1HKMA

High resolution crystal structure of human chitinase in complex with demethylallosamidin
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
365
structure length
365
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEQSGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CHITOTRIOSIDASE
publication title Crystal Structures of Allosamidin Derivatives in Complex with Human Macrophage Chitinase
pubmed doi rcsb
total genus 125
structure length 365
sequence length 365
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1hkmA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hkmA01
2WK2A 4D1JA 5HOSA 4GQRA 1MQQA 2XSAA 4D6EA 1B3WA 3ZQ9A 5C8BB 2WZEA 2DT2A 3N9KA 4Z2LA 3MS8A 2PWDA 2E9LA 2BHUA 3L4VA 4PRWA 2CBIA 4JKMA 2WVUA 5D9PA 1EDGA 3N11A 2IXVA 2F8QA 1QHPA 2J7EA 2WZHA 5A69A 1H4PA 3VDAA 1UR8A 4MNKA 1MW2A 2YJQA 1TFVA 4PTMA 1B3ZA 1H1NA 3WDQA 3CLWA 3GXMA 2YKKA 2DPEA 1BHGA 1VRXA 2V3FA 4JFVA 1JZ6A 3N15A 4WKAA 1PJ9A 3PHAA 3GH4A 3WQVA 1V02A 3U5YA 4AXNA 4UFMA 3UERA 1UR4A 1ESWA 3L4XA 3B9EA 3BC9A 3L4TA 3NUKA 2DSUA 1EOMA 4JZ5A 2X2YA 4PMVA 3ARWA 3VGFA 1J10A 1GCYA 1HJUA 1LF1A 4FMVA 4PTVA 5BXSA 3TP4A 4CCDA 1GORA 1E3ZA 1SMDA 2VRQA 4MAVA 2J25A 4CU8A 3CHCA 4TVDA 6A3HA 2DSKA 2PI6A 5I78A 1GOOA 1WO2A 1HJXA 3F5LA 4GIAA 4HA1A 2VRKA 3WQ4A 1XD1A 3AMCA 1Q6FA 1UKQA 1QBAA 4Z2JA 3PZTA 2YL8A 3NYDA 1GUVA 3VNYA 1HP4A 3CUFA 2BHZA 4TTUA 4P8VA 2DSZA 3VOCA 4B16A 2A3HA 4D6CA 5ABFA 3VIOA 4E4PA 5JBDA 3AROA 1CXFA 1TVPA 5IFPA 1F4AA 2B31A 3QOMA 4Z2HA 3W0KA 3O9NA 3RM4A 1RH9A 8A3HA 3MSDA 2WMIB 3PZVA 1KWGA 3T0AA 1JYNA 1SYTA 3K46A 1AQ0A 1B90A 1WZKA 2O9TA 4ACZA 3HMCA 1C91A 4UOQA 2EPMX 2DT3A 1H41A 5BYWA 4MNLA 1EA9C 3N18A 1G5AA 5CZKA 1DP0A 4X0VA 4W7VA 1CGXA 2XPKA 1KGUA 1I1WA 3WN6A 3WH8A 2W4XA 3F4VA 4W88A 1LLOA 1XSIA 2E40A 1EO5A 3LPGA 1NP0A 5E09A 2W91A 3EMCA 1BYCA 3ZT5A 1E4IA 1R85A 1TUXA 2VZOA 3VMNA 2V5DA 1VEOA 1KXTA 4DWSB 4GINA 3IJ9A 2J7GA 3WENA 4KH2A 4AD4A 3PZGA 1RD6A 1UH4A 1ISWA 3NDYA 3FY1A 2D20A 4Q7NA 4QFUA 3VKKA 4ZFMA 5ABHA 4W93A 4ATLA 4E8CA 1UD6A 5IXEA 5JH8A 1E9LA 3W29A 2QPSA 4M24A 1XYZA 1WB0A 1UQYA 4QLKA 3WDJA 1TMQA 3MMUA 3B9AA 3VO0A 1U2YA 4EE9A 4FF5A 4F9JA 2VTFA 2NW0A 3CO4A 1XH0A 5LA0A 4P8WA 1K9EA 4QAWA 3RILA 4UZUA 3ARTA 2CXGA 2ZOXA 1K6AA 1H5VA 3AJ7A 3QR3A 4TXEA 2XTKA 4J28A 4HMEA 1AQHA 5GPRA 1JDAA 1E6XM 3BCDA 1ISZA 3FAXA 1E6RA 4M8UA 1GQJA 1HVXA 1ZJAA 1C8XA 2YIHA 2UWFA 1BGAA 3VGDA 2WC3A 3SIMA 1G01A 1H09A 2NSXA 4A4AA 1IT0A 1R7OA 3L2MA 4PMQA 1NWSA 1M04A 3BAKA 3SUTA 2GK1B 4W8AA 1BF2A 2FDMA 2VNCA 1GOQA 2XJ7A 4J7RA 3WUFA 1UD4A 1W32A 1JZ7A 1FOBA 2E9MA 2YLLA 1UYQA 4PBGA 3W6MA 4NRRA 4W84A 4JL2A 2EXOA 3RM8A 2WHLA 5FOOA 1EOKA 5I24A 2UY5A 5E0FA 2BXZA 2AAAA 3M07A 3ARQA 1MVYA 2JE8A 5I2UA 1KQZA 3AHXA 1BPLB 2DT1A 2VQUA 4UQ9A 4AD5A 4PYSA 2QHAA 1KBBA 2D3NA 2J75A 4H8VA 1J0JA 3AHYA 1HVQA 4MPKA 3WQ5A 4W5ZA 3CPUA 5A8NA 4L4PA 2HVMA 3CZEA 2WHMA 3BAJA 1V6UA 1V6VA 2ZUSA 1W3HA 2XUCA 3N12A 5GQBA 5C71A 1JIBA 1KGXA 1EDQA 1Z32X 1W3KA 3ZJ8A 3D5HA 4ATWA 3IJ8A 3I3BA 4P7RA 2G4FA 2VOTA 5A1AA 3U57A 1W9UA 1CGWA 1W1PA 4PEEA 4IUGA 4HPGA 1E0WA 1DWFM 5C70A 1VFOA 3BMVA 5BRQA 5A6MA 3DYMA 1PBGA 3GTNA 5JBFA 1L0PA 4M81A 1CXLA 4JKKA 4UQCA 3VDCA 2W92A 3GDBA 3GBDA 1X6NA 3VM5A 3AI0A 3KE0A 5I77A 3FW6A 1HKJA 1BSIA 1E5JA 2J7CA 2UY4A 2EBNA 1E40A 4P8UA 2ZXAA 1WPCA 3KL3A 2WCAA 1KB3A 1OM0A 2WW5A 1SFSA 2J8FA 3VX1A 1UA7A 1QNRA 4J3SA 3EDEA 1JAKA 4MTVA 1LJYA 2GDVA 3T08A 3A6OA 4Z2KA 3GYCA 3QGVA 5DT7A 5IFTA 3AQUA 3N1AA 1NM9A 3I3EA 4W5UA 2FH6A 5DMYA 4D6IA 2W66A 4HMDA 4WK9A 3EYPA 2WMHA 3WNNA 1SR0A 4X9YA 1QW8A 1ITCA 4S3JA 4MAZA 1HL9A 1H0IA 5GNYA 1BAGA 5LA2A 4AD1A 1C7SA 3BSHA 1VF8A 1NWRA 1TR1A 3CIVA 3UCQA 3PTKA 3ARXA 2GSJA 2OSWA 4M80A 3OZPA 2ZICA 3ZJ6A 1LG1A 2E8ZA 3M6DA 5EFDA 4HMCA 1UKSA 1JZ3A 3EMQA 4AZCB 1V3LA 1B1YA 5HDRA 4M56A 1FFRA 4B3LA 5M03A 1JYWA 4N0RA 1PPIA 2YA0A 4IPNB 2BVTA 3GNPA 1OCQA 3OB8A 3SUWA 1GQKA 1OBAA 3OZOA 2ZE0A 2V3EA 3ECQA 3MANA 4NRSA 2WC4A 4ZEPA 3AZSA 4C7DA 1RPKA 5DF0A 1US3A 2X8RA 3AYRA 4UQEA 1J9YA 1QBBA 1DWIM 2VCBA 3G6MA 3AS0A 1BG4A 3TTQA 1GHSA 5EBAA 2EJ1A 1A47A 1J0ZA 3VNZA 2JFEX 2D3LA 4V27A 2EPNA 5A94A 1J11A 3WKZA 4WSJA 5D9NA 1ZJBA 2GJPA 3GBEA 1UKTA 4MNMA 3K4AA 3UR8A 4AEFA 2E3ZA 1KFWA 4JIEA 2YOCA 3K1DA 4FLQA 2F61A 2WMKA 3VIPA 2PF0A 4PSPA 2ZXBA 3J7HA 3MKKA 2WB5A 4U33A 2ESCA 4YHEA 4D6JA 2CBJA 2AMGA 2OWCA 4EK7A 3OGVA 2D0HA 1UHVA 4U5IA 2J47A 4WJXA 2DH2A 4AZ5A 3POHA 3I3DA 3VIMA 3RMEA 3VUPA 1UWUA 4HU8A 3LPPA 5AY7A 3AIQA 3OBAA 2MANA 3WDPP 1V6XA 3AICA 3FNDA 3W26A 4URIA 1UWSA 1HIZA 2VX7A 2XFFA 4OIFA 4XUYA 3VIHA 4CN4A 4MDPA 3UG3A 2WAGA 1JGIA 1C90A 4GO9A 1GHRA 3AMKA 4PMZA 3VIKA 3HJEA 2OLHA 1JXJA 5HNNA 4JAWA 1BFNA 2WMIA 2C8NA 2CBUA 9CGTA 1EQPA 4JL1A 3PZNA 4R27A 4UFHA 3AIBA 3W6LA 1VB9A 4CD8A 3AXXA 1C3FA 1PZ3A 1B31A 4BQ5A 2XWEA 2BVYA 5D4YA 4AW7A 2BNJA 1YQ2A 2GFTA 2YBUA 2ZWZA 3AIUA 2XVLA 3A4XA 3NJ3A 4PSRA 1E6QM 4LX4A 5A6SA 4UFKA 4H04A 4AZBA 1H0GA 1NWTA 2JEPA 3WMSA 4PTXA 2ZX5A 4TVUA 3CMJA 3WD4A 1LG2A 2G3MA 1B2YA 4J3WA 3DHUA 1EGZA 1H2JA 3WELA 1H11A 4EAMA 1XH2A 3WNKA 1BTCA 5I5RA 4DWSA 1G9HA 1UR1A 4LGXA 1WDSA 2CITA 2WSPA 3WSUA 3WNLA 2CETA 1KBKA 1QNPA 3IAQA 1VENA 1UKOA 1ITXA 2D1ZA 4D6HA 3O2LA 5HXMA 1EHAA 5CSUA 4OKDA 2XM1A 2CYGA 1Q6GA 4OUEA 2W62A 5EMYA 1FH8A 4W86A 2J78A 2CERA 2XGIA 4AZ7A 2PC8A 5IHRA 1CGTA 3SCRA 3ZM8A 3BAYA 4R5EA 3VD9A 1GZJA 2WCGA 5FL1A 1E0XA 1UR2A 2ZUUA 1B3VA 1V3KA 2YL5A 1QHZA 2VX5A 1OGGA 1JZ5A 2VX6A 1IZKA 1CECA 3CHEA 1O7AA 2VUYA 4JHOA 4AIEA 4X0NA 2XSBA 1X6LA 1W9VA 4PMRA 3OLEA 2EPOA 1W9BM 4XB3A 2OSXA 1J12A 3OLIA 3WF2A 4UOZA 1MW0A 2CBVA 4XZBA 2A3CA 2WMJA 2CEQA 4A3YA 3S2CA 3TTYA 1ZBVA 2CHOA 1UZ1A 1VEMA 2GK1A 4CCEA 1IV8A 3QHMA 4AD0A 3WY1A 1W9XA 1B30A 3N04A 1BYAA 3MO4A 1QI2A 1ZB5A 2ZUTA 1XSKA 2ZIDA 1J0KA 3W24A 3OGRA 4PCSA 3ZT7A 4CKQA 2CCRA 4XV0A 4AIOA 4A3HA 3EDJA 1W1VA 1NP2A 2Y2WA 5CQ1A 3W25A 2YBTA 1E5NA 1W3JA 2XG9A 1OGSA 2VC9A 3W28A 4UQDA 2WPGA 4MB3A 3SEPA 3F5KA 3LMYA 2D0FA 1VIWA 4BF7A 5A6JA 4HOZA 3WIJA 3UG5A 4B15A 1B3XA 3NSXA 1JAEA 4YN5A 1H49A 3MMDA 4QDMA 3ZMRA 1IZJA 1UG6A 4H7VA 4J3UA 1XC6A 1JNDA 4LYPA 3L4ZA 1QHOA 5M17A 2VL4A 1KQYA 2QLYA 3VD5A 2WHKA 1KR0A 1G1YA 4N42A 1KXQA 2VJXA 1CPUA 4HA3A 2VURA 5E0CA 3MUIA 4GXPA 3FXYA 3PN8A 2W61A 3LPOA 1WCGA 2VCCA 1EDTA 3IANA 4K68A 3VD7A 4PUEA 3ZSTA 1KCLA 4H2CA 1PX3A 1E70M 4CN1A 1UWRA 4QLLA 3U5UA 1JD7A 1M01A 2WANA 1WZAA 2VCAA 3VU2A 5ABGA 3NCOA 1JI1A 1LL4A 2RGLA 4P8XA 2WVVB 1E73M 2BY3A 1K9FA 3WF4A 3T2QA 1JZ2A 3CZJA 3OGSA 5JBEA 4PMYA 1HJSA 2OYMA 2DDXA 2WMGA 2O9OA 4MB1A 1O6IA 2VI0A 4U3AA 3AFBA 1FH7A 2NT0A 2TAAA 3WD2A 2WVTA 1WDQA 2FGLA 4JFSA 1VBUA 4JFWA 2Z1KA 3WF0A 3BSGA 2YDSA 3ZR6A 1ISXA 1ODZA 5FL0A 3ARSA 3WEOA 4AISA 3A47A 1UWTA 1V3HA 1TZ7A 1MW1A 3KEHA 2CPUA 3TTOA 2VVNA 1JDCA 3WFZA 1W1TA 1E71M 1UUQA 3W38A 1QNOA 1GQLA 1CEOA 7TAAA 1XH1A 1UWIA 1HJVA 1V08A 4WKHA 2JF6A 3VMPA 1UKPA 4ZE4A 1JL8A 4C7FA 1MQRA 2XM2A 1Q4NX 3SURA 3AIRA 3AISA 1HP5A 3VGEA 1CLXA 1GQIA 4CD4A 1CGVA 1C8QA 1MXDA 1V0LA 3L4UA 3WD0A 1EXPA 5BRPA 3L4YA 5D9OA 4UTFA 1J18A 3W4RA 1WP6A 3BAWA 2YA1A 2OYLA 4AZCA 4QLJA 4HP5A 1HJQA 3NDZA 3AMGA 1WE5A 3ZR5A 3AS3A 4PUDA 2UY3A 3HN3A 4U31A 5CG0A 3WQWA 5BXTA 2JIEA 3MUY1 4NF7A 4PN2A 2XVNA 1AVAA 5HPCA 1L8NA 4PTWA 4TVCA 1CENA 4GZEA 3POCA 3CZKA 4NZCA 1XHGA 2O92A 1H3GA 3ZO9A 4AIUA 4CUCA 5DO8A 2Y8VA 1JXKA 4HTYA 5CXPA 1GW1A 1EH9A 4LYQA 1FHDA 1ZS2A 4D71A 4BS0A 1NOUA 4CD7A 3SCNA 1N82A 4CCCA 4Q22A 4QCEA 3SCQA 5E9AA 4CVWA 2NT1A 4DUVA 1NOWA 4LQ1A 1RP9A 2QPUA 4OOUA 4WLCA 1TVNA 3CUHA 1JNEA 4ZXLA 2XFYA 1OB0A 4GI9A 4UFIA 2ZX7A 1DHKA 1R87A 4Z2IA 2DEPA 5A2BA 4P7NA 4TOQA 2J7HA 1QI3A 2QV4A 5DFAA 1E1EA 3PZUA 3CMGA 2J62A 4ZENA 4EANA 1JZ8A 1TA3B 3GH7A 3VD4A 5AC5A 3BGAA 3PZOA 4PMNA 3WNPA 3II1A 3WDHA 5CPQA 3T0DA 5E6ZA 3RPMA 4S3KA 1FHLA 4UZSA 4WKFA 4HZ6A 4B3KA 4MADA 1ZL1A 1B0IA 5CLTA 2O9RA 2WCSA 4AD3A 2VZTA 3GXIA 2JALA 1E55A 3WDIA 2FHBA 2Y5EA 1EQCA 2DH3A 4GI6A 1WAWA 2OSYA 3WFLA 4UR9A 3MUZ1 3AS2A 3RIKA 1GNXA 3AXIA 4W7WA 5FKYA 1HX0A 2WLYA 1JFXA 3L4WA 2J7BA 2WKGA 1EHNA 1CXEA 4DUXA 3AS1A 1B3YA 1HKKA 4F9DA 3G6LA 2CNCA 4UQAA 1VEPA 4JHZA 2ZXQA 2E4TA 4FLOA 3ARRA 3WD3A 3BLKA 1MYRA 2X0HA 1AMYA 7CGTA 3AMDA 1V0NA 2DGAA 4JCLA 2X09A 1KWKA 3ALGA 2A3BA 2ZX6A 3PZQA 4ZE5A 4U2ZA 2GJXB 1TE1A 1LWJA 1E56A 3VGGA 4QP0A 1U30A 3NSMA 3GM8A 1VFUA 3UETA 2YL6A 1PIGA 3VD3A 1WDPA 6CGTA 1D7FA 2E0PA 1WZLA 3PZIA 1OIMA 4XX6A 4OJYA 2D2OA 3AYSA 3UR7A 1GPFA 2OYKA 5I6SA 2ZXDA 3ALFA 1UA3A 2J4GA 5AC4A 1HL8A 2UY2A 1CLVA 1JF6A 5CGTA 4PMDA 3TONA 1VBRA 1MQPA 4OBRA 5A8OA 5D8WA 2ZUWA 4JCMA 1CGUA 3AIVA 3PTMA 2WSKA 5CGMA 2J7DA 3K8MA 3CUJA 1JD9A 5FD0A 1BLIA 1GONA 1LQ0A 5M5DA 2OWWA 1NH6A 3BH4A 4V28A 1V03A 3MMWA 3APGA 4UQBA 4MDOA 1GVYA 4OOZA 3CGTA 3BLPX 1NOFA 1KCKA 3RO8A 1OGBA 4GO8A 5A6KA 5JIPA 1C92A 1AQMA 2OWXA 2DIJA 4W85A 2VQTA 4HA4A 2WBKA 1W3LA 3AZRA 2HISA 4DWSD 2DSVA 4W8BA 3DYOA 1LL6A 1CWYA 2XVGA 3FHAA 5A6BD 5AYIA 1BGGA 4E8DA 4F8XA 5ABEA 2EPKX 2PWHA 5HPOA 5CPSA 4OZOA 4AC1X 2W5FA 2XHYA 4NI3A 1D3CA 4MJ4A 1I75A 4H8UA 1CYGA 2Q8XA 4KGJA 4KRUA 3ZIZA 3FAWA 3U7VA 5BWFA 1OT1A 1UR0A 1E0VA 3WBAA 3LPFA 1G94A 1FA2A 4IPLA 2V38A 2RGMA 3DC0A 4BQ2A 1S46A 2PB1A 1V0KA 2X0YA 1C93A 3AIEA 2F2HA 4CD6A 1CBGA 3MSGA 3VMOA 4P7OA 4KRTA 4DUWA 3PZ9A 2BY1A 1R7AA 1W2VA 2WWDA 2PWFA 1QVBA 4CU7A 1W9DM 2BXYA 2Z1SA 1V3MA 1UZ4A 3KL0A 1W2PA 1XYFA 4NSBA 1CTNA 4KMQA 4HU0A 3VVGA 1UD5A 3GZAA 2YLAA 4WSKA 1US2A 1XGZA 3W27A 3OLDA 3GNRA 1UD8A 1QPKA 1JF5A 4CU6A 1U33A 4TX8A 3MV01 3IAPA 5A6BA 5LA1A 5EB8A 2WHJA 1V02E 3N13A 1OWQA 1C8YA 2Y24A 1JZ4A 3SUUA 3NIYA 4D6FA 2D24A 4DM1A 2BY2A 5A3HA 4JKLA 1CZ1A 1WZMA 1TCMA 2YL9A 4H41A 4WIWA 1Q6EA 5KZ6A 1HJWA 5FIPA 3ARYA 1E6SM 1I1XA 3WUBA 3E1F1 2ZX8A 4OBSA 3SCWA 1KGWA 2G41A 2WVVA 3OA5A 2EQDA 1KXHA 1XSJA 3VGBA 2ZX9A 2PBOA 3SCPA 3RDKA 2WBGA 2VZSA 4V2XA 2PBGA 2WYSA 5HBFA 2JF7A 4TTGA 2V5CA 3ARZA 1V6WA 2BFGA 4LPCA 4Y7EA 4KWUA 5GNXA 3CHDA 4UOJA 4UNIA 1WKYA 3VX0A 3DECA 1E1FA 4IM4A 1BQCA 3CHFA 3ZT6A 2DQXA 5I23A 3RJYA 2W63A 3PBGA 1BYDA 1BVNP 5AYBA 3MV11 5A95A 3VIFA 3BAXA 4GI8A 2X1IA 2ZUMA 5E70A 2WZIA 5CSYA 3RM9A 1C7TA 1MW3A 2WC7A 4F66A 1M7XA 4AZIA 4J3XA 2VRJA 5A6AA 3TOPA 1EO7A 4JFUA 1V0MA 1E15A 5A8PA 4PMUA 1GJUA 3SCTA 1BG9A 1JYVA 4BQ4A 7A3HA 3IK2A 3KWXA 3WUEA 1GOMA 1CXKA 3B9DA 4L4OA 2IUZA 1V6YA 2G3JA 2VVSA 1DEDA 2C7FA 2XVPA 1ZBCA 2J8GA 4M29A 2XIBA 1D2KA 2YDRA 3ZOAA 2VMFA 3A4WA 3EBVA 1ISVA 3JUGA 3O6AA 5GNZA 1GOKA 3SUVA 2XIIA 1ZBKA 1CDGA 3RCNA 5BROA 1RP8A 3VTRA 3FHQA 4D6GA 5BCAA 1W9PA 4B9YA 2WMFA 2XWDA 2EO7A 1F4HA 2VT0A 3ZJ7A 2VX4A 4MNJA 1A3HA 4HZ7A 2CESA 2V3DA 3B8SA 3DHPA 1QOXA 3DYPA 4GKLA 4JFTA 4LXFA 3D3AA 4RE2A 5E6YA 1R86A 3MU7A 3WUGA 5TD4A 3BXWA 2W67A 1ISYA 1YHTA 1J0IA 1WNOA 3GXFA 3T2OA 2GUYA 3VGHA 1VJZA 4BCEA 1WDRA 3WQ6A 1W91A 2JIWA 4C7GA 2FH8A 3ARUA 3OLGA 4YHGA 4U3CA 4MB4A 3OIHA 3M46A 3WD1A 2PWGA 4QCFA 4M82A 5KEZA 1LWHA 1CGYA 1HKMA 5ABFB 4ACYA 4UFJA 3CH9A 1MWOA 1QI4A 3W53A 1TA3A 4GZIA 3T09A 2VO5A 4ML4A 1DWHM 5D8ZA 1PX8A 1OSEA 1XD0A 2CIPA 4AEEA 1GOIA 3KL5A 4CVUA 3CBWA 4GQQA 1DWGM 5DT5A 1PZ2A 1Q6CA 3CZGA 4BA0A 3WMCA 4PMOA 3THDA 1QNQA 4TUFA 4ACZB 3AZTA 4AWEA 2ZUVA 4IISA 3GXDA 1NWUA 1VJSA 1NQ6A 3WF3A 4J27A 2QF8A 2G3IA 2VR5A 3WL0A 3CTTA 3PZMA 1QI0A 3VIGA 3VPLA 2AOSA 2FHCA 3ARPA 1PAMA 1CXIA 1PIFA 1NARA 1K9DA 1G0CA 4DM2A 1Q6DA 2XVKA 4FLSA 3SCUA 3WBEA 1W1YA 3T2PA 3WMBA 6TAAA 4AD2A 4EKJA 5DEZA 1E4LA 1ECEA 3VDHA 2J77A 2QMJA 1ZBWA 2BV9A 2ZUNA 3VM7A 1FFQA 4ZXOA 4U5KA 3UESA 1EIBA 5BXRA 3VINA 5CJ5A 2J7FA 1GVIA 3CUGA 1QNSA 2GJXA 3TA9A 1CIUA 4P7LA 2EPLX 2G3NA 1PX4A 4LYRA 3SCVA 2VR4A 3GH5A 3SCSA 1XCXA 4FLRA 3RJXA 1VFFA 8CGTA 5JIWA 2DSWA 2DIEA 4D1IA 4CN6A 5JUVA 4H8HA 1JI2A 1MFVA 2WWCA 3HU7A 4B9ZA 4TX6A 2WVSA 1UQZA 3PTQA 4KGLA 3EDKA 2Y4SA 2GDUA 1UOKA 4AMCA 3WQ8A 2D22A 5IHSA 1VAHA 4GPNA 2G8ZA 3OG2A 1DWJM 3THCA 2V3GA 4YPJA 3WF1A 1J0YA 2WM0A 1J0HA 5A6LA 1Y7VA 2O9PA 5FCZA 1ZU8A 1X1NA 2YDQA 4P7QA 2XYLA 3AHVA 5A8QA 3W37A 3VDBA 4PMXA 4HZ8A 3CUIA 3A3HA 3QHNA 3AHTA 4J3VA 1E72M 1JYXA 3K8KA 3T0BA 2BY0A 1GJWA 3WNOA 1UR9A 4BQ3A 1MFUA 3M7SA 4HOWA 3NSNA 4W89A 3AXHA 3VIJA 3W82A 3S6TA 1OINA 1UD2A 5EFFA 2A3EA 1TG7A 5CPTA 3K4DA 5I0DA 2XFRA 3WH7A 3WDRA 3EDDA 3BMWA 2J79A 3FN9A 4AZHA 3WNMA 4PCTA 4F79A 2QMKA 4ATDA 1HF6A 2EEXA 1E6ZA 1E43A 5BXPA 1BVZA 2A3AA 2Y8KA 1XRVA 3AHZA 2FHFA 1E4NA 1OIFA 1UWQA 4UCFA 3WH5A 1QI5A 1KXVA 2VZUA 1OD0A 3UEQA 1HT6A 4RE4A 1PEZA 4BZYA 3AIWA 1K9TA 1GOWA 2FGZA 3ZSSA 1UH3A 1LL7A 3SUSA 1JFHA 1XV8A 5A8MA 2CKRA 2WLZA 3GNOA 5M3WA 2BS9A 4CGTA 1E6NA 4D72A 1BYBA 4E2OA 3U7BA 2WXDM 3WEZA 2XGBA 4CD5A 5A2CA 3A4AA 1HNYA 1B9ZA 4RL3A 4W8LA 4HOXA 1FP9A 1DWAM 2GVYA 1OT2A 1HN1A 3WH6A 3BAIA 4FK9A 3ZJKA 2CKSA 1KR1A 1UD3A 2GJRA 4U2YA 4UFLA 2J74A 4AZ6A 3TTSA 3VIIA 2DT0A 1J01A 5I79A 3VILA 3L2LA 1FP8A 1V3JA 2WNWA 4J3TA 4W7UA 1HKIA 3CZLA 3BCFA 1JDDA 3N17A 3WH9A 4GZJA 5A2AA 3IJ7A 4MB5A 1UH2A 1ODUA 3F5JA 3AOFA 4W87A 1VFMA 1P6WA 2BHYA 3EMZA 4WF7A 2PWEA 5ECUA 3UG4A 3QOKA 4Z2GA 2CHNA 5LYRA 5CLWA 1MXGA 2D23A 2E8YA 2JEQA 3EDFA 5F7UA 4M1RA 2E9BA 3QHOA 2X05A 1JG9A 3AMLA 3KZSA 4RE3A 1QW9A 4AZGA 4HPHA 1SMAA 3W81A 4AYSA 2C0HA 5IDIA 4D6DA 1M03A 1HXJA 4AY1A 4DWSC 1V3IA 1CNVA 1FH9A 2WKLA 5I3DA 1E6PA 3WL1A 1E3XA 3SCOA 4MJ2A 1R8LA 1E4MM 1OD8A 1DTUA 1CXHA 2IXUA 5D9MA 4XZWA 3ARVA 2ZWYA 3CZ8A 3MUAA 2VZVA 1M53A 2BVDA 3K8LA 2D0GA 3WEMA 1XCWA 2YA2A
chains in the Genus database with same CATH superfamily
2DUZA 3PJUA 4ZSUA 3VABA 1OF6A 4L9ZA 2DT2A 4RDVA 1QPNA 3N9KA 4C65A 3NZRA 1M5YA 4PRWA 3WLLA 5D9PA 3UY8A 5FF7A 1EDGA 1EBHA 1J4IA 1TSIA 2J7EA 5T9CE 2WZHA 5A69A 2IPFA 3VDAA 1JCHB 4JX6A 3B8DA 5FF2A 3CLWA 3O63A 2DPEA 1BHGA 2V3FA 1JZ6A 4AC7C 3N15A 3HV8A 4WKAA 3WMLA 3WQVA 1MNSA 3M16A 1YATA 3W1AA 3OZMA 2YXGA 4C6CA 1ML1A 3UERA 2CWXA 1ESWA 3SQMA 3FSTA 3NUKA 3N29A 3FVMA 1EOMA 4JZ5A 3ARWA 3WLRA 2V68A 3IGSA 2QR6A 2I17A 3VGFA 3RN6A 3BVJA 5B80A 3W1XA 1LF1A 4PTVA 3GFXA 2AL2A 2E1WA 4L1XA 1GORA 2EULA 3BANA 2VRQA 2F6UA 4MAVA 3LLFA 4EOUA 2B7QA 1M7JA 3H24A 4KERA 1XKJA 3ITXA 6A3HA 3Q2DA 2QXWA 1ZALA 4KEZA 4C5ZA 1GOOA 4I9MA 5CZ0A 3OW1A 2QCMA 2IKJA 9RUBA 3UZZA 1K8CA 3LCHA 4HA1A 4N2YA 2WJFA 2DFAA 4QS5A 3KS5A 3W1RA 4MUPA 2XP9A 5I07A 2PS2A 5GJNA 3VNYA 1CCWB 3MY9A 4TTUA 4QITA 3VI2A 3VOCA 3TYDA 4JXCA 2XP4A 2A3HA 4D6CA 2PV2A 4ENLA 1AH4A 2OXNA 1CXFA 1TVPA 1SO5A 3QOMA 1QFEA 3KVJA 1GVRA 3O9NA 5DXXA 5E9XA 3RM4A 1RH9A 3O5MA 5KSWA 2XPAA 8A3HA 2BSLA 3T07A 4UR8A 3PZVA 5AC6A 3LHUA 1JYNA 1FXPA 3K46A 2VC6A 3IUIA 3L12A 5FEWA 2OKOA 1S3TC 4H1ZA 1Q85A 2WZMA 5BYWA 1EA9C 2IKIA 1K6WA 3N18A 1DP0A 3QMTA 5BOOA 4YYCA 1A5MC 1ITUA 3I6RA 4RCXA 1CGXA 1ADDA 1UP2A 3AWNA 1KGUA 3TYBA 4W88A 3MBDA 4DRIA 2OEJA 3EMCA 2E5DA 1BYCA 3ZT5A 1ICQA 1J79A 1E4IA 1F73A 3GXPA 2V5DA 1KM4A 3TJIA 2FVMA 1WQ5A 2V69A 4HZMA 1KXTA 2FVLA 2Z6IA 4GINA 1SU5A 1SO3A 2BASA 1BQGA 4XISA 2ZRUA 4PUMA 3N2MA 5AHFA 1UW9A 3AJXA 1A3XA 1UH4A 1ISWA 3NDYA 3NO5A 3FY1A 2V8ZA 4ZOAA 4QFUA 3W1MA 3EA1A 1ZUAX 3DIPA 3TK7A 3W29A 3EKLA 3SGGA 4QG8A 1P0KA 1U2YA 1A5AA 4FF5A 2PBCA 2VTFA 2NW0A 3BICA 3CO4A 4KEVA 1OZQA 1XH0A 4P8WA 2ZZ6A 3BLDA 3ARTA 4DROA 5HWMA 2B5UB 4KETA 4TXEA 3UPWA 3IJ6A 5GPRA 3QPZA 4FNPA 1E6XM 3M9YA 1N55A 2XP3A 1XWYA 2LGOA 4M8UA 1OFAA 1HVXA 4U10A 5DMLA 1OK4A 2ZRVA 4A4AA 1ONXA 4UWMA 5TF0A 4PMQA 3GE7A 1M04A 1RALA 1A5KC 1PUDA 4AU0A 5A6TC 3SUTA 4W8AA 2FDMA 2VNCA 3OTRA 3ONBA 2E7FA 1RK5A 2YCEA 4JQ3A 2QVNA 1XDJA 2XJ7A 4HK7A 1EX5A 1O1HA 4JTIA 1PCWA 1FOBA 2E9MA 4PBGA 1UYQA 2BBFA 4HNLA 4NRRA 1XIIA 4NAFB 2EXOA 4DY1A 2UY5A 4ODKA 1H60A 3NL2A 4PUWA 3C2YA 1W56A 1KQZA 2P0OA 4UQ9A 2GGJA 4J2PA 2D3NA 1B57A 5LIYX 3V0TA 4C6OA 4DYKA 3VFCA 2WHMA 3BAJA 4O1FA 1V6VA 2OVLA 3N2OA 5C71A 2GVJA 4S3FA 4QSFA 2J66A 4FXSA 4F2UA 1DJWA 3VOFA 3D5HA 3IJ8A 3I3BA 4P7RA 2G4FA 2RAGA 2CLMA 2RHGA 2Z1BA 1W9UA 1CGWA 1W1PA 4UBPC 4LYKA 1JCXA 3HQNA 2DZUA 3B0YA 1N1AA 1Z9AA 1L0PA 4JKKA 6REQB 4AIBA 4DPPA 3VM5A 4N19A 4KIEA 3LQLA 3KP1A 3FW6A 5I77A 4MFEA 1E5JA 4AXKA 2HE8A 4Q32A 3R1ZA 2J7CA 4MY1A 1Z48A 3F03K 2EBNA 1KM0A 2Y88A 2X7VA 3KL3A 3PPGA 3WLQA 2HTMA 2WW5A 3DN5A 3HG2A 5AN7A 3OOBA 1RSCA 4JDBA 1QNRA 3BQ5A 3EDEA 4MTVA 2GDVA 3T08A 1WBHA 4BF8A 1KLZA 4DRNA 4Z2KA 3THUA 3UZJA 3E38A 1DXFA 2C91A 3H53A 4JTQA 5BOFA 4IIBA 3PANA 3LERA 2WMHA 2NUYA 3NEVA 2YBVA 1SR0A 4X9YA 4GYPA 3LN3A 3EZ4A 3WQCA 5CZTA 3PFMA 5GNYA 2ALDA 1V6TA 4AD1A 1THFD 1FWWA 3BSHA 4YXGA 2NQZA 1NWRA 3C8NA 3ARXA 3LNMA 2XP5A 1EEPA 3F1QA 2GSJA 1VR6A 4M80A 3OZPA 1LG1A 4LUTB 2E8ZA 5IRPA 1PDZA 3MP3A 2OEKA 5HDRA 4DJFA 4C1LA 1FFRA 1U1UA 5C9RA 1XF0A 5FF3A 1QDSA 5D37A 3SJ3A 5I98A 1PPIA 2V5JA 1S5MA 3ATYA 3G1FA 3EWXA 4F40A 4JY9A 2ZE0A 3GS6A 3ECQA 3T4CA 5F1VA 4M3PA 4ZB2A 2QDEA 4DO7A 4LAVA 3TE9A 3AYRA 1LOSA 1J9YA 3V1PA 4JS3A 3BLLA 2DJXA 1FWSA 3ZVHA 1TO3A 4GXWA 4Q8QA 4F4RA 3W7OA 2CLLA 1GHSA 5EBAA 2I7GA 3VNIA 4LNYA 2D3LA 4XKYB 5LKYA 5A94A 3BV4A 3M5ZA 1UCWA 4N4PA 3WKZA 2FVKA 1ZJBA 1YPIA 4AEFA 2E3ZA 6ALDA 4FLQA 2F61A 1RBAA 5C9WA 2WMKA 4PSPA 2ZXBA 3J7HA 1VIZA 1FCBA 4IPXA 3I7QA 1JPHA 3LTPA 2WB5A 3QW3A 3GRIA 1YDVA 3B8IA 4D6JA 3T4WA 3T78A 3LV5A 3MBFA 2AMGA 3OGVA 3KCEA 2C1GA 1UHVA 4U5IA 2J47A 1JCNA 4AZ5A 4WR3A 1WXYA 4DX3A 4HU8A 1UWUA 4Q33A 4WGXA 4MSSA 3AIQA 3GFYA 3VKCA 5EMUA 1V6XA 3LZ5A 1Q63A 1VD6A 3W26A 4JFMA 3QR0A 1UWSA 1FWNA 4XZLX 2ZCGA 3VIHA 3QQ0A 4O57A 3O1NA 4YLWA 4CNPA 1KT0A 4GO9A 4DQWA 3VIKA 4V1YA 2DV0A 2IPGA 4AAJA 1VP5A 1ZHAA 2G3FA 2WMIA 3UNTA 2IS7A 2OGJA 1EQPA 4JL1A 3LM3A 3PZNA 4UFHA 3N73A 3AIBA 4IIHA 4B5WA 4CD8A 1C3FA 4UNKA 1B31A 2FDSA 3RLVA 2FPYA 3G1DA 2XH0A 3B04A 2GFTA 3IUHA 3TSBA 5DN1A 3NJ3A 4PSRA 1E6QM 3M0MA 4LX4A 3AYTA 5A6SA 3GHUA 1NWTA 1VBGA 2V81A 4LC6A 5MHBA 3WD4A 2VN1A 1LG2A 2G3MA 3B0XA 1ADOA 2H9AB 3FV9A 1KRBC 1SFJA 1G9HA 4LGXA 1WDSA 3WSUA 3WNLA 4H01A 3UPBA 1KBKA 2HV5A 1QNPA 4U4MA 1ZCCA 3OYZA 1RCOB 1ITXA 3KBVA 4P61A 2D1ZA 2RH9A 1TPB1 5HXMA 1QTWA 2YPIA 3I68A 1EHAA 2OG9A 3DEQA 4R33A 1DQXA 2FYMA 3FCPA 4OUEA 3TN5A 4W86A 3TNBA 5JVLA 1W5QA 4GXMA 1PB0A 5BOEA 5FL1A 2DZVA 1QATA 1UR2A 2ZUUA 2HBXA 3R0UA 4RZ6A 1JZ5A 2VX6A 1O1ZA 4S3AA 3IKDA 3CHEA 2VUYA 4AIEA 3GU9A 2XZ9A 2NSOA 2EPHA 1XGDA 3CK5A 1X6LA 2ZQUA 3EOOA 1P0BA 4AY7A 1KBJA 2YCLB 4XB3A 4GZ7A 3FA3A 3WF2A 2BGQA 4XZBA 3UYIA 2A3CA 4L72B 3NPWA 3UJFA 3QVQA 2CHOA 3IJDA 3URAA 1XLGA 1VEMA 2GK1A 2HK0A 2I56A 2QJIA 3H6OA 1B30A 3N04A 3APYA 1LBFA 1S2WA 5F2GA 2ZYFA 1XSKA 3W24A 4ADUA 4PCSA 4NZ4A 4AIOA 3KDNA 4HVXA 2E6AA 6TIMA 5HR7A 1IT8A 4Z17A 3Q67A 1OFRA 3W28A 4OTKA 3F5KA 4BF7A 5A6JA 3ABOA 4BR1A 3FAPA 3WIJA 1B3XA 1WUEA 1JAEA 2CZFA 4HYWA 3YPIA 2Y6ZA 1SR9A 4IX0A 2DVTA 4ODPA 1GEQA 2QLYA 3VD5A 1KR0A 4JBRA 4CQCA 1EJSC 3IPWA 4GVIA 2PMQA 4HA3A 1TVLA 2VELA 3MUIA 4RZ5A 1TJ2A 2ADAA 3TCEA 1FX6A 2GQAA 1EDTA 3CNYA 6XIAA 1HFBA 1KCLA 4H2CA 4CN1A 2ZR5A 3STCA 4QLLA 2ANUA 3U5UA 3W7RA 3NQCA 3MSYA 3RUBL 1TJRA 4ORMA 3VU2A 2KFWA 1UMYA 4L65A 4H9ZA 4P8XA 3VFLA 1UBSA 1PHWA 1OC7A 1FKIA 4QROA 4KWOA 3GC2A 1SW7A 5JBEA 3S6OA 2DDXA 1FKHA 4MB1A 2OELA 5GPGA 4PZVA 2QQ6A 5XINA 4JFSA 1RVKA 1EJWC 1PKLA 1TPVA 5LHFA 4S39A 3WF0A 3BSGA 3W7DA 4Z42C 4ZZ9A 3GG8A 4U85A 2Z2AA 3EA3A 3N4AA 1K8XA 5G2IA 2IQ0A 3OA3A 4LFYA 3W7PA 1TV4A 4AISA 2FZ9A 3A47A 3UR2A 4XWUA 3NURA 1NFGA 1XYMA 1MW1A 3TA6A 3NZGA 1I2NA 7ENLA 4YNGA 1CEOA 7TAAA 3ISIX 3S4TA 1UKPA 3I7RA 4UNLA 1JL8A 3B4UA 3A3WA 2XM2A 3H22A 3T1GA 3AISA 1HP5A 3LZ3A 4CNTA 3VGEA 3EX1A 1GQIA 4CD4A 1MXDA 1C8QA 1V0LA 3Q58A 4GVHA 5D9OA 1FVPA 4TNSA 1J18A 1QW7A 3GUWA 2UZ9A 1WP6A 3BAWA 3JYJA 1E0TA 4ZO6A 1SSGA 4C1NB 3PR9A 4UDMA 2YA1A 2OYLA 2ODOA 4AZCA 3DG3A 3EB3A 3CTLA 1WE5A 1TQXA 4JYEA 1ICPA 5I3GA 3W73A 3HN3A 1OX4B 3BMBA 1EP1A 3NQ8A 4INFA 3R12A 1BL4A 5K4ZA 3O0KA 4PN2A 2OX1A 1W17A 4ODMA 1K03A 2J13A 4LUJA 2O92A 4AIUA 1H3GA 2YYTA 2E68A 2XGZA 5DO8A 4R7JA 5HQEA 1FKWA 3UBPC 4RPQA 1ZS2A 4D71A 3N2XA 1NOUA 4H6QA 3SCNA 2P5NA 2QKFA 4FR1A 4QCEA 3SCQA 3MA8A 2WM1A 4LQ1A 3BW4A 4GIVA 4JFJA 2DW7A 1RA5A 4DJFD 1EC8A 3E5BA 2QIWA 4UFIA 2ZX7A 3BOLA 1O95A 3HG3A 1R87A 4HN8A 2NQ5A 4P7NA 2QT3A 1D7JA 5C9XA 3CMGA 3V7PA 2J62A 2JGYA 3H2NA 1JZ8A 1WXZA 1T40A 3AALA 1P1MA 2NZLA 5AC5A 1LOQA 4KEUA 4NZFA 1JCLA 3ONCA 3GVQA 2RUQA 1RBOB 4XQ6A 4XKMA 3RPMA 1KBIA 1XLDA 3WCZA 2BTMA 2VENA 2ZZ4A 4FP1A 3W7IA 3DFTA 3WX7A 2DVXA 1E55A 8TIMA 1NDVA 4WOQA 4AVNA 1WAWA 2OSYA 3REQA 2X2GA 3IJLA 4W4QA 3AS2A 1Y5VA 1GNXA 5J6EA 1PINA 3C2RA 3RCYA 1VHCA 3P84A 1C9DA 3C3NA 2WLYA 1KFCA 4KCWA 2J7BA 1CXEA 1FJDA 3G6LA 3KADA 2IMRA 4UQAA 1VEPA 4JHZA 2ZXQA 2E4TA 3ARRA 2X0SA 5FJOA 3BLKA 4KWSA 1U5JA 2X0HA 3URQA 4RZBA 3TC5A 2DGAA 4JCLA 3O07A 5KTLA 2VM8A 3O3RA 1OFBA 4KRZA 4I7VA 4U2ZA 2GGHA 4ZMGA 2C79A 1IYXA 2UZ5A 3T81A 1LWJA 1E56A 2Q71A 2ZRWA 1U30A 1M65A 5AKQA 1T5AA 3PF3A 3URBA 2BMBA 1D7FA 4IT4A 4XX6A 4JDYA 4OJYA 3DU0A 1AUSL 5I6SA 1FWRA 3ALFA 1XQKA 3EWWA 3MZ2A 4CNNA 4JFIA 1Q1CA 1UA3A 4I5XA 1P43A 1HL8A 2OO0A 1UC4A 3O5KA 1M7OA 4NY2A 3BDKA 3G77A 5DLCA 3WK1A 4JCMA 2QCFA 1OEPA 1XLIA 3AIVA 3PTMA 3SRHA 2OO6A 3K8MA 1UUMA 1YXYA 1GGOA 3S5ZA 2GSHA 4ICNA 5M5DA 2OWWA 3BH4A 4EP8C 4MDOA 3OPSA 2EG6A 2NV1A 2XIOA 1NOFA 5LIKX 1KCKA 4HARA 2VP8A 1OGBA 2EG7A 3W6YA 2ISSA 3A4JA 3UJEA 5A6KA 2FMNA 1SSDA 3SQLA 4IFKB 1G7UA 4C60A 4ZOCA 5FEXA 2VQTA 1A5NC 2WBKA 1W3LA 3L0NA 3W2JA 4DXVA 2HISA 3PBWA 1R9XA 5B7YA 4NASA 5HPOA 3GO2A 1I9CB 2WQPA 4AC1X 3HQ1A 4O1BA 3IGHX 4ITZA 4YTRA 2HJPA 1CYGA 2DZTA 2Q8XA 4QDPA 3GXTA 3ZIZA 3IIPA 4MLRA 2ONEA 1G67A 3CV1A 4S1FA 4DUOA 5C2GA 4IPLA 4BQ2A 1S46A 1QR7A 2X0YA 3LX9A 2F2HA 5T9BG 2P8BA 4HT3A 4GUHA 4GI4A 4HSNA 1JULA 1REQB 1LP6A 1SZRA 4F0RA 4HN4A 2ACSA 1QVBA 3CXOA 3IS4A 2ISWA 2A79A 1V3MA 1OX6A 2Z1SA 3FFSA 1CTNA 3GC4A 4KMQA 3E0IA 2ZR6A 3VVGA 4HIBA 4C6KA 3GZAA 3HBLA 4LF2A 5HNTA 1XGZA 3ZZ1A 3GNRA 3GW0A 1JF5A 4HJFA 3VE9A 3JZUA 4JTFA 3FJLA 3IUDA 3N13A 1OWQA 3BZGA 1R47A 1MSSA 1BWLA 1V79A 3ABXA 3GR7A 1A50A 1RD5A 5H8MA 2X30A 4I7WA 3RRXA 1I8JA 3PRBA 2V82A 5HJXA 3TAOA 4ZS6A 2QEZA 3IV8A 2KI3A 1E6SM 4E2DA 2WVVA 2G95A 2VDGA 3OA5A 3H7RA 4IGHA 5ABTA 5C2CA 4MLJA 3M0YA 1SQ7A 4TW7A 2PBOA 1UR3M 3RDKA 2WBGA 2WYSA 4X9SA 1GYLA 3CQ0A 4BKNA 4ZOEA 3ARZA 1EPVA 4LPCA 4Y7EA 4KWUA 1YPFA 1OHLA 2Q3RA 4UNIA 1WKYA 4K37A 4Z08A 2O0TA 1F3EA 1Q6UA 3BGJA 4FB7A 1E51A 4C6MA 4IMFA 3W87A 5A95A 3KRBA 1JPIA 2ZBTA 3VIFA 3S8HA 2G50A 2ZUMA 2VEKA 2WZIA 1XUUA 3RR4A 1S3HA 1TMHA 3WJSA 1M7XA 4J3XA 2VRJA 4XAYA 1DJZA 3E0WA 1RZMA 2OEMA 1NF7A 5C54A 1E15A 4LAOA 3HIJA 3DI0A 5E0KA 4JY8A 1JYVA 5HKGA 1RUSA 1D3GA 3GNXA 1IIGA 1S1PA 1CXKA 3H21A 4S2CA 1FWCC 2PU1A 4D8LA 1XFCA 4GUFA 1PWMA 2IUZA 3A24A 3U4AA 1E44A 4EPEC 1V6YA 2GUBA 3B9NA 2VVSA 2C7FA 4CQBA 3PUDA 1FWJC 2Y5SA 4LVBA 1D2KA 2YDRA 2RDWA 3ZOAA 2VMFA 3UWYA 3TC3A 4BI6A 2OZTA 3KP0A 1ZBKA 3RCNA 4D6GA 4MYAA 2WMFA 5EYWA 1JCJA 1F4HA 2VT0A 3TDBA 3HGSA 2ISFA 2AL2B 1LRNA 2FPVA 4MNJA 2D2HA 2ACUA 4DN1A 2VGBA 5LIXX 3DYPA 1DYSA 4B5NA 4R88A 4O10A 3LU2A 4JFTA 4LXFA 5E6YA 3MU7A 4S23A 3N14A 7TIMA 1ISYA 1YHTA 3W74A 3W7LA 3T2OA 1VJZA 3DI1A 1PYFA 4BCEA 2JKAA 3WQ6A 4XTIA 3GW3A 2JIWA 4C7GA 2I16A 3S47A 4YHGA 4U3CA 4JR5A 3M46A 3WD1A 2F2KA 4QCFA 3GTHA 3PBVA 4E3TA 1TPFA 3ITGA 2CLFA 1PIIA 5CJMA 5F4WA 4DH0A 3W53A 3LEPA 3QQWA 5FEZA 1R2SA 4GZIA 3T09A 3P60A 4LAKA 2VO5A 2CWNA 5DRIA 5BNKA 3UNDA 1PX8A 3M7WA 1OSEA 2I57A 4DJEC 1JCYA 4CVUA 2I5IA 1TWIA 5DT5A 4BA0A 3KACA 1QNQA 4TUFA 3AZTA 1AD4A 1TPWA 1Q66A 4J27A 1YW5A 2QF8A 4FIRA 2VC7A 3KBMA 2H3DA 3VIGA 2FHCA 3ARPA 3UQIA 1PAMA 5DBTA 1V77A 3KBNA 2XVKA 3WBEA 3WMBA 1EX1A 4ZO9A 3L67A 3SO7A 1J8VA 4PGLA 1HGWA 3UXLA 1ECEA 2J77A 2ZUNA 4U5KA 3B8WA 1AW5A 1EIBA 5BXRA 3TSDA 2HDJA 5CJ5A 2J7FA 1GVIA 2FQIA 5H8PA 3NQAA 2OQYA 3P6LA 4LCQA 3TA9A 1F40A 3C0LA 3EPOA 4QRNA 2EPLX 5HUOA 3C61A 1F3XA 2G3NA 4O0QA 2IF4A 4I6KA 2M2AA 3TDFA 1Z8AA 3QQ1A 1AMKA 3RJXA 2DSWA 2DIEA 1EFZA 2GGEA 4IICA 1X1ZA 4DZ5A 2ZFAA 3MB9A 5DY2A 4RPPA 4QG9A 7XIMA 2WVSA 1UQZA 4KGLA 3VNMA 3GLCA 4DB7A 3IJIA 1Q8AA 3C2EA 3WLHA 4AMCA 4ZSTA 3C52A 3R8HA 1QO2A 2G8ZA 3BWWA 3THCA 1W1ZA 4YPJA 3TMLA 1J0YA 2OKTA 1LT8A 7REQA 4Q4QA 5KINA 4C6EA 1ZU8A 1X1NA 2YDQA 3AHVA 5FJJA 3W37A 1U79A 1FKDA 3SIZA 4HZ8A 4UTKA 1GT8A 3QMSA 1HKVA 1GJWA 3M7SA 4HOWA 3NSNA 4GFIA 2RUSA 4JNZA 4G7FA 4V33A 1W5NA 3GU2A 3S6TA 3CV2A 2D73A 3A21A 3NVTA 4XAFA 3K4DA 1ZP3A 5I0DA 2XFRA 4WY0A 3C2OA 1BSLA 3EDDA 3BMWA 4DJDA 1ZNNA 2J79A 2PDWA 1VPXA 4HYRA 4AZHA 4PCTA 4FX6M 1K8ZA 5BXPA 2EHHA 3KCJA 4MZ1A 1BVZA 4DZ2A 2Y8KA 3W1TA 4J4NA 1XJBA 3EB2A 3HQOA 3KRZA 2E1DA 3E02A 1QI5A 1RCXB 1S2TA 3RU6A 3HV9A 3T0CA 4G5DA 4RE4A 1P5QA 3XIMA 4Q4OA 4KQNA 3RITA 4DRSA 3TR9A 2FGZA 4S3DA 3PBYA 2VYOA 3VCCA 3SUSA 3GNOA 1AZ1A 3W3OA 1IE7C 4CGTA 1E6NA 1PYMA 3V35A 3U7BA 2NWRA 1PSCA 2GWNA 2PDXA 5A2CA 3V4BA 5K4XA 3M64A 2Y85A 4W8LA 1BKHA 4HOXA 4LT9A 2GVYA 5FSDC 2GGGA 1WKDA 4XBJA 3W1LA 1UD3A 4H9UA 4UFLA 4AZ6A 2MLZA 4KQZA 3TTSA 3VIIA 3INPA 4NZJA 4AWSA 3M0ZA 3APTA 2PGWA 1YW1A 1AL8A 3STGA 1JDDA 2OTDA 2INEA 3DOPA 4O0KA 4UUIA 4MB5A 4M51A 1TZZA 1ADSA 5H1WA 4A8LA 2XPBA 3AOFA 3LRMA 3EMZA 2BHYA 4WF7A 2PWEA 5LYRA 2Z0IA 2CZEA 3P80A 4A3UA 2E8YA 2JEQA 4K7VA 3TIMA 3PA7A 4GABA 1QW9A 3QY6A 1SMAA 1YNPA 1M03A 4D6DA 2PTWA 2HXUA 4RDZA 4AY1A 3EWDA 4ODRA 4H7CA 1E6PA 4AY8A 1E3XA 3AC0A 3NPVA 1RVGA 1M53A 5BWAA 3K8LA 1YRRA 1XCWA 5I3HA 4JNYA 4JTCA 2FMOA 3UR5A 3UI6A 1XFBA 3E3HA 1FTXA 3MSRA 1MQQA 3DKJA 2XSAA 1Q7MA 3MP5A 1K7EA 1Z42A 4XUGA 3ZQ9A 1Q2SA 3FKRA 3G2GA 1H50A 1PWLA 2SFPA 4Z2LA 3S1XA 3WQDA 2YR1A 3S1WA 2PWDA 5F2LA 4AYGA 1L6GA 2XN1A 4QIBA 2CBIA 4JTHA 2NX1A 4JKMA 3O8AA 5FACA 4TMBA 3IIXA 1VFLA 2F8QA 4Y9PA 2QCDB 4NZ5A 1IXNA 2OT0A 5LGXA 3LENA 2YKKA 4M1BA 4ES4A 1XC4A 3N34A 1V02A 1NY1A 4Z1DA 3ZVHB 3CT2A 2PAJA 1A3WA 3L4XA 4DBDA 5DANA 3SI9A 3ABSA 5A5WA 5BW6A 2J8TA 3HGJA 1GCYA 1HJUA 2OFJA 4KS0A 4G1KA 3W2NA 1E3ZA 1JRCA 2J25A 4GH1A 4CU8A 3CHCA 4IQJA 4NZ3A 4D2JA 3H2FA 5I3IA 2PI6A 1SFTA 4O8RA 1PTAA 1WO2A 2NVDA 2VRKA 4CNOA 1BXBA 3WQ4A 2RDTA 3LBMA 1XD1A 4POCA 3BARA 2AGTA 3NXFA 2YL8A 3NYDA 1GUVA 1K3UA 3UCCA 1QZ2A 4P8VA 3QM3A 2DSZA 1OFPA 3PUOA 4AHPA 4RE0A 2L5HA 3O5EA 1S38A 1OFDA 1VBHA 1FWDC 3S5OA 4W9TA 1B3OA 5D2XA 5IFPA 2PDQA 1F4AA 5CC6A 1B4KA 1DKWA 4K7YA 1UASA 1RY0A 2WMIB 5LIUX 4LS0A 5CCZA 1XRFA 1KWGA 3M0KA 4G9PA 1AQ0A 4PULA 3OHMB 3AXMA 4ACZA 1GVQA 1VLIA 2DT3A 4HCLA 3T0TA 1O5KA 3P61A 4O1EA 5CZKA 1N2VA 1UWAA 3H9RB 1JPDX 4RV8A 3TV8A 1EPXA 2Q02A 4X0VA 3Q45A 4GJIA 1I1WA 1XS2A 1PXGA 1EJ7L 3F4VA 2E28A 1LLOA 1XSIA 1EO5A 5E09A 4ZO8A 2AAMA 3R43A 1R85A 1MXSA 3KABA 2J6XA 4RW3A 2QDDA 3P8JA 4PUKA 2HE5A 1TV7A 4XBKA 2J7GA 2ZZ1A 5BU6A 1K77A 4NYYA 4KH2A 4BI7A 2VEMA 1RD6A 1FKSA 4BFAA 1Z3NA 3NQGA 1W1B1 3NZPA 4HHMA 4RX0A 1YTEA 3OOQA 5ABHA 1KFJA 3T9PA 4ATLA 5IXEA 4M24A 1XYZA 4LY4A 4QLKA 3WDJA 1TMQA 1AG1O 4EE9A 5D2YA 3SAZA 4F9JA 2WSYA 3NRKA 4CCZA 3I4EA 4QAWA 3RILA 3KZPA 1KM3A 1H5VA 1Y5WA 3T40A 4J28A 1VCFA 4HMEA 1C9HA 3BCDA 1IWBA 1F6YA 1VPQA 1LUCB 1C8XA 1AL7A 4DXXA 4UTTA 3CQKA 1QPFA 2UWFA 1BGAA 2ATMA 1FBAA 1DE5A 2A2IA 2NSXA 3L7RA 1IT0A 1I2RA 3LM7A 1R7OA 3KHJA 3L2MA 1NWSA 4EXAA 1F5ZA 1TPH1 1P5BA 3UF9A 3VOHA 2GDQA 2CLIA 2GK1B 1BF2A 3RNDA 1EIXA 2Z7GA 4UIOA 1KFLA 4JIHA 3WUFA 1W32A 2O4QA 4RR4A 3KX6A 2VHLA 4N9CA 3WQOA 2BOEX 3ICJA 4W84A 4JL2A 4W9PA 3R7MA 1JCTA 2QUUA 2OQHA 3RM8A 2WHLA 1F2JA 1EOKA 3CT7A 5E0FA 5KZDA 1KKOA 1LZOA 2AAAA 2A3LA 1MVYA 3RYSA 1I4NA 4PB3A 2PGFA 4HPJA 1BPLB 1GKPA 4PYSA 3W07A 2QHAA 1G4PA 4H8VA 5IBXA 1S5VA 4GY1A 4L4PA 2HVMA 3CZEA 3GFZA 3URNA 3LYEA 1RA0A 4WDTA 3FX4A 3EEGA 5GQBA 2OZ0A 1IT7A 1M41A 3UWZA 2QYGA 2PD9A 1EDQA 1Z32X 1W3KA 3ZJ8A 1DJIA 1ENUA 4S2BA 3UG8A 1V8EA 3AXKA 4AWTA 1L6YA 4YIWA 2NQHA 2Z25A 3W7EA 4PEEA 3QPYA 4IUGA 4HPGA 1WDDA 1E0WA 3N3MA 4ZODA 1TIWA 3RX3A 4LUIA 5DMNA 1RY8A 3TTEA 5JBFA 4MY8A 4NX0A 4B5TA 3VKJA 4UQCA 3VDCA 4O2TA 2W92A 3GDBA 3N6JA 3PFRA 3GBDA 1X6NA 4QEEA 3KE0A 3O7UA 4Z0JA 1NIUA 4DJDD 3W7MA 3Q4DA 1NFBA 1E40A 3QH2A 4P8UA 3TWAA 5TBOA 2ZXAA 3HG4A 2NQJA 1KB3A 3SJNA 3T7VA 3V5OA 1MUWA 3W75A 2VFFA 1UA7A 3ANYA 3CC1A 1YXDA 4XO7A 4O19A 5I03A 4PRTA 4QAIA 1JAKA 1YTDA 3G18A 1W3TA 4H00A 1B5TA 4ZQRA 1D7HA 3PR2A 2EJAA 5DT7A 5IFTA 3ZLGA 3ANUA 5DMYA 4HMDA 4WK9A 4GVFA 3KZ7A 3PULA 2PTDA 3O5IA 5HWCA 4MFDA 3WNNA 1ALDA 3PPFA 1QW8A 4PUNA 1ITCA 1TE6A 1I2OA 4G2DA 1NDWA 3MPGA 1DJHA 4IH3A 1H0IA 4HK5A 3H70A 5C2XA 3F2BA 3CIVA 4DZIA 3PTKA 3MI2A 4MY9A 4IX2A 2XN2A 1FWIC 3UFYA 1M1BA 2ZICA 1TQJA 1UKSA 2Z27A 4AZCB 4CQ9A 1V3LA 2DU2A 1KTNA 4QNWA 4E2VA 4RV3A 5M03A 1J5TA 1GK8A 1GQNA 3TZNA 4N0RA 3LGEA 3IV3A 4GFSA 4PUJA 2BVTA 3QR1A 3SUWA 3MHGA 1F07A 2CLPA 2WC4A 4ZEPA 2F7FA 3IVUA 4C7DA 1G69A 5HMEA 4MUZA 3USZA 3PWIA 4EVZA 2ZQVA 1TPDA 3D46A 3C0JA 1BG4A 1XLHA 3CL6A 4B92A 3LHYA 1J0ZA 3PVFA 1ZRQA 4TQTA 3VNZA 4K2SA 1RBLA 5RUBA 3DH7A 2EPNA 1J11A 4WSJA 3SY8A 1TZ9A 3GG0A 3K4AA 4KFPA 1KFWA 1Z89A 3G1HA 4LANA 2NVCA 5FF0A 2Y8UA 1Q45A 3MKKA 3W85A 1A5OC 4CEXC 1VYPX 4UMBA 2D0HA 5I3FA 4KFOA 4NL1A 4D9PA 3EGJA 1RR2A 4FN2A 3KVLA 3RMEA 3THQA 1PO9A 4FXRA 1J93A 5IOBA 2MANA 3WDPP 4HQVA 3DERA 4PC8A 2A4AA 3AICA 3PPHA 5EMLA 4DYEA 3REQB 3A9IA 1MRAA 2ZA3A 1A5LC 4JQ1A 1UP0A 4O13A 4YWSA 3UGRA 1P6BA 4ODLA 1C90A 2A6LA 1J4EA 1GHRA 3BPWA 3AMKA 4PMZA 2OLHA 1JXJA 3TKFA 1ME7A 2C14A 4KWVA 1BFNA 4I6VA 2O4MA 5CAKA 3GC5A 3VNLA 1BRLA 1EP3A 4L3NA 1RV8A 1ECQA 2XWEA 2BNJA 5GJPA 3AUOA 2YBUA 2ZWZA 1TV3A 4YVXA 2OLSA 3JVAA 4MGVA 4GUJA 1TTJA 4EF8A 2DP3A 2OT1A 4WDXA 3G1RA 4UFKA 2INZA 4H04A 4OWGA 1EYMA 2FTYA 4PTXA 3OVRA 3IRDA 3LV6A 2QUMA 3FDKA 5MKGA 5T26A 3KAOA 4J3WA 1B2YA 1G6CA 1EGZA 1H2JA 2B7PA 1QOPA 2ZQTA 4L5ZA 5AHEA 3WNKA 1DPMA 1AD1A 5I5RA 1XP3A 2WSPA 3PS7A 4I3GA 1VENA 2QUNA 4U84A 4GHRA 3O2LA 1FWFC 4DRJA 1TJ1A 5HQLA 4XTDA 1C29A 4JEQA 3SN4A 1OFQA 2MF9A 4IQEA 1Q6GA 5FAJA 2W62A 3O16A 2CERA 2XGIA 2PC8A 2NUXA 3VD9A 3M41A 4M6PA 1B3VA 1V3KA 2VX5A 2PLMA 4Q4MA 2XP7A 3W2KA 3IHZA 1CECA 4JHOA 4C5YA 4IGNA 3LTSA 1NQKA 1NEYA 4EF9A 4FAPA 4PMRA 1A4MA 1ZGDA 3OLEA 2EPOA 2P76A 3KTSA 1W9BM 1LDCA 5H8UA 3VK5A 1F3WA 2CXEA 3E74A 4DYJA 3GU0A 1MW0A 3LCFA 5FJRA 3BG5A 5DCDA 4A3YA 3H23A 4HBOA 1PE1A 4RLIA 1IV8A 3QHMA 5CGQA 2OFNA 1KD0A 4I9AA 1MDRA 3KW3A 1BYAA 4O0ZA 4XVDA 1ZB5A 2ZUTA 3ZT7A 2CCRA 4LS2A 5HTGA 4M6QA 2P4VA 1NP2A 1X8CA 2R1KA 1EYEA 3TQVA 4NXSA 3W25A 2XSXA 3E0FA 3KBWA 3WBWA 1XG3A 3QKZA 1UMLA 3SEPA 3NTPA 3UG5A 4KWWA 3BE7A 4A6GA 3OG3A 1FCUA 3R25A 4N7QA 4U86A 4H7VA 1XC6A 4LYPA 1R5YA 2LKNA 3R6IA 3V5FA 2QDHA 5M17A 5G4EA 4UTHA 2VL4A 4GK8A 1HUVA 2V67A 4PBFA 3TNOA 2RJHA 5D33A 1DIEA 2VJXA 2OZ3A 3W02A 3M0VA 5E0CA 1ZAJA 4GXPA 4S3BA 3SGUA 4ZO7A 1X6UA 3DFOA 5C7HA 3B8VA 4K68A 4PUEA 1G4EA 1WKEA 1YADA 4OHQA 1PX3A 3S9YA 1R9HA 2PDFA 3U4FA 3BW2A 3W7KA 4O50A 5EMKA 4Y6GA 3NO3A 3KAFA 3MW7A 2VCAA 3UZXA 2WVVB 5LNVA 3NGJA 3VAWA 3MUCA 3WF4A 4MF4A 5K3VA 1JZ2A 2E77A 4FZIA 1HJSA 2OYMA 1BXNA 3NFUA 4IJCA 2O9OA 4MPQA 3G8RA 2VI0A 3AFBA 4MMWA 2WVTA 1O5XA 3IGUA 2GOUA 2QCGA 1DJYA 3DESA 4JFWA 3W7NA 2Z1KA 4A8RA 4JTRA 3V16A 4ICCX 1Q6OA 4DIAA 1R3RA 1YX1A 4OV9A 3QGKC 4OGZA 4LVGA 3WEOA 4OE7A 4O1CA 4ERIA 4WD0A 1UWTA 4XZ9A 1TZ7A 3CJPA 1BKSA 1UJPA 2C1IA 3SR7A 3SY1A 1DOSA 3TYEA 4AFYA 1W1TA 3W38A 1QNOA 4FPSA 3TCZA 4XBSA 3SQSA 3S1GA 1MQRA 3O5GA 1OCJA 3GHRA 3SURA 1Q4NX 1ME8A 2QNEA 2RQSA 4OECA 1KM6A 3L4UA 4ORIA 3WD0A 3L4YA 1UC5A 4HHHA 4UTFA 3H8AA 3W4RA 2GPTA 1TTPA 2Z2BA 4EPDC 1KBLA 4KCTA 2J9ZA 4GIYA 4S3EA 1XINA 1HJQA 4JX5A 2HMCA 3ZXWA 3ZR5A 3AS3A 1ZSXA 3GAYA 5CG0A 3WQWA 2F38A 3DFYA 3IARA 3IIVA 2AWGA 3G0UA 2XVNA 3WBXA 1AVAA 3HM7A 4TVCA 1CENA 4GZEA 3GNNA 1XHGA 2OOFA 1Y5XA 2Y8VA 1XLLA 3BW3A 4XD5A 2VFEA 4X2RA 5HWBA 4DBUA 3GKAA 4BS0A 3H2EA 4CD7A 4CCCA 1NVMA 5C9ZA 2CW6A 4HHLA 3QSRA 5E9AA 1VGAA 1ZTVA 1NOWA 4NNCA 2ISDA 3MMTA 4L6HA 1JNEA 4ZXLA 1KM5A 3RGTA 4JICA 4ILSA 3QYQA 3CYJA 3LG3A 4DIPA 4Z2IA 2VGIA 5A2BA 4TOQA 2NX9A 1E1EA 3PZUA 4J3ZA 1F9CA 4J9JA 1KCXA 3WLNA 1KFBA 3EB4A 4O1DA 4IG2A 3GH7A 4C02B 2W79A 4WCJA 4NNAA 3W7GA 2IPWA 3WNPA 3LCIA 2P0IA 2BVWA 3WDHA 3TJLA 1B54A 2J6VA 1PS9A 4S3KA 4UB9A 1FHLA 3LLXA 4MADA 4ODOA 2BG5A 1B0IA 5CLTA 4L9XA 2PFHA 3WDIA 2FHBA 4IQ2A 4LJ3A 1EQCA 2DH3A 4IJBA 2HCVA 3TFCA 1GOXA 4UR9A 2Y78A 3MUZ1 3RIKA 3AXIA 4B4FA 2QJMA 3NQ2A 4AVFA 4ROPA 3HPFA 3L4WA 1WOBA 1HKKA 3B97A 2KE0A 3FXGA 4FLOA 5HW6A 1AMYA 1YTKA 3CB3A 3QMRA 2PSNA 1KWKA 4NILA 3ALGA 4M5PA 5JQ9A 3M0IA 3MQTA 4GY0A 3VGGA 3W83A 1SUXA 1JCMP 2Y5JA 3NSMA 2NLIA 1XIEA 2YL6A 3VD3A 4AVOA 1WDPA 1AW1A 4LV9A 2E0PA 4NAEA 1OIMA 1IEVA 4K8EA 3IRSA 3WK2A 1VFHA 3NO1A 3L23A 1CLVA 1PVNA 3BCJA 3TONA 1XIJA 1K7XA 1FUYA 3DC8A 3QYSA 1FKFA 1H7RA 5CGMA 2J7DA 3EXTA 4XZIA 3CUJA 2ACQA 2V5BA 5FD0A 4C6BA 1GONA 1LQ0A 1NH6A 4UTWA 1YLVA 1K70A 3NPXA 3MMWA 5CPLA 3APGA 7REQB 3S2MA 4UQBA 2YW3A 2GUUA 4OOZA 3CGTA 1M9HA 1YDOA 3SGZA 2Z24A 2F21A 1D8WA 2OCZA 3CQHA 4IFRA 5EGRA 3UXIA 2GQ3A 1R3QA 3NL5A 5I09A 4C6PA 3F4WA 4G6CA 4W8BA 3DYOA 3UVAA 1CWYA 5HUAA 1FWBC 4E8DA 4F8XA 1T7LA 2EPKX 4JTTA 1TJPA 3BG9A 2B0MA 3EKGA 2XHYA 4WY0B 4JIIX 4KRUA 4LAXA 1E0VA 1TELA 3I4KA 1G94A 1YMYA 4CQ8A 3G1SA 4JQAA 3GDMA 1V0KA 2PTZA 1RLCL 1CBGA 3NVDA 3VMOA 4DUWA 1A0DA 4CU7A 4UTMA 1W9DM 3KL0A 3AUJA 1R3VA 3ES8A 4GNJA 4HU0A 1UD5A 1FRBA 4C6LA 5B7ZA 1PZ0A 4F2BA 3ABRA 2YLAA 3KBJA 1US2A 3W27A 1R30A 3OLDA 3NM1A 4J4KA 3RHGA 1VFTA 1DORA 4S38A 2XIJA 3IAPA 5A6BA 4HNTA 1NSJA 4J1OA 5FA5A 5LA1A 3CWOX 3NQ6A 5EB8A 4GYFA 1V02E 1C8YA 2Y24A 1GJPA 3SUUA 3NIYA 4DO6A 1GPWA 4D6FA 3W2UA 4A29A 2D24A 2QJHA 4DI8A 4JKLA 3V3WA 1CZ1A 2VC5A 2PPOA 4QR6A 1AK5A 3FIGA 1TCMA 2YL9A 1E9IA 4DZHA 4GNVA 1Q6EA 4PB4A 1UOZA 4US5A 2I9UA 2NXGA 2XH4A 1W1IE 5G2HA 2X41A 3RR1A 3TQPA 1XXXA 3AU2A 5CC7A 4H4IA 2ZKMX 4I5UA 4UR7A 2DUAA 4DNHA 2EQDA 4MOZA 3CUZA 4YTTA 1KXHA 1Q6QA 1XSJA 3S83A 4NUWA 3VOIA 4LAUA 4V2XA 2A7RA 3E49A 2PBGA 3K2GA 1A53A 3D3FA 3O05A 1DIDA 1KCZA 1XL9A 4J5NA 4TTGA 3RX2A 2DG4A 5CPMA 3K4WA 1V6WA 2BFGA 3PTDA 3NDOA 4Z1AA 3VX0A 3DECA 1E1FA 1T11A 2FZBA 2I5GA 4IM4A 3ZT6A 3RJYA 4H83A 3PBGA 1BYDA 5AYBA 3W22A 1Q2RA 3GVVA 3BAXA 3LLDA 5FF4A 4GI8A 4OV4A 3R4IA 1T41A 5C5YA 3TWBA 4JYSA 1E9ZB 1MW3A 3KVMA 3ZLFA 4NAFA 5A6AA 1FWTA 1KRMA 4ZQMA 4LB3A 4JFUA 3UCDA 1H63A 1W8SA 3GSMA 2JBMA 3VDGA 1GJUA 3SCTA 1DIKA 2OZ8A 1F8AB 2PODA 7A3HA 1WUFA 1XLJA 3BK0A 3GDLA 2HK1A 2XP8A 3S2LA 3B9DA 4L4OA 4LAZA 4FO4A 4A8IA 2XVPA 1FDZA 4CLMA 4YYFA 4DLMA 3EA2A 3A4WA 3E96A 3EBVA 5HATA 3JUGA 4Q4KA 2L2SA 3H2AA 5AC7A 4JFLA 3FHQA 4ZA0A 4P5UA 1W9PA 2FIQA 4B9YA 1VS1A 2HROA 2VDHA 2XWDA 1EXBA 3KTCA 4Q6JA 3KHDA 4QTGA 4G7EA 3HB9A 4H3DA 5D05A 3ZJ7A 2VX4A 2V3DA 5CZSA 3BZJA 5G4WA 1JPKA 4H6EA 4PODA 3U3HA 1R3SA 1XLMA 3D3AA 5TQLA 5K9DA 2PLKA 4DPQA 3CS2A 4MJMA 3WUGA 4MZYA 3F7JA 5TD4A 1J0IA 3M1ZA 1WNOA 2QV5A 3ITTA 2PCQA 3VGHA 1WDRA 4GE8A 4N9DA 3OLGA 1IGSA 4H9VA 2PDGA 1KTCA 3OIHA 3UGVA 3QY7A 2PWGA 5KZEA 3GVRA 5LHEA 1WYIA 4REQA 4L6DA 4L56A 3L65A 1OYAA 4ACYA 4TR9A 3OVPA 1QI4A 5CPNA 3R11A 4NJGA 5C6MA 1MMFA 3F2CA 1XYAA 4JTGA 2VWTA 1GOIA 5C55A 2EG8A 3WLTA 2FTWA 3CBWA 4GQQA 3RPDA 1PZ2A 3HGOA 1IR1A 5DQPA 3THDA 2ZA1A 4ACZB 2ZUVA 3LK6A 1VJSA 4KFNA 4PL1A 2J9YA 3CL8A 3UF8A 2G3IA 4FX8A 3CTTA 3PZMA 1Q6LA 5AHIA 3VPLA 5BMXA 4IQCA 1CXIA 3ID7A 1PIFA 2MNRA 3P81A 1G0CA 4G56A 3TUUA 4FS9A 4FLSA 3SCUA 2PTXA 6TAAA 4FF7A 2AKMA 3EX3A 5DEZA 2OR2A 1VLWA 3DUGA 2BV9A 2PF8A 5LNWA 4ZXOA 2EGZA 2QIIA 3VINA 1XBVA 2BOFX 3UWEA 1QNSA 2GJXA 3PNZA 1LYXA 1NDZA 2ZADA 1YYAA 2Y63A 1PX4A 4LAYA 3IGXA 3R8RA 3SCSA 3LB0A 5JIWA 8CGTA 3QY8A 3W1UA 4MZ8A 4D1IA 2OU4A 1EUNA 3C3UA 3FGCA 3DHDA 1X38A 4GGHA 3DFQA 3ERPA 3PTQA 5HAOA 1RLDA 3EDKA 2Y4SA 4DJFC 1IXQA 3W7QA 3S5YA 4NX5A 1UOKA 1O12A 3L68A 2D22A 1VAHA 4GPNA 2IKHA 4HU4A 3UY7A 3N2CA 3O5QA 1OQFA 3F4DA 4QZVB 5LNUA 2DQWA 2WM0A 4TU1A 5A6LA 3WO8A 2KR7A 4EWND 3UI4A 2O9PA 5FCZA 4N4QA 4P7QA 2XYLA 3HGRA 2QDGA 5A8QA 4HNVA 2B81A 4FNRA 5E1QA 4GISA 3T8QA 1O5QA 1JQVA 1JYXA 1J2BA 5AYZA 3OIXA 3SBFA 3K8KA 2BY0A 3WG6A 3WNOA 1UR9A 4GH3A 4WRHA 2Y61A 3QKEA 1XBYA 1LWIA 3PPCA 5A8GA 1EP2A 4F48A 1OF8A 3TYAA 4W89A 1SJBA 1XLKA 3W82A 2R1NA 1UD2A 1TG7A 1FWAC 5CPTA 3EOUA 1VPYA 1XIHA 3TQKA 4DWDA 1QJWA 3WDRA 3ITOA 3PB2A 4HCHA 1QK2A 3FN9A 2QGYA 4ATDA 2W9MA 3CU2A 3GR4A 2JKEA 3NQDA 4EXQA 1XRVA 3AHZA 1OYCA 3ME3A 2YCJA 5EY5A 4O4WA 3S3GA 1EWEA 4J40A 1US0A 4UCFA 4X61A 2VZUA 3WQFA 2PDJA 3UEQA 2RKXA 1PEZA 1R9YA 4DT4A 3MO7A 1AA1B 3KLKA 5B8IC 1LL7A 1JFHA 1XV8A 2WLZA 4FX7A 8RUCA 4A2RA 4O8AA 2H9AA 1HW6A 3A4AA 4RL3A 1QPRA 1JR1A 2GJNA 3ZJKA 2FZDA 3KOFA 3B8TA 3UPMA 1H61A 2XINA 2W0UA 1GVSA 4GNKB 4B5UA 3WK0A 1SFLA 4EAYA 2DT0A 4ZQPA 3L2LA 1H62A 3G0SA 4W7UA 1HKIA 3T55A 2NQ9A 3CWNA 3WH9A 2VEPA 2WSRA 4IOTA 1R46A 2C3ZA 5A2AA 4IMGA 3PM6A 2OJPA 2VDIA 4IF2A 3WQPA 5JH1A 1SZGA 1OCNA 3ITYA 3SECA 3H7UA 2RFGA 5ECUA 4Z2GA 3W72A 3B06A 5LNRA 3EDFA 2KAUC 2PRMA 5F7UA 5FAGA 3ZFHA 4Q7IA 2P1FA 3KZSA 4HPHA 2OODA 2C0HA 4YTSA 3OBKA 3PUGA 3Q37A 1QWGA 1FH9A 4RXGA 3PWAA 4NIRA 3USBA 4MJ2A 1R8LA 1E4MM 1P48A 2GSEA 2WNZA 4LUSB 4XZWA 4K8GA 2D0GA 5CPOA 2WK2A 3H12A 1C8VA 4GQRA 2H6RA 4US5D 2G0WA 3EPMA 3NQMA 4EXBA 4D6EA 1B3WA 5C8BB 2PP1A 2WZEA 2X40A 3VZXA 1KRCC 3TQ0A 4ZBCA 3GX9A 2BHUA 3B40A 3FYPA 4BWLC 4IL0A 5C0QA 2HVNA 2IXVA 1QHPA 2WOQA 1O5RA 1LOLA 1H4PA 1UR8A 5FEPA 3MWAA 1Q6HA 1J2WA 2YJQA 4PTMA 3H4XA 3G1VA 4FI4A 1FXQA 4JFVA 4OBTA 1EC9A 1ZLPA 4ZQOA 4QM1A 1PJ9A 3PHAA 5DCEA 3U5YA 5GJMA 4AXNA 4YJ5A 1UR4A 1RHCA 3BC9A 1ZK6A 2V2HA 1IX5A 2X2YA 1ITQA 2MUCA 2N87A 4LV4A 3WLMA 2BOGX 3BSMA 5BXSA 4C91A 3GZ3A 3FOKA 3NGFA 3W00A 1AQFA 3LSCA 4PE8A 1P0NA 2QJGA 2YYUA 4TVDA 3UWUA 4YWIA 3N6QA 2DSKA 5H2ZA 1MNZA 4DRKA 3TN6A 1HJXA 3CAVA 3F5LA 1J96A 3MCMA 2HQAA 3AMCA 1PL9A 4ROQA 4F2TA 1Q6FA 1UKQA 5HNUA 1LM1A 4PCFA 5D2VA 3OQEA 1HP4A 2QZRA 3CUFA 4GCXA 3CUXA 4Q8MA 1F6KA 4AHOA 3SFKA 2HSAA 2VWSA 4HSOA 3UWWA 5ABFA 4E4PA 5JBDA 3AROA 4L1WA 3G1XA 4RKAA 1KC7A 4Z2HA 3W0KA 2MLYA 1LLWA 1KNWA 5D2WA 3G3MA 2ZTJA 3QV7A 3BOFA 2PDNA 4ZTXA 3T0AA 4C6NA 1B90A 1XYCA 1WZKA 3IVSA 2O9TA 1C91A 2NX3A 2EPMX 1H41A 3S46A 2A21A 2FJKA 4MNLA 3WQEA 2HPMA 1G5AA 1DL3A 3BV7A 4QQ3A 2V2CA 3OO2A 3SN0A 2PP3A 2WO5A 5AYXA 2XPKA 3NNTA 4DI9A 2MNTA 2K8IA 4AEOA 2W4XA 5MKGB 2W91A 3C86A 5CZJA 4Y90A 1X98A 1AW2A 2CC0A 1TUXA 3VMNA 4H9XA 3F4CA 4K38A 1CLKA 4PA8A 3T44A 5H91A 5XIAA 3UJ2A 4B5SA 2M1IA 1Q65A 1UZHA 2NLYA 4O15A 2QCEA 3MT1A 3NXLA 3P0WA 2D20A 2RSEA 4Q7NA 3IKGA 1KKRA 1A5CA 3FYOA 3SM0A 4JTAA 5JH8A 1U5HA 1WB0A 1EQ3A 3MMUA 3B9AA 1W1A1 3KOZA 4HB7A 3ZR4A 3NZ1A 5LA0A 4ZPWR 3TEVA 4UZUA 1ZCOA 3S5SA 4OFCA 2ZOXA 3B0VC 1W3NA 3B3DA 4MWAC 3F2DA 4LNCA 2EAWA 3AJ7A 1R0MA 2XTKA 4QDWA 1AQHA 1JDAA 1ISZA 1I0DA 3R2GA 4K39A 2ZDSA 3WH0A 2QS8A 3KAHA 9XIMA 1DBTA 3CLMA 1GQJA 4GJ1A 4QJ5B 2YIHA 1GTEA 3N4FA 2POTA 2Q01A 2WC3A 3SIMA 1G01A 4R34A 5CSRA 5AOUA 1H09A 2HNEA 3GHSA 5TNVA 1F61A 4MVAA 3L2IA 3N2BA 1XLFA 4JTDA 2R14A 1QO5A 2FZNA 2VFIA 1JZ7A 2PRLA 4MKSA 1DTNA 2NVAA 2YLLA 4QQUA 3R10A 5FESA 1KT1A 1ONRA 4TX9A 3QN3A 5I24A 3AYVA 4O53A 1SGJA 2BXZA 3M07A 1M68A 3TW7A 5I2UA 2ON3A 4AD5A 2DT1A 2VQUA 2TPSA 2O56A 1KRAC 4NJJA 4Y9OA 1HQTA 2YZRA 1UIOA 3T05A 2J75A 3Q65A 1HVQA 1RK6A 3WQ5A 5D75A 1EEXA 3CPUA 5A8NA 3S6DA 3DDMA 1V6UA 3BL3A 3NAVA 2LPVA 2XUCA 3B9OA 1H5YA 1JIBA 4UCGA 4ERAA 1DJGA 1KGXA 3SADA 4LSBA 4O17A 3N19B 4HNOA 2PDCA 4JD4A 3U57A 2V5KA 3PK7A 4WZHA 1AODA 1TX0A 1PKMA 1DWFM 5C70A 1SVDA 1TB3A 1VFOA 2C16A 3E9AA 1KV5A 5HWJA 5BRQA 3BQ6A 3DYMA 4FIQA 1XRSA 3GTNA 3SZ8A 1CXLA 1Z6KA 3LS9A 3QTPA 4JTLA 2AQOA 3AI0A 1XYBA 3D6NA 5HJYA 3P5ZA 2GLKA 4X60A 3K5XA 3UI5A 1N8WA 2PV3A 3FSUA 1WPCA 2PDHA 1OM0A 4NNRA 1SFSA 3C6CA 4NNBA 3VX1A 2DVUA 1XPGA 4GUGA 1IEWA 2A1YA 4J3SA 3WBYA 5CC3A 8XIMA 4F0KA 4KCUA 1ZAIA 3A6OA 4B90A 2HNHA 3KXQA 1XUZA 3GG7A 4IT1A 3QGVA 3EWBX 3U0HA 2NQLA 1VZWA 1Q7ZA 3AQUA 4HNNA 1NM9A 1A5UA 4IFKA 3I3EA 2FH6A 3NQ7A 4D6IA 2W66A 2ZRYA 1BF6A 1L2UA 3HPXA 4GLEA 5I06A 2BP1A 1YNQA 3ELFA 4GWEA 4S3JA 2R1MA 3ABQA 2VUNA 1FWGC 3N9SA 4MAZA 4O12A 1D8CA 1J6OA 3EXSA 1FKTA 1C7SA 1VF8A 4MSPA 4K3ZA 1B4EA 3UCQA 5T91A 1XBZA 5LZLA 4QX4A 1A4LA 2R91A 2XZ7A 4AWUA 4I9TA 4DNMA 2X1SA 3A9BA 4HMCA 4ERGA 1NELA 1REQA 3E0LA 4B3LA 3NL6A 3STFA 1TCOC 5U7SA 2I14A 2F6KA 1JYWA 3GAKA 1N7KA 2BGSA 3LXAA 3GK0A 4ZPTR 1O68A 4HA0A 4DEFA 1GQKA 3LQGA 3CB8A 4Y9NA 4NRSA 1MUMA 3F4NA 3G24A 2KX9A 3CHVA 3GDKA 3WLKX 4UQEA 3WK3A 4Q8PA 1WX0A 3GKFA 3AS0A 1YEYA 2NUWA 3TTQA 3C8FA 4OVXA 3CV6A 3O06A 4QNEA 3CEUA 2JFEX 2BXVA 1V5XA 4V27A 3WZ0E 3TN4A 1XDMA 3T6CA 3DGRA 3VE7A 2P3ZA 1UKTA 3ANVA 4LRTA 3LSBA 4JIEA 2YOCA 4DRQA 1QRQA 4BF9A 1MUCA 4U33A 3RK8A 1P0DA 4IG2B 1O66A 1VYSX 4EPKA 2CBJA 2QPXA 2WJDA 2OWCA 3IIZA 1SZFA 3SN1A 2DH2A 2VFDA 3OVGA 3I3DA 3DFHA 3VIMA 1MI3A 5DO2A 3UW6A 3VUPA 2ZVRA 1FDJA 4N6FA 1JPMA 4EPBC 3FKKA 1JJKA 3P5YA 5HT1A 4LUYA 3S0CA 5TIMA 4ODQA 4YVPA 1WV2A 4URIA 3UVIA 3WLPA 1NU5A 2VX7A 3KTXA 4CN4A 4XUYA 3UG3A 2J88A 1VHNA 3DENA 1DXIA 3HJEA 3U48A 1P1XA 5HNNA 5LXXA 1EGMA 4LS1A 2CLKA 4JAWA 1WA3A 2C8NA 2H90A 3LY0A 2E25A 2I1OA 5HJLA 4R27A 1VB9A 3AXXA 1PZ3A 2GZXA 2C1HA 4BHYA 1EL3A 4AW7A 4LAWA 2YX0A 3QZAA 5AHMA 1YQ2A 4F0HA 3AIUA 3DFSA 2XVLA 4S3GA 3S9IA 2PN0A 4G1NA 2GL5A 4BEQA 4FAMA 3B7XA 3KOWA 4AZBA 1Z69A 3NWRA 1X1OA 3WMSA 1IXPA 2J9XA 4IMCA 3BLEA 3JR2A 4NAEB 4TVUA 3PWGA 3CMJA 2RUCA 5G4HC 1I2PA 1AJ0A 4UTJA 3WELA 1H11A 4EAMA 1KA9F 3TSMA 5F4SA 3UD6A 2QCNA 4HPXA 1BTCA 4DWSA 2IPJA 4K1GA 1GG1A 2YDAA 3IAQA 3G1AA 3RXZA 5DIUA 2E6DA 2H8XA 4Q7BA 4P2VA 2XM1A 1X7FA 2CYGA 3GIPA 2I5QA 3LHZA 1FH8A 2ZQSA 3MHFA 2J78A 1TRDA 4AZ7A 5EL1A 5AFDA 3LXBA 1CGTA 3SCRA 4R5EA 2ASHA 2R9RA 1E0XA 1XDLA 1XM3A 2A7NA 2YL5A 1QHZA 3JU2A 1OGGA 1PDYA 1IZKA 1O7AA 3CO8A 4YMZA 2B4GA 3EEZA 5FJTA 4X0NA 1J4HA 2XSBA 1P7TA 2Y1HA 3U2OA 2LJ4A 3E5PA 1X8FA 5D32A 4F3HA 1J12A