K5NA 2Q8VA 1V54C 1TAEA 1VP7A 3JSNA 3J81N 2KE0A 2DSWA 4LF7B 1THZA 5GW7A 2Q5AA 4J10A 3WQVA 4ZS6A 2DT2A 4MNMA 3W4RA 1PPJH 3OMIB 3M7MX 2DWDC 3BMBA 3FB7C 3RYHA 1YF2A 1PNKA 1AJPA 5EC2C 2P5OA 3CGMA 1ZBKA 4K3AA 1J95A 2YSUB 1MNGA 3N2KB 1BQZA 2XUMA 1FXHA 4LF6O 4H44B 2P4VA 1H2SB 5FLXN 1M57C 4GYCB 3RYIA 3O5RA 1VQ8V 5DIVA 4DO2A 4TX0A 2XNDG 1XNQB 1PD3A 4NNRA 4JGSA 4CC6A 3FFQA 3T1YB 1V55B 5CA3A 2PYJA 3PA7A 5LGNA 3CC7V 2F93B 2B31A 4JI6O 5KAFZ 1YXBA 2RQSA 1K3EA 1IBKB 3OT7A 3D3QA 5B1OA 1PL4A 1Y76B 1IURA 4JYBA 1GM7A 5CBHA 1RM1B 2L35A 3UT5A 2R9AA 2YXLA 2UU9O 2CE4A 1V54B 4K8XA 4AY1A 5ITZA 2YEVA 1JFFA 1M56C 3TCZA 2IU3A 1MG1A 3LDCA 5IYDO 1IDSA 1FKBA 4DV4O 2CUGA 3WKZA 1OGBA 1AROP 4DT4A 2PYLA 4ODKA 1ZK6A 3JALB 4TV8A 4YJ3B 4DR7B 1AB3A 4NXMO 1H2NA 2X6CA 1M57B 4UDMA 3QOKA 5J2UA 4JASA 2HP8A 4GT1A 1D7HA 2HFEC 3DXRA 4J4OA 4MAVA 4TUYB 3R65A 3WB2A 2Y0IA 2ZM6O 4J7JA 2ESCA 3ZN0A 3L72H 4WFEA 1JMKC 1DTOA 5TISZ 1ZUQA 2JVDA 4FJCC 1Q86W 4PA9A 1H2MA 4MSPA 2DG9A 4HBNA 2KFWA 4G2KA 3ZS8C 1M56B 2IJJA 4BAYA 5LHIA 4X1KA 3RYCB 3A0BZ 3FYEB 3E2EA 1S77D 3WH0A 3WIJA 1Z2GA 1EN4A 4GKKB 3B9DA 3SR2C 2UUAO 3CRMA 4KP4A 3B7XA 2EZOA 2HJDA 4JAVA 2KR7A 2F21A 2UXCB 1UR9A 1ZWIC 3SJAC 1OCZC 1NU1H 4LC1A 1Q6UA 5B1NA 4B08A 2DT3A 3X2QB 1HR0B 4Z2GA 4B3RO 1FKTA 4LF9B 4DUZB 3ZHQA 1M9NA 4ML4A 4GX0A 1NH2B 4K8ZA 1W9PA 3SYAA 2LFRA 4CZZA 1R73A 3HKBB 1K73W 5LYJB 2E76B 3LDEA 3FXYA 4IHJA 4DWSD 4D7SA 1X6LA 1M5YA 2DYSB 4J42A 2KKWA 1P7BA 3RYFB 3IC7A 3WD3A 5LMNB 1BMFG 1VF6A 1XDCA 2XT9A 1BL8A 2PV1A 4FVMA 2ZR2A 2JZVA 4JI5B 4BW9A 1K4CC 4Z2KA 2WLIA 1V9PA 4X1YB 1SQQH 3SPHA 3HR0A 5A9GA 2GV9A 3B40A 5EIBD 3BABA 2R9RB 1TFVA 4HNAB 4LWSB 1SRYA 3QG5A 3BXWA 3CXCU 3HKDB 4P8UA 4EFBA 1VIBA 5B5EZ 4PD4F 1A7XA 5KHHA 2DSUA 4I4TA 4EB6A 4Z2IA 2QDOA 2VCDA 3CS5A 1LUVA 4X66B 3SGIA 2CH7A 3ARWA 1OCZB 3E22B 5DECA 5IJ9B 2P22C 3SYOA 1E15A 2B1GA 3UM7A 2P7TC 1ZU8A 3CHCA 4RUFA 2QE7G 4LFBB 1TVKA 3CCQV 3TXSA 4FN2A 3WL1A 3JCZA 4QIWF 2UUCB 1JVMA 4MTGA 4RAIA 2JGDA 5J9PC 3K57A 1SQBH 1XL6A 4MTXA 4FFBA 3RVZA 1K4DC 1F51A 1XREA 2YUAA 4I5SA 1YJ9V 4ZPWR 3OE7G 1HNWB 2RURA 2GHYA 2AGAA 2XAQA 2JIZG 4J7ZA 3GTYX 4OX9O 4JI7B 1VF8A 4LBEC 2CTWA 1SC5B 2Y4TA 4OGQB 1XHGA 2OCHA 4FFKA 4Q7NA 3LSUA 4JI2B 1QZ2A 2YC0A 2Q7HA 3WB0A 5E79Z 4BIZA 4DUYO 4FLXA 1XNRB 1XMQO 1JPXA 2NNUA 5IYZA 1Z5WA 5JJJB 1HP8A 1K8AW 4W9QA 4JI0O 4K0KB 4J11A 4LAWA 3APQA 4BIOA 1FJGB 2EX3A 4MVZA 5DN6G 5JCOC 2EJRA 1R9HA 1G1XB 3ASOC 1YW5A 2PV2A 4QNHB 2IF4A 5B8IC 4JFJA 2LJ4A 4PA6A 2G38A 2KQXA 3H01A 1LG2A 1TUBA 1N32O 3I5DA 4JYSA 4LF4B 1ZBVA 1FFXB 2LGQA 3KAHA 1Y74B 1N34O 1VQ6V 2ZNIA 3IKDA 1HNXO 4FM0A 3ARZA 3RYIB 1Y66A 2ZR5A 3ARXA 3RFWA 3FB5C 3OGIB 1WLEA 1BHAA 2UXBB 1BT8A 2DT0A 4I0XA 4URIA 3VQXA 1S5JA 2OIGA 4N19A 1YJNV 1PM9A 1NBMG 1OJHA 4RUEA 4H0LB 1DF4A 4X64B 2ZE6A 1R6TA 1VQ9V 3BCCH 4HAMA 4J9ZB 4TOIA 1SQXH 4H33A 2B9ZA 1MSDA 3CHEA 4LAVA 5EBWC 1VQ5V 1SYTA 2Q73A 3W7TA 1SESA 3ASOB 3AK2A 2F4VO 4ODPA 1J6YA 1MZFA 4JI1O 1GO3F 1JFFB 1BQ0A 1Y76A 3EFFK 4WJXA 3CH9A 1R3KC 1ZL8B 1NH6A 2DPEA 2VRZA 5GONB 2XAJA 4W5UA 2XP9A 3BEHA 2OTJV 3KCXA 2BTQA 1O6IA 3LSQA 4BIUA 1EHNA 3SPGA 5GQBA 4LF8O 1BKFA 5J2UB 3JXVA 5BR8O 3SPIA 2ZCEA 4YHHO 3RGCA 1GUVA 3G6LA 4DV7B 1K34A 4OXSA 4YJ3A 3DXRB 4YY3B 1Y4MA 1WB8A 3LDDA 4DXWA 4L8JA 1E79G 1DLBA 3T1HB 1J5EB 4X62O 1LL6A 2ZE5A 3ABTA 4TUYA 4ZHQA 1N36O 2PPOA 4DRJA 3ZHRA 2HVJC 2CTPA 2LGWA 1GAXA 5B1AC 3JD3A 4DV5B 5H9CA 2EULA 3AS2A 3AS3A 2AZ2A 2IH1C 4LH6A 1PL0A 1F7YA 3ARYA 2HEPA 3BPZA 1BHBA 2WK2A 1GK9A 4GZRB 4WFAV 1BZKA 2PPPA 1JCHB 5HKGA 4DR4O 1YTFB 2WLMA 3B4SA 3RYCA 2MPHA 4LAYA 1M90W 2ZNJA 1KP3A 4PV1B 4NXNB 3L75H 1LQ0A 3WQWA 1SZXA 4UXNA 3GPKA 4DRXA 5HWBA 1OCRB 1XMOO 1EZJA 1FKFA 2RUQA 1AR1B 4ZPTR 1VQOV 5JQGB 4DR5B 3MD0A 1YATA 1Y0OA 3FKSG 5JVDB 3KCYA 5HT1A 2RQ6A 1JOYA 5JH8A 1B6CA 3HKBA 1QPLA 4J41A 3PRDA 4GIVA 5LYJA 1YEWA 2JGUA 4B3TO 2QGNA 4MTVA 2MLXA 2WLIB 2WLYA 5B1AB 3RYFA 2WM0A 2FAPA 2Z3YA 3C90A 4HZ3A 1WAWA 5LL6Y 1IXBA 3H9VA 2UZ5A 5L3FA 1YDXA 3VQWA 4X1YA 1EDQA 4UVBA 2MF9A 3RVYA 1XL4A 3H1JH 3F5WC 3K3WA 4I4TB 4EB6B 2VWJA 4DR3O 2MLZA 4HNAA 4LWSA 2YIBD 2PPNA 5L3CA 4LP8A 4MW8A 3HKDA 3IKGA 3SJBC 1FKAO 3O5QA 2LJ2A 4JFLA 1EFRG 1GN6A 2IW5A 1WP7A 2YDEA 3G6BA 3WG7C 4NTWA 4KL1A 4ODNA 2EINC 4JAAA 4FM2A 2CDYA 1JNTA 3J80N 2ZINA 1KB9F 2GUZB 2LW7A 1W26A 2XP6A 3DC5A 3E22A 2L2SA 3UCSC 5IJ9A 1TVKB 3F5TA 2ZDIC 5EZYB 4TW7A 1VQ4V 5LP6C 4YXWG 4DV2B 4DRKA 3O5PA 3QVNA 4U85A 1COWG 4LFAO 5J6EA 1FS0G 1FYJA 4GKJB 1RP3B 3E8BA 1XHZA 2GTSA 4TQDA 1FAPA 3JASA 3W7UA 3AG1C 1N8RW 1SZTA 2EIMC 3VBBA 3K5OA 2UXDB 4DROA 1ZSPA 2Q5ZA 1UJWB 4C02B 1I7FA 3K79A 4O4HB 2D3OW 2K9PA 5B66Z 4JAUA 2R72A 4X65O 1N33B 2N87A 1WP8A 1F4MA 1HNZB 3LUTB 4LF6B 1KMIZ 1K9MW 3WG7B 2XPBA 4FIPC 2EINB 2WWWA 4FK5C 4UB6Z 4KHPO 1IBMO 3SYCA 4ZI7B 5LMUO 4W4KA 4O2AA 5FL7G 3MAQA 4JI8O 2DSZA 1Q90D 1KUQA 3ZN1A 5H6RA 3ABKC 3M99B 4Q20A 3CMAV 1S5HC 4PI0A 2FL4A 4HBOA 5LP6B 1TUBB 4WFHA 2HLDG 4QT3A 4OPAA 3H1KH 3O65A 2CGOA 3STZC 4O4JB 3AG2C 1IBLO 1HKIA 4U7OA 2UU9B 2YI8A 1FFXA 2W0FC 4DRQA 1FXVA 1P4RA 2FKXA 2YICA 4DW1A 1PINA 3UF8A 2EIMB 2HKOA 4GX1A 4UV8A 1Y74A 4AI8A 3ZHTA 4O2BA 4ODMA 5LBQA 3MDSA 3P32A 4I0XB 4U3JB 4DV4B 1SKVA 4JTCB 3RW0A 5J2TB 4CS3A 3AEIA 3WD0A 1QNMA 3UQ8A 2QKSA 4P9OA 4NXMB 4MVOA 1JJOA 1SQGA 3M8AA 5KHKA 5H5NA 1VQLV 4Z2JA 5KHIA 3CZ8A 3ABKB 1JNEA 2Y69B 1M4UA 1E6ZA 4DV1O 4UCTA 1NTKH 4F4LA 3JD0A 3D36C 4CH5A 2ZM6B 5JCOA 3DTUB 1OCCC 1H2GA 1NVPD 2Q67A 3CSXA 2DWEC 1ZL8A 4CH6A 4DR6O 2BTQB 1N0NA 1ZBCA 3AG2B 4C7UA 4ODRA 1EIBA 5GONA 2OYQA 1CTNA 5JJNB 1D5AA 1W9UA 5BZBA 1BS3A 1E1RG 3U10A 1FKKA 3A2FA 1FPOA 3ZIAG 1KC8W 1S72V 1XOUA 1RFYA 5A2QN 2UUAB 3BHPA 2A3QA 4PHZA 4MS2A 3CCEV 4NYKA 2UXXA 2Q7EA 4R6ZA 3TGUH 5KA5A 1GMGA 4ZHQB 4FZ1A 3AG3C 4S3JA 3ZRVA 1DGSA 1XNQO 1D7JA 3KG2A 3ZBHA 3BAAA 3T1YO 4FLYA 1MMMA 3UI5A 1I08A 5HW8A 2N04A 2XP7A 3A8TA 3KZIZ 2KI3A 4ODQA 1KD1W 4X20B 1ZX3A 4B3MB 2OIEA 3OW2U 3CRCA 1AR4A 1K33A 5E1AC 1EM1A 3RN4A 4KXRA 4JFIA 1FFTB 1W0KG 4I50B 2N74A 2EIJC 4WF9V 4EEQA 1XQ8A 3CHXA 4DV3O 3OA5A 4DRXB 1JCHA 4WKAA 4ODLA 3E89A 3T4ZA 3RM8A 3PR9A 4J9YB 2WLJA 1GOIA 3ZHUA 4I7ZB 1L0LH 1Q6HA 3CE2A 2KG7B 3FD9A 2WSSG 1K5SA 3OR6C 3WU2Z 3JD1A 2ZR6A 2WAMA 4B7KA 4IQCA 4S3KA 1T11A 2IH3C 4X1IB 4QPKA 4UFZA 1VQKV 2HHHB 3D3IA 3AG3B 4Q22A 3E86A 5JQGA 3FAPA 1P49A 2ZT9B 5JVDA 4XDJA 2EILC 3SJCC 3QO5A 4UCOA 3GWKC 3NTPA 2H8PC 3LUOA 2IM9A 3DSQA 4AQYB 3E8GA 4YJ2B 2OT5A 5IT9N 1NKDA 1NMWA 2Z0AA 2A0LA 1Q81W 5DO2A 2F95B 1AILA 2O9OA 3O5FA 2EIJB 1S76D 3KABA 3KAIA 3EHBB 4PA4A 2UUBB 5LXTB 1M93A 4OX9B 2IU0A 4IQ2A 2ADPA 1HJXA 2PI4A 1PKXA 4GKKO 1H0IA 4PDRA 4WKHA 2EIKC 3ZMVA 1VQMV 4TSFG 3GU0A 4ZOLB 2OFNA 1H2LA 3D8CA 2JK5C 5CA1B 2XAFA 2GUZA 2KGJA 4JV5B 1ROPA 1XMQB 3CCVV 2XP4A 1HR0O 1QR9A 2GBOA 4G50A 4LF9O 4DUZO 4JI0B 3ML0A 2A3CA 2AHYA 2X0LA 3AG7A 1SQPH 3B8SA 5EZYA 1QHTA 1KBHA 2EILB 3TDBA 1F40A 4E4EA 4MTFA 1NSGA 3JASB 2EJ7A 4UB8Z 3G6EV 3ZRSA 2ETNA 5LMNO 1L8DA 3JARB 2BOBC 5IE9A 1N32B 3CXHF 2X6BA 1NR7A 4QPJA 1LNQA 4O4HA 1K97A 2XP8A 1HNXB 3L73H 3O5LA 4JI3B 3O5OA 2RN9A 2EIKB 4O2AB 2N05A 4TYOA 1K5QA 5KUKA 2IJIA 2ZQMA 1H8EG 1VQNV 4ZI7A 3BRCA 2JRIA 2XHBA 1W9VA 4CBCA 3ICXA 3KAFA 2ITDC 5DF0A 3OMAB 2DJVA 3L70H 3CB2A 5KMGB 2YBTA 2ZDIA 3IAYA 3B2EE 2PY5A 4GX5A 5DEDA 1AVMA 5LP6A 3JYCA 1E6NA 4UCVA 3OTOB 5F2VO 3UQAA 2F4VB 2Q69A 4JI1B 1W0JG 3KKYA 4DH0A 3NXSA 3O9OA 4UCUA 4O4JA 4O2BB 3NI6A 2RCVA 1QVFU 4X8AA 1L1FA 1I94O 2F4EA 3WD4A 4WKFA 4MVUA 2VQFO 3NRKA 2M1IA 2VN1A 2F23A 2PGGA 3ETEA 4U3JA 4IT5A 4LF8B 2IJKA 5J2TA 4IGGA 1B3QA 3K5MA 3CCMV 4FMTA 2B1IA 5BR8B 4YHHB 3I56V 4ZIBA 2PI6A 3ZMTA 3IC9A 1J4RA 1B6QA 1WPBA 2EBOA 2ZR3A 3T2MA 3P3NA 3RGBA 3AK3A 3ZMZA 4Q6GA 1F8AB 2QTOA 3LNNA 1HKKA 4FM1A 2Y78A 2B5UA 4UVAA 4WFBV 1W1VA 1P84F 1W59A 4K0KO 1HJWA 1URFA 2LO1A 3IGAC 3VQYA 1JX9A 1FJGO 1N36B 3F7VC 2R70A 1KFWA 4U86A 1I0HA 3CX5F 4CH4A 4WBNB 3UO2A 3T4DA 1R6NA 2C2AA 2AXTZ 3LSSA 3ZRWA 2F66C 4MPKA 3G67A 4I9QA 4ITZA 1UPGA 4NSBA 2ODMA 5H2FZ 4JYAB 2LQTA 4Z1MG 1VQ7V 2AW9A 3OGCC 5AG2A 3UI4A 4LF4O 4R5EA 4DWSC 5LHHA 2G8ZA 3B9EA 1PBKA 5FPOA 1G6UA 3GWOA 4LF5O 1OGGA 2OLHA 1SQVH 1SQFA 3WB1A 4H13B 4L3NA 4MVSA 4DV0O 2LGOA 5B3SC 1R6KA 2PUSA 5KAIZ 1XMOB 2UXBO 1ZBWA 2QKCA 3G4SV 3AS1A 5EIBC 4EKWA 3CJHB 3ARPA 5DEZA 4J7KA 5I98A 5KHJA 4X64O 3QO8A 3O5DA 3ALFA 2VS0A 4RQFA 3DC6A 2OWOA 3ARQA 4PA7A 2OCCC 1KECA 3D36A 2V1DA 4LFCB 4YIPA 2CAZC 1BCCH 1KT0A 4X20A 5DM6V 4TV9B 4BF8A 4LH7A 1KKDA 3IFXA 3OMNB 1EBOA 4I50A 3ZCCA 1KT1A 4TWKA 4DK0A 1IVSA
chains in the Genus database with same CATH topology
4MNJA 2G41A 3WH0A 3WIJA 3B9DA 4HBOA 1FKGA 1FFQA 3B7XA 2KR7A 2F21A 3RMEA 4QT3A 3TC5A 1D6OA 1UR8A 1UR9A 1Q6IA 1Q6UA 1HKIA 2DT3A 4Z2GA 1FKTA 1E6PA 4DRQA 4Z2LA 4LAXA 4ML4A 3RM9A 1NWSA 1PINA 3ARVA 3UF8A 1W9PA 1X6NA 4QZVB 1FKDA 4ODMA 1E9LA 1RD6A 3FXYA 4DWSD 1X6LA 1M5YA 1E6RA 1Q1CA 2RUCA 1FJDA 3I6CA 3KAGA 3WD3A 3WD0A 2YBUA 1K9TA 4HARA 2AOSA 2PV1A 3ODKA 2JZVA 2A3BA 2M2AA 3RM4A 4Z2KA 4IPXA 4Z2JA 3CZ8A 4DZ2A 3MDYB 1FKHA 1JNEA 1HKMA 1E6ZA 1TFVA 5DIUA 3BXWA 4KR0B 4P8UA 1A7XA 4MNLA 2FKEA 3B09A 2IUZA 2DSUA 4Z2IA 3EY6A 2VCDA 4U84A 4P8WA 3CHFA 3ARWA 4DRMA 1ZBCA 1EYMA 4ODRA 1EIBA 4IT6A 3UQIA 1E15A 1CTNA 4JFKA 1FKJA 1W9UA 3KZ7A 1ZU8A 3CHCA 1FKIA 1FKKA 4XAKA 2A3EA 1FKLA 4FN2A 3WL1A 1NWUA 4J4NA 1XRVA 4Z2HA 3G6MA 1GPFA 1HXVA 2O92A 4S3JA 1EQ3A 4ZPWR 2RURA 1D7JA 2MNTA 3UI5A 1VF8A 5HW8A 2XP7A 2ZR4A 4ODQA 2KI3A 1XHGA 4Q7NA 1QZ2A 5HW6A 3ALGA 4DWSB 3AROA 4JFIA 1LL4A 3FY1A 4W9QA 4LAWA 3O5IA 3OA5A 4WKAA 4ODLA 1R9HA 3O5JA 3RM8A 3PR9A 1GOIA 1YW5A 2PV2A 3CHDA 2XP3A 5GPGA 5HBFA 4IT4A 2IF4A 1Q6HA 5B8IC 2DSVA 4JFJA 1W1YA 2PBCA 2LJ4A 1LG2A 2ZR6A 4IQCA 4S3KA 1T11A 4JYSA 1FD9A 1ZBVA 4ODOA 4TNSA 1W1PA 2PV3A 4Q22A 3KAHA 3FAPA 4TW6A 4MNKA 1WNOA 5D75A 3KACA 3IKDA 2RUDA 3ARZA 2ZR5A 3ARXA 3NTPA 3RFWA 3CGNA 3LUOA 2DT0A 4URIA 4N19A 4GGQA 1W1TA 1ZCNA 1TCOC 1IX5A 1NMWA 4R0XA 2ZQTA 5DO2A 1L1PA 3WD1A 3WL0A 2O9OA 3O5FA 1NWRA 4DIPA 1N1AA 4QT2A 3KABA 3KAIA 3CHEA 1ZB5A 2QF8A 4LAVA 4IQ2A 4KQZA 1HJXA 1SYTA 1H0IA 2K8IA 4WKHA 3AQUA 4ODPA 1J6YA 3AS0A 1J4HA 4FAPA 2OFNA 4WJXA 1NWTA 3CH9A 1NH6A 1J4IA 2DPEA 1NMVA 4DRIA 2F2DA 1SR0A 3KCEA 2DG4A 3ARRA 2KGJA 2XP4A 4W5UA 2XP9A 1D2KA 4G50A 1BL4A 1HKJA 2A3CA 1O6IA 2RSEA 3B8SA 1EHNA 1WB0A 4L72B 5GQBA 3TDBA 4DRNA 1F40A 1NSGA 1BKFA 3JXVA 3RGCA 1D7IA 1GUVA 3G6LA 3PRBA 1ZL1A 1QPFA 3VAWA 5HUAA 5GPRA 3H9RB 3O5EA 1LL6A 3JYJA 1HJVA 2PPOA 5DITA 2XP5A 4DRJA 2XP8A 3KADA 4PTMA 3O5MA 3O5LA 3O5OA 2DG3A 2DT1A 5BXJA 3AS2A 3O5KA 3AS3A 4HBEA 4TYOA 4WIWA 2D9FA 2FDMA 3ARYA 3ARTA 2AWGA 2WK2A 4ZPVR 3B9AA 1W9VA 2PPPA 5HKGA 3KAFA 4O2TA 2MPHA 4LAYA 5DF0A 4DWSA 1JNSA 3ARSA 4LGXA 5HTGA 1FKRA 2YBTA 3WD2A 3JYMA 1LQ0A 1ROUA 3WQWA 1E6NA 1JVWA 3GPKA 2MLYA 2ZQSA 5HWBA 1JNDA 3UQAA 1FKFA 3PRAA 1FKSA 4DH0A 2RUQA 2KE0A 2DSWA 4ZPTR 2Q5AA 1H0GA 3NI6A 3WQVA 4ZS6A 2DT2A 4MNMA 3W4RA 1YATA 1Y0OA 2F4EA 4TW8A 3WD4A 4WKFA 3NRKA 2M1IA 3CGMA 5HT1A 5JH8A 2VN1A 1ZBKA 1B6CA 4JFMA 1QPLA 3PRDA 4GIVA 4MTVA 2MLXA 2WLYA 4P8VA 1LL7A 2WM0A 4P8XA 2FAPA 2PI6A 1WAWA 1J4RA 3O5RA 2ITKA 4DRHA 5HW7A 2UZ5A 5DIVA 4TX0A 1U79A 2XPAA 1F8AB 4NNRA 1HKKA 2Y78A 1EDQA 1FFRA 2MF9A 3PA7A 1W1VA 2WLZA 1HJWA 2B31A 2MLZA 2LKNA 4QIBA 3ARUA 2PPNA 3IHZA 4U86A 1KFWA 2RQSA 3IKGA 3O5QA 4JFLA 2A3AA 4W9OA 4ODNA 4MPKA 1JNTA 4NSBA 4ITZA 3IK8A 1P5QA 4AY1A 1W26A 2XP6A 3UI4A 4R5EA 4DWSC 3TCZA 5HWCA 2G8ZA 2L2SA 1C9HA 1ROTA 1ITXA 3B9EA 1PBKA 4MGVA 2ZQVA 1FKBA 3OOBA 4TW7A 3WKZA 1OGBA 4DRKA 1OGGA 2OLHA 4DRPA 4W9PA 1OWQA 3O5PA 4DT4A 4ODKA 1ZK6A 4L3NA 2M08A 4U85A 5J6EA 4DZ3A 2LGOA 2ZQUA 4NZCA 2LPVA 4G2PA 1ZBWA 3AS1A 1FAPA 3QOKA 1D7HA 3ARPA 5DEZA 3UI6A 4J4OA 5I98A 4MAVA 4DROA 3O5GA 3O5DA 4C02B 3ALFA 2ESCA 3UQBA 3ARQA 4WK9A 2N87A 1KT0A 2XPBA 1LG1A 4BF8A 4MSPA 2DG9A 2KO7A 2KFWA 1KT1A 2DSZA 1LJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QPL A;  3PRD A;  4GIV A;  4FAP A;  1HXV A;  2OFN A;  3WH0 A;  1EQ3 A;  1J4I A;  1NMV A;  2MLX A;  4DRI A;  2RUR A;  2F2D A;  1D7J A;  1FKG A;  2MNT A;  2FAP A;  3KCE A;  2DG4 A;  2KGJ A;  1J4R A;  3B7X A;  3O5R A;  2XP4 A;  3UI5 A;  2ITK A;  4DRH A;  5HW7 A;  2UZ5 A;  2KR7 A;  2F21 A;  2XP9 A;  4QT3 A;  5DIV A;  4G50 A;  4TX0 A;  5HW8 A;  1BL4 A;  1U79 A;  2XPA A;  1F8A B;  3TC5 A;  2XP7 A;  4NNR A;  2ZR4 A;  4ODQ A;  2KI3 A;  1D6O A;  2RSE A;  2Y78 A;  1Q6I A;  2MF9 A;  3PA7 A;  3TDB A;  4DRN A;  1Q6U A;  1F40 A;  1FKT A;  1NSG A;  1QZ2 A;  4DRQ A;  1BKF A;  5HW6 A;  4LAX A;  3JXV A;  2MLZ A;  1PIN A;  2LKN A;  4JFI A;  4QIB A;  3RGC A;  3UF8 A;  1D7I A;  2PPN A;  3IHZ A;  4U86 A;  2RQS A;  1FKD A;  3IKG A;  3PRB A;  3O5Q A;  4JFL A;  1QPF A;  4ODM A;  4W9Q A;  3VAW A;  5HUA A;  4W9O A;  4LAW A;  4ODN A;  3O5I A;  1M5Y A;  1Q1C A;  2RUC A;  1JNT A;  3H9R B;  4ITZ A;  3O5E A;  1FJD A;  4ODL A;  1R9H A;  3I6C A;  3KAG A;  3O5J A;  3IK8 A;  3JYJ A;  1P5Q A;  1YW5 A;  1W26 A;  2PV2 A;  2XP3 A;  5GPG A;  2XP6 A;  2PV1 A;  3UI4 A;  5HWC A;  3ODK A;  3TCZ A;  2IF4 A;  2L2S A;  2JZV A;  1C9H A;  2PPO A;  1Q6H A;  5B8I C;  5DIT A;  2XP5 A;  1ROT A;  4JFJ A;  2M2A A;  4DRJ A;  2XP8 A;  2PBC A;  1PBK A;  4MGV A;  2LJ4 A;  2ZQV A;  3KAD A;  1FKB A;  2ZR6 A;  3O5M A;  3O5L A;  3O5O A;  3OOB A;  4IPX A;  4IQC A;  4TW7 A;  1T11 A;  2DG3 A;  4DRK A;  4JYS A;  4DRP A;  1FD9 A;  4W9P A;  3MDY B;  3O5P A;  4DT4 A;  4DZ2 A;  1FKH A;  4ODK A;  5BXJ A;  3O5K A;  1ZK6 A;  4ODO A;  4TNS A;  2M08 A;  4U85 A;  4TYO A;  5DIU A;  2D9F A;  4DZ3 A;  5J6E A;  2PV3 A;  2LGO A;  2ZQU A;  3KAH A;  3FAP A;  2LPV A;  2AWG A;  4G2P A;  4TW6 A;  5D75 A;  3KAC A;  1A7X A;  3IKD A;  2FKE A;  3B09 A;  2RUD A;  1FAP A;  2PPP A;  2ZR5 A;  3EY6 A;  3KAF A;  2VCD A;  4O2T A;  2MPH A;  3NTP A;  4LAY A;  5HKG A;  1JNS A;  3RFW A;  1D7H A;  4U84 A;  5HTG A;  3CGN A;  3LUO A;  3UI6 A;  1FKR A;  4J4O A;  5I98 A;  4DRO A;  3O5G A;  4ODP A;  4DRM A;  3JYM A;  3O5D A;  1EYM A;  1ROU A;  4C02 B;  4N19 A;  4GGQ A;  1JVW A;  4ODR A;  3UQI A;  3GPK A;  1ZCN A;  2MLY A;  1TCO C;  1FKJ A;  2ZQS A;  4JFK A;  5HWB A;  3KZ7 A;  1NMW A;  4R0X A;  3UQA A;  2ZQT A;  3UQB A;  1FKF A;  1FKI A;  1FKK A;  1L1P A;  1FKS A;  4DH0 A;  2RUQ A;  2N87 A;  3O5F A;  2KE0 A;  4DIP A;  1KT0 A;  1N1A A;  2Q5A A;  4QT2 A;  3KAB A;  1FKL A;  3KAI A;  3NI6 A;  2XPB A;  4FN2 A;  1YAT A;  4BF8 A;  4MSP A;  2DG9 A;  1Y0O A;  2F4E A;  4J4N A;  4LAV A;  4TW8 A;  2KO7 A;  2KFW A;  4IQ2 A;  2K8I A;  3NRK A;  1KT1 A;  2M1I A;  3CGM A;  5HT1 A;  2VN1 A;  1B6C A;  1J6Y A;  4JFM A;  1J4H A; 
#chains in the Genus database with same CATH topology
 3H1I H;  4NTX A;  5K1P A;  2G41 A;  1VQP V;  1FKG A;  1EN6 A;  3L74 H;  4DR3 B;  1FFQ A;  5LOV B;  5IWA O;  3JAT B;  1T5E A;  3RME A;  3W7X A;  3HKC B;  2V4D A;  2KG7 A;  5B3S B;  3TC5 A;  1VMG A;  2RMK B;  1D6O A;  1I5Y A;  1AP6 A;  4QJF B;  4DV7 O;  4UCS A;  4YY3 O;  2F43 G;  4JZ2 A;  1E6P A;  4X1I A;  2BE3 A;  2E5L O;  1NWS A;  3RM9 A;  2LFS A;  2XAG A;  1VF5 B;  1J5E O;  3CPW U;  1B04 A;  2XAH A;  4K35 A;  1E9L A;  1SS3 A;  5B1B C;  1YCI A;  4RO2 A;  3W7S A;  2YIB A;  1E6R A;  4DR1 O;  4GCZ A;  1BGY H;  3I6C A;  3ZMS A;  3KAG A;  1SF9 A;  2OCC B;  4ZKI A;  4B3S O;  2ADQ B;  1K9T A;  1H2K A;  5IYB O;  4HAR A;  2AOS A;  2A3B A;  4YJ2 A;  2VQE B;  2M2A A;  1K92 A;  1RPR A;  3ABL C;  1FXK C;  4IPX A;  3K08 A;  3U11 A;  1FKH A;  3OR7 C;  1JQ0 A;  1RSO B;  1WJZ A;  1IZ3 A;  1KU9 A;  1AI5 A;  5IDJ A;  1NH2 D;  3FYI B;  5LXT A;  3E35 A;  4MNL A;  3HB3 B;  2FKE A;  3B09 A;  4NXN O;  2IUZ A;  1N0J A;  3BA9 A;  5CBG A;  1ORQ C;  4ZOL A;  5CMU A;  3TCU A;  4P8W A;  2M7W A;  3JCU Z;  1VF7 A;  3CHF A;  2A06 H;  3S3X A;  1Q43 A;  4FZ0 A;  3JAW A;  4UUJ C;  3RWR D;  4A5U B;  1CP9 A;  5CA1 A;  4KHP B;  1QLE C;  1QQC A;  4KFM A;  2DYR C;  1IBM B;  4IT6 A;  3UQI A;  4EFE A;  2R9I A;  3KZ7 A;  4JI8 B;  1X4T A;  1GN4 A;  3CEI A;  4X88 A;  1K7D A;  4XAK A;  2Q6A A;  2V7Q G;  2A3E A;  4UVC A;  4LCU C;  5B1B B;  5CA0 B;  1MA1 A;  3EVK A;  1NWU A;  4YIO A;  5GTH Z;  4UCR A;  4J4N A;  3K03 A;  3HPL C;  1XRV A;  4Z2H A;  3N2G B;  2ZKO A;  5D5Q A;  2YIA A;  2E3C A;  1GPF A;  3JAK B;  1AJQ A;  2FML A;  3K0G A;  3JAR A;  1HXV A;  1IBL B;  1EQ3 A;  3ZX6 A;  2MNT A;  3JD4 A;  4NTY A;  2QEX V;  3E8H A;  2L6L A;  4F6E A;  1QR8 A;  2CTQ A;  3T1C A;  5LA6 B;  2ZIO A;  4NB5 A;  4PDL A;  1JR9 A;  3BY6 A;  4MVQ A;  3QF7 A;  3ARO A;  5H6Q A;  1GM8 A;  3ETG A;  1Y67 A;  3FY1 A;  1QLE B;  4H37 A;  2DYR B;  4JI6 B;  1NTZ H;  2NLJ C;  3CRR A;  4ICG A;  4WCE V;  1WB7 A;  2DOS A;  3CCS V;  5KMG A;  4F6R B;  4DV1 B;  1HW7 A;  5C8Y A;  3CHD A;  1XIL A;  2QWP B;  5BY1 A;  2XP3 A;  5HBF A;  1Q8I A;  4LR3 A;  4IT4 A;  5KX5 B;  2Q0O C;  1W1Y A;  2ZIM A;  4DV6 O;  5LGU A;  3CYO A;  3AG1 B;  4PEL A;  2P90 A;  5IYC O;  1FD9 A;  1GRJ A;  1RM1 C;  1F4N A;  1WA8 B;  3CCJ V;  2PN0 A;  2QKA A;  2PV3 A;  2WA4 A;  4DR2 O;  1A32 A;  2XTA A;  2GTA A;  4TW6 A;  2EZP A;  4PJ0 Z;  4JI4 O;  1WNO A;  3KAC A;  1R3J C;  2UXD O;  3U0Z A;  1EZV H;  2WLL A;  1KYO F;  1Z5V A;  1S0V A;  3B8N A;  3OD4 A;  2B5U B;  2BOC C;  1N33 O;  1HNZ O;  4GGQ A;  3MHH C;  1W1T A;  1MZE A;  3K0D A;  3OFN G;  3PN1 A;  1AJN A;  2QSA A;  1L1P A;  2DE0 X;  3A0R A;  3WL0 A;  4DIP A;  1N1A A;  2KB1 A;  3JSL A;  4QT2 A;  2ILM A;  2Y4U A;  2E74 B;  2CTR A;  4LNU A;  1OCO C;  1U96 A;  3ZRW B;  2QF8 A;  2FTK A;  4KQZ A;  4PI2 A;  2YI9 A;  4WBN A;  1J4H A;  5BMV B;  3AS0 A;  4L87 A;  1NWT A;  4LF7 O;  1J4I A;  1NMV A;  4DRI A;  2F2D A;  1SR0 A;  4G28 B;  2P4K A;  4R50 A;  2DG4 A;  5LGT A;  1CEZ A;  1XHX A;  1BL4 A;  1HKJ A;  1CXZ B;  1WAZ A;  5JJE B;  4DV3 B;  3CRA A;  1QLN A;  2Q0A A;  4DRN A;  1YHQ V;  3G80 A;  3WFV A;  3K5L A;  4NKG B;  3HKE B;  3K59 A;  3PRB A;  1ZL1 A;  2NN4 A;  4B3R B;  4O4I B;  3VAW A;  1D5N A;  1XUQ A;  1ZAU A;  1SET A;  2WLK A;  5GPR A;  3K9A A;  3OAA G;  3O5E A;  3CJH A;  3X2Q C;  3APO A;  3L71 H;  4R7C A;  2BSK B;  1MSW D;  2XOK G;  2A79 B;  1NT2 B;  4MSW C;  5EBM C;  5BXZ A;  2P6J A;  5DIT A;  1OCC B;  2QR4 A;  2XP5 A;  1IBK O;  1OCO B;  2JEU A;  2PZS A;  4MW3 A;  1AI4 A;  3TK1 A;  2RJZ A;  1XI1 A;  2DT1 A;  2DYS C;  2DQ0 A;  3O5K A;  2M6Y A;  4HBE A;  3CC4 V;  4PDV A;  3CC2 V;  2FDM A;  2QM4 A;  4TV9 A;  4ABM A;  3P30 A;  3N27 A;  2JJ1 G;  1N4C A;  4W4L A;  5D5P A;  5IJ0 A;  4ZPV R;  4MTO A;  1WPX A;  3NR7 A;  4O2T A;  4DWS A;  3ARS A;  1U97 A;  4LGX A;  1NJI W;  3ZJZ A;  5LOV A;  4DR7 O;  5KHG A;  2E75 B;  2ZQS A;  2GDS A;  3JAT A;  1GKF A;  4RQE A;  3GVM A;  3PRA A;  3HKC A;  1H8H G;  3A0H Z;  2YXH A;  1FKS A;  2JS5 A;  1H0G A;  3SJQ C;  4QE9 A;  3P3P A;  3C3S A;  4TW8 A;  2IJH A;  2Y0P A;  4P2Z A;  2H94 A;  3K58 A;  3OUF A;  4XBF A;  4JFM A;  5FNV A;  3OEE G;  1YI2 V;  4PDM A;  1YTF D;  1E1Q G;  2UXN A;  2KSD A;  4MVM A;  3EXA A;  3QNE A;  4D7T A;  4P8V A;  1LL7 A;  3CRQ A;  2AZ0 A;  4P8X A;  1Q5O A;  2ATK C;  3H1L H;  4B3M O;  1QVG U;  2ITK A;  4DRH A;  5HW7 A;  1R1B A;  2BCC H;  2JDI G;  2WLH A;  2RNB A;  1U79 A;  2XPA A;  4JTA B;  2Q9L A;  1FFR A;  1JA8 A;  2WLZ A;  2QJ1 A;  4MT8 A;  2LKN A;  1RSO A;  4QIB A;  3ARU A;  4HYO A;  5CB4 A;  3K04 A;  3IHZ A;  1BE3 H;  5L3D A;  2UXC O;  2A3A A;  2ZXW C;  2PTM A;  3JAW B;  4W9O A;  4DUY B;  2O57 A;  1DF5 A;  4JYY A;  1WN7 A;  3GB7 C;  4OPH A;  3I55 V;  3OUS A;  3IK8 A;  1DK1 A;  1P5Q A;  3TET A;  4N21 A;  5FPR A;  3JD2 A;  5HWC A;  3FAV A;  5EC1 C;  1C9H A;  5EYP A;  1ROT A;  1GM9 A;  4DYL A;  1ITX A;  4GLX A;  4MGV A;  5EK0 A;  2ZQV A;  2HHH O;  3LNM B;  2Q7G A;  3OOB A;  1OV9 A;  4DRP A;  2IBZ H;  4W9P A;  1OWQ A;  5EBL C;  5IY5 C;  2CK3 G;  2ZD9 A;  3UKM A;  2M08 A;  4FLZ A;  2DN9 A;  5CA0 A;  4DZ3 A;  4AHC A;  2ZQU A;  4JF3 A;  4NZC A;  2LPV A;  4AQY O;  4JI5 O;  4G2P A;  3L9D A;  1G4Y B;  1BSM A;  3ZHS A;  4JYC A;  3N2G A;  1QCE A;  1NQT A;  5JH7 A;  3JAK A;  5CBF A;  1SA0 A;  2CGN A;  2DQ3 A;  4TT3 G;  1N34 B;  3UI6 A;  4BW5 A;  4P9P A;  3FB6 C;  2QA4 V;  1I94 B;  1FXK A;  3O5G A;  3AG4 C;  3AK1 A;  3OM3 B;  1YZB A;  1L0N H;  2VQF B;  3UQB A;  1YIT V;  2QM7 A;  2UUB O;  1R3I C;  2WPD G;  4WK9 A;  1M1K W;  2ZXW B;  4X66 O;  5LA6 A;  1LG1 A;  2A9H A;  4O4L B;  2KO7 A;  4I55 B;  5C8Y B;  1LJY A;  3Q4H B;  4JV5 O;  1MOF A;  2Q4P A;  4MNJ A;  4IIJ A;  1ZLZ A;  4LFB O;  4F6R A;  5IY5 B;  3RBZ A;  2UUC O;  1R3L C;  3QTC A;  4ZBM A;  5KX5 A;  1H38 A;  1UR8 A;  1Q6I A;  1US6 A;  3SYQ A;  1HNW O;  3CWB H;  2WLL B;  1WA8 A;  4R8C A;  4Z2L A;  4LAX A;  3ASN C;  3RYH B;  1ZTE A;  3ARV A;  2XAS A;  3BFR A;  5L3G A;  1TGO A;  1X6N A;  4QZV B;  2AHZ A;  4JI7 O;  1FKD A;  3PJS K;  1B06 A;  3AG4 B;  2JS3 A;  1NVP B;  5L3B A;  2PF4 E;  1RD6 A;  2YID A;  3CD6 V;  4LF5 B;  1Q1C A;  2RUC A;  1FJD A;  3OEH G;  4JI2 O;  4JI3 O;  4DV0 B;  4Z2W A;  2YBU A;  3ZRX A;  2PI5 A;  2A7W A;  4JPR A;  1XNR O;  3ODK A;  3N2K A;  4TQF A;  1QBZ A;  5C93 A;  4LNU B;  5HFL A;  3RM4 A;  4X62 B;  4GUN A;  1PNL A;  5L3E A;  4DZ2 A;  3MDY B;  1GN3 A;  1O9G A;  1HKM A;  5DIU A;  2HJF C;  4KR0 B;  2VWK A;  1NZ6 A;  1Q3E A;  1YVW A;  2K1E A;  2WLN A;  1AI6 A;  1G8M A;  3STL C;  2YS8 A;  1PV0 A;  3UT5 B;  3EY6 A;  5BMV A;  1I5X A;  4U84 A;  3OTO O;  5ITZ B;  2YEV B;  2Y48 A;  1NS1 A;  4DRM A;  4NVP A;  1EYM A;  4DR4 B;  4B7E A;  3THO A;  1W2B U;  4JFK A;  1FKJ A;  3ASN B;  1LUW A;  2QWO B;  2HVK C;  1FKI A;  2MK3 A;  1UFI A;  5KA6 A;  3F7Y C;  1FKL A;  1QU7 A;  4TV8 B;  5IWA B;  2H3O A;  3HKE A;  1NTM H;  3ZMU A;  3G6M A;  1OCR C;  3JAL A;  3W7W A;  3TJT A;  1GN2 A;  4O4I A;  3G71 V;  4FLW A;  2O92 A;  2FYU H;  1AR5 A;  4BR6 A;  1Q82 W;  2E5L B;  2FB5 A;  2BSK A;  2P67 A;  3J7A U;  4RWU A;  2JJ2 G;  3ABM C;  4B3T B;  1CPY A;  1YJW V;  2LW1 A;  2OTL V;  2ZE8 A;  2ZR4 A;  1VF6 C;  4N23 A;  2W6I G;  2BTO A;  4DR1 B;  5IJ0 B;  4WFG A;  4B3S B;  4ASU G;  2NR5 A;  5HW6 A;  3ALG A;  1IXM A;  4DWS B;  4IYI A;  2ZE7 A;  3CME V;  1LL4 A;  2QWR B;  4X1K B;  1HWY A;  4JYA O;  5KUM A;  3CCU V;  3O5I A;  4Z1V A;  4U7N A;  3RT3 C;  3O5J A;  3JAM N;  5GPG A;  4FLT A;  4J80 A;  4CC5 A;  4D6T H;  3BVO A;  2DSV A;  4CS4 A;  3E83 A;  2P06 A;  2PBC A;  5GTI Z;  1XEQ A;  1ENV A;  2MW2 B;  3ZHV A;  3E8F A;  3T1H O;  2Z5U A;  1Q7Y W;  4ODO A;  4TNS A;  1W1P A;  5FNV B;  3K06 A;  1HDJ A;  3H1H H;  4JTD B;  3B77 A;  1AI7 A;  4MNK A;  5D75 A;  3C3T A;  3CCR V;  4IHJ B;  2RUD A;  4XDK A;  4LFA B;  1OHH G;  3DGE A;  3ABM B;  1P7G A;  3CP1 A;  4DV5 O;  3CGN A;  1TA8 A;  1NI8 A;  1OZ0 A;  1KKC A;  4LFC O;  4MVR A;  4AIL C;  2LP7 A;  4DK1 A;  1ZCN A;  1TCO C;  1IX5 A;  4FPP A;  4R0X A;  2ZQT A;  1MAB G;  2Q68 A;  3WD1 A;  2HG5 C;  3FX7 A;  1YIJ V;  1E44 A;  5CB4 B;  3ETQ A;  1NWR A;  2HR3 A;  2QWN B;  3OTF A;  4IL6 Z;  1M5I A;  1JJ2 U;  2WA3 A;  4X65 B;  1ZB5 A;  3EIP A;  3BA8 A;  2K8I A;  4P30 A;  3AQU A;  2DW4 A;  1PNM A;  5KLV H;  5K1X A;  3MHS C;  4FAP A;  3FAV B;  4FLU A;  5EYP B;  4FLV A;  5LHG A;  2W0X A;  1D2D A;  5LMU B;  1WNS A;  4X89 A;  2CH7 B;  4KUM A;  1LR1 A;  4DR5 O;  3KCE A;  3ARR A;  4DW0 A;  3SPC A;  1X59 A;  4QGP A;  1GH6 A;  5CN0 A;  1D2K A;  4I9W A;  4QE7 A;  3VOU A;  2RSE A;  1F23 A;  1KQS U;  1WB0 A;  4L72 B;  1TUE B;  3ETD A;  4NR1 A;  1PP9 H;  5JH7 B;  1SA0 B;  1YSC A;  1D7I A;  1KP2 A;  2JGD B;  4CS2 A;  3ABL B;  4DV6 B;  1QPF A;  4PA3 A;  1FXK B;  5HUA A;  4FFB B;  4U3F H;  4XDL A;  2GSM B;  1EN5 A;  3H9R B;  2VQE O;  5JWP A;  5HFM A;  3S3W A;  1AP5 A;  3JYJ A;  3TXQ A;  1GTO A;  4DR2 B;  1HJV A;  4BWA A;  2F1M A;  3B8M A;  3R66 A;  4JI4 B;  2X6A A;  4CH3 A;  4JZG A;  3SYP A;  3VQV A;  2RDC A;  4X9Q A;  3KAD A;  4PTM A;  1S3J A;  3O5M A;  3ZED A;  2JEX A;  2DG3 A;  1RPO A;  5BXJ A;  2YXY A;  1XBL A;  3SDL A;  4IYH A;  3K9S A;  1NR1 A;  4WIW A;  2D9F A;  2D2C B;  5IYZ B;  4UV9 A;  2ITC C;  3IJ4 A;  3ART A;  4IIJ B;  4E2L A;  1Y6X A;  4O4L A;  2AWG A;  1VAR A;  4WFF A;  1V55 C;  3UO3 A;  2X7R B;  2QM8 A;  1S5L Z;  2QTS A;  3B9A A;  4I55 A;  3SPJ A;  3FB8 C;  1JNS A;  2QWQ B;  3Q4H A;  4DV2 O;  3ABU A;  3RFR A;  5HTG A;  1FKR A;  1VEW A;  3CCL V;  3WD2 A;  1SER A;  1FAF A;  2Y69 C;  1IX9 A;  2W6J G;  3JYM A;  2DMX A;  4GX2 A;  1ROU A;  1JVW A;  1O9H A;  4GKJ O;  2MLY A;  4G27 B;  1JND A;  3QO7 A;  2ARH A;  4DR6 B;  3K5N A;  2Q8V A;  1V54 C;  1TAE A;  1VP7 A;  3JSN A;  3J81 N;  2KE0 A;  2DSW A;  4LF7 B;  1THZ A;  5GW7 A;  2Q5A A;  4J10 A;  3WQV A;  4ZS6 A;  2DT2 A;  4MNM A;  3W4R A;  1PPJ H;  3OMI B;  3M7M X;  2DWD C;  3BMB A;  3FB7 C;  3RYH A;  1YF2 A;  1PNK A;  1AJP A;  5EC2 C;  2P5O A;  3CGM A;  1ZBK A;  4K3A A;  1J95 A;  2YSU B;  1MNG A;  3N2K B;  1BQZ A;  2XUM A;  1FXH A;  4LF6 O;  4H44 B;  2P4V A;  1H2S B;  5FLX N;  1M57 C;  4GYC B;  3RYI A;  3O5R A;  1VQ8 V;  5DIV A;  4DO2 A;  4TX0 A;  2XND G;  1XNQ B;  1PD3 A;  4NNR A;  4JGS A;  4CC6 A;  3FFQ A;  3T1Y B;  1V55 B;  5CA3 A;  2PYJ A;  3PA7 A;  5LGN A;  3CC7 V;  2F93 B;  2B31 A;  4JI6 O;  5KAF Z;  1YXB A;  2RQS A;  1K3E A;  1IBK B;  3OT7 A;  3D3Q A;  5B1O A;  1PL4 A;  1Y76 B;  1IUR A;  4JYB A;  1GM7 A;  5CBH A;  1RM1 B;  2L35 A;  3UT5 A;  2R9A A;  2YXL A;  2UU9 O;  2CE4 A;  1V54 B;  4K8X A;  4AY1 A;  5ITZ A;  2YEV A;  1JFF A;  1M56 C;  3TCZ A;  2IU3 A;  1MG1 A;  3LDC A;  5IYD O;  1IDS A;  1FKB A;  4DV4 O;  2CUG A;  3WKZ A;  1OGB A;  1ARO P;  4DT4 A;  2PYL A;  4ODK A;  1ZK6 A;  3JAL B;  4TV8 A;  4YJ3 B;  4DR7 B;  1AB3 A;  4NXM O;  1H2N A;  2X6C A;  1M57 B;  4UDM A;  3QOK A;  5J2U A;  4JAS A;  2HP8 A;  4GT1 A;  1D7H A;  2HFE C;  3DXR A;  4J4O A;  4MAV A;  4TUY B;  3R65 A;  3WB2 A;  2Y0I A;  2ZM6 O;  4J7J A;  2ESC A;  3ZN0 A;  3L72 H;  4WFE A;  1JMK C;  1DTO A;  5TIS Z;  1ZUQ A;  2JVD A;  4FJC C;  1Q86 W;  4PA9 A;  1H2M A;  4MSP A;  2DG9 A;  4HBN A;  2KFW A;  4G2K A;  3ZS8 C;  1M56 B;  2IJJ A;  4BAY A;  5LHI A;  4X1K A;  3RYC B;  3A0B Z;  3FYE B;  3E2E A;  1S77 D;  3WH0 A;  3WIJ A;  1Z2G A;  1EN4 A;  4GKK B;  3B9D A;  3SR2 C;  2UUA O;  3CRM A;  4KP4 A;  3B7X A;  2EZO A;  2HJD A;  4JAV A;  2KR7 A;  2F21 A;  2UXC B;  1UR9 A;  1ZWI C;  3SJA C;  1OCZ C;  1NU1 H;  4LC1 A;  1Q6U A;  5B1N A;  4B08 A;  2DT3 A;  3X2Q B;  1HR0 B;  4Z2G A;  4B3R O;  1FKT A;  4LF9 B;  4DUZ B;  3ZHQ A;  1M9N A;  4ML4 A;  4GX0 A;  1NH2 B;  4K8Z A;  1W9P A;  3SYA A;  2LFR A;  4CZZ A;  1R73 A;  3HKB B;  1K73 W;  5LYJ B;  2E76 B;  3LDE A;  3FXY A;  4IHJ A;  4DWS D;  4D7S A;  1X6L A;  1M5Y A;  2DYS B;  4J42 A;  2KKW A;  1P7B A;  3RYF B;  3IC7 A;  3WD3 A;  5LMN B;  1BMF G;  1VF6 A;  1XDC A;  2XT9 A;  1BL8 A;  2PV1 A;  4FVM A;  2ZR2 A;  2JZV A;  4JI5 B;  4BW9 A;  1K4C C;  4Z2K A;  2WLI A;  1V9P A;  4X1Y B;  1SQQ H;  3SPH A;  3HR0 A;  5A9G A;  2GV9 A;  3B40 A;  5EIB D;  3BAB A;  2R9R B;  1TFV A;  4HNA B;  4LWS B;  1SRY A;  3QG5 A;  3BXW A;  3CXC U;  3HKD B;  4P8U A;  4EFB A;  1VIB A;  5B5E Z;  4PD4 F;  1A7X A;  5KHH A;  2DSU A;  4I4T A;  4EB6 A;  4Z2I A;  2QDO A;  2VCD A;  3CS5 A;  1LUV A;  4X66 B;  3SGI A;  2CH7 A;  3ARW A;  1OCZ B;  3E22 B;  5DEC A;  5IJ9 B;  2P22 C;  3SYO A;  1E15 A;  2B1G A;  3UM7 A;  2P7T C;  1ZU8 A;  3CHC A;  4RUF A;  2QE7 G;  4LFB B;  1TVK A;  3CCQ V;  3TXS A;  4FN2 A;  3WL1 A;  3JCZ A;  4QIW F;  2UUC B;  1JVM A;  4MTG A;  4RAI A;  2JGD A;  5J9P C;  3K57 A;  1SQB H;  1XL6 A;  4MTX A;  4FFB A;  3RVZ A;  1K4D C;  1F51 A;  1XRE A;  2YUA A;  4I5S A;  1YJ9 V;  4ZPW R;  3OE7 G;  1HNW B;  2RUR A;  2GHY A;  2AGA A;  2XAQ A;  2JIZ G;  4J7Z A;  3GTY X;  4OX9 O;  4JI7 B;  1VF8 A;  4LBE C;  2CTW A;  1SC5 B;  2Y4T A;  4OGQ B;  1XHG A;  2OCH A;  4FFK A;  4Q7N A;  3LSU A;  4JI2 B;  1QZ2 A;  2YC0 A;  2Q7H A;  3WB0 A;  5E79 Z;  4BIZ A;  4DUY O;  4FLX A;  1XNR B;  1XMQ O;  1JPX A;  2NNU A;  5IYZ A;  1Z5W A;  5JJJ B;  1HP8 A;  1K8A W;  4W9Q A;  4JI0 O;  4K0K B;  4J11 A;  4LAW A;  3APQ A;  4BIO A;  1FJG B;  2EX3 A;  4MVZ A;  5DN6 G;  5JCO C;  2EJR A;  1R9H A;  1G1X B;  3ASO C;  1YW5 A;  2PV2 A;  4QNH B;  2IF4 A;  5B8I C;  4JFJ A;  2LJ4 A;  4PA6 A;  2G38 A;  2KQX A;  3H01 A;  1LG2 A;  1TUB A;  1N32 O;  3I5D A;  4JYS A;  4LF4 B;  1ZBV A;  1FFX B;  2LGQ A;  3KAH A;  1Y74 B;  1N34 O;  1VQ6 V;  2ZNI A;  3IKD A;  1HNX O;  4FM0 A;  3ARZ A;  3RYI B;  1Y66 A;  2ZR5 A;  3ARX A;  3RFW A;  3FB5 C;  3OGI B;  1WLE A;  1BHA A;  2UXB B;  1BT8 A;  2DT0 A;  4I0X A;  4URI A;  3VQX A;  1S5J A;  2OIG A;  4N19 A;  1YJN V;  1PM9 A;  1NBM G;  1OJH A;  4RUE A;  4H0L B;  1DF4 A;  4X64 B;  2ZE6 A;  1R6T A;  1VQ9 V;  3BCC H;  4HAM A;  4J9Z B;  4TOI A;  1SQX H;  4H33 A;  2B9Z A;  1MSD A;  3CHE A;  4LAV A;  5EBW C;  1VQ5 V;  1SYT A;  2Q73 A;  3W7T A;  1SES A;  3ASO B;  3AK2 A;  2F4V O;  4ODP A;  1J6Y A;  1MZF A;  4JI1 O;  1GO3 F;  1JFF B;  1BQ0 A;  1Y76 A;  3EFF K;  4WJX A;  3CH9 A;  1R3K C;  1ZL8 B;  1NH6 A;  2DPE A;  2VRZ A;  5GON B;  2XAJ A;  4W5U A;  2XP9 A;  3BEH A;  2OTJ V;  3KCX A;  2BTQ A;  1O6I A;  3LSQ A;  4BIU A;  1EHN A;  3SPG A;  5GQB A;  4LF8 O;  1BKF A;  5J2U B;  3JXV A;  5BR8 O;  3SPI A;  2ZCE A;  4YHH O;  3RGC A;  1GUV A;  3G6L A;  4DV7 B;  1K34 A;  4OXS A;  4YJ3 A;  3DXR B;  4YY3 B;  1Y4M A;  1WB8 A;  3LDD A;  4DXW A;  4L8J A;  1E79 G;  1DLB A;  3T1H B;  1J5E B;  4X62 O;  1LL6 A;  2ZE5 A;  3ABT A;  4TUY A;  4ZHQ A;  1N36 O;  2PPO A;  4DRJ A;  3ZHR A;  2HVJ C;  2CTP A;  2LGW A;  1GAX A;  5B1A C;  3JD3 A;  4DV5 B;  5H9C A;  2EUL A;  3AS2 A;  3AS3 A;  2AZ2 A;  2IH1 C;  4LH6 A;  1PL0 A;  1F7Y A;  3ARY A;  2HEP A;  3BPZ A;  1BHB A;  2WK2 A;  1GK9 A;  4GZR B;  4WFA V;  1BZK A;  2PPP A;  1JCH B;  5HKG A;  4DR4 O;  1YTF B;  2WLM A;  3B4S A;  3RYC A;  2MPH A;  4LAY A;  1M90 W;  2ZNJ A;  1KP3 A;  4PV1 B;  4NXN B;  3L75 H;  1LQ0 A;  3WQW A;  1SZX A;  4UXN A;  3GPK A;  4DRX A;  5HWB A;  1OCR B;  1XMO O;  1EZJ A;  1FKF A;  2RUQ A;  1AR1 B;  4ZPT R;  1VQO V;  5JQG B;  4DR5 B;  3MD0 A;  1YAT A;  1Y0O A;  3FKS G;  5JVD B;  3KCY A;  5HT1 A;  2RQ6 A;  1JOY A;  5JH8 A;  1B6C A;  3HKB A;  1QPL A;  4J41 A;  3PRD A;  4GIV A;  5LYJ A;  1YEW A;  2JGU A;  4B3T O;  2QGN A;  4MTV A;  2MLX A;  2WLI B;  2WLY A;  5B1A B;  3RYF A;  2WM0 A;  2FAP A;  2Z3Y A;  3C90 A;  4HZ3 A;  1WAW A;  5LL6 Y;  1IXB A;  3H9V A;  2UZ5 A;  5L3F A;  1YDX A;  3VQW A;  4X1Y A;  1EDQ A;  4UVB A;  2MF9 A;  3RVY A;  1XL4 A;  3H1J H;  3F5W C;  3K3W A;  4I4T B;  4EB6 B;  2VWJ A;  4DR3 O;  2MLZ A;  4HNA A;  4LWS A;  2YIB D;  2PPN A;  5L3C A;  4LP8 A;  4MW8 A;  3HKD A;  3IKG A;  3SJB C;  1FKA O;  3O5Q A;  2LJ2 A;  4JFL A;  1EFR G;  1GN6 A;  2IW5 A;  1WP7 A;  2YDE A;  3G6B A;  3WG7 C;  4NTW A;  4KL1 A;  4ODN A;  2EIN C;  4JAA A;  4FM2 A;  2CDY A;  1JNT A;  3J80 N;  2ZIN A;  1KB9 F;  2GUZ B;  2LW7 A;  1W26 A;  2XP6 A;  3DC5 A;  3E22 A;  2L2S A;  3UCS C;  5IJ9 A;  1TVK B;  3F5T A;  2ZDI C;  5EZY B;  4TW7 A;  1VQ4 V;  5LP6 C;  4YXW G;  4DV2 B;  4DRK A;  3O5P A;  3QVN A;  4U85 A;  1COW G;  4LFA O;  5J6E A;  1FS0 G;  1FYJ A;  4GKJ B;  1RP3 B;  3E8B A;  1XHZ A;  2GTS A;  4TQD A;  1FAP A;  3JAS A;  3W7U A;  3AG1 C;  1N8R W;  1SZT A;  2EIM C;  3VBB A;  3K5O A;  2UXD B;  4DRO A;  1ZSP A;  2Q5Z A;  1UJW B;  4C02 B;  1I7F A;  3K79 A;  4O4H B;  2D3O W;  2K9P A;  5B66 Z;  4JAU A;  2R72 A;  4X65 O;  1N33 B;  2N87 A;  1WP8 A;  1F4M A;  1HNZ B;  3LUT B;  4LF6 B;  1KMI Z;  1K9M W;  3WG7 B;  2XPB A;  4FIP C;  2EIN B;  2WWW A;  4FK5 C;  4UB6 Z;  4KHP O;  1IBM O;  3SYC A;  4ZI7 B;  5LMU O;  4W4K A;  4O2A A;  5FL7 G;  3MAQ A;  4JI8 O;  2DSZ A;  1Q90 D;  1KUQ A;  3ZN1 A;  5H6R A;  3ABK C;  3M99 B;  4Q20 A;  3CMA V;  1S5H C;  4PI0 A;  2FL4 A;  4HBO A;  5LP6 B;  1TUB B;  4WFH A;  2HLD G;  4QT3 A;  4OPA A;  3H1K H;  3O65 A;  2CGO A;  3STZ C;  4O4J B;  3AG2 C;  1IBL O;  1HKI A;  4U7O A;  2UU9 B;  2YI8 A;  1FFX A;  2W0F C;  4DRQ A;  1FXV A;  1P4R A;  2FKX A;  2YIC A;  4DW1 A;  1PIN A;  3UF8 A;  2EIM B;  2HKO A;  4GX1 A;  4UV8 A;  1Y74 A;  4AI8 A;  3ZHT A;  4O2B A;  4ODM A;  5LBQ A;  3MDS A;  3P32 A;  4I0X B;  4U3J B;  4DV4 B;  1SKV A;  4JTC B;  3RW0 A;  5J2T B;  4CS3 A;  3AEI A;  3WD0 A;  1QNM A;  3UQ8 A;  2QKS A;  4P9O A;  4NXM B;  4MVO A;  1JJO A;  1SQG A;  3M8A A;  5KHK A;  5H5N A;  1VQL V;  4Z2J A;  5KHI A;  3CZ8 A;  3ABK B;  1JNE A;  2Y69 B;  1M4U A;  1E6Z A;  4DV1 O;  4UCT A;  1NTK H;  4F4L A;  3JD0 A;  3D36 C;  4CH5 A;  2ZM6 B;  5JCO A;  3DTU B;  1OCC C;  1H2G A;  1NVP D;  2Q67 A;  3CSX A;  2DWE C;  1ZL8 A;  4CH6 A;  4DR6 O;  2BTQ B;  1N0N A;  1ZBC A;  3AG2 B;  4C7U A;  4ODR A;  1EIB A;  5GON A;  2OYQ A;  1CTN A;  5JJN B;  1D5A A;  1W9U A;  5BZB A;  1BS3 A;  1E1R G;  3U10 A;  1FKK A;  3A2F A;  1FPO A;  3ZIA G;  1KC8 W;  1S72 V;  1XOU A;  1RFY A;  5A2Q N;  2UUA B;  3BHP A;  2A3Q A;  4PHZ A;  4MS2 A;  3CCE V;  4NYK A;  2UXX A;  2Q7E A;  4R6Z A;  3TGU H;  5KA5 A;  1GMG A;  4ZHQ B;  4FZ1 A;  3AG3 C;  4S3J A;  3ZRV A;  1DGS A;  1XNQ O;  1D7J A;  3KG2 A;  3ZBH A;  3BAA A;  3T1Y O;  4FLY A;  1MMM A;  3UI5 A;  1I08 A;  5HW8 A;  2N04 A;  2XP7 A;  3A8T A;  3KZI Z;  2KI3 A;  4ODQ A;  1KD1 W;  4X20 B;  1ZX3 A;  4B3M B;  2OIE A;  3OW2 U;  3CRC A;  1AR4 A;  1K33 A;  5E1A C;  1EM1 A;  3RN4 A;  4KXR A;  4JFI A;  1FFT B;  1W0K G;  4I50 B;  2N74 A;  2EIJ C;  4WF9 V;  4EEQ A;  1XQ8 A;  3CHX A;  4DV3 O;  3OA5 A;  4DRX B;  1JCH A;  4WKA A;  4ODL A;  3E89 A;  3T4Z A;  3RM8 A;  3PR9 A;  4J9Y B;  2WLJ A;  1GOI A;  3ZHU A;  4I7Z B;  1L0L H;  1Q6H A;  3CE2 A;  2KG7 B;  3FD9 A;  2WSS G;  1K5S A;  3OR6 C;  3WU2 Z;  3JD1 A;  2ZR6 A;  2WAM A;  4B7K A;  4IQC A;  4S3K A;  1T11 A;  2IH3 C;  4X1I B;  4QPK A;  4UFZ A;  1VQK V;  2HHH B;  3D3I A;  3AG3 B;  4Q22 A;  3E86 A;  5JQG A;  3FAP A;  1P49 A;  2ZT9 B;  5JVD A;  4XDJ A;  2EIL C;  3SJC C;  3QO5 A;  4UCO A;  3GWK C;  3NTP A;  2H8P C;  3LUO A;  2IM9 A;  3DSQ A;  4AQY B;  3E8G A;  4YJ2 B;  2OT5 A;  5IT9 N;  1NKD A;  1NMW A;  2Z0A A;  2A0L A;  1Q81 W;  5DO2 A;  2F95 B;  1AIL A;  2O9O A;  3O5F A;  2EIJ B;  1S76 D;  3KAB A;  3KAI A;  3EHB B;  4PA4 A;  2UUB B;  5LXT B;  1M93 A;  4OX9 B;  2IU0 A;  4IQ2 A;  2ADP A;  1HJX A;  2PI4 A;  1PKX A;  4GKK O;  1H0I A;  4PDR A;  4WKH A;  2EIK C;  3ZMV A;  1VQM V;  4TSF G;  3GU0 A;  4ZOL B;  2OFN A;  1H2L A;  3D8C A;  2JK5 C;  5CA1 B;  2XAF A;  2GUZ A;  2KGJ A;  4JV5 B;  1ROP A;  1XMQ B;  3CCV V;  2XP4 A;  1HR0 O;  1QR9 A;  2GBO A;  4G50 A;  4LF9 O;  4DUZ O;  4JI0 B;  3ML0 A;  2A3C A;  2AHY A;  2X0L A;  3AG7 A;  1SQP H;  3B8S A;  5EZY A;  1QHT A;  1KBH A;  2EIL B;  3TDB A;  1F40 A;  4E4E A;  4MTF A;  1NSG A;  3JAS B;  2EJ7 A;  4UB8 Z;  3G6E V;  3ZRS A;  2ETN A;  5LMN O;  1L8D A;  3JAR B;  2BOB C;  5IE9 A;  1N32 B;  3CXH F;  2X6B A;  1NR7 A;  4QPJ A;  1LNQ A;  4O4H A;  1K97 A;  2XP8 A;  1HNX B;  3L73 H;  3O5L A;  4JI3 B;  3O5O A;  2RN9 A;  2EIK B;  4O2A B;  2N05 A;  4TYO A;  1K5Q A;  5KUK A;  2IJI A;  2ZQM A;  1H8E G;  1VQN V;  4ZI7 A;  3BRC A;  2JRI A;  2XHB A;  1W9V A;  4CBC A;  3ICX A;  3KAF A;  2ITD C;  5DF0 A;  3OMA B;  2DJV A;  3L70 H;  3CB2 A;  5KMG B;  2YBT A;  2ZDI A;  3IAY A;  3B2E E;  2PY5 A;  4GX5 A;  5DED A;  1AVM A;  5LP6 A;  3JYC A;  1E6N A;  4UCV A;  3OTO B;  5F2V O;  3UQA A;  2F4V B;  2Q69 A;  4JI1 B;  1W0J G;  3KKY A;  4DH0 A;  3NXS A;  3O9O A;  4UCU A;  4O4J A;  4O2B B;  3NI6 A;  2RCV A;  1QVF U;  4X8A A;  1L1F A;  1I94 O;  2F4E A;  3WD4 A;  4WKF A;  4MVU A;  2VQF O;  3NRK A;  2M1I A;  2VN1 A;  2F23 A;  2PGG A;  3ETE A;  4U3J A;  4IT5 A;  4LF8 B;  2IJK A;  5J2T A;  4IGG A;  1B3Q A;  3K5M A;  3CCM V;  4FMT A;  2B1I A;  5BR8 B;  4YHH B;  3I56 V;  4ZIB A;  2PI6 A;  3ZMT A;  3IC9 A;  1J4R A;  1B6Q A;  1WPB A;  2EBO A;  2ZR3 A;  3T2M A;  3P3N A;  3RGB A;  3AK3 A;  3ZMZ A;  4Q6G A;  1F8A B;  2QTO A;  3LNN A;  1HKK A;  4FM1 A;  2Y78 A;  2B5U A;  4UVA A;  4WFB V;  1W1V A;  1P84 F;  1W59 A;  4K0K O;  1HJW A;  1URF A;  2LO1 A;  3IGA C;  3VQY A;  1JX9 A;  1FJG O;  1N36 B;  3F7V C;  2R70 A;  1KFW A;  4U86 A;  1I0H A;  3CX5 F;  4CH4 A;  4WBN B;  3UO2 A;  3T4D A;  1R6N A;  2C2A A;  2AXT Z;  3LSS A;  3ZRW A;  2F66 C;  4MPK A;  3G67 A;  4I9Q A;  4ITZ A;  1UPG A;  4NSB A;  2ODM A;  5H2F Z;  4JYA B;  2LQT A;  4Z1M G;  1VQ7 V;  2AW9 A;  3OGC C;  5AG2 A;  3UI4 A;  4LF4 O;  4R5E A;  4DWS C;  5LHH A;  2G8Z A;  3B9E A;  1PBK A;  5FPO A;  1G6U A;  3GWO A;  4LF5 O;  1OGG A;  2OLH A;  1SQV H;  1SQF A;  3WB1 A;  4H13 B;  4L3N A;  4MVS A;  4DV0 O;  2LGO A;  5B3S C;  1R6K A;  2PUS A;  5KAI Z;  1XMO B;  2UXB O;  1ZBW A;  2QKC A;  3G4S V;  3AS1 A;  5EIB C;  4EKW A;  3CJH B;  3ARP A;  5DEZ A;  4J7K A;  5I98 A;  5KHJ A;  4X64 O;  3QO8 A;  3O5D A;  3ALF A;  2VS0 A;  4RQF A;  3DC6 A;  2OWO A;  3ARQ A;  4PA7 A;  2OCC C;  1KEC A;  3D36 A;  2V1D A;  4LFC B;  4YIP A;  2CAZ C;  1BCC H;  1KT0 A;  4X20 A;  5DM6 V;  4TV9 B;  4BF8 A;  4LH7 A;  1KKD A;  3IFX A;  3OMN B;  1EBO A;  4I50 A;  3ZCC A;  1KT1 A;  4TWK A;  4DK0 A;  1IVS A; 
#chains in the Genus database with same CATH homology
 4MNJ A;  2G41 A;  3WH0 A;  3WIJ A;  3B9D A;  4HBO A;  1FKG A;  1FFQ A;  3B7X A;  2KR7 A;  2F21 A;  3RME A;  4QT3 A;  3TC5 A;  1D6O A;  1UR8 A;  1UR9 A;  1Q6I A;  1Q6U A;  1HKI A;  2DT3 A;  4Z2G A;  1FKT A;  1E6P A;  4DRQ A;  4Z2L A;  4LAX A;  4ML4 A;  3RM9 A;  1NWS A;  1PIN A;  3ARV A;  3UF8 A;  1W9P A;  1X6N A;  4QZV B;  1FKD A;  4ODM A;  1E9L A;  1RD6 A;  3FXY A;  4DWS D;  1X6L A;  1M5Y A;  1E6R A;  1Q1C A;  2RUC A;  1FJD A;  3I6C A;  3KAG A;  3WD3 A;  3WD0 A;  2YBU A;  1K9T A;  4HAR A;  2AOS A;  2PV1 A;  3ODK A;  2JZV A;  2A3B A;  2M2A A;  3RM4 A;  4Z2K A;  4IPX A;  4Z2J A;  3CZ8 A;  4DZ2 A;  3MDY B;  1FKH A;  1JNE A;  1HKM A;  1E6Z A;  1TFV A;  5DIU A;  3BXW A;  4KR0 B;  4P8U A;  1A7X A;  4MNL A;  2FKE A;  3B09 A;  2IUZ A;  2DSU A;  4Z2I A;  3EY6 A;  2VCD A;  4U84 A;  4P8W A;  3CHF A;  3ARW A;  4DRM A;  1ZBC A;  1EYM A;  4ODR A;  1EIB A;  4IT6 A;  3UQI A;  1E15 A;  1CTN A;  4JFK A;  1FKJ A;  1W9U A;  3KZ7 A;  1ZU8 A;  3CHC A;  1FKI A;  1FKK A;  4XAK A;  2A3E A;  1FKL A;  4FN2 A;  3WL1 A;  1NWU A;  4J4N A;  1XRV A;  4Z2H A;  3G6M A;  1GPF A;  1HXV A;  2O92 A;  4S3J A;  1EQ3 A;  4ZPW R;  2RUR A;  1D7J A;  2MNT A;  3UI5 A;  1VF8 A;  5HW8 A;  2XP7 A;  2ZR4 A;  4ODQ A;  2KI3 A;  1XHG A;  4Q7N A;  1QZ2 A;  5HW6 A;  3ALG A;  4DWS B;  3ARO A;  4JFI A;  1LL4 A;  3FY1 A;  4W9Q A;  4LAW A;  3O5I A;  3OA5 A;  4WKA A;  4ODL A;  1R9H A;  3O5J A;  3RM8 A;  3PR9 A;  1GOI A;  1YW5 A;  2PV2 A;  3CHD A;  2XP3 A;  5GPG A;  5HBF A;  4IT4 A;  2IF4 A;  1Q6H A;  5B8I C;  2DSV A;  4JFJ A;  1W1Y A;  2PBC A;  2LJ4 A;  1LG2 A;  2ZR6 A;  4IQC A;  4S3K A;  1T11 A;  4JYS A;  1FD9 A;  1ZBV A;  4ODO A;  4TNS A;  1W1P A;  2PV3 A;  4Q22 A;  3KAH A;  3FAP A;  4TW6 A;  4MNK A;  1WNO A;  5D75 A;  3KAC A;  3IKD A;  2RUD A;  3ARZ A;  2ZR5 A;  3ARX A;  3NTP A;  3RFW A;  3CGN A;  3LUO A;  2DT0 A;  4URI A;  4N19 A;  4GGQ A;  1W1T A;  1ZCN A;  1TCO C;  1IX5 A;  1NMW A;  4R0X A;  2ZQT A;  5DO2 A;  1L1P A;  3WD1 A;  3WL0 A;  2O9O A;  3O5F A;  1NWR A;  4DIP A;  1N1A A;  4QT2 A;  3KAB A;  3KAI A;  3CHE A;  1ZB5 A;  2QF8 A;  4LAV A;  4IQ2 A;  4KQZ A;  1HJX A;  1SYT A;  1H0I A;  2K8I A;  4WKH A;  3AQU A;  4ODP A;  1J6Y A;  3AS0 A;  1J4H A;  4FAP A;  2OFN A;  4WJX A;  1NWT A;  3CH9 A;  1NH6 A;  1J4I A;  2DPE A;  1NMV A;  4DRI A;  2F2D A;  1SR0 A;  3KCE A;  2DG4 A;  3ARR A;  2KGJ A;  2XP4 A;  4W5U A;  2XP9 A;  1D2K A;  4G50 A;  1BL4 A;  1HKJ A;  2A3C A;  1O6I A;  2RSE A;  3B8S A;  1EHN A;  1WB0 A;  4L72 B;  5GQB A;  3TDB A;  4DRN A;  1F40 A;  1NSG A;  1BKF A;  3JXV A;  3RGC A;  1D7I A;  1GUV A;  3G6L A;  3PRB A;  1ZL1 A;  1QPF A;  3VAW A;  5HUA A;  5GPR A;  3H9R B;  3O5E A;  1LL6 A;  3JYJ A;  1HJV A;  2PPO A;  5DIT A;  2XP5 A;  4DRJ A;  2XP8 A;  3KAD A;  4PTM A;  3O5M A;  3O5L A;  3O5O A;  2DG3 A;  2DT1 A;  5BXJ A;  3AS2 A;  3O5K A;  3AS3 A;  4HBE A;  4TYO A;  4WIW A;  2D9F A;  2FDM A;  3ARY A;  3ART A;  2AWG A;  2WK2 A;  4ZPV R;  3B9A A;  1W9V A;  2PPP A;  5HKG A;  3KAF A;  4O2T A;  2MPH A;  4LAY A;  5DF0 A;  4DWS A;  1JNS A;  3ARS A;  4LGX A;  5HTG A;  1FKR A;  2YBT A;  3WD2 A;  3JYM A;  1LQ0 A;  1ROU A;  3WQW A;  1E6N A;  1JVW A;  3GPK A;  2MLY A;  2ZQS A;  5HWB A;  1JND A;  3UQA A;  1FKF A;  3PRA A;  1FKS A;  4DH0 A;  2RUQ A;  2KE0 A;  2DSW A;  4ZPT R;  2Q5A A;  1H0G A;  3NI6 A;  3WQV A;  4ZS6 A;  2DT2 A;  4MNM A;  3W4R A;  1YAT A;  1Y0O A;  2F4E A;  4TW8 A;  3WD4 A;  4WKF A;  3NRK A;  2M1I A;  3CGM A;  5HT1 A;  5JH8 A;  2VN1 A;  1ZBK A;  1B6C A;  4JFM A;  1QPL A;  3PRD A;  4GIV A;  4MTV A;  2MLX A;  2WLY A;  4P8V A;  1LL7 A;  2WM0 A;  4P8X A;  2FAP A;  2PI6 A;  1WAW A;  1J4R A;  3O5R A;  2ITK A;  4DRH A;  5HW7 A;  2UZ5 A;  5DIV A;  4TX0 A;  1U79 A;  2XPA A;  1F8A B;  4NNR A;  1HKK A;  2Y78 A;  1EDQ A;  1FFR A;  2MF9 A;  3PA7 A;  1W1V A;  2WLZ A;  1HJW A;  2B31 A;  2MLZ A;  2LKN A;  4QIB A;  3ARU A;  2PPN A;  3IHZ A;  4U86 A;  1KFW A;  2RQS A;  3IKG A;  3O5Q A;  4JFL A;  2A3A A;  4W9O A;  4ODN A;  4MPK A;  1JNT A;  4NSB A;  4ITZ A;  3IK8 A;  1P5Q A;  4AY1 A;  1W26 A;  2XP6 A;  3UI4 A;  4R5E A;  4DWS C;  3TCZ A;  5HWC A;  2G8Z A;  2L2S A;  1C9H A;  1ROT A;  1ITX A;  3B9E A;  1PBK A;  4MGV A;  2ZQV A;  1FKB A;  3OOB A;  4TW7 A;  3WKZ A;  1OGB A;  4DRK A;  1OGG A;  2OLH A;  4DRP A;  4W9P A;  1OWQ A;  3O5P A;  4DT4 A;  4ODK A;  1ZK6 A;  4L3N A;  2M08 A;  4U85 A;  5J6E A;  4DZ3 A;  2LGO A;  2ZQU A;  4NZC A;  2LPV A;  4G2P A;  1ZBW A;  3AS1 A;  1FAP A;  3QOK A;  1D7H A;  3ARP A;  5DEZ A;  3UI6 A;  4J4O A;  5I98 A;  4MAV A;  4DRO A;  3O5G A;  3O5D A;  4C02 B;  3ALF A;  2ESC A;  3UQB A;  3ARQ A;  4WK9 A;  2N87 A;  1KT0 A;  2XPB A;  1LG1 A;  4BF8 A;  4MSP A;  2DG9 A;  2KO7 A;  2KFW A;  1KT1 A;  2DSZ A;  1LJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...