1ZL1A

Crystal structure of the complex of signalling protein from sheep (sps-40) with a designed peptide trp-his-trp reveals significance of asn79 and trp191 in the complex formation
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3 like protein 1
publication title Crystal structure of the complex of signalling protein from sheep (SPS-40) with a designed peptide Trp-His-Trp reveals significance of Asn79 and Trp191 in the complex formation
rcsb
molecule tags Signaling protein
total genus 115
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2005-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1zl1A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1zl1A01
4LQ1A 3EMQA 3ALFA 3PN8A 3VD5A 2GSJA 2FH8A 3VMPA 4E8DA 1JAEA 1IZKA 3BAKA 2DEPA 4CN1A 1XH0A 4CD7A 1HXJA 3KEHA 5A6BD 2FGLA 1WDSA 4MAVA 1R8LA 2Y8VA 2PWGA 4IPLA 2YBUA 4PCSA 3ARVA 2XSBA 4N42A 5M3WA 2Y8KA 5A6LA 3BAXA 2FHBA 3W29A 2D0FA 3BLPX 3TTYA 1VFOA 3GZAA 2BY0A 3CZEA 3K46A 1FFRA 3FW6A 4B3LA 3CTTA 5I24A 5F7UA 3AIBA 3K1DA 4UZUA 5GNYA 4UQAA 3WELA 3U5UA 5KZ6A 1R7OA 4HA4A 1TZ7A 4U3AA 2OWCA 3TONA 4XZWA 4AZBA 4MNJA 2GDUA 2X1IA 3ARYA 1NOFA 3UERA 4WKFA 2E9LA 3WDPP 1H3GA 1M01A 3ZT7A 1GORA 1GOKA 1E5JA 3WQ6A 1FH8A 5EFFA 1WNOA 4HOZA 1LWHA 3AIUA 2X0HA 4MDOA 1K9EA 3IAPA 1G94A 4HMCA 1OSEA 1ZBVA 1V6UA 3W27A 3AXXA 4WKHA 1XSJA 3WD3A 7CGTA 2IXUA 2ZXBA 2CHNA 4QDMA 3VVGA 3VGBA 7A3HA 2WM0A 2UY2A 1V0NA 1EDQA 1K9FA 2PI6A 1D2KA 4TVCA 5C70A 3VKKA 1TA3A 4WSJA 3UG3A 3ZJ6A 3N12A 3VO0A 2E9BA 2O9RA 2WSPA 1ISZA 1CGYA 1G0CA 2Z1SA 3B9DA 5CZKA 1O6IA 4IUGA 1XSKA 2VRQA 3OLIA 1TVPA 1LG1A 1DWHM 3ZR6A 4S3JA 3T09A 5HDRA 4WJXA 5E09A 1R85A 2NW0A 1LWJA 3AYSA 4FLSA 4JAWA 2WCAA 1NWSA 5DT5A 3AXHA 4CVUA 3B9EA 1PX3A 3WMBA 4D6GA 3W26A 1QHZA 1PX8A 3GXDA 3T08A 4AY1A 1E72M 2EPNA 4HU8A 2YL6A 4AD1A 4A3YA 1XHGA 3RM4A 3BSHA 4LPCA 2YLAA 3WFLA 2VZOA 5BYWA 2VX5A 2WCSA 1LQ0A 1E6ZA 1OM0A 3WL1A 1UR8A 2VX6A 4H7VA 3EDEA 3VM5A 1JZ6A 1VBRA 3BCFA 1ZS2A 5IFPA 4MADA 2J7BA 3A3HA 1MW2A 1U2YA 2PB1A 1LL4A 2OSYA 1XCXA 2YLLA 5DT7A 2VQUA 3ZIZA 4OZOA 1XH2A 2V5CA 1MQQA 3A4WA 1Q6FA 3CUGA 1V3MA 4UOZA 3NSMA 1OD0A 1QPKA 3BAJA 3L2LA 4AIOA 2ZX8A 2E9MA 1QI4A 1JZ5A 1JF5A 3AMLA 3MUZ1 3AISA 3BSGA 2X05A 2EJ1A 3WH5A 1HVXA 3WQVA 3WDRA 1E4MM 2B31A 2J78A 2YA0A 1BF2A 1JXJA 1CEOA 1KQYA 3BGAA 1CGXA 1CDGA 1UZ4A 3MV01 3PZTA 4YHEA 1U30A 2EPLX 1JDAA 1E1EA 4L4PA 3N11A 3PZQA 1UH4A 1B30A 1HNYA 2ZX9A 2QHAA 1ISXA 1DWJM 4PMYA 1C8QA 1KWGA 1E3XA 4BS0A 2CYGA 4PMRA 4Q7NA 4UFLA 3SURA 1WP6A 3SCUA 1TR1A 2DPEA 2FGZA 2VI0A 2FH6A 4PYSA 3W25A 2ZUVA 1H2JA 1KBKA 1Y7VA 4AD4A 1B0IA 5D9OA 5CSYA 1BYAA 4J27A 3U7VA 4JFTA 1NP0A 4E8CA 1LG2A 5JIWA 2WHMA 5FD0A 4DM2A 1NWUA 3W28A 2WANA 3SCTA 2UY5A 2DGAA 3RMEA 3MUAA 1QOXA 2UY3A 1VF8A 1PJ9A 3WNOA 3AQUA 2VMFA 2XG9A 4HPGA 1J0ZA 1QHPA 1XD0A 1UKSA 3TP4A 3ARQA 2C0HA 4D72A 2JIWA 2DDXA 1JZ3A 2EEXA 1LJYA 3UR7A 1HL9A 3POCA 1XV8A 4GXPA 5CPTA 2V3EA 3SCNA 4WKAA 4V28A 4W88A 3TOPA 3PZOA 1ODUA 3DYPA 1GQJA 2JE8A 4MJ4A 1QI2A 1MVYA 2GVYA 1CGTA 3VIIA 1UKPA 2G3JA 4PMUA 1OWQA 2J77A 5A6JA 1PX4A 4WLCA 2XGIA 1E40A 3I3EA 3VIGA 3ARZA 2IXVA 1NARA 3ZOAA 2O92A 4ATDA 4PMZA 4NSBA 3WD4A 1JF6A 1GQKA 4W7WA 1JL8A 2W62A 1ITCA 1EDGA 4DWSB 5ABFA 1H09A 1G01A 4CD5A 1AVAA 1ZBKA 2V3GA 2WWCA 4L4OA 1W32A 2BY1A 2WMFA 3B8SA 3PZNA 3AZSA 1BTCA 2WVVB 3NSNA 1V02E 1V03A 1YHTA 3SUVA 1E4IA 2ZICA 4BQ2A 3AXIA 3VIJA 4GO8A 2CBIA 4M56A 2GFTA 3QHMA 4X9YA 4DUVA 4CKQA 2Y24A 3WFZA 1JZ8A 2E8ZA 2EXOA 4UFJA 5A6AA 3WKZA 2W67A 1EHNA 3M46A 2C7FA 4ZXOA 1B3VA 3WQWA 1EIBA 4J3SA 3SUUA 1HT6A 2WYSA 2CBUA 4GINA 3MV11 1BG9A 4H8VA 4PTXA 1MW1A 3QHOA 5FL0A 1J0IA 4UCFA 5BRPA 1E9LA 4YHGA 4AC1X 3ALGA 1EHAA 1QW9A 1V3KA 3CUJA 2GJRA 5BXTA 5BXPA 4UFHA 3L4XA 1HJSA 1GHSA 1JG9A 3NYDA 3VD3A 1V0LA 3WBEA 3S2CA 1K6AA 4OOUA 5IHSA 4NF7A 3AIWA 5IXEA 4X0NA 2WCGA 1E6SM 2EO7A 1FH9A 1KXQA 2J7EA 2PF0A 1HJUA 4JL1A 3NIYA 1ISWA 3NCOA 4BA0A 3VTRA 2X8RA 3ARUA 2WZHA 1Q6DA 4QCFA 3BAIA 3ARRA 3NDZA 4A3HA 3K8KA 1AMYA 1FHDA 4AZ7A 1XYFA 2VQTA 3AZRA 4TXEA 4B16A 1UR4A 2O9OA 3FXYA 1KXTA 4AZCB 4ZE4A 3WDQA 2WWDA 5CPQA 1E43A 4Z2HA 3ZSSA 1G9HA 1GOIA 3GYCA 4H41A 1B3YA 3HJEA 5CGTA 1W1TA 8CGTA 5JH8A 3KL3A 2WKGA 2EPKX 3UESA 2WHLA 5EBAA 4EK7A 1I1WA 1QI3A 1H49A 1C3FA 2XUCA 4NRSA 4OKDA 1HP5A 1V3HA 2JALA 3UG4A 3JUGA 2TAAA 4D6IA 3E1F1 1BLIA 1NQ6A 3VDBA 3RO8A 1JYXA 4HPHA 1B3WA 4HMDA 1V0MA 1QNRA 2E4TA 1W9UA 5E0FA 2WC7A 2YL8A 5A69A 1V6VA 2BNJA 2WK2A 1HKKA 4AW7A 4MDPA 3O9NA 5A2CA 3W6LA 5HOSA 3OLGA 4DUXA 3CHFA 1XYZA 4CUCA 5GPRA 1OGSA 4QAWA 4CVWA 5HNNA 3WF1A 5E6ZA 5AY7A 1OINA 1ISVA 1PZ3A 1UA7A 1NOUA 3FHAA 3WF2A 4JL2A 2WKLA 2D1ZA 3LPPA 1ZL1A 1XSIA 3OIHA 3GBDA 2OYMA 1J10A 2VNCA 3ARXA 4GZEA 5FOOA 4W84A 1W3LA 4FLRA 4AEFA 5A8PA 4QLKA 2WMIB 2JF6A 4HZ7A 1BQCA 3L4TA 3OGVA 4XZBA 3T0AA 1KCLA 4KRUA 1CTNA 2BHYA 1E5NA 1SFSA 4MNLA 1C93A 4XX6A 1G1YA 2WC4A 3UETA 1QBBA 1CXLA 2CETA 2J7FA 1UD6A 3L4WA 3L2MA 2QV4A 4UQDA 2YKKA 2WB5A 4QLLA 2J74A 3VMOA 4EAMA 3WEMA 2YJQA 4D6EA 1UWIA 3U57A 2C8NA 2E40A 1VEOA 3DYOA 4TOQA 1J01A 3W53A 3GBEA 1NH6A 3EDJA 3MUIA 2X0YA 1GOOA 1ESWA 1KB3A 1UWSA 3L4VA 4BZYA 1LLOA 4AEEA 3NUKA 4TVDA 1BAGA 2F2HA 2XJ7A 4LYPA 2XVGA 3NDYA 3L4YA 4MB5A 1V3JA 4MNKA 1UD2A 1W3KA 2BV9A 1B31A 3WIJA 3ARSA 2CXGA 4M8UA 3VGEA 1ZB5A 2XM2A 1UZ1A 2XVLA 3AIEA 3AICA 4PMXA 1CXKA 4W5UA 2BXYA 2VURA 4AD0A 2BVTA 2VR4A 5GQBA 1BPLB 4OOZA 1R87A 2WMJA 5FL1A 1VBUA 5AYBA 1UWTA 3K8MA 2BHUA 3AS2A 4JKKA 2A3CA 1CGVA 2CNCA 1HKJA 4PN2A 3PZUA 4CCEA 2VX7A 1X6NA 1HJQA 2ZUMA 4OUEA 3T2QA 4AD2A 1UKOA 1DWFM 3VGDA 1V02A 2WMKA 1MQRA 1ODZA 3NJ3A 4U3CA 2A3HA 1I75A 3I3DA 2OLHA 2JEQA 5E0CA 4H2CA 1KCKA 3VX1A 3EBVA 2CHOA 3LMYA 3WDJA 3VIHA 1UR0A 4AZIA 2QPSA 3ZJ8A 4BQ3A 4UOJA 3LPFA 4IM4A 1QVBA 4LYRA 2CKRA 1F4AA 3PZ9A 1UH3A 2ZWYA 2J7CA 2CBJA 1QI5A 4AWEA 3GXMA 2ZUTA 2F8QA 3VGGA 3KZSA 1CENA 3OBAA 4J7RA 1MXGA 1EO7A 2EPOA 2DH3A 1ZU8A 4J3TA 1SYTA 2ZXDA 2WPGA 3GH7A 4PSPA 2PBOA 1WKYA 2CKSA 3CLWA 3SCSA 1WDPA 4BF7A 2F61A 4RL3A 5CSUA 3AHZA 2W66A 3HMCA 1RPKA 4UQ9A 4GKLA 1BYBA 1UD8A 2XWEA 2A3AA 4LGXA 1KGUA 3DHPA 4W89A 2ZIDA 3VIKA 1E56A 1JDCA 3GNRA 2GJPA 3CUIA 2FHFA 4CU8A 4PMOA 3A6OA 4U2YA 5CGMA 2XFRA 4JCMA 1EOMA 2WMGA 3VMNA 4JHOA 1R86A 2FHCA 3UEQA 4WSKA 1UQYA 1JZ2A 4KH2A 1H41A 1HJXA 1FOBA 3AS3A 3WQ8A 3WH6A 4P7LA 2WHJA 3OLEA 2J8FA 2J25A 3K4AA 3VD9A 1HL8A 4GI6A 1J0KA 3CHCA 3WUEA 3QGVA 3AROA 5A2BA 5DEZA 1J11A 3ZJKA 5A2AA 3WMSA 1HKMA 3FNDA 2VO5A 4CCDA 1PEZA 2GK1B 5HBFA 5ABEA 1WB0A 4BQ4A 1SMAA 4WF7A 4FLOA 3WH9A 4PCTA 1V3IA 3VNYA 2CITA 3WF0A 2D2OA 2WBGA 3UR8A 3VDHA 3AMGA 5ABGA 3GXFA 5LYRA 3WH7A 3EMZA 1MFUA 2CERA 4ZXLA 3OB8A 4M82A 1OT2A 3SIMA 3DYMA 1UA3A 3GM8A 4W5ZA 1AQ0A 3AJ7A 4C7FA 2Y2WA 6TAAA 1CIUA 3PTMA 3CHDA 3QHNA 4HA3A 3BMVA 2ZXQA 4J3WA 3BCDA 1EH9A 2XFYA 4V2XA 1I1XA 1UOKA 3CO4A 3HU7A 3OA5A 1E0WA 4BQ5A 5CXPA 1VAHA 1LL6A 4QFUA 3W24A 3EYPA 1K9DA 1GPFA 2DT0A 4UFIA 1FP8A 1OBAA 3MUY1 1E6NA 1AQMA 1VEPA 3CH9A 2ZX7A 2G41A 2VJXA 4MJ2A 4GO9A 5JBDA 4PTMA 1UH2A 4NI3A 3ARPA 5I79A 3APGA 5IHRA 2YL9A 1UWQA 1XD1A 1GOWA 2EQDA 1FH7A 5AC5A 4M29A 5CJ5A 3MSGA 4TTUA 5LA1A 4LXFA 1E1FA 4RE3A 1QBAA 4XB3A 4XUYA 3NSXA 3SCOA 1E0XA 1BSIA 1B3ZA 1KXVA 1W1PA 3TTQA 1D7FA 1VFUA 1EOKA 4H8UA 1UG6A 1XRVA 2ZOXA 2E3ZA 1OCQA 2GJXB 2Y4SA 1GVYA 3ZMRA 3VPLA 3MMWA 3SCPA 1CBGA 2CPUA 4CD8A 4JCLA 1MFVA 2ZUSA 3PZGA 3CUHA 3WEOA 3GNPA 5M17A 2XIBA 4BCEA 2VC9A 3CZGA 3TTOA 3RCNA 3W37A 4ACZB 1WZKA 2WC3A 3SEPA 3VUPA 4D71A 1C8YA 3OZOA 5CQ1A 4CD4A 4MTVA 1V3LA 3W81A 1B1YA 4Z2JA 2V38A 1TUXA 5LA2A 3WQ4A 1B3XA 2JIEA 3CIVA 3VDAA 1QW8A 3BC9A 4RE2A 1B2YA 4KWUA 4UOQA 2J8GA 1QNSA 3AIQA 3AMCA 2WW5A 3GXIA 5IFTA 3SCVA 4J3UA 4ZEPA 5BWFA 4QCEA 4TVUA 3QR3A 2WAGA 1D3CA 4FLQA 1E6QM 4JKMA 1XC6A 3WQ5A 5A8NA 1E4NA 4B3KA 4MAZA 3MKKA 1US3A 3VILA 3EMCA 3VNZA 1CXEA 1E70M 1FP9A 2XVPA 1GONA 1H5VA 2VVNA 4AZGA 4C7DA 1GW1A 5A6MA 2VRJA 5BXRA 3AI0A 1V6WA 1WE5A 2YBTA 2XHYA 4P7QA 3WNLA 2J4GA 3LPOA 1BG4A 2RGLA 1NWTA 5DMYA 3VM7A 5I6SA 3SCQA 1VJSA 2ZUUA 4GPNA 1M53A 1PAMA 2WSKA 3WDIA 4HP5A 3WUBA 1CWYA 2A3BA 1V0KA 1GJWA 3WN6A 2WHKA 1GCYA 4HMEA 5BROA 2G4FA 3THCA 1VB9A 4FF5A 2OYLA 3N18A 3II1A 3SCRA 2VUYA 3W4RA 2X2YA 1BYDA 1PBGA 4UNIA 1IZJA 1E4LA 1E71M 5A95A 5I78A 4B9ZA 2VZSA 3MO4A 4RE4A 3W82A 3ZT6A 2ZWZA 4GIAA 4LYQA 2J75A 1S46A 2XM1A 4Z2LA 2VVSA 4W85A 3AHVA 1V6XA 4H04A 5I5RA 3WSUA 1UR1A 5D8ZA 3AYRA 3OGRA 1UKTA 4Y7EA 3IJ9A 1CXHA 1NM9A 5I3DA 2AMGA 3M07A 4J3VA 3VX0A 4DUWA 1M03A 3GTNA 3ZSTA 4P7NA 2QMKA 3RM8A 3W38A 1J0YA 5JIPA 4QP0A 1PZ2A 5I0DA 2D0HA 1J0JA 2IUZA 1W2PA 4LX4A 4CN6A 4C7GA 3OZPA 5BRQA 1DEDA 4ZENA 4A4AA 5D4YA 3EDDA 3IANA 4TX6A 4DWSA 3MMDA 3M6DA 1E55A 1CLXA 2W92A 1O7AA 4AZ5A 1GJUA 1W9BM 3HN3A 2DSVA 1JYNA 2WVVA 2OWWA 4Z2GA 5A6BA 3IJ7A 3O6AA 2XPKA 3J7HA 3UG5A 1UWUA 3WF3A 2Y5EA 1NOWA 3WF4A 3L4UA 3N1AA 4F66A 3WUGA 3WENA 3VIPA 2D22A 1JNEA 1E3ZA 2DT2A 4PUEA 1BVNP 1MQPA 3VIFA 4EKJA 3RDKA 1CECA 1W91A 4ZFMA 2BVYA 3BLKA 9CGTA 2PWDA 2CESA 4K68A 4ML4A 2DT1A 1C7SA 3AHXA 1UQZA 2ZUWA 1MW0A 2BHZA 1L0PA 1E73M 1RH9A 2DQXA 4AIUA 1CXIA 1CLVA 3QOKA 2A3EA 1GQLA 1WZMA 1TA3B 1WCGA 1OIMA 4PMQA 4J3XA 1OT1A 1V6YA 4GQQA 1HJWA 5D9MA 2ZE0A 4PTVA 5HPCA 4JFSA 4E4PA 5A94A 1RP8A 3T2OA 5KEZA 1VJZA 4AZ6A 2UY4A 4W7VA 1KBBA 3T2PA 3RM9A 3AZTA 4OBRA 2XWDA 2XVKA 2XYLA 3GH4A 2W63A 2G3NA 4P8WA 1CYGA 2MANA 3MU7A 2YA2A 3F4VA 3ZR5A 1JZ7A 5A3HA 2WLYA 8A3HA 2DIJA 4GI9A 2VCCA 4UZSA 1H1NA 2D3NA 5D9NA 3RPMA 1UHVA 1GQIA 1EA9C 4AZCA 1PPIA 1GZJA 4WK9A 4NRRA 1GOMA 4PMVA 4D6CA 3WD1A 1MYRA 4DWSD 3KWXA 5BCAA 1B90A 1J0HA 1RD6A 2VX4A 1WDRA 3FN9A 1KQZA 2VZTA 4N0RA 4PTWA 5TD4A 4D6HA 7TAAA 3RILA 3CHEA 4P8UA 1LL7A 4CN4A 4U5IA 4JHZA 1C7TA 4TUFA 1KFWA 3PBGA 3ZM8A 4R5EA 3RIKA 1HJVA 1VEMA 4TX8A 3CZLA 1C8XA 2CIPA 4HZ8A 5BXSA 4KGLA 4ATWA 4F9DA 1BVZA 2XTKA 1QNOA 1W3JA 3VINA 1M04A 4NZCA 4WIWA 3L4ZA 3WBAA 1CGUA 2WBKA 3AS0A 2BY2A 3BAYA 4U5KA 4MNMA 3RJYA 5EFDA 2GUYA 6A3HA 1CZ1A 1KGXA 3BXWA 1KR1A 3AHTA 2WLZA 1DP0A 3SUTA 4KMQA 4D6DA 5C8BB 2VCBA 1UWRA 1QNQA 4W8AA 5A8MA 4TTGA 1E0VA 4GQRA 2WVSA 2DT3A 2QPUA 2NT0A 1JIBA 1QNPA 1V08A 2HISA 3N04A 2WMIA 3FAWA 2O9PA 3N9KA 2WZIA 1HP4A 5E9AA 3FAXA 2VR5A 3SUSA 4UR9A 1TE1A 1BGAA 1VRXA 2PWHA 3K4DA 4AXNA 1H4PA 3PTKA 3W0KA 2YDQA 3MS8A 1SMDA 1A3HA 3I3BA 3DC0A 5FIPA 3VDCA 1JZ4A 2YA1A 3F5JA 3OLDA 4S3KA 1MW3A 4AYSA 3LPGA 4AD5A 2G8ZA 5FCZA 3AOFA 1E6RA 1KWKA 5AYIA 3ARTA 4CU7A 4M24A 1DWAM 1W1VA 5CLTA 2CCRA 1J18A 1IV8A 3K8LA 1NWRA 3KL0A 3U5YA 1WZAA 4P7RA 1ISYA 1GHRA 1UKQA 4ACYA 4AMCA 4F8XA 2YDRA 1SR0A 3A47A 1W2VA 2AOSA 1BHGA 3WD0A 3CZ8A 2QMJA 1GVIA 4Q22A 3THDA 1VFMA 4KRTA 5DO8A 1WDQA 3F5LA 3CZKA 2PBGA 3DECA 3AIRA 2DSUA 4JKLA 4JFVA 3WD2A 1BFNA 1WO2A 5ABFB 1PIGA 3EDKA 4UQCA 3T0DA 1JYWA 2BY3A 5JUVA 5I23A 3POHA 2ZXAA 4M81A 4M1RA 3FY1A 3CUFA 3ZT5A 5I77A 2VOTA 5M03A 2DIEA 3TA9A 1BYCA 4OIFA 4M80A 1J9YA 1XCWA 1XGZA 2J7HA 3MSDA 1WAWA 1X1NA 5DFAA 5IDIA 3N13A 2FDMA 4PMDA 3A4AA 2D23A 4P8VA 4AISA 1Q6GA 1JFHA 3BH4A 1EQCA 1PIFA 1VENA 3WNMA 1W3HA 4Z2IA 4UQBA 2WXDM 3SUWA 4AIEA 3WDHA 4D6JA 3W6MA 3CBWA 2BFGA 1AQHA 5C71A 4GI8A 2WVUA 2YIHA 4W7UA 3VIMA 4EANA 2DSKA 2VT0A 4PUDA 1H0GA 1Q6CA 6CGTA 3AMKA 1JI2A 1ZBWA 4JFUA 1JYVA 2D3LA 1OGBA 3T0BA 2DSWA 2D0GA 4PMNA 3G6MA 1KR0A 2XVNA 4W86A 1JAKA 2V3FA 4YPJA 5D8WA 2Q8XA 3AS1A 2E0PA 2ZX6A 4ATLA 2EBNA 4PBGA 5GNXA 3ECQA 5I2UA 2V3DA 3ZO9A 4QLJA 2W4XA 2VTFA 4H8HA 4ZE5A 3ZQ9A 3N15A 5E70A 1JI1A 1H0IA 3ZJ7A 2DSZA 3WNPA 3KE0A 1W9VA 1NP2A 2DH2A 2VL4A 2BS9A 3N17A 3AHYA 1MWOA 3GDBA 4GZIA 1HX0A 1C90A 1C92A 1CXFA 1TMQA 1DTUA 5CLWA 1FFQA 1IT0A 4U33A 4W87A 1P6WA 3U7BA 3QOMA 2VCAA 3WNNA 5AC4A 4JFWA 3WH8A 1ZJBA 3IAQA 3PHAA 4U2ZA 2GK1A 3IK2A 2J7GA 4CU6A 2BXZA 4J28A 3VGFA 1L8NA 1MXDA 4MPKA 1FHLA 4AD3A 1R7AA 5A6KA 1XH1A 3WL0A 1GUVA 3D5HA 4P7OA 2PWFA 4HA1A 3AIVA 1JDDA 4U31A 3VIOA 3WNKA 5ABHA 2PWEA 3OG2A 1EDTA 3OGSA 4KGJA 2X09A 5M5DA 1Q6EA 4CGTA 2AAAA 1JD9A 2EPMX 3SCWA 1QHOA 1HIZA 4AZHA 2YL5A 2VRKA 3PTQA 4UFMA 1EXPA 2JEPA 4MB4A 1N82A 5D9PA 1HKIA 2WZEA 3D3AA 1HF6A 4X0VA 2NSXA 3PZIA 2OSXA 2WMHA 1G5AA 4PSRA 2VZVA 4MB1A 3S6TA 1Z32X 2RGMA 1HN1A 1UD3A 4D1IA 3EDFA 2J47A 2QLYA 4FMVA 4W8LA 5A8QA 4EE9A 1X6LA 2XSAA 3M7SA 4UFKA 3G6LA 2JFEX 2D20A 4PEEA 4GZJA 3WUFA 1W1YA 5HXMA 1OGGA 2ZX5A 3BAWA 5JBFA 2Z1KA 1DWGM 2OYKA 2J62A 3WEZA 1TCMA 3B9AA 1YQ2A 2CEQA 1UD5A 1TVNA 1KXHA 1JFXA 1UYQA 2GJXA 4FK9A 3GH5A 1GNXA 3CZJA 5E6YA 2JF7A 2PC8A 2V5DA 1CPUA 5JBEA 1OB0A 2BVDA 2W61A 1TFVA 1RP9A 4W93A 3CPUA 4D1JA 1QI0A 3BMWA 4ACZA 1K9TA 5EMYA 3KL5A 2QF8A 3CMJA 4UQEA 2W5FA 4R27A 1W9XA 3MANA 1ECEA 4HU0A 1UUQA 3IJ8A 3ARWA 1HVQA 4JZ5A 2D24A 3PZVA 4P8XA 3VOCA 4D6FA 4HOWA 1UR9A 1GOQA 4HZ6A 5EB8A 4DWSC 4V27A 4HOXA 1A47A 1JGIA 4CD6A 4PRWA 3CMGA 3O2LA 2XIIA 4DM1A 1WZLA 3FHQA 3WY1A 4B15A 4IISA 3F5KA 3VU2A 4IPNB 3TTSA 2HVMA 3CGTA 1UD4A 4B9YA 2OWXA 2GDVA 1E6XM 4W8BA 5A1AA 3AMDA 1E15A 1EQPA 1TG7A 5CPSA 1JNDA 2CBVA 4JIEA 4F9JA 4UTFA 1M7XA 1ITXA 1DWIM 4F79A 2OSWA 1C91A 2YDSA 5CG0A 1JD7A 5A6SA 4OBSA 5ECUA 2ESCA 4HTYA 1VIWA 1CNVA 1CGWA 4E2OA 1W9PA 1B9ZA 3GNOA 1DHKA 3UCQA 1ZJAA 2J7DA 1EGZA 3MMUA 1W9DM 4OJYA 1OIFA 2XFFA 2UWFA 2G3MA 2O9TA 4Z2KA 3RJXA 3WMCA 5LA0A 5FKYA 2G3IA 2XGBA 1KGWA 5HPOA 1FA2A 1JXKA 1WPCA 4CCCA 3A4XA 2VZUA 4MB3A 1F4HA 3VD4A 5DF0A 1H11A 3DHUA 3VD7A 1U33A 3AFBA 1BGGA 2ZUNA 1OD8A 1ZBCA 1US2A 2WNWA 3PZMA 2J79A 1E6PA 2W91A 1EO5A 2E8YA 5GNZA 4XV0A 1LF1A 4URIA 2NT1A 1Q4NX 5A8OA 4YN5A 2YOCA 2WVTA 3VGHA 1UR2A 1VFFA 1J12A
chains in the Genus database with same CATH superfamily
1EPXA 2R8WA 3QFEA 3PJUA 1WKFA 4IJCA 3LHZA 2ISVA 3RLGA 3GQYA 2QCEA 1KC7A 3OBKA 3E2RA 5REQB 1W5PA 4GY1A 3KEHA 4I9MA 3TJIA 1EF2A 3SY5A 4CQAA 4EPEC 3BO9A 3ZVHA 1RK5A 1A5MC 2Y8VA 2PWGA 4LAKA 1BWLA 4PCSA 1RQHA 5FF3A 2Y7GA 1LDCA 4AY8A 5M3WA 3W29A 1JDFA 2D0FA 1HZYA 3TTYA 3VNKA 3CZEA 4WSHA 2VDIA 3W88A 1KKOA 2DG9A 5I24A 4MSPA 2EF9A 5F7UA 2A7PA 3G0UA 1XYCA 3WELA 2KI3A 4ERAA 2ZQVA 1XIDA 4JR5A 2ADAA 3TONA 4DELA 4AZBA 2QJGA 4KIEA 3LM7A 4Z17A 3FJLA 3UERA 4WKFA 1M01A 1GORA 5CZSA 5EFFA 3BL3A 3AIUA 4HHMA 4MDOA 3SN4A 2AMXA 3IAPA 1G94A 4TU1A 2PDFA 1OSEA 5AZ1A 3W2LA 3GTIA 5FESA 3QV8A 1VQTA 3VVGA 2CHNA 4DRIA 1AH0A 1YEYA 1TTIA 3EX2A 1K9FA 3RCYA 4TVCA 1D2KA 3JZUA 2I5QA 3VKKA 3FS2A 1TA3A 5JXQA 2E9BA 1TV5A 1ISZA 1KO0A 1OCJA 4R53A 1TZ9A 3QGKC 4IUGA 1TVPA 1LG1A 2Y6ZA 3ZR6A 4LSBA 1I2PA 4ZTYA 3SFWA 4JFMA 3F2BA 2WCAA 3QH2A 4MF4A 4GOAA 1ROUA 2VFIA 2K8IA 5DT5A 2PV1A 1PX3A 1PHQA 3IARA 4D6GA 5GPGA 1QHZA 4MY1A 3HM7A 4HU8A 3RM4A 1Q63A 4RZ6A 1XGDA 2J88A 2YLAA 3UZWA 1JUEA 3W02A 3WFLA 4CEUC 5BYWA 1X1OA 1LQ0A 4PH6A 1IWPA 1TB3A 1OM0A 3EDEA 3PRBA 1XIGA 3EOLA 3LDVA 1WOBA 5IFPA 1SFJA 4MADA 2J7BA 3STGA 1U2YA 2PB1A 3HBLA 2OSYA 1XCXA 2YLLA 2VQUA 2BOGX 3BV4A 4XQ6A 1XQKA 2OX4A 3UA3A 3TN6A 3A4WA 1U1HA 3IJ6A 4GD0A 3W86A 4UOZA 1QPQA 4HNOA 3T4WA 4ZA0A 3AMLA 4UMCA 5HUOA 1AW2A 1W5NA 3AISA 1LCOA 3SQMA 3LRMA 3KBNA 1HVXA 5D38A 1D7HA 4R33A 5G2IA 2OPJA 3UZXA 1TPEA 4UTIA 1JXJA 5C9UA 2C13A 1CGXA 1OFRA 4WDTA 4A05A 3PZTA 4GQBA 1JDAA 3BPWA 2JKPA 2ACRA 4TV6A 1H7NA 3PULA 2QHAA 4LW7A 1ISXA 1RY0A 4O10A 3LGGA 3M1ZA 3KHJA 4PMYA 1MSSA 1KWGA 1QPOA 3ES7A 5G1TA 1WP6A 1OCNA 4BI6A 3R8GA 4JYSA 3FVMA 4DI8A 1YTDA 1UP3A 1XYLA 2FGZA 2VI0A 4PYSA 3IUIA 1Y7VA 1DXEA 2DJXA 2ZZ6A 5D9OA 1N7KA 2ISFA 1FD9A 6REQA 4HVXA 4J27A 2LGOA 3MW7A 3B4YA 4PULA 3GVQA 3APTA 4PUUA 2WHMA 1B54A 4NAFB 4WY0B 4JTFA 4DJFC 1QOXA 2UY3A 1PB0A 1EC9A 1QTWA 3WNOA 3AQUA 2VMFA 3U6WA 1J0ZA 1FWNA 2XIMA 2JIWA 4E38A 5AHLA 2AAMA 1MZRA 2DV0A 1TWDA 1LJYA 3UR7A 1HL9A 4DJDC 3C5QA 2G5WA 4LF1A 4W88A 1XR2A 3PZOA 2EJAA 2JE8A 1MVYA 4JTCA 3W7HA 1DJWA 1X38A 4IMCA 3VIIA 4PB4A 2XINA 3E2VA 1KM3A 1THFD 4M6VA 4PMUA 3CHVA 4A22A 2XGIA 1UWAA 3PWIA 1H7PA 2V69A 5K9CA 3W1XA 2TRSA 2IXVA 3ZOAA 3WD4A 1Z6KA 1ZCOA 2F7FA 3S42A 2W62A 5KETA 1ITCA 1K77A 5ABFA 2F9RA 2WWCA 1W32A 4TO8A 6ENLA 1IXQA 2WMFA 3B8SA 3BW3A 1BTCA 3B04A 1V03A 3BLEA 4NQ1A 2CZDA 2ZICA 1VR6A 3IKGA 4WDXA 4UXDA 1VFLA 2E7FA 4DUVA 4CKQA 3A4JA 3QLDA 3S1VA 1ZHAA 4QGCA 4G1KA 1UR3M 3M46A 1KBJA 2HVNA 1VIZA 1EIBA 8TIMA 4J35A 4LAVA 1NF7A 3NEVA 3CMFA 3PTDA 2PRHA 4TX0A 3MV11 1EA0A 2VKZG 1J0IA 4UCFA 4AC1X 3B06A 3ALGA 1M1BA 1QW9A 3CUJA 1AA1B 2XZ9A 5BXTA 4MLJA 4L9XA 1HJSA 3WBEA 1MNSA 3S2CA 3URNA 3AIWA 3MI3A 5LGXA 4X0NA 5HAOA 1FH9A 1GEHA 2PF0A 2R9RA 4DRSA 4BA0A 2Z00A 1J4IA 4YVVA 1BWVA 3ARUA 4O0KA 4IXHA 1KNWA 4A3HA 3P14A 4JTGA 2QCFA 1AMYA 3PAJA 3KRZA 2ZQSA 4LF2A 2GQ3A 3UCCA 2OQLA 2XN1A 1ICPA 1N55A 1F6KA 1V51A 1FVPA 4TX9A 2PBCA 4O28A 3R11A 1EP2A 1I4NA 2Y1HA 4JBRA 1IIHA 1W3NA 1G9HA 2ITKA 4ODMA 3S6OA 1OG6A 8CGTA 3UESA 1BKFA 4PZVA 3KCJA 2HPMA 1QI3A 3PAOA 1O95A 1XC4A 1K7XA 3WK1A 2XUCA 4HPXA 4LVDA 1NTHA 4OKDA 3G8RA 2G4JA 2TAAA 4D6IA 3VDBA 4DAFA 4HMDA 3DBPA 4G7EA 1V0MA 4YTQA 4C6FA 1JPIA 1J6PA 4O2TA 4Q4RA 2YL8A 5K4ZA 3ITVA 3VE7A 3MVIA 3F4CA 4R88A 1BD0A 3R0KA 1LOLA 5A2CA 4OWGA 3C0QA 2XSXA 4DUXA 1FKIA 3CHFA 1W31A 1OGSA 1FKSA 4DBWA 1B4EA 2OU4A 1K8XA 1OK4A 1NOUA 1XBXA 4JL2A 1ZL1A 1XSIA 3OIHA 3UF9A 3H24A 4RW3A 4C6IA 4GXMA 5C0QA 1UMYA 3P7YA 2OYMA 4NZJA 3RX2A 1J10A 5FOOA 3W71A 1W3LA 5H91A 2PEVA 3L4TA 2Q6ZA 3UI4A 1P0BA 2RUQA 4KRUA 1UZDA 1E5NA 3K1GA 3R1ZA 4XX6A 2WC4A 3UETA 1TTJA 7XIMA 2J7FA 1VYPX 3LXAA 3NQGA 1T41A 2XPBA 2A6LA 4Q3MA 1FKGA 4ZBCA 1T7LA 1HGYA 2YKKA 4QLLA 2PRMA 3WEMA 3LD5A 3GY1A 6TIMA 1XRSA 2E40A 2JGQA 1PCKA 2D2JA 3VKAA 1QPFA 3GBEA 1NFBA 3RGCA 1N8IA 5D37A 1RBAA 1LLOA 3SO7A 4KWVA 2XJ7A 4UDMA 1KFCA 1XIJA 2NLYA 1P6BA 2B7PA 3M7WA 4MNKA 4ODNA 3T44A 3WIJA 3ARSA 4QT3A 4BY3A 2B81A 1VPYA 2KFWA 3CPGA 1YX1A 5HNRA 2OX1A 3HA1A 3AIEA 4HGXA 2PP3A 5LIUX 2CZEA 4W5UA 2BXYA 1IGSA 4UMAA 2GUBA 2VR4A 1BPLB 5BRBA 3DFTA 3T1GA 4OOZA 1B6CA 5FL1A 1VBUA 1OHLA 3GKAA 3LCLA 1Q6HA 2C19A 5HR7A 3HFYA 1U1JA 2F84A 3N9SA 2VX7A 1X6NA 1UW9A 2GOKA 3GYEA 4UBPC 3C0SA 1M3UA 4U3CA 2A3HA 4K36A 3G0XA 1VPQA 3I3DA 2NLIA 1SO4A 4TR9A 1ADSA 4RXGA 4NJGA 1LRNA 3VX1A 3WDJA 3LX9A 3JR2A 3ZJ8A 1FWDC 4UOJA 5EMLA 3LPFA 3C8FA 4IM4A 1QVBA 5JU6A 2ZWYA 2Y7FA 1ZAHA 2V68A 4IZGA 4Q8NA 1RCOB 3PK7A 1ECQA 3VGGA 3OBAA 4BK9A 2I9EA 4GUGA 1J2BA 3MSRA 4J7RA 1EO7A 1Q7ZA 5KMYA 4CEXC 3STFA 1W1B1 3IJQA 1R30A 9XIMA 1Q6RA 1SYTA 4PSPA 5LZLA 2RUSA 2WJDA 2FVKA 3C2VA 3STPA 5J8LA 3CLWA 4RL3A 5CSUA 1FJDA 2P4VA 5XINA 4MZ8A 3L7RA 2XWEA 3U2ZA 4ZO8A 4DBUA 4K3ZA 1ITUA 4MWAE 2GUUA 1PYMA 5JH2A 1JDCA 4KKXA 4LAZA 4O18A 1U5JA 1UIOA 4I6KA 1WKDA 2EAWA 3A6OA 4U2YA 1ME8A 4E2DA 4IQ2A 5I98A 2WMGA 4NL1A 3B03A 4TV5A 2FHCA 4DXVA 1J4EA 1JZ2A 2Q09A 3WQ8A 1RV8A 2WHJA 3S5ZA 1I2OA 3G18A 3CEPA 3IIZA 1LYXA 4A2SA 1GVEA 3OU8A 5REQA 1HL8A 2RAGA 3S2LA 1J0KA 3CHCA 1EF3A 3EX6A 4M7SA 1MDLA 1J11A 3ZJKA 5A2AA 4CNOA 1HKMA 3FNDA 2VO5A 3GVGA 1WB0A 4S39A 4ERIA 1UUMA 1V3IA 3GZ3A 3B97A 3M0ZA 3FAPA 2WBGA 1EIXA 4L65A 3AMGA 4ZO6A 4X22A 3BW2A 3LBCA 4ZMGA 3GAKA 4GBDA 3QSTA 1KBLA 3DXIA 4M82A 1OT2A 3SJ3A 2FIQA 3PTMA 1V93A 4YNGA 4GY0A 3ONCA 2XFYA 1I1XA 1NSGA 1EPVA 1WKEA 1TJPA 4IIEA 3W1TA 2XDFA 3W24A 3EYPA 3ITXA 1FP8A 4GKTA 1DJHA 2VFDA 4NXKA 4ZQOA 1E6NA 3CH9A 4P61A 2G41A 1F73A 3EPOA 1KM5A 4TMCA 1K8YA 4NJJA 5I02A 3TC7A 3OHIA 3W74A 5I7GA 3APGA 3BOXA 1UWQA 2IQDA 3WBYA 5D05A 5AC5A 4BR1A 5CJ5A 3GTFA 1TSIA 4KIRA 5HUPA 3CEUA 3NSXA 3EEGA 1JPHA 1ME9A 1NJJA 3GHSA 1W1PA 3MUCA 1SU5A 4AF0B 2FDSA 1QFEA 3UGRA 2QJNA 1TREA 5HKGA 2FMOA 1CBGA 3KX6A 3NZGA 3CAWA 1TIMA 2ZUSA 3PZGA 2VGFA 3CUHA 3P2VA 4GISA 2F38A 3WQCA 3WEOA 5M17A 2I16A 3LK6A 3TTOA 3IGHX 4D71A 1C8YA 5CQ1A 4CD4A 3GHUA 1F07A 2G37A 1Q6QA 1YNYA 2XIOA 3RITA 2YXXA 2WQPA 3WQ4A 4Z1CA 3WK2A 3FGCB 3WQPA 3M0KA 2RSEA 2YR1A 4LFYA 3AIQA 2WW5A 4XKYB 3QC3A 3AU6A 2GJLA 3SCVA 3O6YX 4QSHA 4ZEPA 4IP7A 5BWFA 1BKHA 3SW6A 4QCEA 5LIXX 3W1UA 3V75A 4FLQA 4XBJA 4JKMA 1S2AA 4RNHA 5DRCA 3W23A 1RA5A 3MKKA 3S6DA 3MHGA 4G9PA 4JTLA 1E70M 3O5RA 1L9WA 1TWZA 4BF9A 4C7DA 3NNTA 1L2UA 2VRJA 3KOYA 2ZZ2A 4Z08A 2DVUA 4U4MA 5H8PA 3M0HA 4AYGA 1SFLA 1BG4A 1EJXC 4DVOA 5I6SA 3VM7A 3SCQA 1VJSA 3SJNA 3N2MA 1M53A 1PAMA 2WSKA 2DIKA 1F05A 3WDIA 1CWYA 2KAUC 1GJWA 4UTJA 3WN6A 2VC5A 5HINA 2Y5SA 5BROA 4UWMA 1VB9A 2PGRA 1S2WA 4M6PA 3NEHA 3N18A 3II1A 4MMWA 5IM51 1M7JA 2X2YA 4UNIA 1PBGA 4Q8TA 2VXNA 1NDZA 2DU2A 3LM3A 4NAFA 4B9ZA 4RE4A 3W82A 1YTKA 3G1YA 3ZT6A 3E5PA 2ZWZA 2CLIA 3W2MA 2VVSA 2DQWA 1V6XA 3WSUA 1W1ZA 4H9YA 5TAOA 3VOJA 1VCVA 5G2WA 2B7QA 5K2ZA 4PGLA 2QPXA 1LM1A 4P7NA 4IT1A 3LHTA 1S5WA 2YGYA 4QP0A 3M9YA 2D0HA 4FEZA 3FA3A 4KQZA 3I65A 2R94A 2OOFA 4CN6A 3TDBA 3TYBA 3ERPA 2FB3A 3L5AA 2VGBA 3FV9A 1NQKA 3NQCA 4L4MA 3GXNA 1NFPA 1GVOA 3LCFA 4JDBA 3V36A 4U84A 1GJUA 3THQA 3TX9A 1HG3A 3BARA 3UY7A 4AVNA 1R9HA 3O6AA 3IJ7A 2GGHA 3J7HA 3N1AA 4F66A 2Y85A 4UR7A 3N6JA 2D22A 1V5XA 1PKMA 2XN2A 3KCOA 3VCNA 1BVNP 4WUIA 1FXPA 2Q5AA 3E12A 4PCPA 1W91A 1ICSA 4ZFMA 2ZRYA 4JTIA 2V82A 1LOSA 4ML4A 2DT1A 3TW7A 4DZAA 4TIMA 3S2NA 2R1MA 4GYPC 2DQXA 1TJ2A 1GQLA 3UW6A 5CBIA 4J3XA 4XZ9A 1TCOC 4QS5A 2WO5A 1S2UA 1HJWA 1QR7A 1OFEA 4L1WA 2AQOA 4D2JA 3REQB 1RP8A 4PFHA 1RJQA 5BU6A 2P0OA 4AZ6A 1AH3A 1ONEA 2UY4A 4GRSA 4O1AA 4LY4A 4LY8A 4L6HA 3T8QA 3RM9A 1HL2A 4C60A 3GH4A 3B8IA 1CYGA 2PPPA 4NAEA 2GZXA 2GOUA 2YA2A 4CQCA 3VZZA 1JZ7A 1VZWA 4AH7A 1H7WA 3S83A 3SIZA 3EB3A 3RPMA 1TPH1 4NVTA 2UZ9A 1QWKA 1C29A 3LB0A 4KR0B 5BCAA 1B90A 1J0HA 5EMUA 3EX4A 3CH0A 3FN9A 4JIPA 1L6SA 2GWGA 3C4UA 2DUZA 3WQOA 4V15A 1C7TA 4TUFA 2OLSA 3PBGA 2HBXA 4UNLA 1U5VA 1Q5MA 4OE7A 4L7ZA 4PCFA 3GRIA 4FOJA 3NQEA 1IEWA 1FRBA 3CYJA 3OBEA 3SFKA 2P50A 1FWWA 1QNOA 4NZCA 1LUCB 4WIWA 2QXWA 2XP6A 1SZRA 2J66A 4HNLA 3WBAA 3MBFA 4Y96A 2BY2A 3PR9A 1RJRA 4MY8A 2HDJA 3AJXA 4MNMA 1AJ0A 1UP2A 3QC0A 4PR4A 1CZ1A 5A5WA 1KGXA 3BDKA 3CQKA 3AHTA 1DP0A 4DF1A 2Y0FA 2PWVA 3V0TA 1C9WA 3D46A 4GH1A 5LXXA 1YXDA 2X7VA 2DT3A 4QQ3A 2QPUA 5I3FA 3URQA 2NT0A 1E9ZB 5LNSA 2FJKA 4O4VA 3WK0A 1V08A 2FKEA 3S9YA 2O9PA 3BMBA 1PSCA 2OO0A 2VR5A 2Z29A 1PYFA 1H4PA 3MS8A 1Z8AA 1W1A1 4JQ2A 5EBUA 1Y5XA 3VDCA 3PFRA 2YA1A 4Q7BA 3FJ4A 3BMXA 3OLDA 1P5QA 4AYSA 3CQHA 4Q8QA 4PUWA 5IBXC 5AYIA 4FAPA 3RYSA 3LN3A 1IV8A 3K8LA 1GJPA 1TR9A 4F2UA 2ACUA 2W9MA 3WLLA 3U5YA 4YCPA 3RLUA 1S39A 4JNZA 3IUDA 3UJEA 3PB2A 4ACYA 4F8XA 3ABRA 4FOKA 4U28A 5AHMA 4LUSB 4TMBA 1QW7A 4Q22A 3THDA 1F3WA 1T11A 5FF0A 3SGUA 2KGJA 1D7IA 3RMJA 5DO8A 3O5QA 1H5YA 2YZRA 2PBGA 4FIQA 3AIRA 3ZVIA 2QCLA 4H2HA 3EDKA 3MKVA 2C18A 5DXYA 4DBDA 4M1RA 2PUZA 4GGBA 4ALDA 4ZOCA 1J9YA 3GK0A 4JNMA 4NZFA 3FYPA 3MSDA 1P0DA 1WAWA 1X1NA 5DFAA 1QAPA 2FDMA 4PMDA 3CJPA 1OFOA 2D23A 1Q6GA 3G1VA 1EQCA 2HXUA 1PIFA 2C3ZA 5H8UA 5BOOA 2E1WA 1KFEA 5AC6A 3DG7A 4H9MA 4Q8OA 5F2GA 1MO0A 3WDHA 1D6OA 1EUNA 5JMUA 2BFGA 3W01A 3QKZA 3P81A 1AQHA 2ZZ5A 5C71A 4R85A 4GI8A 2WVUA 4W7UA 4EANA 2DSKA 4PUDA 4B5SA 4HNVA 5FSEC 3QQWA 2V0TA 3WJYA 1MEWA 4UTWC 1ZCNA 4DZ5A 1ZBWA 3N2XA 1JYVA 2D3LA 4A2RA 3M0VA 4XVEA 5HQEA 2HS8A 4W86A 1JAKA 3LHVA 3PANA 4JICA 4NNRA 4HJWA 4L4LA 4G1NA 4L5ZA 4XO7A 3W1NA 4JEJA 1ZRQA 2EBNA 2PZNA 5GNXA 3CGMA 3ECQA 5I2UA 4Z1YA 2IPJA 5FEZA 4GJJA 2IPWA 1UPMB 4BWLC 3JZEA 2I57A 2TPSA 4H01A 1W9VA 5K9DA 4DO6A 3K5XA 3W7MA 2BS9A 1NDVA 3RLVA 3W2NA 1QASA 4KEZA 1MWOA 1XPGA 2GQ9A 1HX0A 2R1NA 4Q8UA 1TMQA 1AODA 1IT0A 4W87A 3LGDA 5MKGA 4ZSUA 1MEIA 3TA6A 2AGTA 4FSAA 3QOMA 1J4HA 2VCAA 4HBKA 2O0TA 4ADTA 4HHLA 4IFKA 1YATA 3FEMA 1ZJBA 1TV8A 1IEQA 1VHNA 2J7GA 3ZFHA 3FJNA 4R7OA 1X7IA 1L8NA 3GDMA 1RCXB 2WOQA 2HRWA 1F61A 4KETA 4PBFA 3AWNA 4HHPA 4H7ZA 5A6KA 2Z25A 1GUVA 3INPA 3WX7A 3F4DA 4KEVA 3Q37A 3IEBA 4Y9PA 1GG0A 4U31A 3VIOA 1IF2A 3MC5A 1KM0A 4ODQA 5ECVA 1EDTA 3OGSA 4Q4QA 4WXZA 2ICSA 5FJIA 2INZA 3DC8A 4N2YA 1CB7B 1QHOA 3EA2A 2YL5A 2OKOA 3UVAA 3TJXA 2G95A 4UFMA 1EXPA 2BZNA 5D9PA 3HPZA 1HF6A 4N6FA 3GDTA 3PZIA 2OSXA 2BG5A 4PSRA 2RGMA 3BLLA 1HN1A 1UD3A 4D1IA 1FBAA 1M7PA 1R3QA 4PC8A 4FMVA 3S2MA 3BK0A 4ODRA 3A5VA 5MF5A 5EGRA 3DZ1A 1M6JA 4EE9A 3LERA 3IJDA 1H7RA 4DZHA 1DWGM 1VS1A 3QR0A 4L9ZA 3U9IA 4INFA 4JY8A 4AF0A 3HV8A 3H53A 4IXXA 5LIWX 2XP7A 2C6QA 3IGUA 1DJXA 4DJEC 3CZJA 2V5DA 2FGBA 1CPUA 4GYFA 5BMWA 1TFVA 3H23A 3CPUA 3BMWA 1K9TA 3UR5A 2QF8A 2QCDB 4LAXA 5TBOA 4UQEA 1ECEA 4Z1AA 4DRMA 2D24A 4D6FA 3W70A 4HZ6A 3V5CA 4V27A 1A47A 4YTUA 4CD6A 2QVHA 1XGEA 2RDXA 4IIHA 4B15A 3GB6A 1FWIC 3CGTA 2H8ZA 5D03A 3F2CA 1UD4A 1I60A 4B9YA 2VN1A 2OWXA 3NXFA 2HE5A 4W8BA 3AMDA 1TG7A 1ZENA 2CBVA 4GVHA 1WQ5A 3A64A 4C65A 4UTFA 1ITXA 4D8ZA 2E68A 1C91A 4I3GA 2YDSA 4O8AA 3W87A 4WHBA 4JQ3A 1DIDA 1CNVA 4E2OA 1W9PA 4ZODA 3R6IA 2WJZA 4UTKA 2CLOA 3A21A 2J7DA 1EGZA 3MMUA 4G5DA 2XFFA 2UWFA 2G3MA 3GO2A 1R2RA 4YTSA 3W2JA 2XGBA 3TZFA 2Y88A 3EKLA 3LZ3A 4HBEA 3TLLA 1C9HA 1WPCA 3MO7A 4CCCA 4QITA 1XJBA 3QJAA 3W7CA 4F2TA 1WA3A 1CT5A 1H11A 2EKGA 3AFBA 1BGGA 2ZUNA 1US2A 1A5KC 4WEVX 3D0CA 1A5UA 3MWCA 2WNWA 2J79A 1IXOA 4XAFA 1QXLA 4O8RA 3MZNA 3H7UA 3T4CA 2E8YA 1LF1A 2FPVA 2NT1A 3B8DA 3E0WA 3KTXA 3UYCA 3WQFA 3VGHA 1VFFA 3WLKX 4LQ1A 3EMQA 1TCDA 3ALFA 3PN8A 2X30A 2FH8A 3VMPA 2OEMA 2GQ8A 1IZKA 2OFJA 2DEPA 1PL9A 1XH0A 4CD7A 1HXJA 4DROA 2FGLA 4FXJA 4O0QA 3MYOA 3DENA 4MAVA 3MUXA 4OV4A 2ATSA 4AVFA 3BG9A 4IMGA 3ARVA 4N42A 2FHBA 2AL1A 1FCQA 2UV8G 1XLJA 1GRJA 2BY0A 1A5NC 4MZ1A 3AIBA 1VJIA 3TTEA 1N2VA 3U5UA 2VFEA 2GDUA 1S38A 2X1IA 3RU6A 1NOFA 3SRFA 1IIGA 2E9LA 2WNZA 3C3UA 4ML9A 3SADA 3ZT7A 3DERA 1GOKA 4X63A 4IP4A 1IEVA 4GIEA 2OR2A 4RDWA 1WNOA 3QY7A 4DXKA 5I06A 1KV8A 2PE4A 1XICA 4WDWA 3RCMA 1V6UA 3G22A 1KFBA 3AXXA 3VFLA 1PZ0A 3CL7A 1WBJA 1J6OA 1JQXA 7CGTA 3NXLA 2IXUA 7A3HA 5E1QA 3VGBA 2UY2A 2ZRUA 1BXCA 2WNNA 1EDQA 4RJEA 3N34A 1VC4A 4LAUA 1QO2A 1KRBC 4WSJA 1KT1A 2DZTA 3VO0A 5AHNA 3SY1A 1CGYA 3B9DA 4O17A 1O6IA 2DP3A 3EXRA 3L65A 2VRQA 3REQA 4ZVJA 3U3HA 1T96A 4EF9A 4S3JA 3OZYA 3T09A 4LANA 1TO3A 1FDJA 4H83A 3AYSA 1ZAJA 4YL2A 3KCEA 4JGDA 3O06A 2BSLA 3PG9A 2Y7EA 2ISDA 3GU0A 4C6OA 1A5OC 1JNSA 1QRQA 3LEPA 1F8MA 3IK4A 1D9EA 3L5LA 3HMJG 3MP3A 3T9PA 3T08A 1EJTC 2VFHA 2FZMA 1E72M 2ZZ4A 4NNBA 3R89A 4AD1A 3T81A 1XHGA 3BSHA 4B5VA 4LPCA 2REQA 4W9TA 2VZOA 2BODX 2VX5A 1O5QA 1RALA 5JVLA 1ZY9A 3S0CA 3WL1A 2A0NA 2VX6A 1TWWA 2I56A 3L9CA 3MP5A 3H21A 1GYNA 3S1WA 2X40A 5DT7A 4K6AA 1Q3NA 3CUGA 4GBUA 1XYBA 1RK6A 1OVDA 2V9DA 3HPFA 3N2CA 1LT8A 1OD0A 3ZZ1A 5SWUA 1A53A 1HXVA 4O1CA 1QI4A 1JF5A 4G7FA 4IPPA 4ORMA 1WDWA 2X05A 1LUCA 3EB2A 1SUXA 1AH4A 3G0SA 2QAPA 1H61A 3EXSA 4AXKA 4YYFA 4YWIA 2J78A 1EGMA 3M0IA 2GGEA 1CEOA 3BGAA 1CDGA 3NGJA 3MV01 1JDEA 1KFKA 1QCWA 2YCIX 3PZQA 1UH4A 1MZHA 1HNYA 1Y5VA 2QT3A 4WR3A 1Y0OA 3S3GA 1DWJM 1OFDA 1C8QA 1O68A 3A23A 3KAFA 4UFLA 1U5HA 3TJ4A 1FKFA 1TR1A 3GTXA 4GG9A 2DPEA 3WG6A 1PO9A 1UIPA 1ZZMA 5FI8A 4H8NA 2M08A 1H2JA 1A0CA 3WJZA 1QT1A 1BYAA 1VFHA 4JTUA 5BW6A 3PS7A 3T05A 2PU1A 3A22A 5GJMA 3W7DA 2P88A 1NWUA 1KFLA 2DGAA 3CGNA 4MWAB 4K39A 2E77A 3MYPA 1VF8A 2LJ4A 1PJ9A 4F3HA 3V4BA 3BSMA 1QHPA 1XD0A 3AUJA 1UKSA 3K13A 3ATYA 2C0HA 1Z44A 1EWDA 1YDYA 1JZ3A 2RUDA 3C6CA 2P53A 3P93A 2QUMA 3KADA 2VELA 4PUMA 4GXPA 4X3ZA 3SCNA 4WKAA 4V28A 4B5XA 5I3JA 2CXEA 1ODUA 1GQJA 3DYPA 1QI2A 2QS8A 3JRKA 1K6WA 3EX3A 4ZOEA 2G3JA 1HFBA 2J77A 4UC5A 2FLIA 3YPIA 2ZFAA 4LUSA 4AHOA 1E40A 2PV2A 1OC6A 2ZVIA 4EPDC 3GNNA 4PB5A 4ECLA 4LS0A 3I6EA 2O92A 5FF2A 1QO5A 4NSBA 2MLZA 3GFZA 3W7RA 4W7WA 1JL8A 2P8CA 1EDGA 4DWSB 4Q8VA 1AVAA 1ZBKA 4GJIA 4L4OA 2PCQA 3VKCA 1OZMA 4PL2A 3TR9A 4I8YA 1V02E 1GGOA 3V5FA 1DJNA 3AXIA 1T5AA 1TRDA 4M56A 3OG3A 3FSUA 4X9YA 1XLDA 5LIKX 4M0XA 1A3XA 3LQLA 2NUYA 2PP0A 4GK8A 4OVXA 3UWVA 4UFJA 3JYJA 3COTA 1O66A 4ZXOA 1B3VA 1ZSXA 1EQ3A 4AFYA 3GC2A 3E5BA 2YXOA 2WYSA 2CBUA 2DUAA 1XLHA 1I6NA 1P5BA 1UBSA 3OJGA 3SR7A 5FA5A 3S1XA 1V3KA 1JQVA 2GJRA 4QAIA 1DV7A 2BVWA 5BXPA 3L21A 3L4XA 2XH0A 3SN1A 1GHSA 1V0LA 3PM6A 1VPXA 3LV6A 3ICJA 2EO7A 4QXIA 1TPWA 4J40A 1TRIA 2OEKA 4JL1A 1KRMA 3VTRA 3PNUA 4QCFA 5AZ0A 3ARRA 2H9AB 1WYIA 2OQHA 2WSYA 3NDZA 4WY0F 3KUMA 3K8KA 3PWGA 1YPFA 3I6CA 3TK7A 1OJXA 2PPGA 1XYFA 3N6QA 3AZRA 4NILA 1TUFA 4XAKA 1X1ZA 4B16A 1UR4A 4AZCB 3FXYA 4ROQA 4ZE4A 3R8HA 3WDQA 3GWQA 3HJZA 2PFHA 1BSLA 2QYGA 3NG3A 3GYCA 3U4AA 1B3YA 4POCA 5CGTA 1W1TA 1FWHC 1M68A 2EPKX 3BLOA 1EP1A 3BUVA 1XCFA 2NVAA 3CAVA 1BVWA 5EBAA 1I1WA 3VNLA 1GG1A 4WD0A 1HP5A 4QJ4B 3KBJA 1EJVC 3E0VA 1KRCC 2WKJA 5AYZA 2O56A 3WLNA 5CAKA 1DHPA 3TYEA 3PBVA 4E4UA 2OVLA 3MSYA 3R12A 2R24A 1V6VA 2BNJA 4PFMA 3O9NA 3TE9A 3CLMA 3H7RA 1I45A 5HOSA 3AYTA 3L2IA 4FNSA 2BTMA 5TIMA 3IV3A 3M44A 3WBWA 3EXTA 3M6YA 4Q6XA 3SN0A 1QPRA 2ZKMX 3WF1A 5AY7A 1IZCA 4GUJA 3WF2A 3KOWA 2D1ZA 1BL4A 2POTA 4C1LA 3MZ2A 5KZEA 2HJPA 1Q8JA 4KESA 4QE1A 3ARXA 4QIUA 5G5IA 4AEFA 4QLKA 4HZ7A 2FZNA 2ZRZA 2NV9A 2HCVA 3NQ8A 2X41A 4WOQA 4XZBA 4W4QA 4A29A 3EWDA 3GDLA 3T0AA 3NZRA 3V35A 2A1YA 1SJCA 4JN8A 2RJHA 3NPVA 4OU1A 1G1YA 1CXLA 4Y9NA 3USBA 4OHQA 3B8WA 3P8IA 3TAKA 5CPNA 2AKZA 3VMOA 2J74A 4D6EA 2YJQA 3W7KA 4B2DA 3U57A 2X42A 2C8NA 3DYOA 1CCWB 5CSSA 4IX0A 3CT7A 3FEQA 4TOQA 3RR4A 1EYWA 1J01A 2G50A 1Z9AA 4N9CA 1XS2A 3NQ6A 1GOOA 1KB3A 1A5CA 1Q7QA 3L4VA 2H8XA 4WXYA 1HO4A 3PNZA 3TC6A 4LYPA 1W3KA 2BV9A 1OADA 1B31A 5F2LA 1QATA 1KTNA 3KVKA 3BGGA 3OVPA 1GWJA 2XM2A 2V30A 4PMXA 4W9PA 2XP4A 1KM4A 2JGYA 2C16A 2QCDA 1LP6A 2Y78A 2GGJA 3W75A 2WMJA 5AYBA 4QG6A 3LHUA 2BHUA 1R3TA 1FQ0A 4JKKA 4YWSA 4RDVA 3KVJA 3V3WA 1HKJA 1R2SA 1R6WA 3BW4A 3T2QA 1F76A 1UKOA 2W27A 2WMKA 2QR6A 3M16A 5CC6A 3C56A 1K02A 1ODZA 2WSRA 3H26A 4L1XA 2V2DA 2JEQA 4YXGA 2BASA 5JQ9A 1KCKA 3EBVA 3LMYA 4ORIA 3VIHA 4GGQA 1UR0A 4IFRA 4LALA 2CU0A 4BQ3A 3VNIA 4H9XA 4XIMA 3EWUA 9RUBA 1F4AA 3PZ9A 1UH3A 1FWSA 3G8EA 2J7CA 3CB3A 1QI5A 1RY8A 1XPYA 4Z1BA 2F8QA 1E9IA 3MMTA 5GJNA 1T6MA 3KZSA 4QM1A 3LTSA 2CC0A 1MXSA 2DH3A 3MI2A 3VKBA 7ODCA 4ES4A 3XISA 4LUTB 4KRZA 1WKYA 3R13A 1Y5WA 2ZC8A 1WDPA 5HNTA 1NVMA 4FX6M 1ZAIA 3BLFA 3OQ8A 1BYBA 1RVKA 5I03A 3AXMA 4LGXA 1KGUA 4F40A 4CNPA 2CWNA 3VIKA 1E56A 3TVAA 2HBVA 4DYKA 2FHFA 5E0KA 4DAIA 3QGAC 2HE8A 2QAFA 5TNVA 2XFRA 1EOMA 4CQ8A 2V5JA 1E9YB 3P5ZA 3EA1A 4HK6A 4JHOA 1R86A 4ZB2A 3VMNA 5FJUA 3LBOA 1XLIA 4WSKA 2GQAA 5DY2A 4XZNX 1FOBA 3QTGA 3W76A 1R5YA 3UI5A 2J8FA 1J6YA 3QF0A 4ZQMA 2YB4A 4GI6A 4IGMA 5DEZA 1QPLA 1EZ2A 3WMSA 2BWGA 2YDAA 3GC5A 3BJTA 2KO7A 4QE4A 4FN2A 3TAOA 4BQ4A 1SMAA 4FLOA 4A3RA 1TJ0A 4PCTA 7PTDA 3VNYA 4EWJA 1J96A 3GW0A 3VDHA 1G6CA 5D33A 4JQ1A 3GXFA 3A3WA 3KTSA 2D2HA 5DQPA 1S5VA 5F2MA 3LSCA 3OB8A 3SIMA 5K7JA 2QIWA 1W26A 1FKDA 3KTCA 2QJHA 1SM9A 3HQ1A 4C7FA 5DMLA 1CIUA 1GKRA 3UG8A 3ANUA 3QHNA 4HA3A 3BMVA 3VYLA 4J3WA 3B8TA 2BP1A 3KM8A 2ZZ3A 1KLYA 1UOKA 3HU7A 3OA5A 1E0WA 4H7CA 5CXPA 4BQ5A 2RQSA 4S3EA 2DT0A 3MUY1 3FX4A 2NV1A 2YB1A 3I7RA 3WLIA 1VEPA 1PE1A 3VZYA 4K1WA 2Q02A 3R94A 3VC5A 1CW2A 4MFEA 2OGYA 2BX7A 4PTMA 2Z1VA 3ARPA 1F3TA 5KSWA 4QBXA 1EEXA 1A5LC 3KAGA 5EYWA 4YVPA 3IVSA 1R9ZA 2PWUA 5I3GA 5C9XA 1FH7A 1YRRA 5JH1A 3GNDA 3MSGA 4TTUA 4LXFA 1M65A 4XUYA 3IK8A 1BSIA 1B3ZA 2MLYA 1VFUA 3CXOA 2ZOXA 1O12A 1OCQA 2GJXB 1GVSA 2CPUA 3DFNA 3LRKA 2PRLA 2NVCA 4JCLA 1MUWA 1U1UA 3JS3A 4FX8A 3GNPA 3FFSA 4QG8A 4YVXA 3CZGA 3W37A 4ACZB 2WC3A 4C1NA 3NZQA 5DX7A 3H22A 4MTVA 3UWWA 1XI3A 2QQ6A 4ZSTA 4EX4A 5LXEA 5LNWA 2DUXA 1TUXA 5LA2A 2OXNA 3CIVA 4XZIA 3VDAA 1ITQA 1MEHA 3F1QA 2F2DA 1X8FA 1JVWA 1W8GA 2J8GA 4Q4SA 1QNSA 3AMCA 4HQVA 4QNWA 4S38A 3LUTA 5IFTA 4GVFA 4J3UA 4TVUA 1R3YA 4NUWA 3QR3A 4O52A 4LNYA 1EC7A 2FPYA 3KOZA 1E6QM 4IGSA 1E4NA 4B3KA 5A8NA 4IMDA 3NGFA 5FJRA 3BTNA 3EMCA 3VNZA 3ITTA 3JXVA 4AG0A 2XVPA 4G6CA 3UWYA 2QZRA 2B7OA 1GONA 4QIBA 4A21A 4DWDA 4AAJA 3AI0A 3QQ0A 1WE5A 3M0YA 2P10A 3F4WA 1IE7C 4IHCA 2PDHA 3LXBA 2J4GA 3UXKA 1NWTA 1GYLA 5DMYA 1G4TA 1YYAA 4B5WA 3E38A 1M9HA 1WV2A 3O0FA 4XZHA 4HP5A 5K9XA 4DYJA 1YW1A 2A3BA 1V0KA 2WHKA 2CFFA 2Z26A 3DFYA 4HMEA 3SSJA 1AUSL 2G4FA 3KRSA 4FXFA 3STEA 1YXCA 4ADSA 3SCRA 3W4RA 1NFGA 3KVLA 1N8FA 3URBA 4RNFA 2F23A 1BYDA 1IZJA 2OZTA 3DUGA 3RO6A 3NA8A 5EPDA 4CNNA 3R10A 4MWAA 2PD5A 4HPJA 5K3VA 1TYGA 1Q4WA 2XM1A 4W85A 4Z2LA 5D2WA 4I7VA 1UKTA 2FVMA 3OYZA 4G56A 3V0UA 5I3DA 2AMGA 3M07A 3W1AA 1W54A 4DUWA 3NPXA 4PUKA 1W5QA 3GTNA 3GSMA 3UU0A 3HG2A 3P0WA 2EGZA 1QK2A 2J27A 2WZMA 4HIBA 3C0LA 3GFXA 2O7SA 4Q8PA 3PA7A 2IUZA 1H1YA 2Y63A 5G4EA 5BRQA 1DEDA 1FKWA 3UJSA 5M1TA 3P0XA 1Y0EA 3VCRA 3CYVA 5D4YA 4TX6A 4DWSA 1R9XA 5ABTA 1DQWA 3Q58A 2L5HA 1W9BM 3HN3A 2RHGA 1XIEA 5C7VA 2DSVA 3GDKA 4FO4A 4R9OA 3I68A 2POZA 4N6EA 1P7TB 2XPKA 3DGBA 1FWGC 3VI2A 2E5BA 3GNXA 3WF3A 3ZLGA 4NYUA 3WF4A 3HG3A 4GFSA 4FHAA 3WUGA 3PY2A 3K2GA 3W1MA 4E3VA 1JNEA 4PUEA 1MQPA 3FKRA 3VIFA 3M0MA 5K4XA 4JN6A 9CGTA 1W1IE 4IPIA 4K68A 2CESA 3VNJA 2INEA 1C7SA 4DY1A 2QVNA 1UQZA 4WZHA 1MW0A 4A3UA 3T0CA 1E73M 4O12A 1JUBA 4AIUA 3UZ5A 1CXIA 2A3EA 1OIMA 4PMQA 5CSRA 1XF0A 1OT1A 3ENLA 1P1XA 5KTLA 4LNCA 1KD0A 3R4IA 4K7YA 2ZE0A 4WGXA 3ABOA 4PTVA 3TQPA 4E4PA 2BGSA 1VGAA 1VJZA 1LBLA 2OOGA 1DIKA 3VZXA 3PRAA 2ZADA 4NU7A 1TE6A 4QJ5B 1IYXA 4OBRA 5F4SA 2XWDA 1XL9A 1QOQA 5CAHA 2H9AA 1RBLA 1OFBA 1VCGA 2V63A 2FZDA 3F4VA 5A3HA 8A3HA 5EMJA 3AAMA 2WPBA 1QPNA 3PJTA 1UHVA 3DU0A 3DHDA 2J6VA 1EA9C 4AZCA 4JTEA 1PPIA 1GZJA 4WK9A 2QJIA 3KCLA 3PUDA 1GOMA 5HJXA 4D6CA 3Q45A 2HS6A 3RRXA 4DZ3A 1L6FA 1WDRA 4C5YA 2CZ5A 1KQZA 5AC7A 2Z24A 4PTWA 3VNMA 3LNPA 1DIOA 4D6HA 3TZNA 1A50A 1LL7A 4U5IA 2VEMA 3ZM8A 2I17A 1HJVA 1VBJA 4J4OA 1DOSA 2IKIA 5BWAA 3IGSA 5PTDA 1C8XA 2CIPA 1FHUA 5DXXA 3B3DA 3QEZA 2GDQA 2C0AA 3DESA 2MLXA 4JPGA 1ZPTA 3AS0A 3NL5A 3RJYA 2PSNA 1SO5A 6A3HA 4IICA 4EP8C 4HCLA 3BXWA 5F1UA 3WLHA 4LTSA 1KR1A 2FTYA 3H70A 2YYTA 3M5VA 4FALA 1LT7A 1LZOA 5BMXA 4GQGA 4C6QA 2YCKX 3W1PA 1F8IA 1QNQA 3PR2A 4W8AA 4JTSA 5A8MA 4GQRA 3I7QA 3TN4A 3PG8A 4B2DD 3T78A 3TSMA 3EIPA 3RK8A 1S5MA 1Z69A 3N9KA 2WZIA 3DFPA 3PF3A 1TQJA 2VENA 2VEGA 4UR9A 5CG7A 3O5IA 1TMHA 3K4DA 3O1NA 3N73A 3W7OA 1A3HA 2KX9A 4G8TA 4Y9MA 1JZ4A 3SGGA 3F5JA 4JHMA 1OC5A 4CQDA 3LPGA 4DPPA 1XBVA 4IL0A 1WDDA 2Z2BA 1OFPA 2I5IA 3VOFA 4M24A 3BV7A 1ICQA 1W1VA 3SI9A 3KL0A 1WZAA 2J9ZA 1GHRA 3PJXA 1UKQA 1KT0A 3N29A 1RBOB 2CLEA 2BGNE 1W2VA 4C6PA 1SGJA 3TR2A 3KDNA 3W72A 2AOSA 3C2RA 4E5TA 4IQJA 1VFMA 4KRTA 2QEZA 3H7VA 1L6WA 2F2KA 2OFNA 3F5LA 2OZ8A 3D3FA 3DECA 3LU2A 4DN1A 1Q6LA 4IPJA 4UQCA 4FR1A 4NJIA 5JUVA 5I23A 2O7QA 1UB3A 3NOYA 1FWTA 1M41A 4M81A 1WOAA 1XM3A 3ZT5A 5HWMA 1BYCA 4OIFA 2QDEA 3E6EA 3TNOA 3KLKA 3N13A 4R7JA 1IGWA 4AISA 2NXGA 3U2CA 1JFHA 3BH4A 4XG1A 4KS0A 3L5MA 1VENA 3WNMA 4HYVA 4Z2IA 1S2TA 3N25A 1UZHA 2V8ZA 3M0JA 5AKQA 4AIEA 4OUIA 3DKLA 3LUOA 3W6MA 3H2EA 3RFAA 4EPBC 3LYEA 1D8CA 1GQNA 2Z1WA 3I4EA 3QR1A 3AMKA 3UP8A 4JFUA 2H3BA 5CC7A 1MUMA 1I2NA 3TYUA 2O55A 1W3TA 4JTKA 4GMEA 2V3FA 3V1PA 5E9XA 4EXAA 4YPJA 5J6EA 3C2OA 4LUJA 5D8WA 4Y8FA 2NVDA 1AL7A 5FACA 4IMFA 3G1XA 3ZO9A 1DYSA 4QLJA 3CC1A 4UNKA 3DDMA 4CNUA 1UROA 2QCGA 3N15A 1JI1A 3CQ0A 5E70A 2ISWA 1G4EA 4DJFA 1H0IA 2YCJA 4GA8A 2VL4A 4XAPA 1XX1A 3GDBA 1C90A 4DJDA 2GYIA 1DTUA 2WJFA 5CLWA 3QTPA 3GR4A 2DZBA 3UI6A 3UWEA 3KBVA 3QFWA 3U0HA 3OVQA 3DCPA 3B9NA 1OZQA 3I6TA 4JFWA 1ADOA 3QY6A 1F74A 5D09A 1HW6A 4XTIA 4LB3A 4HYRA 1JCNA 1RHCA 3IK2A 4O19A 3M0XA 3TCEA 4J28A 4KFPA 3VGFA 1T99A 4O1DA 2A2IA 1FHLA 4AD3A 2A85A 1R7AA 1L6YA 1XH1A 1OF6A 3WLPA 4O53A 3D5HA 1V79A 4HA1A 1JDDA 2B4GA 1WX0A 2GL5A 4YMZA 3OG2A 1ZLPA 4NX5A 4GFIA 4E0CA 2QDDA 4QZVB 4KGJA 3A5FA 3T7VA 2VFFA 4HCHA 3QY8A 1HIZA 1DPMA 4AZHA 3RGTA 2VRKA 1F8AB 2R82A 3ME3A 3PTQA 4XZLX 5CH9A 3WFAA 3LLDA 4MIMA 2JEPA 1N82A 1IHIA 3G1RA 2E6FA 4X0VA 3Q94A 2NSXA 1S1RA 1GZ1A 4MB1A 4QNEA 1OX5A 1DJGA 3DEQA 4XUGA 3G1FA 4DB7A 1T8XA 3M7SA 2YXGA 3TC5A 2D73A 3EPNA 4GZJA 4GHRA 1W1YA 1NEYA 1OGGA 3BAWA 1F5ZA 2DJLA 4RV3A 4DRNA 5D2TA 5CC3A 1DBTA 2J62A 2NX3A 1YQ2A 5HW8A 1YE4A 1OYCA 4DX3A 1TVNA 1KXHA 3LI1A 3OODA 1JFXA 1UYQA 2PLJA 2ZRXA 2GJXA 1AG1O 1K1DA 1U79A 2PODA 1GNXA 2WSQA 5E6YA 2JF7A 4DO5A 3IKDA 5JBEA 3W7QA 2BVDA 2W61A 3NM3A 1B3OA 3QPEA 5LGZA 5C2CA 1RP9A 3GDRA 1BEUA 4ACZA 1XDMA 2R14A 4JZ5A 4ROPA 1UR9A 5DO2A 5EB8A 1H63A 1HKVA 3CWNA 2XIIA 4MZYA 3IUHA 1WZLA 2RDTA 3CL6A 4F48A 3WY1A 4IPNB 1T8QA 2HVMA 3S2JA 2HZGA 4AWTA 1XISA 1TX0A 5H6HA 5A1AA 4I5RA 2QDHA 4Q4KA 5CPSA 3GTYX 3MPGA 3NQ7A 1OF8A 2HMCA 3RG6A 3KP0A 4F9JA 1M7XA 4N4PA 2OSWA 1XLAA 4GVGA 4OBSA 5A6SA 3FOKA 2ESCA 3F7JA 3QPYA 4JEQA 1CGWA 5HK4A 4H9VA 1OX6A 3GNOA 3QW3A 4XD5A 3R43A 4GLEA 4S1FA 1ZJAA 3W1QA 4LCRA 4E4FA 4J2MA 4RNIA 2O9TA 3RJXA 4XSMA 3W7JA 3O5PA 1QNVA 1EX1A 1TTPA 4EAYA 4LEFA 1JPDX 1AMKA 2Y61A 1F4HA 2Q8LA 3TXVA 4QDWA 1U33A 4H19A 3CQIA 1FHVA 5IDZA 5DANA 1WXJA 3ANYA 1TV7A 2R1PA 2X2GA 3S8HA 1A5AA 2INFA 5C54A 4C6DA 5GNZA 3GIPA 3PUOA 1FDZA 1BRLB 2FMNA 4URIA 4MKVA 1Q4NX 3NOEA 5A8OA 5LSMA 5E93A 1IT8A 4DZ2A 1UR2A 1J12A 4KF1A 2TODA 3EB4A 3QQ1A 2NQZA 3WMLA 3EY6A 4E8DA 2JBMA 3R0UA 3Q65A 1EUAA 5C6MA 3LLXA 2KR7A 3CASA 2ZE3A 3L0NA 5HR6A 2YYUA 4GC4A 4A8LA 4F0SA 3HB9A 3VKJA 1W5OA 5I07A 1PIIA 3TCSA 4C90A 3LSBA 1GTHA 2C1HA 2XSBA 2VFGA 3LI0A 3BAXA 4ZQCA 2PCEA 3BLPX 1VFOA 3GZAA 3K46A 1FFRA 4B3LA 4QHRA 3TWBA 1JPMA 3K1DA 1XLKA 1NY1A 4FNQA 3TV8A 2KE0A 1R7OA 4U3AA 2OWCA 3W2UA 3S1GA 4MNJA 3NL3A 4NJKA 2AWGA 1H3GA 3F2DA 4X61A 1X6UA 1LWHA 5DCBA 3TU9A 4TW6A 1FCVA 1K9EA 1VYSX 1J8VA 3BG5A 3ONBA 1LTDA 3M5XA 4JX5A 1ZJIA 5HQLA 3LRLA 4XK2A 2A4AA 4IPXA 2WM0A 1M7OA 1XLMA 3BGJA 4O0ZA 4Q4PA 4K8EA 5C70A 3ORWA 4EXBA 1P1MA 3SQSA 3ZJ6A 2V81A 4C5ZA 5LKYA 3U2EA 3RRAA 1BXBA 6ALDA 5F4XA 6XIAA 5HMEA 3WO8A 3OLIA 3PWAA 2PDYA 3KHDA 1DWHM 3CNYA 3NTYA 4WJXA 1EKOA 1DTNA 1R3VA 2MUCA 5E09A 1LWJA 1V6TA 2QULA 3B0YA 4R3UA 3KACA 4MG4A 4FLSA 3HQNA 3LXCA 3RX3A 1NWSA 2PGWA 2XP8A 1POJA 3B9EA 1JGMA 3W3OA 3WMBA 5DMNA 2DZWA 3W26A 4HPNA 1EJWC 1Q8AA 4C6NA 4F4RA 1LRTA 4B4FA 2YPIA 3PC0A 3AU2A 3SRKA 3O5GA 3GE7A 1UR8A 1PWMA 1QWGA 2RKXA 3VM5A 4REQB 1JZ6A 2VWSA 1VBRA 3TYAA 2HK1A 1ZS2A 3PPFA 4HNCA 1XRTA 3A3HA 1MW2A 4X2PA 2ABBA 1LL4A 2B7NA 4XTDA 3ZIZA 4QROA 1XH2A 4J3ZA 1JNTA 3B4UA 2V5CA 5AECA 5KITA 2IW0A 1V3MA 3LCGA 3OOBA 1TX2A 1EFZA 3NSMA 4WCJA 3TC3A 1QPKA 3NO3A 1O5XA 3L2LA 3V0SA 4AVOA 2ZX8A 3P67A 1TWSA 2E9MA 1JZ5A 1W0MA 3MUZ1 2PA6A 3BSGA 3BQ5A 3H2NA 2EJ1A 3WH5A 1HO1A 3FYYA 4PL1A 1HGWA 4O54A 1V4YA 4MSSA 5HJLA 4JTTA 3PBUA 2B31A 4DPQA 2YA0A 1BF2A 1KQYA 2V5LA 1U30A 3WJXA 3SRDA 3N11A 5HT1A 5FAGA 2OODA 4BS0A 2CYGA 3CV2A 4Q7NA 3ITGA 4LVGA 3SURA 3SCUA 4Q8MA 4CQ9A 1OQFA 1PTDA 5CBJA 4FNTA 3W25A 2ZUVA 1KBKA 1TPUA 4AD4A 3W00A 5CSYA 4MJMA 4E8CA 1Y65A 5FJJA 4DM2A 3W28A 1RCQA 4NG3A 4LUYA 4A3QA 1VH7A 4HPGA 2XG9A 3MP4A 4QS6A 2E6YA 4HJFA 5HJYA 3HZ3A 3TP4A 4D72A 2SFPA 2ZQTA 3NAVA 2EEXA 2WJEA 4ZCWA 4LBSA 3POCA 3B0XA 4JTHA 5CPTA 2V3EA 5C55A 2BMBA 3NQBA 3O63A 4N7QA 4MJ4A 3CU2A 3T6CA 1ADDA 2GVYA 4ITZA 5D02A 5M2FX 2CLHA 4GIVA 1JCYA 4FZIA 4IGNA 1UKPA 2P3EA 1OWQA 4KCWA 3U4FA 5C9ZA 4ZFCA 2J9YA 2XIJA 3I3EA 3CTLA 4G7EB 3VDGA 4DO7A 1KV5A 1PKYA 4DZIA 3T55A 4E2BA 1WXZA 1EJSC 4ATDA 4GIYA 1EJ7L 1JF6A 3ABXA 2QCCA 2RDWA 4IIGA 3IACA 4AUBA 1TPB1 1M5YA 4KT2A 2ACQA 2BY1A 1F9CA 3PZNA 3NSNA 3SUVA 1YHTA 1E4IA 1TPDA 3E96A 4H1ZA 4BQ2A 3VIJA 2CBIA 4RNJA 3QHMA 2GSHA 2Z2AA 3WFZA 4NKCA 1I9CB 5CJNA 2E8ZA 4BFAA 4ONVA 5A6AA 3WKZA 3SQLA 1EHNA 2C7FA 1XG3A 4LCQA 3SUUA 4BJHA 4IT4A 4YCOA 5J04A 1HT6A 4ZL1A 1BG9A 4H8VA 3QHOA 1JVNA 5HATA 4L6DA 2ZR4A 1TPC1 5C7HA 2CZFA 2QW5A 4H6EA 4GXWA 1RQBA 3UGVA 2CLMA 4UFHA 2XGZA 1FKTA 3KZ7A 1KRAC 3OVGA 4NP7A 1K6AA 4OOUA 4NF7A 1KM1A 1DJIA 3QM3A 1G69A 5IXEA 1V7YA 4IQDA 2WCGA 1E6SM 4J1OA 3OIXA 2J7EA 4C6CA 4DJDD 1YBQB 3NIYA 3NCOA 3PJWA 2X8RA 4LB4A 2WZHA 1F6YA 4TW8A 1NF0A 1K7FA 1S5TA 3M47A 3PSWA 1KTCA 2G96A 2XH7A 3N4AA 3NM1A 5CZ0A 3GW3A 1FHDA 2ZA1A 2VOMA 4G2DA 3CQJA 1JCJA 4WY0A 3C2EA 4TXEA 3EWXA 3B8UA 4NZ1A 3NO5A 3AC0A 4HNNA 2O9OA 1F3EA 2NSOA 2WWDA 4UTTC 1V77A 1GOIA 3V16A 4H41A 4JIHA 4ADUA 3KL3A 4ODLA 2WKGA 3MBDA 3GHRA 3P3BA 2BLEA 1C3FA 3O5LA 1Z7AA 1V3HA 2JALA 3JUGA 3E1F1 3QV9A 5C5YA 2XU2A 1JYXA 4HPHA 4R34A 5L6UA 3QSRA 3FLUA 4GCAA 1W9UA 1DIEA 1IXPA 5E0FA 4ZPVR 2WC7A 1LORA 4GUIA 1HKKA 4MDPA 1XYAA 2F21A 4GVIA 1ZJHA 4JIRA 3W6LA 4NNAA 3H4GA 3OLGA 4GNKB 4X2RA 1K4GA 1PKNA 1ZNNA 2YZ5A 1XYZA 4CUCA 5GPRA 1VYRA 4QAWA 4K38A 4H9ZA 2OO6A 3TMLA 1ISVA 1PZ3A 3P62A 2WKLA 1WBHA 3LPPA 1GVRA 3R0DA 2M1IA 3GBDA 4LU0A 1X97A 4G2PA 2ATMA 6XIMA 4GZEA 4W84A 2WMIB 4LV9A 4GYPA 1B4KA 2ACSA 1KCLA 3W83A 4K8GA 1CTNA 1OYBA 2BHYA 1SFSA 4AU0A 2EKCA 1Q85A 3KBSA 4GUFA 3UYIA 4JIIX 5H2ZA 1QBBA 2CHRA 2PGEA 1UD6A 3KZPA 3L4WA 3L2MA 1NDWA 4DBEA 4UQDA 2NWSA 3AYVA 2WB5A 4EAMA 1G67A 1ZP3A 1L2QA 4FA3A 4FIRA 1Z41A 4NZ4A 4O4WA 3W53A 3HG5A 3EDJA 1TIWA 2E5CA 3MUIA 2X0YA 3UQBA 3C3NA 4BZYA 2F6UA 4AEEA 3NUKA 1BAGA 2F2HA 4S2BA 3VA8A 3MA8A 4MB5A 1UD2A 1YDNA 4US6A 4Y9AA 1PVNA 3MJMA 4G50A 5G4HC 3THUA 4ODPA 4M8UA 3TIMA 4HU3A 1ZB5A 2A5HA 1IWBA 3AICA 5I00A 5LIYX 1SVDA 3LNMA 1CXKA 1K3UA 2VURA 3ES8A 1IWAA 5GQBA 1SW3A 2E09A 1R87A 1UWTA 3AS2A 3IRDA 4NZ3A 2VEKA 2A3CA 2CNCA 4W9OA 2DZAA 3PZUA 4RE0A 3GU1A 1HJQA 3KOXA 4MLRA 4AD2A 1DWFM 2J8TA 3VGDA 1V02A 1VBGA 1MQRA 1TV4A 3NJ3A 3RFWA 1I75A 3DKJA 1PBKA 2XH4A 1DL3A 4H2CA 4UTUA 4LYKA 1A0EA 3BANA 4YIWA 4LYRA 2CKRA 2R91A 4I9AA 1FKHA 4KFOA 4AWEA 4M5PA 1DXFA 3GXMA 1UASA 3SBFA 3LENA 4RZBA 1MXGA 2BDQA 3UR2A 2EPOA 4ICCX 3NZPA 3T0TA 2VEIA 4J3TA 2WPGA 3RN6A 4WQ6A 2CKSA 4QT2A 1JRCA 3SCSA 3VOGA 4BF7A 3UPBA 2F61A 3HMCA 3C52A 4DBSA 4GKLA 3PPHA 4LC8A 1KCZA 2A3AA 5CZTA 3DHPA 1R47A 1IT7A 2ABAA 1SZFA 4IJRA 1DE5A 4JTRA 3USZA 4IQEA 1BRLA 3DHFA 3LGEA 2ZBTA 4CU8A 5IBXA 2ZYFA 4KCUA 3RUBL 3HOJA 1L1PA 4LWWA 1L8PA 1KA9F 4GNVA 4JCMA 2HROA 3H4XA 3UEQA 1IR1A 4ICNA 2ZZ1A 3CB8A 4KH2A 2ZZ7A 1H41A 4KQNA 3UZJA 3AS3A 3NQMA 3WH6A 1XDLA 3KP1A 2J25A 1S3HA 2QUNA 5HQMA 3VD9A 2VEPA 5U7SA 3G24A 3QGVA 1P0EA 3GG0A 3B40A 3ITYA 1VLWA 4CCDA 1PEZA 2GK1B 5HBFA 5ABEA 8XIAA 1XLEA 4WF7A 3W9ZA 3SAZA 3WH9A 3LHYA 2CITA 3LTPA 3OEXA 3WF0A 3EWYA 3UR8A 1LLZA