1HKMA

High resolution crystal structure of human chitinase in complex with demethylallosamidin
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
365
structure length
365
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEQSGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Allosamidin Derivatives in Complex with Human Macrophage Chitinase
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords CHITOTRIOSIDASE
total genus 125
structure length 365
sequence length 365
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1hkmA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hkmA01
1GJWA 2NSXA 3L4ZA 3CMJA 1XGZA 4QLJA 5A6LA 1LLOA 2A3HA 1KBBA 2JFEX 1XSIA 1CGWA 1V0KA 5A8OA 3VD4A 1UOKA 1UKSA 2FGLA 3MANA 3MMWA 3ZJKA 4P7OA 3UCQA 1TA3B 1KWKA 3NJ3A 3B8SA 1G01A 1XH2A 3AIVA 3MUZ1 3A4WA 3FW6A 4ATWA 3FAWA 1EOMA 3F5KA 5E6ZA 1CXFA 4XV0A 5A2AA 3MSGA 1GQIA 3W0KA 1XC6A 5BCAA 5IHRA 4FLQA 5A2CA 3MUY1 3VDHA 1QNRA 3IJ8A 3CTTA 1JZ6A 2WK2A 4WKHA 1SMDA 4PMRA 1FHLA 4UQBA 3WQ4A 3WMSA 9CGTA 1H0GA 2WVSA 4XX6A 3BLPX 2WLYA 1EA9C 1MW0A 1QHPA 4Z2JA 4PCTA 3WQ5A 1BAGA 1K9FA 1HF6A 5ABEA 4AMCA 4P8UA 4PUDA 2ZX9A 1L0PA 5I3DA 3L4XA 3AS3A 4BS0A 4W8LA 3UG4A 1E5NA 3L4TA 3LPGA 1TFVA 3A6OA 1JD9A 5EFFA 2X0HA 4PSRA 1C90A 4UZUA 3UEQA 1TVNA 3ARPA 2DSZA 3AQUA 1ZU8A 3SCNA 1QI2A 1JYNA 1M7XA 2TAAA 1XV8A 3OLGA 3VKKA 3W24A 4CN1A 2VRKA 3WEZA 4EE9A 4D71A 1PEZA 3O9NA 4CU6A 1GOKA 1UQZA 3RJYA 4KGLA 4QLLA 3ZJ6A 2FGZA 2EPKX 3ARWA 4ATDA 1J0ZA 1DWIM 2ZUNA 1E1FA 3WDJA 1VB9A 2CCRA 2WM0A 3MUAA 3VNYA 2VZTA 1QW8A 5C70A 2ZUTA 3A3HA 1ZBKA 1E73M 4CU8A 3ARZA 3PZIA 5BYWA 1C7SA 4BQ3A 2OSYA 3BAXA 2WMIA 3AROA 4LXFA 4N0RA 1DWFM 5JIPA 3VVGA 1BGGA 1JDCA 1RP8A 1KCKA 1EXPA 4HP5A 4AZ5A 4DUVA 2BHUA 1UWSA 2D2OA 1BF2A 3GXMA 4CD4A 1B9ZA 2WBGA 4X0VA 2BHYA 4CD5A 2WZHA 2XFYA 4PMUA 3WUBA 3L4WA 2UY2A 1V3MA 1GOIA 2DPEA 3D3AA 4Y7EA 3WF0A 4LYPA 3WH6A 1XD0A 4J28A 3UETA 4W86A 2CERA 4PTVA 1WE5A 4JHZA 4AWEA 1WPCA 3RM4A 4ML4A 3CZ8A 1UWRA 1UWQA 1EQCA 1F4AA 3QHNA 1UR2A 1E4LA 1WCGA 5A8NA 1Q6GA 1NQ6A 2NT0A 1CIUA 1PBGA 3AI0A 2VZVA 2BNJA 4M80A 3HU7A 3CMGA 3WFLA 4JCLA 3CBWA 4GI9A 1ZBCA 2WZIA 2WVVB 2CETA 1D2KA 4CCDA 5CPSA 3L4YA 3VGEA 4MNMA 1B3ZA 3GNOA 4LX4A 3D5HA 4H04A 3SCSA 1QBAA 4YHEA 1CWYA 2XVNA 1IZJA 2VVSA 2GVYA 1E15A 3WD0A 2YL8A 3SEPA 3NSXA 4W88A 3IK2A 3MKKA 3PZQA 4W7WA 5BWFA 1JZ8A 4AD1A 1HXJA 1ISWA 3WY1A 4W5ZA 3POCA 5ABFB 2WWDA 5E9AA 3AIRA 2DSWA 3B9EA 4WK9A 4MB1A 3G6MA 1GQLA 3VIPA 1UHVA 1KXVA 4V28A 5GNZA 3AHVA 2XFRA 3BCFA 1US3A 3OLDA 1C7TA 3WH9A 2YLLA 5ECUA 3AJ7A 2WZEA 1KBKA 2XIIA 5CJ5A 3VGBA 1W1TA 3SCWA 3PBGA 4TOQA 1QI3A 3RDKA 2OSXA 1BVNP 2CBVA 3DYMA 2W91A 1KQZA 3DC0A 3BMWA 2VI0A 3SCRA 3K1DA 1EDQA 3GTNA 5I77A 2D0FA 2ZX5A 4MAVA 1D3CA 4W84A 1HJSA 2D24A 3RIKA 1JIBA 4A4AA 1V03A 4PSPA 7TAAA 2Z1KA 4K68A 1OSEA 4H41A 4N42A 7CGTA 3ZT7A 3OGSA 4ACYA 1CXIA 4CD6A 2YJQA 4JFVA 4P8WA 1NWSA 1HKKA 3APGA 4HA4A 1XSJA 3MSDA 3KWXA 2AOSA 2XHYA 4X0NA 2V3GA 3RM8A 1GOOA 3KE0A 5I23A 2V3EA 3ZM8A 2Y8KA 4P8VA 5AY7A 3VD5A 2WC7A 3WNOA 5A69A 1GOWA 3W6MA 3AYSA 1LF1A 1U2YA 3NDZA 3VX0A 2W4XA 3SIMA 5A6SA 1FFQA 4NF7A 4KRUA 3ZR5A 4R27A 2J62A 5A3HA 2WAGA 4E2OA 3U5YA 4CCEA 5E0FA 4PUEA 1Q6FA 5HOSA 3FAXA 4AD2A 3EDFA 3N1AA 1HJWA 2DH3A 5CLWA 3VDAA 4OZOA 1D7FA 1GOMA 4PMVA 1VEMA 1FH7A 4Z2IA 2C0HA 5GNXA 2E8YA 3T2PA 3VPLA 4JIEA 4D6IA 3CZJA 5I0DA 2CHNA 1JZ4A 3NSNA 4F9JA 1XD1A 2UY5A 1VAHA 3M07A 4NI3A 2A3BA 2WHKA 1JNDA 8A3HA 3WN6A 1BYAA 4HMDA 4TXEA 3ZJ8A 4UOQA 1H49A 3IJ9A 1ISXA 1M04A 5DEZA 1BGAA 3QHOA 4P7NA 2VUYA 2WVVA 1JFHA 1W3JA 1G9HA 5FCZA 1C8QA 5CZKA 1HP4A 1VJSA 2BHZA 4PEEA 4AISA 4HZ8A 3W53A 3FHQA 1UD2A 1UR9A 1X6LA 1OIFA 1VENA 2CBIA 4WSKA 3RPMA 3G6LA 4MNKA 4URIA 3B9DA 4GI6A 2BY1A 4CD7A 4JKMA 3CZKA 3CHDA 5HPCA 1IV8A 2FDMA 1EO5A 3WUFA 5DF0A 5HDRA 3OGRA 2EPOA 2J8FA 5A95A 3T0BA 4F9DA 1ISYA 5FL0A 1TR1A 2Z1SA 4M81A 2XFFA 1CECA 2Y24A 1W9PA 2CEQA 2VT0A 1PPIA 2J78A 4QCFA 5BXPA 4UOZA 1QHOA 1XSKA 2VZSA 3AIBA 1GW1A 4GO8A 1J0JA 1CXHA 1V0NA 2J7CA 3J7HA 1OGBA 4MB5A 2D0GA 4ZFMA 3AISA 1S46A 3S6TA 4MDOA 4HOZA 4W8BA 2ZXAA 2ZUSA 2E8ZA 4AIEA 1BQCA 4PCSA 1GCYA 1J10A 1VFOA 1EO7A 1FHDA 4AW7A 1DWAM 1PIGA 1UG6A 4KGJA 2WMJA 3VUPA 3N11A 2G4FA 1V0MA 5I79A 3ZR6A 6A3HA 2JALA 3VIFA 4HU0A 3ARQA 5A6BA 2QHAA 3F5JA 1JAEA 4D6JA 3AHXA 1AMYA 3DYOA 2J7HA 1GQJA 3ARXA 4H8HA 4PBGA 3TP4A 1OIMA 3RJXA 1NP2A 2C8NA 4QP0A 1XH0A 1YHTA 4ZENA 4U2ZA 1K9TA 4GI8A 4UFIA 1NOFA 1MWOA 1ISVA 4D6CA 2VOTA 2CESA 3WD3A 1CPUA 1VEOA 1CZ1A 3WMCA 2QLYA 1KQYA 2C7FA 3N15A 2WMGA 3KL5A 4M24A 4F66A 2D23A 1DTUA 3PZGA 4GINA 4XB3A 4E8CA 4B3KA 3EDJA 5JBFA 1L8NA 4LYRA 4RE2A 3VMNA 1EHAA 5I24A 4PMNA 1UKTA 4GZJA 4XUYA 2DT2A 2PBOA 2DIEA 3DECA 1JZ5A 4MB3A 2GJRA 2VURA 1OD0A 1LWJA 5D8WA 1WDRA 2DT1A 3WDRA 2Y5EA 1CNVA 3BAWA 4ZEPA 1OD8A 2YLAA 2VRQA 1GPFA 4OJYA 2JIWA 2J79A 3OZOA 3AIQA 3BC9A 1MQPA 3L4VA 2CHOA 2CKRA 1K9EA 3M46A 3AIUA 1OT2A 3ARYA 3GH4A 1KGUA 4HPHA 3EBVA 2V3DA 2DDXA 1JYXA 5A2BA 5AYBA 3T0DA 3AMDA 5BXTA 1W9BM 4AC1X 2VR4A 3N18A 5IDIA 4H7VA 1V02A 4UFLA 1ZS2A 3WKZA 1A3HA 2WB5A 2F8QA 4HMCA 1XYZA 3AMKA 1ZB5A 3GM8A 5DMYA 2ZX8A 1J0YA 1PAMA 1HJQA 3WDQA 3W38A 1GNXA 3ALGA 3ZQ9A 4B15A 5ABFA 5I78A 4J3UA 5A6AA 2G3NA 1NARA 1XH1A 1W2VA 1J0KA 1BTCA 1GOQA 4HOWA 2WSPA 2FHBA 4OOUA 4NZCA 2X1IA 1CLVA 1W9VA 4H2CA 5HNNA 3TOPA 2XM2A 2ZUWA 4DM2A 3CHCA 3WSUA 1UWIA 4JL1A 4U33A 1W9XA 3BAJA 1NOWA 5CPQA 4PMYA 3ZO9A 4P7RA 1NM9A 2VR5A 3VX1A 2Q8XA 1JI2A 4OOZA 3WIJA 3WQVA 2DIJA 3WELA 3VGDA 3DHUA 4WSJA 3FNDA 4Z2KA 3NSMA 2CKSA 4RE4A 5DT7A 1UR0A 5CSYA 1B31A 1AQ0A 4D6GA 1ITCA 4R5EA 1H5VA 5EFDA 5JH8A 3IAPA 2E0PA 2DSKA 2XSBA 3T08A 1E72M 4JFSA 1NWTA 4JCMA 4AXNA 1WNOA 1PJ9A 3VIKA 3BMVA 1CTNA 2WKLA 1HNYA 2GK1B 4AEFA 1W91A 1NOUA 1UUQA 2ZX7A 4J3XA 2DSVA 2YBTA 1GZJA 2VJXA 2FH8A 2WC4A 2G3JA 2DT3A 3GYCA 1R7OA 2IXUA 3QGVA 1ZL1A 1B3XA 3ZSTA 3VM5A 2A3EA 2E9BA 3WF4A 4KMQA 3VO0A 1VJZA 2ESCA 3II1A 4UCFA 5ABGA 4OBRA 3WDIA 3BAIA 2QPSA 1UD5A 4J3VA 1G0CA 4WJXA 4P7QA 2GDVA 1CGXA 4W93A 2XVPA 5CG0A 1VFUA 1GHRA 3WNKA 3W82A 1E0VA 5LA0A 2EPMX 5C71A 3VINA 2YDQA 2YOCA 4UQ9A 3CGTA 1E70M 4U3CA 3VIHA 3CZLA 2CBUA 1C8YA 2EPNA 4NRRA 1EIBA 3VM7A 1CGTA 4LPCA 4D6HA 1QI5A 3QOKA 2XPKA 1ESWA 2ZWYA 5IFPA 2HVMA 1JYWA 4ACZA 2J47A 4CKQA 1E9LA 4DUXA 1QHZA 2CXGA 4FLSA 1UKOA 5EBAA 3MUIA 1HKJA 4S3JA 2XM1A 1F4HA 7A3HA 3U5UA 1B3VA 3K4DA 1ISZA 1O6IA 5JIWA 1B3YA 3ECQA 5A8MA 4S3KA 1BHGA 1MYRA 2PB1A 4AZIA 4MB4A 1VBUA 2PC8A 1QW9A 1K9DA 1JXJA 3OGVA 2CITA 4AZ6A 1WP6A 4TX6A 1PX4A 4TTUA 1OT1A 2G41A 1UA3A 4CVWA 1HL8A 3EMCA 3O6AA 2J7GA 1UKQA 3N04A 3L2MA 4ZE5A 1DWGM 1OINA 3UERA 1MW3A 2W66A 1H1NA 4LQ1A 2DGAA 1KGXA 3VIOA 3THDA 5CXPA 1KXHA 3AYRA 1PX8A 4MJ2A 3I3EA 1ZBVA 4PTMA 1OB0A 3ZT6A 4WF7A 2VX7A 3CPUA 4GQRA 3I3DA 2BY0A 3HMCA 2ZX6A 1CGUA 3K8KA 1UA7A 3VGFA 2VX4A 2OYLA 3RILA 1JF5A 3WF2A 2BXZA 3K46A 3N9KA 3WL1A 4TX8A 4BA0A 3VDCA 1R87A 2YL9A 2ZUVA 1J9YA 3AXIA 4PMDA 1JAKA 4AZGA 1HIZA 2Y8VA 1WZMA 2OSWA 3W81A 1JZ3A 2JEQA 4J7RA 1H3GA 3L2LA 3WBEA 2QMKA 3VMOA 1MXGA 4UNIA 2IUZA 3SUTA 4AZBA 2NT1A 1EDGA 1XCWA 3CIVA 1QNPA 2F61A 2Y2WA 4AIOA 2VQUA 3UG5A 6CGTA 3N13A 1E4NA 2GJXA 5CLTA 3W25A 5FOOA 2X0YA 1VFMA 2CIPA 4HMEA 2WMIB 2W62A 2X2YA 1LQ0A 1MQRA 3PZMA 1SYTA 4AYSA 5AC5A 2ZWZA 2QF8A 3ALFA 3BAKA 1OGGA 1WAWA 1K6AA 3PTMA 1JFXA 1KXQA 1E6ZA 1W32A 2XVGA 3NDYA 4Z2LA 3CZEA 1O7AA 4BQ4A 4HOXA 2PWEA 4KH2A 1TMQA 2D1ZA 2J7DA 2WHMA 4JL2A 3W29A 1CXKA 1TZ7A 1HJXA 1VF8A 4B9YA 2WANA 3GXIA 2J8GA 5AYIA 3EMQA 3SCOA 1UZ1A 3OBAA 1DP0A 2WCSA 1AQHA 3UR8A 2J74A 1US2A 1W3LA 4B9ZA 3WNMA 3AZSA 5I5RA 3WQ8A 4OIFA 1C91A 1HN1A 3WDHA 3AS0A 5D9PA 4Z2GA 4AD3A 3PZVA 4PMOA 2W92A 4M8UA 1VEPA 4MDPA 1UWTA 1NP0A 2GK1A 1UD8A 2VCBA 3QR3A 1BPLB 1V3HA 1J0IA 4QAWA 5A8PA 4UZSA 1JNEA 4AIUA 4PMXA 1V08A 1HJVA 1W2PA 1ODZA 1BVZA 4XZBA 5EB8A 3GBEA 2RGLA 4BQ2A 2PF0A 3WL0A 3POHA 1P6WA 1JG9A 4E4PA 3WUEA 1PIFA 4P8XA 1QNSA 2YL6A 1BLIA 2OLHA 1C93A 4QLKA 3OLIA 1YQ2A 2PWHA 3WUGA 2YKKA 2J25A 2B31A 1IZKA 8CGTA 4UQCA 2CNCA 1CXEA 4JHOA 1H2JA 2F2HA 1A47A 2BY3A 1V6XA 2WPGA 3S2CA 1H09A 4BQ5A 4LYQA 2ZICA 4MADA 1V6YA 2O9OA 2DT0A 2EEXA 2W63A 5BXRA 3WENA 2JF6A 1SR0A 2FHFA 3WQWA 1E3ZA 3DYPA 1BYCA 3AICA 2QMJA 5JUVA 3GNRA 1CGYA 5GQBA 3SCPA 2J7EA 1QBBA 3VTRA 2O9RA 4GO9A 4W7UA 1QI4A 1B2YA 3WEOA 5M17A 5E09A 3RO8A 4PMZA 1IT0A 1I75A 4U31A 4MAZA 2E3ZA 4HZ7A 2E4TA 3ZIZA 2BVYA 5D8ZA 4D72A 3CH9A 3PZNA 3BSGA 1HL9A 3AXHA 2GFTA 2MANA 4WIWA 1H11A 5CPTA 4Q22A 2JE8A 3ZMRA 5A6KA 3LPPA 3FXYA 6TAAA 1X6NA 3VD9A 3IAQA 5BROA 2WMHA 4RL3A 5FKYA 1E4IA 1E0WA 1HJUA 4WLCA 3HJEA 3ARUA 1E43A 1JF6A 5A94A 3F4VA 4DUWA 1GUVA 5BXSA 5I6SA 3AS1A 1WDPA 3TA9A 1V3LA 2EO7A 1E56A 3WF3A 2X8RA 4IPNB 2EPLX 2VVNA 1B3WA 1E3XA 1JI1A 1UH4A 4RE3A 1M53A 2DSUA 1Q6EA 1EHNA 2XUCA 4IUGA 1LL7A 1LG1A 1V02E 3M7SA 1DWHM 1VFFA 1MXDA 1TUXA 3WNPA 2EQDA 3W37A 3ARTA 1WO2A 3AOFA 3MMDA 2WHJA 3WNNA 2WXDM 4FF5A 1E55A 3DHPA 3WF1A 3WD4A 1HVQA 2ZXBA 4C7DA 2DQXA 5AC4A 1QI0A 1KFWA 4V27A 4H8UA 3W27A 3M6DA 1JYVA 4AZCB 5JBDA 2VO5A 3T2OA 1CEOA 4L4PA 5M5DA 3WH8A 3IANA 1Q6DA 2ZXQA 1B1YA 5A1AA 3FN9A 3SCTA 1BYBA 3WD1A 3F5LA 3K4AA 1KGWA 3ARSA 4JFTA 4BCEA 1EH9A 4HZ6A 4DWSA 4BF7A 3AXXA 3GXDA 4HA1A 3GDBA 3KL3A 2PWFA 2BXYA 2G3IA 2VCAA 5M03A 4KRTA 3OZPA 5LYRA 3GZAA 4JFUA 2OYKA 3T2QA 5D9NA 4A3YA 1W1PA 5F7UA 1CXLA 4HPGA 1BSIA 3CO4A 1B30A 3OB8A 5GPRA 2WSKA 5A6JA 4MNLA 2G8ZA 2JF7A 1KWGA 2VTFA 2WWCA 1G5AA 1C8XA 3KZSA 5BRPA 1Y7VA 1G94A 4EAMA 1JD7A 4DWSD 3WMBA 2XGBA 1QVBA 2PI6A 4AZHA 4Z2HA 5I2UA 4HTYA 3WBAA 2WBKA 3NYDA 2WNWA 3PZ9A 2VZUA 2FHCA 1PZ2A 1J01A 2J7FA 4AZCA 1QNQA 4YHGA 3BCDA 4D6EA 2WKGA 4MNJA 3KEHA 2A3AA 2XVKA 1XRVA 3PTQA 4W87A 3E1F1 2OYMA 3MV11 1G1YA 2G3MA 4F8XA 2XWDA 3LPOA 1PX3A 3GH7A 5D9OA 4AEEA 4JAWA 1V6VA 3O2LA 2O92A 3EYPA 1TCMA 1HP5A 3MS8A 2EBNA 4A3HA 2WLZA 1TE1A 4ATLA 3W28A 1JDDA 3PTKA 3VIMA 5HBFA 4AZ7A 4P7LA 3W6LA 3CUJA 3PZUA 1MW1A 5D9MA 1SFSA 3VMPA 3OA5A 2XVLA 2D3NA 1HX0A 1B0IA 4BZYA 3FY1A 2JIEA 3AZRA 4L4OA 2UY3A 1LL4A 3TTOA 1H0IA 5FD0A 3CUFA 1OCQA 3TTQA 4GPNA 5JBEA 1E6NA 2AMGA 2AAAA 1PZ3A 3MV01 4U2YA 4DWSC 1V3KA 1UKPA 1E40A 1KCLA 3ARRA 2BFGA 1UWUA 3I3BA 4J3TA 3MMUA 3AS2A 3K8LA 2E9MA 4FMVA 4TUFA 3B9AA 1WDSA 1VRXA 1FP9A 1LL6A 3KL0A 5HPOA 4UQAA 5D4YA 4D1JA 3GH5A 1W1VA 3OG2A 3QHMA 3EMZA 3OIHA 1W3KA 2JEPA 3VNZA 2YBUA 3PHAA 4IPLA 2BVTA 1KR1A 3CLWA 3HN3A 2E40A 1E6PA 3W4RA 2VC9A 2CPUA 1WB0A 2FH6A 5HXMA 1C92A 4GKLA 2PWDA 4D6DA 3WFZA 4CN4A 4ACZB 3WDPP 4UR9A 4NSBA 2WC3A 1DEDA 1EDTA 1X1NA 1MVYA 1AQMA 3VDBA 3UG3A 3AHYA 3ZJ7A 5E0CA 4V2XA 1TA3A 3N12A 1FFRA 4M29A 3BSHA 2EXOA 3PN8A 1CDGA 1C3FA 3GBDA 4CU7A 3GNPA 3NUKA 1N82A 1EQPA 1JXKA 4DM1A 2WW5A 2J75A 2A3CA 2ZIDA 4UQDA 3QOMA 1MQQA 5E6YA 4XZWA 3PZTA 4C7FA 2ZOXA 4OBSA 4JKKA 3VIJA 1RP9A 1WZAA 2QPUA 2V38A 1B90A 1KXTA 1H41A 3ZT5A 4U5KA 5A6MA 1GVIA 2W5FA 3T0AA 5IXEA 3CHFA 3TTYA 1R85A 3UR7A 2Y4SA 2DH2A 1KB3A 4J3SA 4GZEA 1FP8A 5LA2A 2GUYA 1ZBWA 3OLEA 1MFUA 2XIBA 4F79A 1E71M 3VIIA 3VU2A 4IISA 1QNOA 4GZIA 2WVTA 1WDQA 4OUEA 4W5UA 3TTSA 4EK7A 3SUSA 3U57A 5CQ1A 1FH9A 3VIGA 2WMKA 4W7VA 1RPKA 1JGIA 5FL1A 1UD6A 3LMYA 5DT5A 1W9UA 1JDAA 2J7BA 3EDEA 1JL8A 1OM0A 3RCNA 3EDDA 5CGMA 4CCCA 4PRWA 3U7BA 1E4MM 4IM4A 4JFWA 5FIPA 3ZOAA 1GVYA 2XSAA 2VNCA 1W9DM 1CYGA 2OWWA 3CZGA 2GSJA 3WEMA 3VGHA 4U3AA 4MPKA 4KWUA 1FH8A 5DO8A 3SUVA 2YA2A 3AZTA 4W8AA 3CUIA 4TVDA 2CBJA 2ZUUA 1M01A 1RD6A 1UYQA 3AIWA 1V6WA 1ZJBA 5A6BD 1UZ4A 2D3LA 3N17A 3A47A 2D0HA 1FOBA 1VIWA 1DHKA 2VRJA 4AD0A 1CBGA 2VZOA 4B16A 2DEPA 2J77A 2CYGA 4D6FA 1OGSA 1WZLA 1XCXA 3SUUA 1CGVA 1Q6CA 3WH5A 1E6SM 2X09A 3PZOA 4EKJA 3THCA 4D1IA 1M03A 3BH4A 4QCEA 4M82A 2VX5A 5KEZA 1CENA 3AMLA 2VX6A 5CGTA 3NIYA 4W89A 3SCUA 3RMEA 2PBGA 1I1XA 1OBAA 2EJ1A 4LGXA 3JUGA 4ZXLA 1NWRA 1ECEA 1JZ2A 1H4PA 3CUGA 2ZE0A 2YIHA 1WKYA 2O9TA 1RH9A 1UR4A 4QFUA 1LJYA 2X05A 3SCQA 2BVDA 5TD4A 1UD4A 2QV4A 1E6QM 4AD5A 2XG9A 4UOJA 3ZSSA 2D20A 2WVUA 4TVCA 2O9PA 3IJ7A 5M3WA 4ZXOA 1Q4NX 2IXVA 1GORA 1HVXA 4UFJA 1J18A 5A8QA 5IHSA 1SMAA 3SUWA 5EMYA 2VCCA 2GDUA 3AMGA 3EDKA 1GQKA 3A4XA 4AD4A 2BS9A 2XTKA 3A4AA 1ZJAA 2W67A 1UR8A 4PN2A 1KR0A 2VL4A 2UWFA 1R7AA 1E6RA 1W3HA 2BV9A 3WH7A 1HT6A 1E1EA 2VMFA 4JKLA 4PTXA 2V5DA 4CN6A 4CVUA 1U30A 4UFKA 3SCVA 3T09A 4E8DA 3K8MA 5GNYA 1LWHA 4W85A 3BGAA 1WZKA 4B3LA 1MFVA 1BG9A 1EOKA 1J0HA 4GXPA 2OWXA 1HKIA 4U5IA 2YA1A 4C7GA 2XWEA 5DFAA 2WHLA 2WCAA 1AVAA 4FK9A 3SURA 2PWGA 4GIAA 4NRSA 1FA2A 2GJPA 4M56A 4TVUA 2E9LA 3AIEA 1VBRA 3LPFA 2YA0A 4UFHA 3VD7A 1TVPA 4MJ4A 4PTWA 2V5CA 1NH6A 2XGIA 1LG2A 4YN5A 3ARVA 4J27A 1DWJM 3UESA 4DWSB 1GONA 3AHZA 4J3WA 1BG4A 3W26A 4OKDA 2J4GA 1UH3A 2D22A 4TTGA 1V0LA 2WMFA 1NWUA 1R86A 4HU8A 4YPJA 2UY4A 5E70A 2YDRA 5ABHA 4Q7NA 3CHEA 4UTFA 4CGTA 3AFBA 3VGGA 2YDSA 4CUCA 1E0XA 1Z32X 1UD3A 1UH2A 1MW2A 2RGMA 1ODUA 3BLKA 3CUHA 2W61A 4H8VA 4UFMA 1W1YA 2VQTA 4PMQA 2YL5A 2XJ7A 1QOXA 4MTVA 1EGZA 3WNLA 4CD8A 3NCOA 1E6XM 4X9YA 5BRQA 5IFTA 4AY1A 4GQQA 5CSUA 4EANA 3RM9A 2GJXB 4JZ5A 2XYLA 1BYDA 1ITXA 4ZE4A 3BXWA 2WCGA 2WYSA 3AHTA 2BY2A 2ZXDA 1I1WA 1XYFA 1U33A 4UQEA 1GJUA 1BFNA 3WD2A 3AMCA 3MU7A 4PYSA 5LA1A 2V3FA 4WKFA 1TG7A 1J12A 1E5JA 4FLRA 3VOCA 3VILA 4FLOA 1CLXA 4QDMA 2HISA 1JZ7A 3TONA 4M1RA 1J11A 2NW0A 3FHAA 3WQ6A 1UR1A 5C8BB 5KZ6A 3MO4A 3GXFA 3U7VA 1V6UA 3L4UA 1V3IA 2OWCA 4WKAA 1XHGA 1OWQA 1GHSA 3VD3A 1QPKA 1V3JA 1HKMA 3BAYA 1UQYA 1R8LA 2ZUMA 4HA3A
chains in the Genus database with same CATH superfamily
1ZJIA 3L4ZA 5PTDA 4QLJA 5MKGB 2A3HA 5JXQA 4PCNA 4LV4A 4K36A 3BJFA 1NU5A 3T05A 5A8OA 3CWOX 1P6BA 3BZJA 1TA3B 1YYAA 3SN0A 5B7YA 3A9IA 3B8SA 3F2BA 1QOPA 1NQKA 1QPRA 1XPGA 2QR6A 3QEZA 2AAMA 4BY3A 3FW6A 5CAHA 1P7TB 1W6TA 2OCZA 3JW7A 5E6ZA 5A2AA 3GNDA 4X9SA 1GQIA 1PTDA 3W0KA 1T41A 1XC6A 3W1TA 3DBNA 2PDUA 3VDHA 3CASA 4XZIA 3GKAA 4XKMA 2VFEA 3DGRA 2NUWA 2WNNA 4HGXA 2BTMA 3UZXA 2DUXA 4XX6A 2ZVIA 2DVUA 4UTIA 2VEKA 3MPGA 4ZMGA 2AKZA 3TJIA 4OVXA 1KNWA 2PDNA 3WK1A 4AMCA 1AD1A 3PB2A 4NKCA 3IK4A 1VFSA 4CNSA 2CLPA 3BTNA 3AJXA 3OO2A 1DIEA 4W8LA 3MC5A 4AWUA 2HJPA 3L4TA 3LPGA 1JD9A 1F40A 4PSRA 1V7YA 3GZ3A 2ZADA 2F4EA 3AUOA 4C6JA 2VC7A 2ZRUA 3S5OA 2VFFA 3QSTA 4FX6M 1JYNA 2RUSA 3BZGA 4O10A 2J66A 2TAAA 1LOLA 5ENLA 4DZ5A 2VRKA 1ZTVA 3NQGA 3Q4DA 1PZ0A 2EPHA 4C1NB 3RJYA 1DIDA 3IGUA 4WHBA 4JPGA 1TWSA 3NQDA 4NAEA 2CZDA 3ARWA 1KD0A 1TPUA 3ME3A 2NQ9A 3O63A 1U5JA 5GJNA 3IWPA 3MUAA 3TFXA 4JFMA 4POCA 1PE1A 3OIXA 1ZBKA 4HSOA 4CU8A 1D7HA 1ALDA 5BYWA 1TJPA 3T0TA 5DN1A 3VVGA 4Y8FA 2ZZ2A 1JDCA 1RP8A 3I6TA 3UXLA 1MI3A 3PB0A 2AQWA 3ANYA 1LDCA 2HVOA 2GVEA 3EOEA 1YRRA 1B9ZA 2WBGA 1ROTA 3WUBA 4IX2A 1DV7A 1J93A 3N4FA 2UY2A 1XYAA 2UBPC 4JQAA 3SQSA 2QNEA 3WF0A 1LOQA 5K2ZA 3TQPA 4H9YA 4J28A 3LHYA 4UUIA 2CERA 4PTVA 4JHZA 1LT8A 4RZ4A 3MDWA 3RM4A 4ML4A 2KX9A 4GC4A 3QHNA 1F4AA 1UR2A 1E4LA 5A6TC 1PBGA 4Y8EA 3CMGA 4ODRA 3NPWA 4JCLA 3CBWA 3K5XA 4GI9A 3G1AA 4L72B 1D2KA 5CPSA 2JBMA 4NG3A 1DBTA 3GDKA 2TODA 3GNOA 3PPHA 3KAOA 2Z00A 1TJ0A 5HUPA 5XINA 5JQ9A 5CC6A 1QBAA 3LHUA 3PBWA 1TV7A 3PRAA 3NSXA 3VI2A 4G7FA 4HB7A 3IK2A 1PCWA 3H4GA 4XBSA 1HXJA 1DE6A 2HMCA 4W5ZA 1WXYA 1XBXA 5DCBA 2GGHA 3GHRA 3G6MA 3M0JA 4DXKA 3LUOA 1KXVA 3O5RA 1TX2A 3AHVA 4PEKA 3UPMA 3O5KA 2XFRA 3TSDA 1L6WA 4LANA 4WJ8A 4DQWA 2ACRA 4GI4A 3OLDA 4L9ZA 2PP3A 2CLOA 1AMKA 3W2JA 2RKXA 2WZEA 3WLLA 1J2WA 3SCWA 3IEBA 1C8VA 1QI3A 1PKYA 3KRSA 1BVNP 3DYMA 3WQDA 3MKCA 2GQ8A 3N3TA 1ME7A 2IPFA 3K1DA 1J6YA 3RF9A 3GTNA 4WDTA 5I77A 1K1DA 1TWDA 2GQAA 2QDHA 2QIIA 3RIKA 4A4AA 3EOUA 1U1UA 1V03A 5EY5A 2QVHA 4N7QA 4DJFD 3N14A 3WLOA 3QV9A 3SRDA 7TAAA 1R2TA 2Z1KA 3A64A 2PFHA 1OSEA 4H41A 7CGTA 3DFHA 1RA0A 1PUDA 1M65A 3V36A 4LU0A 3FFSA 2TPSA 2YJQA 4PRRA 4P8WA 3PG8A 4NJGA 3V4BA 4DB7A 1NWSA 4QE1A 3APGA 1BD0A 2Y7EA 3L0GA 1XSJA 4LNYA 3OW1A 3T4WA 2XHYA 1R9ZA 3IKGA 1H62A 3G3MA 2Z1BA 3BARA 3KE0A 4L7ZA 1FUYA 2V3EA 5U4NA 3AC0A 4TMBA 3FIGA 1TMHA 3STFA 5A69A 1GOWA 3JYJA 1AW5A 4MLJA 4BFAA 3AYSA 3SRKA 3BO9A 5HT1A 1DJZA 2CWXA 4JX5A 3W07A 4R27A 2WSRA 1GYNA 4NX0A 2WAGA 4E2OA 3DKLA 3U5YA 5E0FA 2P0IA 2QDGA 1Q6FA 4PODA 5HOSA 2V5LA 1TCOC 3ZLHA 1PDZA 2WKJA 3FVDA 3SFWA 5AC8A 3F7JA 4QNWA 1P43A 1LZOA 2J9XA 2DW6A 1A0EA 1GRJA 3H70A 3O5GA 3T2PA 1ZP3A 4JIEA 1A50A 2QQ6A 2Y61A 4H9ZA 2D73A 3AXMA 4JBRA 4TV6A 1VAHA 1TIWA 4NI3A 1JNDA 8A3HA 3SM0A 2Y62A 3RO6A 2WSYA 4X60A 2KAUC 2VEIA 4ILSA 4GYKA 2DQWA 1I60A 1ME8A 1M04A 4P7NA 1W3JA 4JHMA 4FB7A 5K3VA 1HP4A 1VJSA 2BHZA 2OODA 1QOQA 4MWAB 3TN6A 1OIFA 1VENA 3I68A 5H1WA 4A8IA 4ZPVR 1RZMA 2ZA1A 3VNMA 3NQAA 3B9DA 3LB0A 4S3CA 1TWZA 2VD9A 3R89A 4KFNA 3DN5A 4JKMA 3WJWA 3S2JA 1CB7B 3ICJA 4QE4A 3CT7A 1XKJA 4O8AA 4FX8A 1K4HA 4OE7A 3H9RB 4F9DA 5J04A 1ISYA 3GKFA 4BF8A 2ZC8A 2C14A 3S0CA 3VK5A 3ORWA 5J8LA 4DJFA 3ZLGA 3RPTA 4A8RA 3UCDA 4R9OA 3TH6A 3TWAA 1XC4A 4QCFA 1GVRA 5BXPA 1H7OA 3AXKA 3AIBA 2L2SA 4YIWA 2QYGA 3EOOA 4UNLA 2J7CA 2D0GA 2RSEA 3AISA 3S6TA 3HIJA 1M5WA 1NSGA 2K8IA 3E96A 4J2MA 1W26A 2E8ZA 4AIEA 1BQCA 1VC4A 3WJXA 1OVDA 1W1IE 1DWAM 3MB9A 4LS1A 4O8RA 3EPOA 4IPIA 2PDLA 3VUPA 5KTLA 1JPKA 2G4FA 3JZUA 5I79A 2FZBA 1EXBA 4JFLA 2JALA 1TX0A 3WO8A 3ARQA 3F5JA 4BKNA 2Z7KA 3PSVA 1H50A 1GQJA 1RR2A 2OFJA 3GU9A 4H8HA 4ITZA 3GR8A 1XH0A 4XVEA 1K9TA 4JYEA 2YXGA 1A4LA 2QAPA 3S6DA 2HWGA 2VOTA 5HK4A 1W5PA 2F6KA 3D46A 3M1ZA 2YCKX 3R6IA 3KCEA 5GPGA 3N29A 4KBXA 3S3GA 1FD9A 1B4KA 5D2XA 3MKVA 3C2YA 1DTUA 3PZGA 4F0HA 3Q65A 4XD6A 4I5UA 2NVCA 1EHAA 1LTDA 3NQ8A 4XUYA 4QISA 3QC3A 1DHPA 7REQB 2Y88A 1R6WA 4KEUA 1OD0A 4ODKA 5D8WA 1WDRA 3SN1A 2ONEA 3WDRA 3P62A 1KCZA 2VRQA 4DBEA 2PPNA 3N2BA 4OJYA 3OZOA 1X39A 3AIQA 3L4VA 1UJQA 4Q4QA 1K9EA 1GVEA 2KR7A 3F2CA 4B4FA 1KGUA 4HPHA 1FHVA 2G96A 5AYBA 4AXKA 3NFUA 2F2DA 5I06A 2ZFAA 3OBKA 2VFDA 3U3HA 3LENA 4H7VA 1J4IA 3C0QA 4GUFA 4UFLA 3UQAA 1ZJHA 4O1BA 1EZWA 2F8QA 1ECQA 1Q13A 2RHGA 5C7VA 4HMCA 2C19A 3LI0A 3AMKA 3IK8A 1ONRA 3K30A 4DUOA 3WDQA 1GNXA 5AVNA 3EX1A 4B15A 5I78A 4IH3A 4Y2WA 4DJDD 1X7IA 3KZPA 1GOQA 2HZGA 4GJ1A 4HOWA 3A9BA 1Y65A 4ZVJA 2FHBA 3H55A 2FB2A 4WY0F 4JN6A 1A7XA 1Z69A 2ZUWA 3CHCA 5DBTA 3UZWA 3WSUA 1UWIA 1LQAA 4HN4A 3GHSA 3FA3A 3NQ2A 3WIJA 5AFDA 1KV5A 1JCHB 1V8EA 3GVGA 2QPXA 4RE4A 4O0KA 1E51A 1H5VA 2VCDA 2YGYA 1MO0A 3N2TA 2DSKA 2FKEA 2XSBA 3EKGA 4AXNA 1TPFA 3H2FA 4Z08A 2WKLA 2F2KA 2OELA 3BGJA 3DFOA 3UI5A 1HNYA 3CC1A 6TIMA 3TDFA 2HDJA 4AEFA 4CQ9A 1W91A 4ZA0A 3FJNA 4S3AA 5JMUA 1X38A 2VJXA 1YMYA 2Q3RA 2IXUA 3T42A 4M1BA 4MVAA 4WGHA 5E5CA 2YCIX 2WJFA 1G4PA 3MMTA 1DPMA 3VO0A 1VJZA 1YPIA 2ESCA 1AUSL 4XG1A 3U6WA 1G0CA 3OHIA 3EOLA 2XVPA 3LD5A 1F3TA 5CG0A 4HCLA 4DPQA 4X2RA 4OECA 4Q32A 3G5EA 3GVVA 1JCXA 2OLAA 5LA0A 3VOGA 3F4WA 5AN7A 4S3FA 5EMLA 3LGDA 2PMQA 3VIHA 3H2MA 2CBUA 1C8YA 1KTCA 1EIBA 4R3UA 2DZSA 4LPCA 3VFLA 4TMCA 1TV4A 1QI5A 4H6RA 1GTHA 2R1PA 1JYWA 4A3QA 4S2CA 3L12A 4OT7A 3CV7A 4TV5A 1RK5A 4A21A 1HFBA 1F4HA 1F5ZA 1B3VA 3U5UA 2A2IA 1JDFA 1UZDA 2F7FA 3P60A 1HO1A 5A8MA 1I6NA 4S3KA 2VOMA 1MYRA 2PB1A 1Q85A 2JKAA 3V5FA 2BGQA 5KMYA 2F6UA 3DAQA 3GRIA 2PDWA 3SADA 4AZ6A 3A4JA 3I65A 2A5HA 1WP6A 2I5IA 1OADA 1PX4A 4S3DA 4MSSA 4NUWA 3L9CA 1UA3A 2BLEA 4DELA 1HL8A 4PRTA 3RCYA 4MUZA 3O6AA 2J7GA 3K13A 1UKQA 1QO2A 4HBEA 3UERA 3V1HA 2W66A 4S3GA 1KTNA 3VIOA 3S46A 1X97A 1VPXA 2REQB 4IIDA 1BVWA 2CZVA 5FF7A 4BI6A 3GG7A 1ZBVA 3ZT6A 2VX7A 3CPUA 4GQRA 3I3DA 1VZWA 3G8RA 2OGJA 1O5QA 1UA7A 3UXIA 1XUUA 3RILA 1ZAIA 3W70A 2BXZA 1R87A 2Y5SA 2RUDA 1KRAC 1EL3A 4LBRA 5TIMA 4ADTA 4L6OA 1J9YA 1JAKA 3LBMA 4AZGA 1KW1A 2QAFA 4CNNA 3TX9A 3O07A 1H3GA 3M0ZA 1MXGA 5KZEA 2PDXA 2XSXA 4KCVA 4AZBA 2CZ5A 4H2HA 5DANA 4I9TA 1EJWC 1SO4A 4GIRA 1XCWA 2PGRA 3IKDA 4N9BA 4K3ZA 1XINA 4DIAA 1A5NC 3G8EA 4JNYA 3E02A 3KS6A 1OCJA 4ENLA 2X0YA 2X1SA 2XFWA 1QR7A 1LQ0A 5EA9A 4B91A 4CEUC 1AZ1A 4ERAA 3W72A 4GY1A 3STGA 4V1XA 2QF8A 1X8FA 3BLOA 4IJCA 1IWPA 3IV8A 1W32A 3IJ6A 4DN1A 4KH2A 2ISVA 1TMQA 2D1ZA 2WHMA 4JL2A 4UC5A 4A2SA 3CV2A 4RDVA 2J8GA 3SCOA 2YFNA 3HQPA 3MA8A 4A6GA 2VGFA 5FF2A 4G6CA 1WUEA 1SSGA 1AQHA 3UR8A 2J74A 4DX3A 2PU0A 4B9ZA 2I16A 2PA6A 5I5RA 3TYBA 1EX1A 3WDHA 4IFOA 1NP0A 3NPUA 1TV3A 4MOZA 3H23A 1BPLB 1V3HA 1J0IA 4UZSA 3HM7A 4PMXA 3BUVA 1H5YA 3TV8A 1QO5A 1RQEA 2PDIA 4JEJA 4BQ2A 2PF0A 5D30A 3UWWA 3POHA 4H6QA 3UJSA 4DHGA 4HJWA 3WUEA 3M4HA 3Q45A 1JDEA 1BLIA 2OLHA 3OLIA 3WUGA 3R0UA 2YKKA 3WLNA 5B7ZA 8CGTA 4UQCA 2OPJA 3CNYA 1Q7ZA 4NASA 3S2CA 3AO0A 3S5ZA 4BEUA 4LYQA 4NNAA 1V6YA 2EEXA 1OFAA 4DRNA 5F1VA 5AB3A 1SR0A 1J2BA 1E3ZA 2Z1XA 1LOSA 3AICA 3GNRA 3HPAA 3LRMA 3HTWA 3VCRA 3WLPA 4UTTA 2ZDSA 2NWRA 1ZALA 4HBKA 4NHVA 3VTRA 4C6QA 2O9RA 4GO9A 4L9YA 2R82A 1QI4A 4QDPA 3WEOA 3B7XA 4PMZA 3CAQA 4ODOA 4U31A 4MAZA 3TIMA 3EIPA 4E4FA 4YCOA 3CH9A 3H6OA 3MBFA 3AXHA 1Q6OA 2GFTA 5CPTA 4E5TA 2V68A 5LGZA 2E1DA 4L64A 3LPPA 3UFYA 3VD9A 6REQA 1U83A 3LLFA 3NQBA 3NQ6A 1XF0A 1E0WA 1HJUA 2FVKA 3F4VA 2ZDRA 5BXSA 4LRTA 3VUSA 3AS1A 1V3LA 2Z27A 3WF3A 3USBA 4P61A 4IPNB 1GJPA 2EPLX 1SJCA 3GAKA 1TV8A 4RE3A 1M53A 2DSUA 2DFAA 3R0KA 1T8XA 1EHNA 4IUGA 1LL7A 5DBUA 1MXDA 3E38A 1GG0A 1KFLA 4Z17A 2VFGA 4FHAA 4JTEA 2GOKA 3AOFA 4QEEA 4PUUA 4NY2A 1H7WA 1EBGA 4ZZ9A 1R2SA 1XI3A 3WD4A 3QQ1A 1YIXA 3UVAA 3AYTA 1FWWA 3LCWA 3FSTA 4H8UA 4B5NA 5LSMA 1IEIA 3LOTA 4IGMA 3WH8A 3IANA 5G2HA 1LCOA 2OO0A 3U8GA 3T07A 3F5LA 3EX6A 2FGBA 1WQ5A 3KZ7A 4HZ6A 5EYWA 4K8HA 3U2ZA 5FJTA 1EJUC 5AZ1A 1LLWA 1AG1O 3AXXA 3GXDA 4HA1A 5HW6A 3TAOA 2DG9A 2YX0A 3A3XA 3LV5A 3OZPA 3W1AA 5LYRA 2OYKA 4PBEA 3T2QA 2QV5A 1K7FA 1CXLA 2VWTA 4HPGA 2CZEA 3CO4A 1UWAA 5A6JA 3NI6A 1GG1A 3DZ1A 5DELA 1C8XA 3KZSA 5BRPA 3UY8A 3W2KA 1IX5A 1JD7A 3WMBA 5H6HA 2XGBA 2CWNA 3U4AA 4Y9OA 2PI6A 4Z2HA 1IR2A 5HMFA 5I2UA 4QROA 2WBKA 3PZ9A 1PZ2A 1AH4A 2CW6A 2EG7A 2VKZG 4AZCA 1BWLA 4ROPA 3QBUA 5FF3A 4XZMX 2XH4A 4I5XA 1RSCA 1W5MA 4PUWA 3HBLA 4DBSA 4TNSA 4O57A 1TE6A 4KEZA 3CYJA 4W87A 3E1F1 3KBVA 3SR7A 4FZIA 4LEQA 4C5ZA 5D9OA 4AEEA 1QT1A 4L3NA 5DMLA 4LAWA 2PSNA 4UR7A 3L21A 2OEMA 3E74A 4A3HA 1TE1A 4AB4A 2QDDA 1JDDA 2PCQA 3KP0A 4UDMA 5TF0A 3CUJA 5CGQA 1QTWA 1MRQA 1B0IA 4F40A 3LTPA 3GIYA 2HE5A 3AZRA 5K9DA 3TMLA 1H0IA 5FD0A 1OCQA 1DQWA 2IF4A 4RCXA 4GPNA 1E6NA 4O0QA 4US5A 2YW3A 2CLMA 1WBJA 4U2YA 3BVJA 5BOFA 4QT3A 1KCLA 1O5KA 4R34A 1UWUA 3CB8A 2R1NA 3LQGA 4ZL1A 1KM5A 3K8LA 4XAFA 4CEXC 4KCTA 2E9MA 1BXNA 4IXHA 2VD8A 1WDSA 1VRXA 2HS8A 1FP9A 2EHHA 2GUBA 5HPOA 4L6DA 5D4YA 2ZZ4A 3KHDA 1IEXA 4XAYA 5AC7A 2JEPA 1J5SA 2PRMA 5F4WA 3KTCA 2PN0A 1LRQA 1TV2A 3EXTA 3BOLA 4ERIA 4EWJA 1LQ2A 1E6PA 1N8IA 3E49A 3LRLA 2VC9A 4DO7A 1J4HA 5HXMA 1SJBA 2F84A 4GQBA 1TRIA 2BVWA 2PWDA 4AVFA 3TC5A 4CN4A 2ZQVA 4UR9A 4FNUA 4NSBA 4G56A 3VXGA 1DEDA 1XJBA 1EBHA 3UG3A 4AHQA 4RZ5A 4RDZA 5E0CA 1ZY9A 3BSHA 5DIUA 3E2VA 1KA9F 2ICSA 1CDGA 2H9AB 3NUKA 3O3RA 3V16A 1N82A 3E6EA 2WW5A 2J75A 2A3CA 3IUHA 4XAZA 2QJGA 3HGJA 3PC0A 1F73A 5E6YA 3RXZA 1IXPA 3DX5A 4OBSA 3UJRA 2E5CA 3P61A 1H41A 5IXEA 3IACA 2A79A 2Y4SA 2DH2A 4J3SA 1FP8A 2GUYA 1ZBWA 3OLEA 3R0DA 4FXFA 4KESA 7TIMA 4GZIA 2C79A 4XAKA 1WDQA 4M7TA 4EK7A 3VKJA 5G1MA 3CB3A 2NV1A 3SGGA 3EWCA 1V5XA 2WMKA 2X2GA 1CLKA 5FL1A 3C3NA 5DT5A 1DORA 1XYBA 5AHIA 1WDDA 4QZVB 4NJJA 5C2GA 1OM0A 1FKTA 1VP5A 4Q4SA 1G4EA 1K77A 4PRWA 1E4MM 4IM4A 3ZOAA 2CLLA 3LDVA 3R43A 3EEZA 2XIJA 1NFPA 3UA4A 4Q8QA 2R14A 2OWWA 3CZGA 1S5TA 3FA5A 4U3AA 4KWUA 2VC6A 2YA2A 2E09A 1L6FA 1TTQA 3UGRA 5C2CA 4A3RA 1UYQA 1BF6A 1M3UA 4GY7A 4LAOA 4LF1A 1XLIA 2D0HA 1FOBA 1VIWA 3W1UA 3H2CA 1CBGA 1Q5MA 2DEPA 2J77A 2P4VA 3PFMA 4WUIA 1NTHA 2OEKA 1Q6CA 5DX7A 3IRDA 1E6SM 3PZOA 4EKJA 4D1IA 1YPXA 1EF3A 4NJIA 1JNTA 3NR0A 1EJTC 4GVIA 5LZLA 1KFEA 1OX4B 2QZRA 3QMTA 3TZFA 4RUBA 2QCDB 5DMNA 2YXOA 2YIHA 3N34A 1WKYA 2FPVA 3UZ5A 1TQJA 5DIVA 5TD4A 1ZENA 1UD4A 4O0ZA 1JCMP 3ZSSA 2XP4A 4IT1A 4TVCA 3HPFA 4Q8PA 2O9PA 3IJ7A 4UTLA 2QCDA 1HVXA 1JNSA 2XP5A 1J18A 1TPEA 3V35A 5IHSA 4F2UA 3SUWA 3PJUA 2GDUA 2AWGA 5FSEC 3EDKA 4DH0A 4BK9A 5CCZA 4Y9MA 3LCLA 3D0CA 3O5QA 1ZJAA 1JGMA 1H60A 3OOBA 2W67A 3WQCA 4E2DA 2W9MA 1RY0A 4IQEA 3KAHA 4XIAA 4O53A 4JXCA 4XO6A 2V5DA 1KT1A 1U30A 4WOZA 3SCVA 3K8MA 3S9ZA 3PSWA 4AAJA 1WZKA 4NQ1A 3W7IA 3GD6A 2YA1A 1IGSA 4HYVA 2WHLA 1T11A 4O16A 1EFZA 1PIIA 4US5D 3NL2A 2E9LA 2ZRZA 1LBLA 3LPFA 3DGBA 2C1IA 2RFGA 3NZRA 3JXVA 2V5CA 1NH6A 5C55A 4J27A 4NXKA 2YZRA 1JCNA 2GJNA 3UESA 4DWSB 3RU8X 3AHZA 3VOFA 1EB3A 1E1CA 1R3QA 4EWND 2OG9A 1UH3A 2D22A 2V8ZA 1NWUA 4AUBA 4Q7NA 4FR6A 2VELA 2OJPA 4I5RA 1L2QA 3VGGA 2YDSA 1EYWA 3MP4A 2PDQA 2NLYA 4FALA 2Z2UA 1UD3A 3LM7A 4DWDA 2O7SA 1H61A 4NAEB 2FKPA 1RK6A 3BLKA 3H54A 2W61A 2WZTA 2DZWA 1OC7A 3H2NA 3T44A 4DYEA 1WXZA 1XFBA 1UMYA 3URQA 4L9XA 1EGZA 1FKFA 2ISFA 4EANA 3RM9A 3AWOA 2GJXB 3RITA 2R24A 4S23A 1I0BA 3BXWA 1K7EA 3FV9A 2CLIA 3AHTA 3GXNA 2R94A 4D8ZA 1XYFA 1BFNA 4JTIA 3HFYA 4TO8A 1TG7A 1E5JA 1F3EA 4WRHA 3M0LA 4CLMA 3IVTA 4DJEA 4YTSA 3R8HA 1JZ7A 2HISA 4DT4A 3NL5A 1J11A 3WQ6A 2XPAA 5C8BB 3GXTA 4DI8A 1A0CA 2INEA 5HUOA 1YW1A 1KM1A 1V6UA 2ATMA 3GW0A 1XHGA 3GUWA 2CFFA 2YCJA 3N6HA 5C9RA 5G4WA 1QPKA 1HKMA 2YZ5A 4C6NA 5LKYA 2ZUMA 1GJWA 1XGZA 1OFEA 5A6LA 3S9IA 1LLOA 4I9AA 1NDVA 2ZRYA 2UZ9A 2JFEX 1XSIA 2CLEA 4X3ZA 3VD4A 1R3RA 2FGLA 1CX9A 3MANA 1G6CA 3ZJKA 4P7OA 3UCQA 3KHJA 1UC5A 2WQPA 4IF2A 3ZWTA 2QT3A 3KS5A 3RUBL 4JQ1A 1E44A 3QPEA 3O5PA 3BE7A 4C6EA 3CAWA 4HCHA 3PBMA 4GACA 2PUZA 1XRSA 1SFJA 3PBVA 3F5KA 4LB3A 1CXFA 4XV0A 3MSGA 3GNNA 1P0EA 4FLQA 3KCOA 5A2CA 3ZVHA 3MUY1 3IJ8A 2Y78A 3NYZA 4GZ7A 2WK2A 1SMDA 1FHLA 1GW9A 3WMSA 4TQTA 1PYMA 4RX0A 3APTA 3O0FA 1HG3A 4PC8A 2VEGA 4KIEA 1EA9C 3ITVA 1QHPA 1ZAHA 1UBPC 4PCTA 3KBJA 2OX1A 4MWAD 1BAGA 2GZXA 5ABEA 4V15A 2ZR6A 2Q02A 4NNRA 1U1HA 4QHRA 1SSDA 2ZX9A 1FBAA 1TZ9A 5XIAA 2XINA 1SW7A 4Q3MA 1M9HA 1X96A 4JTQA 3W23A 3UG4A 3C61A 3C2OA 3A6OA 1QXLA 1W31A 2ABBA 3MP3A 3CYVA 2A4AA 2PTZA 3ARPA 1P48A 2YYTA 2DSZA 4ZQPA 3SCNA 1QI2A 2ZC1A 1XV8A 2PD9A 3O5LA 3S4TA 3WEZA 4ZSTA 3GTXA 1NDYA 3S8HA 4KGLA 4QLLA 3INPA 4UR8A 2V69A 5LNSA 4GC3A 1J0ZA 1DWIM 3WDJA 1OZQA 2CCRA 2WM0A 1XIHA 4HU3A 1XICA 3VNYA 3G1YA 1WUFA 3A3HA 1E73M 4LSBA 3XISA 3PZIA 4LJ3A 3HGOA 1C7SA 4ZR8A 4JN7A 3UF8A 3BAXA 1XLCA 2P10A 4J9JA 4N0RA 3WJZA 4EF8A 1GEHA 1DWFM 4C1LA 3M9YA 3JS3A 2JKPA 3S47A 2DJLA 2LKNA 4DO4A 1KCKA 4QQ3A 4F4RA 3GG1A 4DUVA 4J4OA 2BHUA 4LUIA 3HZ3A 4F3HA 2D2OA 3GXMA 4CD4A 4HJFA 2XIMA 2BHYA 1XDLA 1I2PA 3E5BA 2FAPA 3L4WA 4JIQA 4DZ2A 1A0DA 1JQVA 5LXXA 3WH6A 1XD0A 4OV4A 3UETA 1EQ3A 4DZAA 1J96A 1B5TA 1Q8AA 3G0SA 5XIMA 1NFBA 3TQKA 4HKPA 1EQCA 3A3WA 1Q6GA 2NT0A 2VM8A 1Y0OA 3HU7A 3CAVA 2P53A 2WPBA 4CNPA 4LVDA 2V5KA 2PP1A 3G2GA 5CZTA 4NZJA 3D6NA 4LAVA 2WZIA 4WOQA 3VKBA 3V5OA 2ZRWA 2UV8G 4MNMA 1B3ZA 3KACA 3D5HA 4H04A 5F2IA 4YVPA 2BXVA 2BG5A 1BWVA 3WD0A 5FACA 5G4EA 1Q6HA 2DVTA 4W88A 3M5VA 3PBYA 2WM1A 3MKKA 3PZQA 4HK6A 4YLWA 5BWFA 1JZ8A 2RUQA 3O5OA 2DG3A 1S3TC 2WWDA 5LNWA 1GYMA 1N2VA 5DCDA 1IQ8A 1OC6A 1WKDA 1T5AA 4ZPWR 1I8JA 3LGGA 2D69A 1TREA 3BCFA 1PS9A 2PE4A 1HL2A 2HPIA 3NM1A 4F2TA 1ELSA 3N2XA 3WH9A 4LNCA 2NX1A 3LCXA 2I1OA 2XIIA 3VKAA 3VGBA 4ICNA 3CGMA 2A6LA 3PBGA 4TOQA 1PB0A 2OSXA 2CBVA 3O6DA 1KQZA 3UZJA 1DKWA 3BMWA 4YTRA 4EPEC 4LVAA 3VOHA 3HPSA 2ZX5A 4MAVA 4M51A 2NV2A 1EPXA 4W84A 3EA3A 1JIBA 3OEXA 1CCWB 4ORIA 3YPIA 3KM8A 1RLDA 4J35A 4GFIA 1ZK6A 2TSYA 3WLIA 3OGSA 1HXVA 1LM1A 1KFBA 3BG9A 3C2FA 3NA8A 3GVWA 4CD6A 3BMXA 4EXBA 3W02A 1Q6IA 4JFJA 2V3GA 3IIXA 4RKAA 3RM8A 1GOOA 1ENUA 5I23A 1QRQA 4XTDA 3RNDA 4ODMA 3IV3A 1U2YA 3NDZA 2W4XA 3SIMA 3QLDA 2X16A 4KRUA 1EPVA 2J62A 3W1XA 4MF4A 4H83A 3DESA 4PUEA 1Q2SA 2XZ7A 3FAXA 5JH2A 3WQGA 1FWSA 3N1AA 2DH3A 2PWVA 5CLWA 2DZXA 1OFBA 8RUCA 2Z25A 1D7FA 2HBXA 2RJGA 3EX2A 1VEMA 1FH7A 2C0HA 1QPOA 2EULA 3OYXA 5BMWA 3LZ5A 5AHFA 4R85A 3VPLA 4D6IA 2OO6A 3NZPA 4Z1BA 3DBPA 1Q6LA 4UTWC 1GVFA 4F9JA 2FZDA 3GU0A 3M07A 2WHKA 5CH9A 2QW5A 1MZHA 2VFHA 2MF9A 4O15A 5HWJA 4JDYA 5H91A 4WD0A 1ADOA 4TXEA 4UOQA 3UWYA 1H49A 3IJ9A 4H01A 3QHOA 3LK6A 2G4JA 2WVVA 2V30A 4ADSA 2FYMA 4HZ8A 2AKMA 3M16A 3FHQA 2P3ZA 1FWHC 1X6LA 5HQLA 1OX5A 4IIEA 3UY7A 2YR1A 3R4IA 4Q6XA 1ZCNA 3ITXA 5MF5A 4AFYA 2GGIA 3MHUA 5FA5A 3KOWA 3CHDA 1IV8A 4O52A 5CC3A 2EPOA 5BU9A 2XU2A 1UP0A 3BJTA 3GE7A 5CG7A 3SZ8A 4Q7BA 5JVLA 1XBYA 1ME9A 1R3SA 4DRJA 1YNYA 5EGRA 2Z1SA 3CT2A 4O1EA 3C6CA 3G1HA 2YCLA 2VC5A 3DFPA 2VT0A 1ICPA 2QUTA 4V33A 4UOZA 1QHOA 2VZSA 4IPXA 3FJ6A 1J0JA 1CXHA 3J7HA 2YCEA 3CU2A 3EKZA 1ADDA 1S46A 1SVDA 1PYFA 4MDOA 4IT6A 4ZOBA 1GCYA 2PTXA 2ZZ5A 1NMVA 4J1OA 3LI1A 1LRTA 1FHDA 1UG6A 1VFTA 3HGRA 5BMXA 3UZZA 2HCVA 3QMRA 1PHQA 3LZ3A 1O1HA 1XX1A 3VIFA 3NO1A 2G95A 1SZEA 3GU1A 1JAEA 4D6JA 2AQVA 4Q33A 2INFA 3UQBA 5HANA 4RPQA 3QY6A 1SJDA 3ARXA 4NVTA 4PBGA 3TP4A 3F2DA 3W73A 1OIMA 1NP2A 4WXYA 2C8NA 3OTRA 1GQNA 4UFIA 2PDMA 4G5DA 1A5CA 1VCVA 3G0XA 3RU6A 2V5JA 2PODA 2CESA 4UIOA 3WD3A 1YLVA 1J5TA 2DZPA 4QS5A 1VEOA 4QJ5B 2QLYA 3L7RA 4S1FA 1QFEA 3TC7A 1C9HA 3QW4B 4GINA 3FEQA 4XB3A 3FDGA 3W9ZA 3GFYA 1BXBA 3P5ZA 4LVFA 1UKTA 4PE8A 1R30A 3C8FA 4BI5A 1VHNA 3B9NA 5HQEA 2GJRA 4XTIA 4PB3A 5J5RA 1LWJA 1OY0A 1X7FA 3H24A 2DT1A 1JVNA 2YLAA 3MCOA 4IG2A 2JIWA 5H8PA 3DFSA 4KWWA 1KM2A 1P1XA 3M46A 8XIAA 3AIUA 1OT2A 4BR1A 4U86A 4A29A 1NF7A 2DDXA 5HATA 1Z42A 3T0DA 1W9BM 1C9DA 4Q8WA 3E5PA 4MM1A 1P0DA 3KTXA 4HVXA 7PTDA 4G50A 2V9DA 3DG6A 4R33A 2A0NA 3WLRA 5D03A 4IPJA 3GM8A 4LUYA 5DMYA 3CL8A 1LYXA 1O95A 4YVXA 4O28A 1W2VA 4QBXA 1BTCA 1GZGA 4MFDA 4OOUA 2X1IA 1CLVA 4KIRA 3QR1A 2VEPA 3RLUA 2X7VA 3DKJA 4NYUA 2XP7A 1W9XA 2N87A 4PMYA 3S2NA 3KTSA 4P7RA 1NM9A 4NZ3A 2VR5A 4G7EB 1PL9A 1JI2A 3WQVA 2YB1A 3WELA 3NQFA 1XW8A 1FKHA 3R5EA 4WSJA 2MUCA 2CKSA 5GVJA 2CLKA 3LSCA 5CSYA 1A5LC 2HPMA 4WEVX 3L5LA 3AUJA 2WV8A 2IQTA 1ONEA 2QCGA 4E4UA 1OF6A 1LBMA 1GVQA 2ZZ1A 4JCMA 5IDZA 1F8IA 3GC5A 3VIKA 3RFAA 5HW8A 3BMVA 3PTDA 1CTNA 2O56A 2PDPA 9XIMA 5AC6A 2Z1VA 1NOUA 1UUQA 5D02A 2ZQTA 4J3XA 2DT3A 3TC3A 2OKOA 3GYCA 1R7OA 4QG8A 1B3XA 3LY0A 3LU2A 3H7RA 4KMQA 1FAPA 3LGEA 5IBXC 4UCFA 1L6GA 4F2BA 1VYRA 3WDIA 3CH0A 2QPSA 1DXIA 4KCUA 4MKVA 3B0PA 4J3VA 3DG7A 4IIFA 4HSHA 4IJRA 3F1QA 1VFUA 4LFYA 3VNKA 1GHRA 3HOJA 1TV5A 5HWBA 1E0VA 1SM9A 2EPMX 3VINA 3O5EA 2QUNA 3TDBA 3BG5A 2YDQA 2RQSA 3CZLA 4ZB2A 1FWTA 4NZFA 3W7EA 4UB9A 4NRRA 3VM7A 1M7PA 3S42A 4XSMA 1ESWA 1KLYA 2ZWYA 3H4XA 5IFPA 2HVMA 3V7PA 4A22A 5G1YA 4DUXA 2AMXA 3EX3A 4S3JA 1KC7A 4EPKA 2EJAA 7A3HA 3K4DA 1O6IA 1FWJC 4E38A 1ICQA 4MWAC 4GK8A 4MB4A 1VBUA 3LMZA 2C13A 1QW9A 1VRDA 2CITA 3KRBA 4Q6JA 4TTUA 2G41A 3UI4A 2OQLA 4G1KA 3RGTA 6XIAA 2DZAA 3OOQA 4C5YA 1F76A 2PTWA 3GVRA 3N04A 4ZE5A 1DWGM 1F61A 1H1NA 1NIUA 5CC5A 1KGXA 4TYOA 3JRKA 3NM3A 3SB0A 1DJXA 3THDA 4ZOCA 2IW0A 3DH7A 4F0RA 3EPMA 3B8IA 1PX8A 4Q8OA 3GG0A 4MJ2A 1SU5A 2GLKA 3A5FA 4PTMA 3LM3A 4WF7A 1B57A 3Q67A 3W6YA 1XDJA 2ZX6A 1Z8AA 4C6PA 1FKDA 3K8KA 3QLLA 4ALDA 1JF5A 3CQKA 1NVMA 3EOSA 2B0MA 2X41A 4BA0A 4QM1A 1Q1CA 5BWAA 2ZUVA 3AXIA 5LGXA 1HIZA 1WZMA 2OSWA 3MP5A 4PCPA 3PG9A 3TYEA 3L2LA 1V6TA 2W27A 1XRFA 4B5WA 2B7PA 3EWYA 2E6FA 4DF0A 3SUTA 2PTYA 4H00A 4HPNA 3CIVA 2JGYA 3M0XA 4HQVA 3R12A 1RJPA 1ZGDA 6CGTA 4FP1A 1E4NA 1R3VA 5CLTA 1VFMA 2W62A 2X2YA 1YDNA 3MZNA 3P7YA 1O94A 1XIFA 3PZMA 2O55A 1R3TA 4AYSA 4QSFA 4W9TA 1KXQA 3QH2A 3NDYA 3CZEA 3T81A 3IHZA 4BQ4A 4LW7A 2ZZ6A 4QS6A 3URBA 3B8VA 3RLHA 3BANA 5AYIA 2OKTA 4DVOA 1UZ1A 3EEGA 1RQHA 3M0VA 1RCOB 1DP0A 3KBMA 2RDWA 1US2A 3D3FA 2X1TA 1W3LA 3WNMA 3AZSA 1XLEA 4GY0A 4I3GA 3WQ8A 4OIFA 1O4UA 3WJSA 1ML1A 4M8UA 4ZQMA 4K8GA 1IE7C 2GK1A 1UD8A 2VCBA 2VGGA 2Q6ZA 1FXQA 2AL1A 2BODX 4QAWA 5A8PA 1JNEA 3LX9A 2EG8A 4H9VA 1GVOA 1BVZA 3SECA 3KOZA 2FFIA 3R94A 3NNTA 1JG9A 4E4PA 3BLFA 4C6CA 4NNBA 1QNSA 4OHQA 1C93A 1MNZA 4QLKA 3CIWA 4JGDA 1CT5A 1YQ2A 3EA1A 2B31A 1TPDA 2CNCA 1BTMA 4JIPA 3SY1A 4GG9A 4ODPA 1A47A 1V6XA 2WPGA 1JCJA 2ZICA 2O9OA 2PWUA 1QWKA 2FHFA 3GB6A 1DE5A 3DYPA 3NGJA 1BYCA 1FKGA 3E0WA 3M0IA 1CGYA 4LS2A 4GVHA 3KOXA 4O18A 5FAJA 3WLHA 3PJTA 1HQTA 1KBIA 3DIPA 4NX5A 4W7UA 1UUMA 3M0YA 5I3HA 1O66A 3W88A 5M17A 4XISA 1I75A 1NEYA 2QGYA 2E4TA 4IFKA 4DIPA 1XIEA 4EXAA 5HJXA 4FAMA 5HNRA 3PFRA 1VLWA 2JE8A 5HMDA 6TAAA 2FMNA 1J6OA 1U22A 2WMHA 5FKYA 3E0VA 1E4IA 4WLCA 1YXCA 1NAL1 3GU2A 5DY2A 2OQYA 1N1AA 2FJUB 5G2WA 4L1GA 1IWAA 7ODCA 1OX4A 2HK1A 3HA1A 1WDPA 2X8RA 3W71A 2VYOA 5G5IA 4LOCA 1B3WA 1TWWA 5LHFA 2QDEA 2XUCA 4NZ5A 4DROA 1LG1A 1V02E 3M7SA 5HMEA 1VFFA 2V67A 3HG5A 1GEQA 3W1PA 1T99A 4FPSA 5LIWX 2RDTA 4Q4OA 2HRWA 3TZNA 3KADA 1WO2A 3UPBA 3IRSA 1K4GA 1RQBA 1UJPA 3HV8A 1LORA 1F8MA 2HE8A 4OQVA 1PHWA 4P2VA 4IQCA 1OZMA 1KFWA 4V27A 5BW6A 4DRHA 1ZFJA 4GQGA 4AZCB 5JBDA 2VO5A 1CEOA 4LCQA 1Q6DA 3ODKA 4Y9PA 3FN9A 2OFNA 1Y0EA 1BYBA 3RG6A 1QPNA 4BCEA 2AQOA 1TCDA 1SZFA 4FNSA 3MBDA 3USZA 4LV9A 4BF7A 3GDBA 3W83A 3LLDA 2BXYA 4C1KA 2CU0A 3WLSA 3LCFA 1REQA 4A3YA 3SDOA 1B30A 4IQLA 2WSKA 2JF7A 3BCJA 3DHFA 1Y5WA 1G5AA 4QDWA 2TYSA 1Y7VA 3HPXA 4EAMA 3BG3A 4DWSD 3NZQA 4QQUA 1QVBA 2Y89A 4JN8A 4HTYA 3GK0A 4ROQA 5AYXA 2WNWA 3P80A 2ZA2A 2VZUA 4QG9A 1B3OA 4F0KA 1J01A 2J7FA 2IPWA 4M6QA 3GPKA 2EG6A 4JNMA 4GNVA 4YHGA 3BCDA 2WKGA 3LXAA 1XLJA 3WJYA 3G1DA 2A3AA 2XVKA 1XRVA 2D9FA 3UT0A 4HBOA 1YTEA 2OYMA 2PS2A 3L68A 1VJIA 4FEZA 4JTSA 3KLKA 3EYPA 3BJSA 4I8DA 3MS8A 2EGZA 1Z7AA 2PC4A 2EBNA 1OF8A 3W28A 1X8CA 5HBFA 3NO3A 4AZ7A 3QC0A 4DJEC 3VMPA 4AWSA 3CL6A 1PZ1A 1HX0A 4S2BA 4RV3A 3NQCA 5AYYA 4BZYA 3CQIA 4I7VA 4EPDC 5HTGA 1IGWA 1S2UA 2Z29A 4MWAE 4L4OA 3QXBA 3OVPA 1LL4A 3TTOA 2H8XA 2CLHA 1S38A 5JBEA 4FAPA 2AMGA 2PD5A 3MYOA 1PZ3A 1BWKA 1XYLA 4XKYA 2RDUA 3O1NA 4WXZA 2ZTJA 1UKPA 1GZ1A 3ARRA 1W1ZA 3P8IA 5TNVA 3I3BA 1PWLA 3MMUA 3BMBA 3SFKA 3FVMA 3I4EA 4TUFA 3B9AA 1F6KA 1R9HA 3NPXA 3OG2A 3URAA 5A8GA 3EMZA 3OIHA 3VNZA 5LIKX 3DU0A 4JDBA 3PR2A 2NXGA 4R53A 3C0SA 1QCWA 1TJRA 4ZQRA 4GKLA 4PZVA 3H7VA 2XN2A 2VENA 4MG4A 3WFZA 4ACZB 3WDPP 1QATA 3BGGA 1DJWA 3G1XA 1UUOA 4PFMA 1MVYA 1AQMA 2XN1A 1G4SA 1TA3A 1YXYA 4KEMA 4M29A 4CCZA 2NXIA 4GYPC 3ATZA 3H22A 3P0XA 4CU7A 2UZ5A 3T7VA 1GKPA 4M7SA 3JR2A 3TYAA 1JRCA 3UXAA 3QOMA 2VDGA 4LCRA 2NLIA 1TPC1 3WFAA 3VIJA 2P8CA 1KXTA 5HJYA 5A6MA 2YB4A 3UR7A 1MDRA 2LLEA 4XD4A 4XVDA 4F79A 4PMJA 1E71M 4WDUA 2QCCA 1QNOA 3STEA 4ZO9A 2WVTA 4OUEA 3W1RA 3U57A 5CQ1A 1FH9A 1VBJA 3CO8A 1SW0A 4EACA 3QQWA 4HNCA 4WGXA 3WBYA 4HTBA 3LMYA 3MY9A 1IT7A 3EDEA 4GVFA 3UWQA 4ODQA 4O17A 3EDDA 1P5QA 4CCCA 2GDQA 2FQIA 5FIPA 5DXYA 3NRKA 1GVYA 2VNCA 4O1AA 3F4DA 2GSJA 3WEMA 2DP3A 3VGHA 4K7YA 4MPKA 4J4NA 3CUIA 2FZNA 1REQB 2ISSA 4PTDA 3W1LA 1V77A 1V6WA 4GCAA 1ZJBA 5A6BD 4QITA 1ONXA 3TE9A 3JVAA 2VRJA 4AD0A 3MUCA 3W7CA 5D2TA 4QXIA 4D6FA 3SUUA 3E0IA 2IS7A 1D7KA 2OU4A 1PWMA 1US0A 4QCEA 2VX5A 3AMLA 3VFCA 3SCUA 3RMEA 2J13A 2PBGA 1OBAA 2EJ1A 1P7TA 3JUGA 1GPWA 3ZVHB 1NWRA 1A5AA 3CUGA 1F6PA 4E0CA 4QE5A 1MUWA 1RH9A 4LY4A 3GNXA 2ANUA 2W3ZA 3ZS4A 1EJ7L 2D20A 4Z1CA 2ZA3A 2I57A 2WVUA 2NSOA 1KO0A 3SAZA 5M3WA 1VD6A 4ZXOA 3H2EA 1GORA 4QSHA 3B03A 3XIMA 1XM3A 1ZPTA 1SMAA 3O5IA 2VCCA 2PRHA 1VHCA 2I5GA 2NX3A 3AMGA 3QYQA 3A4XA 4AD4A 3A4AA 2TMDA 4EF9A 1RBLA 4LT9A 1V93A 1UR8A 2FLIA 5HW7A 4HYRA 2UWFA 4RDYA 1X98A 1HT6A 2VMFA 4PTXA 4IG2B 3N4AA 4ZQNA 2CXEA 4UFKA 5HINA 1QAPA 4W85A 1MFVA 1EOKA 1N8FA 1AVAA 3ABSA 4GUIA 1GOXA 4IFKB 3QPYA 4BEQA 2GJPA 4IOTA 4MJZA 5FF4A 2PV2A 2YA0A 1FKJA 2YXXA 4JTAA 1LG2A 4YN5A 3VAWA 1I2OA 4JTKA 4K1WA 4CQBA 3W7JA 3WLTA 4GQ0A 1AL8A 1GONA 4J3WA 1BG4A 1XLDA 4OKDA 5CAKA 2J4GA 4TTGA 1V0LA 4HU8A 4NZ1A 4GBUA 4H6KA 4UTFA 3AFBA 3ZYZA 3THQA 1SFTA 3SJ3A 1E0XA 3P84A 3ITLA 4RZ6A 3W7OA 2IMRA 3PJXA 2OEJA 4DEFA 4H8VA 1W1YA 1TZZA 5EMMA 1VPYA 2YL5A 4QRNA 4KW2A 1QOXA 4MTVA 3C0JA 3S2MA 4O13A 4CD8A 4QAIA 3HQOA 1SUXA 3EKLA 3A13A 4HHMA 2ITKA 3HFTA 5D75A 1ITXA 2DZTA 2ZXDA 3V75A 4LS0A 3AMCA 4HT3A 2V3FA 4R7WA 3C0LA 2O4QA 4G8TA 1D8CA 4O4WA 4OTKA 3VILA 5K9CA 2H6RA 1CLXA 4NAFB 3B06A 3TONA 3FHAA 1UR1A 5KZ6A 3LNPA 4IMEA 3LG3A 1F8AB 3Q94A 3GXFA 1V3IA 4WKAA 1LP6A 1OWQA 3VD3A 2R8WA 1V3JA 1UQYA 1ZCCA 3NPVA 3U9IA 4NJKA 2NSXA 1YNQA 3G0UA 3LCHA 4US6A 3NG3A 1W5NA 2ACUA 1EJVC 4N9EA 1KBBA 5MKGA 3OVGA 2VEMA 5EMJA 4C02B 1UOKA 2NV9A 1JPDX 3TW9A 3PUGA 3CMFA 2XGZA 2ZRVA 1OYBA 3NJ3A 4DRQA 3MDUA 3LEPA 3AIVA 3MUZ1 3ZLFA 4ATWA 3FAWA 4GE8A 3WLQA 3SY5A 5E1QA 5IHRA 3W2UA 4ZTXA 4IQDA 3ZWSA 3D47A 5IM51 3CTTA 1D8WA 4WKHA 2ZR4A 4MGGA 2E25A 3HPZA 4PMRA 3Q58A 1HUVA 4UQBA 3VKCA 9CGTA 1H0GA 2WVSA 1MXSA 3BLPX 2FTWA 1GKQA 3EAUA 1U1JA 4ZO6A 1VR6A 3OQEA 3ONCA 4LUTB 3E2QA 1K8ZA 3WQ5A 4AF0A 1K9FA 1HF6A 1QZ2A 4LEFA 4PUDA 2I7GA 3B05A 4H19A 5I3DA 3ABZA 2C15A 3AS3A 3AYVA 4BS0A 3VC5A 1XIIA 5BOEA 1QMLA 3VCNA 1C90A 4GHRA 1TVNA 3FGCA 3QGKC 1FWEC 1FTXA 4LH8A 4N9CA 3BK0A 3NOYA 4ML9A 3VKKA 4CN1A 5KINA 4I90A 3UR5A 4OGZA 4EE9A 1PEZA 4CU6A 3LXBA 1GOKA 1JR1A 5MHBA 1UZHA 3NEVA 3ZJ6A 1TPH1 3CJPA 2ZCGA 2EPKX 2PDBA 4Q7IA 4FNPA 4R9XA 3FOKA 2G97A 1W8GA 1E1FA 2ZUNA 1KRMA 3GXPA 5C9ZA 1QW8A 3KVKA 5C70A 4HK5A 2ZUTA 2OB3A 3AU2A 2QJMA 4KWOA 3ARZA 2ISDA 2IQ0A 1W5OA 4BQ3A 2WMIA 3E2RA 4DBDA 4LXFA 3OP2A 5HA7A 3PM6A 2R1KA 5JIPA 1BGGA 1IYXA 4AZ5A 4HP5A 4U85A 1DXFA 3RYSA 1VFLA 2FZ9A 1UWSA 5HQMA 4IHCA 3NWRA 4X0VA 2WZHA 2A3LA 2XFYA 4PMUA 4HK7A 1W1A1 3BURA 1V3MA 1GOIA 1KBJA 3KWSA 4QGCA 3FX4A 1W3TA 3BSMA 4W86A 1WDWA 1FKXA 1WE5A 3W84A 4AWEA 1WPCA 3GTIA 4BHYA 4ADUA 2MNRA 1UWQA 3P6LA 3O5MA 4O14A 1G4TA 2IQDA 1J4EA 1JUBA 4KWSA 3AI0A 2FIQA 5F2MA 1XXXA 2BNJA 3GDLA 3KCJA 4M80A 1ITUA 1FDYA 1RBOB 3GVQA 3WFLA 4TW8A 4LUJA 2VDHA 1ZBCA 1EKOA 2WVVB 4CCDA 3L4YA 2BB0A 1KM4A 3VGEA 3LYEA 3N2CA 3NVTA 2OOGA 4LX4A 3SCSA 2OZ8A 1CWYA 2VVSA 2GVYA 1E15A 4AF0B 3UWUA 2YL8A 2EAWA 1S1RA 1R3YA 4HPXA 1ISWA 3TYDA 3WY1A 4ZPTR 3PNZA 3POCA 5ABFB 4BJHA 2DSWA 4WK9A 4MB1A 1Q66A 2Z26A 1GQLA 3VIPA 2ACSA 1UHVA 5IBXA 4V28A 5GNZA 4DF1A 4N19A 4HYWA 2NQLA 2YLLA 5ECUA 3QTPA 1KBKA 1W1TA 1SPQA 3T40A 1MEHA 4M6VA 3BWWA 4MFEA 3PF3A 3LUTA 3RDKA 3XINA 4C6OA 3N9RA 3SCRA 1ZCOA 1A5KC 5M2FX 3UBPC 4XZNX 2D0FA 3E9AA 1D3CA 2ZQSA 4NAFA 1HJSA 2D24A 3NGFA 3JZEA 3W7HA 5DCEA 3F4CA 2P76A 3SRHA 2IKIA 1OEPA 1FDZA 1FRBA 3OQ8A 1WAUA 1QASA 3IIVA 1A5SA 3ZT7A 1WOAA 3LTSA 4KS0A 5G1TA 3S1GA 4ACYA 4O11A 4C90A 1CXIA 4DYKA 1LT7A 2BX7A 1QWGA 4DO6A 1BRLA 1YTDA 4KRZA 1HKKA 3W7MA 4HA4A 2R9RA 1HO4A 3EWWA 3W01A 1FKSA 2OZ3A 3MSDA 1OYCA 3KWXA 2ACQA 4F0SA 1JPHA 1OCNA 3KVMA 4GIVA 3T78A 5BZAA 7REQA 4P8VA 4PCFA 5AY7A 3VD5A 2NQ5A 2WC7A 3WNOA 2X40A 1V79A 1KM3A 3B04A 3ITCA 1LF1A 4JIRA 1W1B1 3LHZA 3VX0A 2QKFA 1H7NA 3ZR5A 1D3HA 3PNUA 5A3HA 5AOUA 1GWJA 1KKOA 4HSNA 4QG6A 4AD2A 3H4WA 1PVNA 4B2DA 3PY2A 5D32A 4K38A 4GIYA 4QNEA 4Z2IA 1VS1A 4Z42C 3CZJA 5I0DA 4UTUA 1S5VA 3ITTA 5H8UA 3TNBA 3IJQA 4KCWA 1AK5A 2UY5A 4YL2A 3UZYA 3RLVA 3C52A 2A3BA 2Z7GA 4LVGA 4AU0A 2GJLA 1BYAA 1Z48A 2J9YA 4HMDA 2OXNA 3FK4A 2A7PA 4H1ZA 2YCLB 4X63A 3R8RA 4Q8TA 5C7HA 1E0TA 5DEZA 1BGAA 1DOSA 2MLZA 1JFHA 3QZEA 1G9HA 5FCZA 4EPBC 5BOOA 1C8QA 4AISA 2RURA 4K7VA 1UD2A 1UR9A 3B40A 1AD4A 3F4NA 4WSKA 3THAA 3JYMA 5J6EA 4GI6A 2IKJA 1EUAA 2BY1A 5HR6A 2C18A 3MI3A 1UPMB 5LNRA 5HPCA 2FDMA 7ENLA 5DF0A 3WYZA 1VIZA 4LUSA 5SWUA 3NTPA 5A95A 3UG8A 4GYJA 4FNRA 1MDLA 1TR1A 3ANUA 4MZ8A 3EXRA 1T0OA 4M81A 1CECA 3RGCA 3O5DA 3B9OA 2EKGA 2GGEA 1PPIA 3N6JA 4TW7A 2J8TA 3N73A 4MY8A 3MTWA 3ERPA 3IIZA 1XSKA 2YPIA 3LQLA 3MT1A 1GW1A 4GO8A 5KSWA 1V0NA 1POKA 4LBUA 1PCKA 4MB5A 3I6CA 1F74A 2PV3A 1XWYA 4ZFMA 2DVXA 4HOZA 4ZOEA 4W8BA 2DG4A 2FDSA 4GYPA 3SBFA 3UVIA 1XR2A 4PL1A 3M7WA 1UW9A 5E93A 3PRBA 1VFOA 1EO7A 1NDZA 1XGDA 3VCCA 2WMJA 1DVJA 1THFD 2A7NA 5FF0A 5F4SA 4GD0A 3TN3A 3ZR6A 5D09A 1UP3A 4N9DA 6A3HA 4XIMA 1XRTA 5A6BA 1EA0A 3PAJA 3ABQA 3AHXA 5A5WA 2Y8UA 4HA0A 3DYOA 4KPLA 2CHRA 2V63A 3W7NA 3EB3A 5CEWA 4QP0A 2OTDA 1YHTA 4U2ZA 3O6CA 1MWOA 3GTFA 2GVJA 2DV0A 4ZTYA 1IHIA 2ZBTA 4FO4A 1MEWA 1CPUA 4GX8A 3WMCA 3O8AA 4R7OA 3W2LA 2C7FA 3KL5A 4F66A 4M24A 2EKCA 5F2LA 2D23A 3SSJA 5EBUA 4E8CA 4B3KA 1QW7A 3EDJA 3P93A 1L8NA 4LYRA 4RE2A 3VMNA 3KW3A 4JTFA 4JX4A 1T8QA 2ON3A 4PMNA 4GZJA 1PXGA 2PBOA 2Y63A 2DIEA 4YTQA 3W76A 5HWCA 2VURA 2XH7A 2Y0FA 4ZODA 1A49A 1WKFA 3TK7A 2ABAA 3NO5A 3WCZA 4JY8A 2Y5EA 4C6MA 1FJDA 2J79A 4DZ3A 3UXKA 3LA4A 2CHOA 1B54A 4XKYB 1TTIA 1ZAJA 4DZHA 4QJ4B 4Y6GA 2V3DA 1KFCA 1JYXA 5A2BA 3C5QA 5E9XA 1I0DA 2VR4A 3N18A 2NVAA 2I9EA 1JVWA 2C0AA 4RNIA 4YMZA 5IDIA 3VA8A 1TIMA 1V02A 1ZS2A 3P0WA 3PPCA 3IVSA 1A3HA 1I4NA 2Z24A 4CNUA 2ZZ3A 2WJDA 1XYZA 2OX4A 1YDVA 1J0YA 1Z9AA 2I14A 3W38A 3ALGA 9XIAA 5DQPA 3ZQ9A 5ABFA 4J3UA 4FOJA 2DU2A 1J0KA 4Q4PA 2VFIA 3L2IA 2WSPA 1ONWA 3L0KA 3LHVA 4DO5A 4UMBA 1Q63A 3TR9A 3M0MA 2P8BA 1W9VA 5HNNA 4JX6A 3URNA 2XM2A 4B4HA 4V1YA 4KFOA 4YVVA 4GABA 4HHLA 4DM2A 5D2VA 3LS9A 4JL1A 4U33A 5CPQA 3ZO9A 3DC8A 3RHGA 1R47A 1K3UA 2DIJA 3KRUA 3NDOA 3VGDA 3FNDA 4Z2KA 1ZLPA 3NSMA 1T96A 5DT7A 3CEUA 1UR0A 4BWLC 3REQB 1O12A 3QMSA 4ES4A 1B31A 1AQ0A 3MCMA 3W7LA 3NURA 4HNLA 5EFDA 5CBBA 5JH8A 3IAPA 4AQLA 2E0PA 3T08A 1DQUA 1E72M 1TJ2A 4JFSA 1PJ9A 3P5YA 3L66A 3IARA 2BP1A 2AGKA 3RPDA 1L1PA 3MI6A 1UIPA 4B5SA 4F48A 5I09A 1VGAA 1AW1A 2DSVA 2YBTA 2FH8A 2WC4A 3FS2A 3QGVA 1BL4A 3ZSTA 3VM5A 2A3EA 2E9BA 3LERA 4TX9A 3MVIA 3II1A 2D2GA 3QF0A 1XIBA 3BV4A 2PGFA 4PL2A 2I17A 4ECLA 1UD5A 4WJXA 4D9PA 4P7QA 1CGXA 3I10A 4W93A 3STPA 4UBPC 2W0UA 1Q4WA 4H9UA 1AODA 5EU9A 3W82A 5DO2A 3MCNA 5C71A 5CZJA 3GX9A 4GKTA 1L6SA 4UQ9A 3CAKA 1E70M 4UMCA 2FFCA 4DJFC 2VWSA 3B8DA 4GUGA 3RCMA 2C91A 4D6HA 1M7OA 4IL0A 4LUTA 4ACZA 4JQ3A 2J47A 4CKQA 1E9LA 1EGMA 3U48A 3W7PA 2CXGA 4FLSA 1UKOA 4QX4A 3MUIA 5FJPA 1HKJA 1H1ZA 1O5RA 3GR7A 2VGBA 2XM1A 1VYPX 3B0YA 4K8EA 3C86A 1B3YA 4JTUA 4K2SA 1BHGA 4IMCA 3CUZA 4FR1A 4R0XA 1S1PA 4FIQA 2Y6ZA 2PC8A 2E77A 1K9DA 1PV8A 3OGVA 2QIWA 1YXDA 2OZTA 3MWCA 4O1CA