1ZL1A

Crystal structure of the complex of signalling protein from sheep (sps-40) with a designed peptide trp-his-trp reveals significance of asn79 and trp191 in the complex formation
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3 like protein 1
publication title Crystal structure of the complex of signalling protein from sheep (SPS-40) with a designed peptide Trp-His-Trp reveals significance of Asn79 and Trp191 in the complex formation
rcsb
molecule tags Signaling protein
total genus 115
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2005-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1zl1A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1zl1A01
3W37A 5A6BD 1J0HA 2FH6A 4GXPA 1UHVA 3MO4A 1CXKA 1PIFA 5AC4A 3WDQA 3TP4A 4XZBA 3WH6A 4CUCA 4NRSA 3VIMA 1V3LA 2A3AA 5I2UA 1G01A 2DDXA 3T2OA 2J7BA 3ZQ9A 4W84A 1JYWA 3UR8A 5I3DA 3VX1A 4JAWA 2VQTA 1JYNA 3GXIA 3ARXA 2IUZA 1GOOA 3RJXA 4AIUA 4H7VA 3EDJA 4U31A 4HA1A 5JH8A 1K9FA 1SR0A 1XD0A 3D5HA 1OD8A 3AZRA 4XV0A 3G6MA 4PMZA 2XVLA 3BAJA 3VIIA 4U33A 3MUY1 1X6NA 1E1EA 4OKDA 3ZT5A 2BNJA 3CTTA 3ZSSA 1LF1A 4WF7A 1HKMA 4D6JA 1HX0A 4GIAA 1VFFA 2CKSA 2VQUA 4AWEA 3T2QA 2WVUA 1TZ7A 1A47A 4HOWA 1BQCA 4K68A 2O9PA 2CHNA 3AZTA 1L8NA 2GDVA 4J3VA 3OIHA 4A4AA 1V02A 2XWEA 2DT1A 1W32A 4ML4A 2VX4A 4U2ZA 3MKKA 1FFRA 1IV8A 1J0IA 4AISA 2JEPA 2VRKA 3W29A 1B2YA 4CN6A 4QAWA 1JFHA 5GPRA 2DH2A 2J79A 3HMCA 3A4XA 4LYQA 3APGA 1JZ4A 3PZUA 1W3KA 4ACYA 1LL7A 1HL8A 2CBJA 1Q6GA 1MVYA 1H3GA 1KGXA 3K8LA 4F79A 2WVVB 4OUEA 3RM4A 5A69A 2PWEA 3WNOA 2ESCA 1EGZA 1WZKA 3CHFA 1XH1A 3U57A 1W3HA 1US3A 4AZ7A 2PWFA 3OGVA 3L4XA 1BYBA 1WDRA 3WUBA 4UFLA 1BFNA 1OSEA 4OZOA 2BHZA 3PTKA 2ZUMA 1W9VA 1RP9A 1ITXA 4TX8A 3T0AA 5C70A 2J25A 3WEMA 1V08A 3VPLA 1BF2A 3T08A 3OLEA 3KWXA 4V28A 1EDGA 5C71A 1BVZA 1UYQA 4JHZA 3W6MA 4B16A 3AMDA 5LYRA 4U2YA 2BY3A 1HJWA 4GZJA 1E40A 3BAIA 3O2LA 4A3YA 1EXPA 1QHZA 1EOKA 2X0YA 2ZOXA 3VIPA 2WMIB 4MTVA 1OM0A 4GI8A 1V3MA 2WMKA 2GJRA 1WO2A 1OT1A 2EPLX 4RL3A 4WSKA 2A3HA 2YDSA 1US2A 3U5UA 2OYLA 4D6GA 2BY0A 4DUVA 4AY1A 1IZJA 1DWFM 3WDJA 1W2PA 4JKLA 2WAGA 3CUIA 1JNDA 3WL1A 3AHYA 4KWUA 3II1A 5A6JA 4X0NA 4WJXA 5EB8A 3WQ5A 5I78A 5DFAA 2ZXBA 1B3VA 1PX8A 2JE8A 3EBVA 2WVVA 4H41A 3WNLA 4EK7A 3FNDA 4B9ZA 1K9TA 1QI4A 2NT0A 1BPLB 3PTQA 3ZMRA 2Y4SA 1CGUA 2GJXB 2WM0A 4X0VA 3SCSA 4UTFA 3NSNA 1JYXA 4NF7A 2W91A 3EMQA 1ZBKA 5CPTA 1QNRA 2WYSA 1QHPA 1WDQA 1KR0A 2OSXA 5EMYA 5I23A 4MDOA 2W61A 2G3IA 2Y8VA 1DWIM 4UOJA 3BCDA 8A3HA 3MMWA 1QOXA 5BXTA 4UFMA 3TOPA 3PTMA 3ZJ8A 4D1JA 2W67A 2E9BA 1WE5A 1X6LA 4J3TA 1VEMA 3MV11 4W8BA 1A3HA 1V3HA 6CGTA 2ZXAA 1Y7VA 2ZX8A 4HP5A 3IJ7A 2WMJA 5LA2A 3VIGA 4XUYA 2BY1A 1JG9A 1V0KA 1E6XM 5BROA 1C91A 3K4AA 1W9DM 4V27A 3ALFA 3N17A 1JZ6A 4GZEA 3CHEA 1R86A 3THCA 4C7FA 1WKYA 2WKLA 4X9YA 3VGDA 4E2OA 3GXMA 1E5NA 5M17A 3WH8A 4TXEA 1CDGA 3LMYA 5CXPA 3MS8A 1CIUA 1VRXA 1V3IA 4ATWA 4FLOA 3KEHA 4MDPA 6A3HA 1R8LA 1V6WA 2BV9A 2GK1B 3AIUA 3D3AA 4AZCA 2YBTA 1NWRA 4KGLA 4QFUA 4F9JA 4YPJA 1CLVA 3GM8A 3GH7A 1D7FA 1MFVA 3CZKA 1Q6DA 4ACZB 5GNZA 3WQ6A 5A6MA 3W27A 1E3ZA 1HIZA 3NSMA 1VAHA 3AIRA 3WNKA 5KZ6A 1CNVA 4IISA 2DGAA 3AMLA 1E4NA 1FP9A 3WEZA 3VGEA 1JNEA 1KR1A 2CEQA 3AMGA 1HJXA 2CIPA 2WHJA 3VX0A 4D6CA 1R7OA 3HU7A 5A6AA 1OCQA 2D20A 3CMJA 3L2MA 3BH4A 3EDKA 2W63A 4UFKA 2EJ1A 5JUVA 5ABHA 1U33A 4KMQA 3POCA 5JBEA 1ODUA 2OWCA 2EPNA 3CUGA 2OLHA 3ZT7A 4HPGA 3NJ3A 2GJXA 3CBWA 4MNLA 2XGIA 1W9UA 4BQ3A 4CN4A 4ATLA 5E6YA 2ZIDA 2YL6A 4J28A 3ZT6A 5EBAA 4Q7NA 3T09A 1E0XA 4D6DA 3MU7A 4CCCA 4MNJA 4OBRA 1KQYA 4CGTA 3DC0A 2WVSA 4ZE5A 3T0DA 2DSZA 5D4YA 7CGTA 2VCAA 3WDPP 1CXLA 2CKRA 5A2AA 3WF1A 4D6IA 1GONA 1LL4A 2D1ZA 4JIEA 1NQ6A 4BZYA 5HDRA 4AYSA 3W28A 5IFPA 1VF8A 2VI0A 1JF6A 3WF2A 4DUXA 2UY3A 4HU8A 3BC9A 4WIWA 2VUYA 3W82A 3WH5A 1GOWA 1U30A 5A8QA 2DT0A 5EFDA 1XC6A 3N15A 2XVKA 1HN1A 2WBKA 2HISA 3DYOA 2O92A 3DHPA 1NOUA 1ISVA 2CBVA 1UD2A 1JIBA 2WWDA 3NDYA 2Y5EA 2G41A 3W26A 5IHSA 4CVWA 5ABEA 5DT5A 2CBUA 2J7FA 4W86A 4QCFA 2V3EA 1UQZA 2WHMA 4M56A 3WD2A 2O9RA 2FDMA 4LGXA 3AQUA 1Q4NX 3KL3A 2X8RA 1HJSA 1NP2A 3PZ9A 1KBBA 4H2CA 1M04A 1JDCA 4PEEA 3W6LA 4AEFA 4Z2JA 4TTGA 3KE0A 3CUFA 3VU2A 2WZHA 1OGBA 1XSIA 4BF7A 3HN3A 4CU8A 1W9XA 3TTQA 1QBBA 2V3DA 5HPCA 1QW8A 2VVSA 3MUIA 1H1NA 3AMKA 3WD1A 2VX7A 1HJQA 1B30A 2XTKA 2VZOA 3B8SA 4P8VA 1GHRA 1QPKA 1JF5A 3IJ8A 2FGLA 3NYDA 1OIMA 3RO8A 3WL0A 2G8ZA 1YQ2A 4NZCA 2V3FA 2VOTA 4CVUA 3KL0A 3WKZA 1QI5A 2BS9A 2E9MA 3WMCA 1ZJAA 3VGFA 4LX4A 4QCEA 1XYZA 4IM4A 4FLRA 3W81A 1TMQA 5D9NA 2JALA 2BVDA 1CGXA 4D6HA 1G9HA 3AXXA 1UH3A 2DSWA 1GOKA 4PUEA 3ARQA 3CLWA 4CN1A 2V3GA 3VIFA 4MB1A 3CIVA 1CPUA 1TR1A 3VDBA 2WCSA 5A3HA 3WELA 3AOFA 4CD7A 4L4OA 3GZAA 1MWOA 1I1XA 2XJ7A 1GJWA 5F7UA 1G94A 1UA7A 3ARZA 4Q22A 2YL9A 3WDHA 3AS0A 2D23A 1E15A 1XHGA 1I1WA 3VNZA 1MW3A 5A1AA 2IXVA 3OZOA 4JL1A 1ISXA 3T2PA 4AD5A 3BMVA 4AIOA 1UH2A 4WKFA 3TONA 1O7AA 4GQQA 4W87A 1VIWA 4J3WA 2PB1A 2YOCA 1ZJBA 1GOMA 1K6AA 4W89A 3CO4A 3AXHA 2QPUA 1SYTA 1HVQA 3OBAA 2XYLA 3TA9A 3EMZA 4BQ4A 4AZIA 2BFGA 4DM2A 5EFFA 5A94A 3VMNA 4MB5A 4GQRA 4UQDA 2ZUWA 1PIGA 1GOIA 1W1TA 2DSVA 1CGVA 1UR1A 3MMDA 3UEQA 4QLJA 2WC7A 6TAAA 4W8LA 1J18A 1DP0A 1E6ZA 1GQJA 3ARVA 1QVBA 3WH7A 5ABFA 1VB9A 1XGZA 2WW5A 4JFUA 3WNNA 3VVGA 2JIEA 1V3KA 1DWJM 4W8AA 2BVTA 1UD4A 4F66A 3RM9A 3M07A 5DO8A 4P7NA 1O6IA 1JDDA 2E3ZA 2YLLA 4UQ9A 3ZSTA 4OIFA 1BTCA 1W3JA 4GO8A 5C8BB 2JIWA 3RPMA 2OSYA 3VOCA 2VT0A 1RPKA 1XCWA 5IDIA 4AZGA 2VRQA 4ZE4A 3GH5A 1PX3A 3M6DA 4JKMA 3UR7A 3IAQA 4D6EA 2EXOA 1OIFA 2X05A 1GPFA 1HKKA 1CZ1A 2YA0A 2PBGA 3VNYA 2DT2A 2ZWZA 1ZBCA 2VTFA 3SIMA 5M03A 4YHEA 5LA1A 1EQCA 4JCMA 3ZJ6A 1NARA 3NUKA 4M80A 2XG9A 3BAXA 3WENA 1UWIA 1KQZA 1L0PA 3BXWA 4PCSA 3SUTA 4FLQA 1PPIA 3A4WA 4PUDA 1GQIA 2WWCA 3VIJA 2PBOA 3N1AA 3MSGA 3RIKA 5FL0A 1D3CA 1AQHA 3FAWA 1UR4A 1MXDA 5D9OA 1Q6CA 3BSGA 2BXYA 1PJ9A 2FGZA 2XFYA 4KH2A 5BXRA 3ARYA 2XGBA 1C7TA 1DWAM 2D3LA 3UESA 3L4YA 2V5CA 2YJQA 4P7OA 2J7EA 1CXHA 1UZ4A 3AS1A 3AFBA 1V6UA 1UZ1A 1G1YA 3F5KA 4M8UA 5AC5A 1JXKA 1MQRA 4M1RA 3AHZA 5KEZA 1MFUA 2C8NA 5GNYA 2OWXA 3EYPA 3WF0A 4AW7A 3WD4A 1J0ZA 3FAXA 4FK9A 4EKJA 1W2VA 4UZUA 2J74A 1V3JA 4J27A 3ARTA 4HPHA 4GKLA 2O9OA 1HJVA 4LQ1A 3SCTA 2UWFA 2PWGA 3PBGA 3WBEA 4AZCB 1R87A 4HA3A 2G3JA 3QOKA 2J8GA 4FMVA 1TFVA 5A6LA 4UNIA 1GUVA 2FHCA 3VD4A 1YHTA 3WFZA 2ZUVA 1B31A 3THDA 4BQ2A 4MNMA 4F8XA 3GDBA 1B0IA 1JDAA 3AIBA 2ZUTA 3SURA 4AZ5A 2WSKA 2XVPA 1UG6A 3W38A 4NSBA 2EPOA 4GI6A 1JD7A 1EOMA 1RP8A 2AMGA 2VZTA 1QI0A 1DTUA 1VEPA 5FOOA 3SUWA 5I0DA 1XH2A 1KXQA 4TVDA 1CENA 1GCYA 3L2LA 3ALGA 3I3BA 3K46A 3PZIA 2C0HA 4D6FA 1C8XA 1RH9A 1UH4A 3U5YA 1KWGA 3VIKA 2YBUA 3L4TA 3WH9A 2OYKA 2DH3A 3NSXA 4J3SA 1W3LA 3AIVA 3OB8A 4HMEA 1LQ0A 4ZEPA 1KXTA 4JHOA 1UR8A 1EHNA 4PSRA 4CD6A 3GNRA 3ZM8A 2D0GA 3TTYA 1NOFA 1KBKA 1IZKA 4AD3A 1XD1A 1BGAA 3OZPA 3AIEA 1XRVA 2NSXA 1MW0A 3QGVA 4RE3A 1BLIA 5IFTA 5TD4A 3BLPX 1Q6FA 1H4PA 5CSUA 3FHQA 3RM8A 1LLOA 1ZU8A 4FF5A 1EIBA 1JAEA 1WP6A 2CESA 1J0JA 2F8QA 4J3XA 1E0WA 1QNOA 1B1YA 4PMRA 2BHYA 2W62A 2CHOA 2WKGA 5A8MA 5E9AA 3CHCA 3WBAA 2XVGA 1KB3A 2VZUA 2DSUA 4UFIA 2OWWA 2BVYA 3B9DA 4PTVA 3U7VA 1VBRA 2JFEX 5JBDA 4JCLA 4JZ5A 2VC9A 3SCQA 4FLSA 5D8ZA 1GVYA 1E1FA 4QDMA 1WZMA 1XCXA 2J7HA 2EQDA 1WZLA 2E4TA 5IXEA 4ATDA 4UOQA 1BYDA 2YL5A 2E9LA 4OOZA 5E0CA 5HNNA 3K4DA 3GTNA 4TTUA 4F9DA 1GVIA 3PN8A 4PMNA 3UETA 4LYRA 2QPSA 1UKTA 2WLZA 5DF0A 1VBUA 1OB0A 2WC3A 5GNXA 1Q6EA 2XUCA 3OGRA 1TUXA 2X09A 2CITA 4Y7EA 3WD0A 4S3JA 5JBFA 4AZBA 4HU0A 1ISZA 5CSYA 5CPSA 4PTMA 4W85A 4N0RA 4QLLA 2VCBA 2E8YA 2OYMA 1JAKA 4GINA 1E70M 3DHUA 1OWQA 3W24A 3AIQA 1ZBVA 2FH8A 3F5JA 5CZKA 4CCEA 4AD4A 1FA2A 1HKIA 1MW1A 5BCAA 1LWHA 2A3BA 2VNCA 1VFOA 3VM7A 2VR4A 1HP4A 4W88A 5A8PA 4Z2HA 5HXMA 1UUQA 2A3CA 1W9BM 2QMKA 3CZEA 3WQVA 1E43A 2CXGA 3J7HA 4QLKA 3VINA 3L4UA 4CU6A 5LA0A 5CQ1A 2Y2WA 2G4FA 1E0VA 1AQ0A 4GO9A 2VR5A 1VJSA 5BWFA 2J7DA 1XYFA 5A8OA 2ZX6A 4JFVA 3L4VA 5A2CA 1ZBWA 1TA3B 2OSWA 5A8NA 1LJYA 2QV4A 4Z2GA 1UKSA 1FH8A 4MB4A 1NH6A 3AXIA 4M81A 2XHYA 2EPMX 4WKHA 5CLTA 3ZOAA 4EAMA 5ECUA 5I24A 1QHOA 4MJ4A 1UKPA 1BG4A 4PCTA 3ZR5A 1UR0A 1C8YA 4DWSB 1E4IA 5BXSA 1H11A 3SCOA 2J77A 2VURA 3I3DA 3VKKA 2YLAA 3AJ7A 4WK9A 3BCFA 4TUFA 2PWHA 5A2BA 4D71A 3IJ9A 3K1DA 3N04A 3IK2A 4PMUA 1H41A 2WPGA 2GSJA 3WUFA 5D8WA 2YIHA 3VD5A 1J9YA 4PBGA 4V2XA 2Y8KA 3T0BA 3VDAA 1V02E 1U2YA 2XSBA 3BAKA 4TVUA 4NI3A 1SMDA 1E5JA 3N18A 3FHAA 5I6SA 1E4MM 3QHOA 1KXHA 4HA4A 4AD2A 4Z2KA 1UWQA 4MADA 5DT7A 1UWRA 4MAVA 2IXUA 3GYCA 3IANA 3PZNA 2FHBA 2DIJA 1WDPA 3F5LA 4CU7A 2ZXQA 1MQPA 3CMGA 4R5EA 4PYSA 1B9ZA 4H8UA 1B3YA 2WHKA 3CPUA 1OGSA 3CZJA 1UWSA 1JFXA 5FD0A 3PZQA 1BSIA 5ABFB 1JZ8A 3W25A 4P8UA 3F4VA 1J0KA 1FOBA 1MW2A 1J10A 4BQ5A 9CGTA 2W92A 4MB3A 5D9MA 2W66A 1TA3A 2D2OA 2GVYA 4MNKA 2CERA 5JIWA 1KCLA 1N82A 3QOMA 3ARWA 1MXGA 1FHDA 3VGHA 3U7BA 4NRRA 2CYGA 1W1VA 2V5DA 3VD7A 4DUWA 1C93A 4DWSA 3EMCA 1ECEA 3POHA 1CGWA 4TOQA 1UA3A 1GHSA 1LG1A 2VJXA 3CHDA 5HBFA 1QBAA 5HOSA 3GNPA 1JZ7A 1W1PA 2G3NA 3CUHA 1GORA 3VMOA 3AIWA 2WNWA 1JYVA 3AYSA 1J11A 1UKQA 3MSDA 1XV8A 1V0MA 1CWYA 2VX6A 3DECA 2YL8A 2VL4A 3GBEA 2V38A 3WSUA 3ARUA 1BGGA 3EDEA 1JI1A 1DHKA 3PZOA 3FY1A 3FW6A 3ZJ7A 1E6RA 1OINA 3AS3A 1HT6A 3RJYA 3CZ8A 1M01A 1ISYA 2WZIA 3WDRA 4UFHA 2QHAA 4WKAA 2O9TA 3BAWA 2MANA 3WNMA 2J75A 1I75A 5FL1A 2QMJA 3DYPA 4J7RA 4BA0A 5CGMA 3I3EA 1DEDA 2WCAA 4B15A 4JFTA 4H8HA 4ZXLA 2VRJA 4AD1A 4RE4A 2WMFA 2C7FA 1QI2A 3JUGA 3ZR6A 2CBIA 3MUZ1 3VMPA 1UWTA 1CXEA 4P7QA 5E0FA 3K8MA 2WVTA 4MAZA 1ESWA 3IAPA 5E6ZA 2BXZA 5DMYA 4KGJA 3VDHA 4LYPA 1KCKA 4PTWA 1B3XA 4XX6A 3WY1A 3CUJA 1HNYA 1GZJA 3AHVA 1HF6A 4P8WA 4B3KA 4AZ6A 4WSJA 3SUSA 1E4LA 4UR9A 3AROA 2Q8XA 1VFMA 2CCRA 1EDQA 1JZ5A 4PMYA 2XFFA 2XIBA 4OBSA 1QW9A 2CETA 4J3UA 3MV01 3UG5A 1CXIA 1UD6A 3SCRA 2VVNA 1GQKA 4P7LA 1NWUA 1AQMA 1CTNA 2ZWYA 1UD8A 5CGTA 2EPKX 4PMDA 3O6AA 2XSAA 1GJUA 3SEPA 5A6BA 3VDCA 1C7SA 3WN6A 4RE2A 1E72M 4UQCA 3M46A 4LXFA 4UOZA 1SMAA 4MJ2A 2WXDM 3GXFA 1J0YA 3EDDA 1D2KA 2PWDA 2A3EA 1ITCA 3AISA 3B9AA 3ZIZA 1H5VA 2D24A 2HVMA 1FH7A 3EDFA 1LL6A 3WDIA 3A47A 3LPGA 1CYGA 1XH0A 3WIJA 4HMCA 4CKQA 2DQXA 5BYWA 1J12A 5DEZA 3WF4A 2DT3A 3ZO9A 1PAMA 1E55A 2WMHA 2W5FA 2WBGA 5D9PA 1PEZA 4AIEA 1TVPA 3RILA 2D0FA 1VJZA 1MQQA 4E4PA 1W1YA 4A3HA 5A6KA 1E56A 5FIPA 3RMEA 2AAAA 1V6YA 2NT1A 1F4HA 1OGGA 4UZSA 2ZICA 4W7UA 1G5AA 1FP8A 1UR9A 3BMWA 1RD6A 4HOXA 2ZUUA 5BXPA 3AHXA 2GFTA 3GXDA 4WLCA 2YA2A 5A6SA 3VGGA 5ABGA 2VZSA 3ECQA 1QNQA 3E1F1 4EANA 2EEXA 4PMQA 1UKOA 1R7AA 4M29A 2RGMA 2YA1A 3OLDA 4JFSA 4ZXOA 3WMBA 1E6PA 4B9YA 1PZ3A 4TX6A 2BHUA 4B3LA 3LPOA 2J7CA 4AD0A 3UCQA 3BSHA 4URIA 5M5DA 5I77A 3OA5A 4C7DA 2ZUNA 3SCVA 1HP5A 1HJUA 1HXJA 1E9LA 2ZX5A 5CLWA 4YHGA 1LG2A 2J8FA 2VMFA 1C90A 4H04A 3AMCA 1EO7A 1BYAA 2YKKA 2VO5A 3QHMA 2ZX7A 2J7GA 4JL2A 1V0NA 1QNSA 2YDRA 1XSJA 1G0CA 1ZB5A 3CH9A 3WQ4A 1CEOA 2FHFA 1DWGM 3S6TA 3A4AA 3OLIA 4W7VA 1QI3A 4U3CA 1W91A 3WF3A 1WAWA 1DWHM 3AI0A 3WD3A 3CZGA 1KGUA 3KZSA 3VIOA 1B3WA 3BAYA 5FCZA 1GW1A 4AMCA 3WMSA 3G6LA 4Z2LA 1HL9A 3W4RA 3K8KA 1WZAA 2WLYA 3WEOA 4Z2IA 4D72A 1E6QM 1V6XA 3MMUA 4OJYA 1M53A 1H09A 1F4AA 2WHLA 3UG3A 4AXNA 3FN9A 1WNOA 3VIHA 3O9NA 4AZHA 5E70A 4C7GA 1HVXA 3WFLA 5IHRA 3NDZA 2BY2A 1FHLA 2GJPA 4UQEA 4E8DA 2ZXDA 3WQ8A 3M7SA 3QR3A 2JEQA 2CPUA 4MPKA 3SUVA 2G3MA 3SCPA 1AMYA 4BS0A 4GI9A 4TVCA 2WMIA 1E71M 2ZX9A 4H8VA 3N9KA 2EO7A 3VD9A 3SCUA 1GNXA 1LWJA 4PRWA 2JF7A 2DPEA 2TAAA 1UQYA 4UFJA 1JI2A 2J4GA 4BCEA 3ZJKA 3VM5A 1C92A 1KGWA 3WQWA 3A3HA 4CD4A 7A3HA 1JXJA 4PMXA 5JIPA 1H0IA 3AHTA 4IPNB 3LPFA 3VD3A 4PMVA 1CECA 1OBAA 3MANA 1EHAA 3N12A 4KRTA 4W5ZA 1J01A 3UERA 1MYRA 1ZS2A 3TTSA 2QLYA 2XVNA 3SCWA 3AS2A 2DEPA 4ZENA 2PF0A 3UG4A 3SUUA 2XFRA 1PBGA 3N11A 3WNPA 3PZGA 4HZ7A 2ZUSA 2VCCA 4LPCA 1JZ2A 1FFQA 1Z32X 1M03A 3RCNA 2EBNA 1NOWA 1KWKA 1PZ2A 1CGYA 3W0KA 3PZMA 2UY5A 2WB5A 3L4WA 3GBDA 5A95A 4M82A 2W4XA 4P8XA 4CCDA 1B90A 1TE1A 1BHGA 2QF8A 4XZWA 1WB0A 1VEOA 2Y24A 2J47A 1TVNA 1W9PA 2F2HA 3VUPA 1V6VA 1E6SM 2F61A 1CXFA 1PX4A 1XSKA 3VTRA 1JD9A 5M3WA 5I79A 2XPKA 3NCOA 1VENA 3KL5A 2D3NA 1H49A 1ODZA 5BRPA 2RGLA 5HPOA 3W53A 1E3XA 3VO0A 1JGIA 4S3KA 5GQBA 1KFWA 1ZL1A 4W5UA 1BVNP 2J62A 1K9DA 1EH9A 4DWSC 4W7WA 1CGTA 1UR2A 4QP0A 3N13A 1V03A 1CLXA 1BG9A 2ZE0A 4JKKA 4HMDA 4XB3A 4GZIA 1NWSA 5CG0A 4PSPA 3SCNA 2GK1A 2VZVA 2Z1KA 4UCFA 4E8CA 5I5RA 2E40A 2XM2A 3ARSA 1VFUA 3HJEA 2WC4A 5AYBA 1JZ3A 1UD3A 2GUYA 1P6WA 4ACZA 3FXYA 4DWSD 4CD8A 1EQPA 2E8ZA 1GQLA 2UY2A 5FKYA 1WCGA 4KRUA 4L4PA 4DM1A 4UQAA 1NP0A 2YDQA 5E09A 1WPCA 3PHAA 1HKJA 2WANA 3OG2A 5AYIA 4ZFMA 2XWDA 4PMOA 4U3AA 1S46A 3RDKA 5AY7A 3WUGA 1B3ZA 1OD0A 1KXVA 1NM9A 1QNPA 1X1NA 1TCMA 2PI6A 3TTOA 3AZSA 2PC8A 3NIYA 4IUGA 3BLKA 4UQBA 1AVAA 2WZEA 3CGTA 4PN2A 2WSPA 1EO5A 4OOUA 1UOKA 2Z1SA 2D22A 2VX5A 4GPNA 2E0PA 3OLGA 2NW0A 4CD5A 1R85A 2B31A 1UD5A 4HZ6A 1E6NA 1SFSA 1C3FA 2JF6A 4M24A 4HOZA 4AEEA 2WMGA 1UWUA 3DYMA 3VGBA 1M7XA 2AOSA 7TAAA 3QHNA 1WDSA 3PZTA 3B9EA 4P7RA 3WUEA 5CJ5A 3AYRA 2X2YA 4HZ8A 1ISWA 3A6OA 1EA9C 1CBGA 2CNCA 5CPQA 2UY4A 1E73M 4R27A 2J78A 1TG7A 1H2JA 3OGSA 4IPLA 3LPPA 3VILA 1JL8A 1K9EA 3L4ZA 1NWTA 1EDTA 2DIEA 4YN5A 3GH4A 2XM1A 4HTYA 3ARRA 1BAGA 1V0LA 1C8QA 3S2CA 3ARPA 1IT0A 3MUAA 4U5KA 4N42A 1FH9A 4EE9A 4D1IA 4JFWA 4AC1X 4W93A 1OT2A 3AICA 3CZLA 3GNOA 3PZVA 2D0HA 2XIIA 1BYCA 4U5IA 2GDUA 4PTXA 2X0HA 8CGTA 2DSKA 5BRQA 1H0GA 2WK2A 1GOQA 2X1IA 2WCGA 3BGAA
chains in the Genus database with same CATH superfamily
1QCWA 3KOFA 1P6CA 1J0HA 4GXPA 4AVOA 1J2BA 2ZRWA 1FWSA 1IZCA 4PUJA 1CXKA 1KM5A 3INPA 4C6CA 2WNQA 4FNUA 2A3AA 4HCLA 2I1OA 3SM0A 2C1IA 3CUZA 3M0VA 2QUMA 1XGDA 1OF8A 2AKZA 2J7BA 2PWVA 3UR8A 2DZXA 3TEVA 3GC5A 2L5HA 3GXIA 2IUZA 4REQA 2V63A 3TYZA 1K4GA 1TPB1 3THAA 1EB3A 4H4IA 5JH8A 1K9FA 1SR0A 1XD0A 1OD8A 2WSQA 4P2VA 2Z29A 3MUY1 2XN1A 2M1IA 2YB1A 2BNJA 3NL3A 4CQAA 2CZEA 3O06A 3CK5A 5I3KA 3NM3A 4D6JA 3GE7A 2CKSA 3EA3A 2ANUA 4AWEA 2DZTA 4ECLA 1TZ7A 4AVFA 5EMKA 1L8NA 2GDVA 4J3VA 3OIHA 1V02A 2VX4A 4ML4A 2A85A 4D2JA 5B8IC 3WJYA 1IV8A 4AISA 2VRKA 4ZB0A 4XWUA 1GKRA 3SIZA 1XQLA 3NQ8A 4BEQA 1Q6IA 1EPXA 5FAJA 1JPIA 4K8GA 4INFA 9RUBA 1Q6GA 1KO0A 1MVYA 1KGXA 3EWYA 5HWJA 3BOLA 2WVVB 1SZNA 2DY3A 5TAOA 4LVFA 1EGZA 2IPWA 3U57A 1W3HA 1EZ2A 1US3A 3KOYA 3CO8A 1EF2A 1BYBA 1WDRA 4GGQA 2PP1A 3MDUA 3WUBA 3AWOA 1BFNA 4ZPWR 2YFNA 1W9VA 5DMNA 1D8CA 3SJNA 4LB4A 1ZJIA 2PDLA 2J25A 1EIXA 4QX4A 4JEJA 4B4FA 3VPLA 5DLCA 4O14A 2FZ8A 4QDWA 1BVZA 5LGZA 4PB5A 3W6MA 5LYRA 1XXXA 3O2LA 4RNFA 2RSEA 4A3YA 2X0YA 2WJEA 1MEWA 2OQHA 2BODX 3BZJA 3HZ3A 5K9CA 4I9AA 1OM0A 2QUUA 4GI8A 3W1AA 2QVHA 2EPHA 5CPNA 2WMKA 5D2WA 1OT1A 2EPLX 3LGEA 1TIWA 3PJXA 4WSKA 4AIBA 2A3HA 4QJ1A 1FWAC 3U5UA 4IMEA 4F3HA 4AY1A 4E4UA 1DWFM 4EXBA 1NIUA 2BVWA 1XM3A 2DORA 3VI2A 5F1VA 1AUSL 3LM3A 3WL1A 3B8VA 4NT0A 2NVDA 4LV9A 3P2VA 3LGGA 3GHTA 3VKBA 2ZXBA 1SU5A 1IEQA 5KTLA 2HVNA 2WVVA 4H41A 4B9ZA 4DBDA 3W2UA 4BY3A 1VFSA 1GT8A 3HGRA 3SCSA 4MWAC 1R3SA 5IBXC 1LYXA 3ODKA 1WDQA 1KR0A 3T81A 4MDOA 2W61A 2XGZA 4JNYA 1FWEC 5DX7A 4GNJA 8TIMA 1X38A 5BXTA 4UFMA 3W73A 2W67A 5DBTA 2QCMA 2CU0A 3EWBX 3A4JA 1ZZMA 1Y7VA 1IYXA 4HP5A 2BY1A 1V0KA 2RDTA 2V81A 4GFSA 1W9DM 2QS8A 5B80A 2Z1XA 3PAJA 3AC0A 3CHEA 1R86A 2FGBA 2Y88A 2JQXA 5DQPA 3CV7A 3FGCB 3QM3A 1S2WA 4G7EA 4TXEA 3ID7A 2OXNA 3MS8A 4KETA 1CIUA 3GAYA 4O4VA 4ATWA 1NVMA 1EGVA 4OV9A 1CLVA 4DXXA 1D9EA 1D7FA 4JNZA 1Q6DA 5GNZA 5E93A 5A6MA 3BLIA 4O1CA 4QM1A 1VAHA 3WNKA 2DGAA 3AMLA 4UNLA 3SRDA 1NSJA 4FO4A 1JNEA 2CEQA 4WOZA 1HJXA 4GI4A 4XZHA 4QISA 3HU7A 1BXCA 3DFPA 1OABA 3BH4A 3L2MA 3Q94A 4UFKA 4QE1A 2VCDA 3E2QA 4ZQCA 4FOKA 3RHGA 5HNRA 1NMVA 3AXMA 4DZ5A 1QPRA 2V8ZA 1XIEA 2HE8A 2OZ0A 4TU1A 3WLOA 2J6XA 3NZPA 3T09A 2A3LA 5AVHA 1S2UA 3EGJA 4NAEB 1KQYA 3OZMA 1RD5A 3TH6A 3DC0A 2WVSA 5FF3A 1F8AB 1I2OA 1PDZA 4E4FA 3SECA 4O10A 1YDYA 2Y0FA 3QQ1A 4C60A 5I3FA 2GUBA 3E9AA 2BGSA 3RK8A 1JF6A 4DUXA 3BC9A 3KAOA 1GOWA 1VRDA 3O5GA 2WBKA 4R53A 3DYOA 1V7YA 4N19A 4C65A 2CBVA 4EXQA 4NHVA 3VAWA 5KZEA 3OZYA 1HZYA 2G41A 2QCDA 2INEA 5AOUA 1HG3A 4Q8OA 2X1SA 3RF9A 1XLGA 2PSNA 2V3EA 4DJDC 3UWEA 1A80A 3R7MA 2B7NA 3SN0A 4DF1A 3R1ZA 4N9CA 1NP2A 3A12A 1KBBA 3RNDA 4PEEA 3W6LA 3R13A 4AEFA 1XFBA 4TTGA 4RDZA 1XSIA 4BF7A 3QV7A 3M16A 3HN3A 1AFSA 1F76A 3IPWA 3S2MA 3TTQA 2OU4A 1S2VA 3GDKA 2Z25A 3SFKA 4Q8VA 3GVRA 3DKLA 2LJ4A 4BF9A 1KCZA 1VP5A 3WD1A 4IXHA 4NAEA 1JF5A 4E2DA 4RNIA 4YL2A 1OIMA 3RO8A 1DV7A 4NZCA 2V3FA 3KL0A 3H2FA 2P0IA 4Z1YA 3L66A 1H61A 2DG3A 1ZJAA 4IM4A 5D9NA 4EX4A 8RUCA 4GJJA 4K8HA 2G96A 3H7VA 2VEMA 1NJJA 3AO0A 1UH3A 1CLKA 2DSWA 4PUEA 3G22A 3BLEA 2V3GA 4LY8A 1XIIA 3WX7A 4MB1A 2VENA 3LCGA 1UC4A 3CH0A 1VCGA 1JCLA 2PDIA 4ALDA 3C0SA 3IGXA 1D7JA 3GNDA 5F7UA 4NVTA 2YL9A 2Z1BA 3AS0A 4C1NB 3EOOA 1E15A 1DXIA 3MBDA 1MW3A 5A1AA 1N1AA 3UWQA 3B7XA 4KF1A 4JL1A 1FDJA 3FCPA 3PF3A 1RCXB 1ZGDA 2CLIA 4O52A 3U2OA 4W87A 1US0A 4J3WA 1FKLA 4KIEA 2YOCA 1GOMA 3O1NA 9XIMA 4KQNA 3AXHA 3GFZA 2WJZA 3LK6A 4LCRA 3TA9A 3GAKA 4BQ4A 2PDJA 1L6GA 3QN3A 5A94A 2OEMA 3T4WA 4GQRA 4IG2A 2ZUWA 1OK4A 4DT4A 1KD0A 3NZRA 5J5RA 4DYEA 2VGIA 1IWAA 1X8FA 4QLJA 1DP0A 1LOLA 3WH7A 5ABFA 1VB9A 4JFUA 2CC0A 2JIEA 2A6NA 3ES7A 4LUSA 3TK7A 4HNUA 4MUPA 1EJWC 4ZFCA 3EWXA 2NZLA 1TV4A 5REQA 3TDFA 4P7NA 3A13A 4O16A 2E3ZA 3ZSTA 2OVLA 4OIFA 2QGYA 4C91A 2PTZA 3RPMA 3EWWA 3RUBL 3ZVHB 3VOCA 2VT0A 5CAHA 4IJRA 4AZGA 1VFTA 3PA7A 1NELA 1PX3A 1JUBA 4N4PA 2RDWA 4AUBA 1IEXA 1ECQA 1OIFA 1PKYA 4ZCWA 2X05A 4O19A 2H9AA 1GPFA 4AF0A 4JDBA 1LBMA 2YA0A 3VNDA 2V2CA 3GC2A 3TV8A 2HBVA 3SBFA 2PBGA 2DT2A 2ZWZA 2DG4A 1ZBCA 2VTFA 3KS5A 4HKPA 4K7VA 3KTSA 3W2NA 3EZ4A 3G1DA 3BMXA 3N2BA 3N3TA 3V0TA 3W3OA 4LBRA 1R3VA 3B8DA 2RFGA 3NUKA 3WENA 1L6YA 3N2TA 3U2EA 2WSYA 1PPIA 3K5XA 2J9XA 3H8AA 1QOQA 3VIJA 4YWSA 4Q4SA 1AQHA 3U4FA 1MXDA 3BSGA 4LCSA 3S0CA 2IPJA 4OUIA 3FK4A 4CNUA 1UR3M 2XGBA 4LH8A 1S5WA 2XH2A 3WLLA 4Q8WA 3VC6A 3AS1A 3RAOA 4I9TA 3F5KA 5HW6A 4M1RA 3AHZA 5KEZA 2C8NA 5T91A 4AW7A 3FJLA 2B7OA 2WSRA 3LHWA 5SWUA 4M19A 1K4HA 3W86A 2KI3A 4FPSA 3ARTA 4ZBCA 2QUNA 2UWFA 5EMLA 2AWGA 3KP1A 2G3JA 1IWPA 4OBTA 4CNPA 3G1HA 1YHTA 4POCA 1B31A 2H3DA 3ZVHA 2NVAA 1U5HA 1B0IA 3W23A 1E9ZB 2XVPA 3DN5A 4YU1A 4GI6A 4XBSA 4IMDA 1JD7A 5FOOA 1KM1A 1N55A 4GQGA 1ZAHA 2GVGA 1MRAA 1LRQA 4TVDA 3L2LA 3EA1A 2AGTA 5MKGB 2ZR4A 2YCLA 3H2EA 3U5YA 1KWGA 5ECVA 2ZVRA 5FJJA 3GYEA 2HJPA 4A8RA 3L4TA 2ZKMX 1YXCA 1ADSA 3OB8A 3AIVA 1QK2A 3KZPA 3L21A 5D2XA 1EHNA 4PSRA 3GNRA 1FKDA 5BMXA 2HV5A 1B5TA 3ZYZA 2EHHA 4QSHA 1IZKA 3FA5A 1XD1A 1XW8A 1BGAA 3PBWA 4ZOBA 1QDSA 3QGVA 4JNMA 1OG0A 1J4EA 3WLRA 1B57A 2QJNA 2IQDA 4ZTXA 1NY1A 1RA0A 4FF5A 1JAEA 1FCBA 2ZRZA 3LBCA 3N25A 2XSXA 3C2EA 3BG9A 3S9ZA 4MSPA 1QNOA 1B1YA 5H6HA 1G6CA 4PMRA 3TSBA 1EJRC 2ACQA 2W62A 2WKGA 5IM51 3WBAA 3O5PA 3UXKA 2DSUA 4C6NA 1RCQA 4MYXA 3U7VA 2FTWA 2JFEX 5JBDA 1X1OA 3D46A 4DJFC 1GVYA 3S46A 1WZMA 3S8HA 3L68A 3O5FA 4DBSA 2EQDA 3KHDA 3MO7A 5LSMA 3MVTA 3KAFA 4F9DA 1GVIA 4XIAA 3S5NA 3EOEA 4H9ZA 1UW9A 2WOQA 5F2GA 3OGRA 1MMFA 1ZALA 2X09A 2CITA 2G3FA 3GVWA 1I0DA 4RNHA 4HMNA 4IQCA 5K7JA 3LCWA 4KS0A 1B54A 5CSYA 5CPSA 4GG9A 4PTMA 4W85A 1NFGA 3UI6A 3PWAA 1FWDC 1GTEA 3GKFA 1R3TA 2VCBA 1FWFC 4L3NA 4KBXA 4XD4A 3OVRA 1XIHA 1OWQA 4DIPA 3AIQA 2FH8A 3F5JA 5IBXA 3QF0A 1IQ8A 5AYZA 1MW1A 2VFGA 1LOSA 1LWHA 2A3BA 2VNCA 4Q33A 4H9TA 1VFOA 3VM7A 3DOPA 2QJHA 3BQ5A 1W9BM 3WQVA 2CXGA 3H23A 4IL0A 3W2KA 2WJDA 5BWFA 1K8ZA 3R25A 1XYFA 2BXVA 2DZSA 3W7GA 4DPQA 3O5KA 3L4VA 1ZBWA 5MF5A 2PD5A 4ASTA 2X30A 1XL9A 4G2PA 4HD5A 1XLIA 2EPMX 4WKHA 4UTMA 3TXVA 1BG4A 4JTAA 2BZNA 1OFAA 4L56A 2JGQA 2HNHA 2Y89A 3QPEA 3WQDA 3PR9A 3TCEA 4IMCA 4JTTA 3AJ7A 4NZ4A 3ZLHA 2ZVIA 2VD9A 1PWMA 3OHMB 4F4RA 4D71A 1GWJA 5LNSA 3K1DA 5C2XA 4PMUA 1JPHA 4V1XA 5D8WA 2NXHA 1YDVA 5AFDA 2YZ5A 2I5GA 1PO9A 3MUCA 1V02E 1CX9A 1YRRA 2PRLA 3GXPA 1M68A 3NPUA 4Q6JA 1PUDA 1QZ2A 4ZA0A 1VH7A 1FWTA 3P82A 2SFPA 3N6HA 4DJDD 2HVOA 3UGRA 3H70A 3ITXA 3ABQA 3IANA 4LF2A 2FHBA 2PDYA 2EKGA 2QCCA 3CQJA 4GUIA 3QV8A 3F5LA 1NEYA 2ALDA 1B9ZA 1OGSA 5E5CA 1Q6HA 1UWSA 1O4UA 1MDLA 4JFMA 1AW1A 4TIMA 4PRTA 4WRHA 2RUQA 1JZ8A 3W25A 1M5YA 1MW2A 2FFCA 2ABBA 3LHUA 5I3GA 2GVYA 5LNWA 4OWGA 4E5TA 1SW3A 2FZMA 3UPBA 1GPWA 1OX5A 5T9CE 2XN2A 1SGJA 1R5YA 1QO2A 4RW3A 3VZYA 3GIQA 2IMRA 2PWUA 2BB0A 4R9OA 3LMZA 2W9MA 2P53A 1TPEA 3NQGA 3MQTA 4ORIA 2PFHA 3AIWA 4FI4A 2R82A 4IIBA 4DO7A 3E96A 3O5EA 3I6EA 1UKQA 1CWYA 4BF8A 5E0KA 3GIPA 4UMAA 4TQTA 2XZ9A 4LOCA 4B4HA 3B97A 2O4MA 4GJIA 3AAMA 4F2UA 3GPKA 5LNVA 3ARUA 4N6EA 5FEZA 1BGGA 1JI1A 5FSEC 1E6RA 5K3VA 3CZ8A 5CEWA 1M01A 2WZIA 4FAMA 3WDRA 1IE7C 3GDRA 4WKAA 2O9TA 2MANA 3H55A 3WNMA 1KV8A 5FL1A 5CGMA 2Q02A 3W76A 2WCAA 4C1LA 4JFTA 1ME8A 4QQ3A 5HJYA 3UFYA 2VRJA 3ITVA 1D3GA 1T40A 2OKTA 3JUGA 3KRZA 4CLMA 4QT3A 3ZR6A 4HK5A 4TNSA 4WUIA 5E0FA 1K8YA 2WVTA 4QNWA 4MAZA 3BSMA 2IPFA 5E6ZA 3M9YA 2BXZA 2F23A 4JTHA 2GJLA 1WKFA 3ITYA 3DI0A 4J9JA 2J24A 4B3ZA 1DVJA 4I7VA 4Q4KA 1VHNA 3CUJA 1REQB 3VCNA 3VOIA 2QJMA 1KBJA 4B3KA 2YB4A 7REQB 3SUSA 4UR9A 3AROA 2Q8XA 4Z1AA 3RCMA 3NQ2A 4TW7A 2CCRA 4J1OA 1KRBC 2QT3A 4PMYA 3T78A 3MV01 1OX4B 1RXOB 4PFHA 3E2VA 4KWWA 4DZ2A 4BJHA 3NXFA 3KCLA 3WBYA 2EPKX 4I5RA 3G18A 3D47A 3KOXA 5CBIA 3NRKA 3G8RA 3U2ZA 4UQCA 3KXQA 4UOZA 1SMAA 4DXKA 1LDCA 2OZ3A 4WY0B 3GXFA 1J0YA 4XD3A 3CL7A 4QG8A 1ITCA 3AISA 1H5VA 2D24A 4DYJA 1U22A 4S1FA 3A47A 3LPGA 1XH0A 1FKWA 3MP3A 4DN1A 4UMBA 5DEZA 4DRSA 5FF0A 2WMHA 3C2OA 1VLIA 3PWIA 3PBYA 3C8NA 4L7ZA 3ABOA 4AIEA 2D0FA 1J96A 1MQQA 4OVXA 3Q67A 2X1TA 4A3HA 3MDYB 1WX0A 5FIPA 1KFEA 2NQLA 1TB3A 3SSJA 3RGCA 1OGGA 1TWWA 2ZICA 4W7UA 1GKQA 1X98A 1FP8A 3NTYA 3U0HA 1TJ0A 1E51A 3LHVA 5HMSA 2YA2A 5A6SA 1LUCA 3ECQA 3E1F1 1SFJA 3CU2A 2PE4A 4PMQA 4DBEA 3TYEA 1JCMP 5FJIA 1ZENA 2V2HA 4M29A 1KLZA 2RGMA 2M2AA 4ZXOA 3EPOA 4J4OA 1E6PA 4B3LA 3PC0A 4ZB5A 5I77A 3HMJG 2FAPA 2ZUNA 3UCDA 4QQUA 1HP5A 3P14A 4IFRA 1F61A 2ZX5A 3E74A 1OX4A 4YHGA 1C90A 3BCJA 3TC5A 1EO7A 3P8IA 1JCNA 2VO5A 4JL2A 3QMSA 2YDRA 3TW7A 1XSJA 3WLTA 1ZB5A 1DWGM 3SW6A 1ONEA 2Z7GA 3VNLA 3A4AA 1QI3A 1W91A 3WF3A 3N6QA 4WY0A 3WD3A 1R0MA 3KZSA 1XFCA 5FCZA 5GVJA 4EPKA 3WMSA 3G6LA 5EGRA 3LHTA 3ABRA 1I2PA 4ZPTR 3EOUA 3W4RA 3K8KA 1OHLA 1BVWA 1CB7B 2H8ZA 2E67A 3WEOA 4ES4A 4I5XA 4RUBA 4KERA 1YXYA 1W8SA 5ABTA 2VEFA 2WHLA 3SR7A 1M6JA 4PH6A 3NTPA 5E70A 3WFLA 1R9ZA 2EG7A 2YXGA 2PRMA 5AECA 3DG6A 3VOJA 3WK1A 4J4NA 3M7SA 1J6PA 3QR3A 3GU2A 4KCUA 3TQ0A 2CPUA 1TZZA 3QRHA 2G3MA 1LZOA 1S2TA 3SCPA 1HKVA 3M47A 4XISA 5AHLA 2QCFA 4BS0A 4GI9A 1TIMA 2WMIA 4F0KA 4LJ3A 4JOMA 4H8VA 1S3HA 3N9KA 1H62A 4N6FA 3GNNA 3HPFA 4LTSA 2RURA 4YWIA 1LWJA 2JF7A 3RN6A 2DPEA 1UQYA 1K7XA 3VM5A 3ZJKA 1KGWA 4OE7A 4PMXA 2F84A 1H0IA 1AQFA 1VYPX 4AHOA 4C5YA 1PINA 3PANA 5CZTA 3QBUA 3AUJA 1Y0OA 3NR0A 3N12A 1UIOA 2GL5A 3UERA 1ZS2A 3TTSA 1T8QA 1K77A 4E0CA 3MA8A 4JN7A 3SUUA 2KX9A 3LN3A 3N11A 4Q8PA 3PZGA 2VCCA 3GWQA 3BANA 1FFQA 4MY9A 2YYTA 4XBJA 1I60A 4L9ZA 1XRFA 4BEUA 1S5NA 3QSTA 4LVDA 4B5SA 3GBDA 3R6IA 3K4WA 1ZTVA 4CCDA 3H6OA 4X22A 4DRMA 1QPNA 5U4NA 1FKTA 1WB0A 2PS2A 4HNVA 2Y24A 2J47A 2F2HA 1YMYA 2DG9A 4Q4OA 1CXFA 2V67A 3KBNA 3W2MA 2J6VA 3GD6A 3W1MA 1LQAA 3NOEA 3LUTA 1TX0A 2QIIA 3TIMA 3NCOA 3STGA 2EG6A 3N4EA 1ODZA 1RQBA 1GYLA 4IFKA 3W53A 1NDZA 4BF5A 3PY2A 4I9JA 3IWPA 1GJPA 4KR0B 3T05A 1ZL1A 4LALA 4L65A 1Q85A 1UIPA 1K9DA 5EL1A 4QP0A 1EYEA 1V03A 4QE4A 1W37A 3UQAA 4H6QA 3O15A 1FDZA 1ZHAA 4XB3A 1NWSA 1P0BA 2GK1A 3URQA 2CLPA 2BBFA 2WC4A 2ZZ5A 3A3XA 4JY9A 1P6WA 3NEHA 4ACZA 4HTBA 4FOUA 4C6QA 2Z0IA 2XP3A 2PTWA 5BU9A 1GG1A 2ODOA 3ZR4A 2X1RA 1WCGA 4L4PA 1I2RA 1NP0A 2YDQA 4UTHA 2DIKA 5E09A 2OX4A 3NQ6A 3KTCA 4UTTA 2WANA 2I5QA 4Z42C 4I3GA 3COTA 5AYIA 5LZLA 1JULA 1S46A 3B0PA 3W1RA 1B6CA 3CV2A 1KXVA 1TCMA 1J2WA 4RDVA 3S5SA 3TTOA 2GWNA 3B05A 4NJKA 3AZSA 3NIYA 2FJKA 4UQBA 1AVAA 2WZEA 3CGTA 3O07A 3VZZA 3CTLA 2WSPA 2Z1SA 3QV9A 2F4EA 2VX5A 2VUNA 4X9SA 2ONEA 3R2GA 3P62A 1FKXA 5LNUA 2B31A 2A1YA 2KAUC 1E6NA 2PD9A 2AL1A 2JF6A 3GHRA 4S23A 1V5XA 4LNCA 4HNLA 4HSHA 3LDVA 2C19A 1WDSA 2NQZA 3QZEA 3T9PA 3AYRA 2B5UB 1ISWA 2QDDA 1ADOA 2B0MA 1XUZA 1TSIA 4WX2A 4OECA 3HBLA 4DRKA 2V82A 1CBGA 1GZGA 2XIMA 4HYRA 2UY4A 1E73M 2GQ3A 2OPJA 4JQ3A 2Y5SA 4MKNA 3LPPA 4UWMA 4U86A 1VPYA 5KZMA 5TNVA 4DRNA 3WYZA 1EDTA 2DIEA 3GH4A 3A24A 3O05A 1L1PA 5TF0A 1KKOA 3S2CA 3ARPA 1IT0A 1EL3A 4DRPA 3WLPA 4N42A 3VKJA 4EE9A 3DG7A 4D1IA 4JFWA 4LVAA 3V1PA 1JPMA 3PZVA 2HMCA 1BYCA 2QJIA 3DENA 2PV2A 1W5MA 1H0GA 4HSOA 4Q8TA 3TWAA 4BK9A 3O5IA 2XP5A 1ZNNA 3GR8A 5A6BD 4ZVJA 3L5MA 4Y90A 2ZQSA 1PCKA 3TYCA 3U6WA 4IP4A 2Y7GA 3TKFA 5B7YA 1ZP3A 1PIFA 4TYOA 1QFEA 1IR1A 3WH6A 3S4TA 3VIMA 5I2UA 1G01A 4JX4A 2PTXA 3T55A 3T2OA 3KDOA 3ZQ9A 1XDMA 4W84A 4ZQNA 3EWDA 1JYWA 4WDXA 4JAWA 1JYNA 3KHJA 1T41A 3QR0A 3GU9A 3RJXA 4GYJA 4H7VA 4JTFA 3W70A 4B5XA 3L0GA 4PMZA 3EX6A 4U33A 1T6MA 1X6NA 3P60A 1E1EA 4OKDA 3DZ1A 2HWGA 3QR1A 2JK2A 3CL8A 3CTTA 3OHIA 3PB2A 3DI1A 3WCZA 3IV8A 3MSRA 4MZ1A 2VQUA 2O0TA 3QGAC 1V51A 1BWLA 1BQCA 4NG3A 2CHNA 3AZTA 4GXMA 2RUSA 1UB3A 5FJOA 4RR4A 4XAKA 1K70A 3EOSA 3ZFHA 2DT1A 1X7IA 3CUXA 2NX3A 1FFRA 1J0IA 1VBHA 4TMBA 2JEPA 3XIMA 1B2YA 1W1ZA 1JFHA 3LLXA 3A4XA 1LCOA 3RPDA 4AQLA 1TCOC 1W3KA 3F2DA 2ACSA 4F79A 2DW7A 1Y5XA 4OUEA 3W7LA 1NU5A 1RV8A 1FKGA 4RPPA 2ESCA 3T0TA 2LGOA 1WZKA 1XH1A 1OADA 3CPGA 3UP8A 3W7QA 1DJYA 1SJCA 2LPVA 1XLJA 1OSEA 1UPMB 1SO6A 4NJJA 3BLOA 1ITXA 3FOKA 3WO8A 3T0AA 3EEZA 1W5PA 4L61A 3WEMA 3KM8A 3DFQA 3GS6A 3EX2A 3FVDA 3DIPA 3T08A 3OLEA 1K02A 3CNYA 3P80A 3PUGA 3GTIA 1BRLB 2OT0A 4KIRA 4C6OA 3TNOA 1Q1CA 1ZUAX 5AHEA 1UYQA 4JHZA 4B16A 3AMDA 4NIRA 3S42A 2YSWA 2BY3A 4GZJA 5HT1A 4E3VA 2ITKA 3VIPA 3HQOA 3STCA 1MNZA 4MTVA 2F6UA 2OZ8A 2GJRA 3AUOA 4H9UA 4RL3A 1O1ZA 2FZDA 4I5UA 3URNA 4GQ0A 4MF4A 2YDSA 2Y5JA 5D30A 2OYLA 4D6GA 3MHGA 2PDFA 1SUXA 2WZTA 4DUVA 4IMFA 2A0NA 1XF0A 2GYIA 3WDJA 1KV5A 4UTIA 3LI0A 4QRNA 1JNDA 3PUOA 1SZFA 4KWUA 3II1A 2OOFA 2VGGA 5CZSA 5HR6A 4WJXA 3N14A 3WQ5A 1L6WA 4MOZA 3WQEA 4LC6A 3GTYX 2AL2B 4G8TA 3EBVA 2FZBA 3EB4A 2NT0A 1BPLB 1Z6KA 3B0XA 4MWAB 1CGUA 1DXEA 2GJXB 2WM0A 4UTFA 3LV5A 1JYXA 1ZBKA 1XUUA 1QNRA 1H51A 2RDUA 4IWWA 5CPLA 3RR4A 3GU0A 2OSXA 4AYGA 5I23A 2G3IA 2DVTA 2A7PA 1M9HA 3LM7A 3TOPA 3PTMA 3ZJ8A 2E68A 4RDYA 4J3TA 3MV11 4B2DD 5BOEA 3HG5A 1Y5WA 1A3HA 5HMFA 1V3HA 1ROUA 6CGTA 3MHFA 2YCKX 2WMJA 4MFEA 3VIGA 2ZTKA 2ZTJA 4AB4A 1K1DA 4C6MA 3IUDA 1Z44A 4ONVA 1E6XM 3K4AA 3IKDA 4GLEA 4LW7A 4DF2A 2C18A 1AD4A 4UR8A 5HJXA 1ZCOA 4C7FA 3THCA 4FNTA 2WKLA 4JTLA 3F2BA 7TIMA 3UWYA 4E2OA 3LLDA 1CDGA 3LMYA 2PDPA 3M0JA 5I03A 1TRIA 1J5TA 3QQWA 1P7TA 1QATA 4WEVX 1KCXA 2IKHA 4FLOA 3KEHA 2R24A 3TUUA 3D3AA 1W1IE 3OTRA 3T42A 4QFUA 1TTQA 2VHLA 4H9MA 4IQEA 2GQ9A 2AQWA 3CZKA 2DVUA 3GW0A 3H53A 3HM7A 3W27A 1HIZA 4H19A 3AIRA 4IISA 3UA3A 4Q3MA 4U84A 3O6YX 3G8EA 1KR1A 2VEKA 4O0KA 1EJSC 4KW2A 4TV5A 4ZR8A 4D6CA 2HK0A 5JH1A 4ZO7A 4LS1A 3HPZA 3KBWA 2W63A 2XH4A 2I9UA 5JUVA 2ZRYA 3UWVA 1U33A 1KT0A 3KVJA 5JBEA 4NX5A 4TW6A 4OHQA 3B8IA 4I7WA 3CUGA 2OLHA 2KGJA 3ZS4A 3NJ3A 2GJXA 3CBWA 4MNLA 2Y85A 4BQ3A 4CN4A 2ZE3A 5BMWA 4Q6XA 5C54A 2WKJA 2ZIDA 2Z6IA 3U2CA 3H21A 4JFJA 1DJNA 4XAYA 3ZT6A 5FF4A 4CQBA 4DAIA 3LUOA 4D6DA 3MU7A 4OBRA 4Z1DA 4C6BA 4FNPA 5D4YA 7CGTA 4IGSA 3ANUA 1OYAA 5DCDA 1CXLA 2CKRA 1VBJA 2Q6ZA 3KW3A 3KX6A 5A2AA 3WF1A 1XBYA 3N9RA 1GONA 1IXOA 4F0RA 4JIEA 1NQ6A 1XIGA 1F6PA 3NWRA 5IFPA 3N4AA 1LRNA 4TMCA 4MKSA 2VUYA 4NASA 5EFDA 1XC6A 3S9YA 1QO5A 3KDNA 2HISA 3R11A 1NOUA 1ISVA 2Q3RA 3N34A 4D9PA 2QR6A 3H7UA 4V33A 2CLKA 2WWDA 3OYZA 3NDYA 4N9DA 2PMQA 1IXNA 3P5ZA 3W26A 1WDDA 2CBUA 2J7FA 4W86A 1MZRA 4QCFA 3V3WA 2WHMA 3UNDA 1OFDA 4M56A 4LNYA 3AQUA 2PGFA 3QW3A 3B8WA 3E49A 5J04A 4L6OA 5HWCA 1HQTA 1HUVA 1HJSA 4H2CA 3M0HA 3VA8A 2F21A 4Z2JA 1R3WA 4DROA 3KE0A 2AMXA 2CW6A 1OGBA 4O2TA 4FNRA 2PLCA 3JU2A 4LVBA 3KUMA 4EF8A 1FBAA 1DJZA 2X42A 3G1FA 3MUIA 3AMKA 2VX7A 4FX7A 2XTKA 4LS2A 2VZOA 3B8SA 2I9EA 3CT2A 4P8VA 1QPKA 4X60A 1QASA 2FGLA 3WL0A 3UQNA 2YXOA 4CVUA 4H01A 3RYSA 1E0TA 1QI5A 2ZBTA 1BKSA 4LX4A 2ZC8A 4QCEA 4O1DA 4MM1A 2KR7A 1JDEA 3N9SA 2XIOA 3QSRA 1XYAA 4D6HA 1CGXA 3C86A 3C4UA 4JTEA 3UG8A 4QDPA 4ZO9A 1G9HA 4IOTA 1W5QA 3IJ6A 1F7BA 3ARQA 3CLWA 1XYBA 4IXXA 3IACA 3O6CA 3E5BA 5HQLA 1XGEA 3W1QA 1EC7A 3EKGA 3EKZA 1O60A 1Z7AA 5HANA 4MY8A 1E0UA 2WCSA 4PUMA 2PTDA 1PZ1A 2FKPA 1RY8A 3GZAA 3LCFA 1MWOA 1P4CA 1TPH1 4AEOA 5HATA 3BTNA 1MUWA 3W02A 1O5KA 5HWBA 1XHGA 4YCOA 1WXZA 4J3ZA 2E5BA 4IL2A 1ISXA 3T7VA 3AXKA 3ZWSA 1SR9A 1KNWA 1ONWA 1VIWA 2PB1A 1J8VA 1ZJBA 1TJ2A 3HIJA 1XIFA 3CO4A 2OLAA 1TJPA 2E25A 1GEQA 1SYTA 2RUDA 2XYLA 3UZJA 4LYKA 3ANYA 4DM2A 1GZ1A 5EFFA 4U85A 3IK4A 3R0DA 4MB5A 3SGUA 1PKMA 5ENLA 1IGSA 4O8AA 3DFNA 5D05A 4DI9A 1GOIA 4WDWA 2DSVA 1CGVA 3GK0A 2PZNA 3UEQA 2WC7A 6TAAA 2X1UA 3HQ1A 1GQJA 3ITOA 3DFYA 3ARVA 2OGJA 1C29A 2XP4A 2ZDRA 3LQGA 4PCNA 4RLIA 1XGZA 2DZBA 2XZ7A 1KLYA 1XI3A 1JCYA 1UP0A 3OA3A 1UD4A 3M07A 2FMOA 1UJPA 3QJAA 1A5MC 5CC7A 2PURA 3KBVA 1BTCA 1K7FA 4EACA 3G3DA 3HF3A 1RPKA 2C1HA 4KWOA 1VBGA 5DBUA 4XKYA 2VD8A 2FTPA 4L9XA 3CWOX 3M6DA 2Z28A 3ME3A 5D37A 1SQ7A 2O55A 3LI1A 1X1ZA 4HZMA 3S6OA 2C79A 1YW5A 4L72B 5G4WA 3IJQA 1PHWA 4XK2A 1EP2A 3SIMA 1JGMA 3V75A 4IF2A 4IT6A 3TQPA 4N7QA 1ZJHA 4E3TA 4MKVA 4JCMA 4K36A 1NARA 2Y70A 3SSZA 1UWIA 1KQZA 2FKEA 3BXWA 4JYSA 3IIZA 1X8CA 3KOWA 1JNSA 3A4WA 3GLCA 4AFYA 4EP8C 2WWCA 4X3ZA 4ZTYA 3RIKA 5FL0A 1D3CA 4GD0A 2FB3A 2BXYA 1PJ9A 4A05A 3ARYA 5AHNA 4DLFA 1X96A 2D3LA 4ODNA 2V5CA 4GFIA 1EYWA 4P7OA 2J7EA 1CXHA 1UZ4A 2R1MA 4RDWA 3LEPA 1V6UA 3TVAA 1UZ1A 1G1YA 1MQRA 4AWUA 4HSNA 2OWXA 3WF0A 4FP1A 1J0ZA 3F2CA 1W2VA 1TVLA 4JTUA 2OODA 2AGKA 2V2DA 4HPHA 2O9OA 3STEA 4LQ1A 3BURA 4GABA 3PBGA 3WBEA 4NKCA 1ELSA 4FAPA 4AZCB 4PRRA 3E0WA 1TFVA 1OC5A 3O0FA 2NWRA 4ZL1A 3THDA 4BQ2A 3EXTA 1JDAA 1NDWA 1GQNA 2EPOA 1SW7A 5D38A 2VZTA 3TWBA 3IGUA 3LD5A 1KXQA 3HA1A 1W6TA 2CZFA 1GCYA 3ALGA 1XWYA 2PU1A 2C0HA 1UWAA 4I9MA 3QMRA 4PUWA 4WVXA 1RH9A 3SY1A 1AJ0A 1UH4A 3H4GA 5CSRA 5U7SA 1Z89A 4ODQA 1DJHA 3WH9A 4YVXA 3APYA 4GIEA 4HMEA 1F3TA 4ZEPA 1KM6A 1KXTA 3CEPA 2F2DA 2UV8G 3O3RA 3ZM8A 3TTYA 3F4DA 1TTPA 3EKLA 1WDWA 4AD3A 3KP0A 3V1HA 3UWWA 4H83A 3MJYA 4IHCA 3OZPA 3G5EA 2BWGA 1YPXA 3FHQA 3OYXA 1ZU8A 2QDHA 4LUTA 3V0SA 3UY8A 2I14A 1E1CA 3KBJA 3IS4A 3TJXA 4JFLA 3S6DA 5D75A 1Z41A 3JZEA 2NQ9A 2CHOA 1ITUA 5E9AA 1RPXA 4N4QA 4UFIA 4DX3A 5GJPA 2BVYA 3B9DA 2VGBA 1VYRA 2CLFA 3BJFA 3IJDA 3TTEA 1EX5A 4JCLA 1GVSA 2KO7A 3CAWA 4FLSA 3N19B 4JQ4A 5D8ZA 5HR7A 4JEQA 1ALDA 5F4WA 5LHEA 6REQA 2QUVA 2JZVA 5AVNA 3EEGA 1W56A 2J7HA 1GVRA 1WZLA 2FFIA 1QUMA 2YL5A 4A8LA 5BOOA 1TTJA 1S39A 4PTDA 4OOZA 2REQA 5HNNA 2W79A 4PMNA 3UETA 5DITA 2HQAA 3UJEA 4LYRA 5H91A 3TCSA 1RJQA 3W7JA 3DUGA 2QPSA 3HG4A 1YKWA 1UKTA 1VBUA 5DF0A 1OB0A 3N3MA 3H12A 3N2XA 2XUCA 3CYJA 4HNCA 4Q4RA 3M7WA 2Z1VA 1TV3A 3P0XA 1F3XA 3WD0A 2X7VA 1IIHA 4ZQPA 4QIBA 3ABZA 4AZBA 3F4CA 1ISZA 3QTPA 1FKJA 3NQEA 3WBXA 3OU8A 4O17A 3NM1A 3Q65A 4WXYA 3WLIA 2OYMA 3R43A 1OQFA 4K8EA 3NVTA 1E70M 1LROA 2Z24A 3DHUA 3W24A 2WQDA 2A5HA 1TWSA 2Q3OA 1ZBVA 3DKJA 4AD4A 1FA2A 4JFKA 1UUOA 3O7UA 2MNRA 4OU1A 5DMMA 4W88A 5HXMA 2A3CA 2CLMA 2E7FA 3CZEA 1E43A 2QCLA 4NZ1A 3VINA 3SN1A 3WK3A 3L4UA 4CU6A 4YVVA 2VC6A 4GO9A 1VJSA 2J7DA 1TPC1 4JFVA 4KCWA 1TA3B 1TKKA 5A8NA 6XIAA 1UKSA 1FH8A 4L9YA 2A4AA 1NH6A 2VC5A 3AXIA 5FACA 4Y9PA 4PCFA 4G2DA 5JXQA 4W9QA 1UKPA 3MKCA 3V0UA 1C8YA 3NQFA 4RKAA 1DL3A 4DJEA 4A3RA 3GY1A 1H11A 2VURA 3I3DA 4XSMA 2P8CA 2Z7KA 3W7KA 2QQ6A 5FJUA 4IQDA 2HROA 3GVQA 2PDMA 4QR6A 3IJ9A 4IX0A 1MUCA 1YX1A 3N04A 2R1LA 2WPGA 1MXSA 1BKHA 2YIHA 3VD5A 1C9DA 1J9YA 1PSCA 3DESA 3VDAA 4EXAA 1FY6A 3IUIA 1F8IA 4MHBA 3TC3A 1U2YA 2VFDA 5I3HA 3H9RB 3SJ3A 3FHAA 1KXHA 4HA4A 3L12A 2QPXA 1UWQA 5DT7A 2YGYA 5EA9A 2PAJA 1XLEA 2IXUA 3PZNA 5JH2A 4H7CA 5G2WA 3TSMA 4G1NA 4JD4A 2DIJA 4YCPA 1HKWA 1EPVA 2C16A 2ZXQA 1QJWA 1I2QA 3WLMA 4R5EA 5E1QA 4PYSA 2HE5A 4H8UA 2WHKA 1V4YA 3MP4A 2G97A 3P81A 4GVFA 1JFXA 3MVIA 3S2NA 3LA4A 4HYWA 1A5AA 3NGJA 4DH0A 2INFA 1J0KA 4NYYA 1A7XA 3IARA 4M6VA 3WLNA 1FVPA 1B9BA 2R8WA 1TA3A 2D2OA 1Q65A 3JS3A 3MCNA 3QOMA 1MXGA 2VXNA 1FHDA 4KCTA 2CYGA 5D2YA 2R1PA 1SVDA 2VDHA 1XLCA 4QSFA 4TX0A 4UTKA 4JYFA 3SGZA 3POHA 2BOFX 1V93A 2RDXA 2PV3A 2GGEA 5LIWX 3KWSA 3TMLA 3PNZA 1YNQA 2YBVA 3VCRA 1JZ7A 4QG6A 3B06A 3OO2A 3EX4A 1N8IA 2G3NA 3P67A 3MWAA 4C5ZA 1H7PA 1VFLA 1VPXA 3AYSA 4FEZA 1N2VA 1J11A 1XV8A 2VX6A 1L9WA 3ITTA 1PIIA 1UBSA 3GBEA 3IJLA 2CLHA 3B8TA 3IGHX 3RX2A 3MCMA 1EP3A 4ROPA 4F2TA 1DHKA 3PZOA 1J6YA 2PDXA 3O16A 1Q2RA 3AS3A 1HT6A 3RJYA 1VD6A 5K4XA 4UFHA 3BAWA 3N2MA 1I75A 3DYPA 3FVMA 2J9ZA 3I3EA 1DEDA 2H8XA 1SO3A 4LRSA 4B15A 1AL8A 5H8MA 3THUA 4GIYA 4AD1A 4RE4A 2C7FA 4YYCA 1JJKA 4DHGA 4RZBA 3L7RA 3MUZ1 3VMPA 1J6OA 1CXEA 4P7QA 1HO1A 4FNQA 4LS0A 3IAPA 3CAQA 4KPLA 4QZVB 5DMYA 4KGJA 2BDQA 3FEQA 3A3WA 3FYOA 1KCKA 3LTPA 2EG8A 1XR2A 4IQLA 2I7GA 1NDVA 1JEZA 1NQKA 3E2RA 4FSAA 1HF6A 4FXJA 4P8WA 1F2JA 3EWZA 2GVJA 1FKRA 4WSJA 1E4LA 4G1KA 3NVDA 5JQ9A 4DRQA 2PPPA 2OOGA 5K9DA 3Q45A 1PHQA 2CETA 3QY8A 3UG5A 1CXIA 1Z8AA 3Q4DA 2V68A 3OBKA 1UD6A 3I7SA 2VVNA 4P7LA 3L23A 4UUIA 4DIAA 1AQMA 1OYBA 2ZWYA 1XPYA 3M5XA 3O6AA 1YNYA 5CKSA 1T8XA 1GJUA 3SEPA 3LGDA 5A6BA 2X7WA 4GA8A 1C7SA 3AALA 3GVGA 3WN6A 3WQFA 3L2IA 3TZFA 4MJ2A 4E38A 2WXDM 4JTGA 4HT3A 2PWDA 3ISIX 5K4ZA 1YTKA 3RRXA 3TW9A 1QTWA 3WIJA 4AWTA 3NFUA 2DQXA 3WZ0E 1J12A 4LAUA 3WF4A 3GXTA 1XLMA 3GVVA 3KBMA 1HO4A 5D9PA 1PEZA 3RILA 1OX6A 1Z42A 1W1YA 4DELA 2PCEA 1E56A 3RMEA 5I06A 3DFSA 2IKJA 2NT1A 3NL5A 4O1AA 1XLHA 1G5AA 2DUXA 3M0YA 1UR9A 4NX0A 1ZAJA 3NI6A 4ZO8A 5CC5A 4HQVA 2ZUUA 5BXPA 2IW0A 3VGGA 1F40A 2EEXA 1JPKA 4JTIA 1Q7QA 2YR1A 4JFSA 3WMLA 3WMBA 4B9YA 2A7RA 2BHUA 3LPOA 3PSVA 4LEQA 3UCQA 4JQ2A 3BSHA 3T07A 1AH3A 2NQJA 5H8UA 4XUGA 2ZZ6A 4R85A 3NQVA 1LG2A 1YNPA 5AHMA 5KSWA 3QHMA 4WCJA 1Y8BA 2J7GA 3SADA 1MZHA 1V0NA 1QNSA 3BW2A 5BNKA 4MIMA 3CH9A 3VCCA 3S6TA 3OLIA 1DYSA 4RJEA 5FF2A 3TJLA 1V77A 5FSDC 4U3CA 4ADUA 1WAWA 4GX8A 1BXNA 3AI0A 1T0OA 4Y9OA 3QXBA 3M5ZA 5CGQA 4I8YA 1GW1A 4AWSA 4S2BA 3IVUA 4QHRA 1L2UA 1VR6A 3NG3A 4W4QA 1OFOA 1DIOA 3RRAA 1V6XA 3MMUA 2XFWA 4OJYA 2QDGA 1M53A 2HS6A 1F4AA 1DPMA 4AXNA 1WNOA 1DJQA 1K7EA 3SZ8A 2I57A 1U1HA 3C2RA 4NJGA 2ACUA 4JX6A 3GW3A 5CH9A 4C7GA 3NQMA 3NO1A 5FEXA 1FHLA 1THFD 3GKAA 3S5ZA 1I9CB 3WQ8A 4QIUA 4S3GA 2FPTA 4MPKA 3SUVA 2AKMA 3GG8A 1AMYA 1LQ2A 4TVCA 4FX8A 3BMBA 4GYPA 1RZMA 3REQB 3E0IA 3SCUA 1UROA 1MEIA 4GCXA 3FV9A 3BLDA 4UFJA 4MFDA 1JI2A 2J4GA 4BCEA 1R38A 1C92A 3A3HA 3QPYA 3P93A 1WBJA 3MZNA 1GYNA 1H5YA 4BFAA 3D6NA 2E6AA 4I8DA 4ODOA 1IWBA 1KTCA 2Z4GA 1KTBA 4W5ZA 4S2CA 1LTDA 1BWVA 1V6TA 3AS2A 2DEPA 4M5PA 1R3RA 3CGMA 2PF0A 4LAXA 3UG4A 4ZPVR 3IGSA 3WNPA 2ZUSA 4QAIA 3NQDA 1JZ2A 4QTGA 3VUSA 1O95A 1L6FA 1M03A 1NOWA 4B2DA 4M7SA 1HW6A 1KWKA 2Y1HA 1ME7A 3UZ5A 2L2SA 1ZCNA 4M82A 4P8XA 1B90A 4XZWA 1AL7A 3LOTA 1TVNA 2V5JA 4ZSTA 3I10A 1E6SM 2D73A 4ZMGA 2V9DA 3VTRA 3DXIA 4NL1A 3S3GA 1VENA 4AH7A 3W1TA 3HO8A 2D3NA 7XIMA 4DO6A 2O56A 5BRPA 5HPOA 1FHVA 2P1FA 3MJMA 3R4IA 1MI3A 3BGJA 1JGIA 3HPXA 3DH7A 5GQBA 3N2CA 4PL1A 1OJXA 2OKOA 1PS9A 2CXEA 4JIHA 3PAOA 1U1JA 1TWDA 3E0FA 3FGCA 1EJXC 1CLXA 1BG9A 2PDGA 2ZE0A 3WLSA 4JKKA 3O5RA 1JCJA 4G50A 1DE6A 1VZWA 4YTUA 1XRTA 2PDHA 3JZUA 4LUIA 4PSPA 3STPA 1OCBA 3SCNA 2Z1KA 5CBJA 4O8RA 4JTQA 2E40A 4R9XA 4KEZA 1AK5A 1F9CA 4JIPA 4YTRA 3IKGA 4J4KA 3FXYA 4DWSD 1SJBA 4CD8A 3URAA 4WJ8A 5H2ZA 1GQLA 2UY2A 4QGCA 2GGIA 4DM1A 3C56A 2PDKA 4ZOAA 3JYJA 1EJ7L 3IRSA 3R10A 1WPCA 3TNBA 1EUNA 1F5ZA 3DBNA 4A2SA 4GXWA 5M1TA 3HJZA 3OG2A 1HL2A 4ZFMA 4PMOA 4U3AA 3BICA 3NAVA 2QW5A 5AY7A 3WUGA 1B3ZA 4B5TA 3KAHA 1QNPA 1X1NA 3GX9A 2QCNA 4NXKA 2PI6A 3IK8A 2PC8A 1SFTA 1WUFA 4GOAA 1NF0A 3AWNA 2BX7A 2DV0A 2GGJA 1EO5A 2X2GA 3GHUA 3ELFA 3KS6A 4XIMA 4YTQA 1H7NA 1TPVA 3LU2A 1UD5A 4HZ6A 1C3FA 3P8JA 5LNRA 2WMGA 3DYMA 4JIQA 2VEIA 1AZ2A 1G4PA 3CM4A 3WLJA 1OVDA 4UIOA 3NO5A 3LRLA 7TAAA 5PTDA 3B9EA 2G95A 3W7IA 3VKDA 5DCBA 1TO3A 2GUUA 5DY2A 1KM2A 4L5ZA 2GJNA 2CNCA 1YXDA 1AMKA 3W1NA 3EA2A 3GRIA 2J78A 1TG7A 3OGSA 4IPLA 3G24A 2CLLA 4JTCA 3VILA 5AC7A 1JL8A 1DIEA 4H9VA 4FOJA 3W7MA 2CZDA 1V0LA 4GISA 2NQ5A 3NQBA 1JVWA 4K39A 3MUAA 2ZZ7A 4JTSA 2QV5A 4RNJA 4W93A 3P7YA 1R2RA 1OT2A 3CASA 3CZLA 4AU0A 2CHRA 2D0HA 3OPSA 3BW3A 8CGTA 3LRMA 4GC4A 2X1IA 3BGAA 3ATYA 2YCEA 3S9IA 1A5UA 5C9UA 4NAFB 1UHVA 2C0AA 4S39A 3TC7A 2VP8A 1DJXA 3M4HA 3MO4A 3GUGA 4G7FA 3OQEA 4ENLA 5AC4A 3ITGA 3WDQA 3TP4A 4XZBA 2ZDSA 4CUCA 4NRSA 1YDOA 1YEYA 2ASHA 1V3LA 4S3FA 5JMUA 1FWBC 2PDQA 1P0NA 2KE0A 5EY5A 4NILA 4NZ5A 3ARXA 1CI1A 1GOOA 2TYSA 1JQVA 4AIUA 3A21A 3MI3A 3PS7A 1W31A 1G4TA 3GDMA 2IQTA 4U31A 3AZRA 3D5HA 3MCOA 4XV0A 3BAJA 3LTYA 3VIIA 3LLFA 2OCZA 4DAFA 4KKXA 3MB9A 3ZSSA 3SDOA 4RK8A 2QULA 4WD0A 3O5MA 1HKMA 2M08A 1VFFA 4GNVA 1RR2A 3UI5A 5GPGA 3TN6A 4HOWA 4K68A 3CWHA 4HNOA 4FA3A 2NV9A 3M5VA 2XWEA 1VKFA 2INZA 1W32A 4U2ZA 2Q5AA 3W84A 1TCDA 2OFJA 3B8UA 3W29A 4CN6A 4QAWA 1RJRA 3HMCA 4YIWA 4LYQA 4D8LA 4DPPA 1XIJA 1JZ4A 1TJRA 1KRMA 4GHRA 1LL7A 1HL8A 2CBJA 3K8LA 4LSBA 4C1NA 3QW4B 4L4MA 3VAVA 3RM4A 5A69A 2PWEA 3VOFA 3WG6A 5J5DA 3WNOA 4PFMA 3PPGA 1OK6A 3I6TA 4OQVA 3GU1A 5H8PA 3RU8X 3BO9A 1KFKA 4J35A 3ZLFA 3L4XA 4B90A 5G4EA 4IIFA 3V7PA 5H1WA 4JTKA 4UFLA 3RFWA 5I00A 3EXSA 4HCHA 4GX9A 2DZPA 3VNKA 4OZOA 3PTKA 2ZUMA 1TMHA 3BLLA 4CCZA 4FN2A 5BZAA 4TX8A 4XAGA 5C70A 3NZGA 3OOBA 2GZXA 4FF7A 4FNSA 1V08A 3LBOA 1PYMA 3HQNA 4O54A 5E9XA 1BF2A 3HPAA 4GMEA 2P0OA 1IR2A 4QT2A 3UI4A 2E28A 4RXGA 4UTJA 3FJ4A 4L4LA 4RPQA 3GR4A 1TUFA 3GTFA 4RE0A 2Q8LA 4JY8A 3LCLA 3BAIA 1PE1A 4HBKA 1QHZA 5I3IA 3TYAA 4YXGA 4FIQA 2BTMA 3ABSA 1MUMA 4XTIA 3V4BA 1XC4A 4QG9A 4HIBA 1ICQA 1V3MA 2YDAA 4M1BA 1JRCA 1BSLA 3W1XA 1WO2A 1OFQA 2PBCA 5HNUA 4B92A 1US2A 3LBMA 4V15A 2Y7EA 4E8GA 1C9WA 2BY0A 1LORA 4GRSA 5HUAA 1W2PA 1ZPTA 1QPOA 4QJ3B 5AYYA 2WAGA 4K38A 1WAUA 2RKXA 4P61A 3PK7A 3N29A 4FR6A 4HN4A 3UZYA 5I78A 5D2VA 1R9HA 1D6OA 2JE8A 3I68A 1DIDA 4CQ8A 4EK7A 1K9TA 2MLZA 3ZMRA 1U5VA 3PFRA 4PZVA 3NSNA 4NF7A 3SI9A 1VCVA 3A9IA 2PLJA 4UCGA 1IGWA 1RK6A 2VEGA 5LIKX 3EB2A 5C6MA 5HK4A 2Y8VA 1DWIM 4UOJA 3BCDA 4BWLA 2GVLA 1YDNA 8A3HA 2Y78A 1FTXA 2Q09A 3TROA 4MWAD 2XIQA 4W8BA 3FS2A 3QFEA 5LA2A 4MGVA 1PTAA 3ALFA 1LT8A 1JZ6A 5C9WA 4TV6A 2F2KA 1WKYA 4AX6A 1AG1O 1A0DA 3VGDA 3LCIA 4ZSUA 4K1WA 3RMJA 1E5NA 3WH8A 4NJHA 4PBEA 4RZ5A 5CXPA 3VE7A 4CNTA 4KWVA 3O5JA 1VRXA 3WBWA 1YYAA 4IIEA 3LXBA 4MDPA 5IDZA 1R8LA 1V6WA 2BV9A 3AIUA 3M0XA 2PV1A 2YBTA 3T1GA 3DX5A 4YPJA 4IPPA 1KKRA 4I6VA 3DERA 2V5BA 1E3ZA 3NSMA 1O1HA 3O5DA 5KZ6A 1CNVA 3WEZA 1E4NA 1FP9A 3UVIA 3VGEA 1LM1A 4FHAA 1DJIA 4M51A 4Q4PA 2E1DA 1S5TA 3QPZA 3GDTA 5A6AA 5FESA 1OCQA 4UTTC 4CQDA 4DBUA 2D20A 3HB9A 1Q6RA 2EJ1A 1XLDA 1RCOB 3TYDA 3POCA 5MKGA 2Z2UA 4HPGA 4MLRA 2XGIA 1WYIA 3FX4A 4JR5A 3M5YA 5E6YA 4J28A 5TBOA 4JX5A 3TR9A 5EBAA 1SZGA 3C2YA 2FVMA 3BE7A 3K13A 2C3ZA 1E0XA 2GPTA 3W9ZA 4MNJA 1F07A 4CQ9A 4CGTA 4HPNA 1P48A 3YPIA 2DSZA 2CWXA 2B81A 2P3EA 1R3QA 3R8RA 4LWWA 4KRZA 3WDPP 1FWIC 1DE5A 2GSHA 3Q37A 4ERGA 1LL4A 1FJDA 3MMTA 2C91A 4DI8A 4LAKA 4AYSA 3W28A 4JYDA 3UXDA 3QFWA 4GH3A 2TPSA 4HU8A 1TTIA 4WIWA 3WH5A 3XISA 5A8QA 2DT0A 3N15A 5J8LA 4L1GA 4FX6M 4J5NA 1FWNA 1P43A 2O92A 2QJGA 3HV8A 1HGWA 1WXYA 1JIBA 4O0QA 4CNSA 2Y5EA 1P0KA 4R34A 3PRDA 1A5KC 1UQZA 4DZAA 5M2FX 3KLLA 2O9RA 2MLXA 3PBMA 5D03A 2X8RA 4N02A 3DAQA 4JBRA 1R3YA 4XO7A 1M65A 3QV6A 2PA6A 4KWSA 1JDCA 4FXFA 3TA6A 3CUFA 3VU2A 2WZHA 1RLCL 5AZ0A 4CU8A 3IV3A 4PCPA 3WK2A 2V3DA 1EX1A 1QW8A 3FIGA 5EBUA 3UR5A 1R2TA 1H1NA 1HJQA 3I7QA 1GHRA 1YBQB 4E6MA 3DHFA 3IIVA 2QKFA 4QS5A 3WKZA 2BS9A 4ZODA 3W72A 2E9MA 3WMCA 4BHYA 3VGFA 4XO6A 3CV6A 2JALA 2HS8A 1TQJA 1XP3A 6TIMA 4F0LA 3CEUA 1WV2A 3AXXA 3TJIA 5CJNA 3VIFA 3E0LA 2GOUA 4LUJA 2TSYA 1DXFA 3VDBA 1JPDX 5A3HA 3AOFA 3HURA 2R91A 2GWGA 1I1XA 2J13A 3EAUA 4UXDA 1GJWA 2FPYA 1SZEA 1G94A 1UA7A 3ARZA 3WDHA 4LT9A 3VDGA 1SO5A 3AJXA 3W87A 1Q7ZA 5G1YA 3KACA 3MBFA 1TELA 4AD5A 1GKPA 4WKFA 3TONA 1O7AA 4GJ1A 3BPWA 3UYIA 1K6AA 9XIAA 1C9HA 4W89A 3BJSA 3VOHA 3TQVA 2ZA1A 3HGJA 2A21A 3PSWA 3NEVA 4AXKA 4W9PA 2BFGA 1RSCA 2PPOA 1G69A 1YBQA 1FQ0A 3GB6A 1PIGA 1W1TA 4NY2A 1UR1A 1DQUA 1L8PA 2G4JA 3SAZA 1RBAA 1J18A 3L5AA 3C0QA 1E6ZA 2WW5A 3VVGA 1NF7A 1Q8AA 3KABA 1F6KA 5DANA 4W9TA 1V3KA 2HPMA 5I07A 4UDMA 4F66A 1W5OA 5G1MA 1RVKA 1LP6A 3C2VA 1OYCA 3USBA 1JDDA 4OFCA 2ISFA 2QDEA 1W3JA 4GO8A 5C8BB 3BQ6A 2JIWA 5IDIA 1GK8A 1G4EA 3EWCA 3GH5A 1S5MA 4PMJA 3H2AA 3IVTA 4C6PA 5FI8A 4X61A 1PV8A 5T26A 5HAOA 3PBVA 2FJUB 3GTXA 3ORWA 5K9XA 1CZ1A 3U48A 3I4EA 5BU6A 1Q5MA 5C2GA 3UY7A 3W7HA 1EA0A 5M03A 4YHEA 2WNZA 1DHPA 5LA1A 3D3FA 4S38A 2YPIA 1AZ1A 5KITA 3ZJ6A 1W3TA 3BAXA 3PWGA 2ZZ4A 3TLLA 4IT4A 1L0PA 4PCSA 2OO6A 3VABA 1J93A 1RAKA 1FWGC 4PUDA 5HUOA 3N1AA 3MSGA 1F74A 3FAWA 2Y8UA 5D9OA 1Q6CA 1ZFJA 4KH2A 4HA0A 4MSSA 2G50A 2E6DA 3L4YA 3MI6A 2ATSA 3TSDA 3QZAA 1VJIA 1DQXA 3W83A 1JXKA 1X6UA 2ISWA 3L65A 1ONRA 4FK9A 5HULA 4EKJA 3ONBA 2ZC1A 4UZUA 2J74A 4J27A 4G7EB 1R30A 4DB7A 4GKLA 2YCJA 1HJVA 5HUPA 2ON3A 3SCTA 1QU4A 1O5XA 1S1RA 3QOKA 2J8GA 4FMVA 5A6LA 3E2SA 4UNIA 1GUVA 2FHCA 5L6UA 2QGHA 2DP3A 1C8VA 2J9YA 1REQA 3GDBA 2VN1A 4YMZA 3SURA 3AIBA 4AZ5A 2WSKA 1UG6A 3UXAA 5T9BG 4NSBA 2QIWA 1IX5A 1UZHA 7REQA 1RP8A 2AMGA 2E1WA 2V69A 1ZSXA 3AYTA 2WV8A 1DTUA 2ZRVA 3SUWA 4IIDA 4LAZA 1QPFA 3S5YA 1XH2A 1DTNA 3H2MA 4LANA 3LSBA 1JCHB 2RUCA 3WQOA 1CENA 2PLMA 1EJVC 4Q7IA 4D6FA 1M7JA 4PL2A 3M0IA 3TXZA 4JTJA 2YBUA 2OYKA 4JFIA 2DH3A 3PJUA 1XG3A 4FIRA 3RX3A 4U4MA 2POZA 4QITA 5LHFA