1ZL1A

Crystal structure of the complex of signalling protein from sheep (sps-40) with a designed peptide trp-his-trp reveals significance of asn79 and trp191 in the complex formation
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the complex of signalling protein from sheep (SPS-40) with a designed peptide Trp-His-Trp reveals significance of Asn79 and Trp191 in the complex formation
rcsb
molecule tags Signaling protein
molecule keywords Chitinase-3 like protein 1
total genus 115
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2005-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1zl1A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1zl1A01
1LG1A 2PWGA 3AHTA 1BFNA 3SCQA 1GPFA 3GXMA 4F79A 1H49A 4WIWA 1B3VA 3DC0A 2Y4SA 2J77A 2GJRA 3NDYA 2Y24A 1CYGA 1J9YA 2XUCA 4LX4A 4JHZA 1BSIA 1QI5A 5TD4A 5JUVA 2EPOA 4U5KA 2E8ZA 1GZJA 2G3NA 2YBUA 1E9LA 3VDCA 1E1EA 2CERA 3GXFA 1CEOA 3AZSA 4GI6A 1MW0A 1KGWA 3AZRA 2UY3A 1QI2A 3RO8A 3MKKA 3WUFA 5LA2A 1A47A 1FFRA 3M7SA 1JD9A 1BGAA 4X0NA 4ATWA 3AMCA 2JIWA 3T2PA 4MJ2A 2J47A 5ABFA 1WZMA 3CBWA 4QP0A 3KWXA 4HOWA 2ZUVA 3KZSA 2V5DA 1CECA 1KXQA 3VDBA 1PX3A 4JFSA 1XHGA 2CBIA 2WMGA 2ZX6A 1VEPA 1HJWA 1LJYA 3UETA 1E0XA 3WDIA 1L0PA 4JZ5A 5EMYA 2OYLA 1OSEA 3AJ7A 2XGIA 3CMGA 4Q22A 4ZENA 2VCCA 2D22A 4GQRA 2B31A 4BCEA 3L4TA 1HJQA 1AQHA 2A3AA 4CD4A 1JYXA 1AVAA 2DIJA 3VD9A 1P6WA 3VIKA 3EDFA 3SUSA 1LG2A 2X0YA 3TP4A 2IUZA 1JIBA 1RD6A 1VJSA 1HX0A 3QOMA 4CCCA 1NP0A 1SFSA 1BGGA 1NARA 2EBNA 1DWIM 3ZIZA 1JF6A 3W6LA 3ZR5A 2WMKA 3VIFA 5FL1A 1EDGA 5IHRA 1MW3A 4TVUA 3PHAA 3UG3A 4XX6A 5DF0A 2G4FA 4PN2A 5A6JA 1CGTA 1I1XA 1KXHA 3QHNA 3CHCA 5I23A 3UEQA 3NJ3A 3CMJA 3WNMA 1UHVA 5D9OA 4Y7EA 4YHEA 1DHKA 1ISXA 5ECUA 1KCKA 1V02E 3W37A 2J25A 2DSWA 2BY2A 2GK1B 2VOTA 1UKPA 2ZUTA 3ARSA 1GHRA 4IISA 4OBSA 3KL0A 1FP8A 2PWFA 1IT0A 4R27A 3WUEA 2UY4A 5JIWA 2O9RA 3VNYA 2FH6A 1I75A 3MV01 4UZUA 2FGZA 3AIQA 4H41A 5JBFA 5A2AA 4AWEA 1V6WA 1H0IA 3BLPX 3POHA 3TA9A 4GZEA 4P8WA 2PF0A 5FIPA 1BYAA 4Z2IA 3W53A 3U7BA 2WVUA 2YBTA 1PJ9A 3T08A 2Z1SA 3WNPA 4CKQA 3CUFA 3UERA 2ZOXA 1KGUA 2WSPA 1FH9A 3KEHA 2AOSA 2ZXBA 4EKJA 2W92A 1GCYA 5A95A 4D6GA 1GORA 4DWSC 1BG9A 2BVTA 2X1IA 5DT5A 2VQTA 1K9FA 4HMDA 4J3VA 2XPKA 1C8XA 5A94A 2E9BA 4TX6A 3W26A 1JDDA 2Y2WA 3OLEA 4GKLA 3THDA 1EHAA 2OYMA 1MQQA 3BAYA 3PTKA 3U57A 4B9YA 1W3LA 1O7AA 2XYLA 1QNQA 1UD5A 5AY7A 4EE9A 4IPNB 1M7XA 4ZE5A 4C7DA 5CLWA 1OINA 3IAPA 1JXKA 3BSGA 1UR0A 4UTFA 1KGXA 5LYRA 1C90A 4AMCA 4D72A 2CKRA 1UD6A 3RM9A 4UNIA 2TAAA 5D9NA 3MSGA 1DWAM 1E40A 3PZ9A 2XJ7A 3ARPA 4XB3A 2W5FA 3WMSA 1GJUA 3QHMA 4PSPA 3WF3A 3AMDA 2CBVA 3SCVA 5E0FA 4CD7A 2ZXQA 1EQPA 2E9LA 2E8YA 5GNXA 3WFZA 2QHAA 4QDMA 4D6DA 3AMKA 2ZWYA 2V3EA 2UWFA 2PI6A 5LA0A 3GZAA 3GYCA 3PZNA 3CO4A 3TONA 5IHSA 4MB4A 1G0CA 1VFOA 2BHYA 1UWIA 5IFPA 3LPFA 4W5ZA 1Q6GA 1GQKA 4J3WA 4HZ6A 3VMNA 1E3XA 2QV4A 2WAGA 4D1JA 2AMGA 4FK9A 2ZUMA 1PIFA 2IXUA 2WMFA 3U5UA 2VZUA 2G3JA 1PIGA 1JAEA 1XSIA 1E72M 2PWEA 3ARXA 1QOXA 4M24A 2VTFA 2WVVB 1CXEA 3MMUA 5FD0A 4CCEA 1OB0A 1WKYA 4PTMA 2BFGA 4GPNA 1D2KA 4CD8A 3RPMA 1J18A 3AHVA 4AEEA 4ML4A 1EO5A 4PMYA 3VMOA 4GZIA 1NWRA 1CZ1A 1R8LA 1VAHA 4ATLA 3SCNA 4PMRA 3ARRA 4CUCA 5ABHA 1UD3A 2D0FA 2F8QA 1HKIA 2NT0A 4DUVA 3LPOA 2RGLA 2WPGA 1BHGA 2J8FA 4CU7A 4E8CA 1MW2A 2OSYA 2J78A 1M53A 4PMUA 1GOKA 4FLRA 2VQUA 1TUXA 3J7HA 3WBAA 1Y7VA 2DEPA 1ESWA 1WZLA 4MJ4A 1XV8A 2XVLA 5BWFA 1DP0A 2C0HA 2DH2A 4W7UA 2J7BA 1X6LA 1W32A 4OZOA 4E2OA 1UH4A 2WCGA 2A3CA 4HOXA 2BV9A 2G8ZA 3LMYA 3SIMA 3MMDA 2X05A 3HMCA 2CNCA 1JYVA 3N17A 4AEFA 4UFJA 2VUYA 1FA2A 2W62A 1QHPA 3VGFA 2FHBA 2OYKA 3L2LA 1KBKA 4WKFA 3WQ4A 1H09A 5CGTA 3VD4A 3ZT7A 3VINA 1US2A 2MANA 1KXTA 1JZ7A 3U7VA 3AIWA 3THCA 3TTQA 2XM2A 3BMVA 2J7EA 4RE4A 2GJPA 1BF2A 3SCUA 5BROA 1V3IA 2WMIA 3VIIA 4PRWA 3WQVA 2WMHA 3SUWA 4AD2A 5HXMA 3A47A 1JZ8A 4PEEA 2BXZA 1W3KA 3VGEA 1V3KA 3TTOA 1EHNA 4ACZB 3WF0A 3FNDA 5BYWA 4C7FA 1EOMA 3LPGA 1W9PA 4IPLA 1JZ2A 3EYPA 1E71M 3WQ6A 4P7NA 2X0HA 4C7GA 1WDPA 4PMOA 3T2QA 4M82A 4PTXA 2YLLA 3VX0A 1MXDA 4HU8A 1E6ZA 4MTVA 1XH2A 3AISA 5I24A 3FHQA 3II1A 3VILA 4B15A 5A6LA 1W9XA 3BCDA 4WLCA 5I78A 3EMZA 1OCQA 2W66A 2D23A 3VIJA 1HT6A 1NM9A 2J75A 2WVVA 1Q6FA 4HA3A 3WBEA 1FOBA 2XWDA 4U3CA 3CUHA 4PTWA 2ZXAA 2XTKA 3POCA 1C3FA 1GVIA 1E6RA 1GOWA 3VNZA 3MSDA 4AD4A 1HL9A 5A6BD 4HA4A 3NSMA 3SCRA 5A8QA 1TCMA 4AD0A 3AFBA 3CZGA 3W25A 3ZJKA 1G9HA 1U2YA 3T2OA 3W6MA 4OIFA 3L4WA 2EO7A 2O9OA 3SCPA 1FH7A 2XFFA 4JCMA 4AD3A 3GBDA 1DEDA 1JG9A 3WMCA 4A3YA 4D6CA 3VIOA 3AMGA 4CGTA 3BAXA 3WUBA 2CCRA 3NYDA 2WMJA 3FHAA 5I79A 1V3HA 1ZU8A 1UH2A 1W9UA 1ITCA 1GHSA 2FDMA 1PZ2A 4HP5A 2F2HA 2GVYA 3OIHA 3N12A 1HL8A 4QLLA 3L4XA 4F66A 2VR5A 7CGTA 1UH3A 4N0RA 1V3LA 4Q7NA 2FHFA 1K9TA 1C7TA 2EJ1A 5M03A 3VPLA 3K8KA 5CQ1A 4UOQA 3T09A 4DWSD 3CHFA 1LL7A 4U2ZA 3SCTA 1E70M 3UR8A 2DH3A 2VVNA 4IUGA 1TR1A 3CH9A 3CGTA 4JIEA 3BXWA 3N9KA 2D0HA 3BLKA 4F9DA 3W29A 4P8XA 4QLJA 4NI3A 1HN1A 1TFVA 4MNLA 2WMIB 1VB9A 2RGMA 1LWJA 3GNOA 4PMNA 3WF2A 1EO7A 4ZEPA 4D6EA 2G3MA 2AAAA 4JCLA 3WDRA 3AOFA 2WSKA 4MB1A 4HA1A 3QGVA 1EA9C 1KB3A 3WNNA 3DHPA 1EIBA 1BQCA 1JFXA 3AIRA 3FN9A 2WW5A 1QNOA 3OLDA 3GH7A 1J01A 2D0GA 3RM4A 1WAWA 1UZ1A 2F61A 4B3KA 4M8UA 3UG5A 3PTQA 3VM7A 6CGTA 4H2CA 4PMVA 1UWSA 3ARYA 3WD2A 2WB5A 2WCAA 1SMAA 3M46A 3VVGA 1L8NA 5ABGA 1BYBA 1NOWA 5FOOA 2XSBA 5HNNA 4OOUA 2YIHA 3WH8A 4Z2HA 3AHYA 1ZBWA 3OGVA 1J0ZA 2ESCA 3EDKA 1SR0A 1GOMA 1B0IA 1VBUA 4BQ4A 1XH1A 1VRXA 3MUY1 4J3UA 1CXLA 1OT2A 3SCWA 3VIGA 2YJQA 4LGXA 4IM4A 2X8RA 3WIJA 3VUPA 2OWCA 4F8XA 4NF7A 3CPUA 3FW6A 2WZHA 3ZQ9A 4UZSA 2WNWA 1GW1A 5D4YA 1RP8A 3M6DA 4AZ7A 1M04A 3W0KA 4J28A 2JEPA 2WHJA 5M3WA 5HBFA 4W7WA 5GQBA 3IJ9A 1W1PA 5I6SA 2QLYA 1J0HA 4HMEA 5IDIA 4PBGA 1WO2A 1J12A 4BS0A 2CHOA 5DT7A 3EDEA 1C7SA 3VO0A 1CTNA 1E4MM 4JFTA 1CLVA 1BTCA 1SMDA 1UKQA 2YL6A 3A4WA 4U5IA 3W27A 3MS8A 3GDBA 3UG4A 2G41A 5I2UA 1U30A 2NSXA 1CGXA 3ARVA 2VX4A 4W86A 4ATDA 3EMQA 3W81A 1CXHA 2IXVA 2J4GA 4OBRA 2DDXA 2ZX8A 4AIOA 3BAJA 3K8MA 4WK9A 1UD8A 5BXTA 4AD5A 1NWSA 1I1WA 4LPCA 4P7QA 1NH6A 1J10A 3BCFA 2XVPA 4TVDA 4NRSA 4KGLA 1LWHA 1ZJBA 1J0KA 2WWDA 1V6VA 3IJ8A 4CN6A 3GTNA 1H41A 3A4AA 1OD0A 1XH0A 4UOZA 5KEZA 1JI1A 2WBGA 3AIVA 4UQ9A 2ZXDA 1K9EA 3MUIA 2VZVA 1GQIA 1H11A 4CD5A 3GM8A 2V38A 1ISVA 4FLOA 1UD4A 2DGAA 2ZE0A 2ZIDA 4WF7A 4JFUA 1QI4A 3WMBA 1JGIA 2DPEA 1BAGA 2QPSA 3BSHA 1Q6DA 3AMLA 4M1RA 4WSJA 2XWEA 1HVXA 1UD2A 4FLSA 2BVDA 4WJXA 1ZBVA 1XCXA 3BMWA 3IK2A 4AXNA 1ZL1A 1W1YA 5HDRA 1JNDA 3RMEA 3AICA 3HN3A 3WD4A 1JFHA 4AZCA 1TE1A 5A6MA 1KFWA 1FHDA 2DSKA 5E0CA 2BS9A 3WF4A 3WQ8A 3O2LA 1QBBA 1W3HA 2YL8A 1PX8A 1Q6EA 5EBAA 2J7GA 4GO8A 1QNRA 3SEPA 4DM1A 1OWQA 4TTUA 1XD0A 2YDSA 3VD5A 2VX6A 1QNPA 4M56A 4J27A 3AROA 3BAIA 3CTTA 1LL4A 2WCSA 1E6PA 4KRTA 4ACZA 4X0VA 1PAMA 1TZ7A 1AQMA 3CIVA 1IZKA 3ARWA 3NUKA 3ALFA 2DQXA 2WYSA 3MUZ1 1BG4A 3HJEA 4TVCA 1V0MA 4J7RA 4EAMA 5E70A 3DYMA 1RPKA 2PWDA 5A8PA 2VX7A 1UWUA 1R87A 3CHDA 4P7LA 1QI0A 4AZCB 1E15A 3FAXA 4UCFA 1W2VA 5A6AA 4M81A 4W87A 2CKSA 3ALGA 4PMDA 2VZTA 2CPUA 5I5RA 3T0AA 3VIMA 5AC4A 5DFAA 5F7UA 2QF8A 1W1TA 4AD1A 4V2XA 2VRQA 1LLOA 1CLXA 2J62A 1JZ6A 1US3A 3SUVA 4DWSA 3WDQA 3NSXA 1NOUA 1MQPA 2ZUUA 2DT3A 1UOKA 1PEZA 1NWTA 5C70A 1GOIA 4NSBA 1HNYA 4PMXA 5GNYA 4BQ3A 5E6YA 1UR2A 1GVYA 3SUTA 6TAAA 1M03A 4UQDA 3NSNA 1MWOA 5A69A 4PTVA 2YL5A 1UR8A 2E9MA 3ZOAA 4XZWA 3VOCA 4JKKA 3VMPA 1VJZA 3N13A 1KWGA 3CZKA 1N82A 2VO5A 3UESA 3WQ5A 3PZUA 1VIWA 4GIAA 3CZEA 1HJXA 4MAVA 4V27A 1CGUA 1QPKA 1UUQA 5BXPA 2CITA 3PN8A 1MXGA 5BRPA 4MB5A 1JZ4A 1J0JA 3D3AA 3IJ7A 2JALA 5FCZA 3T0DA 1BVZA 2VJXA 2PC8A 2EPNA 3NDZA 4KMQA 1R7OA 1EQCA 3GBEA 1E73M 4X9YA 3VGDA 1EGZA 2VR4A 1HP4A 3BAKA 3PZVA 2CXGA 4AZ6A 3WEOA 4U33A 4K68A 2NT1A 1BYDA 4ZXOA 5CXPA 1HKJA 2WKLA 1E43A 5A6SA 2VURA 3WSUA 4Z2GA 4H7VA 3OBAA 2WM0A 3MANA 1TA3B 3CZLA 3GXIA 1KR1A 3AIEA 2CEQA 2J79A 3VIPA 4HPGA 3AQUA 2BVYA 1CXKA 3A6OA 1QI3A 1VFMA 1R7AA 2DSZA 2XVKA 4EK7A 4HOZA 2J7CA 1JAKA 3L4UA 1XD1A 4JKMA 5CJ5A 5E6ZA 4MNJA 3BAWA 3HU7A 1WB0A 4AZBA 5M5DA 4A4AA 2OWXA 4UFLA 2YOCA 4CCDA 4ZXLA 3IAQA 4MB3A 3WENA 2JF7A 2WANA 4BF7A 3VKKA 1WZKA 5DEZA 4F9JA 3ARQA 4S3JA 3D5HA 1Q6CA 1KR0A 3PZGA 3M07A 4U31A 4CD6A 3WUGA 4AC1X 1UA3A 4MNKA 2DIEA 1GOQA 3BC9A 1JDCA 4ZFMA 3B9DA 1XYZA 3I3BA 1LL6A 1H4PA 1RP9A 1WE5A 3IANA 1CXIA 4Z2JA 5EFFA 2VCBA 3PBGA 1ZS2A 3VGGA 3CZJA 1HIZA 1CPUA 1UA7A 1HF6A 1AMYA 3N15A 2CHNA 3RILA 1O6IA 2VZOA 3G6MA 2WC4A 1IV8A 1ISWA 2OSWA 5JBEA 4LYQA 2BXYA 4DUXA 1OD8A 3GXDA 2QMKA 3UCQA 3JUGA 1W9DM 1DWJM 1VEMA 3W4RA 1V3MA 4YPJA 3QOKA 5A8NA 1MW1A 3QHOA 3AI0A 2VCAA 1OGBA 1QBAA 2YLAA 2GSJA 4J3XA 1HKKA 4H8VA 4W8AA 1W9BM 4ZE4A 4NZCA 4MPKA 3ARUA 2DT2A 1OIMA 3VD7A 5AYBA 2G3IA 3WL1A 4FMVA 2E40A 2PBOA 1W91A 1QVBA 1UWRA 1V6YA 1C8YA 3VGBA 3ECQA 1E56A 2D1ZA 4W85A 1GNXA 2WC7A 2C7FA 1GOOA 2EQDA 1XSKA 5DO8A 4UQBA 1KBBA 3VDHA 1E5JA 1QW8A 1XCWA 1WDRA 3W82A 3EDJA 1LF1A 4EANA 1JYNA 1KXVA 2WLYA 5HPOA 4AY1A 2WKGA 3PZMA 3BH4A 2J7HA 2QMJA 4L4PA 2WLZA 1KQYA 4AYSA 1UR9A 3PZOA 1E4LA 3GNRA 4URIA 2YA2A 4GO9A 1GJWA 2D24A 4YHGA 4WKAA 4UFIA 5EFDA 1ZB5A 2W91A 3EMCA 2GDUA 4JAWA 4P7OA 2C8NA 2BY1A 1JD7A 5ABEA 1E4IA 4L4OA 4W89A 1OBAA 1UQZA 2YA0A 2XVGA 1E6SM 4TUFA 3S6TA 5CG0A 1C93A 4HTYA 4H8HA 2WHLA 1WDQA 1F4HA 4KWUA 5BXSA 1OT1A 4UQCA 1FFQA 3WFLA 1OIFA 2GUYA 1HJSA 5JBDA 1XC6A 4Z2KA 1E4NA 2JE8A 4HU0A 2W67A 2V5CA 3AXHA 2VVSA 2DT1A 4GXPA 3AYRA 1CENA 2JF6A 2WC3A 1XGZA 1NWUA 2WVTA 1CGVA 1PZ3A 2W63A 1PPIA 4AZIA 4W8LA 3ZJ6A 1ITXA 4W88A 3MO4A 3TTYA 3WH7A 3WH5A 1CBGA 3CLWA 1D3CA 3AS1A 3QR3A 2V3DA 4UR9A 1UKOA 3MV11 1GQJA 4D6HA 3WQWA 3WH9A 5I77A 1GUVA 3VD3A 1VFUA 4N42A 5CLTA 2UY5A 4TXEA 2WXDM 4PYSA 3A4XA 1FP9A 4MDPA 3VDAA 4M29A 1MQRA 4MAZA 2BY3A 3CHEA 2OSXA 3VM5A 4RE3A 2XIBA 1WCGA 4AZ5A 1W3JA 2XSAA 3WKZA 1QW9A 2XIIA 3ZM8A 3RM8A 4PUDA 1CWYA 3E1F1 3AZTA 1E55A 2GFTA 3PTMA 5I0DA 5CZKA 3WNOA 4W8BA 4WKHA 2GDVA 4S3KA 4HZ7A 4W7VA 1W9VA 2WBKA 3AXXA 3VTRA 4AIUA 1JI2A 2EPLX 1C8QA 1PBGA 4W84A 4LYPA 3AIUA 2W61A 2ZUSA 1H1NA 1UG6A 1ZBCA 5AC5A 2ZWZA 1UQYA 3N11A 4BQ2A 3VIHA 1TMQA 1FHLA 1E6QM 1VF8A 1R86A 4AW7A 1ODZA 1GONA 1ISZA 1W2PA 4JFVA 1B30A 1UYQA 3FAWA 1J0YA 4J3TA 4PUEA 1EDTA 7TAAA 2WZIA 2BY0A 4RE2A 1UWQA 1H5VA 1WPCA 2DSUA 1KCLA 4YN5A 2XM1A 3OGSA 2VRKA 4W93A 4KRUA 5CPQA 3K4AA 1ODUA 2NW0A 2Q8XA 4A3HA 4HZ8A 3WD0A 5C8BB 1V6UA 3AS3A 3N18A 3LPPA 3WDPP 3AHZA 4PSRA 4MADA 2XFYA 4MDOA 1DTUA 1CNVA 1J11A 4OOZA 1J0IA 2BNJA 1K6AA 1B1YA 1OGGA 3WNLA 1IZJA 3WELA 1JYWA 1GQLA 3VX1A 2OWWA 3NIYA 3ZSSA 4D6JA 1H0GA 1ZJAA 5CPTA 3WNKA 2Y5EA 3PZIA 3EBVA 4WSKA 4E8DA 1M01A 2VC9A 1NQ6A 4DWSB 3WN6A 3U5YA 1HKMA 4JFWA 1CGWA 4AZHA 2J7FA 5CPSA 2ZX7A 2Y8VA 4HMCA 4XUYA 1UKSA 3W24A 4P8UA 4LXFA 5A8OA 2E0PA 3L4VA 1WZAA 2O9PA 3AS0A 3BGAA 8A3HA 1EH9A 2A3EA 2OLHA 4GI8A 2WZEA 1HXJA 3OGRA 3ZR6A 1JZ3A 1JXJA 5KZ6A 2DT0A 1ISYA 4XZBA 1QHZA 2W4XA 3L2MA 1MYRA 3ARTA 1PX4A 1E0WA 3TOPA 4AIEA 1JL8A 1DWGM 4P7RA 1HJVA 2Z1KA 3A3HA 1D7FA 3W38A 4QAWA 3GH5A 4UFHA 4CN1A 6A3HA 1WDSA 4H04A 3WF1A 4GQQA 3WDJA 1BPLB 3MMWA 5GNZA 2ZUNA 1E1FA 1EXPA 3SCOA 2D3LA 1ECEA 3ARZA 3ZO9A 1XYFA 4CU6A 2VMFA 1H3GA 1V3JA 3PZQA 1AQ0A 3AYSA 1V6XA 3MU7A 3KE0A 5IFTA 1LQ0A 3N1AA 3O6AA 5I3DA 5DMYA 1RH9A 1JNEA 2YL9A 1E6XM 3FY1A 3CZ8A 4CU8A 3SURA 4LYRA 2PB1A 3AXIA 4TOQA 5A8MA 4ACYA 1FH8A 5EB8A 3OLGA 5JH8A 3B8SA 1E6NA 2EPKX 3KL3A 1B3XA 1H2JA 1S46A 2JIEA 3PZTA 1VFFA 4QCFA 3OA5A 1EOKA 1VENA 2XG9A 3FXYA 5E9AA 1KWKA 1NP2A 4GINA 2QPUA 1TVPA 3DECA 5A1AA 3DYOA 3CUIA 3K8LA 3ZMRA 3ZJ7A 2J74A 1OGSA 3WEZA 4B9ZA 2WHKA 8CGTA 3OZPA 1U33A 4CVUA 3L4ZA 2FH8A 1XSJA 2V3FA 3OB8A 4BZYA 4OUEA 1E0VA 1JZ5A 1G1YA 4D6IA 1B9ZA 1K9DA 2ZICA 1V0LA 1UWTA 2Y8KA 2D2OA 1VEOA 1V0KA 2CIPA 3I3DA 5IXEA 2GK1A 4DM2A 4D6FA 3RIKA 4HPHA 3APGA 2CYGA 5D8WA 4B3LA 1TG7A 2CETA 1CGYA 1YHTA 3N04A 4J3SA 3WEMA 2FGLA 3SUUA 4AZGA 2VT0A 3VU2A 4JKLA 5M17A 4UQEA 1KQZA 2D20A 4PCTA 1B2YA 2VZSA 2GJXA 5LA1A 5BXRA 1MFVA 5JIPA 3WD1A 2VX5A 7A3HA 4JL2A 2XGBA 4PCSA 4KGJA 4QCEA 2VI0A 5AYIA 3WL0A 3S2CA 1QNSA 1DWHM 3O9NA 4BA0A 2FHCA 2PBGA 4U2YA 4JL1A 1UR4A 1C91A 2X2YA 3VGHA 3KL5A 5A3HA 1CIUA 1HP5A 2EPMX 2UY2A 2O9TA 3RCNA 4AISA 1UR1A 4Z2LA 4UFKA 4NRRA 1G5AA 4QLKA 1X1NA 1UKTA 2E4TA 4M80A 1Q4NX 4W5UA 1QHOA 2E3ZA 3WH6A 1TA3A 5A6KA 4OKDA 5A6BA 2JFEX 4PMQA 1A3HA 3NCOA 4XV0A 1JDAA 5CSUA 9CGTA 2VRJA 5GPRA 2D3NA 4E4PA 1G94A 4BQ5A 4V28A 2X09A 1V08A 3GNPA 1B90A 2YDRA 5FKYA 1OM0A 4B16A 1WNOA 3OG2A 2YDQA 1Z32X 3RJYA 5E09A 2HVMA 1WP6A 3EDDA 5A2CA 3AS2A 3OZOA 5D8ZA 4CVWA 1E3ZA 1JF5A 1V0NA 4JHOA 4U3AA 3F5KA 3OLIA 2YA1A 3F5LA 1MFUA 4CN4A 1V02A 5D9PA 2EEXA 4OJYA 1BYCA 1XRVA 3DYPA 2WHMA 1B3YA 2VL4A 5D9MA 4GI9A 5FL0A 3AHXA 3GH4A 3RDKA 3WD3A 2WK2A 5ABFB 4UFMA 4MNMA 4DUWA 3L4YA 5A2BA 3CUGA 2ZX5A 3F5JA 2HISA 3T0BA 2XHYA 3K1DA 5HOSA 2YKKA 3ZT6A 3F4VA 4TTGA 2DSVA 4D71A 1BVNP 3I3EA 4H8UA 5BCAA 4RL3A 1X6NA 4PMZA 4KH2A 3W28A 1B3WA 3ZT5A 4FF5A 2ZX9A 1ZBKA 3SCSA 2XVNA 4UQAA 3WDHA 2XFRA 3CUJA 4TX8A 1V03A 2WWCA 2J8GA 3ZSTA 3UR7A 2EXOA 1G01A 2CBUA 1YQ2A 1HVQA 3WY1A 1EDQA 2BHZA 2ZUWA 4GZJA 3G6LA 1TVNA 1B31A 5CSYA 1CXFA 4UOJA 1E5NA 2J7DA 2CBJA 4FLQA 4R5EA 1HJUA 3TTSA 3B9AA 1MVYA 3K46A 3RJXA 1W1VA 1BLIA 2GJXB 1SYTA 3B9EA 4LQ1A 4QFUA 5BRQA 2V3GA 1C92A 3K4DA 1R85A 2WVSA 5CGMA 1NOFA 2VNCA 3MUAA 4P8VA 2A3BA 2JEQA 2BHUA 3DHUA 1F4AA 2O92A 2A3HA 2CESA 3ZJ8A 5C71A 1VBRA 1B3ZA 1UZ4A 5HPCA 1CDGA 3AIBA 4D1IA 2PWHA 1DWFM
chains in the Genus database with same CATH superfamily
2G97A 1LYXA 1LG1A 1ENUA 1P0EA 1CT5A 3C0JA 4DY1A 2DV0A 1LM1A 1OK4A 2Y24A 1CYGA 3MP5A 2XUCA 3CIWA 2VC5A 3CASA 1QI5A 3NVTA 5JUVA 3VDCA 2QJGA 3P74A 1XYBA 2OLAA 4PUUA 5D2TA 2FKEA 3FDKA 1S2CA 1OC7A 5K7JA 3JW7A 2I17A 3EB4A 3WMLA 4AHPA 4MG4A 3HBLA 3T2PA 1W3IA 4FA3A 1WZMA 1VLWA 1R2TA 3A12A 2GUUA 4EXAA 3MJYA 3MT1A 1KNWA 3GZ3A 3U0HA 3EX4A 2ACRA 2CBIA 2Y61A 3INPA 4JZ5A 1FKJA 3AJ7A 3E0IA 3DFPA 3C0LA 4IQ2A 3EX2A 5KMYA 2YZRA 4MFDA 4JN7A 1MEWA 2XU2A 4DUOA 1CI1A 1EEXA 4G1NA 3EDFA 1T5AA 3GAYA 4N19A 1YIXA 1DTNA 1R38A 1HX0A 3PJXA 1QW7A 3O5PA 4CCCA 5DMLA 1PYMA 1SFSA 2ZCGA 3EA2A 4MHBA 1NARA 4HARA 4UIOA 5DN1A 2WMKA 3T1GA 4GHRA 3TCZA 3EEZA 3PHAA 4FXJA 4PCNA 3H7VA 2G4FA 3NVDA 4DO4A 2QCDA 1EP2A 5C2GA 3DUGA 1EX5A 2Q8LA 3UEQA 3NJ3A 3GG8A 1YW1A 3ITXA 3WNMA 1UHVA 4YHEA 3VNLA 4R3UA 5XIMA 3ABOA 1GYLA 1YBQA 3W37A 4FR6A 4O1EA 1UKPA 1R0MA 4IGMA 3KL0A 2XIJA 4KWVA 1Z6KA 4JYFA 3RU6A 1BRLB 2PWFA 4QEHA 3UWVA 1LOSA 1W17A 1J96A 2PV1A 3WUEA 3HG2A 3CQ0A 2FH6A 5LIXX 2FGZA 1IE7C 5AHEA 1PSCA 2QCDB 1WDWA 3H9RB 5JBFA 5A2AA 4AWEA 1H0IA 1TV8A 4H9MA 1XLHA 4JTDA 2ZR5A 3VAWA 5FIPA 1BYAA 2JKPA 4UTUA 3CL8A 4C65A 1Z69A 3WNPA 5KSWA 4LBSA 1SZGA 1KGUA 4YJ5A 3KEHA 1QPOA 2Z2AA 3ITVA 2KI3A 3PVFA 4EKJA 1R2SA 1XXXA 2OO0A 4D6GA 1TCOC 3T4WA 1JCXA 2C13A 5DT5A 4J3VA 2HK1A 2XPKA 3FA4A 3W75A 4BI5A 3W1QA 5D30A 1JDDA 3LZ5A 1M65A 2Y2WA 1AL8A 2TSYA 1MQQA 3BAYA 4B9YA 1QNQA 3NQ8A 4D8AA 2MNRA 4IPNB 4C7DA 3KCEA 4JFIA 5DO2A 1JXKA 1YXDA 3BVJA 4FB7A 2YFOA 4C5ZA 4UTFA 3EPNA 3UF8A 5TIMA 1M5YA 5LYRA 2A2IA 4A8LA 2O7SA 4ICCX 4CQ8A 4MGVA 2CKRA 1RV8A 1UD6A 4W4QA 3TMQA 3RM9A 4JTHA 5D9NA 1RR2A 1VJIA 5T9CE 4L9ZA 2KFWA 1UZHA 3ARPA 1XRTA 1LT7A 2W5FA 3WMSA 4OBTA 2BGQA 4PSPA 3WF3A 3AMDA 1B9BA 1RPXA 2ZVRA 3QSRA 4V15A 4YWIA 2E8YA 2E9LA 2TPSA 5AYYA 3IVTA 3WFZA 1ICPA 2E5DA 3AMKA 2PMQA 4Q6XA 2ZWYA 3P6LA 3PZNA 3GY1A 3TONA 4UTTA 1VFOA 2PTYA 4C6IA 1TWDA 5IFPA 2OU4A 3R4IA 3LPFA 2I5GA 5FI8A 1BXBA 3T8QA 2WAGA 4NILA 3IJIA 3E74A 1FWDC 3T4CA 1A7XA 2G3JA 1PIGA 4YTRA 4L6DA 2QVHA 4ZGYA 1XSIA 4NAFA 3LCXA 1PKNA 3RNDA 5FESA 4ORIA 1QOXA 4M24A 3KBMA 4CCEA 1OB0A 1PKYA 3VMOA 4GZIA 1NWRA 1CZ1A 1MDLA 3PK7A 5FJRA 3S5SA 3R94A 1VFHA 4ATLA 2F2KA 3T9PA 4PMRA 4CUCA 2D0FA 2OODA 3TROA 4DUVA 3WBXA 4UTWC 1FUYA 1BHGA 4NZ1A 2I7GA 3NXFA 1FAPA 3NI6A 4E8CA 2OSYA 3M0IA 4GABA 4D9PA 1XLEA 1H7OA 1TUXA 3GS6A 4I7UA 2DEPA 3UYCA 3WBAA 3MI3A 2PPOA 1ESWA 4HZMA 4J4OA 3URNA 2INEA 4B90A 1KLYA 1X6LA 3QQ0A 1W1A1 1FWJC 1X38A 1UH4A 1EC8A 2YXGA 3DFNA 1U83A 4O2TA 2A3CA 2GVEA 3LMYA 4LEFA 1GG0A 3GNNA 3T55A 1KFEA 3STCA 1Z9AA 3B4YA 5J5DA 2P1FA 2OZ8A 4AFYA 4AF0A 1QHPA 3R2GA 5EKYA 2FHBA 2OYKA 4RR4A 3L2LA 3GB6A 7ENLA 4R88A 1H09A 4GC4A 1CW2A 3PF3A 3VINA 1YW5A 2MANA 1KXTA 3V36A 1XX1A 2PODA 2ZZ6A 3BJFA 2A79A 4HKPA 1R3SA 3GO2A 4MKSA 1R3WA 3WQDA 3VIIA 3A47A 3CWNA 1JZ8A 1MMFA 4GQGA 4Q6JA 4ACZB 4Q4OA 5I00A 3MUCA 4ZL1A 5K9CA 1E71M 2X1SA 2DW7A 1TR9A 4Q32A 2FGBA 3OEXA 4P7NA 4C7GA 3O5IA 1WDPA 2Y70A 4PMOA 2J8TA 4DB7A 5HW6A 2P0OA 4IIGA 4PTXA 1KO0A 1M68A 2VDHA 3CUXA 2PTXA 4L65A 3OVPA 1MXDA 1GGOA 4MTVA 3VCCA 5MKGB 3SQSA 4DYKA 1QAPA 5I78A 3KLLA 4QG9A 2FAPA 1OCQA 1NM9A 1PIIA 3LI1A 3WBEA 3UZXA 4U3CA 3P0WA 4PUJA 2XTKA 5H2ZA 2HNEA 1GWJA 3KOFA 4B3ZA 1B57A 3MSDA 1LBMA 4AD4A 5A6BD 4LCSA 4HYRA 4DPPA 4C1NB 3WH0A 4AD0A 1LRTA 1UB3A 3ZJKA 3IIVA 1G9HA 1DKWA 1U2YA 1PTAA 3T2OA 5AHLA 2O9OA 3SCPA 2XFFA 2QDGA 4HD5A 4HU4A 1IWPA 2VXNA 2PAJA 4UNKA 4D6CA 1XP3A 3AMGA 3MP3A 2RUQA 3WUBA 3PBUA 3QJAA 4JQAA 4QTGA 1JQVA 3G18A 1W56A 3SFKA 3VXGA 3NQFA 3M5XA 1V3HA 1FWGC 1ZU8A 2JZVA 1ITCA 1GHSA 1PZ2A 1Z8AA 2GVYA 4Q4PA 1HL8A 2B0MA 4A2SA 1UH3A 4UR7A 3B06A 2V81A 3QGAC 4JDYA 2FHFA 2EJ1A 5B80A 3Q94A 2PDYA 3A3XA 3W9ZA 4UOQA 3T09A 4IIBA 1LL7A 4U2ZA 3UR8A 2RFGA 3NOYA 4FALA 5I07A 1IXOA 4GVFA 1PCWA 2NUWA 4JIEA 3CMFA 1Q7QA 3N9KA 3AU6A 2ZZ3A 2KE0A 4F9DA 4Q4QA 3W7QA 1HN1A 4JTLA 4JFMA 1SJCA 5C2XA 3B4UA 3GNOA 3TYEA 3REQA 1TJ2A 4A05A 4LAXA 1EO7A 4AX6A 4ZEPA 5HR7A 1JVWA 1G4PA 2G3MA 1V8EA 4JCLA 3AOFA 1I2NA 1Z44A 2ZRUA 2F9RA 2VC7A 3WNNA 1BQCA 1Q63A 3AIRA 3I65A 3NO5A 5CH9A 3GH7A 2GJLA 4TW6A 3GW0A 4L6OA 3HGOA 4Y9MA 2F61A 3H23A 3UG5A 3VFCA 3PTQA 3VM7A 3O63A 4A2RA 4PMVA 3ARYA 3WD2A 1O5XA 1FWRA 3GC5A 5ABGA 2A5HA 2PRHA 3LCWA 4JTCA 1V7YA 3LCIA 1YTKA 3JR2A 3WH8A 3TC5A 2YCJA 3AHYA 3UA3A 1J0ZA 2ESCA 1GOMA 2QJJA 1VBUA 2OFJA 4C6KA 3LEPA 1BWKA 2I14A 2PV2A 3OBKA 1OT2A 3VIGA 4LGXA 4IM4A 1DXIA 2ATMA 4GJIA 1C8VA 2WZHA 3KACA 1RP8A 4ZQPA 3M6DA 1P0DA 3RX3A 5D2XA 4AZ7A 3TYUA 4MWAE 3KRBA 4J28A 2MNTA 2FKPA 3IJ9A 3CWOX 4DZIA 4EPEC 4I90A 4X63A 1WO2A 1FQ0A 4BS0A 2CHOA 5DT7A 1XUUA 2E28A 4WGHA 3LK6A 1HQTA 3GC2A 3SR7A 1UKQA 4TX0A 3TSDA 4KCUA 4LEQA 3ABZA 3UG4A 3PC0A 2NSXA 1CGXA 3EGJA 3CTLA 3VKCA 1XG4A 3H53A 4W86A 3ZVHB 3EMQA 2J4GA 4XAZA 1EJRC 4KT2A 2O7QA 1JEZA 1Z7AA 4WK9A 1EZWA 3HGRA 3UWQA 4I7WA 1EC7A 3L68A 2XVPA 4TVDA 4NRSA 1DYSA 1V6VA 4CN6A 3PUDA 3A4AA 1XH0A 2A3LA 4HHPA 1JDFA 1JI1A 2ACUA 3RR1A 3AIVA 3MUXA 4GY7A 7REQB 4CD5A 4M7SA 1TCDA 2DZXA 2V38A 2OMAA 4R33A 2ZE0A 1N55A 4KEMA 2GWGA 1W8GA 1CCWB 5FJJA 3CAQA 3K1GA 2DPEA 3XINA 4CQBA 6ALDA 2ZBTA 2WO5A 3TAOA 1DBTA 5DCEA 4PCPA 4ZPWR 3GFYA 4WJXA 3D3FA 3BMWA 3C8FA 4O4VA 5REQA 3W2NA 4JEJA 1W1ZA 3HN3A 4KCTA 4Q7IA 3WD4A 3E38A 1A5AA 1TE1A 1KFWA 1QOQA 2GPTA 3WQ8A 3WJSA 5TQLA 4L6HA 2J7GA 4FXFA 1DIDA 3KAGA 1QNRA 3DGRA 3SEPA 4DM1A 3I6RA 2MLZA 3KBSA 2CHRA 2A7RA 5LGZA 1TSIA 1IIGA 4ZQCA 4QJ3B 2I1OA 3P61A 1ICQA 2XP5A 1XIDA 5G1TA 1AQMA 3CIVA 1IZKA 3ALFA 3MY9A 4TVCA 1V0MA 4J7RA 5AC7A 3R11A 4JNYA 2VEFA 4P7LA 1E15A 1OCJA 3GKFA 4YYFA 2OGYA 1ZP3A 4C6BA 4ICNA 4GNVA 2FLIA 4R9OA 3WBWA 3ALGA 4LFYA 4LV4A 3T0AA 4JTJA 1R3YA 5DY2A 3W71A 2QF8A 1W1TA 4V2XA 4JEQA 1LLOA 1CLXA 4NJIA 4PUKA 4EPKA 1US3A 3SUVA 2ACSA 1A3XA 1JCLA 1MQPA 4DJFC 1XLGA 2WSRA 3FJNA 3CAKA 1UC4A 1JNTA 5TNVA 1PV8A 3N3MA 1UR2A 2P88A 3ABRA 2OX1A 3F4DA 4MMWA 3NQGA 2Z25A 5EL1A 3TW7A 3VA8A 3NSNA 2YL5A 2E9MA 4XZWA 1KTCA 5ENLA 4JX5A 4JKKA 3VMPA 4JQ2A 2ZKMX 4BEUA 4NASA 1R3VA 3OODA 3UESA 3CZEA 4OVXA 4V27A 3SRKA 1CGUA 3WCZA 3LDVA 5CCZA 3I10A 3KXQA 3PNZA 4HK7A 1P5QA 3T0DA 4JQ4A 3RF9A 4Y9AA 3NDZA 2OZTA 1R7OA 1EQCA 1E73M 4X9YA 3A9IA 1TTJA 5IM51 2ONEA 4MLRA 2ISSA 1G69A 1AZ2A 1P6BA 2OR2A 3R7MA 4YXGA 3USBA 1BYDA 1P0NA 1S5TA 1HKJA 1XYCA 4OWGA 1E43A 1W6TA 1YKWA 3QN3A 2R14A 1J4EA 1OF8A 4H7VA 3GHTA 3OBAA 2E7FA 3TEVA 4ZB2A 2GGEA 1TA3B 3CZLA 1X8FA 4P2VA 5DCDA 3W2JA 3WQOA 3GXIA 4DJDC 4DIPA 3T7VA 1JCTA 3AIEA 4GIRA 3K13A 4ERAA 1KFBA 3V1HA 5HWCA 4DT4A 3AQUA 1VFMA 3PTDA 2WNZA 1SQ7A 4EK7A 5CC5A 3PRAA 2QYGA 4Y90A 1XD1A 1VBGA 3H2EA 2PV3A 5CJ5A 4DO7A 2YFNA 4I8YA 2C16A 5J8LA 2GVLA 1FCVA 4J4NA 4UFLA 2YOCA 3EWCA 4XAGA 2WJEA 4PCFA 2Y62A 1WKEA 2WANA 3UZJA 1WZKA 4E6MA 3ARQA 4S3JA 3G8RA 3E0VA 1KR0A 4N9EA 3UNTA 1FCUA 4U31A 1JCNA 3QR1A 2Z6JA 3WUGA 4AC1X 4MNKA 2DIEA 1YEYA 2ABAA 4PEKA 4GY0A 4H4IA 3ZZ1A 3BC9A 1E9ZB 1JDCA 4CNNA 1F6KA 1DXFA 3I3BA 1LL6A 4JIHA 3HGJA 2I57A 1HIZA 3N29A 4PL2A 4LW7A 2Z2UA 3SJNA 1UP2A 1XGDA 3SB0A 3H2CA 3V1PA 1O6IA 3E0LA 2ETNA 3W7NA 1ISWA 5JBEA 3BLEA 1SFJA 4NNAA 5I7GA 7PTDA 4XVEA 5U4NA 1DWJM 1KFJA 1QTWA 2PD9A 3U6WA 4JTQA 1V3MA 5DX7A 1BXCA 2YSWA 3QOKA 1ZZMA 3G1DA 4LALA 4PZVA 3RYSA 2Y7DA 1VCGA 3AI0A 1OGBA 4LC6A 3BK0A 1HKKA 4W8AA 3U2EA 4ZB0A 1UIOA 3LA4A 2ZQUA 1OIMA 1H5YA 3L9CA 3LUTA 3PFRA 4JTRA 1NF0A 4WJ8A 1UC5A 1JPHA 4JYSA 3ECQA 3S2JA 2D1ZA 1RA0A 4W85A 4WVXA 2CLEA 4HPJA 4JTAA 3RPDA 3I7RA 1GOOA 4GIVA 3IGXA 3ES7A 4BF9A 1JYNA 4XZHA 4RUBA 1O5RA 2WKJA 1JCMP 1OG6A 2Z28A 3FGCB 4HN4A 1ZPTA 4L4PA 4PMJA 4AYSA 1LROA 1KBLA 3GNRA 3ITLA 3PM6A 4BY3A 5EA9A 1GJWA 2G5WA 4LOCA 1FWBC 2PZ0A 3CC1A 5JVLA 3GIYA 5EFDA 4FEZA 1ZB5A 2W91A 3NYZA 3GKAA 3GU9A 2G0WA 3EMCA 2GDUA 4P7OA 3GVWA 2C8NA 3L5MA 4XZMX 2BY1A 1NFPA 1JD7A 5ABEA 5HK4A 4L56A 3SRFA 3FSTA 4C6MA 3HG4A 1X96A 4H8HA 1FTXA 4UQCA 4C6CA 2GUYA 1HJSA 1IEXA 4I9AA 3OPSA 4Z2KA 3EA1A 4LVAA 3LM3A 2W67A 2V5CA 5AKQA 4IGHA 1YE4A 2PDGA 3DBNA 4AMAA 2VVSA 2PF8A 4Q4MA 3W83A 3IVUA 3RFAA 1PZ3A 4JGDA 1SM9A 4W88A 4QDWA 3LSBA 1GEQA 1CBGA 1RBOB 1A5BA 2V3DA 2A7PA 2EKGA 2QF7A 3MV11 4JTEA 1GQJA 3WQWA 3UA4A 5I3JA 3Q4DA 1WOBA 3BW3A 1GUVA 3VD3A 4JQ1A 3S5OA 5CLTA 3MP4A 1KFKA 5FACA 1HTIA 2VFIA 7XIMA 1VZWA 4KWOA 3UW6A 1MQRA 3THQA 2NXGA 1M1BA 1G4TA 3RUBL 4Z0SA 1YNYA 2OSXA 3N2OA 3BZGA 2XIBA 5DXYA 1XLCA 4IXXA 2G3FA 3STGA 4PB3A 3EKLA 1W3TA 7TIMA 2FB2A 5EMLA 4PODA 2EKCA 3E1F1 1TPFA 2PZNA 1TTIA 3UWUA 3FXGA 3T78A 4Z1BA 1DIKA 3FS2A 5CZKA 4GC3A 4RV8A 2WBKA 1PHQA 1JI2A 4US5A 1AA1B 4YTSA 1N8WA 2D9FA 1KCXA 1M9HA 3AIUA 4E2BA 4LBUA 1A5CA 1UG6A 1ZBCA 1A5MC 1MXSA 5J5RA 4NJJA 3WLNA 3L0GA 1W2PA 4RE0A 1Z41A 1UYQA 3HFYA 4HHHA 2GQ8A 5D2WA 3GNXA 1X1ZA 3PJTA 3U4AA 3TYDA 3UXAA 1THFD 3P3BA 3K4AA 3C6CA 3M47A 4A3HA 3LYEA 3N18A 1OYBA 3LSCA 2V2CA 1E1CB 2VEKA 5LNRA 2IW0A 3QR0A 2XFYA 2J9XA 3E3HA 1CNVA 1J11A 2BWGA 4C02B 1B1YA 2E6YA 3WNLA 3GXNA 2ANUA 3P93A 2OWWA 3NIYA 5FF0A 3ZSSA 4WDWA 4NVTA 3P84A 4L5ZA 1H0GA 1ZJAA 5FJTA 3RGCA 4HSNA 3WNKA 2QKFA 4HBOA 3UXDA 1ZTVA 3EBVA 2ZA2A 3M5VA 2VUNA 1F8AB 3L23A 2IKIA 2OO6A 3AYVA 3QPZA 3WN6A 2J7FA 5CPSA 4F2UA 3LLXA 4ODQA 3W24A 3ID7A 3ZVIA 1GVQA 4QIUA 2OX4A 1WXYA 3BGAA 5MF5A 2A0NA 1SO5A 4YCOA 3S9IA 1T40A 3WQGA 1JXJA 1PHWA 3GK0A 4ZCWA 4JICA 2DT0A 1GKRA 3BQ6A 4XZBA 1DE6A 2W4XA 2XZ9A 1PX4A 3CLMA 2JBMA 3B8IA 1AW5A 3FV9A 2Z1KA 1L6WA 3TKFA 3MDWA 5K3VA 2JGYA 4UFHA 3P81A 4QGCA 2V5BA 1HO4A 1BPLB 1X1OA 3W1NA 2ZUNA 4IMGA 4MZ1A 4KEUA 3JXVA 2VMFA 4KETA 1AQ0A 3AYSA 3MU7A 3GDMA 1WKFA 3PRDA 5DMYA 2PDJA 4NJGA 3PY2A 3CZ8A 4CU8A 2ZA3A 4LYRA 2DZSA 4GLEA 3AXIA 2NVAA 4ACYA 1UR3M 4NQ1A 1EUAA 4JIPA 2OQHA 3BG3A 1IT8A 1P7TA 2ISVA 2XH0A 1VFFA 3GVRA 1KWKA 2BX7A 2N87A 3SM0A 1KD0A 1EF2A 1TZ9A 2Y88A 1VPYA 2QPUA 4XKMA 5HQLA 3ZMRA 1VIZA 3QW3A 3WEZA 3MSYA 8CGTA 4FF7A 3W7PA 3E2QA 3OZPA 3UI5A 1U33A 3QFEA 4Q4SA 2V3FA 4BZYA 1YDYA 2ZE3A 3MSRA 3UP8A 4MKNA 1BL4A 3D47A 1DJYA 1K9DA 2XDFA 2Y8KA 4QE4A 3WK1A 4DJEC 3L66A 3HG3A 5DXXA 5IXEA 5U7SA 4PH6A 3F03K 1TJRA 2PCEA 3APGA 4R9XA 4GUFA 4IL2A 4J3SA 5LHEA 3NZGA 2VT0A 5FA5A 5M17A 2WJZA 4A3UA 1KQZA 4HJWA 3S5NA 4LTSA 5F2IA 4QAIA 1TV7A 4IFOA 1W3NA 1U79A 1JQXA 3EWXA 4MWAC 4PE8A 1MFVA 3WD1A 5H91A 7A3HA 1EFZA 4PCSA 5AYIA 3BURA 3WL0A 1SR9A 4ZSTA 4IMFA 1DWHM 3O9NA 3GFZA 2PBGA 1SW0A 5FF4A 2VFHA 4O1CA 3IARA 1UR1A 4Z2LA 4NRRA 3M5ZA 1JCHB 2ABBA 1OX5A 1X1NA 4LCRA 3LQLA 1QHOA 1TA3A 2WJFA 3L67A 2JFEX 3IVSA 4L9XA 3HO8A 1JDAA 2VRJA 2D3NA 3DDMA 1G94A 3UF9A 1PBKA 4GUIA 2YCIX 2NQLA 1R30A 2X09A 1V08A 4L4MA 3GNPA 1YTEA 3THAA 2NUYA 4MKVA 3DFHA 3RJYA 1Y5WA 5CPOA 3W88A 1WP6A 2JQXA 2PDIA 5D8ZA 4AC7C 4CVWA 2XP4A 4U3AA 3SAZA 2EGZA 1V02A 1O66A 3AAMA 2EEXA 2NX1A 3LHZA 1FKLA 2O55A 1B3YA 1AD4A 5D9MA 1FKKA 5FL0A 3AHXA 1JUBA 3GH4A 5JXQA 1BKHA 2XH7A 3WD3A 3DCPA 3CQHA 5ABFB 3O5RA 4EACA 3F5JA 3MO7A 3CT2A 1ITUA 2NLYA 3EPOA 4TTGA 3B9OA 3I3EA 4H8UA 5BCAA 4RL3A 1X6NA 2HDJA 1SU5A 4KH2A 1PUDA 4LUJA 1B3WA 4FF5A 2E1DA 4LV9A 1KLZA 1UUMA 3UJEA 4UQAA 4C1NA 2FJKA 2WWCA 1XLMA 2J8GA 2ZC8A 2GLKA 2CBUA 4LSBA 3ZLHA 4X60A 2P53A 1F7BA 4UOJA 4FN2A 2VWSA 5CPNA 4R5EA 3ZXWA 3TTSA 2BVWA 4JR5A 4L72B 4TU1A 3K46A 1BLIA 1UASA 4LQ1A 4PUNA 4DX3A 5BRQA 1C92A 1NOFA 5AVNA 3K4WA 5IRPA 2QJHA 1D7HA 1M7PA 3ZJ8A 4DRHA 3WO8A 1YE6A 3GUGA 4ICMA 2A6NA 1B3ZA 5DMMA 4LNCA 5HPCA 2R1LA 5T91A 4D1IA 3HF3A 1N2VA 2PWHA 3VDGA 3BMXA 1YXYA 3I6EA 4RKAA 3BLFA 2PWGA 3AHTA 3SCQA 3U4FA 3GXMA 4K7YA 4Z1YA 1FDZA 4WIWA 1B3VA 4FXRA 3NDYA 3I4EA 2Y89A 1VGAA 4QROA 1J9YA 3TC7A 3QTPA 4IT6A 3IUIA 4LX4A 5HNUA 3UXIA 4JHZA 5CBJA 4EOUA 3EXTA 1GZJA 3WLHA 4QJ4B 4I8DA 1PTDA 5DY3A 2R24A 2GYIA 3MHUA 1RJQA 4Z08A 4DBEA 3UZYA 3VI2A 1Q2RA 3WUFA 2OEJA 4I5RA 5LA2A 1A47A 4EXBA 2DUAA 4US5D 3DBPA 4X0NA 2JIWA 4DJDD 3D6NA 4MJ2A 3F2BA 4WY0A 2PDBA 8XIAA 4HOWA 3KZSA 2AL1A 1CECA 1A0EA 4H9TA 3IACA 1LUCB 3ATYA 1LJYA 3W74A 3WDIA 4ZQOA 1VFSA 2Z27A 8TIMA 3PR2A 1DQXA 2XGIA 1MDRA 4W9QA 3WQPA 1OZQA 4ZENA 2VCCA 3M1ZA 4GYJA 4NAEB 3KOYA 1IQ8A 2B31A 1MO0A 1ONWA 1JPKA 5CJNA 2QJIA 1AL7A 3BJSA 5EY5A 4CD4A 4BKNA 3VD9A 2WZMA 1P6WA 3O5OA 2X0YA 1KM4A 1VJSA 4I5XA 4U85A 3QOMA 2Z1XA 2QCGA 2Y1HA 1NP0A 3H6OA 1DWIM 4K37A 3LCGA 3ZIZA 3ZR5A 4ZOEA 1DOSA 3VIFA 5FL1A 1QDSA 5IHRA 1MW3A 3TW9A 3UG3A 5F2LA 1FWWA 4LRTA 3R8GA 4PN2A 3IJ6A 3TZNA 5A6JA 1DQWA 4DXKA 1CGTA 1KXHA 3CHCA 4UNLA 3MI6A 1I9CB 1PYFA 4C6LA 2QW5A 3CMJA 3H2NA 3TMLA 3S3GA 4K7VA 3TN6A 3L5LA 4W9TA 1DHKA 1OCNA 4ILSA 1ISXA 5AFDA 1V02E 2J25A 2PDUA 2DSWA 5HMFA 2VOTA 1GHRA 3PSVA 4IISA 4OBSA 4A8IA 4RLIA 2QXWA 1V51A 4AVNA 2ADAA 1IT0A 1POKA 4R27A 4EVZA 2VGGA 2ZTKA 2UY4A 2QCNA 5JIWA 3EWWA 4UZUA 4DIAA 3S6OA 6XIAA 2BOGX 5CPLA 2NLIA 2CWXA 4XK2A 1EYEA 4I5UA 2YBTA 1PJ9A 1OYAA 3T08A 1RD5A 3LRLA 2Z1SA 5G4WA 3HPZA 2ZOXA 3W7CA 3WLOA 2WSPA 2Y63A 2AOSA 2ZXBA 3KZ7A 2W92A 4QG6A 5A95A 3NEVA 2HSAA 3S42A 5HTGA 1WKDA 2X1IA 3CPGA 4ZBCA 3RN6A 2R82A 4NNBA 1XIIA 1ZJIA 5G4EA 1J93A 2BLEA 5A94A 2VD9A 2E9BA 3RO6A 4LAYA 4D8LA 2JGQA 4GJJA 4GKLA 4KFOA 1EHAA 3THDA 3PTKA 4BEQA 3U57A 1O7AA 1ZAIA 4EX4A 3S9ZA 4H9ZA 3SI9A 4EE9A 3V4BA 1SSDA 3IAPA 3BSGA 2KO7A 1UR0A 1B3OA 1ZJHA 4DQWA 1TB3A 2EG7A 1C90A 1S2VA 1HGYA 3KRZA 2V5LA 1UPMB 2I9UA 2TAAA 2O56A 1E0UA 3MSGA 1E40A 3VYLA 4I6KA 3O5LA 3WLJA 2XJ7A 4LRSA 4XB3A 4KFPA 3E5BA 3SW6A 1RA5A 3LBOA 4S3DA 2PLJA 3CXOA 5E0FA 4CD7A 5HUAA 3NFUA 4ERGA 3L65A 1JRBA 3GZAA 3GYCA 3W1UA 4RCXA 4B5NA 5IHSA 1G0CA 2CW6A 4OUIA 4DBUA 4ZR8A 1H7RA 4HIBA 2CZVA 5G2HA 3VMNA 1SO6A 5A5WA 4IIFA 3OOQA 4A35A 3P67A 3UNDA 4O1DA 2ZUMA 3I6TA 4R7WA 3U3HA 1JUKA 1TPWA 1XW8A 2IKJA 2YBVA 1W8SA 4AAJA 3LX9A 4F0RA 3ARXA 2VTFA 3S1GA 3DERA 2AL2B 4PTMA 1D2KA 4C60A 4EPBC 1A5UA 5FSDC 3SO7A 3W22A 5HANA 3T44A 1U1JA 1ZSXA 2GGHA 5ABHA 1FY6A 3OJGA 4GVIA 2NWRA 2F8QA 5BMWA 4O11A 2ZQTA 2NT0A 3BUVA 3B0XA 3AXMA 3LPOA 5H8PA 2I9EA 3SQLA 3V0TA 2J8FA 1ADSA 4O50A 2BODX 1ZRQA 2J78A 3UPMA 4Z1DA 3LD5A 2QPXA 3LU2A 2LKNA 4MJ4A 2CLLA 3EB2A 2DH2A 4FOKA 4E2DA 3TFXA 3KTCA 1TV4A 2BV9A 3VE9A 3A5VA 3SIMA 5FF2A 3W7OA 2X05A 5HR6A 3CAWA 4O10A 1QK0A 4AEFA 1OFRA 4UFJA 3WBYA 5FJPA 1FA2A 3KADA 4UDMA 1EIXA 5C6MA 2A85A 4AIBA 3W07A 4WKFA 3WQ4A 1E44A 1UJPA 1TWZA 3THCA 1RXOB 3BMVA 2J7EA 2NX3A 1XDMA 3BMBA 5H8MA 3SUWA 4ODMA 4PEEA 3N73A 3JU2A 3UWEA 1TQXA 5H6HA 3TTOA 3G0XA 2XP3A 4KCWA 5CZTA 3FNDA 5BYWA 3LPGA 4IPLA 1RK6A 4LU0A 1MEIA 2C6QA 5CKSA 5AVHA 5HWMA 2CXEA 4LAOA 4PA8A 3CQJA 4M82A 1EF3A 4LVBA 3QV8A 3CQIA 1E6ZA 1XH2A 2IPFA 3VOHA 3II1A 4B15A 5A6LA 4WLCA 3N2CA 4RDVA 1UPPA 3TQPA 1S2WA 3O05A 2D23A 3MBDA 4JHMA 4L1XA 2J75A 2WVVA 2QCMA 1FOBA 2QCEA 3HB9A 4C6JA 3CEPA 1SO3A 3POCA 2RAGA 3STEA 5AECA 4TW8A 1OFOA 3WLMA 3NSMA 4XBKA 2V67A 3SCRA 2B7QA 5A8QA 3M64A 2VFEA 5A6TC 2H9AB 4ZQRA 3W25A 3FJ6A 2HTMA 2YB4A 1FRBA 3GVGA 4FZIA 1B4KA 5JH1A 4R53A 4HBKA 3G1YA 3JYJA 3GBDA 3CL6A 2A6LA 1JG9A 1OFDA 3BAXA 1XGEA 1ALDA 3B0VC 3UU0A 1GJPA 3O06A 1IEWA 3CV7A 1R6WA 3FHAA 1RLCL 5I79A 2WSYA 1W9UA 4HMNA 1Q2SA 3OIHA 4B5XA 1OC5A 4CEXC 3EKZA 3O5KA 2NZLA 4BWLA 1A5KC 3L4XA 5C9UA 2VR5A 4Y9NA 1N8IA 5HWBA 1FKHA 4Q7NA 1K9TA 1NEYA 2PDKA 1ITQA 2FB3A 3K8KA 5CQ1A 2P10A 2RUDA 3MBFA 3CHFA 3SCTA 1E70M 2ISFA 4A21A 1H60A 2VVNA 2C18A 2H8XA 3CH9A 4IPIA 1K4GA 3BGGA 2Y5JA 3W29A 3C2VA 2OT1A 1TFVA 3IJLA 1BF6A 1HL2A 4UMBA 4I7VA 5A8GA 3WF2A 1WX0A 3LBMA 3W00A 2AAAA 5FJUA 1UZDA 2WSKA 3W7JA 1KB3A 1XBVA 1JFXA 5E1QA 3FN9A 4JQ3A 1QNOA 3OLDA 4NZ5A 3QC0A 4R0XA 3NQMA 1WAWA 4M8UA 3LY0A 6CGTA 3RX4A 2WB5A 1SMAA 3M41A 3M46A 4BFAA 1L8NA 1I2PA 4L61A 4YVPA 2GVJA 5FOOA 3CT7A 1W5PA 3GG0A 4S1FA 4H6RA 4I6VA 4QRNA 3SRDA 2NQ5A 3N14A 1T6MA 1Q6LA 2OQLA 2FIQA 3W1LA 5LNWA 1XH1A 1CXLA 3MCOA 3R89A 3W3OA 4HNUA 3S46A 1CLKA 4F40A 3KZPA 1XYAA 3NZQA 1XRFA 3VUPA 2OWCA 1OADA 4F8XA 4NF7A 3CPUA 1IWAA 4B5VA 2PDPA 1DE5A 3LLFA 3ZQ9A 3LGEA 2WNWA 1KT0A 1XIEA 4H7ZA 3UYIA 3KOWA 4LS0A 4GVHA 3G8EA 4IGSA 4REQA 5M3WA 4YTQA 2QLYA 1SJAA 4Y96A 4HMEA 2B7OA 4FXSA 3TE9A 1J12A 3EWBX 3PG8A 1C7SA 3VO0A 1EJXC 1CLVA 1SMDA 4DEFA 4JFKA 3MS8A 3GDBA 3M0HA 4EWND 3TYCA 4P61A 3DH7A 3ATZA 3ARVA 2PTDA 3PAOA 5K4ZA 4HPXA 3P5YA 2EF9A 3BAJA 1UD8A 3LTPA 5JMUA 1KM1A 2WZTA 1I1WA 4LPCA 4P7QA 1VHNA 1NH6A 1XDJA 3R0DA 4O53A 1SW3A 4OHQA 4ZO8A 2RHGA 1SZNA 1LWHA 3IJ8A 3GTNA 2M2AA 1OD0A 4UOZA 4WY0B 4JPGA 2B5UB 4O16A 1K9EA 4Q8QA 1EWEA 1HZYA 2X16A 4WJEA 1ISVA 3D46A 3ITYA 4ODNA 4WF7A 1OZMA 4JFUA 2UZ5A 3T07A 1Q6DA 2VGBA 3H24A 3AMLA 3B0PA 2XWEA 3QYSA 4QBXA 1UD2A 4NAEA 4Q8OA 2BVDA 4Y8FA 1XCXA 3N6QA 1ZL1A 2PDLA 1W1YA 3ANUA 4NXKA 5HDRA 3LS9A 3GDTA 3AICA 4AY8A 3UR5A 1RVKA 3FOKA 1YDOA 3EA3A 3KAOA 5A6MA 2FZ9A 2BS9A 3WF4A 4JS3A 3RK8A 2AMXA 2X40A 1W3HA 1KW1A 2OVLA 4GO8A 2RDUA 4IG2A 1A5OC 4TTUA 3VD5A 4ZPVR 3CTTA 2V6AA 1GPWA 3I68A 1FKSA 4S38A 4DRKA 4O18A 1LT8A 1DJZA 1T0OA 1NF7A 2DJXA 2ZR6A 1TZ7A 1HXVA 2AKZA 2C1IA 2XIOA 1TJ0A 3KAHA 3TFCA 3HJEA 4WCJA 2WPBA 1XKJA 5REQB 2EAWA 4DF0A 1JNSA 2XP9A 4O4WA 1A4MA 5A8PA 2VX7A 5AYXA 4E0CA 4YVXA 1GTEA 1F9CA 3AO0A 4M81A 5AHFA 3QC3A 2XIQA 3GR4A 3S5YA 3PB0A 5I5RA 2C3ZA 1UBPC 3NGFA 4YL2A 4KQNA 5DFAA 1XC4A 3O6YX 4O1AA 1PWMA 5FEZA 1XUZA 3NSXA 3UT0A 1AUSL 5DMNA 4HHLA 3EOOA 3S2LA 1LOLA 3SFWA 1GOIA 1AW2A 1S5MA 4PMXA 5GNYA 5E6YA 3WLQA 1GVYA 4PRTA 3SUTA 6TAAA 1M03A 4DBDA 2BXVA 1MWOA 4A8RA 3DKLA 3TJLA 4Q33A 1UR8A 2WNNA 3ZOAA 2AQOA 4UTMA 2RJHA 3VOCA 3N13A 1KWGA 1N82A 3PZUA 1VIWA 1KRMA 4G7EA 4NX5A 4WXYA 5BXPA 3NDOA 3PN8A 5BRPA 4R85A 2BBFA 3KBNA 4S3AA 2JALA 4M6PA 3TWAA 2YCLB 4XZNX 3M0VA 4NY2A 3M0XA 4ADTA 1EJVC 2NQJA 4MLJA 2TMDA 3VGDA 3GBEA 6TIMA 1J2BA 1HP4A 2Z1VA 2X2GA 4LUIA 3WEOA 1S1RA 4JTIA 4PB5A 1E1CA 1REQB 2ISWA 3BWWA 4K68A 4JIQA 3NQ2A 4ZXOA 5CXPA 4MYAA 2WKLA 3TR9A 3ORWA 4RNIA 3WSUA 3NQBA 2WM0A 3TC6A 1GZ1A 3IV3A 3MI2A 4XUGA 1NDYA 5FJOA 2J79A 1IXPA 4UTTC 2O0TA 4G2DA 4F0HA 3R79A 4DRJA 2BVYA 4EXQA 3OU8A 1XQKA 1PL9A 2VEMA 2LLEA 3ANVA 1XM3A 3BTNA 2YCLA 4MWAD 4X61A 4HOZA 1JAKA 3V0UA 3L4UA 1XL9A 4IX0A 3PFMA 4AG0A 1XIBA 5E6ZA 3GR8A 4HVXA 4AZBA 5M5DA 4GZ7A 2QUMA 3KDNA 4ZXLA 3IAQA 4GX9A 1MNZA 3WX7A 4BF7A 5DEZA 4F9JA 3G1RA 4V1YA 3W87A 1Q6CA 1DJGA 3RITA 2JKAA 3EWDA 3M07A 3GWQA 3MDUA 4CD6A 2YR1A 1UA3A 2PU1A 2M08A 1Q13A 3P82A 3WLLA 1XYZA 3WJXA 4UTWA 1BXNA 3IANA 1YYAA 3PBGA 1CPUA 3PWIA 1SO4A 1QOPA 1X98A 1TO3A 4XBJA 3RILA 1TJPA 2PGWA 2VZOA 2DVTA 4KWSA 5C9WA 4LYQA 2BXYA 2Z24A 4Y8EA 4DUXA 3LNMA 3UCQA 1EX1A 3JUGA 3QMRA 3H2AA 3IKGA 4PL1A 2VM8A 3NZRA 2HZGA 4QT3A 5A8NA 3PJWA 2HEJA 1MW1A 3VFLA 1TIWA 3DESA 3QHOA 4XSLA 2VCAA 2BP1A 1QBAA 1MRAA 1KTNA 2MUCA 1KKOA 2DT2A 4RZ4A 1VBJA 4HT3A 2PBOA 3GPKA 4X3ZA 3SZ8A 2D2GA 1G4SA 4N9CA 4CNTA 1E56A 4PR4A 3S2MA 2PDFA 5D2VA 4LUTA 2OKTA 3E2SA 3H70A 2OQYA 2C0AA 1QW8A 1I2RA 1XCWA 5DELA 1LF1A 4EANA 1KXVA 2WLYA 3B9NA 2WKGA 2J7HA 3GXTA 1KQYA 3UJRA 2PDHA 4NI8A 4IUOA 1JCYA 5DITA 1TVLA 5K4XA 1K70A 2ZYFA 1UMLA 4DRPA 4UFIA 1H1YA 2DQWA 1JGMA 1AJZA 4EWJA 3O5GA 1ZCOA 1F6YA 1VYPX 3LLDA 1QJWA 4NZ3A 1OBAA 1LOQA 2HXTA 3EIPA 4TUFA 3S6TA 2GZXA 3W7MA 1AJ0A 5CG0A 1C93A 4HTYA 5EYWA 4H6EA 4GWEA 3C4UA 4MUPA 4KWUA 3WFLA 1OIFA 1QT1A 4LUYA 1P1XA 4QS6A 4TR9A 3GDRA 2PC4A 1KCZA 2JE8A 1D7KA 1PE1A 4H9UA 1VBHA 2VDGA 3LXBA 4GXPA 1RLDA 2FMOA 4H6KA 4CNOA 1CENA 2JF6A 1XGZA 4K8GA 1NWUA 2WVTA 2W63A 4AHOA 3TYBA 4NJHA 3WH7A 1R46A 3CLWA 3BJTA 1D3CA 1AG1O 3AS1A 1UKOA 3QKZA 1QXLA 2QNEA 1QPQA 1KM5A 2PTZA 3M44A 1F07A 4OFCA 3WH9A 3TV8A 3U9IA 4AF0B 2UY5A 4TXEA 3NA8A 4AYGA 3A4XA 4LT9A 4RX0A 2V5KA 3LCLA 4O1BA 4DELA 4ML9A 2HPMA 1F3XA 5AC8A 2BY3A 4AXKA 3CHEA 1XLFA 2PSNA 4OQVA 4RE3A 1WCGA 4AZ5A 3ME3A 3WKZA 3S2NA 2XIIA 3ZM8A 1ZCCA 5DBUA 1K8YA 1Y65A 2FTPA 1VLIA 1XFCA 3E2VA 3T42A 1XF0A 1A53A 1VKFA 1CWYA 4FNPA 3AZTA 1E55A 4HJFA 5I0DA 4H8NA 1MZRA 5C54A 4RNHA 4DRMA 4WKHA 2GDVA 4PUMA 4W7VA 3GW3A 3AXXA 2DZTA 4GCXA 4DZHA 4NIRA 1PBGA 3NNTA 1US0A 1F3TA 1KRAC 1UCWA 3MW7A 4BQ2A 1TMQA 1FHLA 1YRRA 1W31A 1I2OA 4AW7A 5CSRA 1ODZA 1ISZA 4JFVA 3MCMA 4KR0B 3NL3A 3NQ7A 7TAAA 4DYJA 1HKWA 3REQB 4LC8A 1Q45A 3GTHA 3E9AA 2HBXA 1DV7A 1UWQA 3YPIA 1A0CA 1WPCA 2XN1A 2DSUA 1L9WA 4AWUA 4W93A 4KRUA 4DF2A 1G7UA 1F40A 4ERIA 1ODUA 3NTPA 2X41A 3QFWA 1JVNA 1FWHC 3AS3A 3LPPA 2Q5AA 1SUXA 4PSRA 3CJPA 3JVAA 1FWFC 1DTUA 4WEVX 1JPDX 1EYMA 4U28A 1YADA 3AC0A 1K6AA 3H4WA 3G0SA 1ROTA 3FX4A 5I3HA 3WELA 1JYWA 4J40A 2XFWA 2Y5EA 1KT1A 4HK5A 1J6YA 5D32A 4GK8A 4N02A 1M01A 2J6XA 4LNYA 2H3BA 1AODA 1HKMA 4JFWA 4TNSA 4NT0A 3V3WA 5C7VA 4XUYA 5I06A 2INZA 1UKSA 4P8UA 2V5JA 1YTDA 3IGUA 5A8OA 1R3QA 1WZAA 1GEHA 4JFLA 5C2CA 1O1ZA 3O8AA 4TMBA 5G1MA 3OGRA 4RZ5A 3ZR6A 4I9TA 5KZ6A 4FX6M 3KHDA 3ARTA 3T6CA 1E0WA 4XD4A 3TOPA 3OHIA 3QYQA 4AIEA 3P5ZA 4BF8A 5TAOA 5BWAA 3NQAA 5J6EA 1KC7A 1NU5A 3PP7A 4L64A 1PTGA 3W38A 1SFLA 4IMCA 4H04A 3G24A 5AN7A 1GVEA 3G1HA 3WF1A 4BJHA 5GPGA 3OQ8A 4GQQA 4H9YA 3IEBA 4KW2A 2OZ3A 3BV4A 3UZWA 1EXPA 1XLLA 1F76A 2VFFA 3ARZA 3ZO9A 1FVPA 1OF6A 1V3JA 4AQLA 1GKPA 1U22A 4QS5A 1LQ0A 4LAVA 1QPLA 4AVFA 5TF0A 3CHVA 3RRXA 1KKRA 1ZQ5A 1E6XM 1XLJA 3NRKA 1EUNA 2QCLA 4MPQA 1R9ZA 2PB1A 2FPTA 3JZUA 3O5JA 5A8MA 3QRHA 5CAKA 5JH8A 5DBTA 1FKRA 1M41A 1S46A 2O4QA 4QCFA 3OA5A 5CJMA 1AH0A 1EOKA 2P0IA 2H8ZA 2POTA 5BRBA 2XN0A 4GINA 2I56A 2JKEA 2OZ0A 3K8LA 3EWYA 3U8GA 2ZZ1A 3STPA 5BW6A 1KM0A 1RJRA 1XSJA 3LENA 4OUEA 4EPDC 2QULA 1JZ5A 1G1YA 1BVWA 1XG3A 2DZBA 3GVQA 4NZ4A 1VEOA 3VOFA 3P60A 5EPDA 1V0KA 3M0ZA 3W01A 2R1PA 4DM2A 3RIKA 2C1GA 2CYGA 4G5DA 2C91A 2Q02A 4F0MA 1LZOA 5D8WA 4B3LA 3N25A 3E5PA 3A3WA 3SUUA 1M7JA 4ZODA 3AJXA 3VU2A 4JIRA 1B2YA 2VZSA 2OTDA 5BXRA 4J5NA 3DEQA 3B8DA 2VC6A 4JL2A 3OIXA 2A21A 4AVOA 1QNSA 2GGIA 4DZ3A 4BA0A 4Z1CA 4JL1A 2MF9A 1C91A 3TK7A 1HP5A 2EPMX 3H2FA 3S6DA 3OTRA 4S3GA 4AISA 1AJ2A 1PKMA 1PZ0A 5DCBA 1F2JA 1WUEA 3ONBA 1LBFA 4M80A 2E4TA 1Q4NX 2E3ZA 4DZ2A 1GVFA 5A6KA 5A6BA 2VR2A 4IIHA 4XISA 1S3TC 4RW5A 3G1VA 1A0DA 4XV0A 1A49A 5CSUA 4E4PA 4BQ5A 1L8PA 2R9RA 3SY8A 4K1GA 5FKYA 3EOLA 3ITOA 4LVDA 1OM0A 1PCKA 3LUOA 5G4HC 2GGGA 5A2CA 4F2TA 3OZOA 1E3ZA 1CB2A 2YA1A 2YGYA 1MFUA 3BOXA 1BYCA 3DYPA 5I02A 1O4UA 2WHMA 1F8IA 2HWGA 2VL4A 2TODA 3MMTA 2I16A 4C6EA 1QWGA 3KP1A 4MNMA 2EULA 5A2BA 1BRLA 2YB1A 3O15A 3MQTA 2HISA 3K1DA 1XQLA 3ZT6A 1Y5VA 4U10A 1RCQA 3CYVA 2PURA 4JTTA 3DHDA 4BHYA 3H55A 4C1KA 4IIDA 2ZTJA 1MEHA 4PMZA 4K3ZA 2VD8A 4DZ5A 4O12A 5CSSA 4CCZA 2ZX9A 3N2BA 2NSOA 4XWUA 3HZ3A 3SCSA 3GX9A 4IQDA 1PDYA 3WDHA 4QE1A 1XISA 3WZ0E 5I03A 1EGVA 1DJHA 4Q8MA 2BB0A 3ZSTA 4J2MA 4A3QA 2EXOA 1G01A 4PTDA 1HVQA 1Q6UA 3WY1A 2BHZA 1EJWC 4QNWA 1RQEA 3F4NA 3TYZA 5CSYA 1CXFA 4IP5A 1E5NA 4LVGA 2J7DA 2YCKX 3RJXA 1W1VA 1VH7A 3NEHA 2GJXB 1RUSA 4IMDA 3MDYB 3CQKA 2W6RA 2WVSA 5CGMA 3KBWA 2A3BA 3UWZA 2JEQA 3TQVA 3AYTA 4ROQA 2A3HA 1VCVA 1W26A 2Q8ZA 3WK2A 2PGEA 6PTDA 2DVUA 4JTUA 1W1B1 4U4MA 2NUXA 4JN8A 2EPHA 3MYOA 2BGSA 4DI8A 4DO5A 4QITA 1CDGA 2LJ4A 3QMTA 4WD0A 3RAOA 3PWAA 1RZMA 5BZAA 3OO2A 1TRIA 3IS4A 4DROA 1VFLA 2NQ9A 2Y4SA 3BQ5A 2GJRA 4Q4KA 4J9JA 3O6DA 2V30A 4KKXA 4O1FA 1SW7A 3T8LA 4IZGA 4IX2A 4NP7A 4XAPA 4DXXA 2EPOA 2E8ZA 4GI4A 2G3NA 1S5NA 5HNRA 1E9LA 3MZNA 1E1EA 2CERA 5E93A 2DZUA 3GXFA 1CEOA 3AZSA 4MM1A 1MW0A 1KGWA 3AZRA 2ZADA 2UY3A 2CZDA 1T99A 1ZUAX 3B97A 1FFRA 1JD9A 1BGAA 5DIUA 4PB4A 2PRLA 3SADA 2J47A 4Q8PA 1TPDA 5AOUA 2PRMA 3KWXA 2ZUVA 2V5DA 1PX3A 3R0UA 2VEGA 3NO3A 2CFFA 1XHGA 1D6OA 2WMGA 4MFEA 3PSWA 2ZX6A 1VEPA 3EXRA 3FLUA 5FSEC 1DJQA 4RW3A 4YCPA 1OFQA 1OSEA 1FDJA 4Q22A 3ES8A 5LGXA 1IZCA 3RPTA 4H19A 4BCEA 3L4TA 3IHZA 3MZ2A 5F1UA 3DN5A 1Q7MA 1JYXA 1AVAA 4WY0F 3TCSA 4O15A 3W23A 3N34A 4HNOA 3LHWA 3SUSA 4PRRA 2PDWA 2EHHA 1JIBA 1TTQA 2AWGA 1WXZA 4UTLA 3B7XA 1FXPA 2EBNA 4L3NA 3I7QA 1EDGA 4XKYB 4TVUA 1G67A 5IDZA 1D8WA 2R6OA 4XX6A 5DF0A 2VGFA 4C6PA 1R5YA 4ES4A 3QHNA 5I23A 1C9DA 1UUOA 4F0KA 1A3WA 1VFTA 1S2UA 1ONXA 4GBDA 5D9OA 2YXOA 3VOJA 3UGVA 3A4JA 2QEZA 5ECUA 1KCKA 2F6UA 3BG9A 2BY2A 2F4EA 3LGDA 1M7OA 1QMLA 2CLIA 5C55A 1RJPA 2W9MA 1I0BA 4X9SA 1XRSA 3KS5A 1TZZA 1K8CA 2DG9A 5D02A 5LIUX 3UVIA 2O9RA 3VNYA 4S39A 1RBAA 1IR2A 3MV01 2X7VA 1XIMA 3EY6A 1H63A 2ACQA 4H41A 1IX5A 3EOEA 2PFHA 2BGNE 4ADSA 3TA9A 1WAUA 4GZEA 2ZQVA 1F5ZA 3W53A 3U7BA 3SIZA 3DFSA 4FP1A 3VC6A 4IL0A 4CKQA 4B5TA 3UERA 3NPWA 3TJIA 3NGJA 2R8WA 4F48A 4DWSC 1VPXA 2NV9A 1BG9A 3ISIX 2VQTA 3MB9A 2ZZ4A 3MVTA 1GVSA 4AEOA 2V8ZA 4RDYA 6REQB 2X1RA 3UJFA 2W3ZA 3NQVA 3SSJA 3Q2DA 3MHGA 2XYLA 2VKZG 3W2MA 1UD5A 2Z1WA 3VZXA 1NQKA 1MZHA 3P0XA 4ALDA 1F05A 3BGJA 4LH8A 1FKFA 2GWNA 1KGXA 3H21A 3FDGA 4NX0A 4D2JA 4D72A 4FIQA 4QJ5B 4UNIA 2IF4A 3B03A 2ZQ0A 3LB0A 1DJNA 5AZ0A 1J79A 3VC5A 2Z00A 3PZ9A 4QEEA 3QHMA 2IS7A 2CBVA 1EBHA 3QLDA 1EJSC 4L4LA 5CZSA 3VOGA 5GNXA 3MKVA 3HQOA 2QHAA 3G3MA 4QDMA 3NPVA 3SY5A 3B0YA 2PI6A 1R9YA 3OBEA 4AUBA 1FKIA 1OX4A 3IPWA 3CO4A 2OJPA 3ENLA 3M0KA 1BKSA 4GFSA 1EP3A 3CU2A 2OELA 3GD6A 2BHYA 4V33A 3B04A 2PDNA 5HQMA 1B4EA 1DQUA 1UWIA 4W5ZA 1GQKA 2D73A 4HZ6A 3NG3A 3USZA 4QHRA 4F2BA 2QV4A 1V6TA 4D1JA 3XIMA 2AMGA 4FK9A 1TUFA 1Y0EA 1PIFA 3NM1A 4MF4A 3VK5A 2DP3A 1VPQA 4KPLA 3RMJA 1JAEA 4MZ8A 1E72M 3BOLA 3KX6A 3UPBA 2G95A 3MMUA 5FD0A 1XS2A 4TW7A 3BE7A 1EZ2A 4XG1A 1ROUA 4AEEA 1IXQA 4CNSA 3F4CA 3VE7A 4GGHA 1EO5A 4PMYA 1PS9A 1V4YA 2D2JA 1R8LA 1VAHA 2BOEX 3LQGA 3SCNA 3ARRA 5HWJA 5LXEA 1HKIA 4OECA 2BTMA 1W5QA 1DVJA 1MNSA 3K2GA 4S3CA 2WPGA 1R2RA 4LANA 4CU7A 3QY8A 3HPSA 3W86A 4E38A 1M53A 2OT0A 2PDMA 4B2DA 2VQUA 1Y7VA 1WZLA 1NMWA 5BWFA 3FVDA 2C0HA 2PLCA 3QY7A 4W7UA 1E0TA 3FEMA 1C29A 1W32A 4OZOA 2C15A 2WCGA 4DRIA 4HOXA 1IHIA 1NDZA 2VUYA 1TV3A 3Q65A 2W62A 4H6QA 1KRBC 2YDAA 3W1TA 2ZRZA 4H00A 2G50A 2YYTA 3QH2A 4JTKA 4QJ1A 3EKGA 1US2A 1U5HA 3AIWA 2XM2A 1QO2A 3SCUA 3TLQA 4ZOBA 1H62A 5BROA 3B0UX 2WMIA 4PRWA 1KFLA 1POJA 1XINA 4AD2A 4IPPA 4ZZ9A 5HXMA 2E5BA 4FHAA 2VEPA 5LNSA 2BXZA 3VGEA 1V3KA 2P8BA 3N4AA 1J2WA 1TJ1A 4C7FA 3LERA 1EOMA 2BASA 4UR8A 5D37A 3KW3A 2HV5A 3EYPA 2Z1BA 2PN0A 1AH3A 3EOSA 3HOJA 3ZLFA 4MWAA 4FNSA 1O5QA 1W0MA 4S23A 3T2QA 1K77A 1RBLA 3P7YA 5KZEA 2YLLA 1FD9A 1A50A 2PWUA 3VX0A 4N4QA 2IPWA 1TREA 4HU8A 4XAFA 4U86A 2K8IA 2NV2A 3AISA 3FHQA 4GD0A 5I24A 4G7FA 3VILA 1W9XA 3BCDA 4DN1A 2GSHA 4GYFA 3LHYA 3C3NA 2W66A 1RY8A 3VIJA 3C56A 1W54A 1Q6FA 3BLLA 4LB3A 2Z2BA 4Z42C 4PTWA 2ZXAA 4JTGA 1C3FA 1GVIA 1E9YB 3SBFA 1GOWA 3DFQA 1HL9A 1ZHAA 4TYOA 2EG6A 3PBMA 4UC5A 3HIJA 3UCCA 1W5OA 3W6MA 4OIFA 3NZ1A 2XPAA 2E68A 3L4WA 2EO7A 3OVGA 1FH7A 4AD3A 4G7EB 4RXGA 1C9WA 3BW2A 4RZBA 4A3YA 1IXNA 4H9VA 2BMBA 3VIOA 3FA3A 3S5ZA 1VP5A 1K8ZA 3FYYA 2CCRA 3SGZA 2WMJA 1ZAHA 1W1IE 2Y78A 1HO1A 1AD1A 4O0ZA 4HP5A 2F2HA 4TMCA 3KS6A 2DIKA 3UWYA 4F66A 3MYPA 7CGTA 4BI6A 1H7PA 3KP0A 1V3LA 3LTSA 5GJPA 1C7TA 1HUVA 4XZ9A 5M03A 4CLMA 4NZJA 3GTXA 3RCMA 4DWSD 1ICSA 4YVVA 2ALRA 3V5CA 2DH3A 2IPGA 3CWHA 4FOUA 3CGTA 2D0HA 1Y5XA 2KGJA 4N2YA 4P8XA 2FVMA 4QLJA 3STFA 2D2HA 3K30A 4IJBA 3PR9A 3S1VA 4YYCA 1KA9F 5K9XA 1BQGA 4FX7A 1VB9A 2RGMA 2V0TA 3VNJA 5HJLA 3NQ6A 3PRBA 4HQVA 5CC7A 1EJ7L 3M0YA 1P1MA 3TC3A 4D6EA 1RCOB 3O5DA 4YWSA 4MSPA 2W79A 2CZEA 3VCNA 4HA1A 3QGVA 1EL3A 1EA9C 3DHPA 5GJNA 3VCRA 2WW5A 1J01A 1UMYA 3SN4A 1DL3A 5HUPA 3IIZA 3XISA 1SFTA 3KAIA 3GUWA 1QASA 1LLWA 2P3EA 1UZ1A 4B3KA 5I98A 1UROA 3DHFA 1R9HA 2WCAA 1L2UA 1D3HA 3KAFA 1LBLA 1BYBA 4O0QA 2C79A 1NOWA 4JY9A 3AWOA 2XSBA 1WDDA 3FAPA 1PWLA 1V93A 4Y9OA 2VENA 2EJAA 1ZP4A 2AAMA 4ODLA 1SR0A 3G0UA 4O8RA 2XH4A 3KOZA 1VRXA 3MUY1 4Y6GA 4S3BA 1Z89A 1XJBA 1RK5A 3TW6A 3C86A 1EKOA 3WIJA 2VHLA 2ZRWA 3TN3A 3N9SA 4UBPC 4XO7A 5EMKA 5AZ1A 3FW6A 2H9AA 1XPYA 1QPNA 3V7PA 5C5YA 5LXXA 3TJXA 4ZS6A 4ZTYA 2PS2A 5FF7A 3W0KA 2WHJA 1M5WA 2Q3RA 3HURA 5HBFA 5GQBA 1O95A 5I6SA 1F6PA 3UVAA 1UJQA 1J0HA 5IDIA 1XIFA 1SSGA 3CYJA 2ZVIA 3EDEA 4BK9A 3FYOA 4GUGA 3AUOA 1CTNA 3NQDA 1BTCA 4JFTA 4GA8A 1VQTA 3URBA 1TKKA 1U1UA 3PS7A 5I2UA 4HSHA 3UQNA 3S47A 3B8VA 4ATDA 3W81A 4FX8A 1CXHA 2IXVA 4O8AA 2QS8A 2QV5A 2P76A 4EIVA 2ZX8A 3GU2A 4AIOA 1KM6A 4GG9A 5BXTA 3CB3A 5K2ZA 1NWSA 4KGLA 1ZJBA 1J0KA 2WWDA 2CZ5A 1H41A 2QCCA 2WBGA 4K39A 1Q6IA 2FZMA 3V35A 3VKJA 1S2TA 3MUIA 1H11A 1A4LA 2J6VA 3KLKA 1K4HA 3E6EA 1TPB1 1UD4A 4FLOA 3RU8X 1H50A 3PANA 3WMBA 4HHMA 3MWCA 2QPSA 1Q66A 3QZEA 1PB0A 3RR4A 1AZ1A 4WDXA 1I60A 3R12A 4AXNA 1GG1A 4GOAA 4KCVA 4TX9A