3KACA

Structure-guided design of alpha-amino acid-derived pin1 inhibitors
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
113
structure length
113
Chain Sequence
EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-guided design of alpha-amino acid-derived Pin1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 39
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kacA00
4J4OA 2XP8A 2RUCA 2MPHA 3OOBA 4DRMA 3UQBA 2Y78A 1Q6HA 1FKSA 4IPXA 4TX0A 2LKNA 2ZR5A 4QT2A 5I98A 3UQAA 4ODLA 5HW8A 1ROUA 1FKRA 2MLXA 3B7XA 3O5KA 4DROA 1P5QA 4ODPA 1J4HA 5GPGA 3O5FA 4W9OA 5BXJA 1KT0A 1ROTA 2ITKA 2M1IA 2VCDA 2ZQUA 3FAPA 2ZQTA 2XPBA 3GPKA 1Q6IA 3IK8A 3KAHA 1L1PA 2ZR4A 2XP6A 1FKGA 1NSGA 2OFNA 2RSEA 4ODMA 5DIUA 2KE0A 2MF9A 3TDBA 3KZ7A 1R9HA 3O5RA 2PBCA 3O5GA 4NNRA 2F2DA 1ZK6A 2PV2A 2XPAA 3KAGA 5HT1A 2FKEA 3PRDA 5DIVA 2DG4A 4JFIA 2M08A 2ZQSA 2L2SA 3PRBA 3UQIA 1W26A 1Q6UA 1JVWA 4DRIA 3ODKA 4ODNA 1F40A 3NI6A 4GGQA 3I6CA 1HXVA 1J6YA 4O2TA 3CGNA 2PV1A 2ZR6A 3O5DA 1YATA 3O5QA 4DRQA 1Q1CA 1BKFA 2KGJA 4ODQA 4TW7A 4LAWA 4LAVA 1ZCNA 4ITZA 3TCZA 1M5YA 4MSPA 3O5OA 4G50A 3KABA 2M2AA 2F4EA 5HTGA 4TYOA 1FKLA 2XP5A 4GIVA 4JFJA 3NRKA 4MGVA 3PA7A 4DRKA 4DZ2A 3O5EA 2KR7A 2LPVA 4IQ2A 5HW6A 1JNSA 4W9QA 1FKFA 1FD9A 4DH0A 2PPNA 1KT1A 1PBKA 1FKJA 2RQSA 4LAXA 5HWBA 1D7IA 1FKDA 4DRHA 2PV3A 3O5IA 1QZ2A 1F8AB 2MLYA 3UF8A 2N87A 1FKTA 4W9PA 1TCOC 3NTPA 1EYMA 1FKKA 3RGCA 2KI3A 2RUDA 3KAIA 3CGMA 3KCEA 4U84A 4JFMA 5HKGA 1T11A 2VN1A 4JFLA 1NMVA 4ODOA 4DRNA 3TC5A 5HW7A 2LJ4A 3KACA 4JFKA 1D6OA 2JZVA 3EY6A 3UI6A 1PINA 4U85A 4DRJA 2IF4A 1U79A 5D75A 1EQ3A 4FN2A 3UI5A 2KO7A 3WH0A 4C02B 1J4IA 2XP9A 2FAPA 4LAYA 3KAFA 1C9HA 4FAPA 4ODRA 3O5JA 5HUAA 3KADA 1JNTA 1D7HA 2LGOA 2PPOA 4R0XA 2Q5AA 1BL4A 2XP7A 2F21A 2RURA 3JYMA 3O5PA 4U86A 1FKIA 3RFWA 1J4RA 3IHZA 1Y0OA 3O5LA 1FKHA 3MDYB 2AWGA 4J4NA 4JYSA 4DZ3A 5DITA 2MLZA 4ODKA 4N19A 4DRPA 5B8IC 1N1AA 2UZ5A 3JXVA 4QIBA 3IKGA 5HWCA 4IQCA 3VAWA 1YW5A 3JYJA 2RUQA 3LUOA 2DG3A 3O5MA 1FKBA 2XP3A 2ZQVA 4TNSA 4TW6A 1QPLA 5J6EA 1D7JA 1FJDA 4BF8A 4TW8A 2K8IA 2PPPA 1FAPA 1B6CA 1NMWA 2DG9A 3IKDA 4G2PA 4DT4A 3H9RB 2KFWA 3UI4A 4QT3A 2XP4A 2D9FA 4DIPA 2MNTA 1QPFA 1A7XA
chains in the Genus database with same CATH superfamily
4LGXA 2MPHA 1UR8A 3WD1A 4ODLA 4PTMA 4ZS6A 3WQWA 1ROUA 1JCHB 2YBUA 1LL7A 3B7XA 1HJWA 1P5QA 3AS0A 1VF8A 1J4HA 2IUZA 3CHCA 1KT0A 2VCDA 1W1VA 3IK8A 5GQBA 1ZL1A 4DWSD 2A3EA 3O5GA 4NNRA 1ZK6A 1W9PA 4Z2LA 4JFIA 2DSVA 2ZQSA 3PRBA 1Q6UA 1JVWA 1NWRA 3I6CA 4WIWA 1HXVA 1W1TA 1J6YA 4O2TA 3WL0A 4IT6A 4ITZA 4MSPA 3O5OA 2DT3A 4G50A 2F4EA 1EIBA 4JFJA 2EULA 2LPVA 4IQ2A 5HW6A 3PR9A 4W9QA 1LJYA 1FKFA 3ARQA 3CHDA 1PBKA 2RQSA 4WKFA 1D7IA 4XAKA 1W1PA 1FKTA 5GPRA 1HKIA 1EYMA 2OLHA 4DRNA 2VN1A 5HW7A 2JZVA 3EY6A 2DSUA 4NSBA 4WK9A 1W1YA 1HKMA 2KO7A 3ARTA 3ARRA 3WH0A 1FFQA 4NZCA 3B9EA 1ZBKA 1NWTA 1HKJA 3CH9A 2LGOA 4R0XA 3AS1A 2Q5AA 1BL4A 2O9OA 3PRAA 3RFWA 1J4RA 1FFRA 1ITXA 3IHZA 1Y0OA 3MDYB 2AWGA 3CHFA 3B9AA 5DITA 1O6IA 4ODKA 4URIA 4N19A 1LQ0A 1OGGA 1N1AA 5B8IC 4QIBA 3IKGA 5HWCA 4IQCA 1LL6A 1H0IA 3O5MA 3ALFA 1FKBA 2XP3A 4TW6A 1QPLA 5J6EA 2PPPA 1FAPA 1B6CA 1NMWA 2F23A 4G2PA 4DT4A 4Z2JA 4DROA 3TC5A 2DG4A 1QPFA 3B8SA 2XP8A 3W4RA 1GOIA 1Q6HA 2Y78A 1EHNA 4TX0A 2ZR5A 1RD6A 2FDMA 1OWQA 5HW8A 1E6PA 1FKRA 2MLXA 1ROTA 3FAPA 1L1PA 4MNKA 1XRVA 4QZVB 4ODMA 2DSZA 2KE0A 2MF9A 4HBEA 2G41A 2B5UB 2XPAA 3KAGA 2PN0A 5HT1A 4P8WA 5DIVA 1K9TA 2M08A 3RM4A 1HJVA 3UQIA 4ZPTR 3ODKA 1CTNA 1JNDA 2PV1A 1W9VA 3EIPA 4DRQA 1BKFA 1IX5A 4WKAA 2YBTA 3KABA 4DWSB 4GIVA 2ETNA 3AROA 4DRKA 4DZ2A 2KR7A 1X6LA 4DH0A 5HWBA 1FKJA 2DSWA 4LAXA 1FKDA 1GRJA 3O5IA 1EDQA 2DT1A 4Q22A 2KI3A 3KCEA 5HKGA 1W9UA 1NMVA 1D6OA 4Q7NA 1E6ZA 1UR9A 3UI5A 4C02B 2XP9A 3KAFA 4ODRA 3O5JA 2DT2A 4UDMA 1XHGA 3KADA 5HUAA 2B31A 5DO2A 2XP7A 3O5LA 4J4NA 1E6NA 4DZ3A 4MAVA 3ARZA 4DRPA 2A3AA 1WNOA 1E6RA 2WLZA 3CZ8A 4HBOA 3VAWA 3ARPA 2RUQA 4DWSA 2DG3A 4Z2GA 1FJDA 4BF8A 3IKDA 5JH8A 3UI4A 2D9FA 2MNTA 4S3JA 1A7XA 3FXYA 4DRMA 2RUCA 3RM8A 3UQBA 1FKSA 1LG1A 3OA5A 5GPGA 2WM0A 3KAHA 2ZQTA 1Q6IA 5DF0A 1FKGA 1NSGA 1WAWA 2OFNA 2RSEA 5DIUA 3TDBA 3KZ7A 3ARVA 2A3CA 3ARXA 3G6MA 2FKEA 3PRDA 3G6LA 4DRIA 1W26A 4ODNA 3NI6A 4GGQA 3WL1A 3CGNA 3ARYA 4HARA 1SYTA 1YATA 1ZBVA 4W5UA 4TW7A 4LAVA 2P4VA 1ZCNA 3TCZA 1M5YA 2M2AA 2DPEA 5HTGA 4TYOA 1FKLA 3PA7A 3O5EA 2G8ZA 3BXWA 1NH6A 3GU0A 3BMBA 4DWSC 1X6NA 4MNJA 4W9PA 1TCOC 3CHEA 3RGCA 3ARWA 3KAIA 3CGMA 4JFMA 1T11A 1NWSA 4JFLA 3WQVA 2LJ4A 4JFKA 3UI6A 4U85A 1GUVA 2IF4A 4DRJA 4FN2A 3WD3A 1J4IA 3AS2A 2FAPA 4LAYA 3WIJA 1C9HA 1NWUA 1WB0A 4Z2IA 1E9LA 2F21A 2RURA 3JYMA 2WLYA 1OGBA 1ZBWA 1ZB5A 3WD4A 1ZU8A 2AOSA 4P8VA 3LUOA 4TNSA 1D7JA 4TW8A 2K8IA 2DG9A 2KFWA 1U79A 4FAPA 4J4OA 3OOBA 4MTVA 4IPXA 2LKNA 4QT2A 5I98A 1LL4A 3UQAA 1KFWA 4S3KA 3FY1A 1ZBCA 1SR0A 3O5KA 1JNEA 4ODPA 3O5FA 4W9OA 5BXJA 2ITKA 2M1IA 2ZQUA 3GPKA 2XPBA 4P8UA 2ZR4A 3AS3A 1HKKA 1E44A 2XP6A 4Z2HA 3WKZA 1R9HA 3O5RA 2PBCA 2F2DA 3GTYX 2PV2A 3RMEA 4L3NA 4MNMA 4R5EA 2L2SA 1F40A 3ARUA 4P8XA 2O92A 3O5DA 3O5QA 4AY1A 1Q1CA 2KGJA 4MNLA 4ODQA 4LAWA 2XP5A 4WJXA 3NRKA 4MGVA 1D2KA 1JNSA 1HJXA 1FD9A 2PPNA 1KT1A 2ESCA 4DRHA 2PI6A 2PV3A 1QZ2A 1F8AB 1GPFA 2MLYA 3UF8A 2N87A 4KQZA 3AQUA 3NTPA 1FKKA 2RUDA 4U84A 3QOKA 4ODOA 3ALGA 4Z2KA 3KACA 4IT4A 1PINA 4KR0B 5HBFA 5D75A 2DT0A 4ZPVR 1EQ3A 3ARSA 1JNTA 1D7HA 2PPOA 3WD2A 3O5PA 4U86A 1FKIA 3RM9A 4ML4A 1FKHA 2WK2A 2QF8A 4JYSA 2MLZA 5DEZA 2UZ5A 3JXVA 1H0GA 4WKHA 4L72B 4ZPWR 1TFVA 1YW5A 1LG2A 3JYJA 4MPKA 1E15A 2ZQVA 3WD0A 2A3BA 3B9DA 3H9RB 4QT3A 2XP4A 4DIPA 2ZR6A
chains in the Genus database with same CATH topology
4LGXA 2MPHA 1UR8A 3WD1A 4ODLA 4PTMA 4ZS6A 3WQWA 1ROUA 2YBUA 1LL7A 3B7XA 1HJWA 1P5QA 3AS0A 1VF8A 1J4HA 2IUZA 3CHCA 1KT0A 2VCDA 1W1VA 3IK8A 5GQBA 1ZL1A 4DWSD 2A3EA 3O5GA 4NNRA 1ZK6A 1W9PA 4Z2LA 4JFIA 2DSVA 2ZQSA 3PRBA 1Q6UA 1JVWA 1NWRA 3I6CA 4WIWA 1HXVA 1W1TA 1J6YA 4O2TA 3WL0A 4IT6A 4ITZA 4MSPA 3O5OA 2DT3A 4G50A 2F4EA 1EIBA 4JFJA 2LPVA 4IQ2A 5HW6A 3PR9A 4W9QA 1LJYA 1FKFA 3ARQA 3CHDA 1PBKA 2RQSA 4WKFA 1D7IA 4XAKA 1W1PA 1FKTA 5GPRA 1HKIA 1EYMA 2OLHA 4DRNA 2VN1A 5HW7A 2JZVA 3EY6A 2DSUA 4NSBA 4WK9A 1W1YA 1HKMA 2KO7A 3ARTA 3ARRA 3WH0A 1FFQA 4NZCA 3B9EA 1ZBKA 1NWTA 1HKJA 3CH9A 2LGOA 4R0XA 3AS1A 2Q5AA 1BL4A 2O9OA 3PRAA 3RFWA 1J4RA 1FFRA 1ITXA 3IHZA 1Y0OA 3MDYB 2AWGA 3CHFA 3B9AA 5DITA 1O6IA 4ODKA 4URIA 4N19A 1LQ0A 1OGGA 1N1AA 5B8IC 4QIBA 3IKGA 5HWCA 4IQCA 1LL6A 1H0IA 3O5MA 3ALFA 1FKBA 2XP3A 4TW6A 1QPLA 5J6EA 2PPPA 1FAPA 1B6CA 1NMWA 4G2PA 4DT4A 4Z2JA 4DROA 3TC5A 2DG4A 1QPFA 3B8SA 2XP8A 3W4RA 1GOIA 1Q6HA 2Y78A 1EHNA 4TX0A 2ZR5A 1RD6A 2FDMA 1OWQA 5HW8A 1E6PA 1FKRA 2MLXA 1ROTA 3FAPA 1L1PA 4MNKA 1XRVA 4QZVB 4ODMA 2DSZA 2KE0A 2MF9A 4HBEA 2G41A 2XPAA 3KAGA 5HT1A 4P8WA 5DIVA 1K9TA 2M08A 3RM4A 1HJVA 3UQIA 4ZPTR 3ODKA 1CTNA 1JNDA 2PV1A 1W9VA 4DRQA 1BKFA 1IX5A 4WKAA 2YBTA 3KABA 4DWSB 4GIVA 3AROA 4DRKA 4DZ2A 2KR7A 1X6LA 4DH0A 5HWBA 1FKJA 2DSWA 4LAXA 1FKDA 3O5IA 1EDQA 2DT1A 4Q22A 2KI3A 3KCEA 5HKGA 1W9UA 1NMVA 1D6OA 4Q7NA 1E6ZA 1UR9A 3UI5A 4C02B 2XP9A 3KAFA 4ODRA 3O5JA 2DT2A 5HUAA 1XHGA 3KADA 2B31A 5DO2A 2XP7A 3O5LA 4J4NA 1E6NA 4DZ3A 4MAVA 3ARZA 4DRPA 2A3AA 1WNOA 1E6RA 2WLZA 3CZ8A 4HBOA 3VAWA 3ARPA 2RUQA 4DWSA 2DG3A 4Z2GA 1FJDA 4BF8A 3IKDA 5JH8A 3UI4A 2D9FA 2MNTA 4S3JA 1A7XA 3FXYA 4DRMA 2RUCA 3RM8A 3UQBA 1FKSA 1LG1A 3OA5A 5GPGA 2WM0A 3KAHA 2ZQTA 1Q6IA 5DF0A 1FKGA 1NSGA 1WAWA 2OFNA 2RSEA 5DIUA 3TDBA 3KZ7A 3ARVA 2A3CA 3ARXA 3G6MA 2FKEA 3PRDA 3G6LA 4DRIA 1W26A 4ODNA 3NI6A 4GGQA 3WL1A 3CGNA 3ARYA 4HARA 1SYTA 1YATA 1ZBVA 4W5UA 4TW7A 4LAVA 1ZCNA 3TCZA 1M5YA 2M2AA 2DPEA 5HTGA 4TYOA 1FKLA 3PA7A 3O5EA 2G8ZA 3BXWA 1NH6A 4DWSC 1X6NA 4MNJA 4W9PA 1TCOC 3CHEA 3RGCA 3ARWA 3KAIA 3CGMA 4JFMA 1T11A 1NWSA 4JFLA 3WQVA 2LJ4A 4JFKA 3UI6A 4U85A 1GUVA 2IF4A 4DRJA 4FN2A 3WD3A 1J4IA 3AS2A 2FAPA 4LAYA 3WIJA 1C9HA 1NWUA 1WB0A 4Z2IA 1E9LA 2F21A 2RURA 3JYMA 2WLYA 1OGBA 1ZBWA 1ZB5A 3WD4A 1ZU8A 2AOSA 4P8VA 3LUOA 4TNSA 1D7JA 4TW8A 2K8IA 2DG9A 2KFWA 1U79A 4FAPA 4J4OA 3OOBA 4MTVA 4IPXA 2LKNA 4QT2A 5I98A 1LL4A 3UQAA 1KFWA 4S3KA 3FY1A 1ZBCA 1SR0A 3O5KA 1JNEA 4ODPA 3O5FA 4W9OA 5BXJA 2ITKA 2M1IA 2ZQUA 3GPKA 2XPBA 4P8UA 2ZR4A 3AS3A 1HKKA 2XP6A 4Z2HA 3WKZA 1R9HA 3O5RA 2PBCA 2F2DA 2PV2A 3RMEA 4L3NA 4MNMA 4R5EA 2L2SA 1F40A 3ARUA 4P8XA 2O92A 3O5DA 3O5QA 4AY1A 1Q1CA 2KGJA 4MNLA 4ODQA 4LAWA 2XP5A 4WJXA 3NRKA 4MGVA 1D2KA 1JNSA 1HJXA 1FD9A 2PPNA 1KT1A 2ESCA 4DRHA 2PI6A 2PV3A 1QZ2A 1F8AB 1GPFA 2MLYA 3UF8A 2N87A 4KQZA 3AQUA 3NTPA 1FKKA 2RUDA 4U84A 3QOKA 4ODOA 3ALGA 4Z2KA 3KACA 4IT4A 1PINA 4KR0B 5HBFA 5D75A 2DT0A 4ZPVR 1EQ3A 3ARSA 1JNTA 1D7HA 2PPOA 3WD2A 3O5PA 4U86A 1FKIA 3RM9A 4ML4A 1FKHA 2WK2A 2QF8A 4JYSA 2MLZA 5DEZA 2UZ5A 3JXVA 1H0GA 4WKHA 4L72B 4ZPWR 1TFVA 1YW5A 1LG2A 3JYJA 4MPKA 1E15A 2ZQVA 3WD0A 2A3BA 3B9DA 3H9RB 4QT3A 2XP4A 4DIPA 2ZR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J4O A;  2XP8 A;  2RUC A;  2MPH A;  3OOB A;  4DRM A;  3UQB A;  2Y78 A;  1Q6H A;  1FKS A;  4IPX A;  4TX0 A;  2LKN A;  2ZR5 A;  4QT2 A;  5I98 A;  3UQA A;  4ODL A;  5HW8 A;  1ROU A;  1FKR A;  2MLX A;  3B7X A;  3O5K A;  4DRO A;  1P5Q A;  4ODP A;  1J4H A;  5GPG A;  3O5F A;  4W9O A;  5BXJ A;  1KT0 A;  1ROT A;  2ITK A;  2M1I A;  2VCD A;  2ZQU A;  3FAP A;  2ZQT A;  2XPB A;  3GPK A;  1Q6I A;  3IK8 A;  3KAH A;  1L1P A;  2ZR4 A;  2XP6 A;  1FKG A;  1NSG A;  2OFN A;  2RSE A;  4ODM A;  5DIU A;  2KE0 A;  2MF9 A;  3TDB A;  3KZ7 A;  1R9H A;  3O5R A;  2PBC A;  3O5G A;  4NNR A;  2F2D A;  1ZK6 A;  2PV2 A;  2XPA A;  3KAG A;  5HT1 A;  2FKE A;  3PRD A;  5DIV A;  2DG4 A;  4JFI A;  2M08 A;  2ZQS A;  2L2S A;  3PRB A;  3UQI A;  1W26 A;  1Q6U A;  1JVW A;  4DRI A;  3ODK A;  4ODN A;  1F40 A;  3NI6 A;  4GGQ A;  3I6C A;  1HXV A;  1J6Y A;  4O2T A;  3CGN A;  2PV1 A;  2ZR6 A;  3O5D A;  1YAT A;  3O5Q A;  4DRQ A;  1Q1C A;  1BKF A;  2KGJ A;  4ODQ A;  4TW7 A;  4LAW A;  4LAV A;  1ZCN A;  4ITZ A;  3TCZ A;  1M5Y A;  4MSP A;  3O5O A;  4G50 A;  3KAB A;  2M2A A;  2F4E A;  5HTG A;  4TYO A;  1FKL A;  2XP5 A;  4GIV A;  4JFJ A;  3NRK A;  4MGV A;  3PA7 A;  4DRK A;  4DZ2 A;  3O5E A;  2KR7 A;  2LPV A;  4IQ2 A;  5HW6 A;  1JNS A;  4W9Q A;  1FKF A;  1FD9 A;  4DH0 A;  2PPN A;  1KT1 A;  1PBK A;  1FKJ A;  2RQS A;  4LAX A;  5HWB A;  1D7I A;  1FKD A;  4DRH A;  2PV3 A;  3O5I A;  1QZ2 A;  1F8A B;  2MLY A;  3UF8 A;  2N87 A;  1FKT A;  4W9P A;  1TCO C;  3NTP A;  1EYM A;  1FKK A;  3RGC A;  2KI3 A;  2RUD A;  3KAI A;  3CGM A;  3KCE A;  4U84 A;  4JFM A;  5HKG A;  1T11 A;  2VN1 A;  4JFL A;  1NMV A;  4ODO A;  4DRN A;  3TC5 A;  5HW7 A;  2LJ4 A;  3KAC A;  4JFK A;  1D6O A;  2JZV A;  3EY6 A;  3UI6 A;  1PIN A;  4U85 A;  4DRJ A;  2IF4 A;  1U79 A;  5D75 A;  1EQ3 A;  4FN2 A;  3UI5 A;  2KO7 A;  3WH0 A;  4C02 B;  1J4I A;  2XP9 A;  2FAP A;  4LAY A;  3KAF A;  1C9H A;  4FAP A;  4ODR A;  3O5J A;  5HUA A;  3KAD A;  1JNT A;  1D7H A;  2LGO A;  2PPO A;  4R0X A;  2Q5A A;  1BL4 A;  2XP7 A;  2F21 A;  2RUR A;  3JYM A;  3O5P A;  4U86 A;  1FKI A;  3RFW A;  1J4R A;  3IHZ A;  1Y0O A;  3O5L A;  1FKH A;  3MDY B;  2AWG A;  4J4N A;  4JYS A;  4DZ3 A;  5DIT A;  2MLZ A;  4ODK A;  4N19 A;  4DRP A;  5B8I C;  1N1A A;  2UZ5 A;  3JXV A;  4QIB A;  3IKG A;  5HWC A;  4IQC A;  3VAW A;  1YW5 A;  3JYJ A;  2RUQ A;  3LUO A;  2DG3 A;  3O5M A;  1FKB A;  2XP3 A;  2ZQV A;  4TNS A;  4TW6 A;  1QPL A;  5J6E A;  1D7J A;  1FJD A;  4BF8 A;  4TW8 A;  2K8I A;  2PPP A;  1FAP A;  1B6C A;  1NMW A;  2DG9 A;  3IKD A;  4G2P A;  4DT4 A;  3H9R B;  2KFW A;  3UI4 A;  4QT3 A;  2XP4 A;  2D9F A;  4DIP A;  2MNT A;  1QPF A;  1A7X A; 
#chains in the Genus database with same CATH topology
 4LGX A;  2MPH A;  1UR8 A;  3WD1 A;  4ODL A;  4PTM A;  4ZS6 A;  3WQW A;  1ROU A;  1JCH B;  2YBU A;  1LL7 A;  3B7X A;  1HJW A;  1P5Q A;  3AS0 A;  1VF8 A;  1J4H A;  2IUZ A;  3CHC A;  1KT0 A;  2VCD A;  1W1V A;  3IK8 A;  5GQB A;  1ZL1 A;  4DWS D;  2A3E A;  3O5G A;  4NNR A;  1ZK6 A;  1W9P A;  4Z2L A;  4JFI A;  2DSV A;  2ZQS A;  3PRB A;  1Q6U A;  1JVW A;  1NWR A;  3I6C A;  4WIW A;  1HXV A;  1W1T A;  1J6Y A;  4O2T A;  3WL0 A;  4IT6 A;  4ITZ A;  4MSP A;  3O5O A;  2DT3 A;  4G50 A;  2F4E A;  1EIB A;  4JFJ A;  2EUL A;  2LPV A;  4IQ2 A;  5HW6 A;  3PR9 A;  4W9Q A;  1LJY A;  1FKF A;  3ARQ A;  3CHD A;  1PBK A;  2RQS A;  4WKF A;  1D7I A;  4XAK A;  1W1P A;  1FKT A;  5GPR A;  1HKI A;  1EYM A;  2OLH A;  4DRN A;  2VN1 A;  5HW7 A;  2JZV A;  3EY6 A;  2DSU A;  4NSB A;  4WK9 A;  1W1Y A;  1HKM A;  2KO7 A;  3ART A;  3ARR A;  3WH0 A;  1FFQ A;  4NZC A;  3B9E A;  1ZBK A;  1NWT A;  1HKJ A;  3CH9 A;  2LGO A;  4R0X A;  3AS1 A;  2Q5A A;  1BL4 A;  2O9O A;  3PRA A;  3RFW A;  1J4R A;  1FFR A;  1ITX A;  3IHZ A;  1Y0O A;  3MDY B;  2AWG A;  3CHF A;  3B9A A;  5DIT A;  1O6I A;  4ODK A;  4URI A;  4N19 A;  1LQ0 A;  1OGG A;  1N1A A;  5B8I C;  4QIB A;  3IKG A;  5HWC A;  4IQC A;  1LL6 A;  1H0I A;  3O5M A;  3ALF A;  1FKB A;  2XP3 A;  4TW6 A;  1QPL A;  5J6E A;  2PPP A;  1FAP A;  1B6C A;  1NMW A;  2F23 A;  4G2P A;  4DT4 A;  4Z2J A;  4DRO A;  3TC5 A;  2DG4 A;  1QPF A;  3B8S A;  2XP8 A;  3W4R A;  1GOI A;  1Q6H A;  2Y78 A;  1EHN A;  4TX0 A;  2ZR5 A;  1RD6 A;  2FDM A;  1OWQ A;  5HW8 A;  1E6P A;  1FKR A;  2MLX A;  1ROT A;  3FAP A;  1L1P A;  4MNK A;  1XRV A;  4QZV B;  4ODM A;  2DSZ A;  2KE0 A;  2MF9 A;  4HBE A;  2G41 A;  2B5U B;  2XPA A;  3KAG A;  2PN0 A;  5HT1 A;  4P8W A;  5DIV A;  1K9T A;  2M08 A;  3RM4 A;  1HJV A;  3UQI A;  4ZPT R;  3ODK A;  1CTN A;  1JND A;  2PV1 A;  1W9V A;  3EIP A;  4DRQ A;  1BKF A;  1IX5 A;  4WKA A;  2YBT A;  3KAB A;  4DWS B;  4GIV A;  2ETN A;  3ARO A;  4DRK A;  4DZ2 A;  2KR7 A;  1X6L A;  4DH0 A;  5HWB A;  1FKJ A;  2DSW A;  4LAX A;  1FKD A;  1GRJ A;  3O5I A;  1EDQ A;  2DT1 A;  4Q22 A;  2KI3 A;  3KCE A;  5HKG A;  1W9U A;  1NMV A;  1D6O A;  4Q7N A;  1E6Z A;  1UR9 A;  3UI5 A;  4C02 B;  2XP9 A;  3KAF A;  4ODR A;  3O5J A;  2DT2 A;  4UDM A;  1XHG A;  3KAD A;  5HUA A;  2B31 A;  5DO2 A;  2XP7 A;  3O5L A;  4J4N A;  1E6N A;  4DZ3 A;  4MAV A;  3ARZ A;  4DRP A;  2A3A A;  1WNO A;  1E6R A;  2WLZ A;  3CZ8 A;  4HBO A;  3VAW A;  3ARP A;  2RUQ A;  4DWS A;  2DG3 A;  4Z2G A;  1FJD A;  4BF8 A;  3IKD A;  5JH8 A;  3UI4 A;  2D9F A;  2MNT A;  4S3J A;  1A7X A;  3FXY A;  4DRM A;  2RUC A;  3RM8 A;  3UQB A;  1FKS A;  1LG1 A;  3OA5 A;  5GPG A;  2WM0 A;  3KAH A;  2ZQT A;  1Q6I A;  5DF0 A;  1FKG A;  1NSG A;  1WAW A;  2OFN A;  2RSE A;  5DIU A;  3TDB A;  3KZ7 A;  3ARV A;  2A3C A;  3ARX A;  3G6M A;  2FKE A;  3PRD A;  3G6L A;  4DRI A;  1W26 A;  4ODN A;  3NI6 A;  4GGQ A;  3WL1 A;  3CGN A;  3ARY A;  4HAR A;  1SYT A;  1YAT A;  1ZBV A;  4W5U A;  4TW7 A;  4LAV A;  2P4V A;  1ZCN A;  3TCZ A;  1M5Y A;  2M2A A;  2DPE A;  5HTG A;  4TYO A;  1FKL A;  3PA7 A;  3O5E A;  2G8Z A;  3BXW A;  1NH6 A;  3GU0 A;  3BMB A;  4DWS C;  1X6N A;  4MNJ A;  4W9P A;  1TCO C;  3CHE A;  3RGC A;  3ARW A;  3KAI A;  3CGM A;  4JFM A;  1T11 A;  1NWS A;  4JFL A;  3WQV A;  2LJ4 A;  4JFK A;  3UI6 A;  4U85 A;  1GUV A;  2IF4 A;  4DRJ A;  4FN2 A;  3WD3 A;  1J4I A;  3AS2 A;  2FAP A;  4LAY A;  3WIJ A;  1C9H A;  1NWU A;  1WB0 A;  4Z2I A;  1E9L A;  2F21 A;  2RUR A;  3JYM A;  2WLY A;  1OGB A;  1ZBW A;  1ZB5 A;  3WD4 A;  1ZU8 A;  2AOS A;  4P8V A;  3LUO A;  4TNS A;  1D7J A;  4TW8 A;  2K8I A;  2DG9 A;  2KFW A;  1U79 A;  4FAP A;  4J4O A;  3OOB A;  4MTV A;  4IPX A;  2LKN A;  4QT2 A;  5I98 A;  1LL4 A;  3UQA A;  1KFW A;  4S3K A;  3FY1 A;  1ZBC A;  1SR0 A;  3O5K A;  1JNE A;  4ODP A;  3O5F A;  4W9O A;  5BXJ A;  2ITK A;  2M1I A;  2ZQU A;  3GPK A;  2XPB A;  4P8U A;  2ZR4 A;  3AS3 A;  1HKK A;  1E44 A;  2XP6 A;  4Z2H A;  3WKZ A;  1R9H A;  3O5R A;  2PBC A;  2F2D A;  3GTY X;  2PV2 A;  3RME A;  4L3N A;  4MNM A;  4R5E A;  2L2S A;  1F40 A;  3ARU A;  4P8X A;  2O92 A;  3O5D A;  3O5Q A;  4AY1 A;  1Q1C A;  2KGJ A;  4MNL A;  4ODQ A;  4LAW A;  2XP5 A;  4WJX A;  3NRK A;  4MGV A;  1D2K A;  1JNS A;  1HJX A;  1FD9 A;  2PPN A;  1KT1 A;  2ESC A;  4DRH A;  2PI6 A;  2PV3 A;  1QZ2 A;  1F8A B;  1GPF A;  2MLY A;  3UF8 A;  2N87 A;  4KQZ A;  3AQU A;  3NTP A;  1FKK A;  2RUD A;  4U84 A;  3QOK A;  4ODO A;  3ALG A;  4Z2K A;  3KAC A;  4IT4 A;  1PIN A;  4KR0 B;  5HBF A;  5D75 A;  2DT0 A;  4ZPV R;  1EQ3 A;  3ARS A;  1JNT A;  1D7H A;  2PPO A;  3WD2 A;  3O5P A;  4U86 A;  1FKI A;  3RM9 A;  4ML4 A;  1FKH A;  2WK2 A;  2QF8 A;  4JYS A;  2MLZ A;  5DEZ A;  2UZ5 A;  3JXV A;  1H0G A;  4WKH A;  4L72 B;  4ZPW R;  1TFV A;  1YW5 A;  1LG2 A;  3JYJ A;  4MPK A;  1E15 A;  2ZQV A;  3WD0 A;  2A3B A;  3B9D A;  3H9R B;  4QT3 A;  2XP4 A;  4DIP A;  2ZR6 A; 
#chains in the Genus database with same CATH homology
 4LGX A;  2MPH A;  1UR8 A;  3WD1 A;  4ODL A;  4PTM A;  4ZS6 A;  3WQW A;  1ROU A;  2YBU A;  1LL7 A;  3B7X A;  1HJW A;  1P5Q A;  3AS0 A;  1VF8 A;  1J4H A;  2IUZ A;  3CHC A;  1KT0 A;  2VCD A;  1W1V A;  3IK8 A;  5GQB A;  1ZL1 A;  4DWS D;  2A3E A;  3O5G A;  4NNR A;  1ZK6 A;  1W9P A;  4Z2L A;  4JFI A;  2DSV A;  2ZQS A;  3PRB A;  1Q6U A;  1JVW A;  1NWR A;  3I6C A;  4WIW A;  1HXV A;  1W1T A;  1J6Y A;  4O2T A;  3WL0 A;  4IT6 A;  4ITZ A;  4MSP A;  3O5O A;  2DT3 A;  4G50 A;  2F4E A;  1EIB A;  4JFJ A;  2LPV A;  4IQ2 A;  5HW6 A;  3PR9 A;  4W9Q A;  1LJY A;  1FKF A;  3ARQ A;  3CHD A;  1PBK A;  2RQS A;  4WKF A;  1D7I A;  4XAK A;  1W1P A;  1FKT A;  5GPR A;  1HKI A;  1EYM A;  2OLH A;  4DRN A;  2VN1 A;  5HW7 A;  2JZV A;  3EY6 A;  2DSU A;  4NSB A;  4WK9 A;  1W1Y A;  1HKM A;  2KO7 A;  3ART A;  3ARR A;  3WH0 A;  1FFQ A;  4NZC A;  3B9E A;  1ZBK A;  1NWT A;  1HKJ A;  3CH9 A;  2LGO A;  4R0X A;  3AS1 A;  2Q5A A;  1BL4 A;  2O9O A;  3PRA A;  3RFW A;  1J4R A;  1FFR A;  1ITX A;  3IHZ A;  1Y0O A;  3MDY B;  2AWG A;  3CHF A;  3B9A A;  5DIT A;  1O6I A;  4ODK A;  4URI A;  4N19 A;  1LQ0 A;  1OGG A;  1N1A A;  5B8I C;  4QIB A;  3IKG A;  5HWC A;  4IQC A;  1LL6 A;  1H0I A;  3O5M A;  3ALF A;  1FKB A;  2XP3 A;  4TW6 A;  1QPL A;  5J6E A;  2PPP A;  1FAP A;  1B6C A;  1NMW A;  4G2P A;  4DT4 A;  4Z2J A;  4DRO A;  3TC5 A;  2DG4 A;  1QPF A;  3B8S A;  2XP8 A;  3W4R A;  1GOI A;  1Q6H A;  2Y78 A;  1EHN A;  4TX0 A;  2ZR5 A;  1RD6 A;  2FDM A;  1OWQ A;  5HW8 A;  1E6P A;  1FKR A;  2MLX A;  1ROT A;  3FAP A;  1L1P A;  4MNK A;  1XRV A;  4QZV B;  4ODM A;  2DSZ A;  2KE0 A;  2MF9 A;  4HBE A;  2G41 A;  2XPA A;  3KAG A;  5HT1 A;  4P8W A;  5DIV A;  1K9T A;  2M08 A;  3RM4 A;  1HJV A;  3UQI A;  4ZPT R;  3ODK A;  1CTN A;  1JND A;  2PV1 A;  1W9V A;  4DRQ A;  1BKF A;  1IX5 A;  4WKA A;  2YBT A;  3KAB A;  4DWS B;  4GIV A;  3ARO A;  4DRK A;  4DZ2 A;  2KR7 A;  1X6L A;  4DH0 A;  5HWB A;  1FKJ A;  2DSW A;  4LAX A;  1FKD A;  3O5I A;  1EDQ A;  2DT1 A;  4Q22 A;  2KI3 A;  3KCE A;  5HKG A;  1W9U A;  1NMV A;  1D6O A;  4Q7N A;  1E6Z A;  1UR9 A;  3UI5 A;  4C02 B;  2XP9 A;  3KAF A;  4ODR A;  3O5J A;  2DT2 A;  5HUA A;  1XHG A;  3KAD A;  2B31 A;  5DO2 A;  2XP7 A;  3O5L A;  4J4N A;  1E6N A;  4DZ3 A;  4MAV A;  3ARZ A;  4DRP A;  2A3A A;  1WNO A;  1E6R A;  2WLZ A;  3CZ8 A;  4HBO A;  3VAW A;  3ARP A;  2RUQ A;  4DWS A;  2DG3 A;  4Z2G A;  1FJD A;  4BF8 A;  3IKD A;  5JH8 A;  3UI4 A;  2D9F A;  2MNT A;  4S3J A;  1A7X A;  3FXY A;  4DRM A;  2RUC A;  3RM8 A;  3UQB A;  1FKS A;  1LG1 A;  3OA5 A;  5GPG A;  2WM0 A;  3KAH A;  2ZQT A;  1Q6I A;  5DF0 A;  1FKG A;  1NSG A;  1WAW A;  2OFN A;  2RSE A;  5DIU A;  3TDB A;  3KZ7 A;  3ARV A;  2A3C A;  3ARX A;  3G6M A;  2FKE A;  3PRD A;  3G6L A;  4DRI A;  1W26 A;  4ODN A;  3NI6 A;  4GGQ A;  3WL1 A;  3CGN A;  3ARY A;  4HAR A;  1SYT A;  1YAT A;  1ZBV A;  4W5U A;  4TW7 A;  4LAV A;  1ZCN A;  3TCZ A;  1M5Y A;  2M2A A;  2DPE A;  5HTG A;  4TYO A;  1FKL A;  3PA7 A;  3O5E A;  2G8Z A;  3BXW A;  1NH6 A;  4DWS C;  1X6N A;  4MNJ A;  4W9P A;  1TCO C;  3CHE A;  3RGC A;  3ARW A;  3KAI A;  3CGM A;  4JFM A;  1T11 A;  1NWS A;  4JFL A;  3WQV A;  2LJ4 A;  4JFK A;  3UI6 A;  4U85 A;  1GUV A;  2IF4 A;  4DRJ A;  4FN2 A;  3WD3 A;  1J4I A;  3AS2 A;  2FAP A;  4LAY A;  3WIJ A;  1C9H A;  1NWU A;  1WB0 A;  4Z2I A;  1E9L A;  2F21 A;  2RUR A;  3JYM A;  2WLY A;  1OGB A;  1ZBW A;  1ZB5 A;  3WD4 A;  1ZU8 A;  2AOS A;  4P8V A;  3LUO A;  4TNS A;  1D7J A;  4TW8 A;  2K8I A;  2DG9 A;  2KFW A;  1U79 A;  4FAP A;  4J4O A;  3OOB A;  4MTV A;  4IPX A;  2LKN A;  4QT2 A;  5I98 A;  1LL4 A;  3UQA A;  1KFW A;  4S3K A;  3FY1 A;  1ZBC A;  1SR0 A;  3O5K A;  1JNE A;  4ODP A;  3O5F A;  4W9O A;  5BXJ A;  2ITK A;  2M1I A;  2ZQU A;  3GPK A;  2XPB A;  4P8U A;  2ZR4 A;  3AS3 A;  1HKK A;  2XP6 A;  4Z2H A;  3WKZ A;  1R9H A;  3O5R A;  2PBC A;  2F2D A;  2PV2 A;  3RME A;  4L3N A;  4MNM A;  4R5E A;  2L2S A;  1F40 A;  3ARU A;  4P8X A;  2O92 A;  3O5D A;  3O5Q A;  4AY1 A;  1Q1C A;  2KGJ A;  4MNL A;  4ODQ A;  4LAW A;  2XP5 A;  4WJX A;  3NRK A;  4MGV A;  1D2K A;  1JNS A;  1HJX A;  1FD9 A;  2PPN A;  1KT1 A;  2ESC A;  4DRH A;  2PI6 A;  2PV3 A;  1QZ2 A;  1F8A B;  1GPF A;  2MLY A;  3UF8 A;  2N87 A;  4KQZ A;  3AQU A;  3NTP A;  1FKK A;  2RUD A;  4U84 A;  3QOK A;  4ODO A;  3ALG A;  4Z2K A;  3KAC A;  4IT4 A;  1PIN A;  4KR0 B;  5HBF A;  5D75 A;  2DT0 A;  4ZPV R;  1EQ3 A;  3ARS A;  1JNT A;  1D7H A;  2PPO A;  3WD2 A;  3O5P A;  4U86 A;  1FKI A;  3RM9 A;  4ML4 A;  1FKH A;  2WK2 A;  2QF8 A;  4JYS A;  2MLZ A;  5DEZ A;  2UZ5 A;  3JXV A;  1H0G A;  4WKH A;  4L72 B;  4ZPW R;  1TFV A;  1YW5 A;  1LG2 A;  3JYJ A;  4MPK A;  1E15 A;  2ZQV A;  3WD0 A;  2A3B A;  3B9D A;  3H9R B;  4QT3 A;  2XP4 A;  4DIP A;  2ZR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...