1Q6UA

Crystal structure of fkpa from escherichia coli
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
213
structure length
213
Chain Sequence
AFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVKPAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase fkpA
publication title Structural and functional studies of FkpA from Escherichia coli, a cis/trans peptidyl-prolyl isomerase with chaperone activity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 73
structure length 213
sequence length 213
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2003-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF01346 FKBP_N Domain amino terminal to FKBP-type peptidyl-prolyl isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.460 Mainly Alpha Orthogonal Bundle Helix Hairpins Peptidyl-prolyl cis-trans isomerase, FKBP-type, N-terminal domain 1q6uA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1q6uA02
4TYOA 3O5GA 1HXVA 2ZR6A 3O5JA 1QZ2A 2PV3A 4ODRA 4TX0A 3IK8A 1D7HA 1QPLA 3ODKA 3KAFA 4TNSA 4DRHA 4U84A 4IQCA 1C9HA 3B7XA 4IQ2A 3UI4A 1ROTA 4DRQA 4LAXA 5HW6A 1FJDA 2ITKA 2XP8A 1D7IA 2M2AA 4G50A 4U86A 4ODMA 4TW8A 1FKHA 4DRIA 1Q6UA 1Q1CA 2OFNA 1JNTA 3KAIA 2F4EA 1YW5A 3TC5A 5J6EA 2RUCA 2KGJA 3UQBA 1Q6HA 4ODLA 3IKDA 5HT1A 4BF8A 1FD9A 2Q5AA 4ODKA 1L1PA 3KZ7A 4IPXA 3KCEA 1EQ3A 1FKTA 1FKFA 2RUDA 4DRJA 2VN1A 4W9PA 1KT0A 2XP5A 3IHZA 4JFLA 4DIPA 2RUQA 2PV2A 4GIVA 1NSGA 2XPAA 3O5EA 3PA7A 3EY6A 2KFWA 4O2TA 3UQAA 3JXVA 3CGMA 2XP9A 2ZR5A 1PINA 2M1IA 2PV1A 4TW7A 2JZVA 2MLZA 5HW8A 2ZQUA 3O5KA 1Q6IA 1NMWA 1FKGA 4JYSA 2PBCA 3O5DA 4JFMA 4R0XA 2RURA 3NTPA 4QT3A 2MNTA 4JFJA 3LUOA 1FKIA 2DG4A 3UI5A 2Y78A 3H9RB 4J4NA 4DZ2A 2LKNA 4W9OA 1F40A 4QIBA 5HTGA 2F2DA 1D6OA 2MLXA 3PRBA 2MLYA 4DROA 2PPPA 1N1AA 2RSEA 1FKJA 3KABA 1PBKA 3O5LA 2K8IA 1T11A 4QT2A 4MSPA 4NNRA 2L2SA 3RGCA 1FKKA 5DITA 2XP3A 4G2PA 3O5IA 4ODPA 5HUAA 5B8IC 1BL4A 1F8AB 4DRKA 2MPHA 4ODOA 4TW6A 1QPFA 4LAVA 3KAHA 2VCDA 4DZ3A 4LAYA 1J4HA 3KADA 4GGQA 4DRMA 1NMVA 4DRNA 3B09A 2PPNA 1FKLA 4DT4A 3UI6A 2PPOA 3MDYB 2KI3A 2FKEA 2D9FA 1J4IA 4U85A 3O5PA 5DIVA 2M08A 3KACA 3JYJA 3WH0A 4FN2A 1ROUA 1JVWA 2AWGA 4DRPA 2KE0A 3PRDA 1D7JA 2UZ5A 2ZQSA 5D75A 1U79A 3VAWA 2F21A 2XP4A 3NI6A 2KR7A 1M5YA 2XPBA 4JFIA 3O5MA 2ZR4A 4C02B 1ZK6A 3JYMA 4DH0A 5HW7A 2ZQVA 1J6YA 2LGOA 4ODNA 1R9HA 2ZQTA 3NRKA 4FAPA 1KT1A 1P5QA 1FAPA 2DG9A 2XP7A 3O5RA 1Y0OA 5HKGA 1EYMA 1W26A 3CGNA 1J4RA 3UQIA 4MGVA 5HWCA 5BXJA 3O5OA 1FKSA 5GPGA 2IF4A 1YATA 3IKGA 2MF9A 2LPVA 4W9QA 3I6CA 1FKBA 4ODQA 1TCOC 4JFKA 1A7XA 1FKDA 4N19A 5HWBA 1FKRA 2FAPA 4LAWA 4ITZA 1JNSA 3UF8A 2N87A 3TDBA 2DG3A 1B6CA 4J4OA 3GPKA 2XP6A 2KO7A 3KAGA 1BKFA 3O5QA 2LJ4A 2RQSA 3FAPA 3O5FA 5DIUA 5I98A 1ZCNA 3RFWA 3TCZA 3OOBA
chains in the Genus database with same CATH superfamily
1QZ2A 4JI1O 1TVKB 4ODRA 2O92A 4TX0A 5TISZ 4EFEA 2B9ZA 3WL1A 2XAFA 3AS2A 3WD2A 3N2KA 1M5IA 2WM0A 1E44A 4HBOA 1Q1CA 2PYJA 1HJWA 3TC5A 5J6EA 1R3JC 4KL1A 1SESA 2CH7B 5B3SC 3KZ7A 1I5XA 4DV3B 3KCEA 1NQTA 4UB8Z 3SPJA 4WFAV 1K4CC 1PD3A 3BRCA 3BABA 4MTGA 1NSGA 3PA7A 1AB3A 1J95A 3FB7C 3RMEA 4I0XB 4MVRA 1A32A 5JQGA 5IYCO 1IURA 4JI1B 3SPHA 4PA9A 5CBGA 1SETA 3CRRA 1KKCA 5CMUA 1MNGA 1HDJA 3CHDA 5CBFA 3CB2A 3STZC 5HTGA 2F2DA 1N0JA 1KUQA 2EINC 2MLYA 1H8EG 3U11A 3ZN0A 2YXYA 4MVOA 1ZB5A 1T11A 4MVZA 5LYJB 1HNZO 5K1XA 5JCOC 5C8YB 3D3QA 1YTFD 1BL4A 3SYQA 5BMVB 1L1FA 2MPHA 1XQ8A 4JYBA 5KHHA 1SQGA 2EJRA 4DZ3A 4DRMA 5EIBD 3Q4HB 1MMMA 4GLXA 4I50A 4MTVA 2JEXA 4DV4O 3KCYA 2LW7A 1PNKA 5CN0A 2YEVA 4MS2A 1JVWA 4RO2A 1VP7A 5A9GA 4GX5A 3N2GB 2XPBA 1NU1H 4DR4O 2WLJA 3SPIA 2ZQVA 2G38A 1HJXA 4ODNA 4L8JA 3G6MA 5GONA 2DQ3A 5ITZB 2ZE6A 3O5RA 5LHHA 1K9TA 3H1KH 2V4DA 3JD1A 1HNZB 4HAMA 3CCVV 1JR9A 4FFBA 2MF9A 2EIJC 3FKSG 5KX5A 4ODQA 4PA4A 5LP6C 3QNEA 3O9OA 1KKDA 3AK2A 4AQYO 2IJHA 1GPFA 3CEIA 4MSWC 4DV4B 3AS3A 5DIUA 1R3IC 3K5MA 3L9DA 4ZKIA 3QOKA 3G6BA 1TUEB 4DR4B 4YIOA 4FLWA 4TNSA 1F4MA 1C9HA 3LNMB 2QKCA 1Q86W 1AJNA 3B4SA 2ADQB 1EM1A 1SR0A 1FXKA 4ODLA 4K0KO 2Q7HA 1KC8W 1FKFA 3CE2A 5EIBC 4D7TA 2VN1A 2AHZA 2QWRB 3ETDA 4AQYB 2Q69A 4ZOLB 3O5EA 4O2TA 5JVDB 1PNMA 2EILC 1DTOA 4GKKO 5EBWC 2X6CA 2ESCA 3CWBH 1J5EO 4JI0O 3F7VC 2A3QA 4DWSA 4JI4O 2K9PA 3D36A 4WFHA 2CK3G 3HKCA 2W6IG 2BSKB 4O4HB 1NVPB 4OX9O 1RPRA 2R70A 3O5LA 3RYCB 2Q68A 1RFYA 2JGDA 1XRVA 2CUGA 1M4UA 2AHYA 4K0KB 3VOUA 3RFRA 4PDRA 2BTQA 1F8AB 3UO2A 2WLZA 2BOBC 2ZD9A 3G71V 1XBLA 3CHFA 3L75H 4Q7NA 1VEWA 3CP1A 1RM1B 1JNEA 2B5UA 1D2DA 2QM8A 3LDDA 4JI7O 1KECA 4FLVA 4GKKB 2YIBA 2DN9A 5KLVH 2AWGA 2DT2A 2FL4A 1J5EB 4HNAB 4JI0B 4LF6O 2Y0PA 4O2AB 5B1NA 5HW7A 2WLIB 4TV9A 5IJ9A 4QE7A 4JI4B 1QHTA 2YBUA 3AQUA 1KT1A 2OTLV 4OX9B 2HP8A 1VARA 5HKGA 4UVAA 1SQFA 2CGNA 3DSQA 5C93A 4P9OA 1Y76A 2Q7EA 2OCCB 1XL6A 1BS3A 1I5YA 3RYFA 3H1HH 4JYAO 1TCOC 2QSAA 1FKDA 2XHBA 2HJDA 1EN5A 1K4DC 5EC2C 4K8XA 4JAVA 4WF9V 2YBTA 3E8HA 1WPBA 5LA6A 4JI7B 1ZBCA 5J2UB 4P8XA 3B8MA 2LGWA 4X1IB 4LF6B 2LO1A 3ODKA 1W0JG 3ABKB 2RMKB 3BY6A 4DW0A 1YDXA 5GQBA 3CRAA 1FJDA 1FKHA 4A5UB 2HHHO 1ZL8B 1GH6A 2KGJA 4DR7O 4BW9A 1FD9A 5D5QA 4JYAB 1IXMA 1TVKA 1SF9A 1GN2A 5LOVB 3ABTA 3DTUB 1M1KW 3K0GA 5DECA 4DUYB 1WB7A 4X20B 1JFFB 2KFWA 2O57A 2XP9A 2LW1A 3CMEV 2D3OW 2DE0X 4P9PA 1NMWA 1K9MW 3N27A 1ZBKA 2IJJA 2KSDA 1VQ4V 2LFSA 2CH7A 4JFJA 1ROPA 2A3BA 3NXSA 5DEDA 4FLXA 1SYTA 1YSCA 3PRBA 4F6RB 2QWNB 4NTYA 2HHHB 2BE3A 1L8DA 1Y66A 4YIPA 1Y4MA 4I0XA 4ZI7B 2QGNA 4DR7B 1D2KA 3SYCA 5HUAA 3THOA 3ZJZA 4DV2O 4GKJO 4G2PA 3M7MX 4ODOA 2Y4TA 5L3DA 1FKLA 1HR0O 1TGOA 4ZS6A 4WCEV 2KI3A 1KYOF 3JAKB 4X66O 5DIVA 3PN1A 1V54C 3OAAG 5LYJA 5C8YA 3B8NA 4B7EA 1G6UA 3AG3C 2Y69C 3FB5C 5BMVA 1M57B 2OLHA 2QKAA 3JALB 1O9HA 4I7ZB 1K34A 1NZ6A 1YITV 3Q4HA 2DPEA 4DO2A 1YIJV 1VQ7V 2JRIA 4JI6O 5CA0B 4DV2B 4P2ZA 3VQXA 3IC7A 4LF4O 4W9QA 3I6CA 3ASNC 5HWBA 4Q22A 2KB1A 3K03A 3GU0A 4PA3A 5IJ0B 2E5LO 1HR0B 4PTMA 2ZR2A 3FYEB 2RQSA 4UV9A 5ITZA 3E86A 3OOBA 4IT4A 3WD1A 3O5GA 4X88A 1GO3F 4MNMA 3IK8A 4TQFA 1JPXA 1ENVA 4D7SA 2WLNA 3FB8C 1L0NH 1OCCB 4IT5A 3DXRB 5JJJB 4JYYA 2OFNA 1PPJH 2UXDO 3ZRVA 4UVBA 1ZU8A 4LF4B 3ABLB 2GSMB 2ZNJA 2Q5AA 1L1PA 4JV5O 2ETNA 4Z2WA 2E75B 4FZ1A 2DYSC 4MW3A 3H9VA 1H2KA 1GK9A 3F7YC 2E5LB 1E15A 3IHZA 2IH1C 5E79Z 2XASA 3PJSK 1HKMA 4PA7A 1WAWA 2QR4A 5FPOA 2XPAA 3ARXA 3EY6A 3QTCA 1OCRB 3AG2C 4D6TH 5L3EA 5HW8A 3MDSA 2A06H 2UUBO 2PBCA 1IDSA 2B31A 1ZWIC 2G41A 2YDEA 4DZ2A 4I55B 4W4KA 4PDMA 4QIBA 1LUVA 1BHAA 3K9AA 1FKJA 4ZOLA 1K97A 3M99B 1AR4A 5JVDA 4U7OA 1PL0A 1D5NA 1V9PA 3UKMA 5IYDO 2EIMB 4O2BB 5LHIA 4KHPO 2HKOA 2OCHA 1N32O 4JV5B 2IUZA 4TW6A 3KAHA 2VCDA 4UUJC 1P49A 3VQWA 2F23A 1D5AA 4IYIA 1J4IA 2BSKA 4O4HA 2CTPA 4QIWF 3WH0A 3ICXA 2HVKC 1YF2A 2UUBB 3RYCA 5IT9N 3K5NA 4I9QA 1U79A 3B9DA 2EIKB 1SQQH 5J9PC 4DH0A 1LG1A 3ARUA 3JAMN 3RN4A 1V55B 4OPAA 3VBBA 1YZBA 1OCOB 2QKSA 4O4LB 1J4RA 3ZHTA 3CCRV 2ZNIA 3K08A 1LL6A 3FY1A 5HWCA 4KHPB 1SA0B 1N32B 3LUTB 2A3CA 3SGIA 1BSMA 4HNAA 1JNSA 2QE7G 4O2AA 4ITZA 2F43G 2WLIA 1B6CA 1XI1A 1MG1A 3VQVA 2E76B 2YI8A 3ZMTA 3O5QA 1BKFA 2P6JA 2ADPA 1QLEB 4TYOA 1XUQA 4GYCB 3ML0A 4I5SA 1D7HA 1ZL1A 1L0LH 1AR1B 1K3EA 4IQCA 3B7XA 4IT6A 4G50A 5L3GA 2KKWA 3W7UA 4Z2IA 2PY5A 2R9IA 3D3IA 2ZIMA 1GM7A 3E83A 1H0GA 5J2UA 2ARHA 4DR1O 3ARTA 4IPXA 4X1IA 1BGYH 4XBFA 2ZDIC 4W9PA 3OD4A 2XP5A 4U3FH 2CE4A 4XDJA 1NR1A 4BWAA 4R7CA 1DF5A 1VQ8V 3B9EA 3ALFA 3OR6C 1ZL8A 1TUBB 2EJ7A 1W1VA 3NTPA 2QEXV 3CC4V 4JTAB 4PHZA 3GTYX 5LOVA 1NWRA 3TGUH 1GN4A 2E74B 1BMFG 1N1AA 2RSEA 2UUCO 4MPKA 4QPJA 4X20A 1JFFA 1PBKA 1PNLA 3MHHC 1QVFU 2ZR3A 2P5OA 2JK5C 4DR1B 3VQYA 4URIA 3QO8A 4MTOA 2PGGA 4LF5O 4IGGA 2YXHA 1EFRG 1S5LZ 1FFTB 3BA8A 2UXXA 4LF9O 4F6RA 2M08A 3L71H 3ARPA 4ZI7A 4JAAA 1F4NA 3AG4C 2ATKC 1E79G 2UUCB 2ITCC 1EYMA 3CSXA 5J2TB 3X2QC 3JAKA 1WB8A 4WFFA 3G6LA 1VF8A 5KHJA 3CCQV 1FKBA 2XAGA 3OMAB 2NLJC 3G67A 4LF5B 3CMAV 3TDBA 3R65A 2DG3A 4GT1A 3GPKA 4FM0A 2KO7A 3JALA 4AILC 4LF9B 3FAPA 5I98A 2LFRA 3RFWA 3ARYA 1XHXA 5EYPB 1XOUA 5EBLC 4Z2JA 5CA0A 5KHIA 4FLTA 3OE7G 5GTIZ 4WKAA 4P8UA 5IJ0A 5L3CA 1D7IA 4U86A 4TUYB 3CCLV 4E4EA 1E6NA 1Q82W 1THZA 5H6QA 2ZIOA 4IIJB 5KA6A 4DXWA 2W0XA 4JF3A 3C90A 1W9VA 4F6EA 4ODKA 2FYUH 1X6LA 1E6PA 2OIEA 4NZCA 1H8HG 3DXRA 1IXBA 1AP6A 1F51A 1PV0A 2IBZH 2Y4UA 1P4RA 2ZQMA 1WP7A 4QT3A 1G8MA 3LUOA 3HPLC 2DG4A 3HKBB 2GTAA 3RYHB 3OW2U 2GHYA 1B06A 4RQFA 2NN4A 3OEEG 2UU9O 2IU0A 2B1GA 2L2SA 3O5IA 1M56C 4ODPA 3WB1A 2ILMA 4I55A 2X0LA 1UPGA 1SZTA 4DV6O 4OXSA 1KD1W 3ZHSA 1Q5OA 2XP4A 2KR7A 5IY5B 4O2BA 4R5EA 5GTHZ 5A2QN 4JPRA 4MTFA 3CCSV 4UCOA 4WJXA 1JJ2U 5B1BC 2P4VA 2UU9B 1UR8A 1NJIW 1GUVA 3ZHQA 2NNUA 3O5OA 4UB6Z 2ZXWC 3CC2V 1KFWA 1HKIA 2FAPA 5DM6V 2CTWA 4CC6A 1RPOA 4DWSD 1KU9A 3IJ4A 1SS3A 4DV6B 4AY1A 2ZR6A 1T5EA 3AG1B 4O4LA 1Z5VA 3W7TA 2A3AA 2G8ZA 3K5OA 4P8VA 4IHJB 1SA0A 5FPRA 3UI4A 1ROTA 1VF7A 4DRIA 1NH2B 1Q6UA 3KCXA 3ABMB 2F4EA 1FPOA 1ZSPA 3UQBA 2WLYA 4UCUA 2YIBD 1RD6A 3ZHVA 5KAIZ 4BR6A 4JFLA 4NR1A 2RUQA 4TQDA 1OCZC 4H44B 2QM7A 2QTSA 3RBZA 1ITXA 3PRAA 4TW7A 2MLZA 2PI5A 1Y67A 2JGUA 1FXKC 3HKDB 3CHCA 3JCZA 1AR5A 2Z5UA 2GTSA 1O9GA 3L74H 2Y78A 3JYCA 3H9RB 2AXTZ 1N8RW 1WNOA 1WAZA 1VQOV 2N05A 2N74A 2YI9A 4GUNA 4CS2A 5D5PA 4FM2A 3JAWB 5B1AB 3UT5B 1GOIA 2DW4A 1JQ0A 2Q7GA 2P90A 1FKKA 2WLHA 5B8IC 2DMXA 3APQA 1DLBA 1TUBA 4U7NA 1SZXA 5JH8A 2QWPB 1BHBA 4DWSC 1URFA 4DRNA 2HVJC 3UI6A 4MVQA 3ZEDA 4ML4A 3D36C 5JH7B 1E1RG 3LSSA 4H37A 5H2FZ 4MVMA 2CAZC 2F21A 3JD2A 3RGBA 2A79B 4B3RO 4FIPC 4WK9A 3O5MA 2ZR4A 1KMIZ 1XREA 3K04A 4J11A 1NWUA 3SJQC 2XP7A 3T4DA 2JIZG 3RVZA 3ZCCA 3CGNA 1K92A 5GPGA 3W7XA 4ICGA 4QE9A 3ARWA 1CTNA 3LDCA 1MOFA 2DOSA 1EZJA 2QA4V 3BXWA 1JX9A 2DYRB 3WB2A 1E6ZA 1VQKV 4DYLA 1AI5A 3ETGA 3ZMZA 3KAGA 5L3BA 2RCVA 1GKFA 4X1KB 1FAFA 4LNUB 3P3PA 4Q6GA 1XMQB 4UDMA 3FB6C 2M7WA 5J2TA 4B3RB 1NT2B 1BE3H 3ZRWB 2VRZA 1N36O 4ZPTR 1AILA 4LAXA 2CTRA 5LXTB 2F4VO 4ODMA 4DR3O 5JWPA 3CH9A 2FKXA 1TFVA 1E1QG 3OUSA 2UXNA 2ZE7A 5EYPA 3HKEB 1GN3A 4DUYO 4QNHB 3WG7C 4DW1A 1YXBA 1YJWV 1US6A 5IYZB 2PV2A 4H0LB 4UCRA 3P32A 2WLKA 4TUYA 3OFNG 2H94A 4JZ2A 1VQ6V 2PI4A 1AVMA 2F93B 4IIJA 4Q20A 1KP2A 3ARZA 1N36B 2EBOA 1F40A 2MLXA 2F4VB 3ZX6A 4DR3B 4ZIBA 3KABA 2E3CA 5F2VO 4NNRA 2XUMA 4NTXA 2IJKA 1S76D 4DRKA 3LSUA 4PI0A 4LAYA 1ZBWA 1MA1A 3HKBA 1PKXA 3WD4A 1SERA 4U85A 4HARA 1FS0G 3E8FA 2LP7A 4X64O 2WK2A 3T1YO 3VAWA 1XDCA 2RQ6A 2XNDG 1R73A 4PDVA 1BCCH 1I94O 1DK1A 2JJ1G 1QVGU 4DK0A 4FPPA 5KAFZ 4LWSB 3S3WA 4J80A 1HW7A 2VQFO 1R6KA 2ZINA 3JD3A 2IF4A 1LUWA 4YJ2B 2OIGA 1IZ3A 1Q81W 4J9YB 2F1MA 4JFKA 3K06A 1AI4A 1FKRA 1N0NA 2YS8A 2N87A 1Z5WA 3B9AA 4I4TB 5HT1A 2FMLA 1R3LC 4X64B 1HXVA 2GUZB 3T1YB 4L72B 3TJTA 5B1OA 1I94B 3AG7A 3KAFA 4H13B 3M8AA 4DRHA 4CS3A 1XILA 4U84A 3S3XA 4DRQA 2AZ0A 2M2AA 3ZMVA 1S3JA 2F66C 2VQFB 4XAKA 3N2GA 3T1HO 5H6RA 1QNMA 1NVPD 3RT3C 2QWOB 4W5UA 1XEQA 1CXZB 4IHJA 2M6YA 3UQAA 4Z1MG 3CGMA 1PINA 3OUFA 3BFRA 4WKFA 3K3WA 3ZMSA 3G4SV 2LJ2A 3TK1A 3ABUA 5JJEB 1FFRA 4Z2KA 2LKNA 3ZRXA 5BZBA 4AHCA 4DROA 1SQPH 1H0IA 4OPHA 1O6IA 3T1HB 4YHHO 1FXHA 4DRXB 3RM9A 4DR6O 4N23A 3HKDA 4X1YB 1WA8B 3AROA 2MW2B 3W4RA 2PPNA 4DT4A 3CRMA 3EFFK 1QLNA 4JYCA 1VF6A 4Z1VA 3AEIA 1Q7YW 1AJPA 3JAWA 4ZPWR 3UT5A 3ZHUA 1GN6A 3NI6A 1W1TA 1K8AW 4NTWA 4HYOA 1R9HA 4MAVA 3E89A 5B3SB 3NR7A 4KUMA 1EIBA 1MSDA 3WU2Z 5JH7A 1W26A 1OZ0A 3JSLA 2P4KA 4CH6A 5BXJA 4DK1A 1WNSA 5CA3A 4YHHB 3CHEA 2DWDC 2Q9LA 1HKJA 1W1PA 4DR6B 1W1YA 4N19A 1KB9F 1H2LA 2XP6A 3O5FA 4I9WA 4PI2A 5LHGA 3UQ8A 1K7DA 1RM1C 1FKAO 3CZ8A 2CTQA 2HG5C 2UUAO 1GM8A 2EINB 4CH5A 1E9LA 2PZSA 3I56V 5HW6A 3G6EV 1KQSU 2XP8A 3CCMV 3WKZA 3WB0A 5E1AC 4X1KA 2P22C 4B3MO 4LNUA 4MNKA 4JAUA 1P7GA 3RYIB 4JGSA 2OCCC 4MT8A 1AP5A 3UO3A 3ZRWA 3WD0A 1M9NA 2WAMA 5BXZA 4ZHQB 5LXTA 3FX7A 1MABG 1OWQA 1IVSA 1NR7A 2VS0A 4JYSA 4R0XA 1ZAUA 2RURA 1LR1A 2UUAB 1Y74B 3HKEA 4J9ZB 1QU7A 2W6JG 5KX5B 1M93A 2R9RB 1AI7A 1BZKA 2WA3A 4TT3G 4WFEA 5IYZA 2Z0AA 2IW5A 3B2EE 3GWOA 2EIJB 2PI6A 5LP6B 4B3MB 4X89A 2PUSA 1S77D 2IU3A 1JVMA 4NXMO 4LF8O 4JZGA 4LAVA 1Z2GA 4FZ0A 4GGQA 1XHZA 5K1PA 2FDMA 2DT3A 4EEQA 3FXYA 2EULA 2EX3A 3E8BA 1G1XB 5DF0A 3SPCA 1QBZA 3BVOA 1MZEA 3H1LH 3WIJA 1QR8A 1KP3A 2L35A 2DJVA 3ARRA 4FAPA 2Z3YA 4JI2O 3OM3B 4UCSA 3K59A 4GZRB 1YTFB 3TXSA 1UFIA 1WP8A 3CCUV 4NXMB 4LF8B 5LGTA 2EILB 3DC5A 5LGUA 4TSFG 4HBEA 3W7WA 1RSOB 1PM9A 3OT7A 2W0FC 1H2GA 4LWSA 4S3JA 4IYHA 3BHPA 3JCUZ 1N34O 4YJ2A 2OT5A 3CD6V 3RWRD 2BTQB 2LGQA 3JASB 3U10A 2ZE8A 4JI2B 4Z2HA 5FL7G 4LFBO 5HBFA 4MNJA 2QDOA 1M57C 1JNTA 3J80N 1YW5A 4I4TA 3TETA 3T2MA 2GUZA 3D8CA 1U97A 1KBHA 1EN4A 3CXCU 1EQ3A 1FKTA 3T4ZA 3FAVB 2CDYA 4ASUG 2DSVA 4HBNA 4L3NA 2M1IA 2VWKA 1FKGA 5KMGB 1NI8A 2WLMA 1W0KG 1N34B 1YI2V 3UI5A 1Y6XA 3SYAA 4DV1O 4W9OA 1JCHB 1VMGA 1LL7A 1XMOO 4LFBB 2XAHA 4GCZA 3CJHB 1OJHA 1SKVA 2GV9A 4PD4F 2QWQB 4YY3O 1F7YA 4X8AA 3MAQA 1PP9H 4UCVA 1OCCC 1S0VA 5LA6B 1H2SB 2X7RB 2DSUA 5IE9A 2R9AA 3AS0A 2DQ0A 2WWWA 3ABLC 3CPWU 1LQ0A 3JARB 4J41A 4UVCA 3O65A 1YHQV 1NTZH 3BPZA 4BIUA 3B40A 1G4YB 1ROUA 3OGIB 4QZVB 4DRPA 2UZ5A 1EN6A 1OCRC 2ITDC 1B3QA 4DRXA 3DC6A 1UJWB 3JYMA 4J7JA 2JDIG 3RVYA 3T1CA 4DV1B 4X1YA 1WA8A 4G27B 4WFGA 2H8PC 4FM1A 1XMOB 3QO7A 4ZBMA 3CX5F 1BL8A 1IBLO 1B04A 4YY3B 4MVSA 4GX1A 3E22B 4RWUA 4BIOA 2LPVA 3G80A 4W4LA 4PV1B 2EIMC 2YXLA 1EZVH 2IJIA 1Q3EA 1DGSA 4YJ3B 3KG2A 4YXWG 4O4IB 4PELA 3UM7A 4H33A 2PV3A 4K8ZA 1NWTA 2JS3A 2X6AA 4GX2A 5FNVB 2EIKC 1OGGA 4FLYA 2O9OA 4NKGB 3ZS8C 1IBLB 4CC5A 1V55C 2YIDA 3KAIA 4KR0B 4XDKA 1Q6HA 1VQPV 4J7KA 4BF8A 4MNLA 2B1IA 1H2NA 1W9UA 1OCOC 4WFBV 1R6TA 3MHSC 3E8GA 4S3KA 2MK3A 1V54B 4NVPA 1VF5B 1AJQA 4B3TO 4EB6B 2ZR5A 2QM4A 5JCOA 3AG3B 2Y69B 1HNXO 5IWAO 1FKIA 1QLEC 3K57A 3C3TA 3RYIA 4BW5A 3MD0A 2OTJV 1D6OA 3WFVA 4NXNO 1YJNV 1QCEA 2F95B 3ASNB 4JTCB 4ZHQA 4R6ZA 4DUZO 2XP3A 2Y48A 2VWJA 1CEZA 2V1DA 2GBOA 1Y74A 3KADA 1GM9A 1NMVA 1LNQA 4UFZA 4DV0O 4U3JB 2AGAA 4B3TB 1YEWA 3KKYA 3SJBC 3CC7V 1HNXB 1D7JA 4NSBA 5LP6A 4N21A 1I0HA 5IWAB 3GVMA 1ZK6A 1CPYA 2Q67A 1P7BA 4FMTA 1IBMO 1J6YA 3OA5A 2EZPA 4NXNB 5DO2A 1NKDA 3TCUA 4CBCA 1VQ9V 1Q90D 3LDEA 3UQIA 3B77A 4GX0A 3RW0A 2DYSB 4DUZB 1FKSA 1VIBA 1UR9A 3QG5A 2JVDA 4E2LA 1A7XA 3CCEV 4B3SO 3AG2B 1FXVA 2PYLA 4DV0B 1F23A 1ZLZA 3F5TA 1XMQO 5LBQA 4R8CA 1JNDA 1ZCNA 1X59A 3IFXA 4WBNB 4FLZA 4DR2O 2FB5A 5GPRA 5IDJA 2RJZA 3ZN1A 1Q8IA 3CHXA 3OMNB 1IBMB 1X6NA 4IQ2A 1W59A 1AROP 1W2BU 1RSOA 3HB3B 3K0DA 2RUCA 2XOKG 5IYBO 1YCIA 4KXRA 1ZBVA 1TAEA 1GRJA 3JATB 4LBEC 3L72H 5B5EZ 4X65O 1K73W 3ARQA 4B3SB 3ETEA 2WLLB 4O4JB 4Z2GA 3JASA 3ASOC 3JSNA 4LFCO 2AOSA 3WQWA 2DT0A 2PV1A 3SJCC 1JOYA 1LG2A 4K3AA 5BY1A 4DR2B 1Q6IA 1R3KC 4DV5O 3O5KA 3OGCC 3LNNA 3GWKC 1XNRO 4LCUC 1HNWO 1R6NA 3FAVA 1Q43A 2PPPA 2IM9A 5EZYB 3KZIZ 3IGAC 3OEHG 5EK0A 3SPGA 1ORQC 3RGCA 2LQTA 4QGPA 3K5LA 2EZOA 3K9SA 5KMGA 4X65B 1SQXH 3K58A 1XHGA 3WD3A 4AI8A 2AZ2A 4RUEA 1S5HC 1LL4A 4LFCB 4KP4A 1JCHA 3BCCH 1K33A 4MTXA 3O5PA 2Q0AA 3JYJA 2HEPA 4FN2A 5CA1B 4DV5B 3CJHA 3CS5A 3JD0A 5D75A 2RNBA 1M5YA 1K5QA 3A8TA 1N33O 2P7TC 2LGOA 2IH3C 3H1JH 1XNRB 3NRKA 2BCCH 1HNWB 4TV8B 3JARA 1FAPA 1P5QA 1EDQA 1LJYA 1FFXB 3HR0A 1H2MA 4LP8A 3FFQA 1OHHG 1NH2D 2YSUB 1W9PA 3OTFA 3RYHA 5LGNA 1NH6A 5DN6G 4LGXA 1MSWD 4FFKA 2YC0A 1JMKC 4NYKA 1VQ5V 1WJZA 2LJ4A 4F4LA 3TCZA 1COWG 2HFEC 3E2EA 4NB5A 4PDLA 3CRCA 1P84F 3J7AU 4FLUA 3E22A 1S5JA 1N33B 1QQCA 2ZM6O 2XAQA 5IY5C 3IAYA 3W7SA 1HJVA 1NTMH 4JI8O 1FJGO 1NBMG 4TOIA 5CB4B 3AS1A 3SJAC 4YJ3A 2L6LA 2PF4E 1VQLV 3TXQA 1DF4A 4O4IA 4CS4A 2YUAA 5EBMC 1OV9A 4DRJA 1H38A 5FNVA 2YIAA 2XT9A 2A0LA 1JA8A 2OWOA 2PN0A 2JZVA 3CRQA 2Q6AA 4RQEA 1GTOA 4JFMA 3AG4B 4KFMA 3I5DA 1PL4A 4PA6A 2ZM6B 2A3EA 5KUMA 3AG1C 1HKKA 2RDCA 2ZT9B 2QF8A 3X2QB 4P30A 4JI8B 2Y0IA 4QT2A 4RUFA 4EB6A 1FJGB 3WQVA 3A0BZ 2KG7B 4FVMA 3RM8A 3ABMC 1QPFA 3FYIB 3IC9A 2OYQA 4GKJB 4B7KA 2D2CB 4LF7O 2VQEO 4P8WA 2A9HA 2UXBO 1U96A 4J10A 3EHBB 3EVKA 2JEUA 3KACA 2Q73A 2BOCC 2ZQSA 1OGBA 2ZKOA 4G2KA 2V7QG 4X66B 4JFIA 3R66A 3A2FA 5BR8O 1BQ0A 4U3JA 4DR5O 5KUKA 1VF6C 1K5SA 2Q8VA 4QPKA 5B1AC 3QVNA 2PTMA 4JI6B 3RM4A 3N2KB 1YVWA 5HFLA 3WL0A 4LF7B 2DWEC 2VQEB 2UXBB 1BQZA 4CH3A 1MZFA 5KHGA 4JTDB 2UXCO 1I08A 3ARSA 1ZTEA 1VQMV 1NWSA 5LMUO 2WSSG 2R72A 2ZCEA 2ZE5A 2DSWA 3OTOO 5BR8B 2WPDG 2Q5ZA 3JD4A 2HR3A 3BMBA 2KQXA 3EXAA 5JQGB 4DR5B 1M56B 2DSZA 1WLEA 4BAYA 4WBNA 3IKDA 3P30A 2QTOA 4Z2LA 3CXHF 1AI6A 3BEHA 2RUDA 1B6QA 2UXDB 3ARVA 1RP3B 1KT0A 4DIPA 4GIVA 4G28B 3OMIB 2DYRC 2ZQUA 2JJ2G 4JI5O 1SQBH 2UXCB 4X9QA 3L70H 3O5DA 1FYJA 4WKHA 4C7UA 5LMUB 3JATA 3BAAA 3ZHRA 3OTOB 3SYPA 5B1BB 3ZMUA 1SQVH 2K1EA 5DEZA 4I50B 2WLLA 4QJFB 4O4JA 1BT8A 2ZXWB 2YEVB 4CH4A 3CCJV 5DITA 4EFBA 1CP9A 1JJOA 3APOA 1WPXA 4UV8A 4UXNA 5GONB 1R1BA 3L73H 1J4HA 3B09A 2PPOA 2D9FA 2GDSA 3U0ZA 4FFBB 4JI5B 5EZYA 5FLXN 2KE0A 1WN7A 4JI3O 3ABKC 1GMGA 4C02B 3GB7C 2RN9A 2Q4PA 3AK1A 4PJ0Z 2DG9A 2NR5A 3I55V 2BTOA 1S72V 1EHNA 4TWKA 3QF7A 5CA1A 5B66Z 2DT1A 1OCZB 3J81N 4RAIA 4LAWA 1SC5B 2A7WA 3STLC 2Q0OC 4J4OA 3ZIAG 1IBKO 1FXKB 3A0HZ 4TV8A 5AG2A 3UF8A 4MW8A 3O5JA 1EBOA 4JI3B 5LMNO 1FFXA 2CGOA 3UCSC 1QPLA 1ZUQA 2ZDIA 1HP8A 4FK5C 1IX5A 2ITKA 4XDLA 4TW8A 2HJFC 1ZX3A 5KHKA 2XTAA 3SDLA 1M90W 4EKWA 3DGEA 4DWSB 3AK3A 2HLDG 3HKCB 1E6RA 3K79A 3A0RA 3E35A 5KA5A 1IBKB 4J7ZA 3JXVA 3SR2C 2JGDB 3FD9A 3C3SA 1YJ9V 3LSQA 3EIPA 1VQNV 1HWYA 2ODMA 5LMNB 1XNQO 3H1IH 5CB4A 3ZRSA 2H3OA 5L3FA 2MNTA 4X62O 4J4NA 3SYOA 3ALGA 2B5UB 4B08A 1SRYA 4LR3A 3B8SA 4LFAO 5EC1C 2K8IA 4MSPA 2N04A 3F5WC 4UCTA 1TA8A 4TV9B 1NS1A 5IJ9B 4DV7O 4HZ3A 1N4CA 4JASA 3QO5A 4IL6Z 4MVUA 4OGQB 3MDYB 2FKEA 3ASOB 2JS5A 1Y76B 1WB0A 3H01A 4LC1A 5HFMA 3RYFB 5JJNB 1XNQB 3PRDA 4J42A 4K35A 2KG7A 1X4TA 2YICA 4LH6A 4X62B 5H5NA 5LL6Y 2ZQTA 3ZBHA 2P67A 1GAXA 4LH7A 4KQZA 2C2AA 4BIZA 3PR9A 2XAJA 1Y0OA 4LFAB 1QR9A 3WG7B 2WA4A 4MGVA 1I7FA 4L87A 4ZPVR 1YATA 3IKGA 1NTKH 5GW7A 1IX9A 4CZZA 4DV7B 4ABMA 4DV3O 2AW9A 4FJCC 3OR7C 5H9CA 2QJ1A 5CBHA 3ETQA 2X6BA 1XL4A 4R50A 3CYOA 2FTKA 4WIWA 3BA9A 1FFQA 3P3NA 2P06A
chains in the Genus database with same CATH topology
4TYOA 5GPRA 1HXVA 1QZ2A 4L72B 4ODRA 2O92A 4TX0A 1D7HA 3KAFA 1ZL1A 3WL1A 4DRHA 4U84A 1X6NA 3AS2A 4IQ2A 3B7XA 4IQCA 4IT6A 3WD2A 4DRQA 4G50A 2M2AA 2WM0A 4HBOA 4Z2IA 1Q1CA 1HJWA 4XAKA 3TC5A 5J6EA 2RUCA 1H0GA 1ZBVA 5HT1A 3ARTA 3KZ7A 4IPXA 3KCEA 3ARQA 4W5UA 4W9PA 2XP5A 4Z2GA 1NSGA 3PA7A 3UQAA 2AOSA 3CGMA 3WQWA 3RMEA 1PINA 2PV1A 1LG2A 3B9EA 3O5KA 1Q6IA 4WKFA 3ALFA 1W1VA 3NTPA 1FFRA 4Z2KA 2LKNA 3CHDA 1NWRA 5HTGA 2F2DA 2MLYA 4DROA 2PPPA 1H0IA 1N1AA 2RSEA 4MPKA 1O6IA 1PBKA 1ZB5A 1T11A 3RGCA 3RM9A 1BL4A 4URIA 2MPHA 3WD3A 1XHGA 4DZ3A 3AROA 3W4RA 4DRMA 2PPNA 1LL4A 4DT4A 4MTVA 3O5PA 2M08A 3JYJA 4FN2A 1JVWA 4ZPWR 5D75A 3ARPA 3NI6A 1M5YA 2XPBA 1W1TA 2ZQVA 1HJXA 2LGOA 4ODNA 1R9HA 4MAVA 3G6MA 3NRKA 1P5QA 1FAPA 3O5RA 1K9TA 1EDQA 1EIBA 1EYMA 1LJYA 1W26A 3G6LA 5BXJA 3CHEA 2MF9A 1VF8A 1HKJA 1W1PA 1FKBA 4ODQA 1W9PA 1W1YA 4N19A 1NH6A 4LGXA 3TDBA 2DG3A 3GPKA 2XP6A 2KO7A 1GPFA 3O5FA 2LJ4A 3FAPA 3AS3A 5DIUA 5I98A 3RFWA 3TCZA 3ARYA 4Z2JA 3QOKA 3CZ8A 4TNSA 1C9HA 1E9LA 4WKAA 4P8UA 5HW6A 2XP8A 1D7IA 4U86A 3WKZA 1HJVA 1E6NA 1SR0A 3AS1A 4ODLA 4MNKA 1W9VA 4ODKA 1FKFA 4DRJA 2VN1A 1X6LA 1E6PA 3WD0A 3O5EA 4O2TA 4NZCA 2JZVA 1OWQA 4JYSA 2ESCA 4JFMA 4R0XA 2RURA 4QT3A 3LUOA 2DG4A 4DWSA 2A3EA 1HKKA 2QF8A 2PI6A 3O5LA 4QT2A 3WQVA 1XRVA 2L2SA 3RM8A 3O5IA 4ODPA 1F8AB 2WLZA 1QPFA 4LAVA 4GGQA 2FDMA 3CHFA 4Q7NA 2DT3A 3FXYA 4P8WA 1JNEA 3KACA 2AWGA 2DT2A 5DF0A 2ZQSA 1OGBA 2XP4A 2KR7A 4JFIA 5HW7A 3WIJA 4R5EA 2YBUA 3AQUA 3ARRA 4FAPA 1KT1A 4WJXA 5HKGA 1UR8A 1GUVA 3O5OA 1KFWA 1TCOC 1FKDA 1HKIA 2FAPA 3RM4A 3WL0A 4DWSD 4HBEA 2YBTA 4S3JA 1ZBCA 4P8XA 4AY1A 2ZR6A 3ARSA 1NWSA 2A3AA 3ODKA 2G8ZA 4P8VA 2DSWA 5GQBA 3UI4A 1ROTA 1FJDA 4Z2HA 4DRIA 5HBFA 1FKHA 1Q6UA 4MNJA 1JNTA 2DSZA 2F4EA 1YW5A 2KGJA 3UQBA 2WLYA 3IKDA 1FD9A 4Z2LA 1EQ3A 1FKTA 1RD6A 2RUDA 3ARVA 1KT0A 4JFLA 4DIPA 2DSVA 2RUQA 4GIVA 4L3NA 2KFWA 2XP9A 3PRAA 2M1IA 1ITXA 4TW7A 2MLZA 2ZQUA 1NMWA 1ZBKA 1FKGA 3O5DA 3CHCA 4WKHA 4JFJA 3UI5A 2A3BA 2Y78A 3H9RB 1WNOA 1SYTA 5DEZA 4W9OA 1LL7A 3PRBA 2DT0A 1GOIA 1D2KA 5HUAA 1FKKA 5DITA 4G2PA 5B8IC 2DSUA 4ODOA 3AS0A 5JH8A 1J4HA 4DWSC 1LQ0A 4DRNA 3B09A 1FKLA 3UI6A 2PPOA 4ML4A 4ZS6A 2KI3A 2D9FA 5DIVA 1ROUA 4QZVB 4DRPA 2KE0A 2UZ5A 2F21A 4WK9A 3O5MA 2ZR4A 4C02B 3JYMA 2OLHA 1NWUA 2DG9A 2XP7A 2DPEA 3CGNA 5GPGA 1EHNA 3ARWA 1CTNA 2LPVA 2DT1A 4W9QA 3I6CA 5HWBA 4Q22A 3BXWA 4LAWA 1E6ZA 4J4OA 4PTMA 3KAGA 2RQSA 3UF8A 3OOBA 4IT4A 3WD1A 3O5GA 3O5JA 2PV3A 4MNMA 3IK8A 1NWTA 1QPLA 4ZPTR 1IX5A 4LAXA 2ITKA 1OGGA 2O9OA 4ODMA 4TW8A 2OFNA 3CH9A 4KR0B 3KAIA 1TFVA 1Q6HA 4BF8A 1ZU8A 4MNLA 4DWSB 1W9UA 2Q5AA 1L1PA 4S3KA 1E15A 1E6RA 3IHZA 2PV2A 1HKMA 1WAWA 2XPAA 3ARXA 3EY6A 3JXVA 2ZR5A 5HW8A 2PBCA 2B31A 2MNTA 3ARZA 1FKIA 2G41A 4J4NA 4DZ2A 1F40A 4QIBA 3ALGA 1D6OA 2MLXA 1FKJA 3KABA 3B8SA 2K8IA 4MSPA 4NNRA 2XP3A 4DRKA 2IUZA 4TW6A 3KAHA 2VCDA 4LAYA 1ZBWA 3KADA 1NMVA 3MDYB 3WD4A 2FKEA 1J4IA 4U85A 1WB0A 4HARA 3WH0A 2WK2A 3PRDA 1D7JA 4NSBA 1U79A 3VAWA 3B9DA 1ZK6A 4DH0A 1LG1A 3ARUA 1J6YA 3OA5A 2ZQTA 4KQZA 5DO2A 3PR9A 1Y0OA 3UQIA 1J4RA 4MGVA 5HWCA 3FY1A 1LL6A 1FKSA 4ZPVR 2IF4A 1YATA 3IKGA 1UR9A 2A3CA 4JFKA 1A7XA 1FKRA 1JNSA 4ITZA 2N87A 1B6CA 3O5QA 1BKFA 3B9AA 4WIWA 1FFQA 1JNDA 1ZCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TYO A;  3O5G A;  1HXV A;  2ZR6 A;  3O5J A;  1QZ2 A;  2PV3 A;  4ODR A;  4TX0 A;  3IK8 A;  1D7H A;  1QPL A;  3ODK A;  3KAF A;  4TNS A;  4DRH A;  4U84 A;  4IQC A;  1C9H A;  3B7X A;  4IQ2 A;  3UI4 A;  1ROT A;  4DRQ A;  4LAX A;  5HW6 A;  1FJD A;  2ITK A;  2XP8 A;  1D7I A;  2M2A A;  4G50 A;  4U86 A;  4ODM A;  4TW8 A;  1FKH A;  4DRI A;  1Q6U A;  1Q1C A;  2OFN A;  1JNT A;  3KAI A;  2F4E A;  1YW5 A;  3TC5 A;  5J6E A;  2RUC A;  2KGJ A;  3UQB A;  1Q6H A;  4ODL A;  3IKD A;  5HT1 A;  4BF8 A;  1FD9 A;  2Q5A A;  4ODK A;  1L1P A;  3KZ7 A;  4IPX A;  3KCE A;  1EQ3 A;  1FKT A;  1FKF A;  2RUD A;  4DRJ A;  2VN1 A;  4W9P A;  1KT0 A;  2XP5 A;  3IHZ A;  4JFL A;  4DIP A;  2RUQ A;  2PV2 A;  4GIV A;  1NSG A;  2XPA A;  3O5E A;  3PA7 A;  3EY6 A;  2KFW A;  4O2T A;  3UQA A;  3JXV A;  3CGM A;  2XP9 A;  2ZR5 A;  1PIN A;  2M1I A;  2PV1 A;  4TW7 A;  2JZV A;  2MLZ A;  5HW8 A;  2ZQU A;  3O5K A;  1Q6I A;  1NMW A;  1FKG A;  4JYS A;  2PBC A;  3O5D A;  4JFM A;  4R0X A;  2RUR A;  3NTP A;  4QT3 A;  2MNT A;  4JFJ A;  3LUO A;  1FKI A;  2DG4 A;  3UI5 A;  2Y78 A;  3H9R B;  4J4N A;  4DZ2 A;  2LKN A;  4W9O A;  1F40 A;  4QIB A;  5HTG A;  2F2D A;  1D6O A;  2MLX A;  3PRB A;  2MLY A;  4DRO A;  2PPP A;  1N1A A;  2RSE A;  1FKJ A;  3KAB A;  1PBK A;  3O5L A;  2K8I A;  1T11 A;  4QT2 A;  4MSP A;  4NNR A;  2L2S A;  3RGC A;  1FKK A;  5DIT A;  2XP3 A;  4G2P A;  3O5I A;  4ODP A;  5HUA A;  5B8I C;  1BL4 A;  1F8A B;  4DRK A;  2MPH A;  4ODO A;  4TW6 A;  1QPF A;  4LAV A;  3KAH A;  2VCD A;  4DZ3 A;  4LAY A;  1J4H A;  3KAD A;  4GGQ A;  4DRM A;  1NMV A;  4DRN A;  3B09 A;  2PPN A;  1FKL A;  4DT4 A;  3UI6 A;  2PPO A;  3MDY B;  2KI3 A;  2FKE A;  2D9F A;  1J4I A;  4U85 A;  3O5P A;  5DIV A;  2M08 A;  3KAC A;  3JYJ A;  3WH0 A;  4FN2 A;  1ROU A;  1JVW A;  2AWG A;  4DRP A;  2KE0 A;  3PRD A;  1D7J A;  2UZ5 A;  2ZQS A;  5D75 A;  1U79 A;  3VAW A;  2F21 A;  2XP4 A;  3NI6 A;  2KR7 A;  1M5Y A;  2XPB A;  4JFI A;  3O5M A;  2ZR4 A;  4C02 B;  1ZK6 A;  3JYM A;  4DH0 A;  5HW7 A;  2ZQV A;  1J6Y A;  2LGO A;  4ODN A;  1R9H A;  2ZQT A;  3NRK A;  4FAP A;  1KT1 A;  1P5Q A;  1FAP A;  2DG9 A;  2XP7 A;  3O5R A;  1Y0O A;  5HKG A;  1EYM A;  1W26 A;  3CGN A;  1J4R A;  3UQI A;  4MGV A;  5HWC A;  5BXJ A;  3O5O A;  1FKS A;  5GPG A;  2IF4 A;  1YAT A;  3IKG A;  2MF9 A;  2LPV A;  4W9Q A;  3I6C A;  1FKB A;  4ODQ A;  1TCO C;  4JFK A;  1A7X A;  1FKD A;  4N19 A;  5HWB A;  1FKR A;  2FAP A;  4LAW A;  4ITZ A;  1JNS A;  3UF8 A;  2N87 A;  3TDB A;  2DG3 A;  1B6C A;  4J4O A;  3GPK A;  2XP6 A;  2KO7 A;  3KAG A;  1BKF A;  3O5Q A;  2LJ4 A;  2RQS A;  3FAP A;  3O5F A;  5DIU A;  5I98 A;  1ZCN A;  3RFW A;  3TCZ A;  3OOB A; 
#chains in the Genus database with same CATH topology
 1QZ2 A;  4JI1 O;  1TVK B;  4ODR A;  2O92 A;  4TX0 A;  5TIS Z;  4EFE A;  2B9Z A;  3WL1 A;  2XAF A;  3AS2 A;  3WD2 A;  3N2K A;  1M5I A;  2WM0 A;  1E44 A;  4HBO A;  1Q1C A;  2PYJ A;  1HJW A;  3TC5 A;  5J6E A;  1R3J C;  4KL1 A;  1SES A;  2CH7 B;  5B3S C;  3KZ7 A;  1I5X A;  4DV3 B;  3KCE A;  1NQT A;  4UB8 Z;  3SPJ A;  4WFA V;  1K4C C;  1PD3 A;  3BRC A;  3BAB A;  4MTG A;  1NSG A;  3PA7 A;  1AB3 A;  1J95 A;  3FB7 C;  3RME A;  4I0X B;  4MVR A;  1A32 A;  5JQG A;  5IYC O;  1IUR A;  4JI1 B;  3SPH A;  4PA9 A;  5CBG A;  1SET A;  3CRR A;  1KKC A;  5CMU A;  1MNG A;  1HDJ A;  3CHD A;  5CBF A;  3CB2 A;  3STZ C;  5HTG A;  2F2D A;  1N0J A;  1KUQ A;  2EIN C;  2MLY A;  1H8E G;  3U11 A;  3ZN0 A;  2YXY A;  4MVO A;  1ZB5 A;  1T11 A;  4MVZ A;  5LYJ B;  1HNZ O;  5K1X A;  5JCO C;  5C8Y B;  3D3Q A;  1YTF D;  1BL4 A;  3SYQ A;  5BMV B;  1L1F A;  2MPH A;  1XQ8 A;  4JYB A;  5KHH A;  1SQG A;  2EJR A;  4DZ3 A;  4DRM A;  5EIB D;  3Q4H B;  1MMM A;  4GLX A;  4I50 A;  4MTV A;  2JEX A;  4DV4 O;  3KCY A;  2LW7 A;  1PNK A;  5CN0 A;  2YEV A;  4MS2 A;  1JVW A;  4RO2 A;  1VP7 A;  5A9G A;  4GX5 A;  3N2G B;  2XPB A;  1NU1 H;  4DR4 O;  2WLJ A;  3SPI A;  2ZQV A;  2G38 A;  1HJX A;  4ODN A;  4L8J A;  3G6M A;  5GON A;  2DQ3 A;  5ITZ B;  2ZE6 A;  3O5R A;  5LHH A;  1K9T A;  3H1K H;  2V4D A;  3JD1 A;  1HNZ B;  4HAM A;  3CCV V;  1JR9 A;  4FFB A;  2MF9 A;  2EIJ C;  3FKS G;  5KX5 A;  4ODQ A;  4PA4 A;  5LP6 C;  3QNE A;  3O9O A;  1KKD A;  3AK2 A;  4AQY O;  2IJH A;  1GPF A;  3CEI A;  4MSW C;  4DV4 B;  3AS3 A;  5DIU A;  1R3I C;  3K5M A;  3L9D A;  4ZKI A;  3QOK A;  3G6B A;  1TUE B;  4DR4 B;  4YIO A;  4FLW A;  4TNS A;  1F4M A;  1C9H A;  3LNM B;  2QKC A;  1Q86 W;  1AJN A;  3B4S A;  2ADQ B;  1EM1 A;  1SR0 A;  1FXK A;  4ODL A;  4K0K O;  2Q7H A;  1KC8 W;  1FKF A;  3CE2 A;  5EIB C;  4D7T A;  2VN1 A;  2AHZ A;  2QWR B;  3ETD A;  4AQY B;  2Q69 A;  4ZOL B;  3O5E A;  4O2T A;  5JVD B;  1PNM A;  2EIL C;  1DTO A;  4GKK O;  5EBW C;  2X6C A;  2ESC A;  3CWB H;  1J5E O;  4JI0 O;  3F7V C;  2A3Q A;  4DWS A;  4JI4 O;  2K9P A;  3D36 A;  4WFH A;  2CK3 G;  3HKC A;  2W6I G;  2BSK B;  4O4H B;  1NVP B;  4OX9 O;  1RPR A;  2R70 A;  3O5L A;  3RYC B;  2Q68 A;  1RFY A;  2JGD A;  1XRV A;  2CUG A;  1M4U A;  2AHY A;  4K0K B;  3VOU A;  3RFR A;  4PDR A;  2BTQ A;  1F8A B;  3UO2 A;  2WLZ A;  2BOB C;  2ZD9 A;  3G71 V;  1XBL A;  3CHF A;  3L75 H;  4Q7N A;  1VEW A;  3CP1 A;  1RM1 B;  1JNE A;  2B5U A;  1D2D A;  2QM8 A;  3LDD A;  4JI7 O;  1KEC A;  4FLV A;  4GKK B;  2YIB A;  2DN9 A;  5KLV H;  2AWG A;  2DT2 A;  2FL4 A;  1J5E B;  4HNA B;  4JI0 B;  4LF6 O;  2Y0P A;  4O2A B;  5B1N A;  5HW7 A;  2WLI B;  4TV9 A;  5IJ9 A;  4QE7 A;  4JI4 B;  1QHT A;  2YBU A;  3AQU A;  1KT1 A;  2OTL V;  4OX9 B;  2HP8 A;  1VAR A;  5HKG A;  4UVA A;  1SQF A;  2CGN A;  3DSQ A;  5C93 A;  4P9O A;  1Y76 A;  2Q7E A;  2OCC B;  1XL6 A;  1BS3 A;  1I5Y A;  3RYF A;  3H1H H;  4JYA O;  1TCO C;  2QSA A;  1FKD A;  2XHB A;  2HJD A;  1EN5 A;  1K4D C;  5EC2 C;  4K8X A;  4JAV A;  4WF9 V;  2YBT A;  3E8H A;  1WPB A;  5LA6 A;  4JI7 B;  1ZBC A;  5J2U B;  4P8X A;  3B8M A;  2LGW A;  4X1I B;  4LF6 B;  2LO1 A;  3ODK A;  1W0J G;  3ABK B;  2RMK B;  3BY6 A;  4DW0 A;  1YDX A;  5GQB A;  3CRA A;  1FJD A;  1FKH A;  4A5U B;  2HHH O;  1ZL8 B;  1GH6 A;  2KGJ A;  4DR7 O;  4BW9 A;  1FD9 A;  5D5Q A;  4JYA B;  1IXM A;  1TVK A;  1SF9 A;  1GN2 A;  5LOV B;  3ABT A;  3DTU B;  1M1K W;  3K0G A;  5DEC A;  4DUY B;  1WB7 A;  4X20 B;  1JFF B;  2KFW A;  2O57 A;  2XP9 A;  2LW1 A;  3CME V;  2D3O W;  2DE0 X;  4P9P A;  1NMW A;  1K9M W;  3N27 A;  1ZBK A;  2IJJ A;  2KSD A;  1VQ4 V;  2LFS A;  2CH7 A;  4JFJ A;  1ROP A;  2A3B A;  3NXS A;  5DED A;  4FLX A;  1SYT A;  1YSC A;  3PRB A;  4F6R B;  2QWN B;  4NTY A;  2HHH B;  2BE3 A;  1L8D A;  1Y66 A;  4YIP A;  1Y4M A;  4I0X A;  4ZI7 B;  2QGN A;  4DR7 B;  1D2K A;  3SYC A;  5HUA A;  3THO A;  3ZJZ A;  4DV2 O;  4GKJ O;  4G2P A;  3M7M X;  4ODO A;  2Y4T A;  5L3D A;  1FKL A;  1HR0 O;  1TGO A;  4ZS6 A;  4WCE V;  2KI3 A;  1KYO F;  3JAK B;  4X66 O;  5DIV A;  3PN1 A;  1V54 C;  3OAA G;  5LYJ A;  5C8Y A;  3B8N A;  4B7E A;  1G6U A;  3AG3 C;  2Y69 C;  3FB5 C;  5BMV A;  1M57 B;  2OLH A;  2QKA A;  3JAL B;  1O9H A;  4I7Z B;  1K34 A;  1NZ6 A;  1YIT V;  3Q4H A;  2DPE A;  4DO2 A;  1YIJ V;  1VQ7 V;  2JRI A;  4JI6 O;  5CA0 B;  4DV2 B;  4P2Z A;  3VQX A;  3IC7 A;  4LF4 O;  4W9Q A;  3I6C A;  3ASN C;  5HWB A;  4Q22 A;  2KB1 A;  3K03 A;  3GU0 A;  4PA3 A;  5IJ0 B;  2E5L O;  1HR0 B;  4PTM A;  2ZR2 A;  3FYE B;  2RQS A;  4UV9 A;  5ITZ A;  3E86 A;  3OOB A;  4IT4 A;  3WD1 A;  3O5G A;  4X88 A;  1GO3 F;  4MNM A;  3IK8 A;  4TQF A;  1JPX A;  1ENV A;  4D7S A;  2WLN A;  3FB8 C;  1L0N H;  1OCC B;  4IT5 A;  3DXR B;  5JJJ B;  4JYY A;  2OFN A;  1PPJ H;  2UXD O;  3ZRV A;  4UVB A;  1ZU8 A;  4LF4 B;  3ABL B;  2GSM B;  2ZNJ A;  2Q5A A;  1L1P A;  4JV5 O;  2ETN A;  4Z2W A;  2E75 B;  4FZ1 A;  2DYS C;  4MW3 A;  3H9V A;  1H2K A;  1GK9 A;  3F7Y C;  2E5L B;  1E15 A;  3IHZ A;  2IH1 C;  5E79 Z;  2XAS A;  3PJS K;  1HKM A;  4PA7 A;  1WAW A;  2QR4 A;  5FPO A;  2XPA A;  3ARX A;  3EY6 A;  3QTC A;  1OCR B;  3AG2 C;  4D6T H;  5L3E A;  5HW8 A;  3MDS A;  2A06 H;  2UUB O;  2PBC A;  1IDS A;  2B31 A;  1ZWI C;  2G41 A;  2YDE A;  4DZ2 A;  4I55 B;  4W4K A;  4PDM A;  4QIB A;  1LUV A;  1BHA A;  3K9A A;  1FKJ A;  4ZOL A;  1K97 A;  3M99 B;  1AR4 A;  5JVD A;  4U7O A;  1PL0 A;  1D5N A;  1V9P A;  3UKM A;  5IYD O;  2EIM B;  4O2B B;  5LHI A;  4KHP O;  2HKO A;  2OCH A;  1N32 O;  4JV5 B;  2IUZ A;  4TW6 A;  3KAH A;  2VCD A;  4UUJ C;  1P49 A;  3VQW A;  2F23 A;  1D5A A;  4IYI A;  1J4I A;  2BSK A;  4O4H A;  2CTP A;  4QIW F;  3WH0 A;  3ICX A;  2HVK C;  1YF2 A;  2UUB B;  3RYC A;  5IT9 N;  3K5N A;  4I9Q A;  1U79 A;  3B9D A;  2EIK B;  1SQQ H;  5J9P C;  4DH0 A;  1LG1 A;  3ARU A;  3JAM N;  3RN4 A;  1V55 B;  4OPA A;  3VBB A;  1YZB A;  1OCO B;  2QKS A;  4O4L B;  1J4R A;  3ZHT A;  3CCR V;  2ZNI A;  3K08 A;  1LL6 A;  3FY1 A;  5HWC A;  4KHP B;  1SA0 B;  1N32 B;  3LUT B;  2A3C A;  3SGI A;  1BSM A;  4HNA A;  1JNS A;  2QE7 G;  4O2A A;  4ITZ A;  2F43 G;  2WLI A;  1B6C A;  1XI1 A;  1MG1 A;  3VQV A;  2E76 B;  2YI8 A;  3ZMT A;  3O5Q A;  1BKF A;  2P6J A;  2ADP A;  1QLE B;  4TYO A;  1XUQ A;  4GYC B;  3ML0 A;  4I5S A;  1D7H A;  1ZL1 A;  1L0L H;  1AR1 B;  1K3E A;  4IQC A;  3B7X A;  4IT6 A;  4G50 A;  5L3G A;  2KKW A;  3W7U A;  4Z2I A;  2PY5 A;  2R9I A;  3D3I A;  2ZIM A;  1GM7 A;  3E83 A;  1H0G A;  5J2U A;  2ARH A;  4DR1 O;  3ART A;  4IPX A;  4X1I A;  1BGY H;  4XBF A;  2ZDI C;  4W9P A;  3OD4 A;  2XP5 A;  4U3F H;  2CE4 A;  4XDJ A;  1NR1 A;  4BWA A;  4R7C A;  1DF5 A;  1VQ8 V;  3B9E A;  3ALF A;  3OR6 C;  1ZL8 A;  1TUB B;  2EJ7 A;  1W1V A;  3NTP A;  2QEX V;  3CC4 V;  4JTA B;  4PHZ A;  3GTY X;  5LOV A;  1NWR A;  3TGU H;  1GN4 A;  2E74 B;  1BMF G;  1N1A A;  2RSE A;  2UUC O;  4MPK A;  4QPJ A;  4X20 A;  1JFF A;  1PBK A;  1PNL A;  3MHH C;  1QVF U;  2ZR3 A;  2P5O A;  2JK5 C;  4DR1 B;  3VQY A;  4URI A;  3QO8 A;  4MTO A;  2PGG A;  4LF5 O;  4IGG A;  2YXH A;  1EFR G;  1S5L Z;  1FFT B;  3BA8 A;  2UXX A;  4LF9 O;  4F6R A;  2M08 A;  3L71 H;  3ARP A;  4ZI7 A;  4JAA A;  1F4N A;  3AG4 C;  2ATK C;  1E79 G;  2UUC B;  2ITC C;  1EYM A;  3CSX A;  5J2T B;  3X2Q C;  3JAK A;  1WB8 A;  4WFF A;  3G6L A;  1VF8 A;  5KHJ A;  3CCQ V;  1FKB A;  2XAG A;  3OMA B;  2NLJ C;  3G67 A;  4LF5 B;  3CMA V;  3TDB A;  3R65 A;  2DG3 A;  4GT1 A;  3GPK A;  4FM0 A;  2KO7 A;  3JAL A;  4AIL C;  4LF9 B;  3FAP A;  5I98 A;  2LFR A;  3RFW A;  3ARY A;  1XHX A;  5EYP B;  1XOU A;  5EBL C;  4Z2J A;  5CA0 A;  5KHI A;  4FLT A;  3OE7 G;  5GTI Z;  4WKA A;  4P8U A;  5IJ0 A;  5L3C A;  1D7I A;  4U86 A;  4TUY B;  3CCL V;  4E4E A;  1E6N A;  1Q82 W;  1THZ A;  5H6Q A;  2ZIO A;  4IIJ B;  5KA6 A;  4DXW A;  2W0X A;  4JF3 A;  3C90 A;  1W9V A;  4F6E A;  4ODK A;  2FYU H;  1X6L A;  1E6P A;  2OIE A;  4NZC A;  1H8H G;  3DXR A;  1IXB A;  1AP6 A;  1F51 A;  1PV0 A;  2IBZ H;  2Y4U A;  1P4R A;  2ZQM A;  1WP7 A;  4QT3 A;  1G8M A;  3LUO A;  3HPL C;  2DG4 A;  3HKB B;  2GTA A;  3RYH B;  3OW2 U;  2GHY A;  1B06 A;  4RQF A;  2NN4 A;  3OEE G;  2UU9 O;  2IU0 A;  2B1G A;  2L2S A;  3O5I A;  1M56 C;  4ODP A;  3WB1 A;  2ILM A;  4I55 A;  2X0L A;  1UPG A;  1SZT A;  4DV6 O;  4OXS A;  1KD1 W;  3ZHS A;  1Q5O A;  2XP4 A;  2KR7 A;  5IY5 B;  4O2B A;  4R5E A;  5GTH Z;  5A2Q N;  4JPR A;  4MTF A;  3CCS V;  4UCO A;  4WJX A;  1JJ2 U;  5B1B C;  2P4V A;  2UU9 B;  1UR8 A;  1NJI W;  1GUV A;  3ZHQ A;  2NNU A;  3O5O A;  4UB6 Z;  2ZXW C;  3CC2 V;  1KFW A;  1HKI A;  2FAP A;  5DM6 V;  2CTW A;  4CC6 A;  1RPO A;  4DWS D;  1KU9 A;  3IJ4 A;  1SS3 A;  4DV6 B;  4AY1 A;  2ZR6 A;  1T5E A;  3AG1 B;  4O4L A;  1Z5V A;  3W7T A;  2A3A A;  2G8Z A;  3K5O A;  4P8V A;  4IHJ B;  1SA0 A;  5FPR A;  3UI4 A;  1ROT A;  1VF7 A;  4DRI A;  1NH2 B;  1Q6U A;  3KCX A;  3ABM B;  2F4E A;  1FPO A;  1ZSP A;  3UQB A;  2WLY A;  4UCU A;  2YIB D;  1RD6 A;  3ZHV A;  5KAI Z;  4BR6 A;  4JFL A;  4NR1 A;  2RUQ A;  4TQD A;  1OCZ C;  4H44 B;  2QM7 A;  2QTS A;  3RBZ A;  1ITX A;  3PRA A;  4TW7 A;  2MLZ A;  2PI5 A;  1Y67 A;  2JGU A;  1FXK C;  3HKD B;  3CHC A;  3JCZ A;  1AR5 A;  2Z5U A;  2GTS A;  1O9G A;  3L74 H;  2Y78 A;  3JYC A;  3H9R B;  2AXT Z;  1N8R W;  1WNO A;  1WAZ A;  1VQO V;  2N05 A;  2N74 A;  2YI9 A;  4GUN A;  4CS2 A;  5D5P A;  4FM2 A;  3JAW B;  5B1A B;  3UT5 B;  1GOI A;  2DW4 A;  1JQ0 A;  2Q7G A;  2P90 A;  1FKK A;  2WLH A;  5B8I C;  2DMX A;  3APQ A;  1DLB A;  1TUB A;  4U7N A;  1SZX A;  5JH8 A;  2QWP B;  1BHB A;  4DWS C;  1URF A;  4DRN A;  2HVJ C;  3UI6 A;  4MVQ A;  3ZED A;  4ML4 A;  3D36 C;  5JH7 B;  1E1R G;  3LSS A;  4H37 A;  5H2F Z;  4MVM A;  2CAZ C;  2F21 A;  3JD2 A;  3RGB A;  2A79 B;  4B3R O;  4FIP C;  4WK9 A;  3O5M A;  2ZR4 A;  1KMI Z;  1XRE A;  3K04 A;  4J11 A;  1NWU A;  3SJQ C;  2XP7 A;  3T4D A;  2JIZ G;  3RVZ A;  3ZCC A;  3CGN A;  1K92 A;  5GPG A;  3W7X A;  4ICG A;  4QE9 A;  3ARW A;  1CTN A;  3LDC A;  1MOF A;  2DOS A;  1EZJ A;  2QA4 V;  3BXW A;  1JX9 A;  2DYR B;  3WB2 A;  1E6Z A;  1VQK V;  4DYL A;  1AI5 A;  3ETG A;  3ZMZ A;  3KAG A;  5L3B A;  2RCV A;  1GKF A;  4X1K B;  1FAF A;  4LNU B;  3P3P A;  4Q6G A;  1XMQ B;  4UDM A;  3FB6 C;  2M7W A;  5J2T A;  4B3R B;  1NT2 B;  1BE3 H;  3ZRW B;  2VRZ A;  1N36 O;  4ZPT R;  1AIL A;  4LAX A;  2CTR A;  5LXT B;  2F4V O;  4ODM A;  4DR3 O;  5JWP A;  3CH9 A;  2FKX A;  1TFV A;  1E1Q G;  3OUS A;  2UXN A;  2ZE7 A;  5EYP A;  3HKE B;  1GN3 A;  4DUY O;  4QNH B;  3WG7 C;  4DW1 A;  1YXB A;  1YJW V;  1US6 A;  5IYZ B;  2PV2 A;  4H0L B;  4UCR A;  3P32 A;  2WLK A;  4TUY A;  3OFN G;  2H94 A;  4JZ2 A;  1VQ6 V;  2PI4 A;  1AVM A;  2F93 B;  4IIJ A;  4Q20 A;  1KP2 A;  3ARZ A;  1N36 B;  2EBO A;  1F40 A;  2MLX A;  2F4V B;  3ZX6 A;  4DR3 B;  4ZIB A;  3KAB A;  2E3C A;  5F2V O;  4NNR A;  2XUM A;  4NTX A;  2IJK A;  1S76 D;  4DRK A;  3LSU A;  4PI0 A;  4LAY A;  1ZBW A;  1MA1 A;  3HKB A;  1PKX A;  3WD4 A;  1SER A;  4U85 A;  4HAR A;  1FS0 G;  3E8F A;  2LP7 A;  4X64 O;  2WK2 A;  3T1Y O;  3VAW A;  1XDC A;  2RQ6 A;  2XND G;  1R73 A;  4PDV A;  1BCC H;  1I94 O;  1DK1 A;  2JJ1 G;  1QVG U;  4DK0 A;  4FPP A;  5KAF Z;  4LWS B;  3S3W A;  4J80 A;  1HW7 A;  2VQF O;  1R6K A;  2ZIN A;  3JD3 A;  2IF4 A;  1LUW A;  4YJ2 B;  2OIG A;  1IZ3 A;  1Q81 W;  4J9Y B;  2F1M A;  4JFK A;  3K06 A;  1AI4 A;  1FKR A;  1N0N A;  2YS8 A;  2N87 A;  1Z5W A;  3B9A A;  4I4T B;  5HT1 A;  2FML A;  1R3L C;  4X64 B;  1HXV A;  2GUZ B;  3T1Y B;  4L72 B;  3TJT A;  5B1O A;  1I94 B;  3AG7 A;  3KAF A;  4H13 B;  3M8A A;  4DRH A;  4CS3 A;  1XIL A;  4U84 A;  3S3X A;  4DRQ A;  2AZ0 A;  2M2A A;  3ZMV A;  1S3J A;  2F66 C;  2VQF B;  4XAK A;  3N2G A;  3T1H O;  5H6R A;  1QNM A;  1NVP D;  3RT3 C;  2QWO B;  4W5U A;  1XEQ A;  1CXZ B;  4IHJ A;  2M6Y A;  3UQA A;  4Z1M G;  3CGM A;  1PIN A;  3OUF A;  3BFR A;  4WKF A;  3K3W A;  3ZMS A;  3G4S V;  2LJ2 A;  3TK1 A;  3ABU A;  5JJE B;  1FFR A;  4Z2K A;  2LKN A;  3ZRX A;  5BZB A;  4AHC A;  4DRO A;  1SQP H;  1H0I A;  4OPH A;  1O6I A;  3T1H B;  4YHH O;  1FXH A;  4DRX B;  3RM9 A;  4DR6 O;  4N23 A;  3HKD A;  4X1Y B;  1WA8 B;  3ARO A;  2MW2 B;  3W4R A;  2PPN A;  4DT4 A;  3CRM A;  3EFF K;  1QLN A;  4JYC A;  1VF6 A;  4Z1V A;  3AEI A;  1Q7Y W;  1AJP A;  3JAW A;  4ZPW R;  3UT5 A;  3ZHU A;  1GN6 A;  3NI6 A;  1W1T A;  1K8A W;  4NTW A;  4HYO A;  1R9H A;  4MAV A;  3E89 A;  5B3S B;  3NR7 A;  4KUM A;  1EIB A;  1MSD A;  3WU2 Z;  5JH7 A;  1W26 A;  1OZ0 A;  3JSL A;  2P4K A;  4CH6 A;  5BXJ A;  4DK1 A;  1WNS A;  5CA3 A;  4YHH B;  3CHE A;  2DWD C;  2Q9L A;  1HKJ A;  1W1P A;  4DR6 B;  1W1Y A;  4N19 A;  1KB9 F;  1H2L A;  2XP6 A;  3O5F A;  4I9W A;  4PI2 A;  5LHG A;  3UQ8 A;  1K7D A;  1RM1 C;  1FKA O;  3CZ8 A;  2CTQ A;  2HG5 C;  2UUA O;  1GM8 A;  2EIN B;  4CH5 A;  1E9L A;  2PZS A;  3I56 V;  5HW6 A;  3G6E V;  1KQS U;  2XP8 A;  3CCM V;  3WKZ A;  3WB0 A;  5E1A C;  4X1K A;  2P22 C;  4B3M O;  4LNU A;  4MNK A;  4JAU A;  1P7G A;  3RYI B;  4JGS A;  2OCC C;  4MT8 A;  1AP5 A;  3UO3 A;  3ZRW A;  3WD0 A;  1M9N A;  2WAM A;  5BXZ A;  4ZHQ B;  5LXT A;  3FX7 A;  1MAB G;  1OWQ A;  1IVS A;  1NR7 A;  2VS0 A;  4JYS A;  4R0X A;  1ZAU A;  2RUR A;  1LR1 A;  2UUA B;  1Y74 B;  3HKE A;  4J9Z B;  1QU7 A;  2W6J G;  5KX5 B;  1M93 A;  2R9R B;  1AI7 A;  1BZK A;  2WA3 A;  4TT3 G;  4WFE A;  5IYZ A;  2Z0A A;  2IW5 A;  3B2E E;  3GWO A;  2EIJ B;  2PI6 A;  5LP6 B;  4B3M B;  4X89 A;  2PUS A;  1S77 D;  2IU3 A;  1JVM A;  4NXM O;  4LF8 O;  4JZG A;  4LAV A;  1Z2G A;  4FZ0 A;  4GGQ A;  1XHZ A;  5K1P A;  2FDM A;  2DT3 A;  4EEQ A;  3FXY A;  2EUL A;  2EX3 A;  3E8B A;  1G1X B;  5DF0 A;  3SPC A;  1QBZ A;  3BVO A;  1MZE A;  3H1L H;  3WIJ A;  1QR8 A;  1KP3 A;  2L35 A;  2DJV A;  3ARR A;  4FAP A;  2Z3Y A;  4JI2 O;  3OM3 B;  4UCS A;  3K59 A;  4GZR B;  1YTF B;  3TXS A;  1UFI A;  1WP8 A;  3CCU V;  4NXM B;  4LF8 B;  5LGT A;  2EIL B;  3DC5 A;  5LGU A;  4TSF G;  4HBE A;  3W7W A;  1RSO B;  1PM9 A;  3OT7 A;  2W0F C;  1H2G A;  4LWS A;  4S3J A;  4IYH A;  3BHP A;  3JCU Z;  1N34 O;  4YJ2 A;  2OT5 A;  3CD6 V;  3RWR D;  2BTQ B;  2LGQ A;  3JAS B;  3U10 A;  2ZE8 A;  4JI2 B;  4Z2H A;  5FL7 G;  4LFB O;  5HBF A;  4MNJ A;  2QDO A;  1M57 C;  1JNT A;  3J80 N;  1YW5 A;  4I4T A;  3TET A;  3T2M A;  2GUZ A;  3D8C A;  1U97 A;  1KBH A;  1EN4 A;  3CXC U;  1EQ3 A;  1FKT A;  3T4Z A;  3FAV B;  2CDY A;  4ASU G;  2DSV A;  4HBN A;  4L3N A;  2M1I A;  2VWK A;  1FKG A;  5KMG B;  1NI8 A;  2WLM A;  1W0K G;  1N34 B;  1YI2 V;  3UI5 A;  1Y6X A;  3SYA A;  4DV1 O;  4W9O A;  1JCH B;  1VMG A;  1LL7 A;  1XMO O;  4LFB B;  2XAH A;  4GCZ A;  3CJH B;  1OJH A;  1SKV A;  2GV9 A;  4PD4 F;  2QWQ B;  4YY3 O;  1F7Y A;  4X8A A;  3MAQ A;  1PP9 H;  4UCV A;  1OCC C;  1S0V A;  5LA6 B;  1H2S B;  2X7R B;  2DSU A;  5IE9 A;  2R9A A;  3AS0 A;  2DQ0 A;  2WWW A;  3ABL C;  3CPW U;  1LQ0 A;  3JAR B;  4J41 A;  4UVC A;  3O65 A;  1YHQ V;  1NTZ H;  3BPZ A;  4BIU A;  3B40 A;  1G4Y B;  1ROU A;  3OGI B;  4QZV B;  4DRP A;  2UZ5 A;  1EN6 A;  1OCR C;  2ITD C;  1B3Q A;  4DRX A;  3DC6 A;  1UJW B;  3JYM A;  4J7J A;  2JDI G;  3RVY A;  3T1C A;  4DV1 B;  4X1Y A;  1WA8 A;  4G27 B;  4WFG A;  2H8P C;  4FM1 A;  1XMO B;  3QO7 A;  4ZBM A;  3CX5 F;  1BL8 A;  1IBL O;  1B04 A;  4YY3 B;  4MVS A;  4GX1 A;  3E22 B;  4RWU A;  4BIO A;  2LPV A;  3G80 A;  4W4L A;  4PV1 B;  2EIM C;  2YXL A;  1EZV H;  2IJI A;  1Q3E A;  1DGS A;  4YJ3 B;  3KG2 A;  4YXW G;  4O4I B;  4PEL A;  3UM7 A;  4H33 A;  2PV3 A;  4K8Z A;  1NWT A;  2JS3 A;  2X6A A;  4GX2 A;  5FNV B;  2EIK C;  1OGG A;  4FLY A;  2O9O A;  4NKG B;  3ZS8 C;  1IBL B;  4CC5 A;  1V55 C;  2YID A;  3KAI A;  4KR0 B;  4XDK A;  1Q6H A;  1VQP V;  4J7K A;  4BF8 A;  4MNL A;  2B1I A;  1H2N A;  1W9U A;  1OCO C;  4WFB V;  1R6T A;  3MHS C;  3E8G A;  4S3K A;  2MK3 A;  1V54 B;  4NVP A;  1VF5 B;  1AJQ A;  4B3T O;  4EB6 B;  2ZR5 A;  2QM4 A;  5JCO A;  3AG3 B;  2Y69 B;  1HNX O;  5IWA O;  1FKI A;  1QLE C;  3K57 A;  3C3T A;  3RYI A;  4BW5 A;  3MD0 A;  2OTJ V;  1D6O A;  3WFV A;  4NXN O;  1YJN V;  1QCE A;  2F95 B;  3ASN B;  4JTC B;  4ZHQ A;  4R6Z A;  4DUZ O;  2XP3 A;  2Y48 A;  2VWJ A;  1CEZ A;  2V1D A;  2GBO A;  1Y74 A;  3KAD A;  1GM9 A;  1NMV A;  1LNQ A;  4UFZ A;  4DV0 O;  4U3J B;  2AGA A;  4B3T B;  1YEW A;  3KKY A;  3SJB C;  3CC7 V;  1HNX B;  1D7J A;  4NSB A;  5LP6 A;  4N21 A;  1I0H A;  5IWA B;  3GVM A;  1ZK6 A;  1CPY A;  2Q67 A;  1P7B A;  4FMT A;  1IBM O;  1J6Y A;  3OA5 A;  2EZP A;  4NXN B;  5DO2 A;  1NKD A;  3TCU A;  4CBC A;  1VQ9 V;  1Q90 D;  3LDE A;  3UQI A;  3B77 A;  4GX0 A;  3RW0 A;  2DYS B;  4DUZ B;  1FKS A;  1VIB A;  1UR9 A;  3QG5 A;  2JVD A;  4E2L A;  1A7X A;  3CCE V;  4B3S O;  3AG2 B;  1FXV A;  2PYL A;  4DV0 B;  1F23 A;  1ZLZ A;  3F5T A;  1XMQ O;  5LBQ A;  4R8C A;  1JND A;  1ZCN A;  1X59 A;  3IFX A;  4WBN B;  4FLZ A;  4DR2 O;  2FB5 A;  5GPR A;  5IDJ A;  2RJZ A;  3ZN1 A;  1Q8I A;  3CHX A;  3OMN B;  1IBM B;  1X6N A;  4IQ2 A;  1W59 A;  1ARO P;  1W2B U;  1RSO A;  3HB3 B;  3K0D A;  2RUC A;  2XOK G;  5IYB O;  1YCI A;  4KXR A;  1ZBV A;  1TAE A;  1GRJ A;  3JAT B;  4LBE C;  3L72 H;  5B5E Z;  4X65 O;  1K73 W;  3ARQ A;  4B3S B;  3ETE A;  2WLL B;  4O4J B;  4Z2G A;  3JAS A;  3ASO C;  3JSN A;  4LFC O;  2AOS A;  3WQW A;  2DT0 A;  2PV1 A;  3SJC C;  1JOY A;  1LG2 A;  4K3A A;  5BY1 A;  4DR2 B;  1Q6I A;  1R3K C;  4DV5 O;  3O5K A;  3OGC C;  3LNN A;  3GWK C;  1XNR O;  4LCU C;  1HNW O;  1R6N A;  3FAV A;  1Q43 A;  2PPP A;  2IM9 A;  5EZY B;  3KZI Z;  3IGA C;  3OEH G;  5EK0 A;  3SPG A;  1ORQ C;  3RGC A;  2LQT A;  4QGP A;  3K5L A;  2EZO A;  3K9S A;  5KMG A;  4X65 B;  1SQX H;  3K58 A;  1XHG A;  3WD3 A;  4AI8 A;  2AZ2 A;  4RUE A;  1S5H C;  1LL4 A;  4LFC B;  4KP4 A;  1JCH A;  3BCC H;  1K33 A;  4MTX A;  3O5P A;  2Q0A A;  3JYJ A;  2HEP A;  4FN2 A;  5CA1 B;  4DV5 B;  3CJH A;  3CS5 A;  3JD0 A;  5D75 A;  2RNB A;  1M5Y A;  1K5Q A;  3A8T A;  1N33 O;  2P7T C;  2LGO A;  2IH3 C;  3H1J H;  1XNR B;  3NRK A;  2BCC H;  1HNW B;  4TV8 B;  3JAR A;  1FAP A;  1P5Q A;  1EDQ A;  1LJY A;  1FFX B;  3HR0 A;  1H2M A;  4LP8 A;  3FFQ A;  1OHH G;  1NH2 D;  2YSU B;  1W9P A;  3OTF A;  3RYH A;  5LGN A;  1NH6 A;  5DN6 G;  4LGX A;  1MSW D;  4FFK A;  2YC0 A;  1JMK C;  4NYK A;  1VQ5 V;  1WJZ A;  2LJ4 A;  4F4L A;  3TCZ A;  1COW G;  2HFE C;  3E2E A;  4NB5 A;  4PDL A;  3CRC A;  1P84 F;  3J7A U;  4FLU A;  3E22 A;  1S5J A;  1N33 B;  1QQC A;  2ZM6 O;  2XAQ A;  5IY5 C;  3IAY A;  3W7S A;  1HJV A;  1NTM H;  4JI8 O;  1FJG O;  1NBM G;  4TOI A;  5CB4 B;  3AS1 A;  3SJA C;  4YJ3 A;  2L6L A;  2PF4 E;  1VQL V;  3TXQ A;  1DF4 A;  4O4I A;  4CS4 A;  2YUA A;  5EBM C;  1OV9 A;  4DRJ A;  1H38 A;  5FNV A;  2YIA A;  2XT9 A;  2A0L A;  1JA8 A;  2OWO A;  2PN0 A;  2JZV A;  3CRQ A;  2Q6A A;  4RQE A;  1GTO A;  4JFM A;  3AG4 B;  4KFM A;  3I5D A;  1PL4 A;  4PA6 A;  2ZM6 B;  2A3E A;  5KUM A;  3AG1 C;  1HKK A;  2RDC A;  2ZT9 B;  2QF8 A;  3X2Q B;  4P30 A;  4JI8 B;  2Y0I A;  4QT2 A;  4RUF A;  4EB6 A;  1FJG B;  3WQV A;  3A0B Z;  2KG7 B;  4FVM A;  3RM8 A;  3ABM C;  1QPF A;  3FYI B;  3IC9 A;  2OYQ A;  4GKJ B;  4B7K A;  2D2C B;  4LF7 O;  2VQE O;  4P8W A;  2A9H A;  2UXB O;  1U96 A;  4J10 A;  3EHB B;  3EVK A;  2JEU A;  3KAC A;  2Q73 A;  2BOC C;  2ZQS A;  1OGB A;  2ZKO A;  4G2K A;  2V7Q G;  4X66 B;  4JFI A;  3R66 A;  3A2F A;  5BR8 O;  1BQ0 A;  4U3J A;  4DR5 O;  5KUK A;  1VF6 C;  1K5S A;  2Q8V A;  4QPK A;  5B1A C;  3QVN A;  2PTM A;  4JI6 B;  3RM4 A;  3N2K B;  1YVW A;  5HFL A;  3WL0 A;  4LF7 B;  2DWE C;  2VQE B;  2UXB B;  1BQZ A;  4CH3 A;  1MZF A;  5KHG A;  4JTD B;  2UXC O;  1I08 A;  3ARS A;  1ZTE A;  1VQM V;  1NWS A;  5LMU O;  2WSS G;  2R72 A;  2ZCE A;  2ZE5 A;  2DSW A;  3OTO O;  5BR8 B;  2WPD G;  2Q5Z A;  3JD4 A;  2HR3 A;  3BMB A;  2KQX A;  3EXA A;  5JQG B;  4DR5 B;  1M56 B;  2DSZ A;  1WLE A;  4BAY A;  4WBN A;  3IKD A;  3P30 A;  2QTO A;  4Z2L A;  3CXH F;  1AI6 A;  3BEH A;  2RUD A;  1B6Q A;  2UXD B;  3ARV A;  1RP3 B;  1KT0 A;  4DIP A;  4GIV A;  4G28 B;  3OMI B;  2DYR C;  2ZQU A;  2JJ2 G;  4JI5 O;  1SQB H;  2UXC B;  4X9Q A;  3L70 H;  3O5D A;  1FYJ A;  4WKH A;  4C7U A;  5LMU B;  3JAT A;  3BAA A;  3ZHR A;  3OTO B;  3SYP A;  5B1B B;  3ZMU A;  1SQV H;  2K1E A;  5DEZ A;  4I50 B;  2WLL A;  4QJF B;  4O4J A;  1BT8 A;  2ZXW B;  2YEV B;  4CH4 A;  3CCJ V;  5DIT A;  4EFB A;  1CP9 A;  1JJO A;  3APO A;  1WPX A;  4UV8 A;  4UXN A;  5GON B;  1R1B A;  3L73 H;  1J4H A;  3B09 A;  2PPO A;  2D9F A;  2GDS A;  3U0Z A;  4FFB B;  4JI5 B;  5EZY A;  5FLX N;  2KE0 A;  1WN7 A;  4JI3 O;  3ABK C;  1GMG A;  4C02 B;  3GB7 C;  2RN9 A;  2Q4P A;  3AK1 A;  4PJ0 Z;  2DG9 A;  2NR5 A;  3I55 V;  2BTO A;  1S72 V;  1EHN A;  4TWK A;  3QF7 A;  5CA1 A;  5B66 Z;  2DT1 A;  1OCZ B;  3J81 N;  4RAI A;  4LAW A;  1SC5 B;  2A7W A;  3STL C;  2Q0O C;  4J4O A;  3ZIA G;  1IBK O;  1FXK B;  3A0H Z;  4TV8 A;  5AG2 A;  3UF8 A;  4MW8 A;  3O5J A;  1EBO A;  4JI3 B;  5LMN O;  1FFX A;  2CGO A;  3UCS C;  1QPL A;  1ZUQ A;  2ZDI A;  1HP8 A;  4FK5 C;  1IX5 A;  2ITK A;  4XDL A;  4TW8 A;  2HJF C;  1ZX3 A;  5KHK A;  2XTA A;  3SDL A;  1M90 W;  4EKW A;  3DGE A;  4DWS B;  3AK3 A;  2HLD G;  3HKC B;  1E6R A;  3K79 A;  3A0R A;  3E35 A;  5KA5 A;  1IBK B;  4J7Z A;  3JXV A;  3SR2 C;  2JGD B;  3FD9 A;  3C3S A;  1YJ9 V;  3LSQ A;  3EIP A;  1VQN V;  1HWY A;  2ODM A;  5LMN B;  1XNQ O;  3H1I H;  5CB4 A;  3ZRS A;  2H3O A;  5L3F A;  2MNT A;  4X62 O;  4J4N A;  3SYO A;  3ALG A;  2B5U B;  4B08 A;  1SRY A;  4LR3 A;  3B8S A;  4LFA O;  5EC1 C;  2K8I A;  4MSP A;  2N04 A;  3F5W C;  4UCT A;  1TA8 A;  4TV9 B;  1NS1 A;  5IJ9 B;  4DV7 O;  4HZ3 A;  1N4C A;  4JAS A;  3QO5 A;  4IL6 Z;  4MVU A;  4OGQ B;  3MDY B;  2FKE A;  3ASO B;  2JS5 A;  1Y76 B;  1WB0 A;  3H01 A;  4LC1 A;  5HFM A;  3RYF B;  5JJN B;  1XNQ B;  3PRD A;  4J42 A;  4K35 A;  2KG7 A;  1X4T A;  2YIC A;  4LH6 A;  4X62 B;  5H5N A;  5LL6 Y;  2ZQT A;  3ZBH A;  2P67 A;  1GAX A;  4LH7 A;  4KQZ A;  2C2A A;  4BIZ A;  3PR9 A;  2XAJ A;  1Y0O A;  4LFA B;  1QR9 A;  3WG7 B;  2WA4 A;  4MGV A;  1I7F A;  4L87 A;  4ZPV R;  1YAT A;  3IKG A;  1NTK H;  5GW7 A;  1IX9 A;  4CZZ A;  4DV7 B;  4ABM A;  4DV3 O;  2AW9 A;  4FJC C;  3OR7 C;  5H9C A;  2QJ1 A;  5CBH A;  3ETQ A;  2X6B A;  1XL4 A;  4R50 A;  3CYO A;  2FTK A;  4WIW A;  3BA9 A;  1FFQ A;  3P3N A;  2P06 A; 
#chains in the Genus database with same CATH homology
 4TYO A;  5GPR A;  1HXV A;  1QZ2 A;  4L72 B;  4ODR A;  2O92 A;  4TX0 A;  1D7H A;  3KAF A;  1ZL1 A;  3WL1 A;  4DRH A;  4U84 A;  1X6N A;  3AS2 A;  4IQ2 A;  3B7X A;  4IQC A;  4IT6 A;  3WD2 A;  4DRQ A;  4G50 A;  2M2A A;  2WM0 A;  4HBO A;  4Z2I A;  1Q1C A;  1HJW A;  4XAK A;  3TC5 A;  5J6E A;  2RUC A;  1H0G A;  1ZBV A;  5HT1 A;  3ART A;  3KZ7 A;  4IPX A;  3KCE A;  3ARQ A;  4W5U A;  4W9P A;  2XP5 A;  4Z2G A;  1NSG A;  3PA7 A;  3UQA A;  2AOS A;  3CGM A;  3WQW A;  3RME A;  1PIN A;  2PV1 A;  1LG2 A;  3B9E A;  3O5K A;  1Q6I A;  4WKF A;  3ALF A;  1W1V A;  3NTP A;  1FFR A;  4Z2K A;  2LKN A;  3CHD A;  1NWR A;  5HTG A;  2F2D A;  2MLY A;  4DRO A;  2PPP A;  1H0I A;  1N1A A;  2RSE A;  4MPK A;  1O6I A;  1PBK A;  1ZB5 A;  1T11 A;  3RGC A;  3RM9 A;  1BL4 A;  4URI A;  2MPH A;  3WD3 A;  1XHG A;  4DZ3 A;  3ARO A;  3W4R A;  4DRM A;  2PPN A;  1LL4 A;  4DT4 A;  4MTV A;  3O5P A;  2M08 A;  3JYJ A;  4FN2 A;  1JVW A;  4ZPW R;  5D75 A;  3ARP A;  3NI6 A;  1M5Y A;  2XPB A;  1W1T A;  2ZQV A;  1HJX A;  2LGO A;  4ODN A;  1R9H A;  4MAV A;  3G6M A;  3NRK A;  1P5Q A;  1FAP A;  3O5R A;  1K9T A;  1EDQ A;  1EIB A;  1EYM A;  1LJY A;  1W26 A;  3G6L A;  5BXJ A;  3CHE A;  2MF9 A;  1VF8 A;  1HKJ A;  1W1P A;  1FKB A;  4ODQ A;  1W9P A;  1W1Y A;  4N19 A;  1NH6 A;  4LGX A;  3TDB A;  2DG3 A;  3GPK A;  2XP6 A;  2KO7 A;  1GPF A;  3O5F A;  2LJ4 A;  3FAP A;  3AS3 A;  5DIU A;  5I98 A;  3RFW A;  3TCZ A;  3ARY A;  4Z2J A;  3QOK A;  3CZ8 A;  4TNS A;  1C9H A;  1E9L A;  4WKA A;  4P8U A;  5HW6 A;  2XP8 A;  1D7I A;  4U86 A;  3WKZ A;  1HJV A;  1E6N A;  1SR0 A;  3AS1 A;  4ODL A;  4MNK A;  1W9V A;  4ODK A;  1FKF A;  4DRJ A;  2VN1 A;  1X6L A;  1E6P A;  3WD0 A;  3O5E A;  4O2T A;  4NZC A;  2JZV A;  1OWQ A;  4JYS A;  2ESC A;  4JFM A;  4R0X A;  2RUR A;  4QT3 A;  3LUO A;  2DG4 A;  4DWS A;  2A3E A;  1HKK A;  2QF8 A;  2PI6 A;  3O5L A;  4QT2 A;  3WQV A;  1XRV A;  2L2S A;  3RM8 A;  3O5I A;  4ODP A;  1F8A B;  2WLZ A;  1QPF A;  4LAV A;  4GGQ A;  2FDM A;  3CHF A;  4Q7N A;  2DT3 A;  3FXY A;  4P8W A;  1JNE A;  3KAC A;  2AWG A;  2DT2 A;  5DF0 A;  2ZQS A;  1OGB A;  2XP4 A;  2KR7 A;  4JFI A;  5HW7 A;  3WIJ A;  4R5E A;  2YBU A;  3AQU A;  3ARR A;  4FAP A;  1KT1 A;  4WJX A;  5HKG A;  1UR8 A;  1GUV A;  3O5O A;  1KFW A;  1TCO C;  1FKD A;  1HKI A;  2FAP A;  3RM4 A;  3WL0 A;  4DWS D;  4HBE A;  2YBT A;  4S3J A;  1ZBC A;  4P8X A;  4AY1 A;  2ZR6 A;  3ARS A;  1NWS A;  2A3A A;  3ODK A;  2G8Z A;  4P8V A;  2DSW A;  5GQB A;  3UI4 A;  1ROT A;  1FJD A;  4Z2H A;  4DRI A;  5HBF A;  1FKH A;  1Q6U A;  4MNJ A;  1JNT A;  2DSZ A;  2F4E A;  1YW5 A;  2KGJ A;  3UQB A;  2WLY A;  3IKD A;  1FD9 A;  4Z2L A;  1EQ3 A;  1FKT A;  1RD6 A;  2RUD A;  3ARV A;  1KT0 A;  4JFL A;  4DIP A;  2DSV A;  2RUQ A;  4GIV A;  4L3N A;  2KFW A;  2XP9 A;  3PRA A;  2M1I A;  1ITX A;  4TW7 A;  2MLZ A;  2ZQU A;  1NMW A;  1ZBK A;  1FKG A;  3O5D A;  3CHC A;  4WKH A;  4JFJ A;  3UI5 A;  2A3B A;  2Y78 A;  3H9R B;  1WNO A;  1SYT A;  5DEZ A;  4W9O A;  1LL7 A;  3PRB A;  2DT0 A;  1GOI A;  1D2K A;  5HUA A;  1FKK A;  5DIT A;  4G2P A;  5B8I C;  2DSU A;  4ODO A;  3AS0 A;  5JH8 A;  1J4H A;  4DWS C;  1LQ0 A;  4DRN A;  3B09 A;  1FKL A;  3UI6 A;  2PPO A;  4ML4 A;  4ZS6 A;  2KI3 A;  2D9F A;  5DIV A;  1ROU A;  4QZV B;  4DRP A;  2KE0 A;  2UZ5 A;  2F21 A;  4WK9 A;  3O5M A;  2ZR4 A;  4C02 B;  3JYM A;  2OLH A;  1NWU A;  2DG9 A;  2XP7 A;  2DPE A;  3CGN A;  5GPG A;  1EHN A;  3ARW A;  1CTN A;  2LPV A;  2DT1 A;  4W9Q A;  3I6C A;  5HWB A;  4Q22 A;  3BXW A;  4LAW A;  1E6Z A;  4J4O A;  4PTM A;  3KAG A;  2RQS A;  3UF8 A;  3OOB A;  4IT4 A;  3WD1 A;  3O5G A;  3O5J A;  2PV3 A;  4MNM A;  3IK8 A;  1NWT A;  1QPL A;  4ZPT R;  1IX5 A;  4LAX A;  2ITK A;  1OGG A;  2O9O A;  4ODM A;  4TW8 A;  2OFN A;  3CH9 A;  4KR0 B;  3KAI A;  1TFV A;  1Q6H A;  4BF8 A;  1ZU8 A;  4MNL A;  4DWS B;  1W9U A;  2Q5A A;  1L1P A;  4S3K A;  1E15 A;  1E6R A;  3IHZ A;  2PV2 A;  1HKM A;  1WAW A;  2XPA A;  3ARX A;  3EY6 A;  3JXV A;  2ZR5 A;  5HW8 A;  2PBC A;  2B31 A;  2MNT A;  3ARZ A;  1FKI A;  2G41 A;  4J4N A;  4DZ2 A;  1F40 A;  4QIB A;  3ALG A;  1D6O A;  2MLX A;  1FKJ A;  3KAB A;  3B8S A;  2K8I A;  4MSP A;  4NNR A;  2XP3 A;  4DRK A;  2IUZ A;  4TW6 A;  3KAH A;  2VCD A;  4LAY A;  1ZBW A;  3KAD A;  1NMV A;  3MDY B;  3WD4 A;  2FKE A;  1J4I A;  4U85 A;  1WB0 A;  4HAR A;  3WH0 A;  2WK2 A;  3PRD A;  1D7J A;  4NSB A;  1U79 A;  3VAW A;  3B9D A;  1ZK6 A;  4DH0 A;  1LG1 A;  3ARU A;  1J6Y A;  3OA5 A;  2ZQT A;  4KQZ A;  5DO2 A;  3PR9 A;  1Y0O A;  3UQI A;  1J4R A;  4MGV A;  5HWC A;  3FY1 A;  1LL6 A;  1FKS A;  4ZPV R;  2IF4 A;  1YAT A;  3IKG A;  1UR9 A;  2A3C A;  4JFK A;  1A7X A;  1FKR A;  1JNS A;  4ITZ A;  2N87 A;  1B6C A;  3O5Q A;  1BKF A;  3B9A A;  4WIW A;  1FFQ A;  1JND A;  1ZCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...