3KACA

Structure-guided design of alpha-amino acid-derived pin1 inhibitors
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
113
structure length
113
Chain Sequence
EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-guided design of alpha-amino acid-derived Pin1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kacA00
4JFMA 1D6OA 2XP3A 4ITZA 2MF9A 4IPXA 2XP4A 2LJ4A 3KACA 4MGVA 2RUDA 1EYMA 3UQBA 3FAPA 5HUAA 2DG9A 2PV3A 3O5QA 4U85A 1BL4A 2MNTA 3UF8A 1F40A 1ZK6A 1NSGA 2PV2A 2VCDA 2K8IA 4GIVA 2XPAA 3KADA 1FKBA 1U79A 2D9FA 2ZQVA 3O5RA 4DH0A 2XP9A 1QPLA 1FKTA 1J6YA 2ZQSA 1FAPA 5HWBA 4W9PA 1FD9A 2ZQUA 3IK8A 2PV1A 4LAWA 5DIVA 5GPGA 3LUOA 1FKKA 1L1PA 4DROA 4DRHA 1M5YA 5D75A 5HWCA 3UI6A 1FKDA 1ZCNA 1BKFA 4GGQA 2ITKA 4ODPA 1FKSA 1FKRA 4J4OA 4TW7A 1A7XA 1F8AB 3NTPA 5HW8A 4DIPA 2FKEA 4ODLA 1J4RA 4G50A 3OOBA 4MSPA 2LGOA 3O5DA 4FAPA 1JNSA 4LAYA 3CGMA 3KAHA 3PA7A 4DZ2A 3JYMA 1NMVA 3IKDA 1J4HA 4QT2A 2DG3A 4G2PA 5HTGA 4DRMA 4DRNA 4DRJA 4R0XA 3ODKA 3KAIA 2MPHA 2MLYA 3O5LA 2KO7A 3GPKA 1PBKA 1Q1CA 3I6CA 4JFLA 4W9OA 1R9HA 4C02B 4DRQA 2F21A 4JFJA 3NI6A 3RGCA 2UZ5A 1FJDA 1Q6IA 2IF4A 3KAGA 4ODNA 3UI5A 4TX0A 1FKLA 4U86A 5DITA 2RUQA 2MLXA 2KGJA 2XPBA 2FAPA 3KABA 1TCOC 3TC5A 3PRDA 1B6CA 3O5OA 1FKIA 1ROTA 2MLZA 2XP7A 1T11A 1W26A 5B8IC 5J6EA 5DIUA 2RUCA 4QT3A 2L2SA 4W9QA 3O5GA 3O5MA 3H9RB 3KAFA 3KCEA 1FKFA 2ZR4A 4IQCA 3PRBA 4LAXA 2PBCA 2N87A 5BXJA 2PPPA 2RSEA 3KZ7A 5HT1A 1HXVA 2RURA 1JNTA 2M08A 5HKGA 2ZR5A 1J4IA 4QIBA 1D7JA 2LPVA 4JFIA 2Q5AA 1EQ3A 1Q6UA 1KT0A 2Y78A 4TW6A 1QPFA 3IKGA 4TW8A 1JVWA 1YW5A 2F2DA 5I98A 4DRKA 1YATA 2OFNA 4DRPA 1D7IA 1P5QA 2JZVA 2XP5A 3RFWA 1PINA 1NMWA 2M1IA 1FKHA 2KR7A 5HW7A 3NRKA 5HW6A 3JYJA 3MDYB 4TYOA 3O5IA 2DG4A 2M2AA 4ODQA 4BF8A 3UQAA 1Q6HA 2KI3A 4DT4A 4ODRA 3IHZA 4NNRA 2XP8A 4ODKA 2ZR6A 1D7HA 3B7XA 4ODMA 3VAWA 3WH0A 4DRIA 2PPOA 1FKJA 2RQSA 4FN2A 3O5KA 3O5JA 1N1AA 1FKGA 3TCZA 2PPNA 4U84A 4IQ2A 4JFKA 2KE0A 2KFWA 1C9HA 4TNSA 3CGNA 3O5PA 2VN1A 2XP6A 1KT1A 2AWGA 3JXVA 3O5FA 4JYSA 3TDBA 3O5EA 4O2TA 2ZQTA 1Y0OA 1QZ2A 2F4EA 3EY6A 4ODOA 4N19A 2LKNA 3UI4A 3UQIA 4J4NA 4LAVA 4DZ3A 1ROUA
chains in the Genus database with same CATH superfamily
4JFMA 2XP3A 2XP4A 2LJ4A 3ARXA 3UQBA 1GOIA 2DG9A 2DPEA 1LJYA 2MNTA 3UF8A 2PV2A 2VCDA 3WIJA 2K8IA 2D9FA 2ZQVA 4DWSA 4W9PA 1FD9A 2PV1A 4LAWA 3ARRA 1ZU8A 1ZB5A 4DRHA 5D75A 5HWCA 4HBEA 1WNOA 1BKFA 4GGQA 1FKRA 1F8AB 3ARZA 3B9AA 3OOBA 2LGOA 4FAPA 1GRJA 1W1YA 4Z2JA 4WKAA 1WAWA 4Z2KA 2DG3A 4DRMA 3ODKA 1EDQA 1Q1CA 2PN0A 1ZBVA 4JFJA 4URIA 1W9VA 1FJDA 1Q6IA 2IF4A 4TX0A 5DITA 2ESCA 4ZPTR 1FKIA 3OA5A 2MLZA 5DIUA 1E15A 1ZBKA 3O5GA 4IQCA 1FKFA 1FFQA 2PBCA 3KZ7A 2ZR5A 4WIWA 3GU0A 1UR8A 1EHNA 4NZCA 3G6MA 1Q6UA 4Q22A 1NH6A 2DT3A 2DSWA 4TW8A 1HKKA 2F2DA 2OFNA 4XAKA 2XP5A 3CHDA 4WK9A 1E9LA 2G8ZA 4P8XA 1H0IA 5HW6A 4TYOA 2DT0A 2PI6A 3WL0A 4ODQA 1Q6HA 2KI3A 4ODRA 4ODKA 1XRVA 1D7HA 2ZR6A 1ZBCA 1FKJA 4L72B 1VF8A 4HARA 4FN2A 2KFWA 1C9HA 3O5PA 2VN1A 2AWGA 3BMBA 4KR0B 4O2TA 1Y0OA 3UQIA 3FY1A 2LKNA 2B31A 4J4NA 4MSPA 5GPRA 4ITZA 4IPXA 2A3CA 3FAPA 5HUAA 1UR9A 3RMEA 2AOSA 2XP9A 3WD2A 2YBUA 3ARVA 3AS2A 4DROA 5HBFA 3UI6A 4P8WA 1FKDA 2F23A 3AROA 4ODPA 1FKSA 3CHEA 4L3NA 3RM4A 4MNLA 1JNSA 4LAYA 1W9UA 3PA7A 3JYMA 3ARUA 5DF0A 3AS1A 4Z2GA 1NWUA 3PRAA 4S3KA 4G2PA 4DRNA 4R0XA 1FFRA 2MLYA 3O5LA 3RM9A 1ITXA 4W9OA 4C02B 1LQ0A 2F21A 3NI6A 2UZ5A 5JH8A 1GUVA 1E6RA 3O5OA 4UDMA 1LG2A 2DSUA 4W9QA 2L2SA 3O5MA 4PTMA 3KCEA 2ZR4A 4LAXA 2PPPA 5HT1A 1HXVA 1IX5A 1JNTA 5HKGA 4ZPWR 4Z2IA 4QIBA 2FDMA 1OGBA 4JFIA 1EQ3A 1SYTA 2Q5AA 2Y78A 4DWSB 1JVWA 5I98A 2WM0A 4ML4A 4P8UA 2DT2A 4IT6A 4ZPVR 1FKHA 3MDYB 1HJVA 4HBOA 4KQZA 4BF8A 3UQAA 2A3AA 2O9OA 3WL1A 3WD4A 4ODMA 3VAWA 3WH0A 4DRIA 4W5UA 1JNEA 3CHCA 3O5KA 2PPNA 3ARYA 4IQ2A 1KT1A 1E6NA 3JXVA 3TDBA 3CZ8A 2DSZA 4Q7NA 2ZQTA 4DZ3A 4ODOA 4N19A 4LAVA 1ROUA 1D6OA 3CHFA 1X6LA 3ALGA 4MTVA 1LL7A 2P4VA 3AQUA 3KACA 1LL6A 2RUDA 1EYMA 3B9DA 4WJXA 4U85A 1GPFA 1HKJA 2XPAA 1FKBA 4DH0A 4MAVA 1J6YA 1D2KA 3ARWA 2ZQSA 4DWSD 1FAPA 5HWBA 2ZQUA 3IK8A 5GPGA 1E6PA 1FKKA 1E44A 1ZCNA 1W9PA 1NWSA 4J4OA 1A7XA 3NTPA 4Z2HA 2FKEA 4ODLA 3O5DA 3CGMA 3B8SA 1NMVA 3IKDA 1K9TA 4MNMA 4QZVB 4DRJA 3AS3A 3I6CA 1R9HA 4DRQA 2WLZA 3RGCA 1LG1A 3WQVA 2OLHA 3KAGA 4ODNA 4U86A 2KGJA 2FAPA 1CTNA 2DSVA 3KABA 4IT4A 1B6CA 1HJXA 1T11A 1W26A 5B8IC 5J6EA 2RUCA 4QT3A 3H9RB 3PR9A 1X6NA 3KAFA 1JNDA 5BXJA 2RSEA 2RURA 2O92A 2M08A 1HKIA 3ARTA 3B9EA 1HJWA 2B5UB 2LPVA 1KT0A 4DRKA 1YATA 4DRPA 1P5QA 1PINA 2WK2A 1W1PA 1HKMA 1KFWA 3ARPA 5GQBA 2DG4A 2EULA 1RD6A 3IHZA 4NNRA 2XP8A 4WKFA 3O5JA 1N1AA 4U84A 4WKHA 4JFKA 2KE0A 1OWQA 3WD1A 3O5FA 5DEZA 1QZ2A 2F4EA 3BXWA 2MF9A 4MGVA 2PV3A 3O5QA 1BL4A 1WB0A 1F40A 1ZK6A 1NSGA 4GIVA 3KADA 1U79A 3O5RA 1QPLA 1FKTA 2DT1A 1ZBWA 3AS0A 5DIVA 4MNKA 3LUOA 1L1PA 1M5YA 2WLYA 1TFVA 2ITKA 4TW7A 5HW8A 2IUZA 4DIPA 4Z2LA 1J4RA 3ALFA 4G50A 4P8VA 1OGGA 2A3BA 2A3EA 1O6IA 3KAHA 3WD0A 4DZ2A 1E6ZA 1J4HA 2G41A 4QT2A 5HTGA 3W4RA 4AY1A 3KAIA 2MPHA 2KO7A 3GPKA 1PBKA 4LGXA 4JFLA 5DO2A 2ETNA 3G6LA 1XHGA 3ARSA 3QOKA 3UI5A 1JCHB 1FKLA 2RUQA 1H0GA 2MLXA 4MNJA 2XPBA 3FXYA 4ZS6A 1TCOC 3TC5A 3PRDA 1ROTA 2XP7A 4NSBA 3EIPA 4S3JA 3WD3A 1W1TA 3PRBA 2N87A 1NWTA 2QF8A 1J4IA 1D7JA 1EIBA 1SR0A 1NWRA 4TW6A 3WQWA 1QPFA 2YBTA 3IKGA 1YW5A 1D7IA 2JZVA 3RFWA 4DWSC 3WKZA 1NMWA 2M1IA 1ZL1A 2KR7A 5HW7A 3NRKA 3JYJA 3O5IA 2M2AA 3CH9A 3RM8A 4DT4A 3ARQA 3B7XA 1W1VA 2PPOA 2RQSA 4R5EA 4MPKA 1FKGA 1LL4A 3TCZA 4TNSA 2XP6A 4JYSA 3O5EA 3EY6A 3CGNA 3UI4A 3GTYX
chains in the Genus database with same CATH topology
4JFMA 2XP3A 2XP4A 2LJ4A 3ARXA 3UQBA 1GOIA 2DG9A 2DPEA 1LJYA 2MNTA 3UF8A 2PV2A 2VCDA 3WIJA 2K8IA 2D9FA 2ZQVA 4DWSA 4W9PA 1FD9A 2PV1A 4LAWA 3ARRA 1ZU8A 1ZB5A 4DRHA 5D75A 5HWCA 4HBEA 1WNOA 1BKFA 4GGQA 1FKRA 1F8AB 3ARZA 3B9AA 3OOBA 2LGOA 4FAPA 1W1YA 4Z2JA 4WKAA 1WAWA 4Z2KA 2DG3A 4DRMA 3ODKA 1EDQA 1Q1CA 1ZBVA 4JFJA 4URIA 1W9VA 1FJDA 1Q6IA 2IF4A 4TX0A 5DITA 2ESCA 4ZPTR 1FKIA 3OA5A 2MLZA 5DIUA 1E15A 1ZBKA 3O5GA 4IQCA 1FKFA 1FFQA 2PBCA 3KZ7A 2ZR5A 4WIWA 1UR8A 1EHNA 4NZCA 3G6MA 1Q6UA 4Q22A 1NH6A 2DT3A 2DSWA 4TW8A 1HKKA 2F2DA 2OFNA 4XAKA 2XP5A 3CHDA 4WK9A 1E9LA 2G8ZA 4P8XA 1H0IA 5HW6A 4TYOA 2DT0A 2PI6A 3WL0A 4ODQA 1Q6HA 2KI3A 4ODRA 4ODKA 1XRVA 1D7HA 2ZR6A 1ZBCA 1FKJA 4L72B 1VF8A 4HARA 4FN2A 2KFWA 1C9HA 3O5PA 2VN1A 2AWGA 4KR0B 4O2TA 1Y0OA 3UQIA 3FY1A 2LKNA 2B31A 4J4NA 4MSPA 5GPRA 4ITZA 4IPXA 2A3CA 3FAPA 5HUAA 1UR9A 3RMEA 2AOSA 2XP9A 3WD2A 2YBUA 3ARVA 3AS2A 4DROA 5HBFA 3UI6A 4P8WA 1FKDA 3AROA 4ODPA 1FKSA 3CHEA 4L3NA 3RM4A 4MNLA 1JNSA 4LAYA 1W9UA 3PA7A 3JYMA 3ARUA 5DF0A 3AS1A 4Z2GA 1NWUA 3PRAA 4S3KA 4G2PA 4DRNA 4R0XA 1FFRA 2MLYA 3O5LA 3RM9A 1ITXA 4W9OA 4C02B 1LQ0A 2F21A 3NI6A 2UZ5A 5JH8A 1GUVA 1E6RA 3O5OA 1LG2A 2DSUA 4W9QA 2L2SA 3O5MA 4PTMA 3KCEA 2ZR4A 4LAXA 2PPPA 5HT1A 1HXVA 1IX5A 1JNTA 5HKGA 4ZPWR 4Z2IA 4QIBA 2FDMA 1OGBA 4JFIA 1EQ3A 1SYTA 2Q5AA 2Y78A 4DWSB 1JVWA 5I98A 2WM0A 4ML4A 4P8UA 2DT2A 4IT6A 4ZPVR 1FKHA 3MDYB 1HJVA 4HBOA 4KQZA 4BF8A 3UQAA 2A3AA 2O9OA 3WL1A 3WD4A 4ODMA 3VAWA 3WH0A 4DRIA 4W5UA 1JNEA 3CHCA 3O5KA 2PPNA 3ARYA 4IQ2A 1KT1A 1E6NA 3JXVA 3TDBA 3CZ8A 2DSZA 4Q7NA 2ZQTA 4DZ3A 4ODOA 4N19A 4LAVA 1ROUA 1D6OA 3CHFA 1X6LA 3ALGA 4MTVA 1LL7A 3AQUA 3KACA 1LL6A 2RUDA 1EYMA 3B9DA 4WJXA 4U85A 1GPFA 1HKJA 2XPAA 1FKBA 4DH0A 4MAVA 1J6YA 1D2KA 3ARWA 2ZQSA 4DWSD 1FAPA 5HWBA 2ZQUA 3IK8A 5GPGA 1E6PA 1FKKA 1ZCNA 1W9PA 1NWSA 4J4OA 1A7XA 3NTPA 4Z2HA 2FKEA 4ODLA 3O5DA 3CGMA 3B8SA 1NMVA 3IKDA 1K9TA 4MNMA 4QZVB 4DRJA 3AS3A 3I6CA 1R9HA 4DRQA 2WLZA 3RGCA 1LG1A 3WQVA 2OLHA 3KAGA 4ODNA 4U86A 2KGJA 2FAPA 1CTNA 2DSVA 3KABA 4IT4A 1B6CA 1HJXA 1T11A 1W26A 5B8IC 5J6EA 2RUCA 4QT3A 3H9RB 3PR9A 1X6NA 3KAFA 1JNDA 5BXJA 2RSEA 2RURA 2O92A 2M08A 1HKIA 3ARTA 3B9EA 1HJWA 2LPVA 1KT0A 4DRKA 1YATA 4DRPA 1P5QA 1PINA 2WK2A 1W1PA 1HKMA 1KFWA 3ARPA 5GQBA 2DG4A 1RD6A 3IHZA 4NNRA 2XP8A 4WKFA 3O5JA 1N1AA 4U84A 4WKHA 4JFKA 2KE0A 1OWQA 3WD1A 3O5FA 5DEZA 1QZ2A 2F4EA 3BXWA 2MF9A 4MGVA 2PV3A 3O5QA 1BL4A 1WB0A 1F40A 1ZK6A 1NSGA 4GIVA 3KADA 1U79A 3O5RA 1QPLA 1FKTA 2DT1A 1ZBWA 3AS0A 5DIVA 4MNKA 3LUOA 1L1PA 1M5YA 2WLYA 1TFVA 2ITKA 4TW7A 5HW8A 2IUZA 4DIPA 4Z2LA 1J4RA 3ALFA 4G50A 4P8VA 1OGGA 2A3BA 2A3EA 1O6IA 3KAHA 3WD0A 4DZ2A 1E6ZA 1J4HA 2G41A 4QT2A 5HTGA 3W4RA 4AY1A 3KAIA 2MPHA 2KO7A 3GPKA 1PBKA 4LGXA 4JFLA 5DO2A 3G6LA 1XHGA 3ARSA 3QOKA 3UI5A 1FKLA 2RUQA 1H0GA 2MLXA 4MNJA 2XPBA 3FXYA 4ZS6A 1TCOC 3TC5A 3PRDA 1ROTA 2XP7A 4NSBA 4S3JA 3WD3A 1W1TA 3PRBA 2N87A 1NWTA 2QF8A 1J4IA 1D7JA 1EIBA 1SR0A 1NWRA 4TW6A 3WQWA 1QPFA 2YBTA 3IKGA 1YW5A 1D7IA 2JZVA 3RFWA 4DWSC 3WKZA 1NMWA 2M1IA 1ZL1A 2KR7A 5HW7A 3NRKA 3JYJA 3O5IA 2M2AA 3CH9A 3RM8A 4DT4A 3ARQA 3B7XA 1W1VA 2PPOA 2RQSA 4R5EA 4MPKA 1FKGA 1LL4A 3TCZA 4TNSA 2XP6A 4JYSA 3O5EA 3EY6A 3CGNA 3UI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JFM A;  1D6O A;  2XP3 A;  4ITZ A;  2MF9 A;  4IPX A;  2XP4 A;  2LJ4 A;  3KAC A;  4MGV A;  2RUD A;  1EYM A;  3UQB A;  3FAP A;  5HUA A;  2DG9 A;  2PV3 A;  3O5Q A;  4U85 A;  1BL4 A;  2MNT A;  3UF8 A;  1F40 A;  1ZK6 A;  1NSG A;  2PV2 A;  2VCD A;  2K8I A;  4GIV A;  2XPA A;  3KAD A;  1FKB A;  1U79 A;  2D9F A;  2ZQV A;  3O5R A;  4DH0 A;  2XP9 A;  1QPL A;  1FKT A;  1J6Y A;  2ZQS A;  1FAP A;  5HWB A;  4W9P A;  1FD9 A;  2ZQU A;  3IK8 A;  2PV1 A;  4LAW A;  5DIV A;  5GPG A;  3LUO A;  1FKK A;  1L1P A;  4DRO A;  4DRH A;  1M5Y A;  5D75 A;  5HWC A;  3UI6 A;  1FKD A;  1ZCN A;  1BKF A;  4GGQ A;  2ITK A;  4ODP A;  1FKS A;  1FKR A;  4J4O A;  4TW7 A;  1A7X A;  1F8A B;  3NTP A;  5HW8 A;  4DIP A;  2FKE A;  4ODL A;  1J4R A;  4G50 A;  3OOB A;  4MSP A;  2LGO A;  3O5D A;  4FAP A;  1JNS A;  4LAY A;  3CGM A;  3KAH A;  3PA7 A;  4DZ2 A;  3JYM A;  1NMV A;  3IKD A;  1J4H A;  4QT2 A;  2DG3 A;  4G2P A;  5HTG A;  4DRM A;  4DRN A;  4DRJ A;  4R0X A;  3ODK A;  3KAI A;  2MPH A;  2MLY A;  3O5L A;  2KO7 A;  3GPK A;  1PBK A;  1Q1C A;  3I6C A;  4JFL A;  4W9O A;  1R9H A;  4C02 B;  4DRQ A;  2F21 A;  4JFJ A;  3NI6 A;  3RGC A;  2UZ5 A;  1FJD A;  1Q6I A;  2IF4 A;  3KAG A;  4ODN A;  3UI5 A;  4TX0 A;  1FKL A;  4U86 A;  5DIT A;  2RUQ A;  2MLX A;  2KGJ A;  2XPB A;  2FAP A;  3KAB A;  1TCO C;  3TC5 A;  3PRD A;  1B6C A;  3O5O A;  1FKI A;  1ROT A;  2MLZ A;  2XP7 A;  1T11 A;  1W26 A;  5B8I C;  5J6E A;  5DIU A;  2RUC A;  4QT3 A;  2L2S A;  4W9Q A;  3O5G A;  3O5M A;  3H9R B;  3KAF A;  3KCE A;  1FKF A;  2ZR4 A;  4IQC A;  3PRB A;  4LAX A;  2PBC A;  2N87 A;  5BXJ A;  2PPP A;  2RSE A;  3KZ7 A;  5HT1 A;  1HXV A;  2RUR A;  1JNT A;  2M08 A;  5HKG A;  2ZR5 A;  1J4I A;  4QIB A;  1D7J A;  2LPV A;  4JFI A;  2Q5A A;  1EQ3 A;  1Q6U A;  1KT0 A;  2Y78 A;  4TW6 A;  1QPF A;  3IKG A;  4TW8 A;  1JVW A;  1YW5 A;  2F2D A;  5I98 A;  4DRK A;  1YAT A;  2OFN A;  4DRP A;  1D7I A;  1P5Q A;  2JZV A;  2XP5 A;  3RFW A;  1PIN A;  1NMW A;  2M1I A;  1FKH A;  2KR7 A;  5HW7 A;  3NRK A;  5HW6 A;  3JYJ A;  3MDY B;  4TYO A;  3O5I A;  2DG4 A;  2M2A A;  4ODQ A;  4BF8 A;  3UQA A;  1Q6H A;  2KI3 A;  4DT4 A;  4ODR A;  3IHZ A;  4NNR A;  2XP8 A;  4ODK A;  2ZR6 A;  1D7H A;  3B7X A;  4ODM A;  3VAW A;  3WH0 A;  4DRI A;  2PPO A;  1FKJ A;  2RQS A;  4FN2 A;  3O5K A;  3O5J A;  1N1A A;  1FKG A;  3TCZ A;  2PPN A;  4U84 A;  4IQ2 A;  4JFK A;  2KE0 A;  2KFW A;  1C9H A;  4TNS A;  3CGN A;  3O5P A;  2VN1 A;  2XP6 A;  1KT1 A;  2AWG A;  3JXV A;  3O5F A;  4JYS A;  3TDB A;  3O5E A;  4O2T A;  2ZQT A;  1Y0O A;  1QZ2 A;  2F4E A;  3EY6 A;  4ODO A;  4N19 A;  2LKN A;  3UI4 A;  3UQI A;  4J4N A;  4LAV A;  4DZ3 A;  1ROU A; 
#chains in the Genus database with same CATH topology
 4JFM A;  2XP3 A;  2XP4 A;  2LJ4 A;  3ARX A;  3UQB A;  1GOI A;  2DG9 A;  2DPE A;  1LJY A;  2MNT A;  3UF8 A;  2PV2 A;  2VCD A;  3WIJ A;  2K8I A;  2D9F A;  2ZQV A;  4DWS A;  4W9P A;  1FD9 A;  2PV1 A;  4LAW A;  3ARR A;  1ZU8 A;  1ZB5 A;  4DRH A;  5D75 A;  5HWC A;  4HBE A;  1WNO A;  1BKF A;  4GGQ A;  1FKR A;  1F8A B;  3ARZ A;  3B9A A;  3OOB A;  2LGO A;  4FAP A;  1GRJ A;  1W1Y A;  4Z2J A;  4WKA A;  1WAW A;  4Z2K A;  2DG3 A;  4DRM A;  3ODK A;  1EDQ A;  1Q1C A;  2PN0 A;  1ZBV A;  4JFJ A;  4URI A;  1W9V A;  1FJD A;  1Q6I A;  2IF4 A;  4TX0 A;  5DIT A;  2ESC A;  4ZPT R;  1FKI A;  3OA5 A;  2MLZ A;  5DIU A;  1E15 A;  1ZBK A;  3O5G A;  4IQC A;  1FKF A;  1FFQ A;  2PBC A;  3KZ7 A;  2ZR5 A;  4WIW A;  3GU0 A;  1UR8 A;  1EHN A;  4NZC A;  3G6M A;  1Q6U A;  4Q22 A;  1NH6 A;  2DT3 A;  2DSW A;  4TW8 A;  1HKK A;  2F2D A;  2OFN A;  4XAK A;  2XP5 A;  3CHD A;  4WK9 A;  1E9L A;  2G8Z A;  4P8X A;  1H0I A;  5HW6 A;  4TYO A;  2DT0 A;  2PI6 A;  3WL0 A;  4ODQ A;  1Q6H A;  2KI3 A;  4ODR A;  4ODK A;  1XRV A;  1D7H A;  2ZR6 A;  1ZBC A;  1FKJ A;  4L72 B;  1VF8 A;  4HAR A;  4FN2 A;  2KFW A;  1C9H A;  3O5P A;  2VN1 A;  2AWG A;  3BMB A;  4KR0 B;  4O2T A;  1Y0O A;  3UQI A;  3FY1 A;  2LKN A;  2B31 A;  4J4N A;  4MSP A;  5GPR A;  4ITZ A;  4IPX A;  2A3C A;  3FAP A;  5HUA A;  1UR9 A;  3RME A;  2AOS A;  2XP9 A;  3WD2 A;  2YBU A;  3ARV A;  3AS2 A;  4DRO A;  5HBF A;  3UI6 A;  4P8W A;  1FKD A;  2F23 A;  3ARO A;  4ODP A;  1FKS A;  3CHE A;  4L3N A;  3RM4 A;  4MNL A;  1JNS A;  4LAY A;  1W9U A;  3PA7 A;  3JYM A;  3ARU A;  5DF0 A;  3AS1 A;  4Z2G A;  1NWU A;  3PRA A;  4S3K A;  4G2P A;  4DRN A;  4R0X A;  1FFR A;  2MLY A;  3O5L A;  3RM9 A;  1ITX A;  4W9O A;  4C02 B;  1LQ0 A;  2F21 A;  3NI6 A;  2UZ5 A;  5JH8 A;  1GUV A;  1E6R A;  3O5O A;  4UDM A;  1LG2 A;  2DSU A;  4W9Q A;  2L2S A;  3O5M A;  4PTM A;  3KCE A;  2ZR4 A;  4LAX A;  2PPP A;  5HT1 A;  1HXV A;  1IX5 A;  1JNT A;  5HKG A;  4ZPW R;  4Z2I A;  4QIB A;  2FDM A;  1OGB A;  4JFI A;  1EQ3 A;  1SYT A;  2Q5A A;  2Y78 A;  4DWS B;  1JVW A;  5I98 A;  2WM0 A;  4ML4 A;  4P8U A;  2DT2 A;  4IT6 A;  4ZPV R;  1FKH A;  3MDY B;  1HJV A;  4HBO A;  4KQZ A;  4BF8 A;  3UQA A;  2A3A A;  2O9O A;  3WL1 A;  3WD4 A;  4ODM A;  3VAW A;  3WH0 A;  4DRI A;  4W5U A;  1JNE A;  3CHC A;  3O5K A;  2PPN A;  3ARY A;  4IQ2 A;  1KT1 A;  1E6N A;  3JXV A;  3TDB A;  3CZ8 A;  2DSZ A;  4Q7N A;  2ZQT A;  4DZ3 A;  4ODO A;  4N19 A;  4LAV A;  1ROU A;  1D6O A;  3CHF A;  1X6L A;  3ALG A;  4MTV A;  1LL7 A;  2P4V A;  3AQU A;  3KAC A;  1LL6 A;  2RUD A;  1EYM A;  3B9D A;  4WJX A;  4U85 A;  1GPF A;  1HKJ A;  2XPA A;  1FKB A;  4DH0 A;  4MAV A;  1J6Y A;  1D2K A;  3ARW A;  2ZQS A;  4DWS D;  1FAP A;  5HWB A;  2ZQU A;  3IK8 A;  5GPG A;  1E6P A;  1FKK A;  1E44 A;  1ZCN A;  1W9P A;  1NWS A;  4J4O A;  1A7X A;  3NTP A;  4Z2H A;  2FKE A;  4ODL A;  3O5D A;  3CGM A;  3B8S A;  1NMV A;  3IKD A;  1K9T A;  4MNM A;  4QZV B;  4DRJ A;  3AS3 A;  3I6C A;  1R9H A;  4DRQ A;  2WLZ A;  3RGC A;  1LG1 A;  3WQV A;  2OLH A;  3KAG A;  4ODN A;  4U86 A;  2KGJ A;  2FAP A;  1CTN A;  2DSV A;  3KAB A;  4IT4 A;  1B6C A;  1HJX A;  1T11 A;  1W26 A;  5B8I C;  5J6E A;  2RUC A;  4QT3 A;  3H9R B;  3PR9 A;  1X6N A;  3KAF A;  1JND A;  5BXJ A;  2RSE A;  2RUR A;  2O92 A;  2M08 A;  1HKI A;  3ART A;  3B9E A;  1HJW A;  2B5U B;  2LPV A;  1KT0 A;  4DRK A;  1YAT A;  4DRP A;  1P5Q A;  1PIN A;  2WK2 A;  1W1P A;  1HKM A;  1KFW A;  3ARP A;  5GQB A;  2DG4 A;  2EUL A;  1RD6 A;  3IHZ A;  4NNR A;  2XP8 A;  4WKF A;  3O5J A;  1N1A A;  4U84 A;  4WKH A;  4JFK A;  2KE0 A;  1OWQ A;  3WD1 A;  3O5F A;  5DEZ A;  1QZ2 A;  2F4E A;  3BXW A;  2MF9 A;  4MGV A;  2PV3 A;  3O5Q A;  1BL4 A;  1WB0 A;  1F40 A;  1ZK6 A;  1NSG A;  4GIV A;  3KAD A;  1U79 A;  3O5R A;  1QPL A;  1FKT A;  2DT1 A;  1ZBW A;  3AS0 A;  5DIV A;  4MNK A;  3LUO A;  1L1P A;  1M5Y A;  2WLY A;  1TFV A;  2ITK A;  4TW7 A;  5HW8 A;  2IUZ A;  4DIP A;  4Z2L A;  1J4R A;  3ALF A;  4G50 A;  4P8V A;  1OGG A;  2A3B A;  2A3E A;  1O6I A;  3KAH A;  3WD0 A;  4DZ2 A;  1E6Z A;  1J4H A;  2G41 A;  4QT2 A;  5HTG A;  3W4R A;  4AY1 A;  3KAI A;  2MPH A;  2KO7 A;  3GPK A;  1PBK A;  4LGX A;  4JFL A;  5DO2 A;  2ETN A;  3G6L A;  1XHG A;  3ARS A;  3QOK A;  3UI5 A;  1JCH B;  1FKL A;  2RUQ A;  1H0G A;  2MLX A;  4MNJ A;  2XPB A;  3FXY A;  4ZS6 A;  1TCO C;  3TC5 A;  3PRD A;  1ROT A;  2XP7 A;  4NSB A;  3EIP A;  4S3J A;  3WD3 A;  1W1T A;  3PRB A;  2N87 A;  1NWT A;  2QF8 A;  1J4I A;  1D7J A;  1EIB A;  1SR0 A;  1NWR A;  4TW6 A;  3WQW A;  1QPF A;  2YBT A;  3IKG A;  1YW5 A;  1D7I A;  2JZV A;  3RFW A;  4DWS C;  3WKZ A;  1NMW A;  2M1I A;  1ZL1 A;  2KR7 A;  5HW7 A;  3NRK A;  3JYJ A;  3O5I A;  2M2A A;  3CH9 A;  3RM8 A;  4DT4 A;  3ARQ A;  3B7X A;  1W1V A;  2PPO A;  2RQS A;  4R5E A;  4MPK A;  1FKG A;  1LL4 A;  3TCZ A;  4TNS A;  2XP6 A;  4JYS A;  3O5E A;  3EY6 A;  3CGN A;  3UI4 A;  3GTY X; 
#chains in the Genus database with same CATH homology
 4JFM A;  2XP3 A;  2XP4 A;  2LJ4 A;  3ARX A;  3UQB A;  1GOI A;  2DG9 A;  2DPE A;  1LJY A;  2MNT A;  3UF8 A;  2PV2 A;  2VCD A;  3WIJ A;  2K8I A;  2D9F A;  2ZQV A;  4DWS A;  4W9P A;  1FD9 A;  2PV1 A;  4LAW A;  3ARR A;  1ZU8 A;  1ZB5 A;  4DRH A;  5D75 A;  5HWC A;  4HBE A;  1WNO A;  1BKF A;  4GGQ A;  1FKR A;  1F8A B;  3ARZ A;  3B9A A;  3OOB A;  2LGO A;  4FAP A;  1W1Y A;  4Z2J A;  4WKA A;  1WAW A;  4Z2K A;  2DG3 A;  4DRM A;  3ODK A;  1EDQ A;  1Q1C A;  1ZBV A;  4JFJ A;  4URI A;  1W9V A;  1FJD A;  1Q6I A;  2IF4 A;  4TX0 A;  5DIT A;  2ESC A;  4ZPT R;  1FKI A;  3OA5 A;  2MLZ A;  5DIU A;  1E15 A;  1ZBK A;  3O5G A;  4IQC A;  1FKF A;  1FFQ A;  2PBC A;  3KZ7 A;  2ZR5 A;  4WIW A;  1UR8 A;  1EHN A;  4NZC A;  3G6M A;  1Q6U A;  4Q22 A;  1NH6 A;  2DT3 A;  2DSW A;  4TW8 A;  1HKK A;  2F2D A;  2OFN A;  4XAK A;  2XP5 A;  3CHD A;  4WK9 A;  1E9L A;  2G8Z A;  4P8X A;  1H0I A;  5HW6 A;  4TYO A;  2DT0 A;  2PI6 A;  3WL0 A;  4ODQ A;  1Q6H A;  2KI3 A;  4ODR A;  4ODK A;  1XRV A;  1D7H A;  2ZR6 A;  1ZBC A;  1FKJ A;  4L72 B;  1VF8 A;  4HAR A;  4FN2 A;  2KFW A;  1C9H A;  3O5P A;  2VN1 A;  2AWG A;  4KR0 B;  4O2T A;  1Y0O A;  3UQI A;  3FY1 A;  2LKN A;  2B31 A;  4J4N A;  4MSP A;  5GPR A;  4ITZ A;  4IPX A;  2A3C A;  3FAP A;  5HUA A;  1UR9 A;  3RME A;  2AOS A;  2XP9 A;  3WD2 A;  2YBU A;  3ARV A;  3AS2 A;  4DRO A;  5HBF A;  3UI6 A;  4P8W A;  1FKD A;  3ARO A;  4ODP A;  1FKS A;  3CHE A;  4L3N A;  3RM4 A;  4MNL A;  1JNS A;  4LAY A;  1W9U A;  3PA7 A;  3JYM A;  3ARU A;  5DF0 A;  3AS1 A;  4Z2G A;  1NWU A;  3PRA A;  4S3K A;  4G2P A;  4DRN A;  4R0X A;  1FFR A;  2MLY A;  3O5L A;  3RM9 A;  1ITX A;  4W9O A;  4C02 B;  1LQ0 A;  2F21 A;  3NI6 A;  2UZ5 A;  5JH8 A;  1GUV A;  1E6R A;  3O5O A;  1LG2 A;  2DSU A;  4W9Q A;  2L2S A;  3O5M A;  4PTM A;  3KCE A;  2ZR4 A;  4LAX A;  2PPP A;  5HT1 A;  1HXV A;  1IX5 A;  1JNT A;  5HKG A;  4ZPW R;  4Z2I A;  4QIB A;  2FDM A;  1OGB A;  4JFI A;  1EQ3 A;  1SYT A;  2Q5A A;  2Y78 A;  4DWS B;  1JVW A;  5I98 A;  2WM0 A;  4ML4 A;  4P8U A;  2DT2 A;  4IT6 A;  4ZPV R;  1FKH A;  3MDY B;  1HJV A;  4HBO A;  4KQZ A;  4BF8 A;  3UQA A;  2A3A A;  2O9O A;  3WL1 A;  3WD4 A;  4ODM A;  3VAW A;  3WH0 A;  4DRI A;  4W5U A;  1JNE A;  3CHC A;  3O5K A;  2PPN A;  3ARY A;  4IQ2 A;  1KT1 A;  1E6N A;  3JXV A;  3TDB A;  3CZ8 A;  2DSZ A;  4Q7N A;  2ZQT A;  4DZ3 A;  4ODO A;  4N19 A;  4LAV A;  1ROU A;  1D6O A;  3CHF A;  1X6L A;  3ALG A;  4MTV A;  1LL7 A;  3AQU A;  3KAC A;  1LL6 A;  2RUD A;  1EYM A;  3B9D A;  4WJX A;  4U85 A;  1GPF A;  1HKJ A;  2XPA A;  1FKB A;  4DH0 A;  4MAV A;  1J6Y A;  1D2K A;  3ARW A;  2ZQS A;  4DWS D;  1FAP A;  5HWB A;  2ZQU A;  3IK8 A;  5GPG A;  1E6P A;  1FKK A;  1ZCN A;  1W9P A;  1NWS A;  4J4O A;  1A7X A;  3NTP A;  4Z2H A;  2FKE A;  4ODL A;  3O5D A;  3CGM A;  3B8S A;  1NMV A;  3IKD A;  1K9T A;  4MNM A;  4QZV B;  4DRJ A;  3AS3 A;  3I6C A;  1R9H A;  4DRQ A;  2WLZ A;  3RGC A;  1LG1 A;  3WQV A;  2OLH A;  3KAG A;  4ODN A;  4U86 A;  2KGJ A;  2FAP A;  1CTN A;  2DSV A;  3KAB A;  4IT4 A;  1B6C A;  1HJX A;  1T11 A;  1W26 A;  5B8I C;  5J6E A;  2RUC A;  4QT3 A;  3H9R B;  3PR9 A;  1X6N A;  3KAF A;  1JND A;  5BXJ A;  2RSE A;  2RUR A;  2O92 A;  2M08 A;  1HKI A;  3ART A;  3B9E A;  1HJW A;  2LPV A;  1KT0 A;  4DRK A;  1YAT A;  4DRP A;  1P5Q A;  1PIN A;  2WK2 A;  1W1P A;  1HKM A;  1KFW A;  3ARP A;  5GQB A;  2DG4 A;  1RD6 A;  3IHZ A;  4NNR A;  2XP8 A;  4WKF A;  3O5J A;  1N1A A;  4U84 A;  4WKH A;  4JFK A;  2KE0 A;  1OWQ A;  3WD1 A;  3O5F A;  5DEZ A;  1QZ2 A;  2F4E A;  3BXW A;  2MF9 A;  4MGV A;  2PV3 A;  3O5Q A;  1BL4 A;  1WB0 A;  1F40 A;  1ZK6 A;  1NSG A;  4GIV A;  3KAD A;  1U79 A;  3O5R A;  1QPL A;  1FKT A;  2DT1 A;  1ZBW A;  3AS0 A;  5DIV A;  4MNK A;  3LUO A;  1L1P A;  1M5Y A;  2WLY A;  1TFV A;  2ITK A;  4TW7 A;  5HW8 A;  2IUZ A;  4DIP A;  4Z2L A;  1J4R A;  3ALF A;  4G50 A;  4P8V A;  1OGG A;  2A3B A;  2A3E A;  1O6I A;  3KAH A;  3WD0 A;  4DZ2 A;  1E6Z A;  1J4H A;  2G41 A;  4QT2 A;  5HTG A;  3W4R A;  4AY1 A;  3KAI A;  2MPH A;  2KO7 A;  3GPK A;  1PBK A;  4LGX A;  4JFL A;  5DO2 A;  3G6L A;  1XHG A;  3ARS A;  3QOK A;  3UI5 A;  1FKL A;  2RUQ A;  1H0G A;  2MLX A;  4MNJ A;  2XPB A;  3FXY A;  4ZS6 A;  1TCO C;  3TC5 A;  3PRD A;  1ROT A;  2XP7 A;  4NSB A;  4S3J A;  3WD3 A;  1W1T A;  3PRB A;  2N87 A;  1NWT A;  2QF8 A;  1J4I A;  1D7J A;  1EIB A;  1SR0 A;  1NWR A;  4TW6 A;  3WQW A;  1QPF A;  2YBT A;  3IKG A;  1YW5 A;  1D7I A;  2JZV A;  3RFW A;  4DWS C;  3WKZ A;  1NMW A;  2M1I A;  1ZL1 A;  2KR7 A;  5HW7 A;  3NRK A;  3JYJ A;  3O5I A;  2M2A A;  3CH9 A;  3RM8 A;  4DT4 A;  3ARQ A;  3B7X A;  1W1V A;  2PPO A;  2RQS A;  4R5E A;  4MPK A;  1FKG A;  1LL4 A;  3TCZ A;  4TNS A;  2XP6 A;  4JYS A;  3O5E A;  3EY6 A;  3CGN A;  3UI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...