1HKMA

High resolution crystal structure of human chitinase in complex with demethylallosamidin
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
365
structure length
365
Chain Sequence
b'AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEQSGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHITOTRIOSIDASE
publication title Crystal Structures of Allosamidin Derivatives in Complex with Human Macrophage Chitinase
pubmed doi rcsb
molecule tags Hydrolase
total genus 125
structure length 365
sequence length 365
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1hkmA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hkmA01
1E1EA 2VJXA 4JL1A 3UG5A 1BSIA 1HVQA 4GQRA 3W4RA 1U33A 3TTOA 2PC8A 2QLYA 2CHOA 4P7OA 2VOTA 3CZKA 1K9TA 1KXVA 2WSKA 1KWGA 2JEQA 2ZX9A 4UOZA 2WCGA 4MJ4A 2ZUSA 3KEHA 3SUUA 4UFKA 4AZCB 4BS0A 4MJ2A 1J12A 4HOWA 3POCA 5HOSA 2XJ7A 5GNXA 3RJXA 4IM4A 3AXIA 2WB5A 1HJUA 4U31A 2VZVA 2Y24A 1WZLA 1H4PA 1R7OA 1D3CA 3VGBA 3AHYA 3MU7A 2E3ZA 4V27A 2A3BA 4PMRA 4AW7A 3AICA 1GVYA 5D9NA 4CN6A 5BXPA 5C71A 3VVGA 4DUXA 1VIWA 4J3SA 3IJ8A 3WKZA 4CU6A 4B15A 3IANA 3VDCA 1EH9A 1VBUA 4GXPA 5CGMA 2YA1A 4W87A 1KXHA 1QI0A 5KZ6A 5A1AA 1HKMA 3CIVA 3NUKA 1TVNA 2ZX5A 1V03A 4GKLA 3RJYA 1JGIA 3W29A 2VX5A 4V2XA 1KB3A 1QI3A 3HU7A 1J0YA 2AMGA 2VVSA 3N11A 2J7EA 2BY2A 1J0JA 4TTUA 3IAPA 3WH8A 1KCLA 2OWWA 2GFTA 3MSGA 2CBUA 2BHZA 1JL8A 4GZEA 1MW3A 5JBDA 1V08A 4OOZA 3WUFA 2VURA 5C8BB 3K46A 3BH4A 5A6LA 1W32A 2PWEA 1H11A 1BLIA 4AZHA 3MUIA 3O2LA 1FP8A 1QHPA 2ZX6A 1AVAA 1SMAA 1XD1A 2E0PA 4H41A 2BVTA 2Y8VA 4BZYA 1EDQA 4UNIA 1X6LA 5DFAA 4HMEA 4QCFA 2X0HA 3NCOA 1Q6CA 2YDQA 1ISYA 2ZE0A 3SCRA 2YDRA 1V3KA 5D9MA 2GK1A 3VM5A 1WDQA 2VRKA 3W0KA 3EYPA 3RM8A 3PZNA 1OINA 2V3FA 2TAAA 3PZOA 1H0IA 5I77A 5ABHA 1HT6A 1H41A 1TR1A 4OIFA 4PYSA 3ZSTA 3GBDA 1G01A 3EDFA 2DSVA 3PHAA 3GDBA 2JEPA 4R27A 3ARQA 1J0IA 2WAGA 2E8ZA 4MB4A 1VEPA 5I0DA 2YLAA 3EBVA 4AZBA 3BAJA 1BYCA 2F2HA 4V28A 1QNOA 4X9YA 1OIFA 2XIIA 4J27A 2J8GA 4FLRA 5FL1A 3TONA 4X0VA 4BQ5A 5DT7A 3EMQA 4XUYA 3BAWA 1GQIA 5A2CA 2X09A 3PZIA 4KWUA 4Z2KA 2WW5A 2BV9A 5FOOA 1ESWA 1RP9A 5IDIA 1NARA 2VX6A 3WH6A 5CGTA 1DWIM 4AD0A 2WMHA 1UR1A 5CSUA 3B9EA 4HA4A 3WDQA 5AYIA 1CNVA 1BYBA 4NI3A 2FGZA 3VGDA 3OA5A 1ZU8A 1F4HA 2Y8KA 2YLLA 3UR8A 4DM2A 3K1DA 2ZOXA 4IUGA 4LYRA 1JNEA 1XH1A 3QGVA 1EA9C 2WXDM 4J3UA 1CLVA 4EE9A 2XUCA 1M03A 1VJZA 4QFUA 2WHJA 5M03A 2PWGA 1HP5A 3RM4A 4RL3A 7TAAA 1XH0A 5E0CA 2E4TA 1ZS2A 1GOIA 3PTQA 1JZ6A 1KR1A 2ZUWA 3THCA 2W61A 1US3A 3QR3A 5A6MA 4TX8A 2VNCA 3TP4A 1CGXA 4W8BA 3K4AA 3VIIA 1US2A 1HF6A 1QW8A 4MB5A 1MXDA 2G4FA 2Q8XA 4P7LA 4F8XA 3T2OA 3AIBA 4BCEA 4W5UA 1PX3A 3OLGA 3CPUA 2J79A 4L4OA 3N04A 1MW1A 3CHFA 4NZCA 4OUEA 3WL1A 2WVSA 1QOXA 1FH8A 3N17A 3DC0A 2ZIDA 3E1F1 4UOQA 3GNOA 5A2AA 1WB0A 3VUPA 3EDJA 3T2PA 1ISXA 4B9YA 3ARWA 1PPIA 1UWUA 2BY1A 2DQXA 3SURA 4MNKA 3KL3A 3ARPA 3F5KA 3GXMA 3L4YA 4IISA 3WF0A 3K8LA 3BCDA 2ZWZA 4OJYA 4PTXA 3LPFA 3K8MA 3HMCA 5I6SA 1AQHA 5D8ZA 2GVYA 1ODUA 4XB3A 4K68A 4U33A 2G3NA 3GBEA 4D72A 1V0NA 1HJWA 5I5RA 3MS8A 4HZ8A 5HXMA 3CLWA 4WSJA 5E9AA 1V6UA 1K9EA 1V3JA 4HMCA 2CESA 3AS0A 4MAZA 3VX0A 2VT0A 1D2KA 5JIPA 2J8FA 5AY7A 1JAKA 2WMGA 1E55A 3B9AA 3CHCA 4JFVA 1IT0A 1HP4A 5A6BA 3AQUA 2OSYA 1CXHA 3UG4A 5GNZA 1BQCA 1QW9A 1V3HA 2WWCA 4AZIA 4AZ7A 3BLPX 2GJXB 1RPKA 1OGBA 2ZUVA 2EPMX 2WPGA 5IFPA 3SEPA 5DT5A 4PMUA 4MB1A 4AXNA 3J7HA 2OLHA 5CPSA 3VMNA 3CUJA 4PMZA 5CG0A 2G41A 4ATDA 1GHRA 1HJXA 2D20A 3LPOA 1LG2A 1UKQA 1BVZA 1LWHA 4JKLA 1FOBA 3VD5A 1JF5A 3QOKA 5I79A 1IZJA 1Q6FA 3U7VA 5ABFB 2WLZA 1V6XA 3MV01 3RMEA 2VVNA 1E6SM 1PZ3A 1VRXA 1W3JA 4D1IA 3MMWA 4JAWA 1GORA 1K9DA 2PWFA 3EDDA 1E1FA 3SCQA 1HIZA 5M3WA 4MADA 4AZ6A 1F4AA 5HNNA 3WNMA 4F9JA 5E09A 3VIOA 3W37A 1UKPA 1GONA 2CERA 1UUQA 1VEOA 4HU0A 4AWEA 2XVGA 3D3AA 4KRTA 3VMOA 3ZQ9A 2BNJA 3AMDA 4HP5A 2WVUA 4OBSA 4UQEA 4LPCA 2WHKA 4ZENA 3VDHA 5BROA 2BFGA 1AQ0A 3ZR6A 1QNRA 1TUXA 5DO8A 1UD2A 1B1YA 1MYRA 2X8RA 1Q6GA 2YL5A 3MKKA 3WFZA 3W38A 4CD8A 1WDPA 4W8LA 1GOWA 5A8NA 3OLDA 1NWUA 3AMLA 3L4VA 3K4DA 2WVVA 1QBAA 4JFTA 2J7HA 3TA9A 3BAKA 3RDKA 1LF1A 4GZIA 3SUVA 2OYMA 3MUZ1 1PEZA 4Y7EA 3SCTA 3A4XA 3SCWA 5CLTA 4PRWA 2FGLA 1GHSA 1FFRA 1UWTA 5I23A 2A3CA 1H0GA 4MDOA 3WDJA 1X1NA 1JYVA 5FL0A 3OLIA 3W28A 2IUZA 5BXRA 1JZ7A 2W5FA 1LLOA 2V3GA 2ESCA 5EFDA 3FW6A 1QNQA 3ALGA 2DIEA 3VNZA 1MQPA 1TG7A 3ARRA 1BHGA 3N12A 3PZUA 2VC9A 1BGGA 2VCAA 2JE8A 4FK9A 1E3XA 1GJUA 3WENA 1OT2A 1E71M 2EPLX 2WKLA 1CXKA 2BVDA 1E56A 4HA3A 4GIAA 4YN5A 1C3FA 3ARXA 1KXQA 1J11A 4U3CA 1XD0A 2VQTA 3L4UA 3CH9A 4CKQA 1WE5A 3OLEA 2VO5A 2X0YA 2WSPA 1XYZA 1V6WA 1CGWA 3AFBA 1UD4A 4JL2A 3CHDA 2Y5EA 1DEDA 4OBRA 4CD4A 2O9TA 1I75A 1OBAA 3OGRA 2OYLA 2XVNA 2FH6A 3CUFA 2WZHA 4P8XA 1OB0A 1MQRA 3KZSA 4P8UA 3L4WA 2PF0A 2XVKA 1EDGA 1FA2A 3BC9A 2QF8A 3CTTA 4BQ4A 3ARZA 4P8VA 2WC4A 1IZKA 9CGTA 3WMBA 3VIKA 2D23A 1H2JA 1L8NA 4M81A 3CZEA 1W1YA 5BRPA 3FNDA 4AEFA 4ZEPA 4KMQA 4W5ZA 1OIMA 2CPUA 1CLXA 4AZGA 1HJSA 2D0GA 3GZAA 4AD5A 5M17A 3ARYA 1Y7VA 2ZUNA 4TVUA 3VU2A 5DMYA 1BPLB 1IV8A 1E0WA 3A47A 1UZ4A 4BQ3A 1JYWA 5GQBA 5JH8A 3WQ5A 3A4WA 4FLOA 1M53A 4H8HA 1HKJA 5F7UA 4ZFMA 1SMDA 3QHMA 2W4XA 2D0HA 5IHRA 1M7XA 1CGVA 1QI4A 2WMIB 3VD3A 4IPLA 5D9OA 3WF3A 3LPGA 1BTCA 4TX6A 5I2UA 5AC5A 4GO9A 2VUYA 2CITA 3WIJA 1E40A 1OGGA 1JZ2A 5E70A 4D6JA 4AIOA 4EKJA 4LYQA 4HPGA 3NIYA 3O9NA 6TAAA 3ZSSA 4DUWA 1PAMA 2XVPA 3VD9A 3GH4A 4P7NA 4Z2LA 2OSWA 4H04A 3UETA 1CIUA 1G1YA 4ZXOA 4CU8A 4F66A 3S2CA 4AD1A 4PMXA 2WM0A 5A69A 1R86A 2WWDA 1GQLA 1I1WA 2VX4A 1ITCA 4MAVA 3O6AA 2VMFA 5D9PA 3AS1A 4PEEA 2OWCA 1MFUA 2ZXQA 4TTGA 3AHTA 4BF7A 2MANA 4JKKA 2VQUA 3SCOA 1LL7A 4BA0A 1HKKA 1CDGA 4QP0A 1HX0A 1AQMA 1LWJA 4ZE5A 3VM7A 1VFOA 5LA1A 2BY3A 2O92A 1QPKA 1EHAA 3GTNA 3WNPA 3UESA 4UR9A 2A3EA 3VIGA 1UQYA 4QAWA 3FY1A 2XWDA 2FHCA 3PN8A 2F8QA 5LA0A 1B3VA 5E0FA 4AYSA 4W7VA 2Z1KA 1R7AA 1FP9A 3AIVA 2IXUA 4PUEA 1W3HA 4UFIA 3SCVA 4AD3A 2CHNA 3CUHA 4CN4A 2DGAA 5FD0A 5I3DA 4PMQA 3SCNA 4A4AA 4D6HA 4B3LA 2DSUA 4TVDA 1OT1A 4ACZB 2E9BA 3U7BA 6CGTA 2EO7A 2WLYA 1WO2A 1W1PA 4D6GA 2WMJA 4XV0A 4J7RA 1YQ2A 3AS3A 3ZJ7A 2JF6A 1UA3A 4Q7NA 2D22A 4PMDA 4LX4A 4CD5A 4OOUA 3POHA 4CCDA 1KQZA 1JYXA 4AY1A 1BF2A 1CXFA 3VINA 1NWTA 3BLKA 3AI0A 5TD4A 4WF7A 4KH2A 3AIEA 3CHEA 4HZ6A 3ZOAA 3SUTA 1GQJA 2YKKA 3VKKA 1HJVA 2JFEX 3AYSA 3AHXA 3DYPA 4DUVA 2PBOA 3WF2A 4M56A 1GOQA 2UY4A 1DWGM 1WCGA 1JZ3A 1E70M 4PUDA 2JF7A 1VFMA 1C91A 3AS2A 1WP6A 4LQ1A 2J74A 3GNPA 2VRQA 2YBTA 1V02E 4C7GA 4JKMA 4N42A 3T09A 1PX8A 4W86A 1JD9A 5FKYA 1O7AA 4UFMA 1GOMA 4UFHA 3A6OA 1UWRA 4W88A 4RE2A 2J7GA 2YA2A 4W93A 1HNYA 2YIHA 1KBBA 4U3AA 3VPLA 2E8YA 4P7QA 5A3HA 3A4AA 2V5CA 3N13A 1J0ZA 2DT2A 2DSWA 2G3IA 1H1NA 3NSMA 2VZSA 1UR2A 4E2OA 1QI2A 4PTWA 2YL8A 1BYDA 1E4LA 1WDSA 3RIKA 3CUIA 4J3WA 4UZUA 1W9VA 2ZICA 4E4PA 3WQWA 1XCWA 3DHPA 1GZJA 2YL6A 5FIPA 1UWSA 2VR5A 4XZWA 4H8UA 1JF6A 2O9OA 1NH6A 4AIUA 4NRSA 3ALFA 3LPPA 3WD1A 4NSBA 3M6DA 1C7TA 8A3HA 1Q6DA 1E6PA 2ZXDA 1P6WA 2W66A 2B31A 1XCXA 2X05A 4F79A 1JDDA 3W81A 3S6TA 2G8ZA 3WF1A 2V3DA 3CBWA 4DWSA 5A95A 2CBVA 1Q4NX 1B30A 2XFFA 4JCMA 3GM8A 4AZCA 4WJXA 2XM2A 3PTKA 1B2YA 2X2YA 1DWFM 3WDRA 4PTVA 5HDRA 3DHUA 3CZLA 2X1IA 4JHOA 4ATWA 1ZL1A 1V0KA 4EANA 1MW2A 4JFSA 1KXTA 1MWOA 1VB9A 3ZO9A 1J0KA 1CXEA 1FH9A 4P8WA 2GSJA 1JI2A 4WLCA 4ZXLA 3WY1A 3VIPA 1CXLA 1DWJM 4QLLA 1J9YA 5BRQA 4PTMA 2PI6A 3PZTA 1VENA 3SIMA 4M24A 5CPTA 1JAEA 1QHZA 5A6JA 3EMCA 4WKAA 1CBGA 5AYBA 2W92A 1EQPA 1XYFA 2CNCA 1DTUA 2J62A 2VRJA 1BVNP 1C93A 1KWKA 1RD6A 1TA3A 3L2LA 1E5JA 2E9MA 3ZIZA 1W1VA 5HPOA 3OIHA 2V5DA 1CXIA 3FN9A 4C7DA 4AC1X 2CXGA 4PMNA 2PBGA 4UFJA 2ZUUA 1E0VA 4UOJA 2WC7A 1XSJA 1V6VA 5BCAA 2GK1B 3U5UA 3DYOA 1V0MA 2FH8A 2J4GA 3W53A 4ZE4A 4CCEA 2WYSA 3T0BA 3MUY1 1OSEA 4CUCA 1N82A 2CIPA 1XRVA 1QI5A 1XSIA 3OBAA 1GUVA 5CZKA 1UKOA 5GPRA 5JIWA 1ECEA 8CGTA 1UR4A 4ACYA 5IXEA 2WZIA 1UR0A 1LQ0A 3OGVA 1G0CA 2O9RA 1GQKA 3ARTA 4QCEA 3ZJ8A 1HKIA 3BSGA 1WZAA 2D3NA 3WH5A 3B9DA 1R87A 4J3XA 1DHKA 1JIBA 1E6ZA 4CN1A 2D0FA 3AIRA 4M82A 2ZWYA 3F5JA 5A8QA 4JIEA 1ZBWA 1UWIA 2VCBA 3WD4A 1KGUA 5ECUA 3VTRA 4GZJA 4UQBA 1K6AA 4PMOA 2HVMA 1ISWA 1I1XA 2QMJA 4GI9A 2G3JA 1B31A 2YL9A 3W6LA 5CXPA 3WH9A 3WUBA 3RO8A 2BHYA 1Q6EA 3AJ7A 4JFWA 2VZUA 1OD8A 3QHNA 3GNRA 1E43A 1C7SA 1W9UA 2Z1SA 2WHMA 5ABGA 5I78A 3ZJKA 1BFNA 3OG2A 4S3JA 1VFFA 4B9ZA 1UG6A 4AMCA 4HZ7A 1YHTA 3GH5A 4P7RA 4CD7A 4OKDA 3HN3A 3U5YA 1UA7A 4GI6A 4IPNB 1HXJA 3AXHA 3SUWA 2PWHA 1BGAA 1B9ZA 2EXOA 1TFVA 5I24A 3BCFA 4GI8A 4D6DA 4M1RA 2EBNA 2CBJA 3AXXA 1MW0A 2VCCA 3PZVA 1OCQA 2GUYA 3WF4A 1H5VA 3RILA 2FDMA 3I3EA 1UR8A 2Y4SA 3AMGA 2G3MA 3EDKA 2DT0A 3VMPA 1E6NA 2VZTA 3GXFA 3BXWA 1JDCA 4URIA 4PCTA 1ZBVA 3NSXA 1RH9A 2QV4A 3PTMA 1JYNA 1UHVA 3ARSA 1LL6A 4MDPA 4MPKA 3UCQA 2VL4A 4U2ZA 1C8QA 3L4ZA 3W6MA 1CZ1A 4M80A 4UQ9A 4UCFA 1C92A 5BWFA 1TMQA 1OGSA 4MB3A 1LG1A 2PWDA 1JZ4A 1HN1A 3KL5A 3AMKA 1DWAM 4UTFA 4TOQA 2Y2WA 4S3KA 3U57A 2XFYA 1XC6A 1ZB5A 5A6BD 3MV11 4HTYA 2XSAA 3FHAA 1J0HA 3MANA 5A8MA 2NW0A 4AISA 2J7FA 3ZMRA 1W2VA 4M29A 2D2OA 4AD4A 3UG3A 1XV8A 2VI0A 4GO8A 3NYDA 2D24A 4W84A 2YBUA 4HMDA 4Z2GA 1UKTA 3MMUA 1UH3A 1NP0A 1GNXA 1ZBCA 1AMYA 1HL8A 5CSYA 1TZ7A 2VZOA 3WQ8A 1JD7A 4CU7A 2A3AA 4JCLA 3CMJA 2BXYA 2J78A 1NWRA 2E40A 2JALA 2NT1A 1VFUA 1W2PA 1HL9A 1UKSA 2OYKA 4WKHA 4JFUA 4UQAA 2UWFA 3OB8A 3W25A 3IAQA 1XGZA 1KBKA 1VF8A 1UZ1A 3FXYA 4DWSB 1W3KA 1E6QM 3K8KA 4UFLA 3G6MA 4CVWA 1DP0A 1CTNA 4B16A 4NRRA 1CGUA 4W7UA 5A8OA 3AISA 1CPUA 3ZJ6A 1E6RA 3CGTA 1A47A 5EFFA 1A3HA 1E4IA 2XTKA 3WDHA 5GNYA 1GOOA 3OZOA 3AMCA 1X6NA 3CMGA 4KGJA 1WZMA 4XZBA 4PCSA 5A6SA 2C7FA 4MNLA 1OWQA 4J28A 3BAYA 2XG9A 1EDTA 5KEZA 3UERA 4AD2A 2O9PA 3RCNA 1NWSA 1JG9A 1TA3B 1UQZA 2RGLA 5M5DA 3VIFA 2JIWA 1FH7A 2UY2A 4GPNA 1E72M 3M7SA 2GJXA 2YDSA 2AOSA 3GXIA 1GPFA 3WQ6A 1B3WA 1M01A 2NT0A 5EB8A 5D8WA 3TTQA 4UZSA 4QDMA 3M07A 1ISZA 4YPJA 1TCMA 2NSXA 5HBFA 4AIEA 3M46A 5FCZA 1KCKA 2FHBA 1WZKA 1HJQA 2ZXBA 3L4TA 1GJWA 2WVTA 3TOPA 2WC3A 7CGTA 2XWEA 4FMVA 2EPNA 3BMWA 1VAHA 2QPUA 1UWQA 4PSPA 1LL4A 1V02A 2ZX7A 1CWYA 3N18A 3QHOA 1PJ9A 1W9BM 4TUFA 3T2QA 5ABFA 1UOKA 2J77A 3L4XA 3APGA 2J47A 1E15A 1J01A 4EAMA 3BSHA 3THDA 3WEMA 5ABEA 2BXZA 4U5IA 1SFSA 1PIFA 2CKSA 3W27A 2XPKA 3VOCA 1UH4A 2ZXAA 1UR9A 3AZSA 4L4PA 3W24A 2QMKA 5DEZA 3VD7A 2OWXA 1B3ZA 1MFVA 3WMSA 2V38A 2WVVB 3CO4A 3G6LA 1CEOA 3DECA 5E6YA 4LYPA 4LGXA 3EDEA 1E4MM 2DDXA 4WSKA 1OM0A 1U30A 1KR0A 4WKFA 1NOWA 1ZJBA 3GXDA 4PSRA 3ZM8A 2WANA 4H8VA 4PMYA 1CECA 1PX4A 2RGMA 3W82A 3FAXA 2XHYA 1BYAA 1CGTA 4YHEA 1JFHA 1E0XA 1WDRA 4RE3A 2YJQA 1G94A 3T0AA 4U2YA 3AHZA 5JUVA 3FHQA 2YA0A 1V0LA 5CLWA 1M04A 4E8CA 1C8YA 1TVPA 4FLSA 1QVBA 4JZ5A 4C7FA 3WD2A 4R5EA 1EGZA 1MXGA 2CKRA 1H3GA 4UQCA 1R85A 3FAWA 2UY5A 4CD6A 3TTSA 1GOKA 5CJ5A 3WSUA 1XH2A 3CZ8A 3RM9A 5A6AA 1EOMA 2XFRA 1B3YA 1V6YA 2VTFA 2JIEA 1QNPA 2J75A 2J7DA 1LJYA 2W67A 5D4YA 1QBBA 3PZQA 3VNYA 3CUGA 1E73M 1FHDA 3WL0A 4TVCA 5JBFA 1KGWA 3VGEA 2WK2A 4X0NA 1JDAA 1B0IA 1W3LA 3VD4A 2XM1A 5IHSA 2WMFA 2DH2A 3JUGA 4HOZA 1CYGA 3IK2A 2XSBA 3WMCA 3AOFA 1B90A 3ZT6A 1QHOA 3PZ9A 1B3XA 4W85A 5CQ1A 2ZX8A 1KQYA 4D6EA 1EO5A 1JNDA 1W9PA 4D6IA 2D3LA 3AZTA 3BAXA 1D7FA 7A3HA 2W63A 3WNKA 4EK7A 3IJ7A 1EXPA 1BG9A 3D5HA 5AC4A 3ECQA 4H7VA 3DYMA 3VX1A 2F61A 4RE4A 1L0PA 3BGAA 3NSNA 2VX7A 4W7WA 3AIQA 3NJ3A 2W62A 1FHLA 3VILA 2QHAA 3VO0A 4F9DA 2DT3A 1E5NA 3WH7A 4HA1A 1UD6A 1EHNA 3W26A 4D1JA 2XYLA 4B3KA 2EJ1A 3AHVA 3VIHA 2GDUA 4HPHA 3VDAA 4FLQA 1C90A 2XIBA 3UR7A 4AZ5A 3VGGA 1V3LA 3HJEA 1V3MA 3PZGA 1ZBKA 3ARUA 3MSDA 2YOCA 3WDPP 1MQQA 4BQ2A 3N9KA 2J7CA 4W89A 5BXSA 2DT1A 4XX6A 4HU8A 1J10A 1W9DM 1XSKA 4LXFA 5A6KA 4NF7A 2GJRA 4MNJA 1ITXA 4Q22A 2D1ZA 4FF5A 3T0DA 3II1A 2DPEA 4U5KA 4CVUA 1WPCA 2W91A 2BS9A 2CYGA 2WMIA 5A2BA 1JXJA 2QPSA 4D6FA 3CZGA 1JFXA 1GCYA 1NOUA 1TE1A 5LYRA 4WIWA 2BHUA 2WKGA 5BXTA 1NM9A 1KGXA 1K9FA 4H2CA 2EQDA 1C8XA 3NDYA 3SCSA 5EMYA 3A3HA 4N0RA 3SUSA 3IJ9A 6A3HA 1E6XM 4J3VA 1UD5A 1JXKA 3B8SA 4QLKA 3QOMA 4DWSC 3MUAA 4QLJA 2A3HA 2XVLA 3N15A 5CPQA 2IXVA 2BVYA 1H09A 4TXEA 2VR4A 3VIMA 1G5AA 1R8LA 4W8AA 1QNSA 2DH3A 2C8NA 1KFWA 1E4NA 1VJSA 3ZT5A 1E3ZA 1ODZA 4ATLA 1V3IA 2V3EA 2UY3A 3I3BA 1W1TA 3GYCA 3SCPA 3KWXA 2XGIA 5A94A 4Z2JA 4PBGA 3AIWA 2CETA 1GVIA 3WNOA 4E8DA 2EPOA 3VIJA 4PMVA 3RPMA 3MO4A 2CCRA 1W91A 3SCUA 1WKYA 2OSXA 3WNLA 3VDBA 3MMDA 3N1AA 5LA2A 1JZ8A 4J3TA 3ZR5A 1MVYA 2WZEA 2DIJA 4AEEA 4Z2HA 3VGHA 1ZJAA 2XGBA 1RP8A 1SR0A 3OZPA 4HOXA 3AROA 3WN6A 5HPCA 1NOFA 3BAIA 3KE0A 1JZ5A 2FHFA 1PBGA 4MNMA 2GDVA 3GH7A 2E9LA 4KGLA 3EMZA 1W9XA 4GQQA 1U2YA 2WBKA 1PZ2A 3F4VA 3WELA 1O6IA 1S46A 3WQVA 2WCAA 3KL0A 3VGFA 4Z2IA 1EOKA 1DWHM 1GW1A 2CBIA 2DSKA 3TTYA 1E9LA 2PB1A 4OZOA 3WDIA 5A8PA 4ACZA 4ML4A 2WCSA 1PIGA 3WEOA 2WMKA 1CGYA 4M8UA 4A3YA 2EPKX 4WK9A 2J25A 1OD0A 3I3DA 1VBRA 1UD8A 1BG4A 3LMYA 5C70A 1XHGA 1HVXA 1EO7A 2WNWA 1NQ6A 5EBAA 3CZJA 4D6CA 3UEQA 1EIBA 3WEZA 3OGSA 3WQ4A 4DM1A 4CGTA 1UH2A 3WBEA 2GJPA 2WHLA 5IFTA 1JI1A 4CCCA 3ARVA 1Z32X 3PZMA 3L2MA 3T08A 3NDZA 1SYTA 4GINA 1FFQA 3WBAA 3WUEA 3AYRA 3WFLA 2J7BA 1UYQA 4DWSD 4MTVA 1H49A 1ISVA 3PBGA 3WD3A 1BAGA 4YHGA 3ZT7A 1G9HA 2ZUMA 2ZUTA 4A3HA 1EQCA 3AIUA 4KRUA 2AAAA 5JBEA 4JHZA 1J18A 1VEMA 1CENA 3F5LA 2DSZA 4PN2A 2WBGA 2C0HA 2HISA 3WNNA 2DEPA 4D71A 1UD3A 1WAWA 3BMVA 4UQDA 5DF0A 3WUGA 5BYWA 2BY0A 1WNOA 5E6ZA 2CEQA 1NP2A 2EEXA 3AZRA 3WD0A
chains in the Genus database with same CATH superfamily
1E1EA 2Z00A 4JL1A 4NJIA 3VABA 4OT7A 2Z25A 3BGJA 4P5UA 2PEVA 3GXTA 3TNOA 3H21A 2NWSA 3AYTA 3UFYA 4A05A 3LGEA 4O1DA 4UOZA 2WCGA 2QJHA 1SFTA 1YPXA 3KEHA 3SUUA 1SO3A 2NZLA 4WY0B 3UJ2A 4DJDC 5MF5A 1J12A 2YCJA 5GNXA 3PTDA 2WNQA 1HJUA 2VZVA 2Y24A 2QCDB 1WZLA 1R7OA 1D3CA 4N19A 2E3ZA 1EA0A 2XP6A 1X96A 4JHMA 1VIWA 5CBIA 3WKZA 3E2VA 3FA3A 3R89A 1LYXA 2GSEA 3R6IA 3C2EA 1LBMA 1QI0A 3CV6A 1T8QA 2P8BA 4IT6A 5A1AA 2PDHA 3CIVA 3AAMA 3NUKA 2VX5A 1J0YA 1PKNA 2AMGA 3RMJA 2I17A 1GW9A 2HCVA 1J0JA 3ES8A 1GVOA 1FWJC 1W1ZA 2V2CA 3WH8A 1KCLA 5FI8A 1EJTC 4XD6A 3RCMA 5HULA 5CZ0A 2GFTA 4J9JA 4ICMA 2CC0A 1NELA 3MSGA 3S47A 1VZWA 1MDRA 2VURA 3H4GA 2VP8A 5T8GA 3BH4A 4BY3A 4S39A 1Z6KA 4HSNA 4Q3MA 2E0PA 2J6XA 4CEUC 5TAOA 1M5WA 2OEJA 4UNIA 2Y89A 2X0HA 1EZWA 3VM5A 2VRKA 1TO3A 3FJNA 4WRHA 1FWDC 3DUGA 4O28A 3PZNA 3NQBA 4O0QA 3W2NA 1V7YA 2TAAA 3PZOA 1H0IA 5ABHA 1HT6A 1H41A 4OIFA 4PYSA 3ZSTA 3GBDA 1G01A 3PHAA 3GDBA 1AODA 4PRRA 1VYPX 2OU4A 3T42A 1FDJA 4MB4A 2YLAA 3EBVA 2QVHA 3BAJA 4V28A 2PCQA 1QNOA 2C18A 3EIPA 4LALA 4X0VA 4BQ5A 5CBJA 3EMQA 3BAWA 3QW4B 2YYUA 4G50A 4HD5A 4JFJA 4LCQA 1XKYA 3NM3A 3PZIA 1LORA 4Z2KA 4LCRA 4OWGA 4Q8QA 5FOOA 2GVJA 1YMYA 4E2BA 3C2RA 2D2JA 5DX7A 4H6QA 3GDMA 5CGTA 1OK6A 1UR1A 1R9XA 3B9EA 3VKDA 1PVNA 1Q66A 2XSXA 1A53A 2YLLA 3UR8A 4IUGA 4J3UA 3P6LA 2XUCA 3T0TA 1P5QA 2WHJA 3S8HA 3HPSA 3LXBA 4DJEA 1PTAA 4DEFA 2NQLA 4IMAA 2PWGA 4RL3A 1FKRA 1XIGA 1PKMA 2E4TA 3PTQA 1JZ6A 1VCFA 1OZMA 1F8MA 2D9FA 4DNMA 4DXKA 2W61A 1US3A 4FPSA 5DY2A 2VNCA 3R94A 4LAWA 3HBLA 3QQ1A 1P48A 4ZOBA 2FJKA 4DZ5A 1EJRC 3B06A 3M7WA 1U5HA 4GA8A 4JTHA 3G0UA 3RYSA 3MB9A 4L4OA 4L61A 1XQLA 3N04A 1XIDA 3CHFA 3E0IA 4MM1A 2XP7A 1J5TA 1VBJA 1IIHA 3O5MA 1F6YA 3DC0A 1G4EA 3E1F1 3RU8X 3VFLA 3GNOA 3QZAA 5A2AA 3QTGA 1DKWA 3VUPA 4IIGA 3NPWA 3QPYA 4E5TA 2REQA 1O4UA 1PPIA 4R9OA 3UWWA 3L5AA 2DQXA 2VOMA 4XAPA 3SURA 4R0XA 1RBAA 1YBQA 2Z26A 3OVGA 3ARPA 3L4YA 4H9YA 3LY0A 3A12A 3O3RA 2WKJA 3E2RA 4Y6GA 3HMCA 3W7QA 1DYSA 3T9PA 3M0YA 4XB3A 4K68A 2UZ9A 2QQ6A 2NUYA 3BK0A 2P76A 3E96A 3W1AA 4JBRA 1V0NA 1WXJA 2HDJA 3QN3A 2PDFA 3G1VA 3PR9A 2BVWA 1XFCA 5AHNA 3W22A 1L6GA 2ZDRA 5JIPA 3GDRA 2Z1XA 1E55A 3B9AA 1IT0A 2FYMA 1F5ZA 1YXYA 4KWWA 1IXPA 2PGFA 2WWCA 3DOPA 1J79A 3EKLA 5LNUA 3LUOA 4HJFA 3P7YA 1PYMA 4FS9A 4MB1A 2C16A 4BEQA 4JTRA 2GQ3A 1FCUA 4IMDA 2NVCA 5LIKX 4PFMA 5CG0A 1QASA 2G41A 4ZZ9A 4Z1BA 3BCJA 4JKLA 5HKGA 2HRWA 3QOKA 2VWSA 1EFZA 3QV9A 2WLZA 4CQ8A 2DW7A 4IJRA 3VC6A 1E6SM 1GORA 1K9DA 4MPQA 2GGHA 3N6JA 5IM51 3SCQA 2XP9A 4AZ6A 1FVPA 4HHMA 3EEGA 4I8YA 5G2IA 3T78A 4MWAA 1QPQA 1UKPA 1GONA 4RDZA 4IIEA 1VEOA 1M1BA 3KM8A 1N8FA 1KV5A 2H9AB 5I3HA 4LAZA 5HJXA 4MHBA 2JK2A 4QJ4B 3VMOA 2BNJA 1TPEA 3AMDA 3BURA 1ELSA 4OBSA 2DFAA 1IWAA 3G0XA 2WHKA 3FK4A 5T26A 3VDHA 1D3HA 4O14A 3DHDA 4GH3A 3P2VA 3PJTA 3OG3A 2HSAA 2YL5A 4BWLA 1ZZMA 5C9UA 1GOWA 3FOKA 3HG3A 1UIPA 1Z8AA 3BG3A 1EEPA 1KTCA 2J7HA 4JDBA 5AHFA 4KCWA 1CI1A 1E9YB 1OF8A 4TO8A 2LLEA 1Y8BA 3P82A 3SCWA 1XGDA 5U7SA 5I06A 5J8LA 5AHMA 2OLSA 2QZRA 4ZOEA 1RCXB 5HUAA 3SW6A 3N4FA 4H3DA 4J4NA 3ES7A 4J5NA 3PUDA 4FX7A 4MIMA 1JZ7A 2W5FA 3IV3A 1LLOA 1G69A 2Y62A 2WSYA 5EFDA 4FOJA 3FW6A 5CJNA 4GVGA 3B7XA 2DIEA 2FZMA 3NQFA 3VNZA 4C91A 4L65A 4DROA 3N12A 3ZXWA 2OKTA 4PUWA 1RALA 4KT2A 2VHLA 1E71M 4ZR8A 2WKLA 4Z08A 1E56A 2GQ8A 4MWAE 1R5YA 1UZDA 2ZA2A 4U3CA 1DJWA 4KR0B 1VH7A 5TNVA 2CU0A 1XD0A 4BEUA 2PDPA 2X0YA 2OEMA 2ITKA 1CGWA 1GEHA 3AFBA 2EG7A 4JL2A 1NAL1 3P93A 4OBRA 1REQB 1S2UA 3I7QA 4CD4A 2O9TA 1I75A 4XVEA 3TNBA 3C8FA 3M64A 2WZHA 3DU0A 5C0QA 1KCXA 2PF0A 1FKWA 1JCLA 4EXAA 1AW5A 1FA2A 1JVNA 2QF8A 4KBXA 3W85A 4QJ1A 2FTPA 2WC4A 2CFFA 2AQVA 1YE4A 2D23A 1H2JA 1L8NA 1QWKA 4H9TA 1H7OA 4F0MA 3GG0A 2V81A 2GDQA 1CLXA 3UJSA 4HHPA 2OZ0A 3B9NA 1YDOA 4GBUA 4A8RA 1TJRA 3LQGA 1RBOB 3H2EA 3ARYA 4YXGA 2ZUNA 1IV8A 3GNXA 1BVWA 1UZ4A 3O5RA 1HL2A 2R82A 1H63A 4H8HA 3H7UA 3HPZA 1HKJA 3QHMA 3STFA 2D0HA 3KFTA 1M7XA 1CGVA 1QI4A 4IPLA 5D9OA 3B0VC 3IIXA 3W1PA 1BTCA 4TX6A 1MUCA 2JQXA 2VUYA 1JZ2A 1HO1A 5E70A 1ICSA 4JTFA 4RNHA 3GXNA 4RKAA 2D73A 3KAIA 3WLOA 4DJFA 2FIQA 1E9ZB 2XVPA 3VD9A 3GH4A 4DO4A 2Y1HA 4Z2LA 2OSWA 1DJQA 3EOUA 1CIUA 1RQHA 1LRQA 4F66A 2HQAA 5A69A 1KT0A 1W1B1 1GQLA 3V4BA 5ENLA 4R34A 4GACA 2VMFA 3NXFA 3AS1A 3O5IA 3VUSA 2RUQA 3LCHA 4H00A 3GKAA 1TE6A 3EKGA 1M41A 4PEEA 3B9OA 3NQ7A 2B4GA 4FXRA 2ZXQA 1GWJA 3BG5A 2VQUA 1A3XA 4Y8FA 3BLDA 3TSDA 4BA0A 1CDGA 4QP0A 1HX0A 1AQMA 4TMCA 5BOFA 5LA1A 1IXOA 3EAUA 1JPKA 3GTNA 4UR9A 4XZMX 1UQYA 4QAWA 5C6MA 3DFSA 3OPSA 2F8QA 1A5OC 1EBHA 2NQZA 3N34A 2Z1KA 5CZSA 4K39A 2BBFA 4LVBA 1JCMP 3UZ5A 4D2JA 4UR7A 2IXUA 4UFIA 4H19A 1IYXA 4FN2A 1M5YA 2V82A 3URQA 1VYRA 3DIPA 3SCNA 4A4AA 3F1QA 2VR2A 4TVDA 1OT1A 3TYCA 1FCVA 4E3TA 3F2DA 3O5PA 5I3JA 1KKRA 4FR6A 3RGTA 2WMJA 4LC8A 3IS4A 1Z41A 3ZJ7A 4F2BA 4ZS6A 4LX4A 2ZRWA 4WQ6A 4OOUA 3POHA 1WOBA 3V7PA 4CCDA 3W02A 4AY1A 1EQ3A 5CSRA 4WOZA 4WF7A 4KH2A 2KO7A 3CHEA 3AIEA 3BICA 5DO2A 4ZOCA 4C02B 1R2TA 2IKIA 2OTDA 3CQJA 2ZQUA 4PUDA 3W1UA 1VFMA 1WP6A 1IWPA 2AQWA 2OB3A 1V02E 3U9IA 4ZPTR 3T09A 3U8GA 2F9RA 1EJVC 1O7AA 1PCKA 2C1HA 4UFMA 3W7EA 2G96A 5FJOA 3A6OA 1JVWA 3VYLA 5HWJA 2YA2A 2FAPA 4AHPA 2PLMA 1QPLA 3O06A 4LS1A 4P7QA 1X1OA 4IICA 4BI7A 3N13A 1R3WA 1XINA 3LZ3A 3O5EA 3S6DA 4IPIA 1ONEA 3W2MA 3PAJA 2OT0A 4DJEC 3ISIX 2VZSA 2E1WA 4BKNA 1TB3A 5HJYA 1VR6A 3G2GA 1FWWA 3T8LA 4DBWA 5HA7A 2PE4A 1D7IA 4B4FA 3RR4A 3UA4A 3K30A 3FYYA 1XRFA 2VR5A 1ZPTA 3CT7A 3M0ZA 5AB3A 1JF6A 3GIQA 2O9OA 1NH6A 4GE8A 5D02A 4DO6A 3THUA 3ALFA 4MOZA 1A5AA 1E6PA 2Q8LA 5FF2A 4JX5A 4H9XA 4US5A 1U83A 4ODRA 1JDDA 4QJ5B 2DU2A 4DXVA 3RUBL 4DWSA 4JY9A 2Q3RA 5HQLA 1MEHA 1GTEA 1Z69A 4S2CA 4JCMA 3TWAA 2KAUC 5LNRA 2XM2A 1U79A 3WDRA 4PTVA 3SFWA 4JHOA 1MW2A 1KXTA 2PU1A 2WNNA 4PMJA 4ZQOA 3QZEA 4P8WA 1JI2A 4GRSA 3WY1A 1IQ8A 3VIPA 3UQIA 3G1YA 5BRQA 2RUDA 3PZTA 1VENA 3GVVA 1KT1A 3EOLA 1ZAHA 4WKAA 4JFMA 2VRJA 3RGCA 4WDXA 3S9YA 4GNJA 3N2CA 1QPFA 4A6GA 2OGYA 4PMNA 5D2VA 1NMWA 1XLMA 1ONRA 4UOJA 1F6PA 5GJPA 4HNNA 4WZHA 3STGA 3UR5A 1V6VA 3N29A 4HB7A 3CUZA 4J2PA 4ZE4A 2E5BA 2FFCA 2QVNA 3E49A 1R46A 2AWGA 3T0BA 4Q4SA 3M0LA 9RUBA 1XRVA 2VC7A 1XSIA 1GK8A 1GUVA 1IGWA 5AFDA 8CGTA 3OGVA 4AWUA 2O9RA 2Z0IA 1A50A 1YW1A 3BSGA 1M6JA 1WZAA 1EGMA 1HGYA 4J3XA 1OABA 4QQUA 3KP0A 4KF1A 4CN1A 2GL5A 2D0FA 3AIRA 4JTUA 1JCNA 4JIEA 2DUAA 1UWIA 1ITQA 3WD4A 2NX1A 1VP5A 4C6QA 4IIFA 1YE6A 4ROPA 4PMOA 2HVMA 1ISWA 4D8LA 1MXSA 3V5FA 5CXPA 3WH9A 2DY3A 4UCGA 1FWCC 2V30A 5C9WA 1OD8A 5MHBA 3U48A 1C7SA 4F3HA 5ABGA 4CNOA 4HMNA 1VFFA 4AMCA 3GH5A 4OKDA 3HJZA 1WXZA 3UZXA 3HN3A 1PCWA 1XYMA 4NIRA 3U5YA 4GI6A 1FCQA 3WCZA 3AXHA 3TN6A 2PWHA 3H8AA 1BGAA 3BCFA 3RPDA 2OX1A 1SM9A 4M1RA 2VCCA 3GD6A 2FDMA 4PR4A 4JYFA 1BXNA 4ORIA 4M6VA 1JDCA 2CXEA 3FA4A 3RITA 2PCEA 1M3UA 3GUGA 3QVQA 3WLJA 5DLCA 1Y5XA 5REQA 1Q6IA 2GVGA 4DBSA 4UCFA 1C92A 5BWFA 1TMQA 2E6FA 2ABAA 4WXYA 2QIIA 4UTTA 1LG1A 2PWDA 1JZ4A 1FWHC 3PK7A 3KL5A 4DZ2A 2M08A 2A4AA 4RE0A 4UTFA 4S38A 2TSYA 4S3KA 3MWCA 5CC5A 4LF2A 3V3WA 5A6BD 1Q7MA 3FHAA 4W9TA 1VC4A 3KRZA 2REQB 5H8MA 5XINA 2NLYA 3SR7A 1TPUA 2O0TA 3B0PA 5AC7A 4WXZA 4FAPA 4GO8A 3T4WA 4M1BA 4W84A 2YBUA 1SSGA 3MJMA 4HMDA 5CJMA 2Z6JA 1QXLA 2FKPA 5J6EA 4QJ3B 2BODX 3MMUA 4HHLA 1HL8A 2VZOA 3PPFA 4UDMA 4Y9MA 4GYFA 4JCLA 1S5VA 5DMLA 4UMAA 3UVIA 2J78A 4PODA 3ABXA 2E40A 3C3UA 4U28A 1GKRA 1W2PA 1PBKA 1J4HA 1YPIA 1KM3A 4M51A 3IAQA 4MLJA 4XG1A 5CKSA 3EWUA 2LGOA 1Q2SA 1E6QM 2XPAA 2EKCA 5HANA 1CGUA 2J24A 5A8OA 3B40A 3AISA 2NV9A 1E6RA 4DELA 5FSEC 5C7VA 5CGQA 2XTKA 2GGJA 2V68A 1JJKA 1UPPA 3OZOA 3FLUA 3FIGA 1TVLA 2M2AA 4KGJA 4E0CA 5E1QA 1UP3A 5A6SA 4CNSA 2C7FA 3TZNA 2XP8A 4WR3A 3GR8A 3GC4A 3UWZA 3CAQA 3PFRA 7PTDA 3W7PA 3S5SA 2O9PA 3RCNA 4AHQA 1JG9A 1UQZA 2UY2A 3L7RA 4LUSA 2GJXA 1TPVA 3WLRA 2I7GA 4WJ8A 3MYPA 3A22A 3WQ6A 1B3WA 1BTMA 2L5HA 4FIQA 2NT0A 1B4EA 2HEJA 4I90A 4QDMA 5L9FA 1BXCA 1K70A 2NSXA 4AIEA 2I16A 5C9ZA 1R3SA 3NQVA 2CZ5A 4AB4A 2DW6A 1GJWA 2WVTA 3PF3A 1EKOA 4FMVA 4MWAB 3ODKA 3DZ1A 1KRMA 1X7FA 2QPUA 1KFBA 1UWQA 1NU5A 1LL4A 2J27A 3CGMA 3N18A 3QHOA 4RXFA 1PJ9A 2VWTA 5I3FA 5GJMA 3APGA 4PRTA 2TYSA 5EMMA 1UZHA 1J01A 3TSBA 4LUIA 4EAMA 3NTPA 3BSHA 1JCTA 4G1KA 2DZPA 4FI4A 1PIFA 2CKSA 1SO4A 4P2VA 2ZXAA 1W31A 3AZSA 5EYWA 3W24A 1FKXA 1QATA 3WQFA 2OWXA 3Q67A 3TX9A 5FF4A 3G6LA 1CEOA 1J6PA 2E28A 1XM3A 4CQDA 4IMCA 5RUBA 4O53A 1NOWA 2PV1A 4PSRA 3LM3A 5DMMA 4IX0A 2E6YA 2ONEA 2RGMA 5KETA 3GX9A 4MUPA 2XHYA 4ZQRA 5FA5A 1VQTA 3NEHA 4YHEA 4TMBA 4DJDD 3W7RA 1WDRA 1PB0A 2CLMA 1V0LA 3MO7A 5CLWA 2J13A 3FJLA 1H62A 1C8YA 2J9YA 1F3WA 1NMVA 2TODA 3KBWA 4FNQA 3WD2A 1EGZA 3GHTA 1R0MA 2CKRA 1H3GA 3ABOA 1YDVA 4JEQA 4GGHA 4O11A 1TJ0A 1XWYA 3RM9A 5A6AA 1CB2A 3CLMA 1WBJA 4E38A 1OZQA 3TR2A 4AAJA 4P61A 1YDYA 1ZRQA 3VK5A 1PYFA 3PZQA 2JKEA 3AUOA 1I2OA 4GOAA 3C2OA 4NXKA 2WK2A 1JDAA 3LD5A 1TCDA 3VD4A 3B8IA 2ANUA 5LNVA 2WMFA 3QW3A 3R13A 3IK2A 1OX4A 3WMCA 3AOFA 4BF8A 1B90A 4KWVA 3OVPA 3ZT6A 1QHOA 3HPFA 3PZ9A 1B3XA 3EOSA 2OEKA 3LG3A 1QCWA 1JNDA 3A21A 4I5XA 2J6VA 3BAXA 4L9XA 4XUGA 3I6EA 2VEKA 2W63A 7A3HA 3QLLA 2PV2A 3HFYA 3DFOA 3LZ5A 1XIEA 3DERA 3PBYA 3TU9A 5AHLA 3VX1A 3URAA 4GG9A 5LIYX 4IIDA 1FHUA 1W1A1 3AIQA 2AQOA 4GYJA 2MLXA 3UNDA 1F73A 2DT3A 2YCKX 4HA1A 1UD6A 2XYLA 2EJ1A 3VIHA 4DF0A 3OODA 3UR7A 1O5KA 4AZ5A 4XAKA 3HJEA 3LGDA 1DIOA 3PZGA 4XISA 4AH7A 2YDAA 3PG9A 3WDPP 1MQQA 2NUWA 2X1RA 3C2YA 3ZYZA 4BQ2A 4O1FA 3WLPA 3WZ0E 3I7SA 4ERGA 3IV8A 2DT1A 4XX6A 4ODQA 7REQA 3PRAA 3NVDA 1JNTA 2GJRA 3TAKA 1L6SA 3P81A 5J5RA 1AUSL 4MYXA 3II1A 3PJWA 3GC2A 2VDHA 3WQDA 4CVUA 1DHPA 5E0KA 2WMIA 3L23A 3OZYA 5A2BA 2QNEA 2QPSA 3OOQA 4D6FA 4XTDA 1NOUA 1ZAJA 4OHQA 1KLYA 5BXTA 1UUMA 5DN1A 1YKWA 4UIOA 3OP2A 3VOJA 1K7XA 5EMYA 5F2MA 2GWNA 4I9MA 2RSEA 3W71A 1E6XM 4S2BA 3B8SA 4QLKA 1GPWA 4EXBA 4DWSC 4QLJA 3GG1A 2P0IA 4JPGA 3DG7A 2IXVA 2BVYA 2OODA 3B97A 1RD5A 4TXEA 1G5AA 4JD4A 1VLWA 2C8NA 4WGXA 1E4NA 1VJSA 4GUFA 1XLBA 2PURA 3TCZA 1E3ZA 1ODZA 1XIIA 2FVLA 1UP2A 4TU1A 1V3IA 2Y5SA 4NZ1A 4DRNA 2IQDA 3WLIA 3SCPA 4IL2A 5FF7A 2XGIA 4HNVA 3N19B 4PBGA 3VOGA 1GVIA 4EAYA 2EPOA 3DGBA 4HYVA 4PMVA 4RPQA 1FKTA 3U2CA 5FEWA 3WNLA 4Q7IA 1TPWA 3N1AA 4LVDA 5LA2A 3I7RA 1JZ8A 3ZR5A 5F2LA 2DIJA 1NFGA 4MJZA 5D38A 2ZZ4A 3V0TA 3BG9A 1TPH1 1RP8A 4MVAA 3MTWA 4HOXA 4IIBA 1IGSA 3WN6A 1DXEA 4ZB0A 1NOFA 1DQWA 1JZ5A 3R25A 1ZNNA 3M5YA 2E9LA 4IFOA 4KGLA 3M41A 1J93A 1L9WA 3TYZA 3M47A 1P0NA 3LCIA 3W2KA 1NVMA 3NOYA 4GQQA 4IT1A 1U2YA 4X9SA 3VFCA 2CLLA 3P3BA 3VAWA 1NQKA 2WCAA 3V18A 3KL0A 1CW2A 4Z2IA 3U4AA 5D32A 2B7NA 3TYAA 1XLGA 2YXGA 3BSMA 4IIHA 3KTCA 3P5YA 1I2RA 2EPKX 2J25A 4LBUA 4L6HA 3E02A 3ZZ1A 3LMYA 5C70A 3WO8A 4A8LA 3QLDA 3M9YA 1HVXA 1QU4A 4NNRA 3GC5A 3QSTA 1L2QA 5CCZA 1NQ6A 4XD3A 3A5VA 1KA9F 3TMLA 2G50A 3MI2A 1UH2A 3IGXA 5FF3A 2FJUB 1JI1A 4CCCA 2FKEA 4IQCA 2KI3A 4J40A 1IE7C 1OY0A 3T08A 2A6LA 1LCOA 4QM1A 3TK7A 3P5ZA 1CCWB 4MTVA 1H49A 4EIVA 5HWNA 1FWIC 3GWQA 1ROTA 4XBJA 3WD3A 1BAGA 3MMTA 2ZUTA 1D6OA 1Q6OA 3C8NA 3IKGA 3W00A 1AG1O 5IBXC 1PSCA 1VEMA 1KFCA 3USZA 2DZWA 4QEHA 4BF5A 4ZB2A 2WBGA 5CPMA 3WNNA 1K8ZA 2G0WA 1UD3A 3EXSA 5DF0A 4I9AA 3WUGA 3A9BA 3GU2A 1YNQA 3AZRA 5EL1A 4JTIA 3WD0A 3TFCA 2XIOA 3H7VA 3UG5A 1BSIA 1LROA 1TV4A 3GTXA 3W4RA 3PBMA 5CH9A 2PC8A 2QLYA 4P7OA 5M1TA 2VOTA 4Q32A 3CZKA 2XIJA 1TJPA 2WM1A 1XIJA 5HJLA 1S1PA 2ETNA 3W87A 3BZGA 1FKIA 3H7RA 4BS0A 4HOWA 1TJ1A 2QCFA 1KTBA 2PAJA 3KDNA 3QV7A 2A3BA 4PMRA 2VDGA 4DZIA 4AW7A 3AICA 5D9NA 2VGIA 4CN6A 3LS9A 2FPTA 4IP4A 5BXPA 3L5LA 4DUXA 3RR1A 4LU0A 3WLKX 1OG0A 4IUOA 3GTYX 2BGNE 3IANA 3VDCA 3KBSA 4KCUA 2VYOA 2QJIA 4ZODA 1S5WA 2A85A 2YX0A 1HKMA 4E3VA 1TVNA 4GKLA 1JGIA 1R9ZA 4V2XA 1A0CA 1KB3A 3TLQA 4TTUA 4NG3A 5BWAA 3TSMA 2SFPA 6REQA 3W7MA 1QFEA 1T8XA 3PUEA 3BW3A 3OYXA 2OWWA 3FEQA 3HOJA 4NX5A 3DFYA 4TW8A 4PBEA 3P0XA 3D3FA 1VIZA 3PA7A 1OHLA 5JBDA 1V08A 5KINA 3K46A 2PWEA 5H8UA 3TQVA 2CLKA 1QHPA 3DKLA 2F7FA 3TW9A 1I0BA 2ZX6A 5E5CA 1XD1A 1UPMB 4UC5A 3GSMA 5DFAA 1Q6CA 4IQEA 3ID7A 2ZE0A 2YDRA 1V3KA 3B8DA 5D9MA 3FSUA 2GK1A 5GJNA 3VA8A 3MUCA 1WDQA 2PGRA 2R1NA 3BE7A 3QF0A 3MY9A 1DJYA 2V3FA 1J4IA 1C9DA 1NDZA 3Q4DA 1FWEC 3E6EA 3ITYA 1TR1A 3FGCB 3I4KA 2JEPA 4R27A 3ARQA 1J0IA 1KBJA 3O07A 3DHFA 1ROUA 4R33A 2E8ZA 1AA1B 3MDYB 2YXOA 3RRAA 1THFD 1A5BA 3OOBA 4J27A 4IX2A 3RF9A 2J8GA 3GDKA 1A5LC 5FL1A 1EJUC 1TQJA 1MNSA 2BOGX 4O8AA 1GQIA 5A2CA 1F05A 2PZ0A 4KWUA 3C6CA 3NXLA 4WJEA 4LTSA 4GYKA 4AD0A 2WMHA 2IPFA 3O5LA 4UMBA 4UUIA 5I98A 1P6CA 3WDQA 2R91A 2PDXA 4AVNA 1M7PA 4HT3A 4L4MA 1BYBA 3VGDA 2Y8KA 4DM2A 2ACRA 4ZO8A 2QGHA 5DELA 1RLCL 2Z7GA 1XH1A 3QGVA 1EA9C 3JW7A 3PUOA 1W54A 3PY2A 2MNTA 5REQB 5HT1A 4X63A 3H2NA 7TAAA 1H7PA 3KCEA 1ZS2A 3PUGA 3JU2A 3AXMA 2ZUWA 1CT5A 3C4UA 3QR3A 3WQCA 5DITA 1E0TA 2R9RA 4TX8A 3F4DA 1PDYA 3K4AA 1HF6A 5FJRA 1IT7A 1DQXA 3WJYA 1DJGA 2QUNA 2O7SA 3T2OA 5G4WA 1UJQA 3V0UA 3CPUA 2J79A 2WJEA 1W56A 3E2SA 5K4XA 1P6BA 3S1GA 5I3KA 2WVSA 1K77A 1TKKA 5K3VA 3GTHA 1AL7A 3BANA 3MBDA 4UOQA 3FKKA 2HBXA 3LXCA 4LAKA 4UBPC 1WB0A 3B3DA 3NO3A 3ENLA 2OGJA 4A3RA 4NY2A 4NILA 4QZVB 1HO4A 3BARA 3U2ZA 1YW5A 2C13A 3N73A 3F5KA 3GXMA 1V51A 4IF2A 1P0EA 4U10A 1Q8JA 4KFPA 4ORMA 2OXNA 1A5SA 4OJYA 3K8MA 4LVFA 5BU9A 2HROA 2GVYA 1ODUA 2C71A 2OVLA 5I07A 3NPUA 4LWWA 4UNLA 1FWTA 4D72A 2FPVA 2B5UB 2WO5A 3A4JA 4GFSA 2ZVRA 1AJ0A 5I5RA 3V75A 3MS8A 3WLMA 4HZ8A 1ZJHA 4WSJA 4YYFA 5E9AA 1K9EA 3AS0A 4MAZA 1ENUA 4N9BA 2WMGA 4ITZA 3CHCA 1Q13A 1EEXA 4L1WA 3BZJA 3D6NA 1WXYA 1O1ZA 5A6BA 2OSYA 3H2OA 1BQCA 1ZP3A 1QW9A 4C90A 4MMWA 4LUSB 1Q7ZA 2GJXB 1F8AB 3CXOA 2V5JA 1OGBA 2ZUVA 2EPMX 3UZWA 4ICCX 3OJGA 5IFPA 5DT5A 5D03A 5FACA 3TKFA 4NZ4A 2OLHA 2BOEX 2Z27A 2O55A 2WNZA 5HNTA 1F7BA 2GLKA 5G5IA 3DENA 2VEFA 1AH3A 4ATDA 3CEPA 1DVJA 1UKQA 3TJLA 1BVZA 1FOBA 4LF1A 2OQYA 3MA8A 3LCWA 1SW7A 1LQAA 4QT2A 1HTIA 3RFWA 3W7OA 4HU4A 3YPIA 3DH7A 4D1IA 3MMWA 4JAWA 2NSOA 1BWKA 5M3WA 1XUUA 4F9JA 1G6CA 3VIOA 1UUQA 1HKVA 3UWVA 1LDCA 9XIAA 3KS5A 1UCWA 4KRTA 3QPZA 1ZALA 1XG4A 1SJBA 3R0KA 3W1QA 1FWAC 3DI1A 2DZAA 3M5ZA 4UQEA 1JDEA 4NNCA 1GVEA 3UCDA 3MHFA 1XPGA 3VE7A 2BFGA 5B80A 4U86A 3TYDA 4WHBA 2WQPA 5DO8A 1N55A 1MYRA 3IWPA 1KRBC 3MKKA 1X39A 3N2TA 3R0UA 2LJ4A 4CD8A 4UTIA 4AXKA 4KQNA 4NXSA 5A8NA 3OLDA 1NWUA 1VJIA 4AY8A 4MSPA 4PUMA 1BD0A 3K4DA 3R12A 1L1PA 3VNKA 4QIBA 1ZCNA 4DF2A 3W7CA 3SQSA 3VCRA 4GZIA 3BUVA 2XIMA 2OYMA 3MUZ1 3IIZA 4X2PA 4QBXA 1L6YA 2YZ5A 3G22A 2R1KA 2Z7KA 5CLTA 4KEMA 4PRWA 3KCOA 5AVHA 3GXPA 4GC3A 1H0GA 3LTSA 4ADUA 4MDOA 5LNSA 3W28A 3SDOA 2G97A 4G7EA 3P60A 2PDBA 1HKWA 3MZNA 2V3GA 3C0LA 3GU1A 3ALGA 1MQPA 1WDWA 2DG4A 3REQA 4ERIA 2VC9A 4GD0A 1OX4B 1GZGA 3HQ1A 1HUVA 1GJUA 3WENA 4LAVA 4QE1A 2BZNA 2BVDA 5T91A 2NQJA 1VD6A 2EPHA 2AGTA 4HA3A 3ARXA 4GISA 4I5UA 2PRLA 2Y78A 1PE1A 4HARA 4CKQA 2BLEA 3OLEA 1XBYA 3BMXA 5C2GA 1V6WA 1UD4A 4KPLA 2ZA3A 4KIRA 4GQ0A 1DEDA 4DJDA 4DBEA 1EJSC 3M0IA 1KC7A 3WLNA 4B5VA 2DZXA 4LB3A 5I00A 2XVNA 4MFEA 2FH6A 3KABA 3C5QA 4GCXA 4FX6M 4MY9A 2QCGA 4P8XA 1MQRA 3KZSA 3ABRA 3L4WA 1UOZA 3LUTA 3EWCA 3BV4A 3TOYA 2XVKA 3IEBA 3QJAA 2V5BA 2FVMA 4BQ4A 4DO5A 3ARZA 4ONVA 1QK0A 1TSIA 1JUKA 3FNDA 4ZO9A 3H70A 4ZEPA 4AZGA 5DBTA 5EMJA 2D0GA 3GZAA 4AD5A 4C65A 4DPQA 3VU2A 4TVUA 7REQB 1DJNA 1E0WA 3MCOA 3A47A 4IQDA 1QZ2A 4BQ3A 3UPBA 1JYWA 5JH8A 3VE9A 3A4WA 4FLOA 4DRQA 4ZFMA 1SMDA 3QQWA 2YCLA 2VUNA 4LVAA 4AF0A 2WMIB 1DBTA 2QJGA 5I2UA 1T41A 1XBZA 2CITA 3WIJA 3O1NA 4XVDA 1OGGA 2XGZA 3QV8A 1IXQA 3KOYA 4AIOA 2Y63A 1XLAA 4EKJA 1H1YA 4LYQA 4HPGA 3E0LA 3GG7A 4LC6A 4EF8A 4NJKA 4RUBA 3KHJA 4DUWA 1P0KA 4C6MA 4P7NA 3VKJA 4NT0A 1LWIA 2VC5A 2POZA 3NAVA 3JR2A 3G18A 2XP5A 3S5ZA 3S2CA 2KR7A 3QFEA 3W7NA 2IPGA 5AYYA 4V1YA 3PNUA 3O6AA 2V0TA 1GOXA 4GNKB 3CQHA 1O12A 2OWCA 2GVEA 3CL8A 4BF7A 1TZZA 2F21A 2MANA 4JTLA 1Q2RA 1CB7B 4QG6A 2QDHA 5F2GA 3I65A 1SUXA 3BW2A 4XO7A 4R7WA 1VFOA 1XCFA 2BY3A 1OFOA 1I6NA 3UCCA 4H9UA 3LTPA 1MMFA 3PJUA 2O56A 4PTNA 1MUMA 1PZ1A 4LUTA 2EG8A 4UXDA 4S3AA 1QO5A 3BOXA 2A2IA 4EACA 1B5TA 1XYLA 5LA0A 3UWYA 4AYSA 2X16A 3LX9A 1JCJA 3O7UA 4PUEA 1W3HA 4AD3A 1XBVA 4HSOA 5JH2A 2DGAA 4QSFA 3IVTA 5FD0A 3NQ6A 1BXBA 1BEUA 4DWDA 4OBTA 4B3LA 3SQMA 3DI0A 4QE4A 2DZVA 1VBHA 3ANVA 5BOEA 1EWDA 4Q8MA 3TC3A 4D6GA 1TWZA 3NFUA 1YQ2A 3BO9A 3IHZA 4XD4A 3WLTA 3W07A 2ISFA 3WJZA 5C2CA 3KTSA 4CD5A 2HNEA 5HWCA 2ZFAA 3U3HA 4O50A 1BF2A 3VINA 3QM3A 4GKTA 3EB4A 3TQKA 1RK5A 5HW6A 4H9MA 2OFNA 3TXVA 1GQJA 1OC6A 4YJ5A 5AN7A 2JFEX 2V2HA 3LV5A 2ZR4A 3S83A 2PBOA 3B4YA 3WF2A 3GW0A 3ME3A 4PTDA 3CWHA 3UP8A 3W2UA 1OQFA 4Q6XA 1C91A 2VC6A 4LQ1A 3GNPA 2PWVA 2A6NA 2NLIA 3SZ8A 2VEIA 4XKYA 3UT0A 2NVAA 1GOMA 1DXIA 1S5NA 3APYA 1XLDA 4I8DA 4W88A 1RQBA 4W93A 4NI8A 1UC5A 1S2WA 1UWAA 3DESA 3VPLA 3GVGA 2E8YA 2DZBA 3A4AA 3FJ6A 1J0ZA 2DT2A 4CNUA 2DSWA 2G3IA 1LT7A 4RR4A 1E51A 3WK3A 4IP7A 2BTMA 1H1NA 3CK5A 4Q8PA 3DG6A 1L8PA 3RX4A 3FS2A 3DDMA 2QDDA 3GHUA 4QDPA 4A8NA 2YL8A 3CYVA 3PPHA 5AC8A 4JIQA 5A6TC 3VI2A 1W9VA 2AAMA 2I5QA 3WQWA 2P1FA 3SY8A 3F4NA 2A7RA 4H8UA 4EPKA 4HHHA 3IGUA 4AIUA 4C1LA 4NSBA 4DF1A 1YADA 5AYXA 4AC7C 2ZXDA 4YMZA 2PUZA 1LBLA 1XDJA 1H1ZA 3W81A 3S6TA 2V3DA 2ALRA 4JN6A 3CBWA 5A95A 2CBVA 4IPXA 4ICNA 2XFFA 2VN1A 4AZCA 2X2YA 4L64A 3UWQA 3LSBA 2X1IA 1NTHA 4GZ7A 1LRTA 4ATWA 4WOQA 1DORA 5JMUA 1MWOA 3UPWA 1VB9A 3MVTA 6REQB 1CXEA 4WLCA 2GSJA 4ZXLA 2R1PA 4JFIA 3G77A 3GZ3A 1J9YA 2HE8A 4PTMA 3T07A 1PHQA 3L5MA 4B3ZA 1E44A 1WUEA 1ZP4A 1YRRA 3W1MA 1JAEA 1QHZA 2PDCA 5A6JA 3EMCA 4FNSA 1EQPA 1X1ZA 1DTUA 2J62A 3HQNA 4IGMA 3UI4A 1KWKA 1TA3A 3ZIZA 5HPOA 1Q65A 2OT1A 3FN9A 3BGGA 4PA8A 4AC1X 2NXHA 1DJHA 2VFIA 3QFWA 2PBGA 5C9XA 4IFRA 1XQKA 1E0VA 2QCCA 4XAYA 1XSJA 2XDFA 4NZJA 1IEIA 2PTXA 4GUJA 5BCAA 2GK1B 3U5UA 3DYOA 1XX1A 1V0MA 4BR1A 4YL2A 2WYSA 3GUWA 4HK5A 4N9DA 1OSEA 1FDYA 2PPOA 2NQ9A 3VKAA 1QI5A 1UKOA 5CPLA 1Q4WA 4ACYA 1T5AA 2OOFA 1D9EA 1KO0A 1G0CA 4EPEC 1GQKA 4QGCA 2D2HA 3W7JA 3H2MA 5HINA 3WH5A 3TJXA 4K7YA 1K8CA 1R87A 3V16A 2CLOA 1DHKA 2ASHA 3O5GA 3CV2A 1OFRA 2YW4A 1I0DA 4M82A 2ZWYA 4O1BA 4JQ4A 2A79A 2VCBA 1KGUA 5ECUA 3VTRA 4NAFA 3W1RA 4UQBA 4GI9A 4AEOA 1S3HA 1B31A 2YL9A 3W6LA 1ZCOA 3G0SA 1XGEA 2BHYA 4JFWA 1TV5A 3P80A 4Q8WA 3GNRA 2CZDA 3A9IA 3ZJKA 1WOAA 3OG2A 4S3JA 2HXTA 4B9ZA 3CJPA 1N2VA 1S5MA 1H7RA 1S2TA 5LHFA 3NQDA 1M7JA 1UA7A 3C2FA 4RLIA 3G24A 2IW0A 1HXJA 4FNUA 2BX7A 1B9ZA 2EXOA 1TFVA 1ADOA 3AXXA 5H8PA 2GUYA 4PUNA 1H5VA 1QW7A 2W0UA 2YB4A 3I3EA 2Y4SA 3AMGA 3EDKA 4C6CA 2RUCA 2DT0A 2VZTA 3NM1A 2ZKMX 4Q8TA 3MBFA 2PLJA 3WQOA 2Y7EA 2QV4A 3IACA 1T40A 3T81A 4M6UA 3UR2A 3ARSA 1VFHA 3CV7A 4MPKA 5DIUA 1MRAA 4U2ZA 3SGZA 3W6MA 2Y0FA 1R9YA 1B57A 3JZUA 4H83A 1J4EA 3SJNA 2GJLA 4PB3A 5FSDC 2PU0A 3W86A 5C5YA 3W2JA 2XFYA 1XC6A 4S3BA 3MV11 3NWRA 2XSAA 3MKCA 1R3YA 3MANA 4PEKA 2NW0A 5F4SA 3UQAA 3LCXA 4RJEA 3KRSA 4M29A 3ZFHA 4DHGA 4AD4A 4O18A 2VI0A 3N6QA 3O8AA 2JKAA 1WAUA 5DMNA 4JTJA 3RLUA 1UKTA 2WPBA 3HIJA 2KE0A 1UH3A 3G1XA 1NP0A 5FF0A 3T0CA 2P0OA 2A3AA 3RXZA 2CLIA 3KRUA 4YLWA 2PDNA 2BGSA 2D2GA 3MC5A 2JALA 5FAGA 2NT1A 5DCBA 1UKSA 3W1TA 4ENLA 4UQAA 1XGZA 1RY8A 1UZ1A 5D2WA 4L6DA 1YXDA 4ZGYA 1W3KA 3CAVA 3SJ3A 3V35A 4M6QA 3GFYA 4B16A 4MUZA 2PP3A 3HMJG 3PAOA 1QK2A 4IFKB 3WFAA 5G1TA 1UROA 2BWGA 3WDHA 2WSRA 1KFLA 3L21A 3AMCA 1NSJA 1X6NA 1CX9A 1FKFA 3HGSA 1GYMA 4XZBA 3NZQA 1Q63A 4MNLA 4J28A 1RHCA 3CTLA 2LPVA 5BMXA 2PPNA 1LOLA 5I3IA 4RPPA 1M7OA 2YDSA 1GPFA 2I5IA 1M01A 4RNIA 3H2AA 1SQ7A 3OVRA 3FDGA 5DBUA 3M07A 2BGQA 4U85A 4YPJA 1RY0A 4RDWA 1XG3A 1OADA 2MLYA 4JICA 5FCZA 2FHBA 2Y6ZA 2NXGA 2ZXBA 4ODMA 3EZ4A 2QF7A 5HMSA 3TN3A 4PSPA 1OX6A 5B8IC 1CWYA 3IGSA 3PS7A 4O1CA 5LGZA 3HTWA 1W9BM 1ECQA 4M0XA 2R1MA 3DAQA 1ZUAX 4L72B 1QOPA 1Y0EA 1E15A 2J47A 4DIAA 3H23A 3THDA 4GIVA 3WEMA 5ABEA 1ZTVA 2VEGA 3PBVA 1BF6A 3KAOA 4U5IA 1RK6A 3VZXA 3UYCA 2XPKA 3VOCA 2X1TA 4L4PA 4YWSA 1Q45A 1R3RA 5CPOA 2W3ZA 1UJPA 1MFVA 5HNUA 3SSZA 3DECA 1TTJA 3ITXA 5D30A 2MNRA 2OELA 3AUJA 1U30A 3ZM8A 1FUYA 3SADA 4H8VA 4PMYA 1D8CA 1PX4A 5BNKA 4NNAA 1GVFA 2Z1BA 2TRSA 1FKBA 5TF0A 1BYAA 3B05A 3QBUA 3MI3A 1U1UA 4ZFCA 5HWMA 1CGTA 4TV5A 4F48A 4A2SA 3OU8A 4AIBA 2IPWA 2AKMA 2YJQA 1G94A 3QY7A 1ITUA 4G7EB 2XN0A 1QDSA 4JNMA 4CNNA 3GPKA 1BSLA 4JZ5A 3PPCA 2PP1A 1MXGA 1EP3A 5T9CE 3REQB 1QT1A 1ZY9A 2PDMA 3N25A 4DBUA 4GX9A 3P62A 4EP8C 1K4GA 2AKZA 2UY5A 3TTSA 3TR9A 3WSUA 4R53A 3CZ8A 4LW7A 3EOOA 2PN0A 1EX5A 4JIPA 4RNJA 2XFRA 1B3YA 2WJDA 3VNLA 2VTFA 4YVVA 5JU6A 1PDZA 2C3ZA 4POCA 1LJYA 5D4YA 4Q8OA 4INFA 1NDVA 3S42A 3EA1A 1DJZA 2CLEA 1E73M 5DXXA 3WL0A 4O4VA 3KRBA 3PNZA 3VGEA 4I3GA 1B0IA 3K5XA 3UW6A 1PKLA 4V15A 2GZXA 4JDYA 2XSBA 4F0RA 5IRPA 1RLDA 3I10A 5K2ZA 2DZUA 4JNZA 1KBLA 4F2UA 1W9PA 1ZQ5A 4K8EA 1XISA 2F2DA 3IJ7A 1JCHB 1T96A 3O05A 4JIIX 1ONWA 1BG9A 3CMFA 4LEQA 3NA8A 3ECQA 4E2VA 4RE4A 3NSNA 1A5KC 2W62A 4ASTA 3AU6A 5F4XA 4L80A 1E5NA 4ES4A 2QCMA 3WH7A 1F74A 5KSWA 3AHVA 2GDUA 4HPHA 4GXMA 3IJLA 1Q6RA 3GFZA 1YTDA 2YCLB 3VGGA 1LRNA 4AF0B 2PDUA 3EKZA 1V3LA 1V3MA 1ZBKA 1KM5A 2YOCA 1A5MC 1GVQA 3H2CA 1JCXA 3DKJA 3FEMA 4DBDA 3UQNA 2QJJA 1P1MA 1W9DM 3O5OA 4PUUA 1QJWA 3HURA 4AX7A 2D1ZA 2IQTA 3G8EA 1WPCA 2CLFA 2W91A 5TBOA 2CYGA 1JXJA 1JFXA 1GCYA 1M9HA 3ITVA 4GBDA 2N87A 1EUAA 1NM9A 1HQTA 1F76A 4UTLA 3W7DA 3U6WA 4N0RA 4Q7BA 3N3MA 3AJXA 4IGNA 5JVLA 4J3VA 5BRBA 3CM4A 1UD5A 1RJRA 1O5QA 4H9ZA 2C19A 3MUAA 3RLGA 5J5DA 5CPQA 4EVZA 1EXBA 4HBKA 2VR4A 3VIMA 1KW1A 2B7OA 3TW7A 3M43A 1OK4A 1SZFA 1QNSA 1DQUA 3G3MA 1KFWA 2I1OA 3LGGA 4E2DA 3LA4A 3ZT5A 4JX4A 1SO6A 1EC7A 3NQEA 4GVHA 1K7FA 2V3EA 4LAOA 4ZSUA 3B4UA 4LUTB 3W7KA 5HMFA 4GGQA 3GYCA 4KEUA 1QPNA 3KWXA 2HWGA 5A94A 1G7UA 1GRJA 2CETA 3W1NA 3DFQA 5EGRA 2OG9A 2PF8A 3VIJA 3RPMA 3NQAA 1W91A 3VDBA 2BDQA 3L2IA 4J3TA 2WZEA 4AEEA 4Z2HA 1VFTA 3ZVHA 2XGBA 1LUCA 3SIZA 4GIRA 1SR0A 3UVAA 2WV8A 5D37A 2J9ZA 3AROA 1S39A 3KE0A 3NOEA 3LCFA 2GDVA 2B0MA 4WCJA 4ZPVR 2XPBA 1KM1A 1AFSA 4LAMA 1Q7QA 1W9XA 3V1HA 1FWFC 1TTQA 2J66A 5AHEA 2WBKA 4MFDA 2PLCA 3TC7A 3GR4A 4M5PA 2GVLA 3WQVA 4IXXA 1S2AA 3CPRA 4C6PA 3CAKA 1DWHM 1KM4A 4OZOA 2PB1A 5A8PA 1W5QA 4ACZA 2DVTA 1EPVA 3TWBA 4LEFA 4JTAA 3HG4A 1CGYA 2WMKA 1EIXA 4A3YA 3MYOA 3IRSA 4YTTA 1VBRA 2X1UA 1FXPA 2O7QA 2EF9A 3H26A 4WY0F 3V5CA 5C7HA 3N2MA 2IMRA 3NO5A 1T99A 3CZJA 2PTWA 3B8WA 3WQ4A 2ZCGA 3WBEA 2GJPA 2H6RA 2QT3A 3HPXA 3N2OA 1Z32X 3PZMA 3STCA 5I09A 2JKPA 5A5WA 4Q4MA 2HK1A 4OUIA 1XFBA 1SYTA 4GINA 3WBAA 3GQYA 4GFIA 3WUEA 4G7FA 2NUXA 3WFLA 1KM2A 1YDNA 1ISVA 4YHGA 3ZT7A 3CHVA 1MEIA 3AIUA 4DXXA 3E0WA 4N9EA 1FKHA 4JHZA 1CENA 5EY5A 2JGQA 2DSZA 1PS9A 4C6FA 2HISA 2DEPA 4XZLX 4DZ3A 4PL2A 4GVFA 3BMVA 2BY0A 3C0SA 2Y8UA 4H6EA 2EEXA 1K1DA 1FBAA 3OO2A 4K8GA 1UUOA 3TA6A 1GKPA 4WDWA 3EWZA 1U33A 3A3XA 4OE7A 3ATZA 4DN1A 3VAVA 3L65A 2CHOA 1YYAA 5LIWX 1K9TA 3LBCA 1KXVA 1KWGA 3Q2DA 3WLQA 4MJ4A 1XL9A 3CQKA 2EGZA 4AZCB 4WEVX 2PLKA 3RJXA 3ZWSA 4IM4A 2WB5A 1H4PA 3BVJA 4C6KA 4LFYA 1MZHA 4V27A 3KUMA 2ZDSA 1IX5A 1ZK6A 3CS2A 4JXCA 4RX0A 1GVYA 2L2SA 1MO0A 5G1MA 5C71A 4GUIA 4YVPA 4J3SA 2DVUA 1SZGA 4LY8A 3V36A 3E38A 4CU6A 3KCLA 5DRCA 1VBUA 1T6MA 2Z1VA 2YA1A 2Y5JA 1AMKA 2ZRUA 2H8ZA 5AVNA 5KZ6A 1XS2A 5DCEA 3S5OA 2ZX5A 4GGBA 3RJYA 1P7TB 3W29A 5HW8A 1XC4A 3HU7A 3N11A 3SY1A 1F2JA 3ITLA 2VFHA 4BI5A 1DV7A 2B81A 3S3GA 3EWBX 5D04C 3W9ZA 1ZSXA 1FY6A 2BHZA 1JL8A 4GZEA 4JTGA 4AQLA 4L1GA 3SGUA 1RA0A 5K4ZA 4ZTYA 1R9HA 1H11A 3UGVA 3O2LA 4IMGA 3KOWA 4JTEA 1FP8A 3FJ4A 1BRLB 2ZQVA 4C1NA 1AVAA 1YNYA 4N02A 4G2PA 4H41A 2X7VA 1V7AA 3NG3A 2K8IA 4BZYA 3I6CA 4HMEA 1T0OA 3NCOA 3WYZA 2YDQA 1ISYA 3MUXA 4S1FA 1AW2A 5LHEA 4Z1CA 1FAPA 3W0KA 4O10A 5FESA 5AOUA 4W4QA 4TYOA 5I77A 1Y5VA 2B7QA 3EDFA 1V6TA 2PA6A 4LUYA 3KW3A 2ON3A 4HVXA 3ELFA 3V0SA 3OHMB 4MGVA 1GTHA 1VEPA 1GEQA 4AZBA 2RAGA 1BYCA 2F2HA 4JN8A 2IF4A 2I9UA 2XIIA 2ACQA 4C6IA 3NQCA 4ZTXA 3BQ6A 1AD4A 3STPA 2HZGA 3IK8A 4HCDA 4HSHA 2WW5A 2BV9A 1ESWA 3PSWA 3VXGA 2VD9A 2VX6A 1KFEA 1DWIM 1OJXA 2C14A 1TZ9A 1C8VA 4HA4A 1QMLA 3W84A 5AYIA 3P0WA 1CNVA 4FNPA 1UASA 4PE8A 2FGZA 3OA5A 1ZU8A 4CCZA 3K1DA 4BF9A 2ZOXA 5FJTA 2FZ9A 4LYRA 1JNEA 2ATSA 3RPTA 2CW6A 1CLVA 1M03A 3S1VA 2ZZ5A 4ZSTA 1K02A 4N4QA 4E4FA 4B4HA 4FNTA 3UZYA 1W1IE 4GMEA 1XH0A 5E0CA 3LHVA 4BJHA 1KR1A 1LBFA 5A6MA 4ZB5A 3RG6A 3EA2A 3TP4A 4DUOA 2J88A 1CGXA 2Z4GA 3ZLHA 1US2A 1ICQA 1QW8A 3QC3A 3RCYA 3HG5A 3N9SA 1MXDA 2YCIX 2G4FA 3MP4A 2Q8XA 4F8XA 1RJQA 3B8TA 4BCEA 3OLGA 3T55A 3ZR4A 4QISA 2ZVIA 3C3NA 1KD0A 3O0KA 4N4PA 3O15A 4NZCA 3TYUA 2QPXA 1XIBA 4OUEA 4LVGA 3LU2A 1FH8A 1SSDA 3N17A 1A7XA 3UJFA 2GUBA 3E9AA 4XZIA 1REQA 3EDJA 4GI4A 1O60A 4C6LA 1UWUA 4ODPA 2DJXA 4XSLA 2BSLA 4IISA 3KS6A 3BCDA 1XUZA 1R47A 3BL3A 1YIXA 2DUZA 2ZWZA 3IJQA 3UXLA 1D7JA 4DRKA 5I6SA 4B2DD 5IDZA 2G3NA 3W1LA 3EX1A 3GBEA 3OVQA 2VEPA 1Q6HA 1V6UA 2QUMA 4HMCA 4UWMA 2ZZ3A 4PCPA 4BK9A 1UC4A 2JGYA 1D2KA 2J8FA 1K8YA 3SFKA 3MP5A 3W83A 1JAKA 1WKFA 3RO6A 3IIVA 3DN5A 4JEJA 3AQUA 3UG4A 4E6MA 4H9VA 4RK8A 1RVGA 2ZA1A 3G8RA 3BLPX 1RPKA 4G1NA 2WPGA 4F0LA 1V5XA 3SEPA 4HK6A 4PMUA 1QTWA 2PDWA 2ZE3A 1SZNA 4OFCA 2POTA 4AXNA 4ODLA 1MZRA 4IXHA 5CPSA 3VMNA 2QCNA 5G1YA 1DIEA 3PWIA 4O12A 4PMZA 4ALDA 5AZ1A 2ZBTA 3KOXA 1XDLA 4FXJA 4M3PA 2FVKA 2D20A 4I9TA 1Q6UA 3LPOA 2WZMA 2O4QA 3VD5A 3U2EA 4XQ6A 2PD9A 1JF5A 1AD1A 1ALDA 5I79A 3TIMA 1IZJA 1Q6FA 2VFGA 3CIXA 3W01A 2QS8A 3U7VA 3BMBA 3QGAC 1FX6A 1V6XA 3RMEA 2INZA 2V5KA 2PDQA 4A35A 1VRXA 2Y70A 1T11A 3M5VA 4Q8UA 4CEXC 1XP3A 2V69A 4MY8A 2XH7A 1HIZA 3ABQA 5KTLA 1F4AA 5HNNA 1FD9A 2V8ZA 1JGMA 2CERA 3LN3A 1P0DA 4HU0A 1HXVA 3MSRA 3ZS4A 3SAZA 2YCEA 3H2FA 4LPCA 4L3NA 4DT4A 2RJHA 4DPPA 3CYJA 1O5XA 3LNMA 5BROA 5HR7A 3LHYA 3C61A 1TUXA 3TROA 3PSVA 3RX2A 2NV2A 1UD2A 1GT8A 4JQ1A 1Q6GA 3KBVA 3WFZA 3KX6A 1GJPA 3G1DA 1WDPA 4W8LA 2RDWA 2Q3OA 1O94A 3TCSA 3WBXA 3R58A 4XBSA 3L4VA 4TX9A 4K6AA 5D05A 2Y85A 5HQMA 4FXSA 2WVVA 4JFTA 1QBAA 1EP2A 5HK4A 3RNDA 3TA9A 8XIAA 3RDKA 1LF1A 4TX0A 4JOMA 4O2TA 2LKNA 1SW3A 1HW6A 3EPMA 3ABSA 2PTZA 3XISA 4Y7EA 4FSAA 3DXIA 9XIMA 4JTSA 1VLIA 2FGLA 2PDIA 1FFRA 1RVKA 4HCHA 3L0KA 4R88A 1JYVA 5D2XA 5IBXA 2AL2A 1F9CA 5BXRA 1ML1A 2R14A 1SR9A 5LXXA 5H91A 4V33A 5CEWA 1QNQA 1IHIA 2RDTA 3PRDA 1BHGA 2ZZ2A 1BGGA 2VCAA 1YLVA 2JE8A 3GNNA 4FK9A 1E3XA 3JRKA 2C15A 2G3FA 2IKGA 2EPLX 1D7KA 4H4IA 5CC3A 4KFNA 1KXQA 1J11A 3T05A 3CH9A 4C6BA 3S2NA 3O16A 3R8HA 3SRKA 2WSPA 1XYZA 3H24A 5EKYA 3CHDA 4PBFA 1A49A 1H7XA 3LHTA 5M2FX 4Q4OA 3PR2A 3W74A 3TUUA 1OBAA 3OGRA 2OYLA 4IP5A 2PS2A 3CB3A 4FNRA 1W3TA 3CUFA 2W79A 3KVMA 5CC7A 2HS6A 1YBQB 1X6UA 4U4MA 5KZMA 1WBHA 4B91A 5U4NA 1EDGA 3DFNA 4M7TA 3IARA 4DB7A 1LZOA 3AC0A 4RNFA 5IOBA 4P8VA 2HXUA 1OG6A 1IZKA 3VIKA 3F7JA 1K7EA 4J1OA 1FTXA 4M81A 3UWUA 3LV6A 3KVJA 5BRPA 3S5YA 3WQGA 1DJIA 2QJNA 1OIMA 5KITA 2OO0A 1WQ5A 3QRHA 1A0DA 1ADDA 4LYKA 4WDUA 1Y7VA 3OBKA 5DMYA 3CH0A 3O5QA 4GK8A 3M1ZA 1U5VA 2WJZA 5GQBA 3TEVA 2VEMA 4RV8A 3GR7A 4UR8A 2W4XA 3APTA 5IHRA 2QIWA 1P5BA 2ISDA 3WF3A 5AC5A 4GO9A 1R2RA 2QCEA 3LBMA 3G1FA 3IPWA 3A5FA 1DIDA 6TAAA 1PAMA 2F84A 1Q5MA 5BMWA 4JYEA 4CLMA 4F2TA 4H04A 3UETA 2CWNA 4GX8A 3UQBA 5FJJA 4LUJA 1XLKA 3HGOA 4AD1A 4N9CA 2AMXA 2WM0A 4PMXA 3GDLA 1R86A 2WWDA 2HNHA 1I1WA 4DRMA 4GQBA 4MAVA 1WX0A 4AYGA 5D09A 3E2QA 2FQIA 4QEEA 2XFWA 3KP1A 4MSSA 4RZBA 1MFUA 1QO2A 4QT3A 1FKKA 5BW6A 1JQVA 4TTGA 3AHTA 2XU2A 4HCLA 4JTKA 2F6KA 4DI8A 1LL7A 3UNTA 1LWJA 1N7KA 4ZE5A 4AVOA 3SI9A 1U1JA 2O92A 4YTRA 3ZVHB 5XIAA 4NX0A 1LUCB 4DRPA 1ZENA 3VIGA 1EYMA 4O13A 3GYEA 2FHCA 4XD5A 2QUUA 3PN8A 4PB4A 5CSSA 5A8GA 2JBMA 1Q3NA 4LV9A 4LV4A 1KV8A 3WBYA 1PV8A 3N4EA 2Z24A 4W7VA 1R7AA 1ZFJA 3BJSA 1FP9A 3VNDA 4ODKA 2XZ9A 5HAOA 3W88A 3BQ5A 3CUHA 4FX8A 2Z2AA 3S1XA 3TN4A 2IKJA 3PWAA 3F03K 4D6HA 4ACZB 2E9BA 6CGTA 3B04A 1WO2A 4XV0A 4F0SA 3AS3A 2Z1WA 1UA3A 1KTNA 4Q7NA 1RPXA 2D22A 2J9XA 4CQ9A 4E8GA 3S9IA 3BLLA 3FAPA 3O5DA 4ODOA 3GW3A 2ZR6A 4LBSA 4B5SA 1KQZA 3LB0A 2NVDA 1CXFA 2A7NA 3BLKA 3GY1A 4LNCA 3AI0A 2QDGA 3ZOAA 3T40A 4OU1A 2YKKA 3BJFA 1DJXA 2BXVA 2R1LA 1HJVA 3HFTA 4Q6JA 3DG3A 4PH6A 4DUVA 5BZAA 2E5CA 3LLDA 3HF3A 3S5NA 4M56A 1GOQA 4OV4A 2UY4A 1DWGM 1EX1A