3KACA

Structure-guided design of alpha-amino acid-derived pin1 inhibitors
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
113
structure length
113
Chain Sequence
EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided design of alpha-amino acid-derived Pin1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 39
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kacA00
4DH0A 1FAPA 2PPPA 1QPLA 2OFNA 2ZR6A 4W9PA 1PBKA 1YATA 2LGOA 2M08A 2ZQTA 3KACA 4BF8A 1FJDA 3UI5A 3GPKA 4U86A 1ZCNA 1NMWA 2PV2A 3UQIA 3O5OA 4GIVA 2ZQSA 2ITKA 1C9HA 2RUCA 2M2AA 2VN1A 4LAYA 4ODQA 4ODOA 3TC5A 1T11A 2ZR5A 3IKGA 4JFKA 4JFIA 4NNRA 4ODLA 2DG4A 3UF8A 4J4NA 1FKHA 4IPXA 3O5EA 1FKIA 3I6CA 3NRKA 2VCDA 3O5JA 3O5KA 3RFWA 3O5QA 4DRKA 3KAHA 4G2PA 4DRNA 2LKNA 2PBCA 3PRBA 5HWCA 2MLYA 3H9RB 5HKGA 2XPAA 1EYMA 3TDBA 2PPNA 2Q5AA 2F2DA 3RGCA 1N1AA 1JVWA 2XPBA 1QPFA 1Q6HA 3WH0A 2L2SA 4DRHA 2XP8A 2KE0A 1FKFA 3JYMA 3TCZA 2LJ4A 2PV3A 2F4EA 4TNSA 3KAGA 4DRIA 3O5PA 1J6YA 2LPVA 4DIPA 4ITZA 5B8IC 3JXVA 4W9QA 1FKGA 2XP4A 1FKDA 2IF4A 4JFJA 2MLZA 3NTPA 1FKRA 3ODKA 1P5QA 1D7IA 1FKJA 2RUQA 2XP6A 1EQ3A 2DG9A 2FAPA 1TCOC 3NI6A 2AWGA 1FKKA 1J4HA 2M1IA 3MDYB 1F40A 1KT1A 2KR7A 1W26A 4ODPA 4DZ2A 5DITA 4FAPA 3JYJA 4DRMA 3IHZA 1ROUA 4IQCA 4JYSA 4MSPA 1NSGA 5HT1A 1FKBA 4U84A 1Q6IA 4DT4A 2KO7A 4JFMA 4ODNA 3B7XA 1L1PA 4ODRA 1J4RA 4MGVA 1ROTA 1FKSA 3CGNA 2RUDA 3UQBA 2ZR4A 3O5GA 3UQAA 4W9OA 3CGMA 3KABA 3O5IA 1R9HA 3KCEA 1ZK6A 4LAXA 4DROA 5I98A 1JNTA 4TW6A 2MF9A 1KT0A 1HXVA 4GGQA 5HW6A 1U79A 4QT3A 2FKEA 2XP9A 4G50A 1BL4A 4J4OA 4ODMA 4TYOA 1QZ2A 2K8IA 2XP3A 3O5LA 2D9FA 4N19A 3IK8A 4ODKA 4U85A 4LAWA 5HUAA 1D6OA 1D7HA 1FKLA 3OOBA 5BXJA 3KZ7A 1J4IA 3PA7A 4DRPA 1YW5A 3KAFA 1M5YA 2PV1A 4TX0A 2MLXA 3UI4A 2MPHA 5DIVA 2Y78A 5HW8A 4TW8A 3O5DA 2N87A 4QT2A 5HW7A 3FAPA 4FN2A 4C02B 3O5MA 1JNSA 5DIUA 2RQSA 1FD9A 2RSEA 3KAIA 3UI6A 2UZ5A 4IQ2A 3VAWA 1NMVA 4QIBA 2RURA 3EY6A 5GPGA 4DZ3A 2DG3A 3IKDA 5HWBA 1FKTA 5J6EA 4DRJA 2JZVA 2XP5A 2KGJA 3PRDA 4LAVA 2PPOA 2KI3A 2ZQVA 1Q6UA 4O2TA 1D7JA 5HTGA 4DRQA 2XP7A 2KFWA 1BKFA 3O5FA 1B6CA 3KADA 4R0XA 4TW7A 5D75A 1F8AB 2MNTA 3O5RA 1Y0OA 1A7XA 2ZQUA 3LUOA 4JFLA 1Q1CA 2F21A 1PINA
chains in the Genus database with same CATH superfamily
3UQAA 1QPLA 4W9PA 4Z2IA 1XHGA 2LGOA 1LG2A 3UI5A 4P8VA 3UQIA 3O5OA 2DT1A 1LG1A 2VN1A 3AS1A 4LAYA 1W9PA 3B9AA 1T11A 4JFIA 4ODLA 2DG4A 4XAKA 1GUVA 3O5EA 1ZBKA 1OGBA 3W4RA 2MLYA 3H9RB 3BXWA 1EYMA 2Q5AA 2F2DA 3RGCA 1JVWA 2OLHA 1QPFA 1F40A 2XP8A 3JYMA 1FKFA 1X6NA 3KAGA 4UDMA 3ARTA 4DWSB 2F23A 2XP4A 2YBTA 3NTPA 1HKJA 3RM9A 3WQVA 1FKRA 3ODKA 1FKJA 3WD3A 4L72B 1RD6A 2AWGA 1W26A 5DF0A 4JYSA 1Q6IA 1TFVA 3FY1A 4ODRA 1W1YA 1HJXA 4KR0B 1NWSA 3WD4A 1W1VA 4LAXA 2WLYA 2MF9A 2DSUA 5HW6A 1U79A 1XRVA 2FKEA 4J4OA 4ODMA 1QZ2A 3O5LA 2XP3A 1ZL1A 4S3JA 2ETNA 1D7HA 4WK9A 1JNDA 1YW5A 3UI4A 4IT6A 3O5DA 2A3BA 2N87A 3O5MA 5DIUA 3WKZA 1EDQA 3CHEA 3EY6A 4DZ3A 4DRJA 2XP5A 3G6MA 4LAVA 1UR8A 2PPOA 3ARPA 3PR9A 4ML4A 2KFWA 1BKFA 1B6CA 4R0XA 1F8AB 2MNTA 3O5RA 3AQUA 2PI6A 2DT3A 4JFLA 2OFNA 2ZQTA 3GPKA 2PV2A 1NMWA 4GIVA 2ZQSA 2ITKA 1C9HA 1GRJA 1W1TA 4JFKA 4NNRA 4J4NA 4IPXA 1SR0A 3RFWA 3ALGA 3O5KA 3O5QA 3KAHA 3ARVA 3PRBA 1UR9A 4ZS6A 5HKGA 3TDBA 2PPNA 4LGXA 3B9EA 3WD0A 3WH0A 3RM4A 4DRIA 2LJ4A 2DT0A 4Q7NA 4WKHA 2DT2A 4DIPA 4ITZA 4MNKA 5B8IC 4WJXA 3ALFA 4P8XA 1W1PA 2MLZA 1D2KA 1P5QA 1LL6A 3ARUA 1HJWA 1EQ3A 2A3AA 2QF8A 1J4HA 3MDYB 3G6LA 1FFQA 3JYJA 4DRMA 4ZPVR 1ROUA 4MSPA 2KO7A 4MGVA 1ROTA 2RUDA 1HKKA 2ZR4A 4W9OA 3CGMA 1X6LA 3WIJA 2O9OA 4Z2HA 1ZK6A 1JNTA 1SYTA 4Q22A 3ARSA 4QT3A 3ARQA 4G50A 1BL4A 4TYOA 4Z2KA 2D9FA 4LAWA 1E6ZA 5HUAA 5BXJA 3CZ8A 3PA7A 3KAFA 1M5YA 4ZPWR 2MPHA 2Y78A 1LJYA 2IUZA 1E6NA 5HW7A 3CHCA 4MTVA 1E9LA 3VAWA 3AS3A 3ARZA 1FFRA 2DG3A 4P8WA 5HWBA 2B5UB 5J6EA 2A3EA 2WK2A 1ITXA 3B9DA 3PRDA 2KI3A 2ZQVA 1ZBCA 1D7JA 4HARA 2XP7A 4TW7A 3O5FA 3KADA 1H0GA 4MNJA 2DSVA 4KQZA 1Q1CA 2F21A 1FD9A 1PINA 5HWCA 4DH0A 2ZR6A 1L1PA 4BF8A 1YATA 1FJDA 1LL7A 4U86A 1HKIA 3ARWA 2PN0A 2RUCA 4Z2JA 3TC5A 1HKMA 1KFWA 4ZPTR 3WL1A 3PRAA 1FKHA 1FKIA 1W9UA 1IX5A 3GTYX 3CHFA 2XPAA 2G8ZA 3ARXA 4DRHA 2L2SA 4PTMA 3TCZA 2PV3A 4TNSA 3O5PA 3WD2A 4Z2GA 3JXVA 4W9QA 1FKGA 1FKDA 4JFJA 3WQWA 1NH6A 3CH9A 2RUQA 1HJVA 4P8UA 4WKAA 4Z2LA 1TCOC 3NI6A 2M1IA 2KR7A 4ODPA 4DZ2A 4DWSD 5HT1A 1FKBA 4U84A 4JFMA 3B7XA 4MPKA 1J4RA 1EIBA 3ARRA 1ZBVA 3O5IA 4W5UA 3KCEA 1KT0A 1HXVA 2WLZA 2G41A 2XP9A 3RM8A 1NWUA 4QZVB 4URIA 2P4VA 1D6OA 1GOIA 2B31A 3KZ7A 4HBOA 2AOSA 2YBUA 2PV1A 3B8SA 5DIVA 5HW8A 1EHNA 1WNOA 3AS0A 3FAPA 4FN2A 1W9VA 1JNSA 3KAIA 1CTNA 2UZ5A 4IQ2A 4MNLA 4QIBA 3AROA 5GPGA 3IKDA 5DEZA 5HBFA 4IT4A 3CHDA 4NZCA 4O2TA 5HTGA 4DRQA 1OGGA 3WL0A 5D75A 5JH8A 1Y0OA 1VF8A 3LUOA 3BMBA 1ZB5A 1FAPA 1E15A 2PPPA 1PBKA 3KACA 2M08A 3FXYA 1ZCNA 4ODOA 1JCHB 2M2AA 4ODQA 2ZR5A 3IKGA 2A3CA 3UF8A 4NSBA 3I6CA 3NRKA 2VCDA 3GU0A 3O5JA 4DRKA 4G2PA 2FDMA 2LKNA 4HBEA 4DRNA 2PBCA 1OWQA 1N1AA 1JNEA 2XPBA 1Q6HA 4WKFA 2KE0A 4R5EA 1O6IA 2F4EA 1J6YA 4S3KA 1NWRA 2LPVA 4DWSC 2IF4A 3OA5A 1H0IA 1D7IA 2XP6A 2DG9A 2FAPA 1FKKA 3QOKA 1KT1A 4FAPA 5DITA 3WD1A 1E6PA 3IHZA 4IQCA 1NSGA 4DT4A 1WB0A 2DSWA 2DSZA 4ODNA 1FKSA 3CGNA 3UQBA 5GQBA 3O5GA 4MAVA 3KABA 2DPEA 1R9HA 4DROA 5I98A 4TW6A 3AS2A 4GGQA 1E44A 4L3NA 4DWSA 3ARYA 2K8IA 4N19A 4U85A 3IK8A 4ODKA 1FKLA 3EIPA 3OOBA 4DRPA 1J4IA 3RMEA 4TX0A 1ZU8A 2WM0A 2MLXA 1ZBWA 4TW8A 2ESCA 1LQ0A 1K9TA 4C02B 2RQSA 2RSEA 1E6RA 3UI6A 2EULA 1NMVA 1WAWA 2RURA 5GPRA 5DO2A 4AY1A 1FKTA 2JZVA 1GPFA 2O92A 2KGJA 1Q6UA 4WIWA 4MNMA 1NWTA 1A7XA 2ZQUA 1LL4A 4QT2A
chains in the Genus database with same CATH topology
3UQAA 1QPLA 4W9PA 4Z2IA 1XHGA 2LGOA 1LG2A 3UI5A 4P8VA 3UQIA 3O5OA 2DT1A 1LG1A 2VN1A 3AS1A 4LAYA 1W9PA 3B9AA 1T11A 4JFIA 4ODLA 2DG4A 4XAKA 1GUVA 3O5EA 1ZBKA 1OGBA 3W4RA 2MLYA 3H9RB 3BXWA 1EYMA 2Q5AA 2F2DA 3RGCA 1JVWA 2OLHA 1QPFA 1F40A 2XP8A 3JYMA 1FKFA 1X6NA 3KAGA 3ARTA 4DWSB 2XP4A 2YBTA 3NTPA 1HKJA 3RM9A 3WQVA 1FKRA 3ODKA 1FKJA 3WD3A 4L72B 1RD6A 2AWGA 1W26A 5DF0A 4JYSA 1Q6IA 1TFVA 3FY1A 4ODRA 1W1YA 1HJXA 4KR0B 1NWSA 3WD4A 1W1VA 4LAXA 2WLYA 2MF9A 2DSUA 5HW6A 1U79A 1XRVA 2FKEA 4J4OA 4ODMA 1QZ2A 3O5LA 2XP3A 1ZL1A 4S3JA 1D7HA 4WK9A 1JNDA 1YW5A 3UI4A 4IT6A 3O5DA 2A3BA 2N87A 3O5MA 5DIUA 3WKZA 1EDQA 3CHEA 3EY6A 4DZ3A 4DRJA 2XP5A 3G6MA 4LAVA 1UR8A 2PPOA 3ARPA 3PR9A 4ML4A 2KFWA 1BKFA 1B6CA 4R0XA 1F8AB 2MNTA 3O5RA 3AQUA 2PI6A 2DT3A 4JFLA 2OFNA 2ZQTA 3GPKA 2PV2A 1NMWA 4GIVA 2ZQSA 2ITKA 1C9HA 4JFKA 1W1TA 4NNRA 4J4NA 4IPXA 1SR0A 3RFWA 3ALGA 3O5KA 3O5QA 3KAHA 3ARVA 3PRBA 1UR9A 4ZS6A 5HKGA 3TDBA 2PPNA 4LGXA 3B9EA 3WD0A 3WH0A 3RM4A 4DRIA 2LJ4A 2DT0A 4Q7NA 4WKHA 2DT2A 4DIPA 4ITZA 4MNKA 5B8IC 4WJXA 3ALFA 4P8XA 1W1PA 2MLZA 1D2KA 1P5QA 1LL6A 3ARUA 1HJWA 1EQ3A 2A3AA 2QF8A 1J4HA 3MDYB 3G6LA 1FFQA 3JYJA 4DRMA 4ZPVR 1ROUA 4MSPA 2KO7A 4MGVA 1ROTA 2RUDA 1HKKA 2ZR4A 4W9OA 3CGMA 1X6LA 3WIJA 2O9OA 4Z2HA 1ZK6A 1JNTA 1SYTA 4Q22A 3ARSA 4QT3A 3ARQA 4G50A 1BL4A 4TYOA 4Z2KA 2D9FA 4LAWA 1E6ZA 5HUAA 5BXJA 3CZ8A 3PA7A 3KAFA 1M5YA 4ZPWR 2MPHA 2Y78A 1LJYA 2IUZA 1E6NA 5HW7A 3CHCA 4MTVA 1E9LA 3VAWA 3AS3A 3ARZA 1FFRA 2DG3A 4P8WA 5HWBA 5J6EA 2A3EA 2WK2A 1ITXA 3B9DA 3PRDA 2KI3A 2ZQVA 1ZBCA 1D7JA 4HARA 2XP7A 4TW7A 3O5FA 3KADA 1H0GA 4MNJA 2DSVA 4KQZA 1Q1CA 2F21A 1FD9A 1PINA 5HWCA 4DH0A 2ZR6A 1L1PA 4BF8A 1YATA 1FJDA 1LL7A 4U86A 1HKIA 3ARWA 2RUCA 4Z2JA 3TC5A 1HKMA 1KFWA 4ZPTR 3WL1A 3PRAA 1FKHA 1FKIA 1W9UA 1IX5A 3CHFA 2XPAA 2G8ZA 3ARXA 4DRHA 2L2SA 4PTMA 3TCZA 2PV3A 4TNSA 3O5PA 3WD2A 4Z2GA 3JXVA 4W9QA 1FKGA 1FKDA 4JFJA 3WQWA 1NH6A 3CH9A 2RUQA 1HJVA 4P8UA 4WKAA 4Z2LA 1TCOC 3NI6A 2M1IA 2KR7A 4ODPA 4DZ2A 4DWSD 5HT1A 1FKBA 4U84A 4JFMA 3B7XA 4MPKA 1J4RA 1EIBA 3ARRA 1ZBVA 3O5IA 4W5UA 3KCEA 1KT0A 1HXVA 2WLZA 2G41A 2XP9A 3RM8A 1NWUA 4QZVB 4URIA 1D6OA 1GOIA 2B31A 3KZ7A 4HBOA 2AOSA 2YBUA 2PV1A 3B8SA 5DIVA 5HW8A 1EHNA 1WNOA 3AS0A 3FAPA 4FN2A 1W9VA 1JNSA 3KAIA 1CTNA 2UZ5A 4IQ2A 4MNLA 4QIBA 3AROA 5GPGA 3IKDA 5DEZA 5HBFA 4IT4A 3CHDA 4NZCA 4O2TA 5HTGA 4DRQA 1OGGA 3WL0A 5D75A 5JH8A 1Y0OA 1VF8A 3LUOA 1ZB5A 1FAPA 1E15A 2PPPA 1PBKA 3KACA 2M08A 3FXYA 1ZCNA 4ODOA 2M2AA 4ODQA 2ZR5A 3IKGA 2A3CA 3UF8A 4NSBA 3I6CA 3NRKA 2VCDA 3O5JA 4DRKA 4G2PA 2FDMA 2LKNA 4HBEA 4DRNA 2PBCA 1OWQA 1N1AA 1JNEA 2XPBA 1Q6HA 4WKFA 2KE0A 4R5EA 1O6IA 2F4EA 1J6YA 4S3KA 1NWRA 2LPVA 4DWSC 2IF4A 3OA5A 1H0IA 1D7IA 2XP6A 2DG9A 2FAPA 1FKKA 3QOKA 1KT1A 4FAPA 5DITA 3WD1A 1E6PA 3IHZA 4IQCA 1NSGA 4DT4A 1WB0A 2DSWA 2DSZA 4ODNA 1FKSA 3CGNA 3UQBA 5GQBA 3O5GA 4MAVA 3KABA 2DPEA 1R9HA 4DROA 5I98A 4TW6A 3AS2A 4GGQA 4L3NA 4DWSA 3ARYA 2K8IA 4N19A 4U85A 3IK8A 4ODKA 1FKLA 3OOBA 4DRPA 1J4IA 3RMEA 4TX0A 1ZU8A 2WM0A 2MLXA 1ZBWA 4TW8A 2ESCA 1LQ0A 1K9TA 4C02B 2RQSA 2RSEA 1E6RA 3UI6A 1NMVA 1WAWA 2RURA 5GPRA 5DO2A 4AY1A 1FKTA 2JZVA 1GPFA 2O92A 2KGJA 1Q6UA 4WIWA 4MNMA 1NWTA 1A7XA 2ZQUA 1LL4A 4QT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DH0 A;  1FAP A;  2PPP A;  1QPL A;  2OFN A;  2ZR6 A;  4W9P A;  1PBK A;  1YAT A;  2LGO A;  2M08 A;  2ZQT A;  3KAC A;  4BF8 A;  1FJD A;  3UI5 A;  3GPK A;  4U86 A;  1ZCN A;  1NMW A;  2PV2 A;  3UQI A;  3O5O A;  4GIV A;  2ZQS A;  2ITK A;  1C9H A;  2RUC A;  2M2A A;  2VN1 A;  4LAY A;  4ODQ A;  4ODO A;  3TC5 A;  1T11 A;  2ZR5 A;  3IKG A;  4JFK A;  4JFI A;  4NNR A;  4ODL A;  2DG4 A;  3UF8 A;  4J4N A;  1FKH A;  4IPX A;  3O5E A;  1FKI A;  3I6C A;  3NRK A;  2VCD A;  3O5J A;  3O5K A;  3RFW A;  3O5Q A;  4DRK A;  3KAH A;  4G2P A;  4DRN A;  2LKN A;  2PBC A;  3PRB A;  5HWC A;  2MLY A;  3H9R B;  5HKG A;  2XPA A;  1EYM A;  3TDB A;  2PPN A;  2Q5A A;  2F2D A;  3RGC A;  1N1A A;  1JVW A;  2XPB A;  1QPF A;  1Q6H A;  3WH0 A;  2L2S A;  4DRH A;  2XP8 A;  2KE0 A;  1FKF A;  3JYM A;  3TCZ A;  2LJ4 A;  2PV3 A;  2F4E A;  4TNS A;  3KAG A;  4DRI A;  3O5P A;  1J6Y A;  2LPV A;  4DIP A;  4ITZ A;  5B8I C;  3JXV A;  4W9Q A;  1FKG A;  2XP4 A;  1FKD A;  2IF4 A;  4JFJ A;  2MLZ A;  3NTP A;  1FKR A;  3ODK A;  1P5Q A;  1D7I A;  1FKJ A;  2RUQ A;  2XP6 A;  1EQ3 A;  2DG9 A;  2FAP A;  1TCO C;  3NI6 A;  2AWG A;  1FKK A;  1J4H A;  2M1I A;  3MDY B;  1F40 A;  1KT1 A;  2KR7 A;  1W26 A;  4ODP A;  4DZ2 A;  5DIT A;  4FAP A;  3JYJ A;  4DRM A;  3IHZ A;  1ROU A;  4IQC A;  4JYS A;  4MSP A;  1NSG A;  5HT1 A;  1FKB A;  4U84 A;  1Q6I A;  4DT4 A;  2KO7 A;  4JFM A;  4ODN A;  3B7X A;  1L1P A;  4ODR A;  1J4R A;  4MGV A;  1ROT A;  1FKS A;  3CGN A;  2RUD A;  3UQB A;  2ZR4 A;  3O5G A;  3UQA A;  4W9O A;  3CGM A;  3KAB A;  3O5I A;  1R9H A;  3KCE A;  1ZK6 A;  4LAX A;  4DRO A;  5I98 A;  1JNT A;  4TW6 A;  2MF9 A;  1KT0 A;  1HXV A;  4GGQ A;  5HW6 A;  1U79 A;  4QT3 A;  2FKE A;  2XP9 A;  4G50 A;  1BL4 A;  4J4O A;  4ODM A;  4TYO A;  1QZ2 A;  2K8I A;  2XP3 A;  3O5L A;  2D9F A;  4N19 A;  3IK8 A;  4ODK A;  4U85 A;  4LAW A;  5HUA A;  1D6O A;  1D7H A;  1FKL A;  3OOB A;  5BXJ A;  3KZ7 A;  1J4I A;  3PA7 A;  4DRP A;  1YW5 A;  3KAF A;  1M5Y A;  2PV1 A;  4TX0 A;  2MLX A;  3UI4 A;  2MPH A;  5DIV A;  2Y78 A;  5HW8 A;  4TW8 A;  3O5D A;  2N87 A;  4QT2 A;  5HW7 A;  3FAP A;  4FN2 A;  4C02 B;  3O5M A;  1JNS A;  5DIU A;  2RQS A;  1FD9 A;  2RSE A;  3KAI A;  3UI6 A;  2UZ5 A;  4IQ2 A;  3VAW A;  1NMV A;  4QIB A;  2RUR A;  3EY6 A;  5GPG A;  4DZ3 A;  2DG3 A;  3IKD A;  5HWB A;  1FKT A;  5J6E A;  4DRJ A;  2JZV A;  2XP5 A;  2KGJ A;  3PRD A;  4LAV A;  2PPO A;  2KI3 A;  2ZQV A;  1Q6U A;  4O2T A;  1D7J A;  5HTG A;  4DRQ A;  2XP7 A;  2KFW A;  1BKF A;  3O5F A;  1B6C A;  3KAD A;  4R0X A;  4TW7 A;  5D75 A;  1F8A B;  2MNT A;  3O5R A;  1Y0O A;  1A7X A;  2ZQU A;  3LUO A;  4JFL A;  1Q1C A;  2F21 A;  1PIN A; 
#chains in the Genus database with same CATH topology
 3UQA A;  1QPL A;  4W9P A;  4Z2I A;  1XHG A;  2LGO A;  1LG2 A;  3UI5 A;  4P8V A;  3UQI A;  3O5O A;  2DT1 A;  1LG1 A;  2VN1 A;  3AS1 A;  4LAY A;  1W9P A;  3B9A A;  1T11 A;  4JFI A;  4ODL A;  2DG4 A;  4XAK A;  1GUV A;  3O5E A;  1ZBK A;  1OGB A;  3W4R A;  2MLY A;  3H9R B;  3BXW A;  1EYM A;  2Q5A A;  2F2D A;  3RGC A;  1JVW A;  2OLH A;  1QPF A;  1F40 A;  2XP8 A;  3JYM A;  1FKF A;  1X6N A;  3KAG A;  4UDM A;  3ART A;  4DWS B;  2F23 A;  2XP4 A;  2YBT A;  3NTP A;  1HKJ A;  3RM9 A;  3WQV A;  1FKR A;  3ODK A;  1FKJ A;  3WD3 A;  4L72 B;  1RD6 A;  2AWG A;  1W26 A;  5DF0 A;  4JYS A;  1Q6I A;  1TFV A;  3FY1 A;  4ODR A;  1W1Y A;  1HJX A;  4KR0 B;  1NWS A;  3WD4 A;  1W1V A;  4LAX A;  2WLY A;  2MF9 A;  2DSU A;  5HW6 A;  1U79 A;  1XRV A;  2FKE A;  4J4O A;  4ODM A;  1QZ2 A;  3O5L A;  2XP3 A;  1ZL1 A;  4S3J A;  2ETN A;  1D7H A;  4WK9 A;  1JND A;  1YW5 A;  3UI4 A;  4IT6 A;  3O5D A;  2A3B A;  2N87 A;  3O5M A;  5DIU A;  3WKZ A;  1EDQ A;  3CHE A;  3EY6 A;  4DZ3 A;  4DRJ A;  2XP5 A;  3G6M A;  4LAV A;  1UR8 A;  2PPO A;  3ARP A;  3PR9 A;  4ML4 A;  2KFW A;  1BKF A;  1B6C A;  4R0X A;  1F8A B;  2MNT A;  3O5R A;  3AQU A;  2PI6 A;  2DT3 A;  4JFL A;  2OFN A;  2ZQT A;  3GPK A;  2PV2 A;  1NMW A;  4GIV A;  2ZQS A;  2ITK A;  1C9H A;  1GRJ A;  1W1T A;  4JFK A;  4NNR A;  4J4N A;  4IPX A;  1SR0 A;  3RFW A;  3ALG A;  3O5K A;  3O5Q A;  3KAH A;  3ARV A;  3PRB A;  1UR9 A;  4ZS6 A;  5HKG A;  3TDB A;  2PPN A;  4LGX A;  3B9E A;  3WD0 A;  3WH0 A;  3RM4 A;  4DRI A;  2LJ4 A;  2DT0 A;  4Q7N A;  4WKH A;  2DT2 A;  4DIP A;  4ITZ A;  4MNK A;  5B8I C;  4WJX A;  3ALF A;  4P8X A;  1W1P A;  2MLZ A;  1D2K A;  1P5Q A;  1LL6 A;  3ARU A;  1HJW A;  1EQ3 A;  2A3A A;  2QF8 A;  1J4H A;  3MDY B;  3G6L A;  1FFQ A;  3JYJ A;  4DRM A;  4ZPV R;  1ROU A;  4MSP A;  2KO7 A;  4MGV A;  1ROT A;  2RUD A;  1HKK A;  2ZR4 A;  4W9O A;  3CGM A;  1X6L A;  3WIJ A;  2O9O A;  4Z2H A;  1ZK6 A;  1JNT A;  1SYT A;  4Q22 A;  3ARS A;  4QT3 A;  3ARQ A;  4G50 A;  1BL4 A;  4TYO A;  4Z2K A;  2D9F A;  4LAW A;  1E6Z A;  5HUA A;  5BXJ A;  3CZ8 A;  3PA7 A;  3KAF A;  1M5Y A;  4ZPW R;  2MPH A;  2Y78 A;  1LJY A;  2IUZ A;  1E6N A;  5HW7 A;  3CHC A;  4MTV A;  1E9L A;  3VAW A;  3AS3 A;  3ARZ A;  1FFR A;  2DG3 A;  4P8W A;  5HWB A;  2B5U B;  5J6E A;  2A3E A;  2WK2 A;  1ITX A;  3B9D A;  3PRD A;  2KI3 A;  2ZQV A;  1ZBC A;  1D7J A;  4HAR A;  2XP7 A;  4TW7 A;  3O5F A;  3KAD A;  1H0G A;  4MNJ A;  2DSV A;  4KQZ A;  1Q1C A;  2F21 A;  1FD9 A;  1PIN A;  5HWC A;  4DH0 A;  2ZR6 A;  1L1P A;  4BF8 A;  1YAT A;  1FJD A;  1LL7 A;  4U86 A;  1HKI A;  3ARW A;  2PN0 A;  2RUC A;  4Z2J A;  3TC5 A;  1HKM A;  1KFW A;  4ZPT R;  3WL1 A;  3PRA A;  1FKH A;  1FKI A;  1W9U A;  1IX5 A;  3GTY X;  3CHF A;  2XPA A;  2G8Z A;  3ARX A;  4DRH A;  2L2S A;  4PTM A;  3TCZ A;  2PV3 A;  4TNS A;  3O5P A;  3WD2 A;  4Z2G A;  3JXV A;  4W9Q A;  1FKG A;  1FKD A;  4JFJ A;  3WQW A;  1NH6 A;  3CH9 A;  2RUQ A;  1HJV A;  4P8U A;  4WKA A;  4Z2L A;  1TCO C;  3NI6 A;  2M1I A;  2KR7 A;  4ODP A;  4DZ2 A;  4DWS D;  5HT1 A;  1FKB A;  4U84 A;  4JFM A;  3B7X A;  4MPK A;  1J4R A;  1EIB A;  3ARR A;  1ZBV A;  3O5I A;  4W5U A;  3KCE A;  1KT0 A;  1HXV A;  2WLZ A;  2G41 A;  2XP9 A;  3RM8 A;  1NWU A;  4QZV B;  4URI A;  2P4V A;  1D6O A;  1GOI A;  2B31 A;  3KZ7 A;  4HBO A;  2AOS A;  2YBU A;  2PV1 A;  3B8S A;  5DIV A;  5HW8 A;  1EHN A;  1WNO A;  3AS0 A;  3FAP A;  4FN2 A;  1W9V A;  1JNS A;  3KAI A;  1CTN A;  2UZ5 A;  4IQ2 A;  4MNL A;  4QIB A;  3ARO A;  5GPG A;  3IKD A;  5DEZ A;  5HBF A;  4IT4 A;  3CHD A;  4NZC A;  4O2T A;  5HTG A;  4DRQ A;  1OGG A;  3WL0 A;  5D75 A;  5JH8 A;  1Y0O A;  1VF8 A;  3LUO A;  3BMB A;  1ZB5 A;  1FAP A;  1E15 A;  2PPP A;  1PBK A;  3KAC A;  2M08 A;  3FXY A;  1ZCN A;  4ODO A;  1JCH B;  2M2A A;  4ODQ A;  2ZR5 A;  3IKG A;  2A3C A;  3UF8 A;  4NSB A;  3I6C A;  3NRK A;  2VCD A;  3GU0 A;  3O5J A;  4DRK A;  4G2P A;  2FDM A;  2LKN A;  4HBE A;  4DRN A;  2PBC A;  1OWQ A;  1N1A A;  1JNE A;  2XPB A;  1Q6H A;  4WKF A;  2KE0 A;  4R5E A;  1O6I A;  2F4E A;  1J6Y A;  4S3K A;  1NWR A;  2LPV A;  4DWS C;  2IF4 A;  3OA5 A;  1H0I A;  1D7I A;  2XP6 A;  2DG9 A;  2FAP A;  1FKK A;  3QOK A;  1KT1 A;  4FAP A;  5DIT A;  3WD1 A;  1E6P A;  3IHZ A;  4IQC A;  1NSG A;  4DT4 A;  1WB0 A;  2DSW A;  2DSZ A;  4ODN A;  1FKS A;  3CGN A;  3UQB A;  5GQB A;  3O5G A;  4MAV A;  3KAB A;  2DPE A;  1R9H A;  4DRO A;  5I98 A;  4TW6 A;  3AS2 A;  4GGQ A;  1E44 A;  4L3N A;  4DWS A;  3ARY A;  2K8I A;  4N19 A;  4U85 A;  3IK8 A;  4ODK A;  1FKL A;  3EIP A;  3OOB A;  4DRP A;  1J4I A;  3RME A;  4TX0 A;  1ZU8 A;  2WM0 A;  2MLX A;  1ZBW A;  4TW8 A;  2ESC A;  1LQ0 A;  1K9T A;  4C02 B;  2RQS A;  2RSE A;  1E6R A;  3UI6 A;  2EUL A;  1NMV A;  1WAW A;  2RUR A;  5GPR A;  5DO2 A;  4AY1 A;  1FKT A;  2JZV A;  1GPF A;  2O92 A;  2KGJ A;  1Q6U A;  4WIW A;  4MNM A;  1NWT A;  1A7X A;  2ZQU A;  1LL4 A;  4QT2 A; 
#chains in the Genus database with same CATH homology
 3UQA A;  1QPL A;  4W9P A;  4Z2I A;  1XHG A;  2LGO A;  1LG2 A;  3UI5 A;  4P8V A;  3UQI A;  3O5O A;  2DT1 A;  1LG1 A;  2VN1 A;  3AS1 A;  4LAY A;  1W9P A;  3B9A A;  1T11 A;  4JFI A;  4ODL A;  2DG4 A;  4XAK A;  1GUV A;  3O5E A;  1ZBK A;  1OGB A;  3W4R A;  2MLY A;  3H9R B;  3BXW A;  1EYM A;  2Q5A A;  2F2D A;  3RGC A;  1JVW A;  2OLH A;  1QPF A;  1F40 A;  2XP8 A;  3JYM A;  1FKF A;  1X6N A;  3KAG A;  3ART A;  4DWS B;  2XP4 A;  2YBT A;  3NTP A;  1HKJ A;  3RM9 A;  3WQV A;  1FKR A;  3ODK A;  1FKJ A;  3WD3 A;  4L72 B;  1RD6 A;  2AWG A;  1W26 A;  5DF0 A;  4JYS A;  1Q6I A;  1TFV A;  3FY1 A;  4ODR A;  1W1Y A;  1HJX A;  4KR0 B;  1NWS A;  3WD4 A;  1W1V A;  4LAX A;  2WLY A;  2MF9 A;  2DSU A;  5HW6 A;  1U79 A;  1XRV A;  2FKE A;  4J4O A;  4ODM A;  1QZ2 A;  3O5L A;  2XP3 A;  1ZL1 A;  4S3J A;  1D7H A;  4WK9 A;  1JND A;  1YW5 A;  3UI4 A;  4IT6 A;  3O5D A;  2A3B A;  2N87 A;  3O5M A;  5DIU A;  3WKZ A;  1EDQ A;  3CHE A;  3EY6 A;  4DZ3 A;  4DRJ A;  2XP5 A;  3G6M A;  4LAV A;  1UR8 A;  2PPO A;  3ARP A;  3PR9 A;  4ML4 A;  2KFW A;  1BKF A;  1B6C A;  4R0X A;  1F8A B;  2MNT A;  3O5R A;  3AQU A;  2PI6 A;  2DT3 A;  4JFL A;  2OFN A;  2ZQT A;  3GPK A;  2PV2 A;  1NMW A;  4GIV A;  2ZQS A;  2ITK A;  1C9H A;  4JFK A;  1W1T A;  4NNR A;  4J4N A;  4IPX A;  1SR0 A;  3RFW A;  3ALG A;  3O5K A;  3O5Q A;  3KAH A;  3ARV A;  3PRB A;  1UR9 A;  4ZS6 A;  5HKG A;  3TDB A;  2PPN A;  4LGX A;  3B9E A;  3WD0 A;  3WH0 A;  3RM4 A;  4DRI A;  2LJ4 A;  2DT0 A;  4Q7N A;  4WKH A;  2DT2 A;  4DIP A;  4ITZ A;  4MNK A;  5B8I C;  4WJX A;  3ALF A;  4P8X A;  1W1P A;  2MLZ A;  1D2K A;  1P5Q A;  1LL6 A;  3ARU A;  1HJW A;  1EQ3 A;  2A3A A;  2QF8 A;  1J4H A;  3MDY B;  3G6L A;  1FFQ A;  3JYJ A;  4DRM A;  4ZPV R;  1ROU A;  4MSP A;  2KO7 A;  4MGV A;  1ROT A;  2RUD A;  1HKK A;  2ZR4 A;  4W9O A;  3CGM A;  1X6L A;  3WIJ A;  2O9O A;  4Z2H A;  1ZK6 A;  1JNT A;  1SYT A;  4Q22 A;  3ARS A;  4QT3 A;  3ARQ A;  4G50 A;  1BL4 A;  4TYO A;  4Z2K A;  2D9F A;  4LAW A;  1E6Z A;  5HUA A;  5BXJ A;  3CZ8 A;  3PA7 A;  3KAF A;  1M5Y A;  4ZPW R;  2MPH A;  2Y78 A;  1LJY A;  2IUZ A;  1E6N A;  5HW7 A;  3CHC A;  4MTV A;  1E9L A;  3VAW A;  3AS3 A;  3ARZ A;  1FFR A;  2DG3 A;  4P8W A;  5HWB A;  5J6E A;  2A3E A;  2WK2 A;  1ITX A;  3B9D A;  3PRD A;  2KI3 A;  2ZQV A;  1ZBC A;  1D7J A;  4HAR A;  2XP7 A;  4TW7 A;  3O5F A;  3KAD A;  1H0G A;  4MNJ A;  2DSV A;  4KQZ A;  1Q1C A;  2F21 A;  1FD9 A;  1PIN A;  5HWC A;  4DH0 A;  2ZR6 A;  1L1P A;  4BF8 A;  1YAT A;  1FJD A;  1LL7 A;  4U86 A;  1HKI A;  3ARW A;  2RUC A;  4Z2J A;  3TC5 A;  1HKM A;  1KFW A;  4ZPT R;  3WL1 A;  3PRA A;  1FKH A;  1FKI A;  1W9U A;  1IX5 A;  3CHF A;  2XPA A;  2G8Z A;  3ARX A;  4DRH A;  2L2S A;  4PTM A;  3TCZ A;  2PV3 A;  4TNS A;  3O5P A;  3WD2 A;  4Z2G A;  3JXV A;  4W9Q A;  1FKG A;  1FKD A;  4JFJ A;  3WQW A;  1NH6 A;  3CH9 A;  2RUQ A;  1HJV A;  4P8U A;  4WKA A;  4Z2L A;  1TCO C;  3NI6 A;  2M1I A;  2KR7 A;  4ODP A;  4DZ2 A;  4DWS D;  5HT1 A;  1FKB A;  4U84 A;  4JFM A;  3B7X A;  4MPK A;  1J4R A;  1EIB A;  3ARR A;  1ZBV A;  3O5I A;  4W5U A;  3KCE A;  1KT0 A;  1HXV A;  2WLZ A;  2G41 A;  2XP9 A;  3RM8 A;  1NWU A;  4QZV B;  4URI A;  1D6O A;  1GOI A;  2B31 A;  3KZ7 A;  4HBO A;  2AOS A;  2YBU A;  2PV1 A;  3B8S A;  5DIV A;  5HW8 A;  1EHN A;  1WNO A;  3AS0 A;  3FAP A;  4FN2 A;  1W9V A;  1JNS A;  3KAI A;  1CTN A;  2UZ5 A;  4IQ2 A;  4MNL A;  4QIB A;  3ARO A;  5GPG A;  3IKD A;  5DEZ A;  5HBF A;  4IT4 A;  3CHD A;  4NZC A;  4O2T A;  5HTG A;  4DRQ A;  1OGG A;  3WL0 A;  5D75 A;  5JH8 A;  1Y0O A;  1VF8 A;  3LUO A;  1ZB5 A;  1FAP A;  1E15 A;  2PPP A;  1PBK A;  3KAC A;  2M08 A;  3FXY A;  1ZCN A;  4ODO A;  2M2A A;  4ODQ A;  2ZR5 A;  3IKG A;  2A3C A;  3UF8 A;  4NSB A;  3I6C A;  3NRK A;  2VCD A;  3O5J A;  4DRK A;  4G2P A;  2FDM A;  2LKN A;  4HBE A;  4DRN A;  2PBC A;  1OWQ A;  1N1A A;  1JNE A;  2XPB A;  1Q6H A;  4WKF A;  2KE0 A;  4R5E A;  1O6I A;  2F4E A;  1J6Y A;  4S3K A;  1NWR A;  2LPV A;  4DWS C;  2IF4 A;  3OA5 A;  1H0I A;  1D7I A;  2XP6 A;  2DG9 A;  2FAP A;  1FKK A;  3QOK A;  1KT1 A;  4FAP A;  5DIT A;  3WD1 A;  1E6P A;  3IHZ A;  4IQC A;  1NSG A;  4DT4 A;  1WB0 A;  2DSW A;  2DSZ A;  4ODN A;  1FKS A;  3CGN A;  3UQB A;  5GQB A;  3O5G A;  4MAV A;  3KAB A;  2DPE A;  1R9H A;  4DRO A;  5I98 A;  4TW6 A;  3AS2 A;  4GGQ A;  4L3N A;  4DWS A;  3ARY A;  2K8I A;  4N19 A;  4U85 A;  3IK8 A;  4ODK A;  1FKL A;  3OOB A;  4DRP A;  1J4I A;  3RME A;  4TX0 A;  1ZU8 A;  2WM0 A;  2MLX A;  1ZBW A;  4TW8 A;  2ESC A;  1LQ0 A;  1K9T A;  4C02 B;  2RQS A;  2RSE A;  1E6R A;  3UI6 A;  1NMV A;  1WAW A;  2RUR A;  5GPR A;  5DO2 A;  4AY1 A;  1FKT A;  2JZV A;  1GPF A;  2O92 A;  2KGJ A;  1Q6U A;  4WIW A;  4MNM A;  1NWT A;  1A7X A;  2ZQU A;  1LL4 A;  4QT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...