1ZL1A

Crystal structure of the complex of signalling protein from sheep (sps-40) with a designed peptide trp-his-trp reveals significance of asn79 and trp191 in the complex formation
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Chitinase-3 like protein 1
publication title Crystal structure of the complex of signalling protein from sheep (SPS-40) with a designed peptide Trp-His-Trp reveals significance of Asn79 and Trp191 in the complex formation
rcsb
total genus 115
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2005-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1zl1A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1zl1A01
5D9MA 2W61A 1CGYA 3EDDA 3PTKA 1HKIA 3AS3A 4DWSD 5I79A 2EJ1A 1B3WA 2ZUTA 4GO9A 1ODUA 1WAWA 1CECA 1GOKA 4AD4A 1PX8A 1QNPA 4CGTA 2BY3A 2F2HA 2CITA 1ISYA 3AIRA 3MU7A 3WELA 4JIEA 3LPFA 4CVWA 4IPNB 1MW2A 4Q22A 4W93A 1NH6A 4NRSA 3GZAA 6TAAA 4AD0A 4WF7A 5DO8A 1UHVA 1V3HA 4W8LA 5ABHA 5HDRA 5I2UA 3D5HA 1CLXA 1JYVA 4Z2KA 4DUVA 1EH9A 1RP8A 1JZ4A 4CVUA 1PZ3A 4KWUA 1HJSA 5E0CA 3WDRA 1XH2A 2BHYA 1AMYA 1HF6A 1G5AA 4U5IA 4K68A 1E9LA 2PWFA 2WC3A 5FL1A 3AMKA 1KBKA 4UQBA 1E1EA 2W5FA 4AXNA 4MPKA 1XYFA 2PWEA 4JCMA 3VPLA 4HA1A 4MNMA 1OIFA 4JFWA 4PTMA 2GSJA 2D23A 2VT0A 3VIOA 1DEDA 1JNEA 3SIMA 3VDHA 4HPHA 2YLLA 3CGTA 4FLQA 5ABFA 3WNKA 1UKTA 2E9LA 3AICA 4OOUA 1UWRA 1V02E 5C71A 1BG9A 4JCLA 1LL4A 3UEQA 2YBTA 1XSJA 2G3IA 1WE5A 4ACZA 4ACZB 1VF8A 3DYOA 1EQPA 4C7DA 5CSUA 2VTFA 2DSKA 4UQ9A 1GOQA 4DUWA 3W6MA 2QF8A 2BY0A 1CGWA 1LLOA 1LL7A 2BV9A 2CNCA 1OT1A 5JIPA 2VCAA 4U33A 4GXPA 4KMQA 4S3JA 2YJQA 1M7XA 4E4PA 4W5UA 1UA7A 4W5ZA 3PHAA 3NDZA 3GH5A 2VR5A 3MSGA 2PBGA 1K9TA 4RL3A 2WMIA 1E5NA 1R87A 4M8UA 2O9PA 3AHYA 1GQLA 1W1TA 1WO2A 4CN4A 2VVNA 3CUIA 3S6TA 2VR4A 3RMEA 4MB3A 4CUCA 4AW7A 2CHOA 2J7GA 1CXEA 3WQ6A 1BYBA 1UG6A 1JGIA 2DSVA 5M03A 5GNYA 4DM2A 2VO5A 1WKYA 4H8UA 4EANA 5A8NA 2E4TA 3IANA 1UQZA 1NWSA 1JG9A 1ZBWA 2OSXA 5DF0A 2GFTA 1KR0A 3F5KA 1E6NA 2Y8KA 1E73M 1J0IA 4Z2HA 2CXGA 3MUIA 3RIKA 2FHCA 3N11A 4WKAA 5I23A 1MYRA 2FDMA 4U3CA 2YIHA 3BC9A 4IM4A 4PMXA 2HVMA 4LPCA 4AZCA 2CPUA 4DWSB 3VGDA 3THCA 2C0HA 2G3JA 3T2OA 2J8FA 4LX4A 2G3MA 1IZJA 4GI9A 2XFFA 2GJXA 4QLKA 4D1IA 3T0BA 4JZ5A 2UY3A 4UFKA 3WUEA 4QP0A 2VRKA 1UD2A 4P8WA 2CKRA 1E6ZA 4C7GA 1XYZA 3AS0A 3CHCA 1FOBA 1W3JA 1WP6A 3AZRA 4W86A 4AZGA 2OYKA 1V0NA 1E56A 1KWGA 4AD5A 4IUGA 1HJVA 2BXZA 1V08A 2E3ZA 2VJXA 1KCKA 4MDPA 2ZUNA 2D0HA 3B9EA 3ARXA 5M17A 4KGJA 3U7BA 2VX7A 1C93A 3MMUA 4B16A 4ZXLA 1OGBA 1PZ2A 1X6NA 1E4MM 4WKHA 3WDHA 2FHBA 1HIZA 3B9DA 4H04A 3AJ7A 4AC1X 4N0RA 3L4ZA 3ZT7A 4JFVA 3CMJA 1AQ0A 3LPGA 2DSUA 3AIUA 2YL9A 2W92A 5ABEA 1FFQA 2XVNA 5FIPA 3VO0A 4EK7A 5I5RA 1CBGA 3TTSA 4DM1A 1VRXA 4D6IA 3VD5A 2XSAA 4J3SA 4N42A 2TAAA 3L4TA 1JZ7A 3T09A 4F66A 3VDAA 5E09A 1FFRA 1GHSA 1P6WA 4ACYA 3N18A 1G0CA 2WVTA 4PMRA 4B15A 1H49A 1U30A 2CBVA 2ZX5A 2D1ZA 4JAWA 4D1JA 3FAXA 3W81A 2JIWA 4WSJA 3VD3A 1BYCA 1DWHM 3T0AA 1BVNP 2PB1A 2J7CA 1NWRA 3AIBA 1CENA 4MJ4A 3A47A 1UH3A 1TA3A 5JBDA 1TA3B 3IJ8A 3K1DA 3PZVA 1J0KA 1C7TA 3SUSA 4P8VA 1HNYA 3GDBA 5DFAA 1E70M 1GOIA 3ARTA 1UD5A 3FNDA 3NSMA 1QI2A 1DHKA 4TTUA 4D6EA 2XTKA 2BFGA 1N82A 1OD0A 1HP4A 2CBIA 3WDQA 3B8SA 1NQ6A 5A3HA 1W1PA 2YA1A 1DWFM 3UR7A 1X1NA 1XH0A 3VVGA 2XFYA 7CGTA 3K8MA 3WUBA 4AIOA 1E0VA 4B3LA 3ARQA 1BSIA 3MV01 3EDKA 4CKQA 2DIJA 5JBFA 3SCRA 4FF5A 3QR3A 4UOQA 2VZOA 5DT5A 5FOOA 2DH2A 3WENA 2WWDA 2FGZA 3LPOA 2WZEA 3N12A 2XUCA 4QFUA 3AFBA 4QCFA 3APGA 4R27A 4LQ1A 4PMYA 4GZEA 4L4PA 3ZSSA 2WXDM 3UERA 1GORA 3WBEA 2WVVB 4D6JA 3NSXA 4PCSA 1U33A 1OM0A 1J0YA 3WH8A 2WSKA 3ARVA 1WCGA 1WZAA 3AHZA 2E40A 1CXFA 3IJ9A 1DTUA 1MFVA 4ZFMA 1I1XA 3WD3A 2OYLA 4TTGA 1J0JA 3WF2A 1DWGM 5E9AA 1OD8A 5I77A 4BCEA 4BQ4A 2BHUA 1UWUA 1ZL1A 3VOCA 5HPCA 2J7BA 4FLSA 4TVUA 4U3AA 3M7SA 1BYDA 2ZXDA 3ZO9A 1MQRA 4HPGA 1B3YA 1E6XM 2VL4A 3VD7A 1JYWA 3UG5A 4HZ6A 1OGSA 4M80A 1JF6A 2V3DA 3ZJ7A 1S46A 3I3DA 3PZ9A 2IXUA 3DECA 3SUVA 2G41A 1UOKA 3NYDA 1B90A 4PMOA 2J75A 3W27A 3W37A 4MDOA 4NI3A 2QHAA 1JDCA 1JXJA 4QLLA 2PC8A 1UKQA 3GH7A 3BSGA 2WLZA 1BLIA 3OLIA 1ECEA 4PMQA 5D9OA 3SCTA 4JFTA 3N1AA 4RE4A 1JZ2A 3WMCA 3AIVA 1W9XA 5C70A 3ARPA 3CUHA 1JIBA 4E8DA 4J7RA 1UYQA 2VQUA 3BAIA 4W89A 2A3BA 2FH6A 1HVQA 3N17A 3WSUA 4W7VA 4JL1A 1CXHA 4OBSA 1CXKA 3AIWA 5I0DA 3WQ4A 4HA4A 1EXPA 4NF7A 1U2YA 1KFWA 4X9YA 2D0GA 5E70A 1W3HA 3QOMA 5CLTA 1D2KA 3TTYA 4NSBA 2J4GA 3AQUA 2JIEA 4JKMA 1VEPA 5LA2A 2ZX6A 2CHNA 1VEOA 1ZBVA 1G1YA 2WZIA 4WSKA 2O92A 4GI6A 5CG0A 2V3EA 4XUYA 1H2JA 3HN3A 5FKYA 2O9TA 3N15A 4PMZA 4JHZA 1J01A 3TTQA 4PBGA 3WH5A 4HU8A 3RM9A 2YL6A 3L4WA 3THDA 3BAYA 4Z2GA 4TXEA 3ECQA 3VUPA 3FHAA 4NZCA 5JH8A 4P7RA 3BSHA 1GOWA 4H8VA 2WMFA 1B3XA 3RCNA 1KB3A 1RP9A 3F5LA 1TZ7A 4CD5A 4HA3A 4J27A 2DIEA 2OWWA 1GNXA 2UY4A 2WHKA 2YA0A 5A2CA 3VIKA 2WYSA 3WL0A 3QHOA 4OBRA 4MADA 3W26A 1OB0A 3BH4A 5LA0A 3WQVA 5EMYA 1JAEA 3AS2A 1KGWA 3AI0A 3TP4A 1AVAA 4B9YA 3NJ3A 3AMDA 4CN6A 4GPNA 1XRVA 1ISVA 2NSXA 2V5DA 3I3BA 5JBEA 1FA2A 4URIA 5GPRA 1J10A 4BZYA 1G94A 4MNJA 4OJYA 1ISZA 1SMDA 3QGVA 4UFHA 1HVXA 3AMLA 3BCDA 4B3KA 1ZU8A 3W25A 3VMOA 1ZJAA 2WZHA 3L4YA 1RPKA 3D3AA 3BAKA 5JIWA 3O2LA 2CEQA 4OOZA 4PTXA 3ZT6A 5EFFA 3VIFA 4HTYA 4QCEA 1QNQA 1Z32X 4AEFA 1JZ6A 4JFUA 2GVYA 5A2BA 2E9BA 4AYSA 1QNSA 3OGVA 2VURA 1C3FA 4YPJA 2EEXA 2XWDA 2XYLA 1GQKA 1VFFA 4AD3A 1Q4NX 4MAZA 4BF7A 1ESWA 1GZJA 3KWXA 4BS0A 3RM4A 3VMNA 4F79A 1UD3A 1UR2A 2O9OA 3ARZA 3MKKA 1GJUA 2JALA 1JDDA 3MUY1 1H1NA 1ZB5A 2A3CA 1E1FA 2WVSA 1C8QA 1LWHA 4JHOA 1MW3A 4LYRA 2D3NA 3WD0A 4LYPA 1IZKA 3U57A 2GUYA 4FK9A 1CYGA 1JZ3A 2BY1A 4YHEA 4P7LA 5ABFB 4FLOA 1JFXA 1AQHA 2EPKX 5IXEA 1XC6A 1VBUA 2D0FA 1QHOA 3MO4A 1F4HA 5BXRA 1K6AA 2YOCA 1L0PA 4P8UA 3VGGA 1G9HA 2VZUA 3OLGA 5TD4A 5GNZA 3AXXA 2EPNA 5BYWA 5DEZA 3EMCA 4IISA 3FW6A 4P8XA 1BYAA 1TUXA 4U2YA 1VIWA 1WB0A 2VOTA 2JE8A 1PIGA 4E8CA 1R7AA 1JZ5A 1UWIA 2EBNA 2CETA 2WMIB 4KRUA 1YQ2A 4S3KA 1SR0A 3WNPA 5HXMA 4ZENA 4AZHA 5IHRA 2ZXQA 1E4LA 1M03A 3CHDA 3RJYA 2XVKA 4H8HA 3KL0A 3VMPA 1C92A 1DP0A 2ZUWA 2JFEX 5CPQA 1KWKA 3ARYA 3CZGA 1V6YA 1UR1A 1VFUA 2A3HA 3MV11 2XHYA 4AZ5A 4XV0A 4UQEA 1UKOA 3MANA 3DC0A 3T2QA 1QI4A 1GPFA 1HT6A 1EOMA 1MW1A 5A6SA 1MQPA 2QPUA 1J9YA 1UR8A 5D8WA 3PZOA 1MQQA 2BS9A 3AXIA 3PTMA 1VB9A 4AZCB 2YDSA 3GNPA 1UA3A 2GJRA 3WD1A 4PMUA 3DYMA 4MB1A 3W29A 1XV8A 1O6IA 5A6KA 5ABGA 1OBAA 4H41A 2XGIA 2JF6A 1UWQA 4CD7A 3VILA 1OIMA 3CUFA 1E40A 2WBKA 2GJXB 1TR1A 1XSKA 1TVNA 3AYRA 1ISXA 3OLEA 5E6ZA 1IT0A 1FH8A 1QW9A 1CZ1A 2G3NA 1W1VA 4LGXA 4BQ3A 3S2CA 1QI0A 5CPTA 4W8BA 4ATDA 5HOSA 3BGAA 2XPKA 3CUGA 3SUWA 5I3DA 1E0WA 2J79A 5A6MA 1BPLB 3RPMA 7A3HA 1H0GA 4J3XA 3ZR5A 1E0XA 5A2AA 3MMWA 1W9UA 1F4AA 3FN9A 2VRJA 1QHPA 1V0LA 4PSRA 4M56A 1GCYA 2J62A 5AC4A 4HU0A 3ZJ6A 4AZ6A 4QDMA 3WNOA 1ZJBA 4P7OA 3VNZA 3MMDA 1LJYA 4ZE5A 1R85A 1PAMA 3CLWA 2W4XA 3LMYA 1V0KA 3PZUA 3PZQA 3ARUA 3WKZA 1C7SA 3CZKA 2E9MA 3LPPA 3TA9A 2VVSA 2J77A 2YA2A 1HP5A 5HBFA 3MUAA 4PUDA 4PTVA 1WPCA 2EO7A 4D6DA 1PJ9A 2FGLA 2WKGA 3WDJA 3N04A 3POHA 1TE1A 3AZTA 2CCRA 4UTFA 2ZIDA 5A6LA 3TONA 1H0IA 3OB8A 4LXFA 2ZUSA 3W6LA 3KL3A 4D6GA 1QNRA 4PCTA 5CGMA 4KRTA 4OZOA 2ZXAA 2DT0A 1UR4A 1GONA 1W2VA 2PF0A 3ZIZA 1A47A 3POCA 5A8PA 5A95A 3WF0A 1MWOA 1LG1A 4UOZA 1GJWA 1J12A 2J7FA 1BQCA 2XM2A 4PN2A 3VX1A 4GQRA 4CD8A 3VDBA 3FXYA 5DMYA 1WDRA 1MVYA 2YL8A 3F5JA 3AYSA 3T2PA 1BGGA 1Q6FA 3EDEA 3I3EA 1GQJA 3GH4A 3CHEA 3SCUA 1HJXA 2WKLA 3AISA 2UWFA 1D7FA 2W62A 5M3WA 3GM8A 1E71M 3RM8A 1E6PA 4UZUA 4GKLA 4AISA 7TAAA 5A6AA 3FAWA 5A6BA 3GYCA 3WH6A 4PRWA 1EDGA 3VDCA 2WSPA 4M24A 4X0VA 4MAVA 1EHNA 3WF4A 3CZJA 5BWFA 1GQIA 4AZBA 5LYRA 4UCFA 1TG7A 2WMGA 2J47A 4A4AA 1W32A 1V3JA 3OBAA 5D4YA 4D72A 1JAKA 1E3ZA 3FHQA 1W9VA 2W63A 4RE3A 4HMDA 4AIUA 5BCAA 5FD0A 1CGXA 4YN5A 2DGAA 1QNOA 1V6XA 3L2MA 4BQ5A 1FP9A 2VZVA 3OG2A 4OKDA 3GTNA 3VU2A 2YDQA 1KBBA 2CIPA 4KGLA 3VGBA 1E3XA 4WK9A 1BG4A 5EBAA 2Q8XA 4AWEA 2EQDA 4CU6A 1EDQA 1DWAM 3WD4A 1Q6DA 3WEZA 1KQYA 4W7UA 3ZJ8A 2ZUMA 4KH2A 3CH9A 1GUVA 1B30A 2WCGA 3AIQA 4PYSA 3MSDA 4JKKA 1W2PA 1AQMA 1PX3A 2XFRA 5CGTA 2X8RA 1V03A 1B0IA 3BMVA 1ODZA 3AHVA 1ZBCA 2QV4A 4AY1A 3ARRA 1I1WA 3OZPA 2ZOXA 1CGVA 2RGMA 1OSEA 1XH1A 3WQ5A 1E6SM 2MANA 1VBRA 2WB5A 3EDFA 4J3WA 2OSWA 4W85A 5HPOA 4GO8A 5D9PA 1WDSA 1Q6CA 2Z1SA 2GDVA 1W1YA 2WBGA 5IFTA 1V6UA 4ZXOA 1J18A 4MJ2A 3WQWA 3WMBA 1GHRA 3DHUA 3MS8A 3GXMA 3BLKA 4M29A 2V5CA 3CBWA 4V28A 3ZT5A 4EKJA 1WNOA 5CJ5A 1PEZA 1XCXA 3K4AA 1KXQA 1NP0A 2YKKA 1OWQA 5LA1A 4AD1A 2YLAA 4BA0A 4W88A 1NWTA 4Z2LA 3G6LA 1V3MA 1W3KA 3ZSTA 2DSZA 1B31A 1OT2A 9CGTA 6A3HA 1VEMA 1M04A 2G8ZA 1JXKA 3W38A 3W0KA 1VFMA 2DSWA 2EPLX 1UD4A 1JD7A 3WMSA 1LL6A 4M1RA 5KEZA 3CPUA 3O9NA 4ML4A 3CZ8A 3SCNA 1TFVA 2WC4A 1JL8A 3AOFA 3SCQA 1HX0A 3WL1A 1JDAA 3EMZA 3K8KA 1QBAA 3OLDA 4GZIA 2E0PA 3WEMA 4D6CA 3GNOA 3GBEA 4HP5A 1GOMA 1TVPA 1EQCA 2D3LA 5M5DA 1HKMA 4CU8A 1H11A 3AROA 2WCAA 2YBUA 1JNDA 1JI2A 4NRRA 1B3VA 1KCLA 5BXSA 2D22A 3FY1A 1MXGA 3ZOAA 1C8XA 1KXVA 4ATWA 2DT3A 4U2ZA 4PMVA 3PZIA 1H41A 3GXFA 4A3HA 1ITCA 5AYIA 5CXPA 4MTVA 3CO4A 5E0FA 2WMJA 4UQAA 3CHFA 1JD9A 2F61A 1CIUA 3HMCA 8A3HA 2WW5A 3NSNA 3II1A 1NWUA 2Y24A 1J11A 2DQXA 2EXOA 3SCWA 3PZGA 4Y7EA 3SUUA 4L4OA 5EB8A 5JUVA 3AHTA 2ZX9A 2X05A 3SCSA 8CGTA 2VX5A 3VX0A 2DDXA 4MNKA 4AMCA 4ZE4A 3EYPA 1WZMA 2Z1KA 2XVLA 3VD4A 4HZ8A 2WWCA 3VIHA 4B9ZA 1XCWA 3ZMRA 4CN1A 3KE0A 1HJWA 3WQ8A 4GQQA 3ARSA 3F4VA 2VC9A 2W66A 1E15A 2ZWYA 1C8YA 2QPSA 4D71A 3BXWA 4UFMA 1QI3A 3WEOA 1CXLA 3W28A 1XHGA 3UCQA 2OSYA 2IXVA 5D9NA 3W4RA 2W67A 1LF1A 4GINA 1TMQA 1CTNA 3AIEA 1MFUA 1B2YA 3OGRA 3N9KA 3SCVA 4J3VA 1E4IA 4XZBA 1UD8A 5ECUA 3SUTA 4UOJA 2WMHA 1OINA 3TTOA 3GXDA 3VGEA 2B31A 1C91A 4D6FA 1QPKA 1FH7A 1PBGA 1CNVA 4PEEA 2BVTA 1H3GA 1UQYA 1KR1A 4RE2A 4AIEA 1QW8A 1H5VA 2ZUUA 3N13A 1G01A 3A4WA 4UNIA 2J78A 3AMGA 2NT1A 1HL9A 5HNNA 4MB4A 2ZICA 4OIFA 3RJXA 1PX4A 3WH9A 1R8LA 1UUQA 3VTRA 4EAMA 3WBAA 5A8MA 1NOWA 3QHMA 4UFLA 1E55A 1UR0A 3WIJA 2CBJA 2ZE0A 4FLRA 3ZR6A 3ALGA 4D6HA 2WAGA 5AC5A 4MNLA 4A3YA 3MUZ1 4HOWA 3WFZA 3GNRA 4WKFA 1BF2A 2XG9A 2J7DA 1XD1A 1XD0A 2O9RA 1K9EA 4IPLA 2W91A 3WFLA 1XGZA 4JFSA 5A6BD 4AZIA 3BCFA 3A4XA 2AMGA 2ESCA 3RDKA 5I24A 5AYBA 4X0NA 3WF3A 2DEPA 1JZ8A 3WNNA 1UWTA 4W87A 1US2A 2XIIA 2BXYA 2YL5A 2WHJA 4WJXA 1E4NA 1NOUA 1CEOA 1OGGA 2BVYA 5CQ1A 2X1IA 4DWSA 2UY5A 1QHZA 2BVDA 2WHMA 3VINA 3TOPA 3DYPA 3A3HA 1EOKA 4FMVA 3ALFA 1QBBA 1QVBA 1UD6A 5IFPA 4PMDA 1V6WA 1FHLA 1BHGA 2A3AA 3M46A 4TX8A 4MB5A 1B9ZA 3CMGA 2XSBA 1CXIA 4W84A 1EDTA 1V6VA 2DH3A 2YDRA 2NW0A 3UR8A 5I6SA 3ZQ9A 1W91A 3VM5A 4H7VA 1V02A 2VX6A 1EHAA 1SMAA 4JKLA 6CGTA 5A6JA 4Z2JA 3PBGA 4UQCA 2C8NA 4TVDA 1E6QM 2GK1A 3SURA 1Q6GA 5A1AA 2GK1B 4AD2A 5GQBA 1R7OA 1JFHA 4XB3A 1VAHA 2Y5EA 1E5JA 1HN1A 3CZLA 4C7FA 1SYTA 2V3GA 5AY7A 1W9PA 3W82A 2AAAA 4ZEPA 1W9BM 5BRPA 3L4XA 1W9DM 3VD9A 2D24A 1D3CA 4CU7A 2CBUA 3VNYA 3VIJA 2XWEA 1K9FA 1EGZA 4Z2IA 1WZLA 1HKJA 2EPMX 3ZJKA 2ZX7A 1KGUA 3WUFA 2PWHA 4R5EA 4CD4A 2FHFA 1KQZA 2DPEA 2FH8A 5CZKA 3K8LA 1VFOA 1CGUA 4P7NA 3ARWA 3SCPA 3CIVA 3B9AA 1KGXA 5C8BB 1A3HA 1W3LA 3W53A 4U5KA 4UFIA 1NM9A 4E2OA 3K46A 4JL2A 2PWGA 3AZSA 3KEHA 2OLHA 4DUXA 1UZ1A 1US3A 5A8OA 1ZS2A 1BVZA 3BAJA 3WNLA 1FHDA 4EE9A 3U5UA 2ZXBA 2VX4A 2V3FA 1GVYA 1UH4A 1V3KA 3L4UA 2J7EA 4CCDA 4W7WA 4J3TA 1J0ZA 2QMJA 4QAWA 4XX6A 5BROA 1C90A 4PMNA 1RH9A 4M81A 3CZEA 1WDPA 5BXPA 2F8QA 4GI8A 4AEEA 2X2YA 5BRQA 3EBVA 2UY2A 3GXIA 1EA9C 3QHNA 3A6OA 4TVCA 2Y8VA 5KZ6A 1BGAA 4XZWA 3VIGA 1CDGA 1XSIA 2C7FA 3O6AA 1EO5A 1KXTA 3IJ7A 4HMEA 3AS1A 1VJSA 1MXDA 2WM0A 1DWJM 3G6MA 2RGLA 2EPOA 3UG4A 3IK2A 4HOZA 1DWIM 2VI0A 4HZ7A 3PTQA 4UFJA 4V27A 3WY1A 1Q6EA 3E1F1 4GZJA 3U7VA 1NOFA 3WNMA 2D20A 2J25A 3SCOA 5IHSA 2GDUA 4Q7NA 3A4AA 1E72M 4BQ2A 4UZSA 3W24A 3ZM8A 2WK2A 1YHTA 2VUYA 2VRQA 4UQDA 2G4FA 2V38A 5DT7A 3K4DA 4QLJA 3CTTA 1CGTA 2DT1A 1PPIA 2WVVA 3VGFA 4OUEA 3NDYA 1UKSA 5F7UA 1CLVA 2X0HA 2D2OA 1M53A 3WF1A 1UZ4A 3GBDA 1QI5A 1V0MA 3NIYA 4J3UA 2WHLA 2WANA 1JF5A 1UH2A 5CLWA 2J8GA 3BLPX 4J28A 5A8QA 4PSPA 5IDIA 2WCSA 3AXHA 2XIBA 3BAXA 3VIMA 5A94A 2VMFA 2X0YA 1HJUA 3OIHA 2CYGA 4HMCA 1TCMA 3VIPA 3UETA 3T08A 1GW1A 1B3ZA 1K9DA 3NUKA 3KL5A 2ZWZA 2XM1A 1J0HA 2VCCA 1H4PA 2XVPA 1ZBKA 4PUEA 3VGHA 2E8YA 1BFNA 4YHGA 4TX6A 1ISWA 1JYXA 2J74A 1GOOA 3BMWA 1WZKA 1VENA 1O7AA 3WUGA 2WVUA 3AMCA 2ZX8A 4ATLA 2BHZA 3RO8A 3EDJA 4H2CA 2WLYA 2VZTA 3PN8A 1ITXA 2A3EA 2XJ7A 3M07A 1CPUA 4UR9A 1GVIA 2HISA 3WH7A 2PI6A 1WDQA 3AHXA 5BXTA 4U31A 3DHPA 2Y4SA 1LWJA 3RILA 1LG2A 3VM7A 1PIFA 4V2XA 4TUFA 3VIIA 2CKSA 5CPSA 2BY2A 3WN6A 2WC7A 4CCEA 3EMQA 1L8NA 1H09A 2XVGA 3PZNA 2JEPA 2VCBA 1UWSA 2J7HA 4AZ7A 3T0DA 2ZUVA 5I78A 4HOXA 2PWDA 1UKPA 1HJQA 3WD2A 3VKKA 1BTCA 1CWYA 1MW0A 2JF7A 3WDIA 1R86A 1JYNA 2CERA 3WDPP 4WIWA 2QLYA 3OZOA 2WMKA 1RD6A 1B1YA 3PZMA 1E6RA 3HU7A 3HJEA 4TOQA 5FL0A 1M01A 2GJPA 3BAWA 5EFDA 2E8ZA 1E43A 3UESA 3OA5A 2NT0A 1EO7A 5CSYA 3J7HA 2X09A 4DWSC 4P7QA 4GIAA 1JI1A 1OCQA 2CESA 4CCCA 5A69A 3M6DA 1EIBA 2OYMA 1LQ0A 1BAGA 1SFSA 2BNJA 3UG3A 4WLCA 1I75A 3CUJA 3OGSA 3IAPA 1FH9A 3U5YA 4F8XA 4PTWA 5D8ZA 2OWCA 2PBOA 2Y2WA 3QOKA 5FCZA 1NARA 1V3IA 4M82A 4CD6A 2VNCA 4W8AA 1VJZA 5GNXA 3L2LA 1UR9A 2WNWA 1Y7VA 3SEPA 2AOSA 2QMKA 5E6YA 4LYQA 4F9DA 4F9JA 3KZSA 2XGBA 1HKKA 2VQTA 2DT2A 1FP8A 2WPGA 1HXJA 1QOXA 1NP2A 3IAQA 3PZTA 3JUGA 3NCOA 1KXHA 1X6LA 1IV8A 2IUZA 2OWXA 2VZSA 2JEQA 1HL8A 3L4VA 1V3LA
chains in the Genus database with same CATH superfamily
1FKTA 1CGYA 3S6OA 3GFZA 1PDZA 2VEIA 1B3WA 3IRSA 2PRHA 1CECA 2CLPA 1GOKA 4AD4A 4CGTA 2Z6IA 5DELA 4P2VA 2OKOA 5C0QA 4OV4A 3LV5A 2ATMA 4M3PA 2GLKA 3MU7A 1H1ZA 1S1RA 3WELA 3W2KA 4IPIA 4Q22A 4W93A 4GABA 4GC4A 4NRSA 4GVIA 3QV7A 4UMCA 4LVFA 2ZZ4A 1CLXA 3RPDA 1JNSA 3H4GA 2PPPA 1FDJA 2C18A 3PSVA 4IIGA 5E0CA 1SJDA 3U4AA 2BHYA 1HF6A 1G5AA 4U5IA 4FX7A 4DLFA 2VEMA 1D3GA 3AMKA 2YDAA 1KBKA 1E1EA 2W5FA 3OP2A 1OIFA 2OEJA 2GSJA 3AJXA 5B80A 2VT0A 2FZBA 1DEDA 5AZ0A 3SIMA 3VDHA 1L6GA 3GZ3A 4HPHA 3GAKA 4NNAA 1ADDA 3NURA 4FLQA 3M47A 3WNKA 4YMZA 3FA5A 1UWRA 5D33A 1T96A 1KRCC 4U4MA 4JCLA 3T6CA 4YL2A 3BMXA 3SJNA 3DYOA 4J35A 2QNEA 4UIOA 3UQIA 1B6CA 4UQ9A 1GOQA 3W6MA 2MLZA 1CGWA 3NO3A 1LL7A 3E6EA 4NX5A 1XLMA 3U6WA 1Q7ZA 4XKMA 4GXPA 4ALDA 4KMQA 5TQLA 5C9RA 4W5UA 1UA7A 4PGLA 4O11A 3W1RA 3GQYA 2DORA 2E25A 1GQLA 3A4JA 1W1TA 3LU2A 2V69A 4HN4A 4K38A 3CUIA 3S6TA 1KKOA 2VR4A 3UI4A 4MB3A 2LJ4A 2I17A 2HSAA 3RF9A 4QS6A 2CHOA 2ZYFA 3T0CA 1UOZA 1BYBA 3ZVHB 1EX5A 1BRLA 3WBYA 2VO5A 5AFDA 1WKYA 5MKGB 2JKAA 1N8FA 3LNMA 4EANA 5A8NA 3IANA 1ZCCA 4S3EA 1YEYA 1JG9A 1ZBWA 2B7QA 3QY8A 3EY6A 2GFTA 3KOYA 3F5KA 2NXHA 4MWAC 3IIOA 4FXSA 3V75A 4Z2HA 2FHCA 4EVZA 4ZBCA 4JQ4A 2Q5AA 4ORIA 3PA7A 4IM4A 2VDHA 4AZCA 4C6IA 3VGDA 3PFMA 1X39A 2PPOA 3B0PA 3F4DA 3OODA 3LYEA 4UTWC 5HT1A 5FSEC 4J3ZA 2PGEA 3SN4A 2GJXA 3SAZA 1AL7A 1VHNA 3T0BA 4UTKA 1YATA 1T5AA 2X1TA 3LCHA 4LVDA 2ACUA 4OHQA 2XH7A 3PULA 3MA8A 5E5CA 4NZ5A 1W3JA 1RBAA 1WP6A 5IBXA 5LIXX 4W86A 2OYKA 1XLIA 3VOFA 1E56A 1OCJA 3H2AA 4IUOA 1BSLA 3L23A 4K6AA 3LQGA 2GGGA 2TRSA 4JDYA 2E3ZA 3MP3A 3KBWA 3HPXA 1KCKA 2ZUNA 3B9EA 1UUMA 5F2IA 4Y96A 4N4QA 4H9ZA 2VX7A 1C93A 1GW9A 1X6NA 2G97A 3WDHA 3QR0A 3B9DA 1LYXA 4AC1X 1EF3A 3ZT7A 4JFVA 3CMJA 1RK5A 4FOKA 3P3BA 4HNLA 2YL9A 4B5VA 1F3XA 2PDFA 5ABEA 4DRPA 3N73A 2XVNA 4IPPA 2ZRZA 4L9XA 5I5RA 3MO7A 4A29A 3TTSA 4DM1A 5E1QA 2REQB 4ZQRA 1P7TA 2XSAA 4UWMA 4J3SA 1EL3A 1EQ3A 4LAKA 2TAAA 1ZSXA 1S2AA 1UJPA 3VDAA 5E09A 5AC6A 1DJHA 3ZFHA 1H1YA 1GHSA 3USZA 2NVDA 4LUIA 1OYCA 3UF9A 4B15A 1H49A 3TR9A 3OW1A 5FJRA 3GHUA 4ERGA 4R88A 1DWHM 4XZ9A 3EXRA 2Y62A 3AIBA 1CENA 3A47A 1GJPA 4L6DA 5JBDA 5LKYA 3NNTA 3PZVA 4HBKA 1EZWA 3GDBA 2V0TA 1E70M 4JICA 2EHHA 4OVXA 4FF7A 1FDYA 3FNDA 3NSMA 1UPPA 4YTTA 1YYAA 1HP4A 3WDQA 4FB7A 1J4EA 1DWFM 5GJMA 4BF5A 1XH0A 3B7XA 1A3WA 3LERA 1NMVA 4AIOA 3ARQA 1FHUA 2PGFA 3GDRA 1U5JA 4FN2A 3GDKA 4LRTA 5FJUA 4UOQA 5G4WA 2A85A 2DH2A 2WPBA 5HR7A 2CFFA 2WWDA 1RALA 3GG1A 3LPOA 5J04A 5K7JA 3SW6A 3W2NA 1TO3A 3GPKA 4PMYA 3UP8A 3UERA 4NASA 5H2ZA 3GKFA 1B3OA 4XAFA 2QCGA 4IL2A 1VFHA 3WBEA 1U33A 1J0YA 2WSKA 3AHZA 2E40A 4KRZA 2YCLB 3HPAA 3TE9A 3WF2A 1DWGM 5E9AA 1FKLA 5K4ZA 4RPPA 5HPCA 4FLSA 1GG1A 5BRBA 3GW3A 3UY7A 2ZXDA 3ZO9A 1MQRA 1UBSA 2GGHA 4MSSA 3H53A 3UG5A 4WUIA 1QOPA 3N14A 4RXGA 2PDBA 1ZHAA 4M80A 4FO4A 3IARA 3QN3A 2C0AA 1JDEA 2IXUA 3DECA 2J75A 3W37A 1YE4A 3GIYA 3RCMA 4C90A 4DXKA 2XISA 3OVGA 1UKQA 1DVJA 3MWAA 4MFEA 2GVGA 4NNCA 1KV5A 3KXQA 1FWAC 3HGJA 1ECEA 1XIIA 4O14A 5D9OA 2PDXA 4DZ5A 1QUMA 2GSEA 1FKHA 4ZPTR 2PP1A 2Z24A 2OQHA 2RJGA 2YXGA 3LX9A 5KZMA 4ASTA 3T55A 3BAIA 4W89A 3MJMA 5REQA 1R9HA 3AU6A 3EIPA 2FH6A 1GKQA 1HVQA 3QQ1A 3KAFA 2I5QA 1CXHA 2V5BA 2ZQVA 4HKPA 1BKFA 3WQ4A 4QAIA 4GX8A 1OABA 5D38A 4YU1A 3I4EA 3QOMA 3TTYA 2C91A 1PINA 3M5YA 3BJSA 2PWVA 1ICPA 1VEPA 5LA2A 5D02A 1G1YA 5HWCA 2BWGA 5CSRA 4WSKA 4LV9A 3QGAC 2OQLA 4DF2A 1D7HA 3ZR4A 3DAQA 4Z0JA 3M0MA 1ZAHA 4OQVA 4D9PA 1W1IE 4HSHA 3JRKA 2VDGA 3E0WA 2XN0A 4HU8A 1LDCA 3L4WA 2ZQUA 3QVQA 3C8FA 5JH8A 5KTLA 4V1YA 1JCJA 3BSHA 4H8VA 3LV6A 3C6CA 1B3XA 1KB3A 4GUFA 1TZ7A 1X1ZA 1A5NC 1YTEA 2OWWA 1GNXA 4S3AA 2UY4A 2YA0A 5A2CA 3EZ4A 3S5OA 1NVMA 3K4WA 3W26A 1QK2A 4PULA 4QDPA 5LGZA 5EMYA 1ZLPA 4EAYA 4RJEA 1AVAA 1LOQA 1QR7A 1PCWA 4B9YA 4IJBA 3SGUA 4IFRA 1MEIA 4CN6A 1WAUA 5AZ1A 1XRVA 3BUVA 4BEQA 3FJ6A 3B03A 3I3BA 3UGRA 3KRZA 2CWNA 1YPIA 1J2BA 1J10A 3KX6A 2QQ6A 2C13A 1O94A 4IZGA 1Y0EA 3W74A 3W7QA 3BCDA 1CW2A 2W27A 1H5YA 3NOYA 3PBUA 2O7SA 3W25A 3L4YA 1VCFA 3QY6A 5AC7A 2QDDA 2O56A 5U4NA 4LS2A 3O5KA 3O2LA 3RPTA 1M5WA 3HV8A 1RJQA 1VPYA 1XYMA 5CBBA 4EXAA 4DAIA 4Z1AA 2DJXA 4ZQNA 2QAPA 2OO0A 3T1GA 1QNSA 2VURA 3ES8A 3O5PA 1DOSA 1SUXA 4ERIA 3H7UA 1FWWA 1Q4NX 4MAZA 4BF7A 4JNYA 3VMNA 1UD3A 3EWZA 3IGSA 3ARZA 2J9YA 3T9PA 2PC4A 1H1NA 1ZB5A 1C8QA 4LYRA 2D3NA 2B7NA 3WD0A 3M0JA 1LRQA 1IZKA 3MJYA 2GUYA 2B4GA 2BY1A 4YHEA 4P7LA 2BVWA 1QPQA 1P0EA 4WY0F 3MDWA 1JFXA 1XC6A 1VBUA 4LAUA 1G6CA 1F4HA 5BXRA 1OC6A 4G6CA 4EF8A 3AXXA 4JTDA 1QT1A 3B06A 1EC9A 4HCDA 3W1TA 1TUXA 1BWLA 3DFOA 4RX0A 1C9WA 1JZ5A 4MY8A 4AX6A 2EBNA 1LTDA 3KTSA 3UNTA 1SR0A 3V5CA 4GKTA 4LCRA 1B5TA 2X7WA 4MY9A 1P43A 3GXPA 4S3GA 1S39A 3PAJA 3RJYA 5LNUA 4EF9A 2XVKA 1XC4A 2R94A 1C92A 3G3MA 5DRCA 3IACA 1DP0A 1X97A 2ZUWA 1HUVA 4O50A 1VZWA 3CAQA 2QUVA 5CPQA 2RH9A 1KWKA 2NVCA 5DMMA 3C61A 1UR1A 2FZMA 2DZXA 2JQXA 3KS6A 1GPFA 2PDYA 2ZZ6A 3IIPA 4JTLA 1FKXA 4OU1A 3Q58A 1MQPA 1TV8A 6TIMA 4KS0A 1MQQA 3AXIA 4PFHA 1IR2A 3PNZA 4RK8A 4AZCB 4WVXA 1UA3A 2QKFA 3WD1A 3DYMA 2H9AA 1HZYA 5ABGA 1UWQA 2E5BA 3VILA 5F2MA 4JTQA 4JR5A 2GJXB 3KBJA 3U2CA 3UT0A 1TR1A 3GRIA 2DJLA 1IEVA 2PFHA 4O19A 1F8AB 1SR9A 2X0SA 5C2CA 1FH8A 1CZ1A 4AWUA 2G3NA 5DCEA 1KBJA 2VP8A 4GCXA 2YCEA 5JH2A 3EB4A 3UZJA 3R94A 3G1FA 3VNKA 3XINA 1RY8A 5HOSA 1IEQA 4ZO7A 4E38A 3BGAA 3WLIA 5I3DA 5G1TA 3USBA 1PCKA 3GVRA 1H0GA 2DW7A 2RKXA 2HWGA 2WJEA 5A2AA 4BWLA 1I4NA 5C9XA 3WLNA 1BXBA 4PSRA 3WJYA 1M3UA 4AZ6A 4QDMA 4P7OA 1RJPA 3BANA 3S46A 4C6PA 4GFSA 5I3KA 1A5OC 4ZE5A 3JS3A 3VFCA 1R85A 4DLMA 2XPBA 3G5EA 3ARUA 1XCFA 3WKZA 3LPPA 4S38A 4HQVA 2VVSA 1PHWA 4KEZA 3MUAA 5FJIA 1WPCA 4D6DA 1P7TB 3N04A 4IQEA 1WOAA 2CCRA 4YWSA 2ZIDA 3BTNA 4Q6JA 2ZUSA 1H50A 5C55A 4KRTA 3JR2A 3EGJA 2P0OA 5J5DA 4J4OA 1A47A 3POCA 1MWOA 1LG1A 5CPNA 1A7XA 2XP4A 2CC0A 2Y7DA 4AY8A 2CZFA 1GJWA 4QM1A 4XBJA 8RUCA 2P4VA 1SO5A 2Y89A 3GXTA 2DZVA 4PB3A 1P6BA 5AVNA 3FJLA 4CD8A 1WDRA 3A3WA 1MVYA 1QCWA 4S2CA 1Q6FA 4JGDA 5AN7A 3SCUA 4DYEA 3OZYA 1TTJA 1NDYA 4KWOA 1D7FA 2Q3RA 4GKLA 4AISA 4RDWA 5A6AA 3WH6A 4PRWA 3I6RA 3VDCA 4X0VA 1Z9AA 3T0TA 1GKPA 3WK3A 4H1ZA 3GKAA 3C3NA 5J8LA 4UCGA 4LT9A 4AZBA 1JVWA 2GYIA 2WMGA 4ICNA 3W2UA 3CTLA 1W32A 3H8AA 1V3JA 1G69A 3FHQA 4KEUA 4RE3A 4LEQA 3MI3A 4K7VA 4HN8A 5BCAA 1FWFC 3H21A 4AMAA 1DIKA 2DGAA 1QNOA 3IKDA 3OG2A 4OKDA 3E2RA 4I3GA 3DBNA 1OG0A 2CIPA 4KGLA 3VGBA 3M41A 4WK9A 4KCTA 1EDQA 2I9UA 4F0RA 3OVQA 1Q6DA 3CT2A 2MNRA 3TN4A 3ZJ8A 4KH2A 3CH9A 2PTXA 3O3RA 1GUVA 3KM8A 4IHCA 3RGCA 1TZZA 4LUTA 4IP5A 3RU6A 3TWBA 1REQA 3AIQA 4PYSA 2XFRA 4LWWA 2P53A 3BMVA 4WDUA 1O12A 5EGRA 1HW6A 4IQLA 4AY1A 3ARRA 4JDBA 1XIEA 2I16A 3MBFA 2ZOXA 1CGVA 2FMNA 1U79A 3RCYA 3BGJA 2DV0A 3EDFA 3G1XA 5HPOA 4TU1A 1P0DA 1Q85A 1Y5WA 2WNZA 3CM4A 1XJBA 1WDSA 1Q6CA 1AD4A 1XKJA 1W1YA 2WBGA 4C6QA 1V6UA 2ISDA 1PO9A 1X38A 3IIZA 3DHUA 4WX2A 5REQB 3QV9A 3GXMA 2D9FA 3DG7A 4K1GA 2V5CA 2FMOA 2P88A 3KRSA 5CJ5A 2A0NA 2E6FA 3CAWA 2YKKA 1OWQA 4IP7A 5D30A 4AD1A 2V81A 1AD1A 3P61A 4N6FA 1EEPA 2A1YA 2BXVA 1KM0A 3EPMA 1EYEA 2ISWA 1S5MA 3MB9A 2G8ZA 1P5BA 1OFDA 5FJJA 1K4HA 2QDGA 3LMZA 4LANA 3UNDA 4HCHA 2Y63A 4J2PA 3PWAA 4HJWA 1QO5A 2CLKA 4HYWA 3EWBX 3I6CA 3BDKA 1R3VA 3HG3A 3W7CA 3UZYA 2WC4A 1QK0A 3W7MA 2Y61A 1HX0A 1ROTA 3O15A 3BL3A 3EMZA 1MUWA 4PTNA 3GNOA 2XFWA 3GBEA 4LUJA 3BSMA 1TWZA 1EA0A 5M5DA 4CU8A 1RD5A 1VBHA 3NGJA 2WCAA 1TV7A 3EWWA 1KCLA 1AH3A 1S5VA 1N8IA 3LI1A 5FF0A 4PZVA 4GNKB 4U2ZA 1LORA 1H41A 1LBLA 3PUDA 5CXPA 4MTVA 3CO4A 1TTIA 3BZGA 3LBCA 2WMJA 5E93A 3LHTA 4UTHA 3TJXA 4IT1A 1NF0A 4RXFA 4LU0A 3NSNA 4E6MA 1NWUA 1J11A 3H54A 5IM51 3PZGA 2JGYA 3SUUA 4LAOA 4L4OA 4NYUA 4QJ4B 4Q4RA 3FOKA 4H9MA 4DJDA 4MNKA 1Q4WA 4KEVA 4AMCA 2NUWA 3HTWA 4IH3A 3AWNA 1XLFA 2XVLA 4TMBA 3KAGA 2EG8A 3VIHA 3IIXA 4QNWA 2OMAA 1HJWA 1KBIA 4EOUA 2QVNA 4M5PA 2ZWYA 1C8YA 1BD0A 2VGBA 4D71A 1S2VA 1F74A 2FQIA 3M0XA 3BXWA 3NRKA 3WEOA 1XHGA 3ONCA 5XIAA 2EF9A 3HGSA 4DIPA 2OSYA 3OU8A 5D9NA 3W4RA 2W67A 5C9ZA 4GINA 4RNJA 3IS4A 1RBOB 1O5QA 1IX5A 4L3NA 3N9KA 4J3VA 1E4IA 3GU1A 1UD8A 5ECUA 3RLGA 3SR7A 2WMHA 1OINA 3TTOA 3VGEA 1EEXA 5HANA 2B31A 3G1VA 4O1CA 3ABOA 1C91A 1PBGA 3NFUA 4PEEA 5BXJA 1UQYA 1KR1A 2XP9A 2QS8A 4IMDA 4AIEA 2ACSA 1H5VA 4H9YA 1SPQA 5HJLA 2QJMA 2J78A 3O16A 2NT1A 1HL9A 5I7GA 2UZ5A 2QIWA 4IGSA 2P8BA 4GK8A 2E77A 4BI5A 3WH9A 1R8LA 5LHEA 1XLJA 1FWGC 2PDJA 3WBAA 3PB0A 1NOWA 4UFLA 2A7RA 2CBJA 3ZR6A 3EPOA 4D6HA 1GYNA 3WLTA 4MNLA 4B4HA 3ATZA 4M51A 4TYOA 3OYXA 5JVLA 4XZNX 2XG9A 1IWBA 2J7DA 1XD1A 1M9HA 1XD0A 3S2MA 1RVKA 3WFLA 4XISA 4BEUA 3R10A 3UXIA 3W1QA 1SFJA 2R6OA 3RDKA 5AYBA 4X0NA 2YSWA 1UWTA 3L0GA 2H9AB 2BXYA 4C6MA 4HSNA 1SZGA 1YDNA 3KHJA 5D2WA 4DNHA 2WHJA 4WJXA 3LLXA 4W4QA 1E4NA 2J9XA 5EPDA 1CEOA 1JJKA 4ZSTA 4NJHA 4FXJA 2HNEA 4DWSA 2XH2A 2PD5A 1XBXA 3TOPA 2EJAA 1EOKA 1UD6A 4PMDA 3EXSA 1FHLA 4ZPWR 2C19A 2WQDA 1BHGA 1Y5XA 1I60A 1V6VA 2DH3A 2YDRA 4LCQA 4GACA 4GXMA 4YVPA 6CGTA 3PBGA 4UQCA 1T0OA 2PF8A 1RBLA 4QQUA 4F0KA 3CHVA 4NILA 2ZC8A 4IIEA 2Z7GA 4GYPC 2HBXA 1JFHA 4IP4A 5KZEA 2Z1BA 3EKLA 2Y5EA 2AQOA 1QPNA 1PBKA 4PA8A 2KX9A 2XDFA 1W9PA 2AAAA 3CEUA 4DRKA 2DZTA 1D3CA 3IK4A 1NF7A 3QZEA 1K9FA 4R33A 3EAUA 4G50A 1WZLA 1V93A 1HKJA 5CEWA 2FHFA 1NIUA 3VNIA 2DPEA 3WJSA 1VFOA 1CGUA 4GUHA 1EJRC 3SCPA 3CIVA 2BLEA 2WM1A 3NO5A 2CLFA 4U5KA 1QFEA 4RW3A 5F1UA 4E2OA 3APTA 3LTSA 3P0WA 4XTDA 4PL2A 3NAVA 2QCNA 1FHDA 5DMLA 2VX4A 1GVYA 4ITZA 3BV7A 3R43A 2QEZA 3L4UA 4Z08A 2OEKA 4E2BA 1WQ5A 4EPEC 4ZMGA 1J0ZA 2QMJA 3DU0A 1R3QA 2IPFA 2VOMA 2VN1A 1OC7A 1EBHA 3QSRA 3CZEA 5DXXA 5BXPA 4GI8A 3PBVA 1XBVA 2DZAA 5BRQA 4GG9A 1WOBA 4FOJA 1BQGA 4QQ3A 4O57A 5E9XA 5D75A 1XIBA 2GOUA 3R0KA 2EG6A 3VIGA 1RCOB 4LW7A 1DKWA 2AMXA 1KXTA 1LCOA 4HMEA 1XLEA 3IUDA 2W3ZA 2WM0A 1DWJM 3G6MA 1NY1A 2RGLA 5LZLA 1RR2A 4HZ7A 4ZODA 4CQ8A 3C2RA 5FEXA 3U7VA 2D20A 3BLFA 4Q7NA 3A4AA 4K8GA 1TJ2A 4Z42C 4CQ9A 3F1QA 2V2CA 5DT7A 3V7PA 1OADA 5FJPA 3FS2A 2IKIA 1A5LC 1JULA 4E3VA 3IUIA 2D2OA 1QI5A 4HYRA 2GUUA 5D2YA 3NIYA 1KM2A 4JIIX 2WHLA 2WANA 1DIDA 4LUTB 1Q6LA 5CZSA 1OC5A 2YXOA 5CLWA 1REQB 3UWQA 4FI4A 1TWWA 3BW2A 3M0VA 4RCXA 1DJIA 3ABRA 1CB7B 5B7YA 4O2TA 5CKSA 4MWAA 4EPDC 1TCMA 3DEQA 3VIPA 3UETA 3MY9A 5GJNA 3N2OA 1AQFA 1EJUC 4O1FA 3NUKA 2A3LA 2POTA 4C6FA 1J0HA 1VLIA 4N7QA 1SJBA 3TH6A 1OFPA 4AHQA 3LS9A 5HWJA 1J96A 2ASHA 2E8YA 4N02A 1OHLA 1SZFA 4UTWA 4PCFA 3TUUA 1LBMA 1WZKA 2ZRVA 3NOEA 3AMCA 2ZX8A 5HTGA 3FYYA 2A3EA 1F8IA 1U5VA 1CPUA 2RJHA 1DE5A 1DV7A 4UR9A 4U31A 1K03A 2Y4SA 3N2MA 3T8LA 1EIXA 3VM7A 2QUNA 4GVGA 1K70A 4TUFA 3VIIA 1FWRA 3S1UA 2BY2A 3IWPA 1TPB1 3QKEA 2B5UB 1L8NA 3TC5A 2XVGA 3T4CA 1JCYA 2JEPA 4IWWA 2ZUVA 3ITOA 4G7EA 4DF0A 3A24A 2VCDA 3TW6A 3GXNA 1CWYA 3PC0A 3EWCA 2O7QA 1R86A 3G1YA 2ZDSA 1S2WA 4WIWA 2WNQA 2BX7A 3PF3A 4RR4A 4A8NA 3PZMA 1S2CA 1D7IA 5FL0A 4TIMA 3ITTA 2GJPA 2VGGA 5EFDA 1PSCA 3OA5A 4INFA 4YVXA 2J24A 4JTRA 3I7SA 5CSYA 4Z0SA 5KSWA 4GIAA 3G1AA 1IT7A 2CESA 1Q6IA 5A69A 3GWQA 3M6DA 4GUGA 1SFSA 2BNJA 1I75A 3IGUA 3WLRA 3RLUA 3CUJA 1QO2A 3UXLA 3IAPA 3B40A 1VYPX 3RHGA 4PTWA 5D8ZA 1TWIA 5DCBA 2HBVA 2R24A 4XWUA 3QPZA 4K8EA 5HW7A 3VKCA 4I9AA 1VJZA 3GHSA 1J6PA 2ZZ7A 1UR9A 2WNWA 2PDUA 3OYZA 3FV9A 3GTFA 1IWAA 2VQTA 3IV8A 1HXJA 1QOXA 1NP2A 1JR1A 1OG6A 1WX0A 2FYMA 3NCOA 1K02A 1X6LA 1XIGA 1IV8A 4GNJA 2OWXA 4RDVA 2JEQA 1HL8A 2D73A 1TX2A 3KOWA 2EKGA 2C15A 5C6MA 1YTDA 2W61A 1IQ8A 1NELA 1W54A 1GG0A 1S3TC 1HKIA 1IT8A 1U1HA 2ZUTA 4LY4A 1WAWA 3K13A 3KVKA 5BMWA 2D2JA 1PX8A 4XAKA 5JQ9A 1W3NA 4NNRA 5FSDC 3T7VA 2F2HA 1UZHA 5HMSA 1ISYA 1A5BA 1GVOA 3G1RA 5F2GA 4JIEA 3O0KA 3ANUA 1OFOA 4IPNB 1NH6A 4Y9PA 3KRBA 3CV1A 3R8GA 4AD0A 6TAAA 4HPNA 3NQ6A 1UHVA 1Y5VA 1EBGA 1Z69A 4G5DA 4IGHA 1F7BA 4Z2KA 4B92A 2PLJA 1EH9A 3FVDA 4CVUA 4HNUA 1HJSA 3EOOA 3WDRA 1AMYA 1LBFA 2HE5A 1KM6A 4K68A 2WC3A 3LLFA 4NJKA 4MPKA 5DXYA 1XYFA 3VPLA 3E02A 4KCWA 5A8GA 4JFWA 3UG8A 2QDHA 2BTMA 4JTIA 4L6OA 4DVOA 2TPSA 1C8VA 1F61A 3CGTA 3IJQA 1UKTA 2KE0A 2E9LA 1X96A 2QJIA 2O4MA 5HWNA 1A4MA 2PLMA 2C79A 1XSJA 1IXQA 4ADSA 3VKBA 3U2OA 1VPQA 4ACZB 1RXOB 1AZ1A 4LAXA 4QRNA 1EQPA 3BG3A 4NU7A 3LOTA 2VTFA 3N6HA 1JCTA 1F3WA 4GWEA 4QS5A 2BV9A 2XH4A 2CNCA 2PD9A 1Y8BA 4S1FA 4E4PA 3NI6A 1F2JA 3GUWA 3PHAA 2VR5A 3MSGA 1MI3A 4RL3A 1E5NA 1TELA 4QGCA 1YNPA 3AHYA 1WO2A 4CN4A 4LC8A 3F2CA 4DZ3A 3FKKA 4MF4A 4RDYA 2GQ3A 5EU9A 4RZ5A 1UG6A 1I45A 3REQA 3C2FA 3HQPA 5GNYA 4GXWA 3QSTA 4RE0A 3W23A 2IQDA 1UQZA 2FGBA 4X63A 3FA4A 3DFYA 1KR0A 3QQ0A 3ZLFA 1E6NA 2Y8KA 2RUCA 4IQ2A 4V33A 1LQAA 3O5OA 2FDMA 4U3CA 4X61A 4LPCA 1K7FA 1XWYA 1M5YA 1Q7QA 4DWSB 1ADOA 2C0HA 2B7PA 3GIQA 2VC6A 5CZ0A 3KAHA 1Z3NA 1IZJA 4JTUA 1ELSA 5HMDA 3QRHA 4D1IA 3FEMA 2PRLA 4JZ5A 2VFDA 4UFKA 4O0KA 4US5D 3EXTA 2VRKA 2KO7A 4DF1A 4P8WA 4B5WA 3H70A 4C7GA 5LNVA 1XYZA 3AS0A 3TXZA 1JRBA 3TC7A 1KTCA 3UQAA 4AZGA 3UXAA 1RY0A 4AD5A 1H63A 1H60A 4IUGA 3BG5A 1FCVA 3ICJA 1V08A 4J4KA 4LF1A 2D0HA 2RAGA 5M17A 5JMUA 4JD4A 4KGJA 3MMUA 3R1ZA 1MMFA 3I4KA 4HPXA 2FHBA 1HIZA 3VZZA 2XN1A 2ONEA 1JUBA 3LPGA 4WJEA 2WJFA 3QXBA 4NJGA 2DSUA 2W92A 4N2YA 1TPC1 5SWUA 1VCGA 4DAFA 2E1WA 5I3FA 4EK7A 5DIVA 2LGOA 4D6IA 5HULA 3VD5A 5BWAA 1DQXA 3BOXA 3CLMA 3GG0A 3NEHA 2C6QA 1JZ7A 1NSGA 2ZRWA 4J40A 2A5HA 3T09A 4X22A 5BU9A 1ITQA 4BR1A 3S2JA 2DQWA 3N18A 3W86A 4UTIA 3GG7A 4UTLA 2ZX5A 3GO2A 1FKIA 2QUMA 4WSJA 5AHFA 3EB3A 1BYCA 2OG9A 6ENLA 3LSBA 3T0AA 1BVNP 4N19A 4HA0A 3H26A 5DANA 4MJ4A 1JPKA 3NA8A 1TA3B 4IQJA 2WNNA 1C7TA 3SUSA 1A0EA 2IKHA 4P8VA 2RQSA 1HNYA 1JPMA 1GOIA 3L66A 3ARTA 1UD5A 1QI2A 1L6WA 1ZY9A 2XTKA 1JUEA 2BFGA 2CBIA 1OD0A 2PPNA 3B8SA 4XO6A 4P61A 1W1PA 2YA1A 4AFYA 3UR7A 3DFQA 1L1PA 1PKYA 7CGTA 3E2SA 1EWEA 3S5SA 5D03A 4B3LA 3MV01 1YNYA 3FLUA 4CKQA 4H9VA 4FF5A 5I09A 3UI6A 3BZJA 3KLKA 5DT5A 5FOOA 1TWSA 4XKYA 4BFAA 2WZEA 2XUCA 3ABQA 3BARA 4QCFA 3APGA 4WJ8A 1DJYA 7TIMA 4R27A 4BI7A 3KCOA 4DT4A 3NG3A 4WDWA 4PCSA 2ZA1A 5EYWA 1RSCA 4Y9NA 4A8RA 1WCGA 1F40A 3VAWA 1YXCA 1WZAA 4WGHA 1DTUA 1ZP4A 4U10A 4G1KA 3BVJA 2E5CA 4NKCA 4E8GA 1MNZA 1F3TA 3C0SA 1YBQA 1ZL1A 1HKVA 2J7BA 5KITA 3O06A 3QPEA 3OTRA 4MWAB 4PUJA 4HPGA 1E6XM 2VL4A 3C0QA 1OFAA 4BF8A 3PRDA 5FF3A 3U2ZA 1JF6A 1FY6A 2V3DA 1S46A 3I3DA 3PZ9A 3SUVA 2G41A 1UOKA 1B90A 3DBPA 5LIWX 3W27A 1JPIA 1I6NA 4Q8QA 4HGXA 1KFCA 3STFA 4AIBA 4R9XA 3D0CA 3RK8A 3S2LA 1R5YA 2WLZA 4PMQA 1HXVA 3SCTA 5EMMA 1W9XA 1VH7A 5F1VA 4ROQA 3HBLA 1UYQA 4J7RA 4GH1A 2VQUA 4DI9A 4DRIA 3CK5A 4JYFA 5K9CA 3WSUA 2ACRA 3ES7A 4JL1A 4FX6M 4KEMA 3VZYA 4OBSA 1CXKA 4G7EB 3H2CA 1WXYA 2OX1A 5I0DA 4HA4A 3UZWA 3ANYA 3G1DA 3JYMA 2CW6A 2FVLA 1XLDA 1SJCA 1XM3A 1SO3A 3W83A 1W3HA 1FVPA 1D2KA 3KBSA 1W5OA 4NSBA 2J4GA 1H51A 3AQUA 3RFAA 1OZQA 3CXOA 1YPFA 2CHNA 1VEOA 4TW8A 3ITLA 4DY1A 3FKRA 1IYXA 2P50A 2V3EA 3N15A 1XIMA 3BWWA 1J01A 3TTQA 3WQEA 3M5XA 1S1PA 3PFRA 1LP6A 4C02B 2YL6A 4IPXA 3SGZA 4U86A 3C5QA 2NV9A 1J6OA 4JTJA 4Z2GA 4TXEA 3LHUA 2Z27A 3VUPA 1ZJHA 3FHAA 3ERPA 3S8HA 4P7RA 2VWTA 2ZCGA 5HNUA 1LRNA 3GFXA 2WMFA 2Y7FA 2GVLA 3T44A 1RP9A 3VUSA 4CD5A 3FVMA 1XINA 2HE8A 4FNPA 3VIKA 2VEFA 2WYSA 2AGTA 3WL0A 3QHOA 4I90A 2M1IA 1I2PA 4OBRA 1OB0A 3TLLA 4DJED 3TYDA 3BOLA 2Q6ZA 5DY3A 4YWIA 3UWZA 4PODA 1I2OA 3AUOA 2NSXA 3TW7A 4PCPA 4DB7A 5JBEA 2R91A 3P84A 5HA7A 4URIA 4JY9A 5GPRA 3S0CA 1G94A 4U85A 3DKLA 1VBGA 3UGVA 4UFHA 1OYBA 4HU3A 4JTGA 5KMYA 3NQGA 4B3KA 4ZO8A 4KIRA 3O5RA 3FJNA 3G0SA 3W2JA 4XBKA 1ZU8A 4QITA 2WZHA 2Y6ZA 3VOJA 1RPKA 4HK5A 4ZFCA 3JXVA 1F76A 5LSMA 2J88A 1TWDA 3IEBA 3P8IA 1WYIA 3AO0A 4XBSA 3VNMA 4HTYA 2FJUB 3G1SA 1XRFA 1SO6A 2GPTA 4QCEA 3QZAA 3SIZA 4M6QA 4AEFA 1DE6A 1R0MA 3N4FA 4JFUA 3E2VA 2C1HA 4JYEA 4JIQA 3G3DA 3DCPA 3VNJA 1THFD 2XWDA 2XYLA 1EJTC 1GQKA 4AD3A 4ZO9A 1ESWA 1GZJA 3KWXA 4BS0A 3RM4A 4F79A 2QGYA 3QBUA 4YJ5A 5KINA 5G5IA 2JALA 3ORWA 3MUY1 3MW7A 1TE6A 3L12A 5GPGA 1DORA 2A2IA 2A3CA 1E1FA 3AXMA 2GQAA 1MW3A 3D47A 1EJWC 4LYPA 4I7VA 4FK9A 4A35A 1JZ3A 3B0UX 1UASA 4FLOA 4FNTA 4PRRA 3SQLA 9RUBA 1FWDC 2EPKX 3TFCA 2VM8A 2D0FA 3CUZA 1XG4A 1K6AA 2YOCA 3EOUA 4LAZA 3OLGA 4WZHA 4L80A 1PS9A 3BV4A 2W9MA 5BYWA 2HMCA 3SFKA 2Y70A 1BYAA 2PS2A 4U2YA 1VIWA 2PTDA 5HWBA 5B8IC 1PIGA 3DOPA 3RX3A 3NPXA 4KRUA 1MZHA 1YQ2A 1EX1A 4JTAA 3TSBA 5FJOA 3G0XA 4AZHA 2ALDA 1Q7MA 1XRSA 1E4LA 3CHDA 5I98A 4H7ZA 4RZ6A 1KTNA 3KL0A 3REQB 2VD8A 3VMPA 2Q01A 5EMLA 1M41A 2JFEX 3FYPA 4JFIA 2CLHA 5CZJA 1UKOA 3MANA 4H2HA 3O5DA 5I07A 2DG4A 3T2QA 1DBTA 1QI4A 1HT6A 4RLIA 1MW1A 5DY2A 1J4HA 1POKA 1Y65A 1V51A 3OOBA 3MUXA 1XYCA 5D8WA 1V8EA 3PZOA 3OVRA 3QGKC 3PTMA 1YW1A 3QY7A 3E3HA 4RUBA 1XV8A 3LDVA 5A6KA 4BK9A 4BY3A 3RLVA 2WBKA 3T4WA 1XGDA 4UDMA 3P62A 1XSKA 3OEXA 2VEGA 2PTWA 2DZPA 2PODA 1ISXA 3O5IA 3TAOA 5C9UA 3S5YA 2VFHA 5E6ZA 1W56A 3W73A 4YTSA 1QW9A 1EP3A 4UBPC 4BQ3A 1TB3A 4XUGA 3LXBA 5CPTA 4W8BA 1XYBA 4ATDA 4UMAA 1GVRA 3QZ6A 1R3TA 1S2TA 3LTPA 4H01A 2ZKMX 2WKJA 1JQVA 3CUGA 4M7TA 3SUWA 3TDBA 1BPLB 3A21A 1E0XA 3STGA 3MMWA 3UWYA 1F4AA 2VRJA 4DYKA 2NSOA 2ALRA 3MCOA 4Y8EA 1GCYA 4N9BA 2J62A 3S1WA 2FZ9A 3T78A 5FACA 4GBDA 3CQJA 2IW0A 4A8IA 1B57A 4Z1YA 2OKTA 1V0KA 1OK4A 3PZUA 3AWOA 3CZKA 4LVBA 3TA9A 2FVKA 5CSSA 4QT2A 5HBFA 5EMKA 4PUDA 3VFLA 3HZ3A 4PTVA 4GA8A 3LB0A 2EO7A 4ADUA 4ODLA 1V7YA 2EPHA 2GDQA 3POHA 1YXYA 1TE1A 1W1B1 1TIMA 1H0IA 1D3HA 3S9IA 5CC5A 4OZOA 5CGMA 2OOGA 1O68A 1GONA 2PF0A 3ZIZA 5CAKA 3LI0A 3B0VC 1H7OA 4UOZA 1XUZA 3GAYA 2J7FA 3B3DA 3YPIA 4KIEA 1KNWA 3I10A 4L61A 4PN2A 2CU0A 4UTTC 4YIWA 3THQA 3VX1A 4PUWA 5DMYA 3GDLA 3CL7A 3AYSA 3T2PA 1EC7A 1BGGA 1HKWA 1GQJA 2QXWA 2TSYA 5KZDA 3CQ0A 2VFEA 3GK0A 3GH4A 4G1NA 2WKLA 3UPBA 4EACA 1HGWA 3GM8A 4NG3A 1E71M 1E6PA 4UZUA 7TAAA 3FAWA 5A6BA 3WQFA 3H9RB 4M24A 4MAVA 3NPUA 1EHNA 3WF4A 5BWFA 1GRJA 5LYRA 3B8IA 1TZ9A 2OGJA 4M6UA 2J47A 4A4AA 1OQFA 4XKYB 4ZR8A 5D4YA 4D72A 2AL2A 1TUFA 4AIUA 3LY0A 5FD0A 3T40A 4B2DD 2MPHA 1ZJIA 1V6XA 3L2MA 1WDWA 1FP9A 1HTIA 2X1SA 2ZQ0A 3QFWA 3GE7A 3H7RA 3O07A 2VZVA 2V30A 3O7UA 4FNSA 2ZQTA 2GVEA 4CEXC 1XRTA 4NZ3A 3P0XA 4PMJA 1L2UA 1KO0A 2Q8XA 1YBQB 2J6VA 1RAKA 3WD4A 2FAPA 2WZTA 4KT2A 3GNXA 2X2GA 2ZUMA 4G2PA 4XAYA 1MZRA 3KOXA 1UP2A 2OELA 2WCGA 1JQXA 3HJZA 3MSDA 5FJTA 3CMFA 2X8RA 3PJXA 1AW1A 1ODZA 3DKJA 3E0FA 5K4XA 2NQZA 1G4SA 3JZEA 8XIMA 2Z2BA 4CNSA 1I1WA 3TV8A 4K8HA 1JCMP 2J9ZA 3ENLA 3I7RA 1P6CA 2MANA 2WB5A 1PZ0A 4GY7A 1QATA 1SSGA 1AMKA 5HUAA 1L6YA 2PE4A 2D2HA 1TPWA 1ME8A 3WQWA 1ZNNA 4QISA 3FSUA 1TYGA 4GYJA 3V3WA 3BLKA 4M29A 3CBWA 4V28A 4EKJA 3BGGA 1O5KA 1WNOA 1XCXA 3K4AA 4GYPA 3UJRA 5LA1A 1XKYA 2B81A 1KTBA 4BA0A 3G6LA 3QC0A 1KT0A 5FESA 1W3KA 2NV1A 5RUBA 3SRHA 9CGTA 4ODKA 1VEMA 1FKBA 1GT8A 2EPLX 1UD4A 1VJIA 1HO4A 1JD7A 5CAHA 2DUXA 3SQMA 4AQLA 4M1RA 5CZTA 3UZZA 3CPUA 2Y5SA 4KFPA 3KW3A 3SCNA 4S3DA 1XYAA 4WD0A 1FWNA 1JL8A 4DYJA 4FR1A 1CB2A 3CYJA 4BF9A 3IVUA 2FFIA 2WQPA 1KFLA 4FALA 3WEMA 4D6CA 4HP5A 4RV3A 3WLJA 2D3LA 1HKMA 5LNSA 3IUHA 1O1HA 3EWYA 1HG3A 4MZYA 5BXSA 2D22A 3FY1A 1MXGA 1KXVA 4ATWA 1BWVA 1EB3A 1RCQA 3BLLA 2DT3A 1XX1A 3W76A 3GXFA 3VI2A 1ITCA 4A3HA 3H55A 5HUPA 4ZQPA 1O4UA 3CHFA 1XLCA 3IPWA 1CIUA 1PTDA 2V63A 2WW5A 3GNDA 1RVGA 3PR9A 2UBPC 1OZMA 5EL1A 2DQXA 2EXOA 3GDTA 4ONVA 3A9IA 1TV5A 2PLCA 4I5RA 5EB8A 1J79A 4C6EA 2ZX9A 4DEFA 3CL8A 4XVEA 3LGDA 5CPLA 4YXGA 3E0IA 4PEKA 4NJJA 4ODMA 2OOFA 4DBWA 3ABZA 4PL1A 1OF6A 4O18A 4BHYA 2WJZA 3WQ8A 4GQQA 3F4VA 2VC9A 1OF8A 2W66A 1E15A 1TCOC 2HS8A 2QPSA 5D2XA 2HK1A 1Q66A 2WO5A 4UFMA 2Z25A 1CXLA 1UIOA 3UCQA 1Q8AA 4JPGA 3H4WA 3KAOA 3AIEA 3TVAA 3OGRA 3PPHA 3QF0A 3IRDA 4ERAA 3GTXA 3DGBA 4PUKA 4HK6A 3SUTA 1XPYA 4TX9A 3R7MA 4DELA 4IJRA 2P5NA 3GXDA 3F2DA 4JTSA 3D46A 3GHRA 1JPDX 2FJKA 2ZZ1A 5EBUA 1QPKA 1FH7A 4MSPA 3GDMA 3IHZA 3HGRA 3SRFA 1O5XA 1Q6QA 1A0DA 1QW8A 4NYYA 3N13A 3BJTA 2CZVA 3A4WA 4UNIA 1UP3A 3TYBA 3L68A 4MB4A 2ZICA 4OIFA 1X7IA 2BP1A 2V5JA 1H61A 2G37A 1IGWA 4Z1DA 3U2EA 3RX4A 3AALA 1PV8A 3QHMA 1E55A 4PBEA 2WAGA 2FZDA 3MDYB 3MUZ1 4FHAA 4HOWA 4LS1A 3F4NA 2O9RA 2YYUA 2TYSA 1CLKA 1U5HA 4JFSA 3VXGA 3TROA 4AZIA 5FAGA 3GNNA 2ZRYA 3QV6A 4C1NA 2KGJA 3D6NA 1NJJA 2R8WA 2QDEA 3R79A 2X1UA 3W2LA 2XIIA 4S3CA 1FHVA 5HATA 2NX1A 3UYIA 2DVUA 1OGGA 3CB3A 5CQ1A 2UY5A 1BTMA 2GGJA 1PZ1A 1QHZA 2WHMA 1A50A 1LRTA 2O55A 1QVBA 2HJPA 5IFPA 3LLDA 1KFBA 2PDMA 1V6WA 2OVLA 1POJA 2IPGA 3M46A 4TX8A 1H7XA 2XSBA 4W84A 1TR9A 1FKGA 4H7VA 1SMAA 4YNGA 4Z2JA 4TVDA 2GK1A 3SURA 5GQBA 4ZQMA 4IMEA 3WMLA 3EKZA 4XB3A 2NLIA 2PU0A 4AHOA 2VKZG 1E5JA 3GC5A 3H24A 3NEVA 1SQ7A 2GJNA 4B91A 3P2VA 4QG8A 4F0SA 5AY7A 3W82A 4ZEPA 4J4NA 5BRPA 3L4XA 3DFTA 4QIBA 2D24A 1YTKA 3EB2A 1DQWA 4K36A 2Y1HA 3O5GA 3Q2DA 3SRKA 4TQTA 4Q4PA 2XWEA 2PV3A 4Z2IA 3QMRA 5CCZA 1P0BA 2EPMX 2ZX7A 2PWHA 2R1KA 1KQZA 2FH8A 5CZKA 4JNZA 3ARWA 5TNVA 4RKAA 1ICQA 1KGXA 2PCQA 4RPQA 1NFBA 1ZAIA 2VHLA 1W3LA 1K8YA 3W00A 5I00A 4D8AA 3CWNA 5AVHA 3QC3A 1TKKA 3FSTA 3UCDA 3MMTA 1UMLA 4DUXA 3KAIA 1UB3A 5A8OA 1BVZA 2QW5A 3BAJA 1NQKA 1XLLA 3R4IA 5AECA 1M65A 3GTIA 4HTBA 2J7EA 3HQNA 2QJJA 3CWHA 2ZZ5A 3M0KA 4REQA 2ABBA 3DX5A 4MM1A 1NTHA 4R0XA 1VD6A 5C7VA 4XIAA 4ZCWA 1C90A 4PMNA 3L5LA 3HGOA 1RH9A 3PJWA 4F2BA 4M81A 3MP4A 4ZB0A 2DG3A 2X2YA 1AFSA 3B0XA 4RZBA 1SW7A 4H8NA 3EWXA 3GXIA 3GLCA 4PE8A 4WR3A 3WYZA 3A6OA 3BG9A 2Y8VA 3UZ5A 4TVCA 4XZWA 1CDGA 1QWKA 2Z1WA 1W37A 1XSIA 1MUMA 1EO5A 3C2OA 2AL2B 4KQNA 3IJ6A 2ODOA 5CBJA 1KBLA 4D8ZA 4KCUA 3IK2A 1FRBA 1DWIM 4UFJA 1Q6EA 3JZUA 3W85A 3ONBA 3WNMA 2J25A 3SCOA 1TPH1 2Y5JA 1LM1A 5CBIA 4AU0A 4G7FA 4POCA 3W24A 3W7HA 1ECQA 3TXVA 2WK2A 1YHTA 1Q3NA 2VRQA 2G4FA 5D37A 1M6JA 2KI3A 1AH4A 1XR2A 2DT1A 1PPIA 1TPFA 1V7AA 3RR1A 4UTJA 2WVVA 4FIRA 4OUEA 3H6OA 5C54A 2PDQA 1CLVA 2PTZA 3SSJA 1M53A 3DN5A 2HRWA 1ROUA 1UZ4A 2W0UA 3GBDA 3URAA 3M64A 3OG3A 4HK7A 4L65A 2EAWA 4ICMA 3UYCA 2VD9A 1AUSL 2KZHA 1TVLA 3N2XA 2J8GA 3BLPX 4J28A 4DWDA 4FXRA 3RFWA 3M4HA 5BU6A 1R46A 5A8QA 4FAMA 4PSPA 4K37A 1BF6A 3VIMA 4AF0A 1XLGA 2CYGA 4NJIA 4XD5A 3B0YA 4JTFA 1K8XA 2PWUA 6XIMA 4JX6A 1B3ZA 1K9DA 1MUCA 3KL5A 3PWGA 1H4PA 1TQJA 4PUEA 3VGHA 3LUTA 1BFNA 3DI1A 4IX2A 4TX6A 4BI6A 3W1LA 1JYXA 1RK6A 4GD0A 5T9BG 2BHZA 3V0SA 2GQ9A 4H2CA 2WLYA 2VZTA 4GQ0A 3N9RA 1ITXA 4Q8OA 2XJ7A 3C52A 3M07A 1GVIA 3WH7A 1WDQA 5BXTA 3NTPA 3HV9A 5H8PA 4DHGA 4HT3A 2EULA 2Z1VA 1SM9A 3VZXA 3WN6A 3KACA 4XO7A 2WC7A 4CCEA 1KCZA 3PZNA 2VCBA 2WSYA 3MZ2A 1UWSA 1PTAA 3T0DA 1ZRQA 1UKPA 3VKKA 1O95A 3WDIA 2CERA 3WDPP 4NI8A 4F0MA 3OZOA 2P76A 4LAMA 1E6RA 2IQTA 3BAWA 2E8ZA 5AHNA 1EP2A 4QJ3B 4WOQA 2NT0A 1EO7A 2H90A 3W9ZA 4IPJA 2FKEA 4JHMA 4M19A 4P7QA 2QCHA 3SO7A 4WQ6A 1T40A 3IV3A 2OYMA 4RV8A 1LQ0A 1BAGA 1TJ1A 5JH1A 4Q4SA 5HUOA 4WLCA 1YDYA 3QR1A 1OFQA 4TNSA 1W5NA 2CLOA 5CJMA 1B4KA 3C2YA 2PBOA 4UB9A 1T8QA 2ICSA 4LJ3A 4WGXA 1AH0A 2ZDRA 4DJFD 3QOKA 4HVXA 4QE5A 2BOEX 4M82A 1DJZA 5GNXA 4MLJA 1KA9F 1XYLA 2BOFX 3SEPA 2QMKA 5E6YA 4XZHA 4F9JA 1TREA 4X3ZA 2WPGA 4YTRA 4GUJA 3IAQA 1RJRA 3PZTA 1UIPA 1KXHA 3HB9A 2IKJA 3HA1A 2IUZA 3ZZ1A 2PZ0A 4XZMX 1OVDA 4N9EA 2MLXA 1T8XA 3Q67A 4GIVA 4FS9A 3M0IA 1US0A 3NWRA 3AYVA 1V3LA 4XZLX 2PDPA 3TN5A 5D9MA 2L5HA 4KQZA 3GR4A 1DJQA 3EDDA 2OQYA 7ODCA 3GU0A 3R8RA 2HROA 5I79A 3QYQA 4QEEA 2EJ1A 4GO9A 1ODUA 3ANVA 2XP8A 2BY3A 1GOXA 1IHIA 4B3ZA 4C65A 2OJPA 3AIRA 3O05A 3CS2A 2Q8LA 3LPFA 4CVWA 4MUZA 4J1OA 2YR1A 2INFA 3M16A 2BDQA 2IPWA 3NM3A 1A4LA 3GZAA 4YLWA 4WF7A 5DO8A 3HM7A 5HDRA 2XSXA 3D5HA 1MEWA 1JYVA 1KFKA 2R9RA 4GFIA 4DUVA 1JZ4A 2DFAA 2G4JA 1DJGA 1BL4A 3BO9A 2GOKA 4H19A 1D8WA 1XH2A 1TIWA 3LTYA 4O0QA 2PWFA 5FL1A 2OZTA 4QHRA 1IXNA 3GC4A 4IF2A 4AXNA 4JCMA 1ENUA 4H6RA 1IXPA 4PTMA 5AKQA 2D23A 1JNEA 4J9JA 1OFRA 4DRQA 1FKKA 2YLLA 2NV2A 3N2TA 3QFEA 1V02E 3FXGA 3WQPA 5C71A 1X98A 1LL4A 3W1NA 2Q3OA 4FA3A 3ME3A 1WKDA 5H91A 1VF8A 3TCZA 3TC6A 1U1UA 3APYA 2QF8A 4IMGA 4DBEA 4HD5A 2BY0A 3KBMA 4X2RA 4A3RA 1OT1A 3WLPA 1UBPC 3IVTA 3W88A 1VCVA 3M0ZA 2DW6A 1Z7AA 4S3JA 2YJQA 3B4UA 5EMJA 3NDZA 1K9TA 5D04C 1MDLA 2O9PA 2LKNA 3MI2A 4DJFA 2VVNA 3UFYA 2OT0A 3RMEA 3O5FA 2WZMA 4S2BA 4CUCA 1IZCA 2R1LA 2J7GA 1CXEA 3WQ6A 4IGMA 1JGIA 2DSVA 1LROA 4Q8NA 1J4RA 4DM2A 4KWVA 4LEFA 1BRLB 1AODA 2CLEA 4GJJA 4ODQA 1XQLA 2E4TA 4I5XA 4LUSA 1NWSA 3EA3A 3RNDA 4C1NB 2OSXA 5DF0A 3ITXA 4DNMA 5BZAA 4HHMA 3NQEA 2OT1A 4GVHA 1J0IA 3VK5A 3MUIA 2OGYA 3VCCA 3EWUA 5I23A 3E9AA 1MYRA 3GW0A 4A8LA 3BC9A 4PMXA 2HVMA 3W7EA 4KFOA 3SB0A 5K9DA 1FJDA 4ZL1A 2CPUA 3MYPA 3AUJA 3S6DA 3THCA 3T2OA 2J8FA 4LAWA 4OWGA 4UNLA 4C5ZA 4LX4A 2G3MA 4KW2A 4GI9A 1XUUA 2Z6JA 2WOQA 2UY3A 4LV4A 3R5EA 2C3ZA 3WUEA 1GYMA 3FAPA 4QP0A 1UD2A 2OEMA 4MYXA 2HTMA 4DZ2A 4XSLA 3GTYX 1E6ZA 1FOBA 2PSNA 3KCLA 1FKWA 1KWGA 3L9CA 3A22A 1EFZA 2F4EA 2ZTKA 4L4LA 2R1NA 1TV3A 2VJXA 5I3GA 4MDPA 3GR8A 3ARXA 3PP7A 4Z17A 4XAGA 3T05A 3U7BA 4ZXLA 1PZ2A 1E4MM 1T99A 2IS7A 4H04A 4N0RA 2UZ9A 2Z28A 3L4ZA 5C7HA 4ECLA 4K39A 3C86A 1V6TA 3AIUA 2W79A 1J2WA 4LFYA 3G8EA 1PXGA 2E28A 2CXEA 3VO0A 4DBSA 1RLCL 2C14A 3V36A 3DHFA 5IDZA 4N42A 1X7FA 5M1TA 4Y9AA 2KFWA 2F38A 4WOZA 3WQGA 2DZWA 3W70A 3U4FA 3NXFA 5LHFA 3MSRA 2ZBTA 4CNOA 3GHTA 3TW9A 2HXTA 2WVTA 4PMRA 4REQB 1U30A 4JQ2A 4D1JA 3FAXA 2PGRA 3I68A 4AHPA 2F23A 3O6DA 4LSBA 2J7CA 5DBTA 3DDMA 4OECA 1UH3A 5CPOA 1ML1A 1I0BA 1W3IA 1GGOA 1J0KA 3K1DA 5HMEA 4LS0A 3VE7A 1Q45A 1DHKA 2PBCA 2DUAA 5DITA 3ISIX 4D6EA 4Q32A 1YX1A 4I5UA 3LZ3A 1NQ6A 4HJFA 5A3HA 1KM5A 3G0UA 5CGQA 2XFYA 1O66A 2TMDA 3WUBA 4NL1A 4QDWA 7XIMA 3EDKA 3C8NA 2DIJA 4FNRA 3VKJA 5HMFA 3SCRA 4V1XA 1FWHC 1RQHA 4JEJA 2I7GA 3QR3A 3F2BA 3P93A 2VZOA 1DXFA 3WENA 2FGZA 3N12A 4HIBA 3MYOA 3Q4DA 1VGAA 4QFUA 3AFBA 2PDHA 3P8JA 1JPHA 4LQ1A 1K8CA 4L4PA 3ZSSA 2WXDM 3CB8A 4MIMA 1W1A1 3P5YA 1GORA 4JQ3A 2WVVB 4D6JA 3NSXA 3EWDA 1JDFA 3IK8A 3I65A 4F2TA 3ARVA 1ZZMA 1OFBA 1CXFA 3IJ9A 2PP3A 3P80A 3UA3A 4I8DA 2I56A 2V68A 4QEHA 2OYLA 3WD3A 3NO1A 4TTGA 1DPMA 3S5NA 1OD8A 5I77A 4BCEA 4HSOA 1AL8A 1UWUA 3SECA 3DGRA 4TVUA 4AF0B 4U3AA 3M7SA 3U0HA 1AZ2A 1PKLA 3PANA 9XIAA 1B3YA 3URNA 1JYWA 5LGXA 3UWUA 1ONEA 2PP0A 2XIOA 1QZ2A 4IQDA 1FQ0A 3SY8A 3NYZA 2PDLA 3EX3A 3OZMA 3QMSA 3NYDA 4PMOA 3VE9A 4US6A 2DIKA 4EP8C 4QLLA 4ZGYA 2PC8A 3BQ6A 3GH7A 4H83A 1K7XA 4IMFA 1PWLA 1BLIA 2PZNA 4DROA 4JFTA 3N1AA 4RE4A 1JZ2A 3WMCA 4WRHA 4H7CA 3CUHA 4UC5A 1JIBA 4YCPA 4JBRA 3V0UA 4DRNA 3FK4A 3UI5A 2A3BA 1D8CA 4LC6A 1ONWA 1EXBA 3R0DA 3N17A 4W7VA 2HDJA 5FF4A 2RUSA 3AIWA 4OE7A 4FIQA 4DJEC 1V5XA 6PTDA 1EXPA 4NF7A 4HMNA 3QM3A 4X9YA 1V79A 3KCJA 2D0GA 3ZWTA 4XQ6A 3UWEA 1EF2A 4IICA 2JIEA 3GR7A 1GVEA 2ZX6A 1ZBVA 2WZIA 4GI4A 4RZ4A 1FKFA 5XINA 2O92A 1QU4A 4GHRA 4I6KA 4GI6A 3O8AA 5CG0A 2INEA 4XUYA 1H2JA 3HN3A 5FKYA 1ME9A 5D32A 2O9TA 3TN3A 3SRDA 1AW5A 3WLMA 2NVAA 5BW6A 5FEWA 2WV8A 3L7RA 3RM9A 3PWIA 3BAYA 3IVSA 7PTDA 1D9EA 3ECQA 4NZCA 3DESA 5HNRA 5C5YA 3UW6A 3RCNA 4QG6A 4XD4A 2DIEA 2WHKA 4GMEA 3S9YA 2IMRA 3XISA 3WQVA 4UTTA 1JAEA 3AS2A 1KGWA 3TP4A 2NQLA 3PJTA 1XS2A 1BEUA 4HYVA 3V5OA 2YW4A 1VIZA 3NJ3A 4H6QA 4NX0A 3OBEA 3W02A 4CNUA 1XLKA 3SFWA 1ISVA 2A79A 3KRUA 2QUUA 4FZIA 1O5RA 3VOIA 3W7JA 2V5DA 4XD3A 4C6CA 1N55A 3TDFA 4IFKA 2EKCA 4BZYA 4MNJA 4MMWA 3MT1A 2AL1A 5F4SA 3Q45A 1I0DA 3V18A 1SZEA 3W72A 1SMDA 3E38A 3QPYA 3QGVA 1HVXA 3AMLA 3NQ8A 4N9DA 2NWSA 4KR0B 1F6KA 1P1XA 4Q4QA 3QKZA 4IIHA 3D3AA 3VYLA 2P3EA 4BJHA 1RV8A 2Q02A 3BAKA 1X1OA 5JIWA 1P4CA 4OOZA 3UQNA 3ZT6A 5EFFA 4C6JA 2IPJA 3OQ8A 3GY1A 3OQEA 2GVYA 2E9BA 3QTGA 2YB1A 2POZA 3NQFA 1C3FA 4YPJA 2FTYA 5I02A 1UR2A 2O9OA 3MKKA 1GJUA 1X6UA 3LCLA 3TTEA 1W5QA 1K8ZA 1UCWA 2VDIA 3TMLA 4JHOA 2FPYA 3EOLA 4AC7C 1FXPA 1T41A 3W7DA 1LLZA 1W31A 4GY1A 4IG2A 3PR2A 1GVSA 1AQHA 2OU4A 1UMYA 1QHOA 2ZZ3A 1FUYA 1F07A 3S5ZA 3CQKA 4KFNA 3R8HA 3VGGA 1L0PA 4P8UA 1Z48A 1G9HA 5GNZA 2RDXA 2RFGA 3PM6A 2EPNA 3BOFA 4IISA 2GZXA 2HNHA 3DZ1A 4P8XA 3FW6A 3LHZA 4X60A 3IJIA 1WB0A 4E8CA 1R7AA 2RDTA 3Q37A 8TIMA 4H9UA 5ENLA 5F2LA 3DFNA 4ZENA 2Z0IA 4QE4A 3L67A 2IKGA 3UF8A 3NXLA 5AOUA 1M03A 1H7WA 4ILSA 2XN2A 4F0HA 5MHBA 1C9DA 1AK5A 3ARYA 4KWWA 4LUSB 2XPAA 1R9YA 2ZVRA 1VFUA 3MI6A 2A3HA 3H22A 2XHYA 3MV11 3GFYA 3KS5A 3EX6A 4XG1A 3S42A 1QAPA 4ZOBA 2E5DA 4F2UA 2ISFA 2BS9A 4JQ1A 3UPWA 2YDSA 3GNPA 2GJRA 4M0XA 3CT7A 1O6IA 5I3IA