1ZL1A

Crystal structure of the complex of signalling protein from sheep (sps-40) with a designed peptide trp-his-trp reveals significance of asn79 and trp191 in the complex formation
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
361
structure length
361
Chain Sequence
b'YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3 like protein 1
publication title Crystal structure of the complex of signalling protein from sheep (SPS-40) with a designed peptide Trp-His-Trp reveals significance of Asn79 and Trp191 in the complex formation
rcsb
molecule tags Signaling protein
total genus 115
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2005-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1zl1A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1zl1A01
2WVVA 4Z2HA 4XV0A 1R8LA 3F4VA 1KQZA 4C7FA 1M03A 1W9UA 1KBBA 2WYSA 1XGZA 1AQMA 2ZX8A 1UOKA 2ZWYA 5D8ZA 1BG4A 5EFDA 3ALGA 3K46A 1EDQA 4HPHA 3SUWA 1JD9A 4BA0A 4MNMA 1VB9A 1DWIM 3DYMA 3N15A 1JG9A 3UESA 5FD0A 5A8PA 3PZ9A 5HXMA 3NUKA 3MKKA 1UR9A 2X1IA 2WB5A 1BGGA 1ESWA 3O6AA 4E8DA 4OKDA 2YDSA 2VZOA 1J0ZA 5CZKA 2CEQA 3VIIA 3SURA 1HNYA 1J01A 2YL9A 2ZUMA 3ZQ9A 1WE5A 4QLJA 1KR1A 3ARUA 2UY4A 4LXFA 3T2OA 2PI6A 1V3LA 2ESCA 4NRSA 2W92A 1O7AA 3GNRA 1BF2A 1I1WA 1J12A 1DWFM 3OGRA 3K8KA 4GPNA 3WH5A 2MANA 1J0IA 2V5CA 3AXHA 5E0CA 3MMDA 1E0XA 1W2PA 3RPMA 3AS2A 3GNPA 4IPLA 1SMAA 4PMZA 3IK2A 1E56A 1LL4A 4PMYA 3GXMA 3VU2A 2YJQA 2ZICA 2VOTA 4ZFMA 4CVUA 3CMJA 5A6AA 5HPCA 3CH9A 3ZMRA 4CD7A 4MB1A 3WH6A 1BPLB 1B31A 4PMQA 5KEZA 2YBUA 1W1YA 1NARA 4MB3A 1TFVA 3CZJA 3W27A 1CIUA 2OWWA 3VGBA 3ARWA 3W82A 3AHXA 4PN2A 4Q22A 2JE8A 1UWIA 2WVSA 1E5JA 1N82A 4GO9A 4GQQA 2V3DA 4W7VA 2FH6A 1WP6A 4AZCA 4GZEA 3WQVA 1JDCA 1GOKA 2X0HA 1RP9A 3VPLA 4JL2A 2WMJA 1IZJA 1M01A 3EBVA 2GSJA 5D9NA 2VTFA 3N04A 4W8AA 2VZUA 3MUY1 5A8QA 4EAMA 1B3YA 1NM9A 4KRTA 3AZRA 1ZBCA 1UWSA 3OLEA 2W4XA 3SCTA 3M6DA 3SCUA 5A94A 3ZJKA 3WEOA 3GH4A 1HN1A 1GHRA 2VI0A 5IDIA 3VIHA 2ZE0A 3L4UA 3AS3A 4WSKA 5CPQA 3WNKA 1B1YA 4OOUA 1E40A 3PZUA 2W91A 4HOWA 3UR8A 4S3JA 1TE1A 1NWSA 2G3NA 1H41A 2WLZA 4TVDA 4UCFA 1XH1A 1VJSA 2WPGA 3DYPA 2JF6A 2WMIA 1GQJA 3AHTA 3RJYA 1V0MA 1FOBA 4WKHA 3IANA 2DSZA 2GUYA 4B3KA 5LA2A 1B3XA 1KCKA 1C7SA 1VFMA 1LL7A 3QHMA 3MUIA 4P8UA 3NDZA 1JZ6A 1OGBA 5E70A 5DFAA 1ITCA 5E6ZA 2WANA 1LWJA 4UQCA 4AD1A 5LA0A 1QBBA 2YKKA 1BYCA 3OIHA 5JBEA 2WK2A 3AXXA 2X2YA 3K1DA 5E9AA 1KGXA 1VENA 3ZR5A 4D6DA 2XWEA 8CGTA 4J3SA 2XHYA 3SCOA 4JCLA 4A3HA 1XYZA 5GNYA 2QMJA 4AIUA 4MPKA 1EQCA 1UHVA 3JUGA 2CKRA 2DSUA 2XFFA 2WCSA 2WZHA 2ZUNA 1TA3A 4CD6A 3VM7A 2J77A 2YBTA 2EPNA 3EDDA 3RM8A 1DEDA 2VX5A 4MB4A 4RL3A 2D2OA 3AIRA 1JNDA 2O9OA 1JI2A 1CYGA 4AD2A 2YL5A 2A3EA 3VIPA 1JZ8A 2OYMA 3VDHA 2WNWA 1HVQA 3A6OA 2X05A 3CUJA 4MTVA 4JHOA 5M5DA 1BYDA 5DO8A 4W5ZA 3K4DA 3AHVA 3VIMA 1GW1A 4M24A 2PWGA 3BMWA 1OBAA 3EMZA 3EDFA 3BAKA 4PUEA 1XHGA 1QNOA 4HMEA 3VMOA 1HKKA 1D7FA 4OUEA 2VQTA 4FF5A 1V0NA 2EQDA 2J74A 2E0PA 2ZOXA 2HVMA 1QVBA 1Q6CA 3T0AA 4EKJA 2D20A 1B2YA 1CGWA 3CPUA 3W25A 1UUQA 5EBAA 3GZAA 4OBRA 4GINA 4D1JA 2DSVA 3QHNA 2OWXA 1NWTA 3PTQA 3W29A 1CPUA 2EEXA 2WCGA 3GH7A 1C3FA 1XSJA 1W3KA 5JIPA 3DHUA 2PF0A 2QMKA 1BGAA 1RD6A 1V3MA 4AW7A 2W5FA 1JZ2A 4H8UA 2WVUA 1UZ1A 1BQCA 2WW5A 4NF7A 3FXYA 4U31A 2VCAA 2WWCA 1GHSA 4NI3A 2WMHA 2W61A 1MXGA 5ABGA 3VDCA 3VTRA 2VUYA 1KXQA 1XD0A 3OBAA 1UQZA 4D6CA 4Z2KA 2A3BA 1YHTA 3AHZA 1OIMA 4R5EA 3OZOA 4HU8A 1J0JA 1WDPA 4H8VA 1XSKA 4N0RA 4WK9A 1V08A 4J3UA 3KZSA 3CUFA 1K9FA 2WVTA 1CGUA 2BY2A 1PJ9A 4QFUA 2ZX6A 2DT3A 3J7HA 4BQ3A 3CZGA 4Q7NA 4D6GA 1UD6A 3NCOA 4E2OA 4Z2LA 4QLKA 1JZ3A 2RGLA 1W1TA 1HL8A 3WMSA 3WFLA 2GJRA 2O9RA 4BS0A 4EANA 5FCZA 2JF7A 3WQ8A 4ZEPA 3EMQA 5FL0A 3W24A 4GO8A 3BH4A 4E4PA 4CCCA 3WUEA 2J7BA 3VD3A 2BY0A 3S6TA 3VGFA 2JIWA 2XIIA 2QHAA 4B9ZA 2NSXA 3AYRA 1FFRA 3TONA 4CVWA 2J7EA 2EPMX 1V02E 3VIOA 2GDUA 1F4HA 4F9DA 3I3DA 3OA5A 2DH2A 3W4RA 3WIJA 3N18A 4AZHA 1BG9A 4UFJA 2J7HA 2J75A 4TOQA 3AYSA 4LYQA 1NOFA 4UFLA 2J7FA 1WNOA 1XH0A 4QAWA 1RP8A 5BCAA 3ARPA 2CBUA 2WMFA 4HU0A 1GOMA 2JEPA 3I3BA 5A6JA 2YA2A 3FNDA 1QPKA 3GDBA 2WMKA 3WBAA 2OSWA 4J3WA 3VD9A 1V6WA 1FH7A 3FHQA 3ARVA 1HXJA 4M82A 3U5YA 4D6EA 4CU6A 1WZMA 1W1VA 3AIBA 3QHOA 5HBFA 3SCSA 4F66A 4JFTA 3ZT5A 5A1AA 1XCXA 2V3FA 2E9MA 1UWUA 3KL5A 3WF4A 1QI4A 4L4PA 3RMEA 1UR1A 1KQYA 5A95A 3WQ4A 2VR4A 4UNIA 1MW3A 3U7VA 1MFUA 2E9BA 5A69A 1KWGA 3MS8A 5A6BD 2WZIA 3L4VA 1GUVA 2VNCA 5C8BB 4OIFA 3QR3A 3AJ7A 3CZLA 2VR5A 1TZ7A 4IUGA 1VEMA 3WDHA 2Q8XA 1SR0A 1CXFA 2X8RA 5A6KA 5LYRA 4QP0A 4HA1A 4ACZB 4PMVA 2F8QA 3VNYA 2BY3A 3SCPA 3FN9A 5AC5A 3AROA 1US3A 1C8YA 4CN4A 2CBJA 3TTYA 2XJ7A 3CGTA 4N42A 4PCSA 3T0BA 1JXKA 1Z32X 1B3ZA 5IFPA 2WHJA 4X0NA 4DM2A 1E1FA 5I3DA 4GIAA 3W6LA 3ARTA 4Y7EA 4Z2IA 1C8XA 3WD1A 3VDBA 2FHFA 1O6IA 5BXTA 3PZIA 1EDGA 4U2YA 5IHSA 1VAHA 1I1XA 2Y4SA 2PBGA 5BRPA 1E55A 1QW8A 4OJYA 4GQRA 1CGXA 2CKSA 3BC9A 3TA9A 2ZUVA 2PWDA 3OG2A 5FIPA 1J11A 3AI0A 3WF3A 1EDTA 1HJQA 1J18A 3WNNA 4TX6A 3U57A 1LLOA 1TR1A 1PIGA 4AD3A 3PTKA 4JCMA 1HKIA 4M80A 4TTUA 2PWEA 1E9LA 1JZ4A 1XV8A 3SEPA 1J10A 2F61A 5CGTA 2D24A 2BS9A 1E43A 4W8BA 1Q6DA 2XVNA 4E8CA 2VRKA 3L4YA 2WBGA 1JF5A 2OYKA 3WMBA 4GI6A 3WUBA 3II1A 5A6BA 3AS0A 4HP5A 4DWSC 4JHZA 1MWOA 2XVPA 1CGVA 5CLTA 1NH6A 1Q6GA 4P8XA 5BXSA 1X1NA 3MANA 3G6MA 2XM1A 3O2LA 4HPGA 1B3VA 4MNLA 4P8VA 2ZUSA 3AMCA 4TVCA 1JYXA 2DQXA 2EBNA 2XFRA 4JL1A 4FLRA 3HJEA 1V03A 4PCTA 4LQ1A 1CECA 1UD5A 5JBDA 1UH4A 1BVZA 3L4TA 3GXIA 4NZCA 1WPCA 3AIVA 1V6YA 3UCQA 3ARRA 2CESA 3T08A 1V6XA 2BHZA 3CUHA 3WQ6A 2WSKA 3VGHA 2CBVA 4U5IA 4TVUA 3W26A 1WDQA 1EO5A 4LPCA 2VO5A 1M04A 1DP0A 2J8FA 1XSIA 2XGBA 4AEFA 3HN3A 3FAXA 3RO8A 1V3KA 2WCAA 2CPUA 4IISA 4UR9A 2PWFA 4HZ6A 3WDRA 3PZNA 1MYRA 5M03A 5F7UA 1PIFA 5BXPA 1WB0A 3ZT6A 3WNMA 3T09A 3WH9A 4HMCA 1LF1A 1UKOA 1K9TA 3QOKA 2WMGA 5ABFB 1W9BM 1W1PA 5JH8A 3RM9A 2XM2A 1NP0A 2WKLA 2A3HA 2AOSA 1ZJAA 2VQUA 4MNKA 3A3HA 3SIMA 4MJ4A 5FOOA 2WZEA 4KWUA 3AXIA 3BMVA 3VINA 3MUZ1 1CXHA 3UG3A 3WSUA 2Y24A 3I3EA 2DEPA 1EQPA 2DGAA 3F5KA 1L8NA 1R87A 2E8ZA 2Z1KA 2D22A 1E3ZA 3CZKA 4YN5A 4XUYA 2WHMA 3CBWA 4AZ7A 1UD2A 1M53A 4LGXA 1OSEA 4PBGA 1UD4A 4PMDA 3ARZA 4RE4A 1JD7A 1E71M 5I78A 1HIZA 1V3JA 4V2XA 1UWQA 3AOFA 3VD7A 1LWHA 1G1YA 2ZX5A 1QW9A 4HA3A 1QHOA 2W67A 3QGVA 2ZXBA 5AC4A 1FHDA 1R7OA 2G3MA 2YOCA 1WZAA 3WF1A 1UD8A 2DSKA 1XD1A 3RCNA 3UETA 4D6JA 1U30A 2WWDA 1JZ7A 1A3HA 4CCEA 2F2HA 1CTNA 4LX4A 3BCDA 1US2A 3N1AA 2WAGA 4DWSB 5A2BA 5CSUA 3L4WA 5A3HA 2GK1B 2C7FA 3WD3A 2WHKA 4UFKA 5ECUA 1UH3A 1E4LA 1Q4NX 2Y8VA 3GTNA 1JDAA 1DWJM 3N13A 1VEPA 4OOZA 1XYFA 1X6LA 2UWFA 2G3JA 4AYSA 3SUVA 2DT0A 3AIUA 4W7UA 4PSPA 3PZQA 1UA3A 3AICA 3EMCA 5ABHA 1G94A 1UKPA 3ZO9A 2ZXDA 5I77A 7A3HA 2G8ZA 1ISWA 3AQUA 1BFNA 1HVXA 3UERA 4CD5A 1GPFA 3W0KA 3WEZA 3MV01 4GI8A 4DUWA 3BLPX 4WSJA 1CXIA 1EO7A 1WZKA 1HP4A 3OLGA 1VRXA 3WY1A 1EOKA 2BHUA 3PZOA 2TAAA 1LQ0A 5DMYA 3UEQA 4BZYA 1GVYA 4X0VA 1VFOA 3WNLA 4JFSA 4ACZA 3G6LA 4W89A 3WMCA 3VOCA 4PMRA 1G01A 1KGWA 4WKFA 5BWFA 3PZTA 3M7SA 2V3GA 4HTYA 2BFGA 4J3VA 3K8MA 3NJ3A 1JAKA 3VGGA 1OD8A 3AIEA 3W37A 2D0FA 2EO7A 4W5UA 2AMGA 1PPIA 1TVNA 1E4IA 4W7WA 4H2CA 3KWXA 1AQHA 4UFHA 4RE3A 2XUCA 4UFMA 2XWDA 4J3TA 4TUFA 2BV9A 1QBAA 3T2QA 3CHDA 1W3LA 2NT0A 3AS1A 4W8LA 2FGLA 4W86A 2VCCA 2CYGA 2DIEA 5D9MA 4PTVA 1EHNA 1QOXA 3WUGA 5I2UA 3VIKA 1UA7A 3ZR6A 1YQ2A 2E40A 1B90A 2XSAA 3A4WA 3KEHA 1QI3A 1ISVA 2IUZA 4K68A 1ODUA 4MDPA 4PTXA 9CGTA 1BLIA 1E0VA 1W91A 1FHLA 5CPTA 2EJ1A 4TTGA 3VMPA 3QOMA 1UH2A 3IAPA 3ARYA 2WC3A 4HA4A 1ISZA 3ZJ7A 1IZKA 3FHAA 2FDMA 3RJXA 3O9NA 1E4NA 3GXFA 4PTWA 1OWQA 4ZXLA 3BAIA 1C90A 4GZIA 2J8GA 2CITA 2FHBA 1JYNA 5BXRA 4R27A 1ZBVA 2YA1A 3N11A 5ABEA 3CZ8A 1DWGM 1GOQA 1K9EA 2XPKA 5D8WA 4H8HA 1TVPA 3VILA 1GORA 2W63A 4KH2A 1LJYA 1NWRA 3NYDA 4Z2GA 2V3EA 2WBKA 1OGSA 4UTFA 1H09A 3GBDA 4D6IA 1UR8A 4WIWA 1XCWA 1H1NA 2CHNA 1H49A 3ECQA 4P7LA 2PWHA 3BSHA 3EDJA 2VX6A 1LG2A 4BQ2A 3DYOA 4AD0A 3NDYA 1AVAA 1WZLA 1AQ0A 1RPKA 4W87A 4C7DA 4PMNA 3WENA 4AZIA 1J0HA 4MDOA 2V5DA 2Y2WA 3S2CA 1CBGA 3AFBA 3GM8A 4YHEA 3KL3A 1GQIA 3ZOAA 4YPJA 1QNQA 4ZENA 4AY1A 2UY2A 4D6HA 2ZUUA 5D9PA 2CHOA 4DWSD 1FFQA 3F5LA 2BVTA 3D3AA 3MU7A 1E6QM 3GXDA 4GI9A 3B9AA 4PEEA 2D3NA 2OSXA 4URIA 4P8WA 4UZSA 2PC8A 4FLSA 4PMUA 3AMLA 1A47A 1QI2A 3APGA 1JFHA 2YDQA 1OB0A 1JIBA 2YLAA 1OINA 1TMQA 1H0GA 1UWRA 5CGMA 1H2JA 1MVYA 1QHZA 5ABFA 1PEZA 1UR4A 2BXZA 1W2VA 1H4PA 4YHGA 1G9HA 5C71A 4D1IA 4D6FA 1E4MM 3PZGA 4H7VA 2UY5A 2WMIB 2VVSA 3U7BA 1KFWA 4KGJA 5I24A 1CXEA 1GCYA 3SCWA 5A6LA 1GZJA 2BVDA 2YL8A 2JIEA 5GPRA 2CNCA 4NRRA 1S46A 3RILA 1ZBWA 5TD4A 2YDRA 2FHCA 2WM0A 1W3HA 3CHEA 1GNXA 2J47A 1JF6A 4P7NA 4JIEA 4BF7A 2V38A 2XYLA 5FL1A 4MNJA 3NIYA 4W88A 5E0FA 4GXPA 1ZB5A 3CTTA 2D23A 3PHAA 3T0DA 3CHFA 2GJXB 2QF8A 1D3CA 3BCFA 2OYLA 1NOWA 1ODZA 3AZSA 1Y7VA 4F9JA 1C8QA 4CUCA 1BSIA 1C92A 1UG6A 1H0IA 2ZXAA 5IHRA 4ZE4A 3OGSA 4DWSA 3TTOA 4UQ9A 4QDMA 1GOIA 4UOZA 1C91A 4HOZA 3W38A 2GK1A 4TXEA 5DT5A 1CDGA 2DDXA 2XIBA 1JZ5A 2AAAA 4PUDA 3MO4A 5AYIA 5AYBA 1KR0A 4BQ5A 5DF0A 1JI1A 3VO0A 2OLHA 4FMVA 3NSNA 3PBGA 2ZUTA 1E5NA 3M46A 4UZUA 3AHYA 3WDPP 3A4AA 4M29A 3OLDA 1NQ6A 3WD2A 2EPKX 1WDRA 1BYAA 4AIOA 1HJXA 4AZ6A 1RH9A 2VCBA 1E6ZA 2B31A 2ZIDA 3D5HA 3GYCA 1GJUA 1CWYA 1UR0A 1UKQA 4GKLA 3EDKA 1EOMA 2WC7A 1E72M 4J28A 4AD4A 1CNVA 2NW0A 2VZVA 3VD4A 1NOUA 3VM5A 2XVKA 2VX4A 5EMYA 3AMGA 4W84A 4KMQA 1OGGA 4AD5A 3MMWA 3VNZA 2PB1A 3HU7A 3WF0A 2VRQA 5I0DA 5A8OA 1QNPA 1PX8A 4CN1A 4PSRA 1CXLA 2O9PA 4IPNB 4U3AA 3BSGA 1R7AA 4MB5A 1UKTA 2J25A 4XX6A 5AY7A 2VL4A 2D1ZA 4CU7A 1B0IA 4UQBA 5CSYA 1OT1A 1V0LA 2BVYA 1K9DA 1JFXA 3LPOA 4A3YA 1ITXA 1SMDA 3OB8A 5GQBA 2ZWZA 1HP5A 4DM1A 4F79A 5I6SA 1C93A 4JKKA 3KL0A 3FW6A 5D4YA 5CPSA 2A3CA 4ATDA 4U5KA 1TUXA 3CUIA 4P7RA 3UR7A 1KCLA 3VGDA 1JAEA 2PBOA 1ZBKA 7CGTA 3SUTA 1OCQA 1IT0A 3EDEA 1MW1A 4RE2A 1W3JA 1B3WA 6A3HA 1HJSA 1HKMA 3OZPA 3RM4A 5HPOA 2DIJA 2XVLA 1AMYA 3WNOA 3BAYA 4TX8A 3L4ZA 5M17A 3B8SA 3WUFA 1FP8A 2CERA 5A2AA 1E6RA 1JXJA 3MSGA 4PTMA 1J0YA 1Q6EA 4CN6A 5M3WA 4H41A 2ZX7A 4MJ2A 2DH3A 4DUXA 5KZ6A 1QNSA 2ZUWA 2VVNA 3A47A 3OGVA 2GDVA 1GONA 1UWTA 2E4TA 2GVYA 1EXPA 4EE9A 1FP9A 3SCRA 6CGTA 3AMKA 3WF2A 3WN6A 4KGLA 4AZBA 3CO4A 1I75A 3VUPA 3GBEA 3ZIZA 5CXPA 4U3CA 1F4AA 4WF7A 3DHPA 5FKYA 1JNEA 1E3XA 5EFFA 4AZ5A 1SFSA 1HKJA 2Y5EA 1OD0A 2VC9A 5A8NA 2CBIA 3HMCA 1DWHM 4JFVA 1EIBA 3WKZA 2WKGA 1EHAA 4W93A 4XZWA 3WL1A 1BVNP 2YLLA 3AMDA 2EXOA 1W9VA 3AZTA 5DT7A 4BQ4A 3B9EA 2W66A 4JKLA 4AMCA 1HL9A 1VBRA 2DSWA 1PZ2A 4ZE5A 1D2KA 7TAAA 2WLYA 2IXVA 4XZBA 3SCVA 6TAAA 3LPGA 4CU8A 5IFTA 1CEOA 5CG0A 3LPPA 1CENA 1E15A 1LL6A 2OWCA 3WNPA 2BXYA 2WC4A 1G5AA 1V6VA 4MAVA 4AWEA 3WEMA 4B3LA 1HJVA 4CD8A 4CCDA 3N12A 5A6MA 2DT2A 4QCFA 3CLWA 2CCRA 4QCEA 5CJ5A 1PX4A 3BLKA 3WQWA 2VMFA 4AISA 1PBGA 2C8NA 3WDQA 4F8XA 5HDRA 1CLVA 1XRVA 2JFEX 2IXUA 1J0KA 1MQRA 4UQEA 5C70A 5IXEA 2G41A 2BNJA 3UG5A 2RGMA 4S3KA 5A8MA 2X0YA 1TG7A 1V0KA 3VMNA 3RDKA 1M7XA 5D9OA 1C7TA 3AIQA 1DTUA 4JZ5A 1GVIA 4ATWA 2VX7A 2GJXA 4AXNA 1W9DM 2J7GA 1NWUA 4ML4A 3E1F1 4DUVA 1BAGA 5HOSA 2BHYA 4CGTA 4U33A 4UOJA 4MAZA 3WH7A 3ZSTA 2WVVB 1BYBA 2QPUA 1HJWA 3WBEA 3TP4A 2J7CA 2J79A 1J9YA 3WH8A 3THCA 1TCMA 3NSXA 4IM4A 5E09A 2WHLA 4EK7A 2G4FA 3CIVA 3BAWA 1ZS2A 1XC6A 4OBSA 4KRUA 3THDA 3POHA 2EPLX 3VVGA 3A4XA 5GNZA 5JBFA 3CZEA 1V3IA 3CMGA 3VIFA 3SCQA 3PTMA 1CLXA 4LYRA 1MFVA 2JEQA 1H3GA 4J3XA 3M07A 3SCNA 1ISYA 4X9YA 4W85A 3ARXA 3RIKA 2D0GA 1WO2A 1KWKA 3K4AA 1CXKA 4H04A 2EPOA 2YA0A 3GH5A 2J4GA 2VZSA 2E3ZA 2O9TA 4JAWA 4L4OA 3TTSA 3WDIA 2Z1SA 3L4XA 3IJ7A 1VIWA 4ACYA 3MV11 3VX0A 4UQAA 3IAQA 3LPFA 2W62A 2VURA 2NT1A 1GQLA 1OT2A 2QPSA 2X09A 3PZVA 3ZM8A 4UQDA 1UYQA 8A3HA 2VJXA 2CIPA 2GFTA 4HOXA 1HJUA 2VRJA 5A6SA 1VBUA 1E0WA 1XH2A 3CHCA 3UG4A 1H11A 1VJZA 4C7GA 3F5JA 4JFWA 1ZU8A 5I5RA 3MMUA 1WDSA 1QI0A 1OM0A 1KB3A 2D0HA 2BY1A 1E6PA 5HNNA 5GNXA 1U2YA 1MXDA 3N9KA 1DWAM 3BGAA 3VIGA 1W9XA 3W28A 4FLOA 3WL0A 2QLYA 3W81A 5LA1A 1P6WA 1UR2A 1JL8A 2C0HA 2Y8KA 1V3HA 4FLQA 4AZCB 1MQQA 5JIWA 3L2LA 3LMYA 3CUGA 3MUAA 3DC0A 3W53A 1HX0A 4B15A 3WDJA 1E6NA 5CLWA 1EGZA 1UZ4A 2A3AA 4PMXA 3WD0A 3TTQA 3ZJ6A 3OLIA 3ZT7A 1ISXA 1GOWA 4D72A 2JALA 1KXVA 2WSPA 2FH8A 3WQ5A 3ZSSA 1B30A 1V02A 2J7DA 1IV8A 1W9PA 4XB3A 4M8UA 2FGZA 2J78A 1NP2A 2GJPA 1U33A 3VKKA 4AIEA 3IJ8A 3VDAA 3N17A 4BCEA 1HF6A 5JUVA 2D3LA 4AZGA 1EA9C 3BXWA 1Q6FA 4CD4A 4B16A 2HISA 1K6AA 4WLCA 5CQ1A 5BROA 1WKYA 4JKMA 1CGTA 4PRWA 4PYSA 1HT6A 3FY1A 2CETA 3AISA 3VD5A 1UQYA 3MSDA 5E6YA 3BAXA 2QV4A 1FA2A 3B9DA 1E70M 4CKQA 5EB8A 1FH8A 4M1RA 3POCA 3BAJA 4NSBA 1R86A 4UFIA 3W6MA 4UOQA 1W32A 3EYPA 1SYTA 4JFUA 4D71A 1CZ1A 1QNRA 1QHPA 3WFZA 3VIJA 1UD3A 1B9ZA 4M56A 3FAWA 1QI5A 1G0CA 4WKAA 4PMOA 3ARSA 3AIWA 1DHKA 1PZ3A 3PZMA 4MADA 1BTCA 2CXGA 1R85A 3PN8A 2G3IA 4QLLA 4P7OA 1V6UA 1KXHA 3NSMA 1JDDA 3WELA 1ECEA 1VF8A 1BHGA 5I23A 1MW0A 1JYWA 3K8LA 4WJXA 4AEEA 1EH9A 5I79A 1E73M 1GJWA 5DEZA 3SUSA 3T2PA 5A2CA 1UKSA 3L2MA 2OSYA 1E6SM 2DT1A 1TA3B 2ZXQA 4J7RA 2VZTA 1L0PA 4OZOA 4GZJA 1FH9A 3SUUA 4HMDA 1JGIA 3TOPA 2ZX9A 1CGYA 1WCGA 1VEOA 2YL6A 4B9YA 3ALFA 1KGUA 1KXTA 2XSBA 3DECA 3ARQA 1ZL1A 5BRQA 4P7QA 4LYPA 4HZ7A 1KBKA 1H5VA 1X6NA 3VX1A 2UY3A 2WXDM 2XFYA 4HZ8A 4AC1X 3WD4A 4FK9A 2XG9A 2DPEA 2XTKA 3ZJ8A 1MQPA 4V27A 2E9LA 1ZJBA 3IJ9A 1GOOA 4ZXOA 4J27A 3VGEA 3KE0A 2E8YA 1MW2A 1PAMA 2XGIA 2VT0A 2YIHA 2XVGA 1PX3A 1E1EA 1OIFA 4V28A 1LG1A 3U5UA 4Z2JA 1VFFA 3GNOA 1WAWA 5BYWA 4U2ZA 4ATLA 4M81A 1JYVA 4A4AA 2O92A 1E6XM 2J62A 1VFUA 1GQKA
chains in the Genus database with same CATH superfamily
4Z2HA 4PRRA 1K7EA 3LTYA 1M03A 2WYSA 1KBBA 4QNEA 3W86A 3CAQA 4RNHA 3KOYA 1ZLPA 1X7FA 4C5YA 4IX0A 4Q4QA 2Z00A 2WJDA 3ZZ1A 4DO7A 3UQNA 3SUWA 1JD9A 1XI3A 2JKEA 2TMDA 5JMUA 1DWIM 4C90A 3DYMA 4M0XA 1RCQA 2WO5A 1UR9A 2X1IA 4C6PA 4U28A 3AU2A 2DY3A 2YDSA 1AUSL 2VZOA 2GQAA 5CZKA 4ADUA 4EVZA 5H8MA 4B5SA 3Q45A 3ZQ9A 3ARUA 2UY4A 1D7IA 1A4MA 3T2OA 1GW9A 4A6GA 4RDYA 3IV3A 4NRSA 2Q8LA 3WCZA 3GNRA 1XLCA 1I1WA 3DHDA 1J12A 3R13A 3W74A 1W1IE 1D7KA 3KDOA 1W8SA 3WH5A 2TRSA 2MANA 1J0IA 2V5CA 5E0CA 3REQA 3B8TA 1ZALA 3RPMA 3GNPA 1E9IA 1FAPA 2CLLA 1E56A 1LL4A 2EPHA 4PMYA 2ZICA 4CVUA 3DHFA 1ZAJA 5HPCA 3PWGA 3ZMRA 1DIKA 3UI5A 4IJRA 4L4MA 3G22A 4U84A 2ACSA 3PTDA 2KR7A 1AW1A 1KTCA 3QY7A 2DORA 3GUGA 1TFVA 2F23A 3PNZA 5FI8A 1CIUA 3MDWA 4ERGA 3HZ3A 3AHXA 4Q22A 2FDSA 2WVSA 1E5JA 4IMEA 1YADA 2W79A 1N82A 1KKOA 2JKAA 4B5NA 2V3DA 2F7FA 1FUYA 3RLUA 1A5OC 1LT8A 4GZEA 4MIMA 3SM0A 1MO0A 3T0TA 2ISSA 3VPLA 1Q7QA 2IW0A 4LCRA 5A8QA 5D9NA 3BG9A 4W8AA 5HJXA 2GGHA 4EWJA 4E38A 2W4XA 3CAVA 3QZAA 3GU0A 3UZYA 2F2KA 1FWJC 5A94A 1BXBA 4FO4A 4Q6JA 5IDIA 3UQBA 2ZE0A 3AS3A 3E0WA 4WSKA 3P2VA 3WNKA 2P0OA 1NF0A 4OOUA 1FKGA 4FR1A 1E40A 3PZUA 2W91A 4JTDA 2CLHA 4W9QA 1KLZA 1TE1A 3UJEA 1EJ7L 5C9XA 1QK2A 2G3NA 1H41A 4TVDA 4UC5A 4O14A 5C9RA 1XYAA 4LEQA 1JNSA 5D32A 4S3BA 1Z42A 4WHBA 1XH1A 1VJSA 2WV8A 4MY8A 4A05A 2WMIA 3N73A 1T99A 1XLGA 3CS2A 5CSRA 2DSZA 5LA2A 1JEZA 3KOWA 2BMBA 2I5IA 4JIQA 1VFMA 3BCJA 1SUXA 6REQA 4H9MA 4HVXA 3NDZA 3LBCA 5DFAA 3ABQA 1MDRA 5EGRA 3DFSA 3VYLA 4UMAA 2F4EA 3E5PA 3V4BA 5LA0A 5CBBA 2PZ0A 3CIWA 4A21A 3OIHA 2YCEA 4HYVA 4NG3A 2WK2A 3AXXA 1I6NA 3K1DA 1W0MA 1KGXA 1VENA 4D6DA 3LN3A 4JCLA 3LM3A 3TJLA 1DJNA 1VCFA 1Z89A 2Y0FA 3N2CA 1Q7ZA 1WQ5A 2I9EA 5FEPA 1VPYA 2VX5A 2FMNA 4MB4A 4RL3A 5EA9A 3RITA 2D2OA 4H4IA 3TAOA 1A5CA 3SADA 4GVFA 2HQAA 5HW6A 4BEUA 2Z28A 3GTYX 2A21A 2Y78A 3OQ8A 2A3EA 4O1AA 3TROA 3VOGA 4C6JA 4L9YA 2OYMA 1G6CA 4IF2A 1HVQA 1P1MA 9XIMA 3INPA 3CUJA 3RX2A 4JHOA 3BWWA 4NU7A 3M0ZA 5FJJA 4W5ZA 3K4DA 3A12A 4M24A 2PWGA 1J4EA 3DCPA 1DVJA 2YW4A 1XP3A 4PUEA 4QEEA 4ONVA 4LWWA 4IGSA 2EULA 4OUEA 4C1NB 4ZA0A 5FF4A 4FF5A 3EWYA 3KACA 1V0NA 4TV5A 4PB5A 2EQDA 2J74A 3BVJA 3MA8A 3GSMA 1P1XA 2HVMA 2I56A 2H3BA 2QPXA 1P0DA 3JZUA 2XINA 3S3GA 2A0NA 3FA5A 5FF3A 3W7CA 3GZAA 1ZAHA 4GINA 4D1JA 2OWXA 3R8HA 3W29A 4REQB 3TFCA 1FWEC 2WCGA 4HNOA 2MPHA 1W3KA 3S1GA 1RD6A 2W5FA 1JZ2A 2VR2A 1L2UA 5D09A 3GXNA 1S2WA 2G4JA 4MGVA 3PFMA 4YJ5A 3EX3A 3O6DA 1EYEA 4Y6GA 2WMHA 1L6YA 1MXGA 3UWUA 5ABGA 2BODX 4FPSA 3VTRA 1CCWB 3SBFA 4RLIA 3KFTA 4Z2KA 2H8ZA 3RR4A 4IJCA 3OZOA 3P3BA 4S1FA 1XSKA 2A79A 4MFEA 4WK9A 1K9FA 4IXHA 2WVTA 3BLLA 1PJ9A 1EYMA 4YWSA 1E9YB 2O56A 2DT3A 3J7HA 3CQJA 3RN6A 1XBZA 1Y0OA 2H3DA 2RJHA 4RPPA 1V79A 1GOXA 1HL8A 3BMXA 4EANA 1AJZA 5FCZA 4K37A 2JF7A 3GW3A 1EX1A 2V9DA 3WQ8A 3QVQA 4ZEPA 1RXOB 1PKLA 3NTYA 4Z1AA 4E4PA 1BF6A 4GJ1A 3VGFA 3FA3A 2JIWA 2QHAA 2NSXA 1FFRA 4CVWA 4KQNA 3IJQA 2J7EA 2EPMX 3LGEA 1FTXA 3I3DA 5SWUA 1JCHB 1GQKA 3FJLA 3S4TA 2J7HA 1YBQA 1AJ0A 1TJRA 1NOFA 1J6YA 2HV5A 1F05A 2INFA 4XBKA 1GRJA 2YZ5A 3ARPA 2CBUA 4HU0A 4LV9A 2JEPA 3O15A 2QUVA 1S39A 5FESA 1PE1A 2RFGA 3T42A 3WBAA 1I9CB 4F4RA 4J3WA 4G1KA 3BZGA 3U5YA 3M0LA 3QHOA 4ZODA 4JFKA 5F2LA 5TQLA 3SCSA 4JFTA 5A1AA 1HKVA 4ASTA 4FOKA 4ZO6A 4N9EA 4NNCA 5H8PA 4S3FA 4LU0A 2DG3A 5A69A 3GW0A 1Y0EA 3MS8A 2QCFA 4RNJA 3T05A 3W3OA 3H53A 3LHTA 4G7EA 1OK4A 5C8BB 3N2XA 1H7PA 1M5YA 1V7YA 3AJ7A 1US0A 2VR5A 1TQXA 3P7YA 2JK2A 3NPUA 2Q8XA 2X8RA 1SVDA 3B8WA 4O18A 1Y5WA 2F8QA 3P6LA 4H00A 3DGRA 3FN9A 3MP4A 4CN4A 2XJ7A 1TPWA 2FJKA 1Z32X 3QM3A 5BWAA 3V5FA 1B3ZA 2WHJA 1OYBA 3GIPA 5I3DA 1CW2A 4J9JA 5RUBA 4Z2IA 1C8XA 3W83A 1TCDA 2PP3A 4XIMA 3C86A 2X1UA 1O6IA 1EDGA 3UGRA 1I1XA 4E3TA 1I4NA 1ZJHA 3FVMA 3TH6A 1YW1A 2X7VA 1W5NA 3E2SA 4GQRA 2V30A 2CKSA 3BC9A 3N2OA 2ZUVA 4AQLA 5KZMA 1XIJA 4TQTA 1HJQA 1LUCB 3SN1A 3W7KA 3I10A 4GE8A 4AD3A 1EJWC 2C1IA 3W7IA 4TTUA 2PWEA 1JZ4A 1XV8A 5DLCA 2ZA1A 5CGTA 3OVRA 2IPGA 4I5UA 3L4YA 1Q2SA 2WBGA 1KM0A 3C56A 2EF9A 3E0LA 3U2ZA 2DG4A 5T9CE 3O5JA 4IUOA 4HNVA 3KXQA 5A6BA 2WSQA 3AS0A 1GEHA 4HP5A 1ELSA 1CGVA 3SDOA 1NH6A 1Q6GA 3MANA 3BARA 4LSBA 4ZO9A 2XM1A 3HQPA 5AVNA 1HGYA 3AUOA 3VNJA 2QDEA 1Z9AA 3LUOA 2DUAA 3B8UA 3R4IA 3NQGA 2IPWA 2XFRA 3P74A 3HJEA 2PBCA 2EG7A 4U4MA 1CLKA 5JVLA 1BVZA 4ITZA 3E0IA 3GXIA 4JQ3A 4XBJA 1V6YA 1A5AA 4PH6A 3WQ6A 4MFDA 7ENLA 1TWZA 1YX1A 2ISWA 4OU1A 5CSSA 4KEUA 2QF7A 1YNQA 1EO5A 2VO5A 3TAKA 1DP0A 4AEFA 3RO8A 3AWNA 2BBFA 1FCUA 4JTEA 4LAKA 3RU6A 2PWFA 3ICJA 1OHLA 3GVGA 5LKYA 5AC7A 1YRRA 3JYMA 5BXPA 4GGHA 7ODCA 3LV6A 4D2JA 1UKOA 1RALA 1WA3A 1AH0A 4DI9A 1OZQA 1S2AA 4DN1A 1W1PA 1R3VA 1FWIC 4GKTA 1NP0A 2ZFAA 2A3HA 3CT7A 4XQ6A 1FKKA 3GHUA 4MJ4A 4NJHA 3EKGA 7TIMA 4US6A 3AXIA 1VPQA 3NQBA 1W26A 3UG3A 4KT2A 3UY8A 2DEPA 3CASA 5EMJA 3TJIA 2D22A 2XGZA 5H91A 2P76A 1UD2A 1B5TA 1OSEA 4PBGA 4PMDA 2GVEA 1JD7A 4AWTA 2A5HA 4K6AA 1V3JA 2FVLA 1UWQA 1G1YA 4FALA 4HA3A 2W67A 2ZXBA 1SFJA 1ICPA 2PDFA 3G0UA 3GU1A 2G3MA 4PFHA 5HMEA 3UETA 3PK7A 4C6IA 1THFD 3RLVA 1A3HA 4IL2A 2F2HA 4DAFA 3R6IA 1YNYA 4B5XA 3IUIA 3BCDA 1RVKA 1US2A 3K13A 3N1AA 4G50A 4GYPA 2NQJA 4XIAA 1QT1A 4GIVA 3L4WA 3KUMA 4AAJA 1LRNA 2D2JA 2GK1B 3P5ZA 3T8QA 4H6KA 3MI2A 3MHGA 2QCEA 4ZL1A 3KOFA 1VEPA 3LLDA 3EXTA 4NX0A 2G3JA 1QJWA 1ZK6A 3F7JA 3VOIA 2ZA3A 3OVQA 1UA3A 3AICA 4KW2A 5CH9A 3CV1A 1Z69A 3ZO9A 3MT1A 4H9UA 2G3FA 1EC8A 5I77A 1M9HA 2QJNA 2G8ZA 1Y8BA 3L66A 3PPGA 3AQUA 1EEPA 1FKTA 2Z24A 3B7XA 1CXIA 2GGJA 1YDVA 3BTNA 1HP4A 3W73A 1AZ2A 3SJNA 1EOKA 3E5BA 3PZOA 2QIIA 1LQ0A 1JRCA 3HGRA 4UTHA 5DMYA 1XLLA 3T4WA 4QJ4B 1VFOA 4OFCA 3KCLA 2Y85A 4JFSA 3W88A 4ACZA 3G6LA 1Q65A 2VUNA 3QQ1A 3N2MA 4ROPA 4UBPC 4IMAA 4PMRA 4L9ZA 4WR3A 4WZHA 1W1A1 5K2ZA 2V3GA 1VCGA 4A2RA 3M7WA 4HTYA 3L5LA 3OVGA 2PPOA 3P80A 1TREA 3CV2A 2BB0A 3EWUA 4UFHA 3VZXA 4XD4A 4RE3A 1JCJA 3PAOA 1JGMA 3UGVA 2GVGA 2BV9A 1R9HA 2Z2UA 4HZMA 3CEPA 2PGEA 3IK4A 2PDYA 3NQFA 3N3MA 2PDPA 1G4EA 2H9AB 2FGLA 3B04A 2VCCA 4IIGA 1QCWA 3HQNA 1QOXA 2FZDA 3NVTA 1J6PA 2ZKMX 4HSOA 1YQ2A 2E40A 2QULA 3UWYA 2GUUA 1B90A 3KEHA 4C02B 4IP5A 3PP7A 4MDPA 2RUDA 1W91A 4XAGA 2PDHA 4NYUA 5CPTA 3IAPA 4ICCX 4BFAA 4Y9MA 2NXIA 3SI9A 3LEPA 2ICSA 1IZKA 1G67A 4HHHA 3UQAA 3H2AA 1XC4A 4K3ZA 2XN0A 1S5TA 4PTWA 3VE9A 3TR2A 3WQEA 1F8AB 3BAIA 1PO9A 1FWGC 3UW6A 1W1B1 1M6JA 1ZY9A 4HPNA 1JYNA 4R27A 1ZBVA 4NJKA 1XDMA 5D8WA 2XPKA 1GZ1A 3PRDA 5CC3A 1LJYA 1NWRA 4TYOA 2HE8A 3M0VA 2V3EA 4IZGA 1FWSA 1OGSA 4S2CA 1EA0A 4H9XA 1UR8A 1XCWA 3HGOA 1H1NA 2CHNA 1BRLB 5DRIA 1IEIA 4JR5A 2PWHA 3UJFA 1LG2A 4BQ2A 1XYCA 2PGFA 3L7RA 1HFBA 1XBVA 1WZLA 1RPKA 2R24A 3E6EA 4C7DA 5EY5A 5AHFA 3E49A 3WQOA 1CBGA 2VDHA 5KMYA 4ZFCA 5BZAA 3ZOAA 3SGGA 1QNQA 5TF0A 3KHDA 2DW6A 1RPXA 1SU5A 3H7RA 5D9PA 4MGGA 4PULA 4DWSD 1YXYA 3PWAA 2J13A 3UWZA 3CH0A 2ZZ2A 4GI9A 2QCDA 3B9AA 1QPLA 4PEEA 3GDRA 2D3NA 2OO6A 3TN3A 3CU2A 4FEZA 4PMUA 1DOSA 4NJIA 1NELA 1E1CA 1G7VA 1YLVA 2ZR6A 2YDQA 1JIBA 1OINA 2EKCA 2YYUA 3N2BA 5CGMA 4LH8A 5ABFA 1UR4A 3KS5A 4JNYA 4LUSB 3EWBX 1FWCC 4AVOA 4D1IA 4GHRA 4K36A 2UY5A 3BGGA 3BW2A 3U7BA 2X16A 4O4VA 2OKOA 2REQB 2B81A 4MJZA 1ALDA 3H2FA 4IQ2A 2DG9A 3SCWA 5J5DA 1GZJA 1TTJA 3CWHA 2BLEA 2X1TA 3PUEA 3W02A 1GNXA 4MHBA 5EMUA 4DJED 1KFEA 4Q33A 1H5YA 2A7NA 5LGXA 2Q02A 2V38A 2XYLA 5LHEA 3NIYA 1PBKA 3IIPA 5E0FA 4GXPA 4B4HA 1RJQA 1IIHA 3CTTA 2D23A 1JPDX 3A24A 3VC6A 2GJXB 3QZ6A 3IVUA 4EACA 3BCFA 2OYLA 5A8GA 1GQNA 1PZ0A 4F0KA 2Z6JA 1UG6A 3BV7A 3BMBA 4HCHA 2ZXAA 5D2WA 3TNOA 5IHRA 4JDBA 4UQ9A 1IR2A 3CNYA 2G97A 4DIAA 2JKPA 5HWBA 3WJYA 1NDYA 1Q13A 3EB2A 4JYFA 1F3XA 3H7UA 2RKXA 1XG4A 3EXRA 1RY0A 2FZMA 3OA3A 5J5RA 4DO5A 4PUDA 3M5YA 2PLMA 5EBUA 2FQIA 1GKQA 4IIDA 4O11A 3SRHA 3T44A 4GH1A 1RCXB 2POTA 3S2MA 2DW7A 3MWAA 5I3KA 3FJNA 3C2YA 3M46A 4UZUA 3WDPP 3A4AA 4M29A 3OLDA 1PYMA 1TJ2A 1EJTC 3P81A 4HJFA 1BYAA 3EGJA 4AY8A 2B31A 2NV1A 3GYCA 3OTRA 4J35A 1UR0A 1AH3A 3KBSA 1I45A 3UA4A 1QPNA 2WC7A 4J28A 1FWBC 4L5ZA 4J4OA 3KABA 1H7WA 3NFUA 4MWAD 5BU6A 3VD4A 5G2IA 3GFYA 3S1UA 2XDFA 2YXGA 5EMYA 5U7SA 2HXTA 2FFCA 5LZLA 4MPQA 4IQDA 3PANA 1FXQA 2OQLA 5I3IA 3KVKA 1AFSA 2IKHA 3MMWA 4IXXA 3VNZA 2PB1A 3WF0A 2VRQA 4PUJA 1VR6A 2E25A 4US5A 3GVQA 2QCCA 1MRAA 1ME7A 3H8AA 1R7AA 1M5WA 4MB5A 3ATYA 2D1ZA 4WX2A 4CU7A 1QPQA 3MY9A 3ITVA 1K9DA 3L68A 1RBLA 1JFXA 3W7NA 1PHWA 2Z6IA 1AMKA 1HP5A 4ZOEA 2CLMA 3EX2A 1TZZA 1C93A 4U5KA 3FDKA 4O10A 2KAUC 3M44A 2PBOA 1ZBKA 3CLMA 4GXMA 3CL8A 4ZSUA 4RE2A 1T40A 6A3HA 1OCJA 1SFTA 3RM4A 2VD9A 3G8EA 3LXBA 4DPPA 3UA3A 4RNFA 4J4KA 1GVFA 2Q01A 4XKMA 2OEJA 3KM8A 2RJGA 4XD3A 4H41A 2ZX7A 4O8AA 2OB3A 3CHVA 4LAOA 3W2KA 4MKSA 1B9BA 2GDVA 2BX7A 4L4LA 4EXBA 1FP9A 2D9FA 3WF2A 4EP8C 3M9YA 1PWMA 1I75A 1OYAA 2ETNA 4GX9A 2ASHA 1BXNA 5CXPA 1UC4A 2JBMA 4U3CA 2H8XA 5FACA 3DHPA 1R38A 3TVAA 4F0LA 3QYQA 1I0BA 1WX0A 1OD0A 5A8NA 3G1RA 1EKOA 3QQ0A 4JFVA 1XICA 1EIBA 3WLKX 1FKHA 1Q8AA 4O28A 4WOQA 4XZWA 3AMDA 1BVNP 2RAGA 1JDEA 1W9VA 1GYMA 3NPWA 1EGMA 3I6CA 5DT7A 1UASA 4BQ4A 2X0SA 3ES7A 1HL9A 4ZE5A 3WQPA 4LTSA 1WUEA 5KETA 1VFTA 3IGUA 3SCVA 3TCZA 3S42A 4IMFA 4GFSA 2PWUA 4JQ4A 3EIPA 3LPPA 2OWCA 4JTFA 4UTMA 4KPLA 2VDIA 1G5AA 2HCVA 3NTPA 4B3LA 3EAUA 1HJVA 3O07A 1TPUA 1R3YA 2OO0A 3DXIA 3N12A 4KRZA 3CLWA 4PBEA 3CJPA 3BW4A 2VM8A 3BLKA 3UPWA 4XSMA 1QXLA 2LKNA 2C8NA 3NQ6A 1CLVA 1XWYA 3V1HA 1XLIA 3NZ1A 4WY0A 3XIMA 4F40A 2IXUA 1MQRA 3KDNA 5C70A 5IXEA 2V63A 1UWAA 3UG5A 5A8MA 2X0YA 1TG7A 3COTA 1J93A 1Q6HA 1M7XA 2W27A 5AHIA 2B5UB 4ML4A 4MSPA 2Z27A 1FKXA 1TPVA 2OGJA 4JXCA 3KX6A 1X1ZA 2BHYA 3FDGA 3JXVA 3EA3A 3R58A 4F3HA 4MAZA 4RXGA 2MNRA 2QPUA 4AG0A 4QDWA 4QZVB 3HPSA 1QATA 3WH8A 3NSXA 4Q8VA 2V2DA 3I68A 3PC0A 1VS1A 2CLFA 4W4QA 4D8LA 1ZS2A 4OBSA 5JBFA 1V3IA 3CMGA 3VIFA 1L1PA 3B0YA 3SCQA 3OW1A 3PTMA 2Z1VA 4GGQA 3M07A 1LP6A 1NSJA 1ISYA 2ZR4A 1ZENA 1U1HA 1TWDA 1XQKA 3NNTA 1RK6A 1WO2A 2INEA 4PCNA 4Q4RA 4POCA 3VE7A 1KWKA 3UBPC 3E12A 3KP0A 2DVXA 4JTHA 5CPMA 4LAVA 2J4GA 3H22A 3I4EA 4IFKB 4V1XA 3DFYA 2E3ZA 2F2DA 2O9TA 3QBUA 1VIWA 3MV11 5LIYX 3GU2A 1VYSX 3PZVA 1MDLA 2O7QA 3DN5A 2R1LA 2PGWA 2PA6A 5A6SA 1E0WA 1XH2A 3BG5A 1VJZA 3ITGA 3F5JA 3W9ZA 5T9BG 4KKXA 1SW0A 3FKKA 2YYTA 2BY1A 4FXRA 4F0HA 1MXDA 1IXQA 1WYIA 4GQBA 1DWAM 3VIGA 1K8CA 1PB0A 1GVQA 3HBLA 4GCXA 2ACUA 3GDKA 4PB4A 4RDVA 2E7FA 3VK5A 5D2YA 5DO2A 1MQQA 1V51A 5I98A 3QV6A 1DE5A 3MVIA 4ZSTA 3CUGA 3MUAA 3DC0A 3BQ6A 4RKAA 4HK7A 1E6NA 4EPBC 3DDMA 1EGZA 1UZ4A 2VWTA 1HUVA 2Q3RA 3NA8A 3ZJ6A 3OLIA 3ZT7A 1ISXA 4D72A 2YBVA 2WSPA 2A4AA 4GLEA 2O55A 2I9UA 4QR6A 4B90A 5FEZA 1K03A 1OY0A 4O53A 4ZQMA 4XB3A 3QYSA 2ZZ4A 4Q4OA 1NP2A 2GJPA 3O5PA 3S2LA 3AXKA 1U33A 5HULA 3U8GA 1HF6A 5JUVA 3L0NA 4AZGA 3BXWA 3NDOA 2YCLB 2MLYA 3IK8A 5DXYA 4CD4A 1TPB1 4B16A 2HISA 2PF8A 4LY8A 4QJ1A 4PRWA 3VNIA 6XIMA 2R91A 2OCZA 4O1BA 3MSDA 3BAXA 3P82A 1FA2A 1HO4A 5EB8A 7REQA 5K4XA 1M68A 3BAJA 4FN2A 4NSBA 3H21A 2NX1A 2RH9A 3L5AA 3LOTA 3BDKA 1W32A 1U79A 1ENUA 1CZ1A 3WFZA 3VIJA 4M56A 3FAWA 3NQ2A 2WQDA 4YL2A 2R8WA 1A5SA 4PMOA 3QSRA 3ARSA 4M7SA 4NHVA 1DHKA 3PZMA 3FAPA 4DF1A 3RCMA 4DJFA 2GSHA 1R85A 1MRQA 1J6OA 3PN8A 3EWCA 4XZMX 4QLLA 4ZQOA 4NY2A 1KXHA 3FX4A 3TQPA 4DWDA 3U48A 1EH9A 1QO2A 5I79A 3T2PA 4LAWA 2AKZA 3LI0A 1UKSA 4MM1A 2ZXQA 1TA3B 4H19A 2PDMA 3CYJA 4BR1A 3EXSA 1H7NA 3O5KA 4YIWA 4B9YA 3TUUA 1KGUA 2Y62A 5ECVA 1V77A 3CUXA 2PUZA 3ARQA 5BRQA 1KRMA 4LYPA 3UXKA 4WRHA 1O60A 2EHHA 1EL3A 3GTFA 1XGDA 2NSOA 4HZ8A 1ROUA 3MKCA 3PB0A 2PDJA 3NXFA 2DPEA 4LF2A 5LNVA 3GHSA 4WY0F 4IMCA 1ZJBA 3IJ9A 1AD4A 1GOOA 2QR6A 1ZQ5A 2PCQA 4CNTA 5HWMA 3BJTA 3F4WA 1SSGA 4LC8A 3EZ4A 1PKYA 1E1EA 5I07A 3MCMA 3JW7A 3NGJA 4Z2JA 4JYDA 1RJPA 4MJMA 1KM3A 4JNZA 2FFIA 1LZOA 4M81A 2O92A 1FHVA 1VIZA 4Y8FA 2J62A 1VKFA 2HE5A 1OX4A 4QCFA 4C6FA 2WVVA 4XV0A 2XIQA 4OWGA 4DROA 1OVDA 2HEJA 1AQMA 1KRAC 1S5VA 1UOKA 4FNRA 3U6WA 3C3UA 1OFAA 2ZWYA 5CC5A 4N6FA 5DIUA 3HG4A 1EDQA 2M1IA 3ONCA 1VB9A 1FJDA 3N15A 2ZRUA 2NX9A 5FD0A 5HW8A 5A8PA 4UB9A 1G4SA 5AYZA 4QE5A 2WB5A 2PTXA 4PR4A 4IIFA 3SGZA 2PDLA 2J6VA 4XZNX 2A85A 1OFBA 4NX5A 2EJAA 1WE5A 2AL1A 4QLJA 3W84A 1WBJA 5HUOA 3LHUA 1V3LA 3LHVA 4OUIA 4JN7A 2W92A 4Q32A 3UZZA 1L2QA 5LXXA 1BF2A 3OGRA 4GPNA 3OJGA 2XIOA 4EX4A 3FKRA 4MUPA 3AS2A 4IPLA 1V6TA 3V36A 4DRNA 3GXMA 3N6HA 2V81A 3MBDA 2VOTA 3CMJA 4BK9A 5A6AA 3CH9A 1W5PA 4N2YA 4YVVA 3GRIA 4GOAA 4MB1A 1SZEA 4ICMA 4CQDA 2BOEX 5K4ZA 3HJZA 3P84A 4X2PA 1UROA 1NARA 2PV1A 3F03K 2OWWA 2A3LA 3HURA 2JE8A 1F5ZA 4GO9A 4GQQA 1QASA 2QJIA 4QITA 4L6DA 4GUGA 3PS7A 1KD0A 2GVLA 4HN4A 3WQVA 2C3ZA 1GOKA 4LJ3A 4E4FA 2C91A 3UZXA 3R0KA 1IZJA 3OPSA 3HV8A 3VCNA 1RQBA 4KEVA 5I06A 3N04A 3MUY1 4EAMA 1AK5A 2E6AA 4WOZA 1NM9A 4CQ9A 2V0TA 3RF9A 3AZRA 1UWSA 3OLEA 2QGHA 1QO5A 5MF5A 3ZJKA 3VUSA 3L4UA 2XIJA 3DG6A 1D8WA 3RYSA 5CPQA 1CT5A 3GHTA 3EKZA 4R0XA 2CHRA 3UR8A 4JS3A 1IR1A 2WLZA 3A9BA 4UCFA 1XS2A 3CB8A 4NYYA 3N9RA 3OYXA 3T9PA 2WPGA 4RZ5A 3TJXA 1B3OA 3CWOX 1JQXA 4UTWA 4ICNA 5I3FA 1F8MA 2C18A 4WKHA 3LV5A 4B3KA 1LROA 1B3XA 1I2PA 1KCKA 5T8GA 3NM3A 1C7SA 4DEFA 3DIPA 4KBXA 1OFQA 4P8UA 3GNXA 2NVAA 1IXNA 3OYZA 1OGBA 1FKDA 2YFOA 1RQEA 4BKNA 4DXKA 5JBEA 2GPTA 3TC3A 1RQHA 2PDUA 8CGTA 1DXIA 2XWEA 2XHYA 2DZVA 4A3HA 1XYZA 4M6QA 4KEMA 2QMJA 1R3SA 5HMFA 1R6WA 4AIUA 5D03A 3P14A 1UHVA 2CKRA 2NV2A 2PLKA 1XLFA 1PINA 3P67A 4HSNA 1ICQA 3VM7A 2HVOA 2YBTA 1S1PA 4KESA 3EDDA 1DEDA 1O66A 3UY7A 3UXLA 2WJZA 3TN4A 4J2MA 1JCMP 1W1ZA 1TPH1 1TYGA 1JI2A 3VIPA 4LAXA 1JZ8A 1XINA 3WLLA 4EPDC 1PTAA 1VRDA 3FYYA 1GTHA 3A6OA 1Q2RA 3SR7A 2X7WA 3NRKA 4BEQA 2BG5A 4I8YA 3RRAA 5BOEA 2PDXA 4XZ9A 4PUWA 4DNHA 3K2GA 1DJWA 1OBAA 4AF0B 2CLOA 1R2RA 3M16A 3AO0A 2E1WA 2DIKA 3VNKA 2DZWA 3CC1A 1S3TC 2DP3A 1D7FA 4H6EA 3TK7A 2V67A 2E0PA 2P53A 1ZTVA 3H12A 1X8CA 4EKJA 2D20A 5BOFA 2Q3OA 1XIDA 3URQA 3NEHA 2DSVA 1SZFA 1XXXA 2ZRZA 2FTPA 1K8XA 4JQ2A 3WJZA 3V0TA 3MCNA 1F6KA 2O0TA 4PC8A 2B7OA 1O1HA 1F2JA 3O63A 4QQUA 1EBHA 2LJ4A 4E4UA 1P0EA 4U31A 5M2FX 2HSAA 1DJQA 3RR1A 5MHBA 3TX9A 1O95A 3SZ8A 1FWNA 5AHLA 1P48A 4QM1A 2A3BA 4YVXA 2KZHA 3GG1A 4NI8A 1J0JA 4C6NA 4H8VA 3RPTA 4N0RA 4J3UA 2O7SA 1XPGA 3CUFA 3QMTA 4QFUA 4GX8A 4Q8NA 5L6UA 4BQ3A 1PUDA 4IWWA 1P43A 4Q7NA 4Z2LA 2PC4A 5AN7A 4N19A 4QLKA 1JJKA 4HHLA 1W1TA 3WMSA 3WFLA 4BS0A 5A5WA 3DBNA 4K39A 4FHAA 5FL0A 4A35A 3W24A 4GO8A 4IQJA 5I03A 2Y70A 4CCCA 3VD3A 2QAPA 2XIIA 2DZAA 3TONA 2TYSA 4Q7BA 1V02E 3VIOA 3KLLA 3ZLGA 2GDUA 1A80A 1F4HA 4ODKA 3OA5A 1T96A 4JTAA 2DJXA 2OFNA 2QCGA 1JUEA 4O1CA 2J75A 1QK0A 5DBUA 2WJFA 4H7ZA 4UFLA 4XZHA 2J7FA 1WNOA 2XN2A 4QAWA 4Q8TA 5C6MA 3DC8A 1TPDA 1GOMA 5A6JA 2YA2A 3WLSA 3C5QA 1D9EA 3IVTA 2WMKA 1J2WA 1EPVA 3FHQA 3ARVA 1HXJA 4M82A 4D6EA 3OZYA 2NWSA 1WZMA 1YYAA 2A7PA 5HBFA 2V3FA 4IPXA 1EQ3A 3KL5A 4L4PA 3RMEA 1KQYA 5A95A 3WQ4A 1MW3A 1KWGA 5REQB 4UMBA 4Z0SA 5A6BD 2WZIA 3L4VA 1GUVA 1GT8A 1ADSA 1HTIA 1VYRA 2Y7FA 4YVPA 1Q6LA 2QVNA 5HINA 4IUGA 3O16A 3WDHA 1BWLA 1CXFA 1U5JA 5A6KA 4QP0A 1X6UA 3H2EA 2ZTJA 3DFQA 3VNYA 4NAEB 1ICSA 3KADA 1XYBA 1US3A 3F2DA 2CBJA 3TTYA 3CGTA 3M0MA 1XDLA 4PCSA 1G4TA 1JXKA 1PHQA 3CQKA 5IFPA 3W6LA 5FAGA 2J66A 3VDBA 3QR1A 2FHFA 1TO3A 2NQZA 5BXTA 3QY6A 2ODOA 5IHSA 2Y4SA 2PBGA 5BRPA 3HPZA 3W1PA 1E55A 4OJYA 3LCHA 1CGXA 3FGCB 5HNUA 8TIMA 3OG2A 3IVSA 1F3TA 1SFLA 5HA7A 5CZJA 2ZE3A 3FK4A 5FJUA 3U57A 1SPQA 2WNNA 3URBA 3K4WA 1HKIA 1E9LA 4QSHA 1SR9A 3ORWA 4IQEA 1E43A 4AEOA 5MKGA 3NQMA 4M7TA 1GZGA 2OYKA 4C1LA 3C0QA 3MP5A 4GI6A 3WUBA 2EGZA 3A5FA 3II1A 3AXMA 3V7PA 4I3GA 1KCXA 4JHZA 1MWOA 2XVPA 3VAWA 1Q3NA 1EC7A 3G6MA 4GRSA 3VCCA 4DZHA 3NO5A 3SSJA 4P8VA 2ZUSA 1KKRA 3AMCA 1X39A 3E9AA 3GS6A 2E1DA 4PCTA 1TV4A 4LQ1A 5E5CA 1ROTA 2IQTA 3H55A 2J8TA 2E67A 4BHYA 1QFEA 1UD5A 1KT1A 4JTUA 4GYJA 2ZQSA 1R3WA 4Z1CA 1KFBA 4Q6XA 1W5QA 3PUGA 2BHZA 3CUHA 2PV2A 1KFJA 3ITLA 2Y6ZA 2Z7KA 1XSIA 2XGBA 3HN3A 1F61A 1V3KA 2CPUA 2AQWA 3P61A 4HZ6A 4NZJA 3WDRA 1WXZA 2PPPA 2OT0A 3Q2DA 3JR2A 3NQ7A 5T91A 4ZO7A 1KCZA 3WNMA 4RXFA 4HMCA 2PFHA 2OJPA 5CZSA 3UPBA 2QNEA 3RNDA 3W23A 2P3ZA 3RM9A 3NO3A 4GY0A 2WKLA 2PGRA 1PDZA 3SIMA 5HJYA 1UJPA 3JVAA 3R11A 5FOOA 3CO8A 3R0UA 1BTMA 4FX7A 3VINA 1E0UA 1CXHA 3F5KA 1L8NA 2ONEA 4J40A 4JTQA 1FXPA 3KLKA 2ACQA 4O12A 3ZS4A 4ZQPA 5KINA 3LQLA 3KAHA 2F9RA 3G77A 3EEZA 4QG8A 4XUYA 3D46A 4AZ7A 1TX0A 1IZCA 1UD4A 5HANA 1E71M 2PD9A 5I78A 3CQ0A 1HIZA 1I60A 1LWHA 3T8LA 2ZX5A 1QW9A 3T1GA 1VQTA 5CBIA 4TW8A 3GXTA 5AC4A 2OX4A 4G1NA 4GUHA 1R7OA 2VGGA 2YOCA 1UD8A 2XFWA 4LEFA 3NL5A 1U30A 2WWDA 4LUTA 3DI1A 4V15A 4LUIA 2TODA 3DG7A 3GVWA 3TW9A 1VC4A 1FKSA 1E51A 4DWSB 2ZQ0A 1NFBA 5CSUA 3BSMA 1Q85A 3XINA 1B4EA 4RW5A 3WD3A 1P0KA 2VC5A 1UH3A 4KCWA 5FSEC 1OG6A 1VP5A 4MZ1A 1DWJM 3N13A 4OOZA 3GZ3A 3ISIX 2BDQA 3AIUA 4W7UA 4PSPA 3PZQA 3EMCA 3KVJA 1LM1A 3BQ5A 4R88A 1UKPA 1I2QA 1TJ0A 3EOLA 3R1ZA 4H83A 4GUFA 1VH7A 3BURA 1BFNA 1HVXA 5E93A 5ABTA 5HWCA 2PPGA 3BLPX 4WSJA 1EO7A 3DKJA 1WZKA 2HNEA 3OLGA 4XAPA 1K77A 3WY1A 4CNOA 2BHUA 4LW7A 1JR1A 1GVYA 4X0VA 1VFSA 2Z1XA 5T26A 3F4CA 2PEVA 4A8IA 4OHQA 3MBFA 4W89A 3UD6A 2VEGA 3OHIA 4XK2A 3W1AA 1G01A 1B54A 5BWFA 2BFGA 3K8MA 1SW7A 3NJ3A 1JAKA 5DCEA 3OP2A 2XISA 4LT9A 2EO7A 4W5UA 4WGXA 1PPIA 1TVNA 2TPSA 3HO8A 3B06A 5GJPA 4H2CA 4J3TA 4TUFA 3VNDA 1OABA 3GTHA 1RY8A 3F2CA 4IT4A 3SY8A 1P5BA 5C9WA 2MLXA 4W8LA 3N9SA 1KTNA 2FZNA 3SRKA 4UTIA 3GDTA 2E77A 4GACA 4QGCA 5I2UA 1KBIA 1F7BA 1GTEA 1VHCA 1T8QA 3RK8A 2OU4A 2XSAA 1QI3A 1P7TB 4K68A 5I3JA 4PTXA 2OX1A 5HUAA 1AJ2A 3ANUA 1UJQA 3L12A 4F0SA 1TMHA 3EEGA 1EF3A 3ARYA 3TYZA 4HA4A 1ISZA 5HWNA 2V8ZA 2FDMA 1BKHA 1QZ2A 3LNMA 1E4NA 3MDYB 4DRHA 1LYXA 3GXFA 1QWGA 3JYJA 4JTSA 2ABAA 3W1TA 3C0SA 5D75A 3N11A 5ABEA 3CZ8A 1DWGM 1EXBA 1GOQA 3FJ6A 2A7RA 1TVPA 1FBAA 1O5XA 1GORA 1LOSA 3CEUA 3BGJA 1WKDA 4D6IA 4MWAB 4WVXA 2PDKA 4P7LA 4B5VA 1YXCA 3QV7A 2E6YA 2FIQA 1QU4A 3DYOA 4NJGA 2ATSA 4AD0A 1YMYA 1AQ0A 2DFAA 4JD4A 4QXIA 1XIHA 4PMNA 3WENA 3S2CA 4M6VA 3AFBA 3V18A 4QT3A 3M5ZA 3WG6A 1GQIA 5J8LA 2BASA 4LRSA 4TU1A 2UY2A 2ZUUA 1FFQA 3F5LA 3L0GA 2QJMA 3AU6A 3ZVHB 2O4QA 1B57A 4URIA 3GHRA 1A50A 1NMVA 2PRMA 2QAFA 5M1TA 1OB0A 4BI6A 3H9RB 4XAFA 1UWRA 1MVYA 1T7LA 1H1ZA 4YHGA 2BGNE 1FKWA 1DHPA 3UF8A 2OOFA 5C71A 3LI1A 5B7YA 1G7UA 4D6FA 3O5OA 4ZZ9A 3D6NA 4QROA 3EOUA 2Z1BA 2FPTA 4DZ3A 3KVLA 4LFYA 1TZ9A 3MJYA 3GWQA 5D04C 1A0CA 5F4XA 2FB3A 5EMKA 2BVDA 2FPYA 3ITTA 2CNCA 4H9TA 2PP0A 5TD4A 3W7RA 4B4FA 2FHCA 4LAMA 2WM0A 4MLRA 3MI3A 4F2BA 3LBOA 3B9NA 4MSSA 4P7NA 5XIAA 4PTNA 3TZNA 4JIEA 3B8VA 3B0VC 4XZLX 5FL1A 4MNJA 3ZFHA 2J88A 3GPKA 3CHFA 3HG5A 3W7GA 1D3CA 1T5AA 1NOWA 1ODZA 1Y7VA 1D3HA 3ZLHA 2R14A 3CMFA 1MI3A 3LM7A 1LDCA 2HJPA 4US5D 3GFXA 1H0IA 5HATA 1RV8A 1JQVA 2CLKA 2E09A 3TU9A 4ZE4A 3TTOA 3KS6A 1GOIA 4HOZA 1FKBA 2VEFA 4ERIA 5DT5A 2XIBA 3QEZA 4GQGA 1PCKA 1UUMA 1WOBA 3KCEA 1JZ5A 3APYA 2AAAA 3IUDA 3MO4A 5AYIA 1KR0A 1X96A 1S2CA 3N2TA 3N34A 2OLHA 5TIMA 4FMVA 4IICA 2VYOA 3HPAA 4R9XA 4L80A 1ZJIA 3AHYA 2WOQA 3P93A 3CL6A 2Z4GA 1NQ6A 1EJVC 2QUUA 1WDRA 3ITOA 1PZ1A 2XN1A 5E0KA 1L6GA 3NQAA 3NZGA 1B6CA 4NQ1A 4AIOA 3MSRA 1E6ZA 4QS5A 1ADDA 1CWYA 1HKWA 3PPFA 2QW5A 5J04A 3H54A 1TWIA 1EOMA 2LPVA 1Q4WA 4FF7A 2NW0A 2VZVA 5FJTA 4P2VA 3VM5A 2QIWA 4K8GA 2IPFA 4N9CA 1TV8A 3PG8A 4HCDA 1O5RA 3DX5A 4ILSA 1OGGA 4B5TA 3S8HA 2NUXA 2I16A 2ISVA 3KTCA 2E6FA 1O5QA 4CN1A 4NL1A 3U2EA 1W5MA 3BSGA 3TYEA 4ERAA 3BO9A 2QGYA 1QPFA 1EC9A 2BVYA 4O0QA 5CJMA 4A3YA 1ITXA 5I3HA 1PIIA 2RUCA 1XLJA 3EKLA 1TQJA 2ZCGA 4DM1A 1DXEA 3LCFA 3LLXA 4K38A 5I6SA 1XIFA 3FW6A 3SFWA 2A3CA 3QC0A 1TMLA 1TUXA 3RRXA 3UR7A 2P3EA 1KCLA 4UTJA 7CGTA 1EYWA 3U2OA 1XRTA 1IT0A 3EDEA 1RA0A 1MW1A 2ADAA 3SGUA 1UMLA 3LZ3A 3UWEA 1HKMA 4L9XA 1M7JA 3HV9A 4JTTA 5DMLA 4DJDC 2DIJA 4UIOA 1AMYA 2QDGA 3BAYA 2RDXA 3A3XA 3TQKA 3L4ZA 1DJZA 3WUFA 3UJRA 5CC7A 2LLEA 3NVDA 1JXJA 3MSGA 4PTMA 1XL9A 3G3MA 4WUIA 5FEXA 2DH3A 2AGKA 3KAOA 1XF0A 2Y61A 2E4TA 3S9YA 1MNZA 6CGTA 3F4DA 4AZBA 3TYUA 3OZMA 3GBEA 3ZIZA 2OR2A 2WKJA 4GBUA 1JNEA 1IHIA 4RZ6A 1HKJA 1QTWA 2Y5EA 4ZB5A 4XVDA 2WSYA 1E9ZB 4AHOA 3WKZA 2VFGA 2WKGA 1EHAA 4H3DA 4W93A 4Z0JA 4GQ0A 4QNWA 5GVJA 2NVCA 4MYXA 3WQGA 3BLOA 2DZPA 2QXWA 3WK2A 1UP0A 3B9EA 2MNTA 1VBRA 1VGAA 4M6UA 2WLYA 3DFPA 3G1VA 3LCWA 4AIBA 3JU2A 4LY4A 4XZBA 6TAAA 1CEOA 4IP4A 2P5NA 1Q63A 1EJUC 3HM7A 5CG0A 1E15A 4PRTA 1V6VA 3G5EA 4MAVA 4KWSA 2IF4A 3TSDA 1Z6KA 4FIRA 3WEMA 4CD8A 4CCDA 1AL7A 2XPBA 4JHMA 3LG3A 1SGJA 5HW7A 4MY9A 1I2NA 4AISA 5H2ZA 1PBGA 3NO1A 5KZDA 3B05A 3ZXWA 2Z7GA 1LLWA 1L9WA 2LGOA 1LBLA 2X1RA 2P88A 2Y5SA 5CKSA 2BNJA 2AGTA 4LBSA 1KO0A 1V0KA 3R8GA 1POJA 3O7UA 3AIQA 2XP8A 1T41A 4JZ5A 1C8VA 4NNAA 1GVIA 1R47A 2VX7A 4AXNA 3N29A 4YTRA 1SZRA 1MEIA 4TNSA 3PPCA 4ODLA 1VBJA 3W07A 4LBUA 4PTDA 3SAZA 1MSSA 3WH7A 3N19B 4M51A 1BYBA 2RHGA 4JTRA 3CK5A 1SO3A 3L9CA 3WBEA 1Q45A 1J9YA 3THCA 4GNVA 4LCSA 4ZVJA 3CGMA 4B91A 4DBEA 2G4FA 2A6NA 3THDA 3VVGA 3VNMA 5EKYA 4MMWA 2VFIA 3CZEA 4PODA 1NQKA 1XPYA 2Q09A 3HA1A 4LYRA 2KFWA 1RBOB 1KBLA 3PBYA 4AUBA 4HBKA 4X9YA 3SY5A 1LOQA 1ZFJA 4QX4A 3DKLA 3W1NA 2D0GA 1MEWA 2JGYA 4L7ZA 1IT7A 4JX6A 4NJJA 1CXKA 3GH5A 4ZO8A 2VZSA 4JEJA 1YTEA 4IOTA 3MSYA 4L4OA 2C6QA 2Z1SA 3L4XA 1A3WA 3VX0A 4UQAA 3IAQA 3ES8A 2QPSA 3D3FA 1C29A 3REQB 1UYQA 3O06A 4RV8A 2YCJA 2VRJA 3KAIA 3FSUA 2R1MA 2GJNA 1XLKA 2ZZ6A 3I7SA 1S5NA 4PUUA 4N9BA 2ALRA 5AB3A 4JTIA 2XP4A 1TELA 3MMUA 2OXNA 4GBDA 2FKPA 4UTLA 1E6PA 1REQA 1UP2A 2NXGA 1MUMA 3IGSA 3PJTA 2NUWA 1JUBA 3BGAA 2ZVRA 4DJFD 3W28A 1UCWA 3OODA 5DELA 5FJIA 5DCDA 5JIWA 3ABRA 2OEKA 4MUZA 5AHNA 3SQSA 2BSLA 3W53A 1HX0A 1XJBA 4TR9A 2HBXA 5G1YA 4NAFA 4L56A 2A3AA 4MZYA 1EBGA 4PL2A 3WD0A 1P0BA 1P5QA 4B5WA 4GYFA 1K8YA 2JALA 4GA8A 5C2GA 4LB3A 1U22A 1RUSA 2FH8A 3XISA 3H4GA 3PA7A 4LS2A 1O68A 2PU1A 4TX9A 3W6YA 4ODMA 3UZWA 3GG7A 3S5OA 3VDAA 3SQLA 4Q7IA 3N17A 3M4HA 1VPXA 2D3LA 1S2VA 1S2TA 1EIXA 3C61A 4ZBCA 4UUIA 4PA8A 1K6AA 2GL5A 1VD6A 3FSTA 5BU9A 3IARA 2W6RA 1YE4A 3AISA 3VD5A 3M0YA 5B8IC 2VOMA 2YB4A 1TE6A 1KM2A 3T07A 3TN6A 3GIQA 2R94A 4YU1A 1YEYA 3PSWA 3W6MA 1M3UA 4JFUA 3QH2A 6REQB 1DJHA 1QNRA 2OKTA 2NV9A 1G0CA 4WKAA 4LUJA 3PPHA 3ITXA 2GYIA 1PZ3A 2D73A 1W17A 3BLDA 5EU9A 3H24A 1F74A 4NXSA 3G1XA 4DUOA 4P7OA 4HPJA 3NSMA 1EP2A 1JDDA 1ECEA 4ALDA 1VF8A 2ZRVA 1MW0A 4PCPA 5D2VA 5FJOA 2J9ZA 3P60A 1DQWA 1GJWA 5G1TA 5A2CA 3M0XA 3VDGA 3DG3A 1H7OA 2L2SA 3KAGA 3OO2A 1FH9A 3CXOA 3TOPA 1JGIA 3WZ0E 2YL6A 4Y2WA 4JYSA 4WXZA 2I5GA 1KXTA 5HT1A 3GAYA 1DORA 1J96A 3TZFA 1NY1A 1VHNA 3A4JA 3WK0A 3LGGA 5I02A 1KBKA 5K9XA 2OPJA 1EWDA 1E44A 3LB0A 5PTDA 3ZWTA 4IH3A 3BLFA 3WJSA 4EPEC 2A2IA 3ITCA 3UI4A 2XTKA 1MQPA 3DBPA 4Q3MA 4AH7A 2GQ3A 2AMXA 2QJHA 3GAKA 1R9ZA 2QCHA 4DJFC 3O8AA 4E5TA 1K7FA 2E8YA 3K5XA 3LX9A 1SM9A 3LXCA 1I0DA 1JULA 1PX3A 3SN0A 4V28A 5CCZA 5K3VA 3CYVA 3U5UA 3M41A 2NQ5A 1OQFA 3P0XA 1TR9A 4JQ1A 5BYWA 1GKPA 3HMJG 3G1SA 3ID7A 1SO6A 4GY7A 3F4VA 1KQZA 5FAJA 5U4NA 2XP7A 1W9UA 3O6YX 1ZSXA 4Y90A 2IS7A 5FA5A 4JYEA 3UG8A 5EFDA 3K46A 2PSNA 4HPHA 4K7YA 1SSDA 4BA0A 5EPDA 3S47A 1LBMA 2G5WA 5HXMA 3NUKA 3MKKA 1RHCA 1N55A 5IDZA 4F0RA 4OKDA 1F8IA 1KFCA 2CEQA 3T78A 3DOPA 1HNYA 2RQSA 1J01A 2OG9A 1KR1A 1R2SA 4MOZA 3EA1A 1OCBA 1W54A 4LUYA 4Q8WA 2C1GA 1O7AA 3IGXA 2DZTA 2C16A 1H50A 4AX6A 3MKVA 4Q8PA 3AXHA 5D38A 3MMDA 1FKLA 1E0XA 1W2PA 5JU6A 2W3ZA 4A3QA 4WDWA 4PMZA 3IK2A 3DESA 3RUBL 5F1UA 4DLMA 1LQ2A 1IIGA 1TWWA 1OF8A 4ZTYA 3L0KA 5B7ZA 3LENA 1W8GA 3NQDA 3R12A 3TLQA 3S2NA 1B31A 2VGBA 1LLZA 2BGSA 4MB3A 1KW1A 3CZJA 5LXEA 4X63A 3ARWA 4PN2A 1TUFA 1YBQB 3RFAA 1Q6UA 4JY9A 3IIVA 4W7VA 3MUXA 3GE7A 1XBYA 2FH6A 4CCZA 1WP6A 4AZCA 1JDCA 2QCLA 1XBXA 3S9ZA 1RP9A 2WMJA 4R85A 1GK8A 4MWAE 3EBVA 3GNDA 2VTFA 2VZUA 3ZR4A 1B3YA 4FNSA 3NZQA 4FP1A 4RV3A 4ADSA 1ZBCA 1YTKA 1OFPA 1W3NA 4LAUA 3WEOA 2YB1A 1HN1A 1GHRA 2VI0A 2TSYA 3HGJA 1WUFA 4JNMA 3MMTA 3NEVA 4TW6A 4A3UA 2HRWA 3I65A 3EB4A 1DXFA 4G7EB 3FA4A 3WK1A 1IQ8A 4WQ6A 3HTWA 1Q5MA 4S3JA 3FEMA 1O12A 1NWSA 3RX4A 2GOUA 2V82A 4DRJA 2FLIA 3O0KA 2UBPC 4S3AA 1N7KA 4Q4KA 4DZ2A 2BWGA 4RZBA 3DYPA 3BPWA 1GQJA 4XBSA 5E1QA 3RJYA 1V0MA 3DUGA 1FOBA 3KRZA 3IANA 1FKRA 3VFCA 4L3NA 2QDDA 3CM4A 1LL7A 3MI6A 5HAOA 1H63A 1JZ6A 3RCYA 3GY1A 1FY6A 1ITCA 3LD5A 1UBSA 5E6ZA 2WANA 2VN1A 1QBBA 3NWRA 4DRQA 1BYCA 2H90A 2X2YA 3V5CA 2AQVA 5E9AA 1K8ZA 1OF6A 3TYBA 2YXXA 1NTHA 1UW9A 1CI1A 3V1PA 1EQCA 3LZ5A 3JUGA 3MPGA 3NURA 6PTDA 2DSUA 4O1DA 2WCSA 2WZHA 2ZUNA 3G1DA 3LTPA 3GG0A 2AQOA 2Z25A 2CLIA 4XD5A 2CZFA 3MVTA 3M43A 3VFLA 1XUZA 2V2CA 5CJNA 3EWXA 4MKVA 4KWVA 1CYGA 2B7PA 4AD2A 2YL5A 3BE7A 4HYRA 3S9IA 4AWUA 3VDHA 2WNWA 4GG9A 4IIHA 4IIBA 4QISA 1DKWA 3E38A 1UBPC 4XKYA 2X05A 4A8LA 4HTBA 2Y7GA 1A5MC 4YWIA 5DO8A 4Z1DA 1N8FA 4PUNA 3BMWA 1I2OA 3EMZA 4GUJA 3EDFA 2GLKA 2XIMA 1EX5A 3NM1A 4DZAA 1QNOA 4LB4A 1HKKA 3IUHA 2VQTA 4I6VA 3MDUA 2FTYA 1YXDA 1UC5A 1Q6CA 1B2YA 1CGWA 4FX8A 1KM4A 3W70A 3CPUA 3W25A 4XAZA 2OLAA 2CZDA 1IX5A 4OBRA 1NWTA 3R79A 2EEXA 1JCXA 1NJJA 1C3FA 4YNGA 3IRSA 1QRQA 5GJMA 2I5QA 4IJBA 3DHUA 1FDYA 2QMKA 1MXSA 4AW7A 1M7OA 2WVUA 2WW5A 3LNPA 3SN4A 3U3HA 5BNKA 1EJXC 4NF7A 3FXYA 4OV4A 2VCAA 2FJUB 1GHSA 4NI3A 2ZRYA 3T0CA 3FLUA 1Z44A 3ZVIA 2VUYA 1KXQA 1XD0A 3OBAA 4D6CA 2X2GA 3E02A 1OIMA 3H23A 1TV2A 4I9AA 4HU8A 3A3WA 1WDPA 2SFPA 1AA1B 1VFLA 1V08A 2NXHA 1CGUA 2FB2A 2VELA 2ZX6A 5EL1A 3R10A 1HXVA 3BICA 1U83A 2VFDA 3S6DA 1OG0A 4D6GA 1UD6A 3NCOA 4E2OA 2YW3A 1BSLA 2WZTA 1ZNNA 3BK0A 3TMLA 3O3RA 1NFGA 1DIEA 3N3TA 1H1YA 4JFJA 1HL2A 1PVNA 5LIKX 3ERPA 1JCYA 2HS8A 3WUEA 1XISA 2A1YA 3AUJA 2OMAA 3OG3A 4ORMA 4B9ZA 3W7LA 4JOMA 4F9DA 3GR8A 3B40A 3W4RA 2D2GA 1ZGDA 5DXXA 1XLEA 1X38A 4UWMA 3N18A 2VEMA 3LUTA 5AHMA 4AZHA 1BG9A 3PF3A 4JFLA 1OC5A 3I6TA 4TOQA 4HNTA 4AXKA 4HB7A 1XH0A 1RP8A 1L6SA 5BCAA 3ZLFA 4FNUA 3I3BA 2PDCA 3FNDA 1QPKA 4NIRA 2PTDA 2OSWA 4U86A 4MKNA 1FH7A 4YXGA 1L6WA 3R25A 4S3CA 1YKWA 1TTQA 4HBEA 2ZZ5A 2Y88A 3UI6A 5HWJA 5AECA 4F66A 2VDGA 1XCXA 3WF4A 4HSHA 1LQAA 3O6CA 2VR4A 4UNIA 4LRTA 2E9BA 4PL1A 1A5KC 4HA0A 4RR4A 2VGFA 2VNCA 1U1UA 2ALDA 4A8NA 3GDLA 2JGQA 4OIFA 3QR3A 3W1QA 3CZLA 4O54A 3M6YA 3KZ7A 2DJLA 1TZ7A 3UR2A 4CQAA 1VEMA 5FEWA 3VKDA 3QN3A 5C2XA 2GVJA 4HNLA 4ACZB 4DIPA 2ISFA 2BY3A 2M2AA 5J6EA 5AC5A 4GJJA 2CLEA 3T0BA 4M1BA 5D2TA 2INZA 4GIAA 1ITQA 4Y7EA 4GK8A 4K1WA 3WD1A 3RLHA 2XU2A 1VAHA 5AZ0A 1KM1A 3WLJA 4YCOA 3W7MA 4O1EA 3VCRA 5GPGA 1J11A 3AI0A 1UPMB 4F48A 2OVLA 1J18A 3WNNA 3V0UA 4TMCA 4TX6A 2R9RA 1PIGA 4Z08A 3FXGA 3PTKA 4M80A 3SEPA 1RJRA 2ZR5A 2F61A 2D24A 4L61A 5DANA 4W8BA 3R8RA 2XVNA 3O5RA 2VRKA 3EX4A 3EY6A 4ZMGA 2L5HA 2Y7EA 3BUVA 3S46A 4LVBA 4UDMA 4I7UA 4E6MA 3SFKA 5HNTA 4DWSC 3CV6A 1DPMA 2VFFA 3W1RA 5BXSA 2Y5JA 1NEYA 3SQMA 4JIPA 3QZEA 3M0HA 3O2LA 2Y1HA 4HPGA 1ECQA 4G6CA 3LQGA 4MNLA 3LXAA 3TR9A 5C9UA 4JL1A 4FLRA 1PWLA 4C1NA 1LWIA 2KGJA 1CECA 2OZTA 2IKJA 3PB2A 5JBDA 2XH4A 4JPGA 1F40A 1FWRA 4WSHA 3H70A 1XRFA 4I9MA 1XIIA 1QPOA 2IQ0A 4NZCA 1WPCA 4Y9AA 3AIVA 3ARRA 2CESA 2R1PA 2Q8ZA 1V6XA 2WSKA 3ANVA 2CBVA 1FD9A 4REQA 5KITA 3IIZA 4TVUA 2FGBA 5CAKA 3W26A 1R3TA 3B9OA 4LPCA 1A4LA 9RUBA 3RXZA 3FAXA 4JQAA 3W7PA 3W2JA 3VZYA 4AU0A 4CNSA 1TB3A 2QCDB 2WCAA 4IISA 4C65A 2XPAA 4BF8A 3PZNA 1ML1A 4R7WA 1Q1CA 1MYRA 1D7JA 1HZYA 1PIFA 3ZT6A 1E1CB 1SZNA 4DJEC 1LF1A 1EEXA 3I7RA 3SO7A 3IGHX 2WMGA 3G1FA 5ABFB 1W9BM 1QMLA 3P62A 3UJ2A 3URAA 1FDJA 2XM2A 4UNLA 2ATMA 3SW6A 4G7FA 1V5XA 2AOSA 1IGSA 2VQUA 4MNKA 1MUCA 3IHZA 2IQDA 2Q71A 4KWUA 2GUBA 3BMVA 5JH2A 3K1GA 3WSUA 3I3EA 3QC3A 1R9XA 4LOCA 4Z1BA 4ADTA 2DUZA 2WHMA 3R89A 3C2FA 4LGXA 4F2UA 3KCOA 3ARZA 4LAZA 2QZRA 1PS9A 4HU4A 3VD7A 3NL6A 3C3NA 3NQCA 2AL2B 3QGVA 4YYFA 4UNKA 2AWGA 4LV4A 4RCXA 1F3WA 3MZ2A 1FHDA 3MYOA 4GVIA 1WZAA 3WF1A 4RDWA 2C15A 2DSKA 2DZXA 2QV5A 1WKFA 1XD1A 4D6JA 2OGYA 5F4WA 4WJ8A 1JZ7A 4CCEA 3MZNA 5IBXC 4RJEA 2XZ7A 3B3DA 4LX4A 4GVGA 1NMWA 4G2PA 5DN1A 4O13A 3B0XA 4EIVA 3TLLA 5A3HA 3STGA 2NZLA 2IKGA 2C7FA 4DZ5A 2GGIA 4Y9PA 4UFKA 3WLOA 5ECUA 1E4LA 2E28A 5DBTA 4HBOA 4MWAC 3GTNA 1JDAA 1GYLA 3C2RA 4NZ4A 2DQWA 4BI7A 2UWFA 3V0SA 1A53A 3QTGA 1FWAC 3SUVA 2DT0A 4C60A 1GVOA 2FMOA 1IXPA 1R3RA 2ZVIA 1Q8JA 4S2BA 1G94A 3E0VA 3P8IA 2ZXDA 4XUGA