1HKMA

High resolution crystal structure of human chitinase in complex with demethylallosamidin
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
365
structure length
365
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEQSGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHITOTRIOSIDASE
publication title Crystal Structures of Allosamidin Derivatives in Complex with Human Macrophage Chitinase
pubmed doi rcsb
molecule tags Hydrolase
total genus 125
structure length 365
sequence length 365
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1hkmA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hkmA01
4NSBA 2J4GA 4GQQA 2C0HA 2JF6A 3T08A 4PMVA 1LG1A 4BZYA 4E8DA 1V6XA 2QMJA 2XFYA 1L8NA 3KE0A 1C3FA 4UFKA 5EB8A 1UH2A 1JAEA 4PMYA 3SURA 3MUIA 2ZUNA 2ZOXA 3AHYA 1UH3A 1UZ4A 4K68A 4F9JA 3M7SA 5A2AA 3WF1A 1X6LA 3T0AA 1ZJAA 1HJWA 2DDXA 7TAAA 2OSYA 2WVSA 1V3IA 3K4AA 2DGAA 3CH9A 2DSUA 3ZQ9A 1W9UA 3AXHA 5JBEA 1HIZA 3VTRA 3IAPA 1H11A 3ZSTA 3B9DA 1E5JA 4IPLA 1E3ZA 3E1F1 2ZWYA 3MU7A 1JZ8A 1M53A 2YL6A 3ZJ7A 3K46A 2EXOA 4ZXOA 1QBBA 5A2BA 5E70A 2PWEA 1H49A 1HJSA 2WZEA 1J9YA 3RPMA 5DT5A 1UD6A 1J0HA 2W67A 1J18A 2EO7A 1PIGA 2CITA 5A95A 1DP0A 4UQEA 1E6SM 3ZJKA 1B3WA 4FLSA 4MNLA 1J10A 3FNDA 1R87A 4UQ9A 5A94A 3AJ7A 4AEFA 1AQHA 1QBAA 3AS3A 2EQDA 4PCTA 2Y8VA 3BMWA 4RL3A 4Y7EA 1XHGA 1ISXA 4DWSA 1PAMA 2BXYA 1C8YA 1W2PA 3CZJA 2PBGA 1DWHM 1V0LA 1E9LA 1JGIA 1H3GA 3VDAA 4GI9A 4IISA 3PZ9A 1WDPA 3MKKA 2GK1B 2ZICA 2CXGA 4OBSA 4UQCA 3AOFA 2EBNA 2WK2A 1CWYA 1GOQA 4UFLA 3NDZA 2EPKX 4AZHA 2OSXA 2RGLA 1UQZA 4ML4A 2C7FA 3CUFA 1PZ3A 3WNNA 2OWXA 2WVTA 3DECA 2J78A 4CD7A 2CETA 2GJPA 4L4OA 3UG3A 4TVCA 2VJXA 1QNRA 1EHNA 1JYWA 4AD4A 2BNJA 2ZUSA 1E4IA 3N18A 4EE9A 4BQ5A 1JFXA 9CGTA 4HOXA 3ARYA 3WDJA 3VMNA 3IANA 1KFWA 1A3HA 4JL2A 5FCZA 3EBVA 2D22A 5A6BD 3AS1A 3VGFA 4AISA 3OLEA 2J7GA 4LXFA 1E40A 1UWIA 2PWDA 4D6DA 2ZUTA 2PBOA 3W53A 3FAWA 1HF6A 3LPPA 1BQCA 1W2VA 5A8NA 3EMCA 3WD3A 1E15A 4JFTA 4JIEA 1CXFA 2VUYA 3VUPA 5FD0A 1I1WA 2EJ1A 2ZX5A 3VO0A 4WF7A 4JKKA 3GXIA 4AIEA 3WL1A 4LYPA 1ZU8A 1HVXA 1J0KA 3PTMA 1HT6A 4UFHA 3UCQA 4L4PA 4UOZA 3PZUA 3VDHA 2VCAA 4UZUA 4TVDA 1C8XA 5JIWA 3B9AA 2ZUVA 3L2LA 4J3UA 4UOQA 2OLHA 5I77A 4JKLA 2YIHA 5I0DA 1R85A 2ZXDA 3DYMA 2HVMA 4JKMA 2XSBA 1D3CA 1NOWA 4Z2KA 1QNSA 1CGWA 3WBAA 3AIUA 4M8UA 3OGRA 1V6UA 2E0PA 5CZKA 4QAWA 5CQ1A 2VC9A 4DWSB 3CZLA 1JDAA 1DHKA 5A6SA 1W3KA 3WELA 3L4XA 4TTGA 2FDMA 4NZCA 1JXKA 2J75A 3AICA 5FIPA 3B9EA 4JHZA 3QOMA 3U7VA 3MV01 4BS0A 3LPFA 3N11A 3QHMA 4AIOA 3WFZA 1XRVA 5DO8A 4UFJA 3TTSA 3WF3A 3W25A 3A3HA 1GHSA 1UKPA 2BHUA 1GCYA 2VX5A 2WCAA 1EDTA 2YDSA 4Z2HA 3GNPA 3T0DA 2BVDA 3W37A 1ZBKA 3W29A 1JZ5A 3ARUA 1E0VA 3ZR5A 2X0HA 3MMUA 1WE5A 4OOZA 1VJZA 1GOMA 3L4UA 6TAAA 1JNDA 5IFPA 3AZRA 3GM8A 1HKJA 2WBKA 4AZCA 4QCFA 1K6AA 4W8AA 1WZLA 2X2YA 5C70A 1UWQA 1C90A 2BFGA 3GTNA 4PMUA 2JALA 3SCVA 1OB0A 4U2YA 2D20A 2G3MA 2CBJA 1GJUA 3UG4A 2WNWA 4J3XA 1UQYA 1HX0A 2W91A 2A3AA 5A1AA 2PI6A 4HMEA 4ZFMA 2FHBA 4P8XA 1MQPA 3I3BA 1UUQA 3ZO9A 2D23A 4TX6A 1LF1A 3CZEA 3WNMA 3ZIZA 4W8LA 3LMYA 2WSKA 4M82A 2OYKA 3PN8A 1J11A 3WEOA 1JF5A 3CUGA 4QP0A 3AIEA 4TVUA 4Z2JA 5JBFA 3OLGA 2WZIA 4UQBA 5BXSA 4FLOA 3CMJA 4UFIA 2Y5EA 2X1IA 1KQZA 1R7OA 3WNPA 1HNYA 1ISYA 2G4FA 2BY3A 3M46A 3MS8A 3SUVA 2PC8A 1JNEA 1W91A 3L4YA 4GI6A 4W84A 3IJ9A 4AD5A 1NWRA 4XZWA 5FOOA 1WPCA 1WCGA 4F66A 2IXVA 1E1FA 1JI1A 2V38A 4BF7A 4CCCA 5D9MA 5D8WA 2PF0A 3TTOA 1M01A 1JZ3A 4XZBA 2VTFA 4AEEA 2GUYA 2WMIA 3BC9A 4U5IA 1CLXA 3WN6A 1F4HA 1MW2A 3NSXA 1DWFM 3ZT7A 4AW7A 1QNOA 1JI2A 1PIFA 1B2YA 1GOKA 1K9FA 3GBDA 3L4WA 2X09A 3AIVA 1DWJM 4U3CA 1JXJA 3CHCA 4EANA 1KGUA 2J7FA 4ZXLA 2ZX8A 1HXJA 3GXMA 5CPTA 5JH8A 1TUXA 1WB0A 1E73M 3NYDA 1K9TA 3QHNA 1PEZA 2XIBA 1Z32X 4BQ4A 3CHFA 1KCLA 2G3NA 2OWCA 1TVPA 1RH9A 2WCGA 2XUCA 5EFFA 4HU0A 4TUFA 5CSUA 2VVNA 5A6AA 3NDYA 4OUEA 1V02E 4P7OA 3CZGA 3VINA 4AZCB 3VD4A 2XHYA 2V5DA 2E3ZA 3CTTA 1OGBA 2WZHA 4D6JA 1WAWA 2A3CA 3RCNA 2J7BA 3S6TA 2J62A 2J77A 2VOTA 3IK2A 4GQRA 4HMCA 1ZB5A 2JF7A 3CGTA 2QF8A 1ZJBA 1EIBA 1MW0A 1ISVA 3TONA 1EHAA 1C8QA 2TAAA 3OZPA 3WQ5A 2XGBA 1B3YA 2IUZA 4WJXA 1TVNA 4GKLA 3T0BA 2YL9A 1XYFA 3BLKA 2CIPA 2WPGA 3VDCA 1M04A 3OGVA 1CECA 3VGGA 3ZJ6A 4EKJA 2DPEA 3WUBA 1VBUA 3CUIA 5GPRA 3GDBA 1BYAA 2YLAA 2W4XA 1E4NA 4W86A 1NH6A 1GHRA 5DFAA 3VIHA 1U2YA 1H0GA 3CIVA 1B1YA 1A47A 4U2ZA 3OG2A 2NT1A 2WVVA 3AIBA 1GNXA 5BRQA 2ZXAA 1QOXA 1H1NA 2CBUA 3VU2A 4NRSA 4W88A 2JIWA 1JZ6A 1PX8A 3U7BA 1W9PA 4OKDA 1Q6GA 1PX4A 2NW0A 1EQPA 3S2CA 2DSKA 3HN3A 3KEHA 3SCQA 5A8PA 3WQ4A 4C7FA 3LPOA 3GH5A 2WMIB 3BSGA 3KL0A 3VNYA 3OGSA 1BYBA 4AD2A 1KR0A 5M3WA 3K4DA 5A6BA 1MQQA 1MFVA 3W27A 1QI5A 5JUVA 4PTMA 3WQ6A 3UESA 1HJQA 5I6SA 1NARA 4P7RA 5I3DA 3WQVA 5E0FA 4KWUA 3A4XA 1E43A 1VRXA 1UOKA 3DHPA 3ZJ8A 3VGBA 5M03A 1H41A 4UZSA 1Q6FA 2EPMX 2GVYA 3ZM8A 5M17A 1MW3A 2A3BA 2DIJA 3MUY1 4PMDA 4AZ6A 1GVIA 4TX8A 3W82A 1E5NA 3BAWA 3L4ZA 4CVWA 2CHOA 1TE1A 4CN6A 3POHA 1CENA 5E6YA 1CIUA 4J27A 1BGAA 1CYGA 1EOMA 1UR8A 1GW1A 4AMCA 4DUXA 2ZXBA 1UD3A 3MV11 2Y4SA 3PZOA 4QLJA 2A3HA 2J7CA 4OOUA 2V3GA 2ZUMA 4ZENA 3WMBA 5FL1A 3SCSA 2GDVA 3FHAA 1LG2A 3AMGA 3KL3A 4ACYA 1JDDA 5CGMA 4CGTA 5GNXA 3AQUA 3W4RA 1AMYA 2WLYA 4AIUA 3F4VA 3K1DA 4X0NA 3D5HA 3RM9A 2VQUA 2V3EA 3PBGA 2DT3A 1R8LA 2CBIA 2J74A 3LPGA 3RMEA 3AFBA 2XYLA 4V2XA 2D2OA 4YHEA 1GOIA 3O6AA 1LWHA 3AMDA 4PEEA 2W92A 5ABEA 4LGXA 4WIWA 2PB1A 2BY2A 5GNZA 3ARVA 1ZS2A 4Q22A 3WDPP 1VB9A 1LL7A 2GJXA 2UY5A 1LJYA 1VEMA 2YBUA 3VD7A 4DUVA 2FHFA 1IV8A 2WVVB 5HPCA 1CGXA 1MW1A 1E55A 5F7UA 1H2JA 1WZMA 2DT0A 3NJ3A 5IDIA 1SYTA 3VNZA 1QW9A 5I78A 3OB8A 2BXZA 3TTQA 4EAMA 3RILA 5A8MA 3PZVA 1FP9A 2Y24A 3PZQA 3FN9A 2BVTA 1KR1A 1NQ6A 1XD1A 3ZT5A 4MJ2A 5A69A 5BXPA 4AZ7A 4N42A 2YLLA 2FH6A 2VR5A 1UH4A 2OSWA 1S46A 1QHPA 2FH8A 4J3TA 2DEPA 5IXEA 1B3ZA 2QV4A 3WNLA 2ZE0A 3RJYA 3BGAA 4LX4A 4J3VA 4WLCA 1NWSA 3I3DA 1GORA 1CGVA 4AWEA 1EDGA 3VILA 3SUUA 4HP5A 2XVKA 4HTYA 1RP9A 2GJRA 2VCCA 1PZ2A 3VIIA 5A8OA 5CPSA 4TOQA 1RP8A 1C92A 2DT2A 1J0ZA 3SCTA 3SCOA 1V08A 4QFUA 2IXUA 3VIPA 2QHAA 2VX6A 1Q6CA 4OBRA 1OD8A 1HL8A 1YHTA 4JFWA 3CUHA 2YDRA 2GFTA 4KGLA 3BH4A 4W5UA 2GDUA 2G41A 2VO5A 4DM1A 3WSUA 5HPOA 2ZUWA 3CHDA 1ITCA 2BY1A 4Z2LA 1E70M 2WMJA 3AXIA 1J0JA 2WMKA 1PPIA 1TG7A 1DWGM 1M7XA 4P8VA 3VIOA 2VURA 4CCEA 1P6WA 4LQ1A 1V3HA 2D3NA 4CU7A 2WKGA 3T2PA 1PX3A 3A47A 1UR9A 4CD5A 3ZR6A 2WHJA 1XH2A 1V03A 4HA1A 3GZAA 1TZ7A 4CD6A 1UR2A 2UY4A 1XGZA 4H41A 2XG9A 4E8CA 4JHOA 5BRPA 1J0IA 4KMQA 3CBWA 1WO2A 4PUDA 2E9MA 2GJXB 3WMSA 1MXDA 3WH9A 1C91A 4HZ6A 5HNNA 1CTNA 2VZTA 5CJ5A 3WIJA 3A4WA 1EO7A 5BCAA 1JDCA 4LYRA 2UY2A 3CMGA 3EDJA 4WKAA 3F5KA 3VIKA 5I23A 4BCEA 1G01A 3WF4A 5I5RA 4BQ2A 4S3JA 3W28A 1KGWA 1SMDA 1XSKA 3ARWA 1J01A 1K9EA 2ZWZA 1NP2A 4PBGA 1LQ0A 5LYRA 3SUTA 4ZE4A 4HA3A 3UG5A 2XVLA 5ECUA 1BG9A 2UWFA 2C8NA 1YQ2A 5FL0A 1GUVA 4CD8A 4KH2A 2VL4A 1BSIA 4S3KA 3AHTA 4D6EA 2XFFA 5LA0A 4FLRA 4M81A 5ABFA 1GONA 1CXHA 1OM0A 3ARPA 1JL8A 1DWIM 1FH8A 4GO9A 1UWUA 4JZ5A 1X1NA 4AZGA 1OWQA 3WD1A 1HVQA 4M29A 3THCA 2AOSA 1CPUA 4XB3A 1JIBA 2J47A 1LLOA 2E4TA 1ZBVA 5E09A 3VD5A 4J28A 3BAJA 4H8UA 1J0YA 4X9YA 1PJ9A 3DYPA 1XV8A 1V0NA 3NCOA 3IJ8A 1V6VA 3WDIA 2OWWA 1HN1A 4AD1A 3K8MA 1OINA 3WUGA 3VIFA 2ZX9A 2EPOA 4M1RA 3N13A 2D0FA 4KGJA 2BV9A 2PWHA 3WQ8A 4PTXA 1RD6A 2BHZA 1B90A 4YN5A 3RDKA 2VRJA 5BXTA 4MNKA 3VIMA 1G5AA 1HKKA 2CCRA 1H0IA 3MMWA 3AZTA 4MJ4A 4HZ8A 1GZJA 3ARRA 2QLYA 4B3LA 3RO8A 4R27A 4U31A 1E6XM 3NSMA 3WMCA 2WSPA 4R5EA 5E0CA 3M6DA 1W3JA 4H8VA 1QI3A 2G3JA 3VGDA 1ZBCA 1QW8A 4H04A 4DUWA 2FGZA 4WKHA 1WDRA 3W6LA 4M24A 3AROA 1EA9C 1F4AA 5CLWA 1AVAA 2G8ZA 3N9KA 3AIRA 2EEXA 4JFSA 4DWSC 5KEZA 5BROA 3GH4A 3MSDA 1QVBA 2F8QA 4PRWA 5CGTA 3UR8A 4H8HA 1JZ2A 1FOBA 1UYQA 1FH9A 1G0CA 1LL6A 1OGSA 1UA7A 2XVGA 4CKQA 5A8QA 3WH6A 3GYCA 1OT1A 1KXHA 2EPLX 4HOZA 1HKIA 3CHEA 3HMCA 2VT0A 3VGHA 1GOWA 3POCA 3BSHA 2QMKA 2YA2A 4C7DA 4D6CA 5A6KA 4W8BA 1WZAA 5ABFB 4PMRA 3G6MA 1KCKA 3WL0A 2DQXA 4LPCA 1FHDA 4HPHA 1FHLA 4D1JA 3W38A 1D7FA 4H7VA 3I3EA 1V6YA 2PWFA 1VENA 3CZKA 5TD4A 3ZOAA 3T2OA 4PSRA 1KBBA 1SMAA 4AZIA 5JIPA 2D3LA 4UNIA 4B9YA 4AD3A 1OCQA 4CD4A 4HU8A 2YJQA 4CU8A 3WEMA 1BHGA 1BVNP 2E9BA 2E9LA 4W93A 2FGLA 5EBAA 3UETA 5BYWA 8CGTA 2WWDA 1DTUA 3GXDA 4TTUA 4CCDA 3GXFA 3CUJA 4UR9A 1KWGA 4D6HA 1H09A 5AYIA 1OGGA 5A2CA 1CZ1A 3ZT6A 3N04A 3ARXA 1XYZA 3VVGA 1XC6A 1US3A 2VZUA 4RE2A 1VIWA 2ZX6A 4W7WA 1BGGA 5HBFA 3MUAA 3UR7A 2BHYA 3PZMA 4PMNA 1BPLB 3GNOA 3VIGA 2YA1A 2WAGA 2O9OA 1GQLA 4F9DA 4ZEPA 2YBTA 1W1TA 3QGVA 3WH7A 4A3HA 1NOUA 3AYSA 4MNJA 3HU7A 2XSAA 4MB1A 5IHRA 2QPSA 3WD0A 3GNRA 1QHOA 1W1PA 1GQIA 3OLDA 4GZEA 3DC0A 1VAHA 4GZJA 3FY1A 4CVUA 3THDA 5D9OA 3AIWA 2O9RA 1HL9A 4XV0A 4W7UA 1JF6A 1EQCA 1W9BM 3AYRA 3EDKA 4FK9A 4J3WA 1KWKA 5E6ZA 4W85A 3AXXA 1E4LA 1NWUA 4URIA 3MMDA 4XX6A 3BLPX 1XH0A 3M07A 4MB5A 3ZSSA 3VM7A 5AC4A 4PMZA 1VBRA 2GK1A 2WANA 1Q4NX 3WENA 3W24A 4E2OA 3EDEA 3U5YA 1QI2A 1QI4A 3DHUA 2NT0A 3VGEA 3KZSA 5E9AA 1LL4A 1BVZA 1OIMA 1U33A 4W7VA 2YOCA 4WSKA 2WXDM 1V3JA 3J7HA 5IHSA 4GINA 4EK7A 3ALGA 2W63A 1CDGA 1V0MA 3VD3A 1VF8A 4CU6A 2CKRA 3NIYA 3BAKA 2WWCA 2HISA 3TOPA 1OSEA 4P7LA 1KQYA 3F5LA 2B31A 2V5CA 1U30A 4FF5A 4WKFA 4JAWA 4GO8A 3T2QA 1E1EA 5IFTA 2WHMA 1BYDA 1XSIA 3SUSA 3WF0A 1ZBWA 4PUEA 3U5UA 1E6RA 1UD4A 3SCUA 1IZKA 2WC4A 4GPNA 2XPKA 3KL5A 1TFVA 1B30A 5DT7A 4B16A 2J8FA 1MXGA 5I79A 1J12A 7A3HA 3IJ7A 3MSGA 3AS0A 3AHVA 2ZXQA 3FHQA 2Y8KA 4JL1A 1JYVA 2X05A 1BTCA 3D3AA 1B3VA 1UR0A 4V28A 3BCDA 5A6LA 4KRUA 4N0RA 2DSWA 3BCFA 3PTQA 3PTKA 3SCNA 5CLTA 3QOKA 1V6WA 3GBEA 3ARQA 1UR4A 2J25A 1ESWA 3TA9A 5A6MA 5C8BB 1US2A 1W3HA 2CEQA 1QPKA 2GSJA 4LYQA 5AYBA 3ECQA 1KXQA 4NRRA 4UQDA 2DH2A 4MB4A 4PMXA 4PN2A 2WM0A 3B8SA 2VZOA 1NP0A 1MFUA 2CESA 4A3YA 2Q8XA 4AC1X 5I24A 1XCXA 4U5KA 4JCMA 4A4AA 3BMVA 7CGTA 2BS9A 2DT1A 4B9ZA 1ECEA 4D6GA 1H4PA 2J8GA 2VX7A 3BAYA 2CKSA 4D72A 1VFFA 5LA1A 4JFUA 3WNOA 3AIQA 1V3LA 4ACZA 1Y7VA 1BF2A 1V0KA 4YPJA 1E3XA 3HJEA 4F79A 1BYCA 1JYXA 1XSJA 1GVYA 1SFSA 4NI3A 1CGUA 1GQJA 1CGYA 1QNQA 4B3KA 2J79A 4D71A 2CNCA 4PTWA 4Q7NA 2CPUA 3MUZ1 4AYSA 3UEQA 3OIHA 1UHVA 2ZIDA 2QPUA 1E71M 1GQKA 4Z2GA 4OZOA 2D0HA 2WMHA 4C7GA 3FAXA 4XUYA 4PTVA 2JIEA 1AQ0A 4WK9A 4HZ7A 1EO5A 4HPGA 2O9PA 5CSYA 1DEDA 6CGTA 4NF7A 2F2HA 4FLQA 3VM5A 1V3MA 3MANA 4GIAA 1TA3A 3FXYA 4GI8A 2XM2A 1BFNA 3QR3A 4MAZA 1CXKA 3W26A 2CHNA 2UY3A 2XVNA 3G6LA 3PZGA 5BXRA 3AHZA 4OIFA 3CO4A 2VQTA 3L4VA 1N82A 2XJ7A 5ABHA 5EMYA 3DYOA 4MNMA 5D4YA 2MANA 3N15A 4P7QA 8A3HA 2X0YA 2XWDA 1UKQA 5BWFA 4MPKA 3WH5A 3RJXA 2YDQA 3AHXA 1ODZA 1XH1A 4HMDA 1OT2A 3WDQA 1JYNA 1NWTA 1BAGA 4OJYA 1JG9A 2E8ZA 1E56A 1M03A 1QI0A 2DIEA 4PCSA 4PMOA 4UTFA 1C7SA 5DMYA 4D6IA 1CXIA 3WEZA 1KGXA 2Z1KA 1WNOA 4DM2A 2CYGA 2YKKA 3AMCA 3L4TA 3SIMA 4D1IA 2JEPA 1D2KA 3OBAA 3VX0A 2F61A 1XCWA 2WYSA 2O9TA 2VI0A 4X0VA 1B9ZA 3TTYA 4AY1A 6A3HA 4V27A 1OBAA 1CGTA 3FW6A 2A3EA 1UWRA 3AISA 2XGIA 1B0IA 4MDOA 1EOKA 2O92A 1UWSA 2J7HA 3N1AA 1NM9A 5I2UA 5CXPA 3WUFA 2OYMA 2NSXA 2WW5A 5D9NA 4FMVA 3VD9A 3AMLA 5ABGA 2WHLA 1EH9A 1IT0A 4M80A 4ACZB 2WCSA 3AZSA 5A3HA 1CBGA 1W32A 1MWOA 3T09A 1VEOA 1ZL1A 2G3IA 4ATWA 3WKZA 1JZ4A 4UCFA 3RM8A 3N17A 4QDMA 2W62A 3RIKA 2VVSA 3KWXA 3SCPA 4DWSD 1W1YA 3N12A 5KZ6A 4MTVA 2XM1A 4ATLA 1UKTA 4ATDA 4CN4A 3W6MA 5HXMA 3II1A 1XD0A 1VFOA 3F5JA 2XFRA 5CPQA 3GH7A 2ESCA 2RGMA 1QNPA 1KBKA 1I1XA 4BA0A 1PBGA 1Q6DA 1UG6A 1TA3B 1CXLA 1E72M 3EDFA 1E0XA 1QHZA 5M5DA 2V3DA 3EYPA 5JBDA 2WC3A 1E6PA 3CLWA 3QHOA 4J3SA 3NSNA 3BXWA 1UZ1A 3WBEA 1TCMA 5HDRA 2CERA 1OD0A 1FH7A 4CUCA 1UWTA 1B3XA 1UA3A 3WUEA 1WDQA 2ZUUA 1C7TA 1KB3A 3APGA 3VPLA 2XWEA 3VDBA 1AQMA 2XIIA 1W9VA 4J7RA 2BY0A 2W66A 4AXNA 1E6NA 2DSVA 3SCWA 1G94A 2JEQA 3ARTA 3UERA 4YHGA 4MADA 2X8RA 1B31A 2OYLA 3BAIA 1UKOA 4IPNB 1FFRA 2E40A 1G9HA 5AC5A 3WH8A 1CLVA 4JFVA 5LA2A 2J7EA 1HJVA 4UQAA 1WZKA 1E0WA 2WC7A 1VFUA 5EFDA 1BLIA 1K9DA 3K8LA 3VMPA 4UOJA 4RE3A 2WLZA 3VIJA 3RM4A 5GQBA 1JFHA 3WDRA 2JE8A 1MVYA 3OA5A 1EXPA 1CEOA 3VX1A 1ISWA 1G1YA 2Y2WA 1E6QM 4W87A 4B15A 1W1VA 1VFMA 3AI0A 4H2CA 4JCLA 1ODUA 3WY1A 3K8KA 3PZIA 2E8YA 1E6ZA 1HKMA 3ARSA 1UR1A 4AD0A 2PWGA 2WMGA 2D24A 4AZ5A 1WDSA 3AS2A 1O7AA 3PZTA 1VEPA 2BVYA 2JFEX 4MDPA 4U3AA 2VRKA 2AMGA 5CG0A 2YA0A 4HA4A 3WD4A 3WD2A 4P7NA 3CZ8A 4GZIA 2YL5A 3PHAA 4ZE5A 1R86A 5D8ZA 1EDQA 5D9PA 1CXEA 2VZVA 1UD8A 2VR4A 4UFMA 5C71A 4KRTA 5AY7A 2VZSA 3EMQA 4E4PA 1SR0A 2AAAA 3VMOA 3ZMRA 3PZNA 1BG4A 1NOFA 1W9DM 4BQ3A 3ALFA 2WKLA 4P8UA 3MO4A 2D1ZA 3OZOA 4QLKA 3WF2A 1MYRA 2VCBA 3O2LA 3SUWA 2ZX7A 1FA2A 3WFLA 5A6JA 3NUKA 4PSPA 3IAQA 2W5FA 5DEZA 2WB5A 4MAVA 3CPUA 3L2MA 4PYSA 3W0KA 2VMFA 1H5VA 4Z2IA 4GXPA 3WQWA 3EMZA 4HOWA 2WHKA 1GPFA 1VJSA 4WSJA 1WKYA 2VNCA 4W89A 4QLLA 4AZBA 1V02A 1HP5A 2YL8A 1W9XA 4MB3A 3A4AA 2VX4A 1DWAM 4PMQA 4RE4A 1UD5A 2XTKA 3A6OA 1FP8A 3SCRA 3OLIA 2DH3A 2VRQA 2WVUA 4IM4A 1KXTA 1C93A 1L0PA 3TP4A 3U57A 4P8WA 1LWJA 1EGZA 1UD2A 1TMQA 2WMFA 4F8XA 1X6NA 1HJXA 1WP6A 2XVPA 1CNVA 1Q6EA 4IUGA 1IZJA 1E4MM 4W5ZA 1I75A 5FKYA 3ARZA 1MQRA 3JUGA 4U33A 3EDDA 2WBGA 2W61A 4M56A 1ISZA 2EPNA 3VKKA 3VOCA 1V3KA 5DF0A 2J7DA 3WDHA 1O6IA 2D0GA 1OIFA 1HP4A 1R7AA 2DSZA 4CN1A 1ITXA 3W81A 1GJWA 2Z1SA 3BAXA 1JZ7A 5GNYA 3AMKA 1HJUA 1RPKA 5HOSA 1KXVA 1W3LA 1JD7A 4D6FA 2V3FA 3O9NA 4QCEA 1TR1A 4TXEA 1GOOA 3WNKA 1JAKA 1JD9A 2CBVA 1UKSA 2FHCA 1FFQA 3SEPA
chains in the Genus database with same CATH superfamily
3FEMA 2JF6A 2IS7A 2X2GA 3TN6A 2EG7A 4BZYA 1V6XA 3T8LA 4QDPA 4GQ0A 4US6A 1CT5A 4ZO6A 4I3GA 2YYTA 3M7SA 1SO3A 5A2AA 3QQ1A 3WF1A 4CQ8A 3T0AA 4FNTA 2DDXA 7TAAA 2OSYA 2E7FA 3KBJA 4LV4A 2DSUA 3TV8A 1IEWA 3MJYA 2CU0A 4Z1BA 2XPAA 2QGHA 4GD0A 4K37A 3E12A 2NVDA 1E3ZA 4J4OA 1LQ2A 2PGEA 4Q4PA 4J9JA 2F84A 2XP5A 4LTSA 1GOXA 2PWEA 1C29A 1OFBA 1YBQA 1J0HA 2FVLA 2PDFA 4S39A 5MKGB 1PIGA 1Q6RA 2CITA 2BOGX 4DLMA 3LCLA 5K2ZA 1E6SM 2CFFA 1B3WA 3ZJKA 4MNLA 1R87A 4DJDA 1QBAA 4MIMA 4Y7EA 4PC8A 1ZGDA 5I3IA 3W84A 4A2RA 1JEZA 3A64A 2ZZ4A 4IIFA 1OX4A 1JGIA 1H3GA 2HEJA 3S42A 1MMFA 1XXXA 4Y2WA 3KTCA 3PZ9A 4Q4RA 4RK8A 3GFYA 3U6WA 4OBSA 3BJFA 2PTWA 2EBNA 1GOQA 3Q45A 5HWMA 1OCBA 3NPXA 4BFAA 2MNTA 2NLYA 1PZ3A 4HVXA 2WVTA 2PGFA 2GJPA 4TVCA 1EHNA 3HJZA 5F2MA 3LD5A 1JYWA 3N18A 4YTUA 2G96A 3ANVA 1AZ2A 4XD6A 4HOXA 1VPQA 2X41A 3VMNA 3TN4A 1KFWA 1HZYA 3TQVA 1Z7AA 3EBVA 4HT3A 4GA8A 4GCXA 2OELA 2HS6A 4WQ6A 3AS1A 3ODKA 3WZ0E 2P8BA 2XINA 4LANA 1XINA 4JTTA 4I6KA 1VCFA 3E2QA 2M08A 1S1RA 2GGEA 2ZUTA 3GR7A 3H2AA 1QNVA 1HF6A 3LPPA 1BQCA 3QC3A 3EMCA 2WNQA 2OEMA 1NFBA 3NURA 2QNEA 2F21A 2VUYA 3VUPA 2GGHA 2HMCA 2QT3A 3C5QA 1ZJHA 4ZVJA 3E0IA 1VFTA 3G8EA 2ZX5A 4WF7A 4YNGA 3R6IA 3IJDA 4AIEA 3P84A 4LYPA 4MHBA 2DG3A 1XIDA 4UBPC 3H54A 4UFHA 3LRLA 4UIOA 3TN5A 2WV8A 4EWJA 4TNSA 2A79A 3A24A 3L2LA 4JKLA 3NTPA 4JKMA 3OOBA 4S3FA 2XSBA 2HJPA 2XH4A 4Z2KA 4QE4A 1KFCA 1CGWA 2R14A 3G1FA 3R12A 4QG6A 5D2YA 4DYJA 1FCBA 3WBYA 2ACQA 2O0TA 5CQ1A 3ABRA 2VC9A 1JDAA 2GZXA 1DHKA 3N6JA 4NZCA 3LCXA 2C14A 1JXKA 3AICA 2BX7A 3ABOA 4L61A 5K7JA 5FIPA 3B9EA 1XFBA 3C4UA 3GS6A 1XRVA 4AIBA 3WF3A 3W25A 4Q33A 1EGMA 3VKDA 4O10A 3NVTA 1GHSA 4AWTA 4FN2A 1DTNA 4LAMA 2ZQVA 1UKPA 4HB7A 2VX5A 1QPQA 4ORIA 3GNPA 4O16A 4MFDA 1EJ7L 3T0DA 3NL2A 1IXOA 1D3HA 2BGNE 3BUVA 5KETA 3RUBL 1S5VA 3O16A 2ZE3A 2TYSA 1GOMA 5IFPA 7TIMA 3NQBA 1OYBA 1K03A 4LB3A 1ONXA 3QRHA 2W27A 4AZCA 4W8AA 3RX2A 2J9YA 3C6CA 4HA0A 1ZAHA 2JALA 1Z89A 2G3MA 3FJNA 4QE1A 4QG8A 4J3XA 4Q8OA 1HX0A 2A3AA 5LIUX 5A1AA 2ZVRA 4V1YA 2PI6A 4ZFMA 2ISSA 1B4EA 3TCSA 3EPMA 1A5NC 5HKGA 1UUOA 3ZO9A 1DL3A 3UXLA 4IX2A 1FWEC 4JTIA 4HTBA 2QV5A 3NVDA 2OYKA 1XBXA 1XYMA 1WDDA 5KZMA 4UQBA 4O0KA 4JTFA 3LCIA 4UFIA 3RGTA 1F40A 2E67A 1R7OA 2DVXA 1L8PA 1FKWA 1HNYA 2NX3A 3HTWA 2G4FA 3GC2A 3W83A 4NL1A 1W91A 3L4YA 4YTSA 1FWAC 4LC8A 2QDEA 2E1DA 1WCGA 1MO0A 1E1FA 1JI1A 4BF7A 4IG2A 2A21A 5D9MA 5GJMA 4PB4A 2PF0A 1E44A 4YCPA 2VTFA 2X16A 2GUYA 4GG9A 4U5IA 3LUTA 1VJIA 4B5UA 3MSYA 3WN6A 2F9RA 2EULA 3RX4A 1B2YA 1IX5A 4LAZA 4E38A 4IGSA 4E2VA 2D9FA 2PD5A 3EY6A 4GGHA 2X09A 1DWJM 4IXHA 1KGUA 2J7FA 4EANA 4GNVA 2DZAA 4UNKA 3RR1A 5JH8A 3IIXA 2PLMA 4NNRA 5CJNA 1K9TA 4H9YA 1Z32X 4BQ4A 4C5YA 4G2PA 1KCLA 3WQGA 5HJXA 1TVPA 4ZOCA 1F8MA 1KLZA 2ACRA 4M5PA 3KTXA 4HU0A 4H9UA 4IMDA 3CQJA 3NDYA 1V02E 4JFMA 4MFEA 4P7OA 1KBLA 1FKTA 1GPWA 1BQGA 2XSXA 3ZVIA 3E9AA 1TE6A 4AVFA 2MF9A 1WAWA 1XBZA 1JR1A 3VABA 2VKZG 2XH2A 3CEUA 2FTPA 4V33A 2HS8A 3IK2A 2GWNA 1ZB5A 2CLKA 3HQ1A 4HNCA 4PFMA 3CGTA 1MRAA 3DKLA 2I16A 4BK9A 1EIBA 1MW0A 5B80A 5CPOA 2G5WA 1R3QA 2IQTA 3OZPA 4C6DA 2GJNA 4C6EA 3WQ5A 4OV9A 3RX3A 2XGBA 1H51A 3DG3A 2BP1A 1WBJA 4R7WA 4D8LA 1W56A 3MCNA 4GKLA 4H00A 2V2CA 1OFOA 4GXWA 1UASA 4IP4A 1A0EA 1SJAA 4M7SA 1VBUA 3CUIA 3OBEA 1YTKA 2A3LA 3RU8X 4JX6A 2Q8ZA 2W4XA 1QT1A 4AYGA 3G1XA 1H0GA 4X61A 5FA5A 4L6HA 3HPFA 4F0LA 4JY9A 2WVVA 4GGBA 3PSWA 3UJSA 4J4KA 4XZMX 4Z1AA 4A2SA 6ALDA 1R2RA 1NSJA 4B5WA 1PX8A 1KM4A 2HRWA 4LU0A 2NW0A 1T96A 4IZGA 3C8FA 3KEHA 4LOCA 3W71A 3TEVA 5A8PA 4G6CA 5FSEC 3QGAC 3LPOA 1W6TA 2WMIB 3N73A 5IRPA 5HT1A 3HPZA 3A5VA 3QV6A 1HKWA 4K1WA 2ZADA 1PKMA 3B40A 3H2FA 5DMMA 3UESA 5J5RA 1HJQA 2CZ5A 5I3DA 1FKHA 2ALDA 3WQVA 3GK0A 4DF0A 2QUUA 1BRLB 2IKJA 4JYSA 3NPUA 5M03A 4M6PA 1F6PA 1Y0EA 1XW8A 1JVNA 3UY8A 5BOFA 1A4LA 5M17A 2A3BA 1QWGA 5AHFA 2FZNA 3P0XA 3HG3A 4Q4QA 4LUYA 3AUOA 3PUGA 4AWUA 5HQLA 2A7NA 3W82A 4RLIA 3EOEA 2JKEA 2OO0A 4N6EA 1E5NA 3C86A 2ISVA 4CVWA 2CHOA 2P8CA 4CN6A 5E6YA 4RDVA 4B3ZA 3BL3A 3B8DA 1DQUA 1EOMA 1KCZA 4AMCA 3S5YA 3IUHA 1EYMA 1OFDA 2ZDRA 1KFLA 4JQ3A 4WR3A 4LUSB 3WMBA 3NQMA 3N14A 5C54A 3VFLA 4JTSA 2QEZA 4LF1A 4CGTA 4Q6XA 3MP5A 4K6AA 1LRNA 3FIGA 4X0NA 3SJNA 3AWNA 1TX0A 3DENA 5CJMA 3M0YA 1TIWA 1Q1CA 3BLOA 4V2XA 4XTDA 4JIIX 1GOIA 1LWHA 4B5NA 1W8SA 4PEEA 1P4CA 2W92A 4ICMA 5C9WA 4JFIA 2RDWA 4IFRA 3S46A 1ZS2A 4PCPA 4YJ5A 5BXJA 2YFOA 3PSVA 1LL7A 2FPYA 3VD7A 5CZJA 3PVFA 2WQPA 4B92A 1MW1A 1JNSA 3W1NA 2DV0A 4KR0B 3APTA 3VNZA 3TTQA 2C6QA 5A8MA 1KCXA 4LBSA 2NQ5A 3FX4A 5TIMA 4AB4A 2BVTA 3UW6A 2XFWA 1ADOA 3GDMA 2V5LA 5A69A 5BXPA 4AZ7A 2FH6A 1PCWA 2ZQTA 1JCHB 5IOBA 3A9BA 5DLCA 1QFEA 3NI6A 3WNLA 4DELA 1RD5A 1CGVA 3VILA 2PDXA 2CHRA 1N8IA 3G24A 1SZFA 4PZVA 5H91A 1XIEA 3L2IA 2YCJA 5A8OA 2L2SA 1WOBA 3REQB 2RH9A 3GHRA 1AFSA 2HNHA 1C92A 3DG7A 2DT2A 3BJTA 1YYAA 3CASA 1KRBC 2QHAA 1Q6CA 3KHJA 4JFWA 1NU5A 2GFTA 3T42A 1O68A 1P0KA 2PE4A 3BH4A 1PBKA 2Z2AA 3W7MA 1TVLA 2G41A 3W7LA 3C3UA 2LLEA 1Q6UA 3W86A 2V5JA 1M7XA 2PPNA 4GKTA 4CCEA 1VFHA 2FJUB 3OJGA 4HBEA 2Q5AA 4Z08A 1V3HA 4CU7A 1KT0A 1D7HA 3T2PA 1PX3A 3O5KA 4NYYA 3T0TA 3ZR6A 2WHJA 4JBRA 5F2LA 3W7JA 1V8EA 1UR2A 4EAYA 4C02B 2XG9A 3LV5A 1J0IA 1F74A 5DY2A 1JRCA 4S1FA 4LAOA 1REQA 3M0IA 1MXDA 2Z25A 4AMAA 3A12A 4OFCA 2GVGA 3A4WA 3EB4A 3TKFA 1P48A 2IKGA 1S2UA 5FJIA 3VIKA 5I23A 4BCEA 1SR9A 5I5RA 4BQ2A 3V0UA 1XDJA 2WQDA 1SMDA 1XSKA 4H4IA 5CC3A 3UF8A 2ZWZA 4PBGA 3W1MA 3UG5A 5AECA 3UJEA 5GPGA 2QVHA 5ECUA 2J27A 4CNTA 2RAGA 2Z7GA 3GB6A 2UWFA 2C8NA 3S2NA 1L9WA 4O50A 4KRZA 2VL4A 2BODX 5LA0A 4M81A 2ZRZA 1GONA 2V8ZA 1CXHA 2J9ZA 4I8YA 2QUTA 3OVRA 1FH8A 4GO9A 4JZ5A 4O0QA 1R3TA 4NNBA 3T6CA 4DNHA 1JIBA 4JICA 1MNZA 5C2CA 7PTDA 1EUNA 2E4TA 2D2HA 2WO5A 4J28A 1J0YA 5G1MA 2Q8LA 5J5DA 3PC0A 4DXKA 3IJ8A 1ZCOA 3CS2A 1V6VA 3CC1A 4DJEA 4YS1A 1XLBA 3EKLA 3VKJA 1IWPA 4NHVA 2EKCA 4HBOA 3WUGA 2XP7A 3VIFA 4N6FA 3W1TA 3ABSA 2HZGA 5CC5A 3N13A 4YTTA 2BV9A 2PWHA 3SR7A 4PTXA 3E96A 5H8MA 2WSYA 1TRIA 3CL6A 1BSLA 1IR2A 3HFTA 1DKWA 1A80A 4WEVX 1HKKA 3NM3A 3MMWA 4PL2A 3ARRA 5DIUA 2QLYA 4JQ2A 3RO8A 1AD4A 4U31A 4NUWA 5XINA 4R5EA 3N3MA 4OV4A 1QI3A 2PDPA 2YCLB 4HYRA 3PJXA 4ZSUA 4JIRA 2LKNA 2FGZA 5HR6A 1LORA 1JDFA 4ZODA 4J1OA 3HM7A 3AROA 1EA9C 2QCDB 3NOEA 4JFSA 4DWSC 1L6YA 5KEZA 3E2SA 5BROA 1F73A 1SO6A 3G0XA 2XPBA 3MSDA 3E0LA 3H2MA 3NQ7A 1KW1A 1EWDA 4H9VA 3GG1A 3LK6A 3WLSA 1NELA 2YZ5A 4ZOBA 1RLDA 3VNDA 5CZTA 1UYQA 2DQWA 2XVGA 3HO8A 5A8QA 3F2BA 1B57A 1OT1A 1TTQA 4HARA 4TX0A 2EPLX 1HKIA 4DB7A 3HMCA 4Q8UA 3L21A 3STEA 4UTHA 3BSHA 3QW4B 1JDEA 3KAHA 5HINA 4D6CA 1R9XA 1D3GA 2AQWA 1GT8A 3UYIA 3WL0A 2DQXA 3PAJA 4A3QA 1OCJA 3PR2A 4HPHA 1QK2A 3W38A 1XIGA 4HD5A 6ENLA 3T8QA 1V6YA 4XKYA 3S1UA 5EKYA 4PSRA 1KBBA 4AZIA 4UNIA 4AD3A 2FTYA 2YJQA 4CU8A 4AY7A 1F61A 4XUGA 1JCMP 1I8JA 2MLYA 3M47A 2E9LA 3QVQA 3PBYA 2V2HA 4HJWA 2WWDA 3RRXA 1J6OA 4UR9A 4QDWA 1KWGA 4U4MA 1AZ1A 4WCJA 5B8IC 3ARXA 2Z27A 4US5A 6REQB 2VZUA 4W7WA 1Q6QA 1BPLB 4X63A 4F9DA 4DJED 3QGVA 4NY2A 2VGBA 2VENA 2NXHA 1XI3A 4A3HA 1NOUA 3AYSA 1LOLA 4ZOAA 4MNJA 3HU7A 1JRBA 1XDMA 1RBOB 1EXBA 1XLFA 4Z1CA 1VAHA 2J88A 1RAKA 4MWAB 2ZRXA 4CVUA 3AIWA 2O9RA 1EC9A 1TJ1A 3CJPA 4IQCA 1J4HA 3NQCA 4J3WA 3EDKA 1PKLA 1KWKA 2E77A 5LXEA 1ZP3A 4URIA 4XX6A 3M9YA 3BLPX 1XH0A 1L2QA 3BMXA 3BWWA 1OK4A 2GWGA 4FX8A 1T11A 2WANA 1ADSA 3E5PA 3TCZA 2VN1A 1T99A 2CZFA 3LMZA 3VGEA 3KZSA 4W7VA 2YOCA 3O6DA 4WSKA 2WXDM 2GUBA 3KABA 4FNQA 1ZNNA 3NA8A 3I6CA 3GLCA 4XK2A 2GQ8A 2Y6ZA 3U0HA 4EK7A 1CDGA 3NGJA 4L64A 1VF8A 5C6MA 4L9XA 3D0CA 2HISA 3O5QA 1GQNA 3NO3A 2BG5A 5LNVA 3F5LA 1DE6A 3QTPA 4FF5A 4WKFA 1RPXA 4XWUA 1EJXC 4KIRA 5BU6A 1E1EA 1WUFA 3TAKA 3TH6A 3U5UA 2PV1A 4Q8PA 1E6RA 1UD4A 2PLCA 4GPNA 2XPKA 5DRIA 1G7VA 1TFVA 1B30A 3N29A 2D73A 3H55A 4HHLA 4RDYA 1PO9A 1BTCA 1QPRA 3T44A 4LAYA 2NQLA 3QKEA 3C2YA 2Z26A 4NX5A 3TR2A 4AQLA 3PTKA 4LAKA 3JW7A 1RHCA 4PUWA 3H7VA 3F4DA 5D2WA 1V77A 3NL5A 3SFKA 1G69A 4C6MA 2GSJA 1JCXA 3ECQA 1KXQA 4IL0A 4NRRA 1XDLA 4PMXA 4G7EA 2WM0A 3QPYA 3RO6A 3MHUA 3MHGA 3B8SA 1DJWA 3GTXA 3AU2A 1NMWA 4M0XA 4JCMA 5I06A 1Q7QA 3VKCA 2INFA 3QZAA 4HNOA 3SQLA 2DT1A 1ECEA 3KOFA 2Z28A 3H7UA 1Q66A 2P3EA 1QJWA 1A0CA 3JS3A 4FAMA 4D72A 3TUUA 5LA1A 4RNJA 3GW3A 4JFUA 1Q6IA 2C91A 3MYOA 4ACZA 1Y7VA 1BF2A 4L6DA 3QMSA 2Y7GA 1EJVC 1XSJA 1OEPA 3WJWA 3VZZA 3Q94A 1GQJA 4M51A 1QNQA 1FHVA 5AN7A 4PTWA 3ZXWA 4Z1YA 1OX5A 2CPUA 3D3FA 3UEQA 3OIHA 3HQOA 2OG9A 2QPUA 2B0MA 1GQKA 4NJHA 1BKHA 2FGBA 1LOSA 4ZS6A 3LHVA 2YXXA 4C7GA 1EWEA 5DX7A 4WK9A 5AHLA 1EO5A 3C2EA 4HPGA 2O9PA 3W00A 1U1HA 2D2GA 3U2ZA 4YTQA 1DEDA 3PB0A 3GU1A 2FVKA 4LS2A 5DITA 1TA3A 2YR1A 4GI8A 1Q5MA 4CQBA 5EU9A 3N2CA 2ACSA 3O5RA 1CXKA 4XAGA 3U3HA 4JOMA 3BG3A 2P53A 3U4AA 3AHZA 5HTGA 4NZ5A 2VQTA 2YZRA 3W7DA 4XQ6A 3DYOA 4MNMA 3F4WA 3STFA 1S5MA 8A3HA 1YADA 3TROA 1W1A1 3W2LA 1UKQA 2NUWA 2HSAA 1XQKA 3RJXA 3W2NA 3MYPA 3BZGA 1OT2A 1R30A 1BAGA 3F1QA 1M03A 5CPNA 4UTFA 5AC7A 5DMYA 3INPA 5F1UA 4D6IA 5LSMA 5TQLA 1WNOA 2CYGA 3L4TA 4D1IA 1D2KA 2F61A 3T78A 1T7LA 4R85A 1IR1A 3CWNA 3GC5A 1J2BA 3S2LA 4JGDA 1UMYA 4PGLA 1OYCA 4WDUA 2XGIA 4MDOA 3CXOA 1Q2RA 1F8AB 1EOKA 2ANUA 2ZQUA 3O5EA 2ACUA 3PBMA 1W31A 4YYFA 3DAQA 1NM9A 3MBFA 4MKVA 1DJYA 2EGZA 3DGBA 4JR5A 4A05A 3AMLA 3LXAA 4IGHA 4MKSA 1K4GA 1IT0A 4XKMA 3AZSA 3A5FA 4IT4A 4O1AA 4BJHA 1PS9A 1ZL1A 5BU9A 2OOFA 4RZ5A 4EVZA 1QK0A 1TR9A 3KWXA 4ZQNA 1VHCA 1W1YA 3FA4A 2XM1A 1UKTA 4ATDA 2NQJA 2VM8A 3UY7A 3UI6A 4Y9AA 2BVWA 2OQLA 3F5JA 1EB3A 2EAWA 2BBFA 1DIEA 3L5LA 1KBIA 1BKFA 2YW4A 3CAQA 1Q6DA 1RSCA 4DF1A 3RRAA 5CBJA 1E72M 1E0XA 4W9TA 2WSRA 2WC3A 1DORA 3QHOA 2QJHA 3NSNA 1TCMA 2CERA 3C8NA 3ABZA 1H1YA 1M9HA 4ZMGA 1WDQA 2ZUUA 1C7TA 1KB3A 3UWUA 3NO5A 3SFWA 3TW7A 3VC5A 3GZ3A 4J7RA 3BV4A 3JYMA 2BY0A 2W66A 2VOMA 1UPMB 2Y70A 3IGHX 4YHGA 4GVIA 4MZYA 3WLKX 4EIVA 1A53A 1G9HA 3VNJA 3WH8A 5FAJA 3UI4A 1HJVA 4Q8VA 1L6WA 2WC7A 4DY1A 2YW3A 1VYSX 2NUYA 4I6VA 4UOJA 2DG9A 4MY8A 1O95A 1JCYA 3FDGA 1JGMA 3RM4A 5GQBA 3UWWA 4GYPC 3HG4A 1H60A 1Q3NA 8TIMA 1JFHA 3GDRA 4ZTXA 4RXFA 5C9UA 4ZPWR 1CEOA 4MG4A 1ISWA 2XN2A 1XP3A 3N25A 1G1YA 1E6QM 3NXFA 3P74A 4B15A 1W1VA 4ODLA 3BQ5A 4DI8A 3KP0A 4EF8A 3R0KA 1C9DA 1E6ZA 1UR1A 4WRHA 4I90A 3WK2A 4POCA 3AS2A 2ATMA 3WQDA 1O7AA 2P4VA 4A8RA 3TC3A 4UUIA 2VRKA 1GYLA 3SW6A 1RBLA 1P7TB 3QQWA 4FX6M 3WD4A 3PM6A 3WD2A 3CZ8A 4YXGA 2YL5A 1XYBA 3IEBA 4S2CA 1ZALA 5A5WA 1A7XA 1CXEA 2VR4A 3L0KA 4KRTA 1IT8A 2W0UA 2AAAA 4B90A 3VMOA 3NEHA 4QHRA 3BTNA 3GAYA 4Z17A 2NZLA 3W07A 1KLYA 1NOFA 4CQCA 4OHQA 1ZHAA 1PE1A 3OZOA 4GUHA 1RXOB 4HBKA 1MYRA 5FEZA 3O2LA 2ZC8A 3SUWA 3T81A 1S2VA 1A49A 2OZTA 3T55A 3NUKA 8XIMA 3IAQA 2W5FA 4NJJA 3GVQA 2WB5A 3CPUA 4IIGA 5M1TA 1XUUA 1H5VA 1VYPX 1VC4A 3VCCA 4HCLA 1GPFA 2QCGA 2VNCA 4AZBA 4DZHA 1HP5A 5HATA 1XJBA 1SFTA 1P0NA 1W9XA 4EP8C 4IFKA 2DUZA 4UTIA 3VA8A 1F6KA 1UD5A 2R9RA 4KCWA 3A6OA 1FP8A 1RCQA 1L0PA 2QIIA 3TP4A 4KWVA 2PDIA 1EGZA 7REQA 3W9ZA 2WMFA 4F8XA 5HANA 3SBFA 4RV3A 1CNVA 1IZJA 1I75A 1R3YA 4U33A 2VD8A 3EDDA 1HO4A 3O06A 3N3TA 4M56A 3TA6A 3VC6A 2A7PA 3VOCA 5IDZA 3IK8A 2W9MA 4XAFA 3G1RA 1Z8AA 4GYKA 4ZO8A 3W75A 1UBPC 2GQ3A 2BXVA 2Z1SA 3BAXA 3AU6A 1EJSC 1CCWB 3AMKA 1KXVA 1FY6A 3QFWA 5T26A 2F4EA 2V3FA 4QCEA 1TR1A 1DBTA 4M6VA 4MLJA 1ICPA 1GOOA 4LF2A 3BG9A 1UKSA 2EPHA 1FFQA 2CLIA 3IPWA 4GQQA 1HTIA 1K1DA 4O53A 3KE0A 3BOXA 2PEVA 4J5NA 4UFKA 4RKAA 2PRHA 4D8AA 2Y7FA 3ITCA 3SURA 4H3DA 2ZOXA 5E5CA 4UB9A 2E6YA 2WOQA 3TNOA 4JX4A 3EOOA 4HZMA 4F9JA 3PPHA 2FZDA 1X6LA 1HJWA 1UPPA 4LWWA 4O54A 2NV2A 1QO2A 1V3IA 3K4AA 3KS6A 3HV8A 1EYEA 2PDCA 4M1BA 5ABTA 1YNQA 3M43A 4AEOA 3AXHA 4HU4A 4XAPA 2Z7KA 2V5KA 3OG3A 3V35A 5BWAA 3KZPA 3VOIA 3ZSTA 5J6EA 4GOAA 2OEJA 1YATA 2ZWYA 4IIDA 4QEEA 3UPMA 3K46A 2C18A 4C6NA 2FFCA 3HF3A 1QBBA 5E70A 3Q37A 1HJSA 2WZEA 1J9YA 2E68A 3TC5A 1K70A 5AHIA 4PUKA 3VOGA 1DP0A 3MJMA 1D9EA 3R0UA 3RG6A 2V63A 1YRRA 4K8HA 5A94A 2GUUA 3NO1A 2AQOA 1QPFA 4GQBA 4PCTA 1PL9A 3M5ZA 3IKGA 3P5YA 3UJRA 1XHGA 2KO7A 1WXYA 1ISXA 2IQ0A 4DWSA 1PAMA 1C8YA 2PBGA 3STCA 5FSDC 3NEVA 1DIDA 1V5XA 3GD6A 4ILSA 2Y89A 4IISA 1D7KA 1WDPA 5F1VA 3MKKA 2X7WA 2CLOA 4FXJA 4UQCA 4C6KA 3NDZA 2EPKX 3GUWA 4L72B 2OSXA 3KAGA 4KBXA 4C1NB 4DHGA 3KOYA 3WNNA 3RLUA 2CWXA 2J78A 4CD7A 2VJXA 3BG5A 1TJRA 3VOHA 1BD0A 1H50A 3ITOA 2B81A 2FYMA 1OC7A 2HXUA 9CGTA 5HUPA 4YYCA 4EPBC 2D22A 5A6BD 1YNPA 3EXRA 2YBVA 1A5CA 4IJRA 4AISA 5C2GA 3OLEA 4OU1A 2JBMA 1DJXA 4LXFA 4IJCA 1UWIA 3K5XA 1OG6A 1EPVA 1QASA 3GYEA 4IQDA 5T9CE 3LBCA 1PTDA 3TW9A 1RK6A 2PSNA 1FUYA 1E15A 4MUPA 4QT2A 1Q8AA 5FD0A 3SGGA 4GABA 1XPYA 4JKKA 3GVWA 3QV8A 4AXKA 1SJBA 1ZU8A 3I4KA 4ML9A 1QO5A 1J0KA 3PTMA 3UCQA 1F7BA 1YBQB 3UR5A 3PZUA 1POJA 4TVDA 3CO8A 1ONEA 3H70A 4LUIA 3B9AA 4O14A 2FKEA 4J3UA 3B4UA 1ENUA 4IPXA 3W87A 2OQHA 1XYCA 3UNTA 1K02A 3LENA 3QFEA 4R7JA 4ONVA 4E0CA 4M8UA 3OGRA 1JCLA 4UTTC 4F0HA 1V6UA 2E0PA 5CZKA 4QAWA 2W6RA 4PB3A 1OX4B 1W3KA 3LTYA 2NLIA 3L4XA 2QCDA 3DFPA 4G7FA 1KFBA 1FWGC 4JHZA 3LLDA 3QOMA 1KBJA 3U7VA 4ODKA 3LPFA 4Q8TA 3O5IA 1M6JA 4B2DD 1ZK6A 3MI2A 3A3HA 3GVRA 2AMXA 2OFNA 2PU1A 1GCYA 3U9IA 1A50A 5AB3A 2WCAA 3E0VA 4JEJA 3IGUA 1E0VA 3ZR5A 3ITYA 3G0UA 4QX4A 1VJZA 1JNDA 3N6QA 1HKJA 4ZFCA 3M0LA 1K6AA 1WZLA 5C70A 1I2NA 3M5XA 5DN1A 2QCLA 1C90A 3CT7A 2BFGA 4EPKA 1KM1A 4U2YA 2D20A 3LCFA 4KERA 3DH7A 1GJUA 3BICA 3UG4A 3HV9A 4HMEA 1WKDA 4K38A 4P8XA 3TZFA 1UCWA 1UUQA 1YTEA 4ZQOA 2V6AA 4TX6A 1LF1A 1XWYA 2ZZ7A 3TQKA 3LQLA 4B5SA 2Y7EA 2WSKA 1M1BA 3TN3A 3FJ6A 4YVVA 1J11A 4R9OA 3AIEA 5JBFA 1SW7A 4IIHA 4FLOA 3CMJA 3W7QA 3ONCA 4QNEA 3ES8A 3N19B 2PC8A 3C2RA 3HQPA 4IGNA 4AD5A 1CLKA 4XBKA 3I7SA 4XZWA 5FOOA 4DZ5A 3BLEA 4WY0A 3TJ4A 3BZJA 3N2TA 3GW0A 4J3ZA 3RK8A 3DC8A 3DFSA 4L4MA 1M01A 3OTRA 4QR6A 4H9XA 1EA0A 4C6OA 3CYJA 3B8VA 1CLXA 5EYWA 1MW2A 3NSXA 3SRHA 5DCDA 1DWFM 3TLLA 4AW7A 3UVIA 1W8GA 4HSHA 3CU2A 3WLIA 4ASTA 2Y61A 1W37A 4U3CA 1JXJA 4RW5A 5AC8A 3NQ2A 3AUJA 1M7PA 3MTWA 2CXEA 1XLJA 1S39A 3H2OA 4QQUA 3WLMA 3NYDA 1PEZA 1MNSA 3QMRA 2J13A 4B4FA 3ZVHA 2PODA 3WK1A 4LAWA 2ADAA 1KD0A 2XUCA 5EFFA 3G18A 4HNVA 5CSUA 9XIAA 2VVNA 1L2UA 5A6AA 4OUEA 3CQIA 4C5ZA 4AFYA 1FWSA 3CZGA 1A5OC 3SRDA 3KCJA 4AZCB 4Q4OA 1OGBA 3MVTA 4GVHA 4KEMA 1GW9A 3NM1A 2J7BA 3S6TA 1B6CA 3KRUA 2J62A 1W26A 2J77A 4IICA 3A22A 4HMCA 2I1OA 3B3DA 1ZJBA 4IL2A 1QOPA 3OU8A 2ZZ6A 2OFJA 1EHAA 1C8QA 2TAAA 2VEIA 1O12A 3QLLA 4WJXA 4DF2A 1TVNA 3BLKA 2CIPA 4YTRA 1M04A 1CECA 3LERA 4N4QA 3CWOX 3L7RA 1XR2A 5HMFA 2BB0A 4E6MA 1YPIA 1OCNA 1E4NA 1V6TA 1GHRA 4LY4A 2GVEA 3VIHA 2AL1A 3W74A 1FKSA 2C1HA 1A47A 3W7NA 4LAUA 3OG2A 3QH2A 3AIBA 3DOPA 4L80A 2ZXAA 1QOXA 4G50A 4ZB0A 2CBUA 3VOJA 3U7BA 1W9PA 4KT2A 2Z24A 1Q6GA 4IG2B 2DSKA 4DBDA 3HN3A 4XVDA 3SIZA 3SCQA 3EWDA 3I6TA 1JCJA 4S3BA 2QCFA 4AD2A 4NXSA 5DRCA 3K4DA 3A23A 1MQQA 3W27A 5JUVA 5CEWA 4L56A 3WQ6A 4Z1DA 4EXBA 1VRDA 5FESA 1NARA 4P7RA 2HCVA 1P0DA 3WJZA 2KZHA 3DHPA 1H41A 4LEFA 4ZCWA 2EPMX 4HHMA 3S1GA 3MUY1 4PMDA 4AZ6A 3URQA 1T0OA 1TV3A 1TE1A 1EUAA 3VFCA 3BW4A 3H4WA 1CYGA 1W5PA 2VFGA 4UXDA 4GNKB 1GW1A 1D7JA 1FBAA 3WLQA 2ZXBA 1CI1A 1S1PA 3MV11 4ZA0A 1JCNA 4J35A 4QLJA 3L5MA 3W2MA 2WM1A 3TYEA 2V3GA 2ZUMA 4MYXA 4ZENA 3IHZA 3VAWA 1RBAA 2GDVA 5FEPA 2NXGA 3KL3A 2P1FA 1FDYA 4Y9NA 1S2TA 4GX9A 1TIMA 3FJ4A 5GNXA 1AMYA 3H7RA 4AIUA 2PU0A 3F4VA 3TYBA 3D5HA 2ZR5A 3RM9A 2VQUA 3DX5A 3PBGA 4S2BA 2CBIA 2J74A 3E3HA 3RMEA 1BWVA 4G8TA 4NNAA 3O6AA 3WQOA 1K8YA 3AMDA 1FKIA 4WIWA 5GNZA 3OZYA 4IQEA 3U48A 4MWAC 4Q22A 2QGYA 3GHSA 3FJLA 4HPXA 5C5YA 3SAZA 2P50A 2GJXA 4G2DA 3IUDA 4FXRA 3UNDA 4WZHA 2WVVB 4XSLA 3DCPA 2ZZ3A 4GH1A 2C3ZA 1LCOA 3KBMA 1VPXA 1QW9A 5I78A 3NTYA 3MDWA 3TMQA 5CCZA 1FP9A 3UI5A 3PZQA 4WHBA 4OECA 7ODCA 1LUCA 4IOTA 1NDVA 1JVWA 3G1DA 4NJKA 1N1AA 2YLLA 4HPNA 2VR5A 1S46A 2FAPA 2QJMA 1T5AA 1K6WA 2FH8A 1M7OA 5IXEA 1B3ZA 2QV4A 3FVMA 2ZE0A 4PA8A 3RJYA 2QDHA 3BGAA 1FKKA 3RXZA 1GORA 1EDGA 1FVPA 4IP5A 3UWQA 1J6PA 1XUZA 2O56A 4HP5A 3B8UA 1GKPA 3TYAA 3SY1A 1Y65A 3OA3A 2VCCA 3VIIA 2XIQA 2Q3OA 2XZ9A 4L3NA 4H01A 3P61A 1ITQA 3GDKA 4GYJA 3SCTA 1KM2A 2J8TA 4RZ4A 3SCOA 3LN3A 4QFUA 2XP3A 2YXGA 5DANA 1FKFA 4OBRA 2FQIA 3CUHA 1PXGA 4KGLA 4W5UA 2GDUA 3C52A 3NQGA 2IF4A 2NX9A 1I6NA 4C6PA 4RDWA 1E70M 4QXIA 4PTDA 1XRFA 3T9PA 1K7XA 5CAKA 3VOFA 4C91A 4F2TA 2WMKA 5EMMA 5CC7A 4P8VA 3VIOA 4ZB2A 2VURA 1FDJA 2E28A 3OVPA 4DT4A 4DJFA 4XO7A 4AH7A 1S2WA 4BEUA 2WKGA 3CGNA 2E1WA 2AGTA 1UR9A 1W5QA 4M19A 3O07A 1V03A 1G4SA 3STPA 5DIVA 2REQA 3G8RA 5EGRA 3WQEA 4BKNA 4E8CA 1NY1A 5FJPA 3H9RB 1OHLA 4DBWA 3T0CA 1WO2A 1JPIA 1D7IA 4TV5A 3B0YA 5HNNA 1QXLA 1H63A 4KCUA 1KRMA 1JDCA 3QGKC 1R0MA 3CB8A 5AHNA 2N87A 3DERA 4TV6A 3IJ6A 4S3JA 2CWNA 2UZ9A 1KGWA 1I2PA 1J01A 1NP2A 5LYRA 3W01A 2PLJA 2A0NA 4K2SA 4IQLA 4JXCA 4WSHA 3S1XA 2FTWA 4Y9OA 4S3KA 2DG4A 4FLRA 3SY8A 4KEZA 1F76A 1FXPA 1GZ1A 4YU1A 3ARPA 3CMFA 1MSSA 4AZGA 1X1NA 3P67A 1QZ2A 1OWQA 3WD1A 4CNPA 1CPUA 4XB3A 4GX8A 2DVTA 2J47A 1G4TA 3RMJA 3KOZA 4NILA 5A8GA 1ZBVA 5T91A 4DXXA 1ZY9A 3C56A 1L6FA 3BAJA 2RUDA 4UMBA 4X2RA 4X9YA 2VXNA 4JTRA 2R91A 1AUSL 5EL1A 2A5HA 1HN1A 3WLOA 3EWUA 4AVNA 2ZX9A 3KS5A 1AL7A 3CV2A 2OT0A 3R58A 1RY8A 3LHWA 1TREA 2B7OA 4KGJA 3M0HA 4JYEA 1RD6A 3LHYA 1YDVA 3T4WA 5AVHA 4MNKA 3VIMA 1G5AA 4RZ6A 1T6MA 2RJHA 2CCRA 4MJ4A 4HZ8A 3NSMA 3WMCA 2WSPA 3MT1A 5E0CA 3BANA 3M6DA 5CBIA 2VD9A 1M5YA 1F3EA 1NIUA 3KZ7A 4ECLA 3RCMA 2DVUA 5TAOA 2V2DA 3IV3A 4XZNX 3VNKA 4DJFD 5M2FX 2ZA3A 4C6LA 2G8ZA 1R5YA 1REQB 4DPQA 4HJFA 4HCHA 3GH4A 4QROA 1UW9A 1ME9A 3ANYA 3IIOA 5CGTA 1XLKA 4XZ9A 3E6EA 3UU0A 4H8HA 1KO0A 1JZ2A 2WNZA 1FOBA 1FH9A 3TMLA 5D38A 1HO1A 1UA7A 5G2HA 4BI7A 2FB3A 4TMCA 2E5BA 3GYCA 1CW2A 4HOZA 3B0VC 1GEHA 2VT0A 5BOOA 3L5AA 3H21A 1Z42A 4L4LA 3K2GA 3Q67A 2F6KA 4W8BA 2AKZA 1SGJA 5REQA 1M65A 5HWBA 1KCKA 5LIKX 4E4UA 1FHDA 3R43A 1FHLA 4NJGA 2ZCGA 1D7FA 4H7VA 3BSMA 2YFNA 2PGWA 1OYAA 4AVOA 4DRNA 5HMSA 2R1NA 1SMAA 2PTXA 4I9TA 4GCAA 5JIPA 5JQ9A 2D3LA 1OCQA 3QYQA 1YXCA 3ZLHA 4EPEC 1DXEA 5IM51 2V82A 3ZS4A 2Q6ZA 5CG7A 1BHGA 3W23A 2YB4A 5FF0A 4DPPA 2XIOA 4GFIA 5G4HC 2GOKA 2E6FA 8CGTA 1DTUA 2Z00A 2ZQ0A 4CCDA 3GXFA 2NQZA 3BOLA 3TVAA 2FPTA 5A2CA 4GBDA 1TV2A 3FDKA 3LTSA 2GOUA 3VVGA 1SO5A 1XC6A 3UBPC 1US3A 1EKOA 2X42A 4RE2A 2FKPA 1BGGA 3FKRA 3UR7A 1YW5A 2BHYA 1Y5XA 3GNOA 2O9OA 3LLFA 3IUIA 4ZEPA 2YBTA 5ECVA 4DAFA 5D75A 1DQXA 1U22A 2QPSA 3WD0A 3B8TA 1WUEA 2P0OA 3QY7A 1WBHA 4GZEA 1Q6HA 4H7ZA 1QWKA 1IHIA 4LRTA 1CX9A 2LGOA 3QY6A 4O8AA 2DZSA 3BLDA 3ZLFA 2PFHA 4GI4A 4S3CA 4XV0A 1W9BM 3AYRA 2BMBA 1J6YA 2JKPA 1TWWA 5EPDA 3PUDA 3AXXA 1NWUA 1EL3A 2QJIA 3EPNA 1UIPA 1EYWA 3N2MA 1OG0A 1AODA 4MB5A 4LEQA 3UWVA 1ALDA 5AC4A 1PTGA 1Q4NX 3WENA 3W24A 4E2OA 1TELA 1QI4A 1VIZA 3JVAA 2WJEA 2ZRYA 2NT0A 4BWLC 3G1YA 5E9AA 1BVZA 5F2GA 2W63A 3T05A 1A3WA 4CU6A 3BAKA 1UWAA 1OSEA 4BF8A 2QUVA 4PH6A 3UJ2A 4U28A 4DZAA 4GO8A 1FWWA 1I2RA 3DIPA 3T2QA 3C2FA 2WHMA 1BYDA 3WF0A 4AG0A 4XKYB 1GJPA 3DHFA 1FWRA 3M6YA 3W3OA 1U1UA 1GKQA 1Q85A 2IPFA 3KAFA 1NQKA 4B16A 2VYOA 5I79A 7A3HA 3TAOA 3MSGA 2MNRA 3N6HA 3ZLGA 4C6IA 2OOGA 2Y8KA 4PRRA 2X05A 3D3AA 3O05A 1KKRA 1B3VA 1ZPTA 3HMJG 3GY1A 4KRUA 1C9HA 1TPB1 3S5SA 3PTQA 1MXSA 5DXYA 5CLTA 2J25A 1ESWA 1ZZMA 3ME3A 5C8BB 2ZFAA 3AO0A 1B4KA 1US2A 1W3HA 2CEQA 2QJNA 2DH2A 2UBPC 3PNZA 3QV7A 4RZBA 3ONBA 5KINA 2VZOA 1ME7A 5F4SA 2Q8XA 4AC1X 1XCXA 4U5KA 2PC4A 3L0NA 2P76A 3PUEA 1X98A 4DROA 3BAYA 2VX7A 3N4AA 4A21A 3BLFA 5HJYA 1VFFA 2ZTJA 5U7SA 2FPVA 1V3LA 3LRKA 2NVCA 3M44A 1F6YA 1E3XA 2NVAA 5GVJA 4JN8A 4F79A 1BYCA 1GVYA 4JPGA 3EIPA 4NI3A 1CGUA 4A8NA 1CGYA 3U2OA 3DI0A 1IXNA 4D71A 2CLLA 4M3PA 4WX2A 3KUMA 4Q7NA 3G1HA 4ZL1A 3BE7A 3RR4A 4NZFA 3ITVA 3AYTA 2ZIDA 1E71M 4OZOA 1TWDA 2OGJA 1ZLPA 1X38A 4PTVA 1RALA 2I56A 1OQFA 4BHYA 3LHUA 1EGVA 4JN7A 1DOSA 4GIVA 3HPAA 3VM5A 4O17A 2TODA 1QCWA 1LLWA 3LOTA 3SJ3A 3QR3A 1J93A 3CIXA 3E38A 3B9OA 2CHNA 4HGXA 3PZGA 3WLJA 4FR6A 1BTMA 5H6HA 3L4VA 4HU3A 3A21A 1DV7A 5ABHA 4FA3A 5D4YA 2MANA 3N15A 1IE7C 2XWDA 1XKJA 4QM1A 4MPKA 2PTDA 4RR4A 5HWJA 1QOQA 1Y5VA 3WDQA 1QI0A 2P3ZA 1C7SA 4Y8FA 3GR4A 4GUIA 1CXIA 3W85A 4MYAA 3NQVA 3AMCA 2E6AA 2JEPA 5DCBA 2XP9A 2WYSA 4C6CA 3TTYA 4AY1A 4G7EB 3F4CA 4DZIA 4PBFA 2GSEA 4K1GA 5I3HA 4WDWA 4F40A 1TMHA 1HQTA 1B0IA 5LNWA 3EAUA 2QAPA 2J7HA 3VCRA 1BXCA 1SZGA 5I2UA 1W3NA 1UMLA 1O1HA 5D9NA 1JCTA 3VD9A 5U4NA 5AZ1A 4DJDD 4ACZB 3H26A 4FXFA 4MF4A 2EKGA 4HMNA 3T09A 3P8IA 3BURA 4OT7A 1JZ4A 4M6UA 4QDMA 3RPTA 3WLRA 1PHWA 3RIKA 2HXTA 1ZAIA 3SCPA 3UZYA 5PTDA 3KVKA 1M68A 2Y62A 1A4MA 3N12A 4MTVA 2Q02A 1PTAA 3W6MA 1OY0A 1Z48A 1XD0A 1VFOA 4R3UA 5CPQA 2ESCA 1OADA 2HE8A 4LUTA 4KWWA 1V51A 5D09A 3F03K 1F8IA 4IQJA 1PBGA 1A5LC 3Q65A 3MUXA 2IQDA 3P6LA 2QJGA 3PBVA 1TA3B 1CXLA 1BVWA 3KVLA 1AL8A 1H62A 3EDFA 4RPQA 1OFEA 1MEIA 3EYPA 5C9XA 1P1XA 2B4GA 3P3BA 4JNMA 3DFOA 1A5AA 3LU2A 4J3SA 3T7VA 3NOYA 3BXWA 1XIJA 3A9IA 5E1QA 1UZ1A 2V0TA 1W3TA 1OD0A 1SO4A 1UWTA 1B3XA 1O66A 5CZSA 1ROTA 3VPLA 3GKFA 3QKZA 3R4IA 3VDBA 1AQMA 1FWIC 1TZ9A 4JTDA 1J96A 1UB3A 4QS5A 3SCWA 5CC6A 4EXQA 3SQMA 1A0DA 3HPSA 3DU0A 2X8RA 3GFXA 3IJLA 5DBUA 3BAIA 3NQ8A 2E40A 5HK4A 3LZ5A 4JFVA 2J7EA 3UJFA 4UQAA 3OO2A 1P6BA 2A85A 3P0WA 3ELFA 1BLIA 2XZ7A 1AH3A 1K9DA 3K8LA 3NXLA 3OODA 3ICJA 4JTAA 3VIJA 5F4XA 3LNMA 4XAKA 3VDGA 1MVYA 1TPWA 3OA5A 5AYXA 2OB3A 4JYDA 5FJRA 4W87A 5CZ0A 3LYEA 5AVNA 1VFMA 2HV5A 3AI0A 6XIAA 1QR7A 1ODUA 4F0MA 3K8KA 3GXNA 2Z6IA 4AY8A 1XICA 3ARSA 1UC5A 4AD0A 1WDSA 1K8XA 4J4NA 1EEPA 2BVYA 3UFYA 5FF4A 3IWPA 4UTJA 4HA4A 1LLZA 3CB3A 3L12A 3O8AA 1GK8A 2ZA1A 4EXAA 1EDQA 5D9PA 2VZVA 2P5NA 3L23A 3MP3A 1DJHA 1UD8A 1Q2SA 5AY7A 4JTJA 2VZSA 4GJJA 3M5VA 3LBMA 1TMLA 4ZQPA 4E4PA 4YIWA 4DRQA 1G6CA 5H8PA 1UR3M 2Z4GA 2RUQA 4C6BA 4GIRA 4KKXA 4BQ3A 2PZ0A 3W73A 2R1MA 3PB2A 3O5GA 4P8UA 3MO4A 2D1ZA 1AD1A 4CLMA 4QLKA 3WF2A 5HW6A 1Q65A 3MHFA 5DY3A 4G1NA 4PYSA 3F7JA 3KTSA 2Q3RA 3KBSA 3VE7A 5KSWA 1RLCL 3FS2A 3WQWA 3EMZA 1WKYA 3IIVA 1XBVA 3L9CA 4QLLA 3TFXA 1R3VA 2HE5A 1Y5WA 3V0TA 1V93A 3A4AA 2VX4A 1DWAM 4RE4A 3W1AA 2XTKA 3CQKA 3OLIA 3P93A 4BF5A 1VQTA 2JZVA 1KXTA 1C93A 4IH3A 4JEQA 1G4EA 3CL7A 4R33A 1UD2A 1IZCA 4IPPA 4K8GA 5FF7A 4IUGA 3OBKA 4I8DA 3TSMA 3CGMA 4WUIA 1BKSA 2DJXA 1YXDA 1ISZA 1NFGA 3W70A 2X7VA 2YCEA 1V3KA 3WDHA 4AWSA 1O6IA 1T41A 5CBBA 1HP4A 3LQGA 2DSZA 1Q6LA 1GJWA 5HR7A 1W0MA 2OODA 1RPKA 2Z29A 4A8IA 3TU9A 1IEXA 1W3LA 5EMLA 4O57A 5L9FA 4OUIA 3O9NA 2D2JA 4ZO7A 2PPOA 2Y88A 2CZEA 1JAKA 1YPXA 2CLEA 1JD9A 2CBVA 1BWKA 3NAVA 2ISDA 4Q8QA 3SEPA 3B04A 4NSBA 4XD3A 4YMZA 2C0HA 2H90A 4PMVA 1L8NA 1XBYA 1HUVA 3EA1A 1C3FA 2E09A 5EB8A 1JAEA 3PFMA 4R9XA 4PMYA 1T8XA 3MUIA 5CGQA 2ZUNA 3O5PA 4G5DA 1NVMA 1H7PA 3AHYA 3RITA 1UZ4A 3E2RA 4FPSA 3UQIA 4HYWA 3G1SA 3N9SA 1ZJAA 2RHGA 3R79A 3PNUA 4LAXA 3RGCA 4W4QA 3ZQ9A 1W9UA 1WYIA 5JBEA 1HIZA 2C16A 3VTRA 3IAPA 4KS0A 1AG1O 4BI6A 1H11A 1TWIA 3DUGA 3NPWA 3B9DA 5G4EA 2DZUA 3SECA 4IPLA 4UTWA 3MU7A 4QSFA 4HSOA 4L9ZA 2AWGA 3TXVA 4AAJA 3CQ0A 3C0QA 3P80A 4B91A 4FNRA 1D8WA 4JTGA 3RPMA 5KZEA 5DT5A 1UD6A 2W67A 1THFD 1O5XA 1A5UA 4IFKB 5A95A 3FSTA 4FLSA 3SM0A 2AKMA 1XS2A 1R3RA 3O6CA 3V18A 5I98A 1AQHA 4AEFA 1QAPA 3AS3A 2EQDA 4DIPA 7REQB 2Y8VA 5FJUA 2A7RA 3BMWA 3S5ZA 4RL3A 4L65A 1H7WA 3W2JA 4B5TA 4JFLA 1W2PA 2R82A 1XCFA 3CZJA 4UTLA 5H1WA 1AK5A 4G56A 1E9LA 1LQAA 4IUOA 3EOSA 4GI9A 1DJIA 4ES4A 1RVGA 3KXQA 5TBOA 2P10A 2V67A 2ZICA 1R9ZA 3P14A 3KAIA 3W7HA 3AOFA 3GNDA 2QULA 4UFLA 3LDVA 3TJXA 4R7OA 2RGLA 4ML4A 4HNNA 3CUFA 2JKAA 2BGQA 2OWXA 3DECA 4N2YA 3SSZA 3O5JA 2P0IA 4L4OA 5IBXA 1QNRA 4TU1A 2ISWA 2ZC1A 1MEWA 4ENLA 2Z1XA 1SSDA 3LBOA 2X30A 4BQ5A 1MUWA 1JFXA 3WLPA 4A3UA 3ARYA 3WDJA 4JTKA 1TV4A 1A3HA 4JL2A 3H4GA 3HIJA 2XIJA 2ZDSA 3VGFA 2ZQSA 3PJWA 3PK7A 2HWGA 1AA1B 1E40A 1FRBA 3W53A 2XP6A 5D04C 5A8NA 3UXDA 5LNUA 2NQHA 3B8IA 3WD3A 2CLHA 4MMWA 2Q09A 3I7RA 1VR6A 4JFTA 2RUSA 2V81A 4EF9A 4O1FA 5LHFA 4IMFA 4KW2A 3SGUA 2EJ1A 2POZA 3GXIA 4GJIA 2FDSA 2R6OA 1HVXA 3QM3A 2V68A 3EX1A 2VDHA 1HT6A 1L1PA 2VCAA 4UZUA 4FB7A 3EWCA 5FJOA 5G4WA 1PB0A 5E0KA 4DO7A 2ZUVA 4UOQA 5I77A 2OLHA 4O0ZA 3TXZA 4NZ1A 1QUMA 1KFKA 5G2IA 3SO7A 4DRHA 3MC5A 2QUNA 1NOWA 1QNSA 3W7OA 4GZ7A 3UZWA 1E9YB 2PCQA 3R2GA 2VELA 4AF0A 4A6GA 3KM8A 4DWSB 3WELA 4A8LA 4FALA 1S2AA 2FDMA 5E9XA 3IK4A 3M41A 5H2ZA 3YPIA 3VNMA 3JU2A 1EBGA 1FWNA 3W1LA 1SVDA 3WFZA 4UFJA 2XIMA 5D02A 2I14A 1SJCA 2PP1A 1FQ0A 2RFGA 1EDTA 4BEQA 4TX9A 4Z2HA 5BOEA 1KRCC 2BVDA 5T9BG 5DELA 1JZ5A 3ES7A 3WBWA 2X0HA 2PDUA 3MMUA 2INZA 1S3TC 5CPMA 2QJJA 2HDJA 3R1ZA 1A3XA 1QATA 4QCFA 3ZR4A 4QRNA 2X2YA 1UWQA 3URBA 4I9AA 1EPXA 3SN1A 4QS6A 4DAIA 3COTA 3GTNA 2QDDA 1VBHA 4DRIA 2DW7A 3SCVA 1OB0A 4GQGA 1LBLA 2WJFA 2DUXA 2WNWA 1UQYA 1GGOA 2W91A 1EC7A 3R8GA 1EEXA 1MQPA 3I3BA 3GU2A 2D23A 3ORWA 3CK5A 2PWUA 1HKVA 4RUBA 3CZEA 3LI0A 2YCKX 3WNMA 3ZIZA 5C2XA 3LMYA 2EF9A 4PEKA 5I7GA 3CHVA 3PN8A 3BPWA 3WEOA 3CUGA 2C13A 1T8QA 4QP0A 4TVUA 3V3WA 4XBSA 5BXSA 3W1RA 1BEUA 4PUJA 2Y5EA 2IKHA 2X1IA 6XIMA 1ICSA 1KQZA 3WNPA 1U5HA 3UGVA 2BY3A 3MS8A 1F9CA 2J9XA 4GI6A 4CNOA 3HA1A 5K4ZA 1NWRA 2FVMA 4Q6JA 3S8HA 2KI3A 1PKNA 2CW6A 4ODRA 2ITKA 4F66A 2IXVA 2HNEA 3OP2A 1W17A 2V38A 2AGKA 4CCCA 4S3GA 2ZZ2A 4N7QA 4JFKA 4ICCX 2YX0A 3E74A 1JZ3A 4XZBA 4AEEA 2OJPA 2BOEX 4O8RA 3LX9A 1GWJA 1SM9A 5FJTA 4QAIA 2FZ9A 2PURA 2I5GA 3VKAA 1FCUA 3I10A 4NASA 1EP3A 1K9FA 4QJ5B 4JQAA 3EGJA 4GNJA 3NQ6A 4ROPA 2ZX8A 5LIYX 3GXMA 1IWAA 1TUXA 1J5TA 1E73M 3QHNA 3JZUA 5LHEA 4FEZA 5C7HA 1I2OA 2VHLA 1TCDA 1RH9A 2WCGA 3NQAA 2C79A 2A6NA 3RFWA 4IXXA 1K8ZA 4LNYA 3VINA 3QLDA 3NZPA 3HURA 2V5DA 3KAOA 5AFDA 2E3ZA 1PINA 3PRAA 4D6JA 3MB9A 4KWSA 2A3CA 3CV1A 1HGWA 3P8JA 3FV9A 5TF0A 2VOTA 1EFZA 3LUOA 3C2VA 4GQRA 3PRDA 2JF7A 1I2QA 4P61A 4CNSA 1FXQA 4M7TA 3LTPA 3UPWA 3TONA 4LV9A 3IGSA 4JNYA 3ITLA 1B3YA 2IUZA 1GVEA 3GHTA 5KMYA 4I9JA 2OZ3A 3NDOA 2WPGA 3VDCA 1PWMA 1LRQA 3VGGA 4EKJA 4LUJA 2DPEA 2ZBTA 4LSBA 2GVLA 3KFTA 5FJJA 2H9AA 4JHMA 3SZ8A 4NXKA 3XIMA 1J4IA 2HQAA 3GVGA 5GPRA 2YLAA 4LCRA 4ZTYA 3RLVA 1MUCA 3OYZA 3ITGA 5JU6A 4W86A 1NH6A 4XAZA 3S9ZA 3WJXA 3PFRA 4YL2A 1S5NA 4U2ZA 1X7FA 2NT1A 3G3DA 4D2JA 1SUXA 1JJKA 1H1NA 3CAWA 4N9DA 4GE8A 4NRSA 4I7WA 4WY0B 7ENLA 4KCTA 1PX4A 9XIMA 5JVLA 3CM4A 3WQ4A 3V0SA 4L7ZA 1YDOA 4NKCA 3GH5A 3R10A 1WA3A 1BYBA 2FLIA 1KR0A 1TQJA 3V5FA 1MFVA 3GDTA 2OKTA 3RAOA 3KLKA 5I6SA 1M41A 1KC7A 3A4XA 1E43A 1VRXA 5HWNA 1EJUC 1UOKA 5CH9A 4KETA 3VGBA 4UZSA 1Q6FA 3TJLA 3EWXA 1TRDA 1MW3A 3V5CA 3TDBA 1RCXB 1XISA 2DIJA 3S5OA 3ZVHB 3KBWA 4J40A 1IWBA 4TX8A 4U85A 1WXJA 3BAWA 2Y7DA 1CENA 1CIUA 4J27A 1BGAA 3G3MA 1GZGA 4QBXA 3C3NA 1VHNA 3AALA 1UR8A 1XLMA 1XC4A 2Y4SA 3PZOA 1UP0A 1OFPA 1W1IE 4DJEC 4KCVA 3WYZA 4ZBCA 5FL1A 3KRBA 3FHAA 2BASA 5B7YA 4E3TA 4ACYA 2AL2A 5EBUA 3AXMA 4H9ZA 3AQUA 2XN0A 4Q8NA 3W4RA 1H5YA 2DZVA 3K1DA 1P0BA 3SN4A 4UR8A 1YTDA 4XD5A 4UMAA 4ERAA 2DT3A 3GUGA 2D2OA 1PSCA 5AZ0A 4N02A 1N55A 1IEQA 2YYUA 4ZQRA 1QPLA 1DXFA 1POKA 3ARVA 4MSPA 2W3ZA 2FB2A 2PLKA 1U5VA 3DXIA 2MLZA 2YBUA 2QF7A 4DUVA 2FHFA 4US5D 3FYOA 2J6XA 5HPCA 1CGXA 1XX1A 5I07A 1E55A 5F7UA 3NWRA 2QAFA 1WZMA 4MM1A 2DT0A 4XSMA 2BWGA 5IDIA 3UA4A 3RF9A 3EA3A 1FWCC 1GG0A 3R13A 2WZTA 3CUZA 3N4EA 3L66A 2DW6A 3FN9A 1KR1A 3I6EA 3HG2A 3ZT5A 2QYGA 3HQNA 1S38A 2OSWA 1CB7B 1OJXA 1QHPA 4XIMA 4J3TA 3ID7A 4LW7A 3TYZA 4WLCA 4LX4A 4J3VA 3I3DA 4KIEA 4AWEA 3W6YA 3JR2A 4KEUA 4F48A 1WKEA 3RPDA 5HULA 3SUUA 1AJZA 1XPGA 3H8AA 1RP9A 3S1VA 4RE0A 3BQ6A 1PZ2A 1X1OA 4TOQA 2FFIA 4K7VA 2Z1BA 1J0ZA 3ZFHA 4E2BA 2X1SA 4JIPA 2R8WA 3VIPA 4E5TA 2R1PA 1HL8A 3I65A 2YDRA 3TE9A 4ZPTR 1MDRA 4H83A 2E25A 3SDOA 2VO5A 3LHTA 2PV2A 5HPOA 2ZUWA 3CHDA 4N9CA 1FWDC 3WX7A 4B5XA 1X8FA 3BW3A 1GVSA 5C7VA 3AXIA 2PN0A 4C90A 2DZBA 3UPBA 1TG7A 1DWGM 5CKSA 2EJAA 4WD0A 1PYMA 3M5YA 1P6WA 5C0QA 3GNNA 5C55A 1EF3A 2D3NA 4FNPA 3S9IA 5EA9A 3A47A 1NJJA 5K9CA 4HA1A 1TZ7A 2PRLA 4HN8A 1ZSXA 2UY4A 4H41A 3RNDA 2F38A 3CL8A 2G3FA 1TPFA 4JHOA 3APYA 4KMQA 1XIBA 4PUDA 3MDYB 2GJXB 1LBFA 1W1ZA 2Y78A 5KZDA 4HZ6A 1CTNA 2VZTA 5CJ5A 2NXIA 3WIJA 2ABBA 1EO7A 5BCAA 1RJRA 4LYRA 2ZR4A 3GC4A 2I5IA 3CMGA 3ZWTA </