3KACA

Structure-guided design of alpha-amino acid-derived pin1 inhibitors
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
113
structure length
113
Chain Sequence
b'EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-guided design of alpha-amino acid-derived Pin1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 39
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kacA00
1JVWA 3O5GA 3O5MA 5B8IC 2LPVA 3KCEA 3O5RA 1F8AB 2FKEA 2XP8A 4ODRA 4JFJA 3UQIA 1ZCNA 2XP6A 1PINA 4LAYA 2RURA 1FJDA 2XPAA 2F2DA 1FKKA 2L2SA 1Q1CA 2UZ5A 2ZR4A 3KZ7A 2XP7A 4BF8A 4W9QA 4LAWA 3GPKA 1FKFA 3IKGA 3JXVA 3UI6A 2ZQUA 2XP5A 1FKTA 1D7IA 3MDYB 4ODLA 5HW7A 1M5YA 2LJ4A 2PPPA 3CGNA 4MGVA 3O5JA 2ZQSA 4ODNA 4U84A 5I98A 4JYSA 3NI6A 4LAXA 4ODMA 3RGCA 1F40A 1TCOC 2M1IA 4JFIA 1YW5A 4R0XA 4IQ2A 1J4HA 3OOBA 2N87A 4FAPA 2RUDA 5GPGA 2PV3A 4G2PA 2DG9A 1P5QA 3PRBA 3O5DA 3UI4A 1D7HA 1W26A 2ZR6A 1NSGA 5HKGA 3TC5A 2ITKA 1PBKA 3JYMA 2LKNA 1QPLA 2M08A 2RUCA 2KI3A 2Y78A 1BL4A 4JFMA 3VAWA 5HW8A 4NNRA 1FKRA 2M2AA 1FAPA 1FKDA 3UI5A 4DZ3A 3H9RB 4JFKA 3TCZA 1JNSA 3EY6A 2K8IA 3O5IA 3ODKA 2MLXA 1L1PA 1ZK6A 2Q5AA 3UF8A 4DT4A 5HUAA 5J6EA 1KT0A 1D6OA 4JFLA 4DRHA 2PV1A 1HXVA 4DROA 3KAGA 2RUQA 1FKIA 2RQSA 3JYJA 5D75A 4LAVA 2F21A 4DRJA 4DH0A 3UQAA 1Y0OA 1J6YA 3IHZA 4QT2A 3O5QA 2F4EA 5HT1A 1EQ3A 4TYOA 2KE0A 4W9PA 1J4RA 1FKLA 2MPHA 4DRKA 3KABA 3KADA 1FKJA 4DRQA 2XP9A 3RFWA 2DG3A 4IQCA 4DRIA 3I6CA 3NTPA 4J4NA 1BKFA 4TNSA 2PPNA 2DG4A 3O5EA 4J4OA 2KR7A 4FN2A 3KAFA 4GIVA 4TW8A 3TDBA 2MLZA 4ODKA 1J4IA 3KACA 5DIVA 3KAIA 4G50A 2IF4A 2XPBA 5DIUA 1FKSA 2KO7A 5HWBA 1FKHA 1EYMA 2AWGA 3WH0A 2PBCA 1FKGA 4QT3A 3PA7A 4GGQA 1A7XA 2FAPA 1KT1A 3IK8A 2XP4A 2MF9A 5HW6A 1Q6UA 2LGOA 2ZQVA 5HTGA 3IKDA 2PV2A 4IPXA 4U86A 2XP3A 2ZR5A 4C02B 3O5PA 4DRMA 1NMVA 3KAHA 4QIBA 5HWCA 1N1AA 3CGMA 1C9HA 3O5KA 4DZ2A 4ODOA 1U79A 4MSPA 3NRKA 4ODPA 4DIPA 4DRPA 3O5LA 2JZVA 4ITZA 4W9OA 3UQBA 3FAPA 2KFWA 1T11A 1FD9A 4DRNA 4TW6A 1JNTA 1ROTA 1ROUA 2RSEA 1D7JA 4N19A 5DITA 5BXJA 2PPOA 3O5FA 1Q6IA 2D9FA 1NMWA 4TW7A 1R9HA 1Q6HA 1YATA 1QZ2A 3O5OA 2ZQTA 3B7XA 1B6CA 2MNTA 2KGJA 2VN1A 1FKBA 4U85A 4ODQA 3PRDA 2OFNA 1QPFA 3LUOA 4O2TA 4TX0A 2VCDA 2MLYA
chains in the Genus database with same CATH superfamily
3O5GA 3O5MA 2LPVA 3UQIA 1LL6A 4JFJA 3ARRA 1PINA 1FJDA 1FKKA 2L2SA 2ZR4A 2XP7A 1H0GA 3UI6A 1H0IA 4KR0B 2DSVA 1FKTA 3MDYB 4ODLA 4NZCA 4P8VA 5HW7A 4MGVA 4ODNA 4U84A 3NI6A 4R0XA 1D2KA 4MTVA 3CHEA 5GPGA 1W9PA 2PV3A 2WLYA 3BMBA 2G41A 4DWSA 3PRBA 3UI4A 2ZR6A 3WL0A 3JYMA 2Y78A 1OWQA 2M2AA 1FAPA 3ARUA 3CZ8A 3CH9A 3H9RB 3TCZA 4IT6A 3EY6A 3ARYA 2DT2A 1WNOA 3GTYX 4Z2HA 1HXVA 2PV1A 3JYJA 1FKIA 2F21A 4DRJA 4DH0A 2DSUA 4QT2A 1CTNA 3GU0A 4UDMA 2A3AA 1EQ3A 1OGBA 3ARSA 1HKJA 4DRIA 3ARXA 2WK2A 3NTPA 4TNSA 3WIJA 5HBFA 1X6NA 3B9EA 3KAFA 4GIVA 4TW8A 2MLZA 3KACA 1W1TA 4G50A 2DT1A 3WH0A 1SR0A 1FKGA 4MNMA 5HW6A 2MF9A 2ZR5A 3ARZA 4C02B 4DRMA 1NMVA 1OGGA 3O5KA 4ODOA 1VF8A 2A3BA 4DRPA 3B8SA 4ITZA 4W9OA 2KFWA 4MNLA 1JNTA 1D7JA 3O5FA 1Q6IA 4IT4A 4P8XA 2QF8A 1FKBA 2B31A 1ZBKA 2PN0A 2OFNA 3LUOA 3PRDA 2A3CA 2FKEA 4URIA 1IX5A 4ZPTR 2DPEA 1LL7A 4W9QA 3GPKA 1FKFA 1E9LA 1D7IA 3RM8A 3OA5A 2PPPA 2ZQSA 4HARA 3ARPA 4JYSA 4ODMA 4S3KA 1O6IA 4IQ2A 1NWSA 3WL1A 3OOBA 2N87A 4ZS6A 5HKGA 1W26A 1NSGA 1GOIA 2ITKA 1PBKA 2LKNA 1QPLA 2M08A 1BL4A 2P4VA 4NNRA 1ZBVA 3UI5A 4WK9A 1JNSA 2YBTA 1E6ZA 1L1PA 3UF8A 3WQVA 4MNKA 4DT4A 5HUAA 1KT0A 1D6OA 4JFLA 3B9DA 3KAGA 2RUQA 4LAVA 2YBUA 2O9OA 3UQAA 3ARWA 4WIWA 2O92A 3IHZA 2ETNA 3AS1A 1E6PA 2KE0A 1FKLA 3KABA 3RFWA 3AS3A 2DG3A 1XRVA 4IQCA 4S3JA 1BKFA 3O5EA 4J4OA 3TDBA 5DEZA 4ODKA 1J4IA 1NWUA 2IF4A 1FKSA 2KO7A 4QZVB 1EYMA 2AWGA 4ZPVR 4Z2JA 1ZBCA 4GGQA 4DWSC 1JNEA 4MPKA 2XP4A 1LL4A 1Q6UA 2ZQVA 3IKDA 2PV2A 4U86A 5DO2A 1NWRA 1N1AA 4PTMA 1W1VA 1NWTA 4P8UA 1LG2A 3WD3A 4ODPA 1E44A 4Z2GA 2JZVA 3UQBA 1ZU8A 2B5UB 3ARQA 1FD9A 4N19A 4WJXA 1XHGA 1R9HA 4KQZA 1EHNA 1UR8A 4TX0A 4O2TA 3WKZA 1JVWA 3O5RA 1F8AB 2XP8A 4LAYA 3RM4A 2UZ5A 1FFRA 5DF0A 2F23A 3FXYA 3KZ7A 4LAWA 3RMEA 3IKGA 3JXVA 1E6NA 1W9VA 4MNJA 2ZQUA 2XP5A 2OLHA 4XAKA 1M5YA 3EIPA 3O5JA 4AY1A 5I98A 4LAXA 1HJVA 1HKMA 3RGCA 1TCOC 1E15A 2M1IA 1E6RA 1P5QA 1JCHB 1WB0A 1HKIA 3O5DA 4DWSB 3TC5A 3PRAA 5HW8A 4JFMA 2WLZA 1FKRA 3AQUA 1FKDA 1W1YA 4JFKA 2K8IA 3CHFA 3ODKA 2MLXA 2Q5AA 2RQSA 5D75A 2AOSA 3ALFA 4W5UA 1Y0OA 3WD4A 5HT1A 4TYOA 3FY1A 2MPHA 4DRKA 2XP9A 4J4NA 4WKHA 1K9TA 2DG4A 1GPFA 4FN2A 1HKKA 1LQ0A 5DIVA 3AS2A 1ZL1A 1FFQA 1FKHA 2WM0A 4QT3A 1ITXA 1W1PA 1HJXA 5HTGA 4IPXA 3BXWA 4Q22A 3AS0A 3KAHA 4QIBA 5HWCA 1EIBA 3CGMA 1WAWA 1C9HA 4DZ2A 1W9UA 1HJWA 4Q7NA 4MSPA 3NRKA 3WD0A 1SYTA 5BXJA 1ROTA 1ROUA 2RSEA 1GRJA 3G6MA 2FDMA 2D9FA 1UR9A 1EDQA 1QZ2A 1RD6A 3O5OA 1LJYA 3B7XA 2KGJA 2VN1A 1GUVA 1QPFA 2MLYA 5B8IC 3KCEA 3QOKA 3W4RA 4ODRA 1X6LA 1ZCNA 2XP6A 2XPAA 2F2DA 1Q1CA 2DT0A 4BF8A 4Z2LA 3WD1A 5GPRA 1LG1A 3G6LA 4Z2IA 2DT3A 3WD2A 1ZBWA 4R5EA 2LJ4A 3CGNA 1F40A 3ARVA 4MAVA 4JFIA 1YW5A 1J4HA 4FAPA 1KFWA 2RUDA 4G2PA 2DG9A 2G8ZA 1D7HA 4WKFA 4Z2KA 2RUCA 3VAWA 2KI3A 3AROA 4L72B 4DZ3A 2PI6A 4NSBA 3O5IA 2DSWA 5GQBA 2IUZA 1ZK6A 5J6EA 4DRHA 5JH8A 4DROA 3B9AA 1J6YA 4WKAA 3WQWA 3O5QA 2F4EA 1JNDA 1NH6A 1J4RA 4W9PA 3KADA 1FKJA 2ESCA 4DRQA 1TFVA 4ML4A 3I6CA 2EULA 2PPNA 4LGXA 2KR7A 4HBEA 3KAIA 2XPBA 5DIUA 5HWBA 2A3EA 2PBCA 3PA7A 1A7XA 2FAPA 3CHDA 1KT1A 3IK8A 2LGOA 2XP3A 3O5PA 1ZB5A 3RM9A 1U79A 3ALGA 4DIPA 3O5LA 3ARTA 3FAPA 1T11A 4DRNA 4TW6A 5DITA 4ZPWR 2PPOA 4TW7A 1NMWA 1YATA 1Q6HA 4P8WA 2ZQTA 2DSZA 1B6CA 2MNTA 4DWSD 3PR9A 4L3NA 3CHCA 4U85A 4ODQA 2RURA 2VCDA 4HBOA
chains in the Genus database with same CATH topology
3O5GA 3O5MA 2LPVA 3UQIA 1LL6A 4JFJA 3ARRA 1PINA 1FJDA 1FKKA 2L2SA 2ZR4A 2XP7A 1H0GA 3UI6A 1H0IA 4KR0B 2DSVA 1FKTA 3MDYB 4ODLA 4NZCA 4P8VA 5HW7A 4MGVA 4ODNA 4U84A 3NI6A 4R0XA 1D2KA 4MTVA 3CHEA 5GPGA 1W9PA 2PV3A 2WLYA 2G41A 4DWSA 3PRBA 3UI4A 2ZR6A 3WL0A 3JYMA 2Y78A 1OWQA 2M2AA 1FAPA 3ARUA 3CZ8A 3CH9A 3H9RB 3TCZA 4IT6A 3EY6A 3ARYA 2DT2A 1WNOA 4Z2HA 1HXVA 2PV1A 3JYJA 1FKIA 2F21A 4DRJA 4DH0A 2DSUA 4QT2A 1CTNA 1EQ3A 2A3AA 1OGBA 3ARSA 1HKJA 4DRIA 3ARXA 2WK2A 3NTPA 4TNSA 3WIJA 5HBFA 1X6NA 3B9EA 3KAFA 4GIVA 4TW8A 2MLZA 3KACA 1W1TA 4G50A 2DT1A 3WH0A 1SR0A 1FKGA 4MNMA 5HW6A 2MF9A 2ZR5A 3ARZA 4C02B 4DRMA 1NMVA 1OGGA 3O5KA 4ODOA 1VF8A 2A3BA 4DRPA 3B8SA 4ITZA 4W9OA 2KFWA 4MNLA 1JNTA 1D7JA 3O5FA 1Q6IA 4IT4A 4P8XA 2QF8A 1FKBA 2B31A 1ZBKA 3PRDA 2OFNA 3LUOA 2A3CA 2FKEA 4URIA 1IX5A 4ZPTR 2DPEA 1LL7A 4W9QA 3GPKA 1FKFA 1E9LA 1D7IA 3RM8A 3OA5A 2PPPA 2ZQSA 4HARA 3ARPA 4JYSA 4ODMA 4S3KA 1O6IA 4IQ2A 1NWSA 3WL1A 3OOBA 2N87A 4ZS6A 5HKGA 1W26A 1NSGA 1GOIA 2ITKA 1PBKA 2LKNA 1QPLA 2M08A 1BL4A 4NNRA 1ZBVA 3UI5A 4WK9A 1JNSA 2YBTA 1E6ZA 1L1PA 3UF8A 3WQVA 4MNKA 4DT4A 5HUAA 1KT0A 1D6OA 4JFLA 3B9DA 3KAGA 2RUQA 4LAVA 2YBUA 2O9OA 3UQAA 3ARWA 4WIWA 2O92A 3IHZA 3AS1A 1E6PA 2KE0A 1FKLA 3KABA 3RFWA 3AS3A 2DG3A 1XRVA 4IQCA 4S3JA 1BKFA 3O5EA 4J4OA 3TDBA 5DEZA 4ODKA 1J4IA 1NWUA 2IF4A 1FKSA 2KO7A 4QZVB 1EYMA 2AWGA 4ZPVR 4Z2JA 1ZBCA 4GGQA 4DWSC 1JNEA 4MPKA 2XP4A 1LL4A 1Q6UA 2ZQVA 3IKDA 2PV2A 4U86A 5DO2A 1NWRA 1N1AA 4PTMA 1W1VA 1NWTA 4P8UA 1LG2A 3WD3A 4ODPA 4Z2GA 2JZVA 3UQBA 1ZU8A 3ARQA 1FD9A 4N19A 4WJXA 1XHGA 1R9HA 4KQZA 1EHNA 1UR8A 4TX0A 4O2TA 3WKZA 1JVWA 3O5RA 1F8AB 2XP8A 4LAYA 3RM4A 2UZ5A 1FFRA 5DF0A 3FXYA 3KZ7A 4LAWA 3RMEA 3IKGA 3JXVA 1E6NA 1W9VA 4MNJA 2ZQUA 2XP5A 2OLHA 4XAKA 1M5YA 3O5JA 4AY1A 5I98A 4LAXA 1HJVA 1HKMA 3RGCA 1TCOC 1E15A 2M1IA 1E6RA 1P5QA 1WB0A 1HKIA 3O5DA 4DWSB 3TC5A 3PRAA 5HW8A 4JFMA 2WLZA 1FKRA 3AQUA 1FKDA 1W1YA 4JFKA 2K8IA 3CHFA 3ODKA 2MLXA 2Q5AA 2RQSA 5D75A 2AOSA 3ALFA 4W5UA 1Y0OA 3WD4A 5HT1A 4TYOA 3FY1A 2MPHA 4DRKA 2XP9A 4J4NA 4WKHA 1K9TA 2DG4A 1GPFA 4FN2A 1HKKA 1LQ0A 5DIVA 3AS2A 1ZL1A 1FFQA 1FKHA 2WM0A 4QT3A 1ITXA 1W1PA 1HJXA 5HTGA 4IPXA 3BXWA 4Q22A 3AS0A 3KAHA 4QIBA 5HWCA 1EIBA 3CGMA 1WAWA 1C9HA 4DZ2A 1W9UA 1HJWA 4Q7NA 4MSPA 3NRKA 3WD0A 1SYTA 5BXJA 1ROTA 1ROUA 2RSEA 3G6MA 2FDMA 2D9FA 1UR9A 1EDQA 1QZ2A 1RD6A 3O5OA 1LJYA 3B7XA 2KGJA 2VN1A 1GUVA 1QPFA 2MLYA 5B8IC 3KCEA 3QOKA 3W4RA 4ODRA 1X6LA 1ZCNA 2XP6A 2XPAA 2F2DA 1Q1CA 2DT0A 4BF8A 4Z2LA 3WD1A 5GPRA 1LG1A 3G6LA 4Z2IA 2DT3A 3WD2A 1ZBWA 4R5EA 2LJ4A 3CGNA 1F40A 3ARVA 4MAVA 4JFIA 1YW5A 1J4HA 4FAPA 1KFWA 2RUDA 4G2PA 2DG9A 2G8ZA 1D7HA 4WKFA 4Z2KA 2RUCA 3VAWA 2KI3A 3AROA 4L72B 4DZ3A 2PI6A 4NSBA 3O5IA 2DSWA 5GQBA 2IUZA 1ZK6A 5J6EA 4DRHA 5JH8A 4DROA 3B9AA 1J6YA 4WKAA 3WQWA 3O5QA 2F4EA 1JNDA 1NH6A 1J4RA 4W9PA 3KADA 1FKJA 2ESCA 4DRQA 1TFVA 4ML4A 3I6CA 2PPNA 4LGXA 2KR7A 4HBEA 3KAIA 2XPBA 5DIUA 5HWBA 2A3EA 2PBCA 3PA7A 1A7XA 2FAPA 3CHDA 1KT1A 3IK8A 2LGOA 2XP3A 3O5PA 1ZB5A 3RM9A 1U79A 3ALGA 4DIPA 3O5LA 3ARTA 3FAPA 1T11A 4DRNA 4TW6A 5DITA 4ZPWR 2PPOA 4TW7A 1NMWA 1YATA 1Q6HA 4P8WA 2ZQTA 2DSZA 1B6CA 2MNTA 4DWSD 3PR9A 4L3NA 3CHCA 4U85A 4ODQA 2RURA 2VCDA 4HBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JVW A;  3O5G A;  3O5M A;  5B8I C;  2LPV A;  3KCE A;  3O5R A;  1F8A B;  2FKE A;  2XP8 A;  4ODR A;  4JFJ A;  3UQI A;  1ZCN A;  2XP6 A;  1PIN A;  4LAY A;  2RUR A;  1FJD A;  2XPA A;  2F2D A;  1FKK A;  2L2S A;  1Q1C A;  2UZ5 A;  2ZR4 A;  3KZ7 A;  2XP7 A;  4BF8 A;  4W9Q A;  4LAW A;  3GPK A;  1FKF A;  3IKG A;  3JXV A;  3UI6 A;  2ZQU A;  2XP5 A;  1FKT A;  1D7I A;  3MDY B;  4ODL A;  5HW7 A;  1M5Y A;  2LJ4 A;  2PPP A;  3CGN A;  4MGV A;  3O5J A;  2ZQS A;  4ODN A;  4U84 A;  5I98 A;  4JYS A;  3NI6 A;  4LAX A;  4ODM A;  3RGC A;  1F40 A;  1TCO C;  2M1I A;  4JFI A;  1YW5 A;  4R0X A;  4IQ2 A;  1J4H A;  3OOB A;  2N87 A;  4FAP A;  2RUD A;  5GPG A;  2PV3 A;  4G2P A;  2DG9 A;  1P5Q A;  3PRB A;  3O5D A;  3UI4 A;  1D7H A;  1W26 A;  2ZR6 A;  1NSG A;  5HKG A;  3TC5 A;  2ITK A;  1PBK A;  3JYM A;  2LKN A;  1QPL A;  2M08 A;  2RUC A;  2KI3 A;  2Y78 A;  1BL4 A;  4JFM A;  3VAW A;  5HW8 A;  4NNR A;  1FKR A;  2M2A A;  1FAP A;  1FKD A;  3UI5 A;  4DZ3 A;  3H9R B;  4JFK A;  3TCZ A;  1JNS A;  3EY6 A;  2K8I A;  3O5I A;  3ODK A;  2MLX A;  1L1P A;  1ZK6 A;  2Q5A A;  3UF8 A;  4DT4 A;  5HUA A;  5J6E A;  1KT0 A;  1D6O A;  4JFL A;  4DRH A;  2PV1 A;  1HXV A;  4DRO A;  3KAG A;  2RUQ A;  1FKI A;  2RQS A;  3JYJ A;  5D75 A;  4LAV A;  2F21 A;  4DRJ A;  4DH0 A;  3UQA A;  1Y0O A;  1J6Y A;  3IHZ A;  4QT2 A;  3O5Q A;  2F4E A;  5HT1 A;  1EQ3 A;  4TYO A;  2KE0 A;  4W9P A;  1J4R A;  1FKL A;  2MPH A;  4DRK A;  3KAB A;  3KAD A;  1FKJ A;  4DRQ A;  2XP9 A;  3RFW A;  2DG3 A;  4IQC A;  4DRI A;  3I6C A;  3NTP A;  4J4N A;  1BKF A;  4TNS A;  2PPN A;  2DG4 A;  3O5E A;  4J4O A;  2KR7 A;  4FN2 A;  3KAF A;  4GIV A;  4TW8 A;  3TDB A;  2MLZ A;  4ODK A;  1J4I A;  3KAC A;  5DIV A;  3KAI A;  4G50 A;  2IF4 A;  2XPB A;  5DIU A;  1FKS A;  2KO7 A;  5HWB A;  1FKH A;  1EYM A;  2AWG A;  3WH0 A;  2PBC A;  1FKG A;  4QT3 A;  3PA7 A;  4GGQ A;  1A7X A;  2FAP A;  1KT1 A;  3IK8 A;  2XP4 A;  2MF9 A;  5HW6 A;  1Q6U A;  2LGO A;  2ZQV A;  5HTG A;  3IKD A;  2PV2 A;  4IPX A;  4U86 A;  2XP3 A;  2ZR5 A;  4C02 B;  3O5P A;  4DRM A;  1NMV A;  3KAH A;  4QIB A;  5HWC A;  1N1A A;  3CGM A;  1C9H A;  3O5K A;  4DZ2 A;  4ODO A;  1U79 A;  4MSP A;  3NRK A;  4ODP A;  4DIP A;  4DRP A;  3O5L A;  2JZV A;  4ITZ A;  4W9O A;  3UQB A;  3FAP A;  2KFW A;  1T11 A;  1FD9 A;  4DRN A;  4TW6 A;  1JNT A;  1ROT A;  1ROU A;  2RSE A;  1D7J A;  4N19 A;  5DIT A;  5BXJ A;  2PPO A;  3O5F A;  1Q6I A;  2D9F A;  1NMW A;  4TW7 A;  1R9H A;  1Q6H A;  1YAT A;  1QZ2 A;  3O5O A;  2ZQT A;  3B7X A;  1B6C A;  2MNT A;  2KGJ A;  2VN1 A;  1FKB A;  4U85 A;  4ODQ A;  3PRD A;  2OFN A;  1QPF A;  3LUO A;  4O2T A;  4TX0 A;  2VCD A;  2MLY A; 
#chains in the Genus database with same CATH topology
 3O5G A;  3O5M A;  2LPV A;  3UQI A;  1LL6 A;  4JFJ A;  3ARR A;  1PIN A;  1FJD A;  1FKK A;  2L2S A;  2ZR4 A;  2XP7 A;  1H0G A;  3UI6 A;  1H0I A;  4KR0 B;  2DSV A;  1FKT A;  3MDY B;  4ODL A;  4NZC A;  4P8V A;  5HW7 A;  4MGV A;  4ODN A;  4U84 A;  3NI6 A;  4R0X A;  1D2K A;  4MTV A;  3CHE A;  5GPG A;  1W9P A;  2PV3 A;  2WLY A;  3BMB A;  2G41 A;  4DWS A;  3PRB A;  3UI4 A;  2ZR6 A;  3WL0 A;  3JYM A;  2Y78 A;  1OWQ A;  2M2A A;  1FAP A;  3ARU A;  3CZ8 A;  3CH9 A;  3H9R B;  3TCZ A;  4IT6 A;  3EY6 A;  3ARY A;  2DT2 A;  1WNO A;  3GTY X;  4Z2H A;  1HXV A;  2PV1 A;  3JYJ A;  1FKI A;  2F21 A;  4DRJ A;  4DH0 A;  2DSU A;  4QT2 A;  1CTN A;  3GU0 A;  4UDM A;  2A3A A;  1EQ3 A;  1OGB A;  3ARS A;  1HKJ A;  4DRI A;  3ARX A;  2WK2 A;  3NTP A;  4TNS A;  3WIJ A;  5HBF A;  1X6N A;  3B9E A;  3KAF A;  4GIV A;  4TW8 A;  2MLZ A;  3KAC A;  1W1T A;  4G50 A;  2DT1 A;  3WH0 A;  1SR0 A;  1FKG A;  4MNM A;  5HW6 A;  2MF9 A;  2ZR5 A;  3ARZ A;  4C02 B;  4DRM A;  1NMV A;  1OGG A;  3O5K A;  4ODO A;  1VF8 A;  2A3B A;  4DRP A;  3B8S A;  4ITZ A;  4W9O A;  2KFW A;  4MNL A;  1JNT A;  1D7J A;  3O5F A;  1Q6I A;  4IT4 A;  4P8X A;  2QF8 A;  1FKB A;  2B31 A;  1ZBK A;  2PN0 A;  2OFN A;  3LUO A;  3PRD A;  2A3C A;  2FKE A;  4URI A;  1IX5 A;  4ZPT R;  2DPE A;  1LL7 A;  4W9Q A;  3GPK A;  1FKF A;  1E9L A;  1D7I A;  3RM8 A;  3OA5 A;  2PPP A;  2ZQS A;  4HAR A;  3ARP A;  4JYS A;  4ODM A;  4S3K A;  1O6I A;  4IQ2 A;  1NWS A;  3WL1 A;  3OOB A;  2N87 A;  4ZS6 A;  5HKG A;  1W26 A;  1NSG A;  1GOI A;  2ITK A;  1PBK A;  2LKN A;  1QPL A;  2M08 A;  1BL4 A;  2P4V A;  4NNR A;  1ZBV A;  3UI5 A;  4WK9 A;  1JNS A;  2YBT A;  1E6Z A;  1L1P A;  3UF8 A;  3WQV A;  4MNK A;  4DT4 A;  5HUA A;  1KT0 A;  1D6O A;  4JFL A;  3B9D A;  3KAG A;  2RUQ A;  4LAV A;  2YBU A;  2O9O A;  3UQA A;  3ARW A;  4WIW A;  2O92 A;  3IHZ A;  2ETN A;  3AS1 A;  1E6P A;  2KE0 A;  1FKL A;  3KAB A;  3RFW A;  3AS3 A;  2DG3 A;  1XRV A;  4IQC A;  4S3J A;  1BKF A;  3O5E A;  4J4O A;  3TDB A;  5DEZ A;  4ODK A;  1J4I A;  1NWU A;  2IF4 A;  1FKS A;  2KO7 A;  4QZV B;  1EYM A;  2AWG A;  4ZPV R;  4Z2J A;  1ZBC A;  4GGQ A;  4DWS C;  1JNE A;  4MPK A;  2XP4 A;  1LL4 A;  1Q6U A;  2ZQV A;  3IKD A;  2PV2 A;  4U86 A;  5DO2 A;  1NWR A;  1N1A A;  4PTM A;  1W1V A;  1NWT A;  4P8U A;  1LG2 A;  3WD3 A;  4ODP A;  1E44 A;  4Z2G A;  2JZV A;  3UQB A;  1ZU8 A;  2B5U B;  3ARQ A;  1FD9 A;  4N19 A;  4WJX A;  1XHG A;  1R9H A;  4KQZ A;  1EHN A;  1UR8 A;  4TX0 A;  4O2T A;  3WKZ A;  1JVW A;  3O5R A;  1F8A B;  2XP8 A;  4LAY A;  3RM4 A;  2UZ5 A;  1FFR A;  5DF0 A;  2F23 A;  3FXY A;  3KZ7 A;  4LAW A;  3RME A;  3IKG A;  3JXV A;  1E6N A;  1W9V A;  4MNJ A;  2ZQU A;  2XP5 A;  2OLH A;  4XAK A;  1M5Y A;  3EIP A;  3O5J A;  4AY1 A;  5I98 A;  4LAX A;  1HJV A;  1HKM A;  3RGC A;  1TCO C;  1E15 A;  2M1I A;  1E6R A;  1P5Q A;  1JCH B;  1WB0 A;  1HKI A;  3O5D A;  4DWS B;  3TC5 A;  3PRA A;  5HW8 A;  4JFM A;  2WLZ A;  1FKR A;  3AQU A;  1FKD A;  1W1Y A;  4JFK A;  2K8I A;  3CHF A;  3ODK A;  2MLX A;  2Q5A A;  2RQS A;  5D75 A;  2AOS A;  3ALF A;  4W5U A;  1Y0O A;  3WD4 A;  5HT1 A;  4TYO A;  3FY1 A;  2MPH A;  4DRK A;  2XP9 A;  4J4N A;  4WKH A;  1K9T A;  2DG4 A;  1GPF A;  4FN2 A;  1HKK A;  1LQ0 A;  5DIV A;  3AS2 A;  1ZL1 A;  1FFQ A;  1FKH A;  2WM0 A;  4QT3 A;  1ITX A;  1W1P A;  1HJX A;  5HTG A;  4IPX A;  3BXW A;  4Q22 A;  3AS0 A;  3KAH A;  4QIB A;  5HWC A;  1EIB A;  3CGM A;  1WAW A;  1C9H A;  4DZ2 A;  1W9U A;  1HJW A;  4Q7N A;  4MSP A;  3NRK A;  3WD0 A;  1SYT A;  5BXJ A;  1ROT A;  1ROU A;  2RSE A;  1GRJ A;  3G6M A;  2FDM A;  2D9F A;  1UR9 A;  1EDQ A;  1QZ2 A;  1RD6 A;  3O5O A;  1LJY A;  3B7X A;  2KGJ A;  2VN1 A;  1GUV A;  1QPF A;  2MLY A;  5B8I C;  3KCE A;  3QOK A;  3W4R A;  4ODR A;  1X6L A;  1ZCN A;  2XP6 A;  2XPA A;  2F2D A;  1Q1C A;  2DT0 A;  4BF8 A;  4Z2L A;  3WD1 A;  5GPR A;  1LG1 A;  3G6L A;  4Z2I A;  2DT3 A;  3WD2 A;  1ZBW A;  4R5E A;  2LJ4 A;  3CGN A;  1F40 A;  3ARV A;  4MAV A;  4JFI A;  1YW5 A;  1J4H A;  4FAP A;  1KFW A;  2RUD A;  4G2P A;  2DG9 A;  2G8Z A;  1D7H A;  4WKF A;  4Z2K A;  2RUC A;  3VAW A;  2KI3 A;  3ARO A;  4L72 B;  4DZ3 A;  2PI6 A;  4NSB A;  3O5I A;  2DSW A;  5GQB A;  2IUZ A;  1ZK6 A;  5J6E A;  4DRH A;  5JH8 A;  4DRO A;  3B9A A;  1J6Y A;  4WKA A;  3WQW A;  3O5Q A;  2F4E A;  1JND A;  1NH6 A;  1J4R A;  4W9P A;  3KAD A;  1FKJ A;  2ESC A;  4DRQ A;  1TFV A;  4ML4 A;  3I6C A;  2EUL A;  2PPN A;  4LGX A;  2KR7 A;  4HBE A;  3KAI A;  2XPB A;  5DIU A;  5HWB A;  2A3E A;  2PBC A;  3PA7 A;  1A7X A;  2FAP A;  3CHD A;  1KT1 A;  3IK8 A;  2LGO A;  2XP3 A;  3O5P A;  1ZB5 A;  3RM9 A;  1U79 A;  3ALG A;  4DIP A;  3O5L A;  3ART A;  3FAP A;  1T11 A;  4DRN A;  4TW6 A;  5DIT A;  4ZPW R;  2PPO A;  4TW7 A;  1NMW A;  1YAT A;  1Q6H A;  4P8W A;  2ZQT A;  2DSZ A;  1B6C A;  2MNT A;  4DWS D;  3PR9 A;  4L3N A;  3CHC A;  4U85 A;  4ODQ A;  2RUR A;  2VCD A;  4HBO A; 
#chains in the Genus database with same CATH homology
 3O5G A;  3O5M A;  2LPV A;  3UQI A;  1LL6 A;  4JFJ A;  3ARR A;  1PIN A;  1FJD A;  1FKK A;  2L2S A;  2ZR4 A;  2XP7 A;  1H0G A;  3UI6 A;  1H0I A;  4KR0 B;  2DSV A;  1FKT A;  3MDY B;  4ODL A;  4NZC A;  4P8V A;  5HW7 A;  4MGV A;  4ODN A;  4U84 A;  3NI6 A;  4R0X A;  1D2K A;  4MTV A;  3CHE A;  5GPG A;  1W9P A;  2PV3 A;  2WLY A;  2G41 A;  4DWS A;  3PRB A;  3UI4 A;  2ZR6 A;  3WL0 A;  3JYM A;  2Y78 A;  1OWQ A;  2M2A A;  1FAP A;  3ARU A;  3CZ8 A;  3CH9 A;  3H9R B;  3TCZ A;  4IT6 A;  3EY6 A;  3ARY A;  2DT2 A;  1WNO A;  4Z2H A;  1HXV A;  2PV1 A;  3JYJ A;  1FKI A;  2F21 A;  4DRJ A;  4DH0 A;  2DSU A;  4QT2 A;  1CTN A;  1EQ3 A;  2A3A A;  1OGB A;  3ARS A;  1HKJ A;  4DRI A;  3ARX A;  2WK2 A;  3NTP A;  4TNS A;  3WIJ A;  5HBF A;  1X6N A;  3B9E A;  3KAF A;  4GIV A;  4TW8 A;  2MLZ A;  3KAC A;  1W1T A;  4G50 A;  2DT1 A;  3WH0 A;  1SR0 A;  1FKG A;  4MNM A;  5HW6 A;  2MF9 A;  2ZR5 A;  3ARZ A;  4C02 B;  4DRM A;  1NMV A;  1OGG A;  3O5K A;  4ODO A;  1VF8 A;  2A3B A;  4DRP A;  3B8S A;  4ITZ A;  4W9O A;  2KFW A;  4MNL A;  1JNT A;  1D7J A;  3O5F A;  1Q6I A;  4IT4 A;  4P8X A;  2QF8 A;  1FKB A;  2B31 A;  1ZBK A;  3PRD A;  2OFN A;  3LUO A;  2A3C A;  2FKE A;  4URI A;  1IX5 A;  4ZPT R;  2DPE A;  1LL7 A;  4W9Q A;  3GPK A;  1FKF A;  1E9L A;  1D7I A;  3RM8 A;  3OA5 A;  2PPP A;  2ZQS A;  4HAR A;  3ARP A;  4JYS A;  4ODM A;  4S3K A;  1O6I A;  4IQ2 A;  1NWS A;  3WL1 A;  3OOB A;  2N87 A;  4ZS6 A;  5HKG A;  1W26 A;  1NSG A;  1GOI A;  2ITK A;  1PBK A;  2LKN A;  1QPL A;  2M08 A;  1BL4 A;  4NNR A;  1ZBV A;  3UI5 A;  4WK9 A;  1JNS A;  2YBT A;  1E6Z A;  1L1P A;  3UF8 A;  3WQV A;  4MNK A;  4DT4 A;  5HUA A;  1KT0 A;  1D6O A;  4JFL A;  3B9D A;  3KAG A;  2RUQ A;  4LAV A;  2YBU A;  2O9O A;  3UQA A;  3ARW A;  4WIW A;  2O92 A;  3IHZ A;  3AS1 A;  1E6P A;  2KE0 A;  1FKL A;  3KAB A;  3RFW A;  3AS3 A;  2DG3 A;  1XRV A;  4IQC A;  4S3J A;  1BKF A;  3O5E A;  4J4O A;  3TDB A;  5DEZ A;  4ODK A;  1J4I A;  1NWU A;  2IF4 A;  1FKS A;  2KO7 A;  4QZV B;  1EYM A;  2AWG A;  4ZPV R;  4Z2J A;  1ZBC A;  4GGQ A;  4DWS C;  1JNE A;  4MPK A;  2XP4 A;  1LL4 A;  1Q6U A;  2ZQV A;  3IKD A;  2PV2 A;  4U86 A;  5DO2 A;  1NWR A;  1N1A A;  4PTM A;  1W1V A;  1NWT A;  4P8U A;  1LG2 A;  3WD3 A;  4ODP A;  4Z2G A;  2JZV A;  3UQB A;  1ZU8 A;  3ARQ A;  1FD9 A;  4N19 A;  4WJX A;  1XHG A;  1R9H A;  4KQZ A;  1EHN A;  1UR8 A;  4TX0 A;  4O2T A;  3WKZ A;  1JVW A;  3O5R A;  1F8A B;  2XP8 A;  4LAY A;  3RM4 A;  2UZ5 A;  1FFR A;  5DF0 A;  3FXY A;  3KZ7 A;  4LAW A;  3RME A;  3IKG A;  3JXV A;  1E6N A;  1W9V A;  4MNJ A;  2ZQU A;  2XP5 A;  2OLH A;  4XAK A;  1M5Y A;  3O5J A;  4AY1 A;  5I98 A;  4LAX A;  1HJV A;  1HKM A;  3RGC A;  1TCO C;  1E15 A;  2M1I A;  1E6R A;  1P5Q A;  1WB0 A;  1HKI A;  3O5D A;  4DWS B;  3TC5 A;  3PRA A;  5HW8 A;  4JFM A;  2WLZ A;  1FKR A;  3AQU A;  1FKD A;  1W1Y A;  4JFK A;  2K8I A;  3CHF A;  3ODK A;  2MLX A;  2Q5A A;  2RQS A;  5D75 A;  2AOS A;  3ALF A;  4W5U A;  1Y0O A;  3WD4 A;  5HT1 A;  4TYO A;  3FY1 A;  2MPH A;  4DRK A;  2XP9 A;  4J4N A;  4WKH A;  1K9T A;  2DG4 A;  1GPF A;  4FN2 A;  1HKK A;  1LQ0 A;  5DIV A;  3AS2 A;  1ZL1 A;  1FFQ A;  1FKH A;  2WM0 A;  4QT3 A;  1ITX A;  1W1P A;  1HJX A;  5HTG A;  4IPX A;  3BXW A;  4Q22 A;  3AS0 A;  3KAH A;  4QIB A;  5HWC A;  1EIB A;  3CGM A;  1WAW A;  1C9H A;  4DZ2 A;  1W9U A;  1HJW A;  4Q7N A;  4MSP A;  3NRK A;  3WD0 A;  1SYT A;  5BXJ A;  1ROT A;  1ROU A;  2RSE A;  3G6M A;  2FDM A;  2D9F A;  1UR9 A;  1EDQ A;  1QZ2 A;  1RD6 A;  3O5O A;  1LJY A;  3B7X A;  2KGJ A;  2VN1 A;  1GUV A;  1QPF A;  2MLY A;  5B8I C;  3KCE A;  3QOK A;  3W4R A;  4ODR A;  1X6L A;  1ZCN A;  2XP6 A;  2XPA A;  2F2D A;  1Q1C A;  2DT0 A;  4BF8 A;  4Z2L A;  3WD1 A;  5GPR A;  1LG1 A;  3G6L A;  4Z2I A;  2DT3 A;  3WD2 A;  1ZBW A;  4R5E A;  2LJ4 A;  3CGN A;  1F40 A;  3ARV A;  4MAV A;  4JFI A;  1YW5 A;  1J4H A;  4FAP A;  1KFW A;  2RUD A;  4G2P A;  2DG9 A;  2G8Z A;  1D7H A;  4WKF A;  4Z2K A;  2RUC A;  3VAW A;  2KI3 A;  3ARO A;  4L72 B;  4DZ3 A;  2PI6 A;  4NSB A;  3O5I A;  2DSW A;  5GQB A;  2IUZ A;  1ZK6 A;  5J6E A;  4DRH A;  5JH8 A;  4DRO A;  3B9A A;  1J6Y A;  4WKA A;  3WQW A;  3O5Q A;  2F4E A;  1JND A;  1NH6 A;  1J4R A;  4W9P A;  3KAD A;  1FKJ A;  2ESC A;  4DRQ A;  1TFV A;  4ML4 A;  3I6C A;  2PPN A;  4LGX A;  2KR7 A;  4HBE A;  3KAI A;  2XPB A;  5DIU A;  5HWB A;  2A3E A;  2PBC A;  3PA7 A;  1A7X A;  2FAP A;  3CHD A;  1KT1 A;  3IK8 A;  2LGO A;  2XP3 A;  3O5P A;  1ZB5 A;  3RM9 A;  1U79 A;  3ALG A;  4DIP A;  3O5L A;  3ART A;  3FAP A;  1T11 A;  4DRN A;  4TW6 A;  5DIT A;  4ZPW R;  2PPO A;  4TW7 A;  1NMW A;  1YAT A;  1Q6H A;  4P8W A;  2ZQT A;  2DSZ A;  1B6C A;  2MNT A;  4DWS D;  3PR9 A;  4L3N A;  3CHC A;  4U85 A;  4ODQ A;  2RUR A;  2VCD A;  4HBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...