3KACA

Structure-guided design of alpha-amino acid-derived pin1 inhibitors
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
113
structure length
113
Chain Sequence
b'EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-guided design of alpha-amino acid-derived Pin1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 39
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kacA00
2DG9A 4QIBA 4QT2A 3CGMA 2RURA 4DRMA 2KI3A 2LJ4A 2LGOA 1BL4A 1FKLA 1JNTA 2OFNA 3KCEA 4ODMA 5HW7A 3TDBA 2KGJA 2UZ5A 3O5PA 4LAVA 3RFWA 3UI4A 4DZ3A 3EY6A 2F21A 2LPVA 3I6CA 1N1AA 4TX0A 2DG3A 5DIVA 2M2AA 4U86A 2XPAA 3UQBA 1A7XA 1Q6IA 1EQ3A 1ZCNA 4MSPA 4FAPA 2JZVA 2ZQUA 1FAPA 2FKEA 1C9HA 3KAIA 2FAPA 4J4OA 3O5DA 2MLZA 3O5KA 4JFIA 4ODPA 3UI5A 3UF8A 5GPGA 1J6YA 5DITA 2PPNA 2PBCA 3KAGA 3O5LA 5HT1A 5HUAA 3O5OA 4ODLA 2MNTA 2KO7A 3GPKA 2KFWA 3NRKA 4JFJA 2DG4A 2D9FA 1J4IA 4IPXA 2XP3A 4ITZA 1F8AB 1FKGA 1NMWA 3PA7A 4FN2A 2PV1A 4G50A 4TW6A 4DT4A 1FJDA 2MLXA 3JXVA 1FKDA 2F4EA 3KAFA 2XP8A 1Q1CA 1B6CA 4ODOA 1YW5A 1QPFA 1T11A 2M08A 4ODKA 2XP4A 1Q6UA 2ZR4A 2PV2A 3UI6A 4ODNA 3ODKA 5HW6A 1KT0A 1U79A 5DIUA 4DRQA 5HWBA 3KZ7A 1PBKA 4W9PA 3O5JA 4DRKA 2KE0A 2RUQA 2XP7A 1W26A 2K8IA 3CGNA 4QT3A 3PRDA 4TNSA 4W9OA 4TW8A 3RGCA 1FKTA 2MLYA 3JYJA 5HTGA 4JFLA 3TC5A 4N19A 1J4HA 2PV3A 1QPLA 4C02B 1JVWA 4IQCA 1D6OA 3O5FA 2N87A 2VN1A 3LUOA 5J6EA 3FAPA 3WH0A 1FKJA 1FKIA 1ROTA 3JYMA 1JNSA 1J4RA 4JYSA 1FKKA 4TYOA 4G2PA 4JFMA 3H9RB 2ZR6A 3NTPA 2MPHA 2RQSA 3PRBA 1R9HA 4W9QA 3IKDA 3IKGA 5I98A 4DZ2A 4U84A 2PPOA 3OOBA 2M1IA 3IHZA 3KAHA 2RSEA 5HWCA 2KR7A 4TW7A 4J4NA 1QZ2A 1FKHA 3B7XA 3O5GA 1BKFA 4DRJA 4DRNA 2VCDA 3O5QA 1P5QA 5HW8A 1YATA 3MDYB 1EYMA 4MGVA 1TCOC 2ZQTA 1NSGA 2LKNA 2RUCA 2XP5A 3KACA 4DROA 2XP9A 4DRIA 4R0XA 2PPPA 5B8IC 1FKBA 1KT1A 4BF8A 1FKRA 4GIVA 2ZR5A 1Y0OA 3O5EA 1PINA 1ROUA 2AWGA 1FKFA 4O2TA 4ODRA 3TCZA 2ITKA 3VAWA 5BXJA 1F40A 4IQ2A 5HKGA 1D7JA 4U85A 3O5IA 4NNRA 3NI6A 1ZK6A 5D75A 4DRPA 2L2SA 2RUDA 3KADA 2MF9A 2ZQVA 2ZQSA 2F2DA 3KABA 1FD9A 3O5RA 1NMVA 2XPBA 4GGQA 4LAWA 4DIPA 3UQIA 1D7HA 2IF4A 4LAXA 1FKSA 2Q5AA 1HXVA 4DH0A 3UQAA 1L1PA 1Q6HA 1M5YA 2Y78A 3O5MA 4JFKA 2XP6A 4LAYA 4DRHA 3IK8A 1D7IA 4ODQA
chains in the Genus database with same CATH superfamily
1W9UA 2LGOA 1FKLA 3KCEA 3GTYX 4ODMA 3TDBA 3O5PA 4LAVA 3UI4A 3WQVA 4KR0B 3RM8A 3I6CA 2DG3A 4U86A 1A7XA 3G6LA 4HBOA 4NZCA 4LGXA 1C9HA 3O5KA 5DITA 1W1PA 1CTNA 3ARPA 3CHDA 4ODLA 3W4RA 3NRKA 4AY1A 2DG4A 2DT3A 1J4IA 4MNLA 4ITZA 1FKGA 1NMWA 1WB0A 3PA7A 2MLXA 3JXVA 3RM4A 4MTVA 2XP8A 4ODOA 1KFWA 1T11A 4ODKA 1Q6UA 2IUZA 1EHNA 3ARUA 4Z2LA 3OA5A 4S3KA 1ZL1A 4QT3A 4W9OA 1E15A 1FFRA 2QF8A 2WLYA 3JYJA 4JFLA 1LL4A 2DSUA 4QZVB 1JVWA 4IQCA 1GRJA 3BXWA 3FAPA 1FKJA 4NSBA 4G2PA 2MPHA 1R9HA 4W9QA 3IKGA 4DZ2A 2PPOA 3PR9A 2M1IA 2RSEA 4TW7A 1E9LA 1BKFA 4DRNA 4HBEA 1P5QA 2PI6A 5HW8A 1EYMA 4MGVA 1NSGA 2XP5A 3ARZA 3KACA 3AS2A 3B9DA 4GIVA 2WLZA 4ODRA 4O2TA 4ML4A 2PN0A 1F40A 4P8UA 4IQ2A 5HKGA 1D7JA 1IX5A 4NNRA 3NI6A 3ALFA 1E44A 1ZBVA 3O5RA 2P4VA 1D7HA 2IF4A 4LAYA 2WK2A 1D7IA 1HKKA 4ODQA 4WK9A 4QT2A 4QIBA 4DRMA 2RURA 2LJ4A 1JNTA 2OFNA 3ARYA 3RFWA 2F21A 1N1AA 2M2AA 2XPAA 3UQBA 1W9VA 4FAPA 2FKEA 3UI5A 2YBUA 2DSZA 2PPNA 3KAGA 3O5LA 1JNEA 2MNTA 4W5UA 2KO7A 3GPKA 2KFWA 4Z2HA 4JFJA 2D9FA 1LL6A 1F8AB 3AS3A 1EIBA 4FN2A 1OGBA 1Q1CA 1YW5A 2AOSA 4S3JA 1QPFA 1OWQA 2PV2A 1NWUA 3UI6A 4PTMA 3EIPA 4DWSD 1KT0A 1U79A 4DRQA 2DPEA 3O5JA 4W9PA 4TNSA 3CGNA 4HARA 4TW8A 4N19A 2PV3A 3O5FA 2N87A 3LUOA 3WH0A 1JNSA 3JYMA 1J4RA 2RQSA 1H0IA 2DT2A 3WIJA 4U84A 3IHZA 3KAHA 4J4NA 1QZ2A 3B7XA 4DWSC 4DWSB 4P8WA 2RUCA 3WQWA 4DROA 4DRIA 4R0XA 2FDMA 3AQUA 1FKBA 4BF8A 4MNMA 1RD6A 1FKRA 2ZR5A 1Y0OA 4R5EA 1ROUA 1FKFA 1NWTA 3TCZA 1WAWA 3VAWA 1GOIA 4Z2JA 3O5IA 4DRPA 2L2SA 3KABA 4GGQA 4URIA 1FD9A 4LAXA 2Q5AA 1W1YA 1H0GA 4DH0A 1L1PA 1Q6HA 1ITXA 1M5YA 3O5MA 4L72B 2DSVA 2O9OA 1WNOA 4P8VA 2DG9A 3CGMA 1BL4A 5DF0A 1HKJA 1HJXA 5HW7A 1HJWA 2UZ5A 4Q7NA 3EY6A 5DEZA 4Q22A 4TX0A 1E6PA 5DIVA 4MNKA 1Q6IA 4WKAA 4MSPA 2JZVA 4ODPA 2FAPA 4J4OA 3O5DA 2MLZA 2ESCA 3UF8A 1J6YA 2PBCA 5HT1A 2YBTA 4XAKA 1JNDA 1TFVA 3WL0A 2B5UB 1E6NA 1XRVA 4DT4A 1FJDA 1FKDA 2F4EA 3KAFA 4IT6A 1B6CA 3ARWA 3WKZA 4ZPWR 2M08A 2XP4A 2ZR4A 3ODKA 1W1TA 5HWBA 4Z2IA 3ARQA 1PBKA 4DRKA 2KE0A 2RUQA 2XP7A 1W26A 3PRDA 5HTGA 3RGCA 1LQ0A 2MLYA 1D6OA 5J6EA 3GU0A 4KQZA 4JYSA 1FKKA 3H9RB 3IKDA 1JCHB 1NWRA 3OOBA 3CHFA 2KR7A 1FKHA 2VCDA 3O5QA 3MDYB 3RM9A 3WD3A 1TCOC 5JH8A 2EULA 1X6NA 2XP9A 2O92A 2PPPA 1UR9A 1XHGA 1FFQA 1KT1A 3O5EA 3CHEA 4P8XA 2ITKA 3CZ8A 1SR0A 2DSWA 1ZBWA 3WD4A 3ARTA 5D75A 2A3EA 2B31A 5GQBA 1LG2A 2MF9A 5GPGA 4LAWA 1W1VA 1NMVA 2XPBA 4DIPA 4IT4A 1VF8A 4WIWA 1FKSA 3PRAA 4DWSA 2F23A 4ZS6A 3ARVA 3IK8A 4Z2GA 2KI3A 2OLHA 2KGJA 4DZ3A 3CHCA 3G6MA 4WKHA 2LPVA 4ZPVR 4WKFA 2A3AA 1O6IA 1EQ3A 1ZCNA 3WL1A 2ZQUA 1FAPA 3KAIA 5B8IC 1GPFA 4JFIA 5HUAA 2A3BA 1E6ZA 3O5OA 3ARRA 2DT0A 3BMBA 4MPKA 4WJXA 4MAVA 2ETNA 4IPXA 2XP3A 1LL7A 4G50A 2PV1A 1X6LA 2WM0A 3FXYA 4TW6A 1NWSA 1GUVA 1UR8A 2DT1A 4ODNA 5HW6A 3WD2A 3WD0A 1ZB5A 5DIUA 1SYTA 5HBFA 3KZ7A 1E6RA 2K8IA 1FKTA 4UDMA 3TC5A 1J4HA 4C02B 1QPLA 1ZBCA 2G8ZA 3FY1A 2VN1A 1D2KA 4MNJA 1FKIA 1ROTA 3QOKA 4TYOA 1HKIA 4JFMA 3NTPA 2ZR6A 1HKMA 1K9TA 3PRBA 3ALGA 3B8SA 5I98A 1LG1A 1EDQA 5GPRA 3AS1A 5HWCA 1ZBKA 3RMEA 3O5GA 3B9AA 4DRJA 1HJVA 1YATA 1W9PA 3AROA 2ZQTA 2LKNA 1ZU8A 4L3NA 3B9EA 1PINA 2AWGA 5DO2A 4Z2KA 5BXJA 1NH6A 3CH9A 1LJYA 1OGGA 4U85A 3ARXA 1ZK6A 3KADA 2RUDA 2ZQVA 2ZQSA 2F2DA 3UQIA 3WD1A 4ZPTR 1HXVA 3AS0A 3UQAA 3ARSA 4JFKA 2Y78A 2G41A 2A3CA 2XP6A 4DRHA
chains in the Genus database with same CATH topology
1W9UA 2LGOA 1FKLA 3KCEA 4ODMA 3TDBA 3O5PA 4LAVA 3UI4A 3WQVA 4KR0B 3RM8A 3I6CA 2DG3A 4U86A 1A7XA 3G6LA 4HBOA 4NZCA 4LGXA 1C9HA 3O5KA 5DITA 1W1PA 1CTNA 3ARPA 3CHDA 4ODLA 3W4RA 3NRKA 4AY1A 2DG4A 2DT3A 1J4IA 4MNLA 4ITZA 1FKGA 1NMWA 1WB0A 3PA7A 2MLXA 3JXVA 3RM4A 4MTVA 2XP8A 4ODOA 1KFWA 1T11A 4ODKA 1Q6UA 2IUZA 1EHNA 3ARUA 4Z2LA 3OA5A 4S3KA 1ZL1A 4QT3A 4W9OA 1E15A 1FFRA 2QF8A 2WLYA 3JYJA 4JFLA 1LL4A 2DSUA 4QZVB 1JVWA 4IQCA 3BXWA 3FAPA 1FKJA 4NSBA 4G2PA 2MPHA 1R9HA 4W9QA 3IKGA 4DZ2A 2PPOA 3PR9A 2M1IA 2RSEA 4TW7A 1E9LA 1BKFA 4DRNA 4HBEA 1P5QA 2PI6A 5HW8A 1EYMA 4MGVA 1NSGA 2XP5A 3ARZA 3KACA 3AS2A 3B9DA 4GIVA 2WLZA 4ODRA 4O2TA 4ML4A 1F40A 4P8UA 4IQ2A 5HKGA 1D7JA 1IX5A 4NNRA 3NI6A 3ALFA 1ZBVA 3O5RA 1D7HA 2IF4A 4LAYA 2WK2A 1D7IA 1HKKA 4ODQA 4WK9A 4QT2A 4QIBA 4DRMA 2RURA 2LJ4A 1JNTA 2OFNA 3ARYA 3RFWA 2F21A 1N1AA 2M2AA 2XPAA 3UQBA 1W9VA 4FAPA 2FKEA 3UI5A 2YBUA 2DSZA 2PPNA 3KAGA 3O5LA 1JNEA 2MNTA 4W5UA 2KO7A 3GPKA 2KFWA 4Z2HA 4JFJA 2D9FA 1LL6A 1F8AB 3AS3A 1EIBA 4FN2A 1OGBA 1Q1CA 1YW5A 2AOSA 4S3JA 1QPFA 1OWQA 2PV2A 1NWUA 3UI6A 4PTMA 4DWSD 1KT0A 1U79A 4DRQA 2DPEA 3O5JA 4W9PA 4TNSA 3CGNA 4HARA 4TW8A 4N19A 2PV3A 3O5FA 2N87A 3LUOA 3WH0A 1JNSA 3JYMA 1J4RA 2RQSA 1H0IA 2DT2A 3WIJA 4U84A 3IHZA 3KAHA 4J4NA 1QZ2A 3B7XA 4DWSC 4DWSB 4P8WA 2RUCA 3WQWA 4DROA 4DRIA 4R0XA 2FDMA 3AQUA 1FKBA 4BF8A 4MNMA 1RD6A 1FKRA 2ZR5A 1Y0OA 4R5EA 1ROUA 1FKFA 1NWTA 3TCZA 1WAWA 3VAWA 1GOIA 4Z2JA 3O5IA 4DRPA 2L2SA 3KABA 4GGQA 4URIA 1FD9A 4LAXA 2Q5AA 1W1YA 1H0GA 4DH0A 1L1PA 1Q6HA 1ITXA 1M5YA 3O5MA 4L72B 2DSVA 2O9OA 1WNOA 4P8VA 2DG9A 3CGMA 1BL4A 5DF0A 1HKJA 1HJXA 5HW7A 1HJWA 2UZ5A 4Q7NA 3EY6A 5DEZA 4Q22A 4TX0A 1E6PA 5DIVA 4MNKA 1Q6IA 4WKAA 4MSPA 2JZVA 4ODPA 2FAPA 4J4OA 3O5DA 2MLZA 2ESCA 3UF8A 1J6YA 2PBCA 5HT1A 2YBTA 4XAKA 1JNDA 1TFVA 3WL0A 1E6NA 1XRVA 4DT4A 1FJDA 1FKDA 2F4EA 3KAFA 4IT6A 1B6CA 3ARWA 3WKZA 4ZPWR 2M08A 2XP4A 2ZR4A 3ODKA 1W1TA 5HWBA 4Z2IA 3ARQA 1PBKA 4DRKA 2KE0A 2RUQA 2XP7A 1W26A 3PRDA 5HTGA 3RGCA 1LQ0A 2MLYA 1D6OA 5J6EA 4KQZA 4JYSA 1FKKA 3H9RB 3IKDA 1NWRA 3OOBA 3CHFA 2KR7A 1FKHA 2VCDA 3O5QA 3MDYB 3RM9A 3WD3A 1TCOC 5JH8A 1X6NA 2XP9A 2O92A 2PPPA 1UR9A 1XHGA 1FFQA 1KT1A 3O5EA 3CHEA 4P8XA 2ITKA 3CZ8A 1SR0A 2DSWA 1ZBWA 3WD4A 3ARTA 5D75A 2A3EA 2B31A 5GQBA 1LG2A 2MF9A 5GPGA 4LAWA 1W1VA 1NMVA 2XPBA 4DIPA 4IT4A 1VF8A 4WIWA 1FKSA 3PRAA 4DWSA 4ZS6A 3ARVA 3IK8A 4Z2GA 2KI3A 2OLHA 2KGJA 4DZ3A 3CHCA 3G6MA 4WKHA 2LPVA 4ZPVR 4WKFA 2A3AA 1O6IA 1EQ3A 1ZCNA 3WL1A 2ZQUA 1FAPA 3KAIA 5B8IC 1GPFA 4JFIA 5HUAA 2A3BA 1E6ZA 3O5OA 3ARRA 2DT0A 4MPKA 4WJXA 4MAVA 4IPXA 2XP3A 1LL7A 4G50A 2PV1A 1X6LA 2WM0A 3FXYA 4TW6A 1NWSA 1GUVA 1UR8A 2DT1A 4ODNA 5HW6A 3WD2A 3WD0A 1ZB5A 5DIUA 1SYTA 5HBFA 3KZ7A 1E6RA 2K8IA 1FKTA 3TC5A 1J4HA 4C02B 1QPLA 1ZBCA 2G8ZA 3FY1A 2VN1A 1D2KA 4MNJA 1FKIA 1ROTA 3QOKA 4TYOA 1HKIA 4JFMA 3NTPA 2ZR6A 1HKMA 1K9TA 3PRBA 3ALGA 3B8SA 5I98A 1LG1A 1EDQA 5GPRA 3AS1A 5HWCA 1ZBKA 3RMEA 3O5GA 3B9AA 4DRJA 1HJVA 1YATA 1W9PA 3AROA 2ZQTA 2LKNA 1ZU8A 4L3NA 3B9EA 1PINA 2AWGA 5DO2A 4Z2KA 5BXJA 1NH6A 3CH9A 1LJYA 1OGGA 4U85A 3ARXA 1ZK6A 3KADA 2RUDA 2ZQVA 2ZQSA 2F2DA 3UQIA 3WD1A 4ZPTR 1HXVA 3AS0A 3UQAA 3ARSA 4JFKA 2Y78A 2G41A 2A3CA 2XP6A 4DRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DG9 A;  4QIB A;  4QT2 A;  3CGM A;  2RUR A;  4DRM A;  2KI3 A;  2LJ4 A;  2LGO A;  1BL4 A;  1FKL A;  1JNT A;  2OFN A;  3KCE A;  4ODM A;  5HW7 A;  3TDB A;  2KGJ A;  2UZ5 A;  3O5P A;  4LAV A;  3RFW A;  3UI4 A;  4DZ3 A;  3EY6 A;  2F21 A;  2LPV A;  3I6C A;  1N1A A;  4TX0 A;  2DG3 A;  5DIV A;  2M2A A;  4U86 A;  2XPA A;  3UQB A;  1A7X A;  1Q6I A;  1EQ3 A;  1ZCN A;  4MSP A;  4FAP A;  2JZV A;  2ZQU A;  1FAP A;  2FKE A;  1C9H A;  3KAI A;  2FAP A;  4J4O A;  3O5D A;  2MLZ A;  3O5K A;  4JFI A;  4ODP A;  3UI5 A;  3UF8 A;  5GPG A;  1J6Y A;  5DIT A;  2PPN A;  2PBC A;  3KAG A;  3O5L A;  5HT1 A;  5HUA A;  3O5O A;  4ODL A;  2MNT A;  2KO7 A;  3GPK A;  2KFW A;  3NRK A;  4JFJ A;  2DG4 A;  2D9F A;  1J4I A;  4IPX A;  2XP3 A;  4ITZ A;  1F8A B;  1FKG A;  1NMW A;  3PA7 A;  4FN2 A;  2PV1 A;  4G50 A;  4TW6 A;  4DT4 A;  1FJD A;  2MLX A;  3JXV A;  1FKD A;  2F4E A;  3KAF A;  2XP8 A;  1Q1C A;  1B6C A;  4ODO A;  1YW5 A;  1QPF A;  1T11 A;  2M08 A;  4ODK A;  2XP4 A;  1Q6U A;  2ZR4 A;  2PV2 A;  3UI6 A;  4ODN A;  3ODK A;  5HW6 A;  1KT0 A;  1U79 A;  5DIU A;  4DRQ A;  5HWB A;  3KZ7 A;  1PBK A;  4W9P A;  3O5J A;  4DRK A;  2KE0 A;  2RUQ A;  2XP7 A;  1W26 A;  2K8I A;  3CGN A;  4QT3 A;  3PRD A;  4TNS A;  4W9O A;  4TW8 A;  3RGC A;  1FKT A;  2MLY A;  3JYJ A;  5HTG A;  4JFL A;  3TC5 A;  4N19 A;  1J4H A;  2PV3 A;  1QPL A;  4C02 B;  1JVW A;  4IQC A;  1D6O A;  3O5F A;  2N87 A;  2VN1 A;  3LUO A;  5J6E A;  3FAP A;  3WH0 A;  1FKJ A;  1FKI A;  1ROT A;  3JYM A;  1JNS A;  1J4R A;  4JYS A;  1FKK A;  4TYO A;  4G2P A;  4JFM A;  3H9R B;  2ZR6 A;  3NTP A;  2MPH A;  2RQS A;  3PRB A;  1R9H A;  4W9Q A;  3IKD A;  3IKG A;  5I98 A;  4DZ2 A;  4U84 A;  2PPO A;  3OOB A;  2M1I A;  3IHZ A;  3KAH A;  2RSE A;  5HWC A;  2KR7 A;  4TW7 A;  4J4N A;  1QZ2 A;  1FKH A;  3B7X A;  3O5G A;  1BKF A;  4DRJ A;  4DRN A;  2VCD A;  3O5Q A;  1P5Q A;  5HW8 A;  1YAT A;  3MDY B;  1EYM A;  4MGV A;  1TCO C;  2ZQT A;  1NSG A;  2LKN A;  2RUC A;  2XP5 A;  3KAC A;  4DRO A;  2XP9 A;  4DRI A;  4R0X A;  2PPP A;  5B8I C;  1FKB A;  1KT1 A;  4BF8 A;  1FKR A;  4GIV A;  2ZR5 A;  1Y0O A;  3O5E A;  1PIN A;  1ROU A;  2AWG A;  1FKF A;  4O2T A;  4ODR A;  3TCZ A;  2ITK A;  3VAW A;  5BXJ A;  1F40 A;  4IQ2 A;  5HKG A;  1D7J A;  4U85 A;  3O5I A;  4NNR A;  3NI6 A;  1ZK6 A;  5D75 A;  4DRP A;  2L2S A;  2RUD A;  3KAD A;  2MF9 A;  2ZQV A;  2ZQS A;  2F2D A;  3KAB A;  1FD9 A;  3O5R A;  1NMV A;  2XPB A;  4GGQ A;  4LAW A;  4DIP A;  3UQI A;  1D7H A;  2IF4 A;  4LAX A;  1FKS A;  2Q5A A;  1HXV A;  4DH0 A;  3UQA A;  1L1P A;  1Q6H A;  1M5Y A;  2Y78 A;  3O5M A;  4JFK A;  2XP6 A;  4LAY A;  4DRH A;  3IK8 A;  1D7I A;  4ODQ A; 
#chains in the Genus database with same CATH topology
 1W9U A;  2LGO A;  1FKL A;  3KCE A;  3GTY X;  4ODM A;  3TDB A;  3O5P A;  4LAV A;  3UI4 A;  3WQV A;  4KR0 B;  3RM8 A;  3I6C A;  2DG3 A;  4U86 A;  1A7X A;  3G6L A;  4HBO A;  4NZC A;  4LGX A;  1C9H A;  3O5K A;  5DIT A;  1W1P A;  1CTN A;  3ARP A;  3CHD A;  4ODL A;  3W4R A;  3NRK A;  4AY1 A;  2DG4 A;  2DT3 A;  1J4I A;  4MNL A;  4ITZ A;  1FKG A;  1NMW A;  1WB0 A;  3PA7 A;  2MLX A;  3JXV A;  3RM4 A;  4MTV A;  2XP8 A;  4ODO A;  1KFW A;  1T11 A;  4ODK A;  1Q6U A;  2IUZ A;  1EHN A;  3ARU A;  4Z2L A;  3OA5 A;  4S3K A;  1ZL1 A;  4QT3 A;  4W9O A;  1E15 A;  1FFR A;  2QF8 A;  2WLY A;  3JYJ A;  4JFL A;  1LL4 A;  2DSU A;  4QZV B;  1JVW A;  4IQC A;  1GRJ A;  3BXW A;  3FAP A;  1FKJ A;  4NSB A;  4G2P A;  2MPH A;  1R9H A;  4W9Q A;  3IKG A;  4DZ2 A;  2PPO A;  3PR9 A;  2M1I A;  2RSE A;  4TW7 A;  1E9L A;  1BKF A;  4DRN A;  4HBE A;  1P5Q A;  2PI6 A;  5HW8 A;  1EYM A;  4MGV A;  1NSG A;  2XP5 A;  3ARZ A;  3KAC A;  3AS2 A;  3B9D A;  4GIV A;  2WLZ A;  4ODR A;  4O2T A;  4ML4 A;  2PN0 A;  1F40 A;  4P8U A;  4IQ2 A;  5HKG A;  1D7J A;  1IX5 A;  4NNR A;  3NI6 A;  3ALF A;  1E44 A;  1ZBV A;  3O5R A;  2P4V A;  1D7H A;  2IF4 A;  4LAY A;  2WK2 A;  1D7I A;  1HKK A;  4ODQ A;  4WK9 A;  4QT2 A;  4QIB A;  4DRM A;  2RUR A;  2LJ4 A;  1JNT A;  2OFN A;  3ARY A;  3RFW A;  2F21 A;  1N1A A;  2M2A A;  2XPA A;  3UQB A;  1W9V A;  4FAP A;  2FKE A;  3UI5 A;  2YBU A;  2DSZ A;  2PPN A;  3KAG A;  3O5L A;  1JNE A;  2MNT A;  4W5U A;  2KO7 A;  3GPK A;  2KFW A;  4Z2H A;  4JFJ A;  2D9F A;  1LL6 A;  1F8A B;  3AS3 A;  1EIB A;  4FN2 A;  1OGB A;  1Q1C A;  1YW5 A;  2AOS A;  4S3J A;  1QPF A;  1OWQ A;  2PV2 A;  1NWU A;  3UI6 A;  4PTM A;  3EIP A;  4DWS D;  1KT0 A;  1U79 A;  4DRQ A;  2DPE A;  3O5J A;  4W9P A;  4TNS A;  3CGN A;  4HAR A;  4TW8 A;  4N19 A;  2PV3 A;  3O5F A;  2N87 A;  3LUO A;  3WH0 A;  1JNS A;  3JYM A;  1J4R A;  2RQS A;  1H0I A;  2DT2 A;  3WIJ A;  4U84 A;  3IHZ A;  3KAH A;  4J4N A;  1QZ2 A;  3B7X A;  4DWS C;  4DWS B;  4P8W A;  2RUC A;  3WQW A;  4DRO A;  4DRI A;  4R0X A;  2FDM A;  3AQU A;  1FKB A;  4BF8 A;  4MNM A;  1RD6 A;  1FKR A;  2ZR5 A;  1Y0O A;  4R5E A;  1ROU A;  1FKF A;  1NWT A;  3TCZ A;  1WAW A;  3VAW A;  1GOI A;  4Z2J A;  3O5I A;  4DRP A;  2L2S A;  3KAB A;  4GGQ A;  4URI A;  1FD9 A;  4LAX A;  2Q5A A;  1W1Y A;  1H0G A;  4DH0 A;  1L1P A;  1Q6H A;  1ITX A;  1M5Y A;  3O5M A;  4L72 B;  2DSV A;  2O9O A;  1WNO A;  4P8V A;  2DG9 A;  3CGM A;  1BL4 A;  5DF0 A;  1HKJ A;  1HJX A;  5HW7 A;  1HJW A;  2UZ5 A;  4Q7N A;  3EY6 A;  5DEZ A;  4Q22 A;  4TX0 A;  1E6P A;  5DIV A;  4MNK A;  1Q6I A;  4WKA A;  4MSP A;  2JZV A;  4ODP A;  2FAP A;  4J4O A;  3O5D A;  2MLZ A;  2ESC A;  3UF8 A;  1J6Y A;  2PBC A;  5HT1 A;  2YBT A;  4XAK A;  1JND A;  1TFV A;  3WL0 A;  2B5U B;  1E6N A;  1XRV A;  4DT4 A;  1FJD A;  1FKD A;  2F4E A;  3KAF A;  4IT6 A;  1B6C A;  3ARW A;  3WKZ A;  4ZPW R;  2M08 A;  2XP4 A;  2ZR4 A;  3ODK A;  1W1T A;  5HWB A;  4Z2I A;  3ARQ A;  1PBK A;  4DRK A;  2KE0 A;  2RUQ A;  2XP7 A;  1W26 A;  3PRD A;  5HTG A;  3RGC A;  1LQ0 A;  2MLY A;  1D6O A;  5J6E A;  3GU0 A;  4KQZ A;  4JYS A;  1FKK A;  3H9R B;  3IKD A;  1JCH B;  1NWR A;  3OOB A;  3CHF A;  2KR7 A;  1FKH A;  2VCD A;  3O5Q A;  3MDY B;  3RM9 A;  3WD3 A;  1TCO C;  5JH8 A;  2EUL A;  1X6N A;  2XP9 A;  2O92 A;  2PPP A;  1UR9 A;  1XHG A;  1FFQ A;  1KT1 A;  3O5E A;  3CHE A;  4P8X A;  2ITK A;  3CZ8 A;  1SR0 A;  2DSW A;  1ZBW A;  3WD4 A;  3ART A;  5D75 A;  2A3E A;  2B31 A;  5GQB A;  1LG2 A;  2MF9 A;  5GPG A;  4LAW A;  1W1V A;  1NMV A;  2XPB A;  4DIP A;  4IT4 A;  1VF8 A;  4WIW A;  1FKS A;  3PRA A;  4DWS A;  2F23 A;  4ZS6 A;  3ARV A;  3IK8 A;  4Z2G A;  2KI3 A;  2OLH A;  2KGJ A;  4DZ3 A;  3CHC A;  3G6M A;  4WKH A;  2LPV A;  4ZPV R;  4WKF A;  2A3A A;  1O6I A;  1EQ3 A;  1ZCN A;  3WL1 A;  2ZQU A;  1FAP A;  3KAI A;  5B8I C;  1GPF A;  4JFI A;  5HUA A;  2A3B A;  1E6Z A;  3O5O A;  3ARR A;  2DT0 A;  3BMB A;  4MPK A;  4WJX A;  4MAV A;  2ETN A;  4IPX A;  2XP3 A;  1LL7 A;  4G50 A;  2PV1 A;  1X6L A;  2WM0 A;  3FXY A;  4TW6 A;  1NWS A;  1GUV A;  1UR8 A;  2DT1 A;  4ODN A;  5HW6 A;  3WD2 A;  3WD0 A;  1ZB5 A;  5DIU A;  1SYT A;  5HBF A;  3KZ7 A;  1E6R A;  2K8I A;  1FKT A;  4UDM A;  3TC5 A;  1J4H A;  4C02 B;  1QPL A;  1ZBC A;  2G8Z A;  3FY1 A;  2VN1 A;  1D2K A;  4MNJ A;  1FKI A;  1ROT A;  3QOK A;  4TYO A;  1HKI A;  4JFM A;  3NTP A;  2ZR6 A;  1HKM A;  1K9T A;  3PRB A;  3ALG A;  3B8S A;  5I98 A;  1LG1 A;  1EDQ A;  5GPR A;  3AS1 A;  5HWC A;  1ZBK A;  3RME A;  3O5G A;  3B9A A;  4DRJ A;  1HJV A;  1YAT A;  1W9P A;  3ARO A;  2ZQT A;  2LKN A;  1ZU8 A;  4L3N A;  3B9E A;  1PIN A;  2AWG A;  5DO2 A;  4Z2K A;  5BXJ A;  1NH6 A;  3CH9 A;  1LJY A;  1OGG A;  4U85 A;  3ARX A;  1ZK6 A;  3KAD A;  2RUD A;  2ZQV A;  2ZQS A;  2F2D A;  3UQI A;  3WD1 A;  4ZPT R;  1HXV A;  3AS0 A;  3UQA A;  3ARS A;  4JFK A;  2Y78 A;  2G41 A;  2A3C A;  2XP6 A;  4DRH A; 
#chains in the Genus database with same CATH homology
 1W9U A;  2LGO A;  1FKL A;  3KCE A;  4ODM A;  3TDB A;  3O5P A;  4LAV A;  3UI4 A;  3WQV A;  4KR0 B;  3RM8 A;  3I6C A;  2DG3 A;  4U86 A;  1A7X A;  3G6L A;  4HBO A;  4NZC A;  4LGX A;  1C9H A;  3O5K A;  5DIT A;  1W1P A;  1CTN A;  3ARP A;  3CHD A;  4ODL A;  3W4R A;  3NRK A;  4AY1 A;  2DG4 A;  2DT3 A;  1J4I A;  4MNL A;  4ITZ A;  1FKG A;  1NMW A;  1WB0 A;  3PA7 A;  2MLX A;  3JXV A;  3RM4 A;  4MTV A;  2XP8 A;  4ODO A;  1KFW A;  1T11 A;  4ODK A;  1Q6U A;  2IUZ A;  1EHN A;  3ARU A;  4Z2L A;  3OA5 A;  4S3K A;  1ZL1 A;  4QT3 A;  4W9O A;  1E15 A;  1FFR A;  2QF8 A;  2WLY A;  3JYJ A;  4JFL A;  1LL4 A;  2DSU A;  4QZV B;  1JVW A;  4IQC A;  3BXW A;  3FAP A;  1FKJ A;  4NSB A;  4G2P A;  2MPH A;  1R9H A;  4W9Q A;  3IKG A;  4DZ2 A;  2PPO A;  3PR9 A;  2M1I A;  2RSE A;  4TW7 A;  1E9L A;  1BKF A;  4DRN A;  4HBE A;  1P5Q A;  2PI6 A;  5HW8 A;  1EYM A;  4MGV A;  1NSG A;  2XP5 A;  3ARZ A;  3KAC A;  3AS2 A;  3B9D A;  4GIV A;  2WLZ A;  4ODR A;  4O2T A;  4ML4 A;  1F40 A;  4P8U A;  4IQ2 A;  5HKG A;  1D7J A;  1IX5 A;  4NNR A;  3NI6 A;  3ALF A;  1ZBV A;  3O5R A;  1D7H A;  2IF4 A;  4LAY A;  2WK2 A;  1D7I A;  1HKK A;  4ODQ A;  4WK9 A;  4QT2 A;  4QIB A;  4DRM A;  2RUR A;  2LJ4 A;  1JNT A;  2OFN A;  3ARY A;  3RFW A;  2F21 A;  1N1A A;  2M2A A;  2XPA A;  3UQB A;  1W9V A;  4FAP A;  2FKE A;  3UI5 A;  2YBU A;  2DSZ A;  2PPN A;  3KAG A;  3O5L A;  1JNE A;  2MNT A;  4W5U A;  2KO7 A;  3GPK A;  2KFW A;  4Z2H A;  4JFJ A;  2D9F A;  1LL6 A;  1F8A B;  3AS3 A;  1EIB A;  4FN2 A;  1OGB A;  1Q1C A;  1YW5 A;  2AOS A;  4S3J A;  1QPF A;  1OWQ A;  2PV2 A;  1NWU A;  3UI6 A;  4PTM A;  4DWS D;  1KT0 A;  1U79 A;  4DRQ A;  2DPE A;  3O5J A;  4W9P A;  4TNS A;  3CGN A;  4HAR A;  4TW8 A;  4N19 A;  2PV3 A;  3O5F A;  2N87 A;  3LUO A;  3WH0 A;  1JNS A;  3JYM A;  1J4R A;  2RQS A;  1H0I A;  2DT2 A;  3WIJ A;  4U84 A;  3IHZ A;  3KAH A;  4J4N A;  1QZ2 A;  3B7X A;  4DWS C;  4DWS B;  4P8W A;  2RUC A;  3WQW A;  4DRO A;  4DRI A;  4R0X A;  2FDM A;  3AQU A;  1FKB A;  4BF8 A;  4MNM A;  1RD6 A;  1FKR A;  2ZR5 A;  1Y0O A;  4R5E A;  1ROU A;  1FKF A;  1NWT A;  3TCZ A;  1WAW A;  3VAW A;  1GOI A;  4Z2J A;  3O5I A;  4DRP A;  2L2S A;  3KAB A;  4GGQ A;  4URI A;  1FD9 A;  4LAX A;  2Q5A A;  1W1Y A;  1H0G A;  4DH0 A;  1L1P A;  1Q6H A;  1ITX A;  1M5Y A;  3O5M A;  4L72 B;  2DSV A;  2O9O A;  1WNO A;  4P8V A;  2DG9 A;  3CGM A;  1BL4 A;  5DF0 A;  1HKJ A;  1HJX A;  5HW7 A;  1HJW A;  2UZ5 A;  4Q7N A;  3EY6 A;  5DEZ A;  4Q22 A;  4TX0 A;  1E6P A;  5DIV A;  4MNK A;  1Q6I A;  4WKA A;  4MSP A;  2JZV A;  4ODP A;  2FAP A;  4J4O A;  3O5D A;  2MLZ A;  2ESC A;  3UF8 A;  1J6Y A;  2PBC A;  5HT1 A;  2YBT A;  4XAK A;  1JND A;  1TFV A;  3WL0 A;  1E6N A;  1XRV A;  4DT4 A;  1FJD A;  1FKD A;  2F4E A;  3KAF A;  4IT6 A;  1B6C A;  3ARW A;  3WKZ A;  4ZPW R;  2M08 A;  2XP4 A;  2ZR4 A;  3ODK A;  1W1T A;  5HWB A;  4Z2I A;  3ARQ A;  1PBK A;  4DRK A;  2KE0 A;  2RUQ A;  2XP7 A;  1W26 A;  3PRD A;  5HTG A;  3RGC A;  1LQ0 A;  2MLY A;  1D6O A;  5J6E A;  4KQZ A;  4JYS A;  1FKK A;  3H9R B;  3IKD A;  1NWR A;  3OOB A;  3CHF A;  2KR7 A;  1FKH A;  2VCD A;  3O5Q A;  3MDY B;  3RM9 A;  3WD3 A;  1TCO C;  5JH8 A;  1X6N A;  2XP9 A;  2O92 A;  2PPP A;  1UR9 A;  1XHG A;  1FFQ A;  1KT1 A;  3O5E A;  3CHE A;  4P8X A;  2ITK A;  3CZ8 A;  1SR0 A;  2DSW A;  1ZBW A;  3WD4 A;  3ART A;  5D75 A;  2A3E A;  2B31 A;  5GQB A;  1LG2 A;  2MF9 A;  5GPG A;  4LAW A;  1W1V A;  1NMV A;  2XPB A;  4DIP A;  4IT4 A;  1VF8 A;  4WIW A;  1FKS A;  3PRA A;  4DWS A;  4ZS6 A;  3ARV A;  3IK8 A;  4Z2G A;  2KI3 A;  2OLH A;  2KGJ A;  4DZ3 A;  3CHC A;  3G6M A;  4WKH A;  2LPV A;  4ZPV R;  4WKF A;  2A3A A;  1O6I A;  1EQ3 A;  1ZCN A;  3WL1 A;  2ZQU A;  1FAP A;  3KAI A;  5B8I C;  1GPF A;  4JFI A;  5HUA A;  2A3B A;  1E6Z A;  3O5O A;  3ARR A;  2DT0 A;  4MPK A;  4WJX A;  4MAV A;  4IPX A;  2XP3 A;  1LL7 A;  4G50 A;  2PV1 A;  1X6L A;  2WM0 A;  3FXY A;  4TW6 A;  1NWS A;  1GUV A;  1UR8 A;  2DT1 A;  4ODN A;  5HW6 A;  3WD2 A;  3WD0 A;  1ZB5 A;  5DIU A;  1SYT A;  5HBF A;  3KZ7 A;  1E6R A;  2K8I A;  1FKT A;  3TC5 A;  1J4H A;  4C02 B;  1QPL A;  1ZBC A;  2G8Z A;  3FY1 A;  2VN1 A;  1D2K A;  4MNJ A;  1FKI A;  1ROT A;  3QOK A;  4TYO A;  1HKI A;  4JFM A;  3NTP A;  2ZR6 A;  1HKM A;  1K9T A;  3PRB A;  3ALG A;  3B8S A;  5I98 A;  1LG1 A;  1EDQ A;  5GPR A;  3AS1 A;  5HWC A;  1ZBK A;  3RME A;  3O5G A;  3B9A A;  4DRJ A;  1HJV A;  1YAT A;  1W9P A;  3ARO A;  2ZQT A;  2LKN A;  1ZU8 A;  4L3N A;  3B9E A;  1PIN A;  2AWG A;  5DO2 A;  4Z2K A;  5BXJ A;  1NH6 A;  3CH9 A;  1LJY A;  1OGG A;  4U85 A;  3ARX A;  1ZK6 A;  3KAD A;  2RUD A;  2ZQV A;  2ZQS A;  2F2D A;  3UQI A;  3WD1 A;  4ZPT R;  1HXV A;  3AS0 A;  3UQA A;  3ARS A;  4JFK A;  2Y78 A;  2G41 A;  2A3C A;  2XP6 A;  4DRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...