3KACA

Structure-guided design of alpha-amino acid-derived pin1 inhibitors
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
113
structure length
113
Chain Sequence
EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided design of alpha-amino acid-derived Pin1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 39
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kacA00
1BL4A 2MLZA 2M08A 5DIVA 3MDYB 1FKJA 2XP4A 3IK8A 4TW7A 4DRNA 2RUCA 2FKEA 3OOBA 5HTGA 2ZQUA 1YATA 2RUQA 4U86A 2ZQSA 1D7IA 1NSGA 3KAFA 2DG9A 3NTPA 3TCZA 4DRMA 2KI3A 2XPAA 3O5DA 4ODKA 1FKRA 3O5LA 2N87A 5BXJA 2ZR6A 1Y0OA 5HWCA 3IHZA 4JFLA 4MGVA 4JYSA 5B8IC 5D75A 3O5GA 1F8AB 1FKSA 4JFJA 3WH0A 4ITZA 2ZR5A 4TYOA 2KR7A 4IQCA 1P5QA 2XP8A 1FKFA 2L2SA 3IKGA 3KAIA 2OFNA 4TX0A 3H9RB 2RSEA 4DROA 3UI6A 3PRDA 1ZK6A 2MLXA 4DT4A 3CGNA 3KACA 4DZ3A 1ROTA 2ZQTA 1L1PA 2XP9A 4C02B 4DRQA 4JFMA 4W9QA 2M2AA 4FN2A 4FAPA 3UI4A 4DRJA 4DZ2A 4W9PA 1FKKA 1F40A 5I98A 4QT3A 2XP5A 1FKIA 4DH0A 4ODRA 3NRKA 4R0XA 5HT1A 3TDBA 4U84A 2PV1A 3B7XA 4ODOA 2FAPA 4IPXA 4ODMA 2XP7A 1EQ3A 1NMVA 2RUDA 3O5IA 2KFWA 1T11A 3JYJA 4J4OA 1QPLA 2LGOA 3O5PA 4ODNA 1PINA 3KZ7A 5HKGA 3O5EA 1D7HA 5HW8A 3O5KA 4QIBA 4LAVA 3UQIA 4G50A 1QZ2A 2PPNA 4IQ2A 1JVWA 2RQSA 3KCEA 4ODPA 1HXVA 2F21A 2PV3A 1FKLA 2DG3A 4BF8A 3I6CA 1B6CA 2AWGA 2VCDA 3O5QA 1FKTA 3PRBA 3GPKA 1FD9A 3FAPA 1FKBA 2PPPA 2Q5AA 4J4NA 4ODQA 4ODLA 3TC5A 1NMWA 2ZR4A 3RFWA 2LKNA 4LAWA 2XP3A 1BKFA 2VN1A 1JNSA 2XP6A 1J4RA 2KE0A 1R9HA 1D7JA 4DRPA 4DRIA 2RURA 1JNTA 3VAWA 5HW6A 3UI5A 2KGJA 3O5JA 1Q6IA 4GIVA 1PBKA 4U85A 2PPOA 4GGQA 1KT1A 1KT0A 2D9FA 4NNRA 5DIUA 1W26A 1U79A 5HUAA 4QT2A 3UQAA 4O2TA 4TW8A 2LJ4A 1FKHA 2PBCA 2MF9A 3KADA 3O5OA 4MSPA 2UZ5A 1J6YA 1FAPA 5HW7A 2DG4A 2MNTA 3KAHA 3PA7A 3RGCA 1A7XA 3JYMA 2LPVA 3KAGA 2JZVA 2K8IA 3UQBA 1FJDA 1Q6UA 2PV2A 1Q1CA 1Q6HA 2XPBA 2ZQVA 4JFKA 2MLYA 3LUOA 3NI6A 1ROUA 1TCOC 1C9HA 1J4IA 2KO7A 1ZCNA 5GPGA 2Y78A 3O5MA 4DIPA 4DRHA 1FKDA 1J4HA 2F2DA 4W9OA 2MPHA 3ODKA 4G2PA 4LAXA 1FKGA 1M5YA 1EYMA 4DRKA 3EY6A 3KABA 4TW6A 3O5RA 4LAYA 3O5FA 1D6OA 1YW5A 3IKDA 2IF4A 3CGMA 5J6EA 2ITKA 3UF8A 1QPFA 3JXVA 5HWBA 2M1IA 5DITA 4JFIA 4TNSA 2F4EA 4N19A 1N1AA
chains in the Genus database with same CATH superfamily
1NWRA 3CHCA 1FKJA 1JCHB 1SYTA 2G8ZA 4ZPWR 3OOBA 1GUVA 1ZL1A 2OLHA 2QF8A 1W9PA 3ARZA 1VF8A 4Q22A 2PN0A 3WD4A 5B8IC 3W4RA 3O5GA 4IQCA 1P5QA 2L2SA 1FFRA 3H9RB 3UI6A 1LL7A 3PRDA 3CGNA 3KACA 4DZ3A 3BMBA 2ZQTA 4C02B 2M2AA 4DWSD 1NH6A 1NWSA 4FAPA 2DPEA 3ARTA 3PRAA 4HBOA 1UR8A 3NRKA 5HT1A 3RM9A 3TDBA 3B8SA 4U84A 1OGGA 4ODOA 2FAPA 4KQZA 2RUDA 4QZVB 1EDQA 1W1PA 4J4OA 2LGOA 4ODNA 1PINA 1D7HA 5HW8A 3UQIA 4G50A 4WJXA 2RQSA 4ODPA 1WNOA 1ZBWA 3O5QA 4WK9A 3PRBA 3FAPA 1GRJA 3ALFA 2Q5AA 4ODLA 4Q7NA 3WD1A 2ZR4A 1H0IA 1EHNA 3RFWA 1LG2A 3WL1A 4IT6A 1R9HA 1E6RA 1JNTA 5GQBA 4GIVA 3ARPA 1Q6IA 4Z2IA 3AS3A 1KT0A 4ML4A 1U79A 1E6NA 4TW8A 2PBCA 2MF9A 3ARXA 3ARQA 2MNTA 4Z2LA 3KAGA 2JZVA 4MNLA 1C9HA 1LL4A 3EY6A 4LAYA 3ARWA 1D6OA 3UF8A 1CTNA 4L3NA 4TNSA 2F4EA 4DRJA 4DZ2A 4L72B 1E6ZA 1N1AA 1BL4A 2M08A 5DIVA 3MDYB 2XP4A 4ZPTR 2FKEA 1H0GA 4U86A 1D7IA 1NSGA 4WKAA 2KI3A 4P8UA 2XPAA 4ODKA 5DF0A 2ETNA 2ZR6A 5HWCA 4MGVA 5D75A 3WD2A 1EIBA 3WH0A 4ITZA 2FDMA 1X6LA 2XP8A 1FKFA 3IKGA 2OFNA 4HBEA 3PR9A 1ZB5A 2XP9A 4JFMA 1ITXA 4W9QA 3UI4A 2B31A 2DT1A 1FFQA 2XP5A 4R0XA 1HKJA 1JNEA 1HKIA 3AS0A 3G6MA 4NZCA 3G6LA 1UR9A 1E6PA 1O6IA 1ZU8A 1HKKA 3KCEA 3I6CA 3CHEA 4UDMA 4ZPVR 1GOIA 3GPKA 3WIJA 2WLZA 4J4NA 4ODQA 3TC5A 1OGBA 2XP3A 1BKFA 1JNSA 2XP6A 1J4RA 2KE0A 3B9DA 2DT2A 3ARSA 4URIA 2DT3A 2RURA 4PTMA 1WB0A 3RMEA 3AS2A 4IT4A 2D9FA 1W26A 2YBTA 1TFVA 1J6YA 4P8VA 3WD0A 1A7XA 4WKFA 2K8IA 1FJDA 5DEZA 1Q6UA 1Q1CA 2XPBA 4MNJA 3NI6A 3O5MA 4DRHA 2F2DA 1J4HA 3WD3A 1WAWA 1M5YA 1W9VA 3FY1A 3KABA 3AQUA 2A3BA 4S3JA 2ITKA 2A3EA 1QPFA 4N19A 2DSZA 2AOSA 2RUQA 3NTPA 4DRMA 2DG9A 2WM0A 5DO2A 3O5LA 4S3KA 3IHZA 4JFLA 4JYSA 3CZ8A 1GPFA 1FKSA 1HJVA 2ZR5A 3KAIA 2RSEA 2MLXA 1L1PA 2WK2A 1KFWA 1W1YA 4W9PA 3ARYA 5I98A 2O9OA 4DH0A 3WKZA 4P8WA 4ODMA 1EQ3A 3ARRA 2KFWA 1QPLA 3KZ7A 4MNMA 4QIBA 2EULA 4LAVA 1JVWA 2F21A 1FKLA 4BF8A 4WIWA 1B6CA 2VCDA 1E9LA 1FKTA 5HBFA 1FKBA 1SR0A 2PPPA 4KR0B 2DT0A 2LKNA 4LAWA 1D7JA 2A3AA 1LG1A 3ARUA 3O5JA 1OWQA 1PBKA 4P8XA 1E44A 2PPOA 1KT1A 3WQVA 3UQAA 5HUAA 4QT2A 2LJ4A 1FKHA 2YBUA 3KADA 2UZ5A 1W1TA 2DG4A 3KAHA 3PA7A 1HJWA 3JYMA 2LPVA 2IUZA 4W5UA 2MLYA 5GPGA 1ROUA 2KO7A 1J4IA 1ZCNA 2Y78A 4WKHA 4DIPA 1NWUA 4MNKA 3FXYA 4W9OA 4AY1A 4G2PA 4LAXA 4TW6A 3O5FA 3IKDA 3WQWA 3AROA 3RM8A 5J6EA 3BXWA 5HWBA 2M1IA 5DITA 4JFIA 1HJXA 3B9EA 2MLZA 3B9AA 3IK8A 4TW7A 4DRNA 2RUCA 5HTGA 1ZBVA 2ZQUA 1YATA 2PI6A 2ZQSA 3KAFA 3TCZA 1LJYA 4NSBA 3O5DA 1RD6A 1FKRA 3RM4A 1ZBCA 1W9UA 2N87A 5BXJA 1Y0OA 5JH8A 2ESCA 4Z2JA 1HKMA 1F8AB 4JFJA 3ALGA 3OA5A 1X6NA 4XAKA 4TYOA 2KR7A 1W1VA 4DWSC 4TX0A 4DROA 3CHFA 1ZBKA 4DT4A 1ZK6A 2G41A 1ROTA 2WLYA 4ZS6A 4DRQA 4FN2A 4DWSB 1FKKA 1F40A 4QT3A 1FKIA 4ODRA 1XHGA 2P4VA 2PV1A 3B7XA 4R5EA 1XRVA 1K9TA 4IPXA 2XP7A 1NMVA 3O5IA 3WL0A 3ARVA 1T11A 3JYJA 1IX5A 3O5PA 5HKGA 3O5EA 4MTVA 3O5KA 1QZ2A 2PPNA 4IQ2A 1HXVA 2PV3A 2DG3A 2AWGA 4LGXA 4MPKA 1FD9A 5GPRA 3AS1A 4DWSA 3GTYX 1NMWA 2VN1A 3CH9A 4DRPA 4DRIA 2DSWA 3VAWA 5HW6A 3UI5A 1NWTA 2KGJA 1JNDA 3QOKA 2B5UB 4U85A 4GGQA 2A3CA 4NNRA 5DIUA 4Z2GA 3CHDA 4O2TA 4MSPA 3O5OA 1FAPA 2DSUA 2O92A 5HW7A 3RGCA 4Z2HA 1LL6A 1D2KA 4Z2KA 3UQBA 2PV2A 4JFKA 1LQ0A 1Q6HA 2ZQVA 1E15A 3LUOA 1TCOC 1FKDA 2MPHA 3ODKA 4MAVA 1FKGA 2DSVA 1EYMA 4DRKA 3O5RA 4HARA 1YW5A 2IF4A 2F23A 3GU0A 3CGMA 3JXVA 3EIPA
chains in the Genus database with same CATH topology
1NWRA 3CHCA 1FKJA 1SYTA 2G8ZA 4ZPWR 3OOBA 1GUVA 1ZL1A 2OLHA 2QF8A 1W9PA 3ARZA 1VF8A 4Q22A 3WD4A 5B8IC 3W4RA 3O5GA 4IQCA 1P5QA 2L2SA 1FFRA 3H9RB 3UI6A 1LL7A 3PRDA 3CGNA 3KACA 4DZ3A 2ZQTA 4C02B 2M2AA 4DWSD 1NH6A 1NWSA 4FAPA 2DPEA 3ARTA 3PRAA 4HBOA 1UR8A 3NRKA 5HT1A 3RM9A 3TDBA 3B8SA 4U84A 1OGGA 4ODOA 2FAPA 4KQZA 2RUDA 4QZVB 1EDQA 1W1PA 4J4OA 2LGOA 4ODNA 1PINA 1D7HA 5HW8A 3UQIA 4G50A 4WJXA 2RQSA 4ODPA 1WNOA 1ZBWA 3O5QA 4WK9A 3PRBA 3FAPA 3ALFA 4Q7NA 2Q5AA 4ODLA 3WD1A 2ZR4A 1H0IA 1EHNA 3RFWA 1LG2A 3WL1A 4IT6A 1R9HA 1E6RA 1JNTA 5GQBA 4GIVA 3ARPA 1Q6IA 4Z2IA 3AS3A 1KT0A 4ML4A 1U79A 1E6NA 4TW8A 2PBCA 2MF9A 3ARXA 3ARQA 2MNTA 4Z2LA 3KAGA 2JZVA 4MNLA 1C9HA 1LL4A 3EY6A 4LAYA 3ARWA 1D6OA 3UF8A 1CTNA 4L3NA 4TNSA 2F4EA 4DRJA 4DZ2A 4L72B 1E6ZA 1N1AA 1BL4A 2M08A 5DIVA 3MDYB 2XP4A 4ZPTR 2FKEA 1H0GA 4U86A 1D7IA 1NSGA 4WKAA 2KI3A 4P8UA 2XPAA 4ODKA 5DF0A 2ZR6A 5HWCA 4MGVA 5D75A 3WD2A 1EIBA 3WH0A 4ITZA 2FDMA 1X6LA 2XP8A 1FKFA 3IKGA 2OFNA 4HBEA 3PR9A 1ZB5A 2XP9A 4JFMA 1ITXA 4W9QA 3UI4A 2B31A 2DT1A 1FFQA 2XP5A 4R0XA 1HKJA 1JNEA 1HKIA 3AS0A 3G6MA 4NZCA 3G6LA 1UR9A 1E6PA 1O6IA 1ZU8A 1HKKA 3KCEA 3I6CA 3CHEA 4ZPVR 1GOIA 3GPKA 3WIJA 2WLZA 4J4NA 4ODQA 3TC5A 1OGBA 2XP3A 1BKFA 1JNSA 2XP6A 1J4RA 2KE0A 3B9DA 2DT2A 3ARSA 4URIA 2DT3A 2RURA 4PTMA 1WB0A 3RMEA 3AS2A 4IT4A 2D9FA 1W26A 2YBTA 1TFVA 1J6YA 4P8VA 3WD0A 1A7XA 4WKFA 2K8IA 1FJDA 5DEZA 1Q6UA 1Q1CA 2XPBA 4MNJA 3NI6A 3O5MA 4DRHA 2F2DA 1J4HA 3WD3A 1WAWA 1M5YA 1W9VA 3FY1A 3KABA 3AQUA 2A3BA 4S3JA 2ITKA 2A3EA 1QPFA 4N19A 2DSZA 2AOSA 2RUQA 3NTPA 4DRMA 2DG9A 2WM0A 5DO2A 3O5LA 4S3KA 3IHZA 4JFLA 4JYSA 3CZ8A 1GPFA 1FKSA 1HJVA 2ZR5A 3KAIA 2RSEA 2MLXA 1L1PA 2WK2A 1KFWA 1W1YA 4W9PA 3ARYA 5I98A 2O9OA 4DH0A 3WKZA 4P8WA 4ODMA 1EQ3A 3ARRA 2KFWA 1QPLA 3KZ7A 4MNMA 4QIBA 4LAVA 1JVWA 2F21A 1FKLA 4BF8A 4WIWA 1B6CA 2VCDA 1E9LA 1FKTA 5HBFA 1FKBA 1SR0A 2PPPA 4KR0B 2DT0A 2LKNA 4LAWA 1D7JA 2A3AA 1LG1A 3ARUA 3O5JA 1OWQA 1PBKA 4P8XA 2PPOA 1KT1A 3WQVA 3UQAA 5HUAA 4QT2A 2LJ4A 1FKHA 2YBUA 3KADA 2UZ5A 1W1TA 2DG4A 3KAHA 3PA7A 1HJWA 3JYMA 2LPVA 2IUZA 4W5UA 2MLYA 5GPGA 1ROUA 2KO7A 1J4IA 1ZCNA 2Y78A 4WKHA 4DIPA 1NWUA 4MNKA 3FXYA 4W9OA 4AY1A 4G2PA 4LAXA 4TW6A 3O5FA 3IKDA 3WQWA 3AROA 3RM8A 5J6EA 3BXWA 5HWBA 2M1IA 5DITA 4JFIA 1HJXA 3B9EA 2MLZA 3B9AA 3IK8A 4TW7A 4DRNA 2RUCA 5HTGA 1ZBVA 2ZQUA 1YATA 2PI6A 2ZQSA 3KAFA 3TCZA 1LJYA 4NSBA 3O5DA 1RD6A 1FKRA 3RM4A 1ZBCA 1W9UA 2N87A 5BXJA 1Y0OA 5JH8A 2ESCA 4Z2JA 1HKMA 1F8AB 4JFJA 3ALGA 3OA5A 1X6NA 4XAKA 4TYOA 2KR7A 1W1VA 4DWSC 4TX0A 4DROA 3CHFA 1ZBKA 4DT4A 1ZK6A 2G41A 1ROTA 2WLYA 4ZS6A 4DRQA 4FN2A 4DWSB 1FKKA 1F40A 4QT3A 1FKIA 4ODRA 1XHGA 4R5EA 2PV1A 3B7XA 1XRVA 1K9TA 4IPXA 2XP7A 1NMVA 3O5IA 3WL0A 3ARVA 1T11A 3JYJA 1IX5A 3O5PA 5HKGA 3O5EA 4MTVA 3O5KA 1QZ2A 2PPNA 4IQ2A 1HXVA 2PV3A 2DG3A 2AWGA 4LGXA 4MPKA 1FD9A 5GPRA 3AS1A 4DWSA 1NMWA 2VN1A 3CH9A 4DRPA 4DRIA 2DSWA 3VAWA 5HW6A 3UI5A 1NWTA 2KGJA 1JNDA 3QOKA 4U85A 4GGQA 2A3CA 4NNRA 5DIUA 4Z2GA 3CHDA 4O2TA 4MSPA 3O5OA 1FAPA 2DSUA 2O92A 5HW7A 3RGCA 4Z2HA 1LL6A 1D2KA 4Z2KA 3UQBA 2PV2A 4JFKA 1LQ0A 1Q6HA 2ZQVA 1E15A 3LUOA 1TCOC 1FKDA 2MPHA 3ODKA 4MAVA 1FKGA 2DSVA 1EYMA 4DRKA 3O5RA 4HARA 1YW5A 2IF4A 3CGMA 3JXVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BL4 A;  2MLZ A;  2M08 A;  5DIV A;  3MDY B;  1FKJ A;  2XP4 A;  3IK8 A;  4TW7 A;  4DRN A;  2RUC A;  2FKE A;  3OOB A;  5HTG A;  2ZQU A;  1YAT A;  2RUQ A;  4U86 A;  2ZQS A;  1D7I A;  1NSG A;  3KAF A;  2DG9 A;  3NTP A;  3TCZ A;  4DRM A;  2KI3 A;  2XPA A;  3O5D A;  4ODK A;  1FKR A;  3O5L A;  2N87 A;  5BXJ A;  2ZR6 A;  1Y0O A;  5HWC A;  3IHZ A;  4JFL A;  4MGV A;  4JYS A;  5B8I C;  5D75 A;  3O5G A;  1F8A B;  1FKS A;  4JFJ A;  3WH0 A;  4ITZ A;  2ZR5 A;  4TYO A;  2KR7 A;  4IQC A;  1P5Q A;  2XP8 A;  1FKF A;  2L2S A;  3IKG A;  3KAI A;  2OFN A;  4TX0 A;  3H9R B;  2RSE A;  4DRO A;  3UI6 A;  3PRD A;  1ZK6 A;  2MLX A;  4DT4 A;  3CGN A;  3KAC A;  4DZ3 A;  1ROT A;  2ZQT A;  1L1P A;  2XP9 A;  4C02 B;  4DRQ A;  4JFM A;  4W9Q A;  2M2A A;  4FN2 A;  4FAP A;  3UI4 A;  4DRJ A;  4DZ2 A;  4W9P A;  1FKK A;  1F40 A;  5I98 A;  4QT3 A;  2XP5 A;  1FKI A;  4DH0 A;  4ODR A;  3NRK A;  4R0X A;  5HT1 A;  3TDB A;  4U84 A;  2PV1 A;  3B7X A;  4ODO A;  2FAP A;  4IPX A;  4ODM A;  2XP7 A;  1EQ3 A;  1NMV A;  2RUD A;  3O5I A;  2KFW A;  1T11 A;  3JYJ A;  4J4O A;  1QPL A;  2LGO A;  3O5P A;  4ODN A;  1PIN A;  3KZ7 A;  5HKG A;  3O5E A;  1D7H A;  5HW8 A;  3O5K A;  4QIB A;  4LAV A;  3UQI A;  4G50 A;  1QZ2 A;  2PPN A;  4IQ2 A;  1JVW A;  2RQS A;  3KCE A;  4ODP A;  1HXV A;  2F21 A;  2PV3 A;  1FKL A;  2DG3 A;  4BF8 A;  3I6C A;  1B6C A;  2AWG A;  2VCD A;  3O5Q A;  1FKT A;  3PRB A;  3GPK A;  1FD9 A;  3FAP A;  1FKB A;  2PPP A;  2Q5A A;  4J4N A;  4ODQ A;  4ODL A;  3TC5 A;  1NMW A;  2ZR4 A;  3RFW A;  2LKN A;  4LAW A;  2XP3 A;  1BKF A;  2VN1 A;  1JNS A;  2XP6 A;  1J4R A;  2KE0 A;  1R9H A;  1D7J A;  4DRP A;  4DRI A;  2RUR A;  1JNT A;  3VAW A;  5HW6 A;  3UI5 A;  2KGJ A;  3O5J A;  1Q6I A;  4GIV A;  1PBK A;  4U85 A;  2PPO A;  4GGQ A;  1KT1 A;  1KT0 A;  2D9F A;  4NNR A;  5DIU A;  1W26 A;  1U79 A;  5HUA A;  4QT2 A;  3UQA A;  4O2T A;  4TW8 A;  2LJ4 A;  1FKH A;  2PBC A;  2MF9 A;  3KAD A;  3O5O A;  4MSP A;  2UZ5 A;  1J6Y A;  1FAP A;  5HW7 A;  2DG4 A;  2MNT A;  3KAH A;  3PA7 A;  3RGC A;  1A7X A;  3JYM A;  2LPV A;  3KAG A;  2JZV A;  2K8I A;  3UQB A;  1FJD A;  1Q6U A;  2PV2 A;  1Q1C A;  1Q6H A;  2XPB A;  2ZQV A;  4JFK A;  2MLY A;  3LUO A;  3NI6 A;  1ROU A;  1TCO C;  1C9H A;  1J4I A;  2KO7 A;  1ZCN A;  5GPG A;  2Y78 A;  3O5M A;  4DIP A;  4DRH A;  1FKD A;  1J4H A;  2F2D A;  4W9O A;  2MPH A;  3ODK A;  4G2P A;  4LAX A;  1FKG A;  1M5Y A;  1EYM A;  4DRK A;  3EY6 A;  3KAB A;  4TW6 A;  3O5R A;  4LAY A;  3O5F A;  1D6O A;  1YW5 A;  3IKD A;  2IF4 A;  3CGM A;  5J6E A;  2ITK A;  3UF8 A;  1QPF A;  3JXV A;  5HWB A;  2M1I A;  5DIT A;  4JFI A;  4TNS A;  2F4E A;  4N19 A;  1N1A A; 
#chains in the Genus database with same CATH topology
 1NWR A;  3CHC A;  1FKJ A;  1JCH B;  1SYT A;  2G8Z A;  4ZPW R;  3OOB A;  1GUV A;  1ZL1 A;  2OLH A;  2QF8 A;  1W9P A;  3ARZ A;  1VF8 A;  4Q22 A;  2PN0 A;  3WD4 A;  5B8I C;  3W4R A;  3O5G A;  4IQC A;  1P5Q A;  2L2S A;  1FFR A;  3H9R B;  3UI6 A;  1LL7 A;  3PRD A;  3CGN A;  3KAC A;  4DZ3 A;  3BMB A;  2ZQT A;  4C02 B;  2M2A A;  4DWS D;  1NH6 A;  1NWS A;  4FAP A;  2DPE A;  3ART A;  3PRA A;  4HBO A;  1UR8 A;  3NRK A;  5HT1 A;  3RM9 A;  3TDB A;  3B8S A;  4U84 A;  1OGG A;  4ODO A;  2FAP A;  4KQZ A;  2RUD A;  4QZV B;  1EDQ A;  1W1P A;  4J4O A;  2LGO A;  4ODN A;  1PIN A;  1D7H A;  5HW8 A;  3UQI A;  4G50 A;  4WJX A;  2RQS A;  4ODP A;  1WNO A;  1ZBW A;  3O5Q A;  4WK9 A;  3PRB A;  3FAP A;  1GRJ A;  3ALF A;  2Q5A A;  4ODL A;  4Q7N A;  3WD1 A;  2ZR4 A;  1H0I A;  1EHN A;  3RFW A;  1LG2 A;  3WL1 A;  4IT6 A;  1R9H A;  1E6R A;  1JNT A;  5GQB A;  4GIV A;  3ARP A;  1Q6I A;  4Z2I A;  3AS3 A;  1KT0 A;  4ML4 A;  1U79 A;  1E6N A;  4TW8 A;  2PBC A;  2MF9 A;  3ARX A;  3ARQ A;  2MNT A;  4Z2L A;  3KAG A;  2JZV A;  4MNL A;  1C9H A;  1LL4 A;  3EY6 A;  4LAY A;  3ARW A;  1D6O A;  3UF8 A;  1CTN A;  4L3N A;  4TNS A;  2F4E A;  4DRJ A;  4DZ2 A;  4L72 B;  1E6Z A;  1N1A A;  1BL4 A;  2M08 A;  5DIV A;  3MDY B;  2XP4 A;  4ZPT R;  2FKE A;  1H0G A;  4U86 A;  1D7I A;  1NSG A;  4WKA A;  2KI3 A;  4P8U A;  2XPA A;  4ODK A;  5DF0 A;  2ETN A;  2ZR6 A;  5HWC A;  4MGV A;  5D75 A;  3WD2 A;  1EIB A;  3WH0 A;  4ITZ A;  2FDM A;  1X6L A;  2XP8 A;  1FKF A;  3IKG A;  2OFN A;  4HBE A;  3PR9 A;  1ZB5 A;  2XP9 A;  4JFM A;  1ITX A;  4W9Q A;  3UI4 A;  2B31 A;  2DT1 A;  1FFQ A;  2XP5 A;  4R0X A;  1HKJ A;  1JNE A;  1HKI A;  3AS0 A;  3G6M A;  4NZC A;  3G6L A;  1UR9 A;  1E6P A;  1O6I A;  1ZU8 A;  1HKK A;  3KCE A;  3I6C A;  3CHE A;  4UDM A;  4ZPV R;  1GOI A;  3GPK A;  3WIJ A;  2WLZ A;  4J4N A;  4ODQ A;  3TC5 A;  1OGB A;  2XP3 A;  1BKF A;  1JNS A;  2XP6 A;  1J4R A;  2KE0 A;  3B9D A;  2DT2 A;  3ARS A;  4URI A;  2DT3 A;  2RUR A;  4PTM A;  1WB0 A;  3RME A;  3AS2 A;  4IT4 A;  2D9F A;  1W26 A;  2YBT A;  1TFV A;  1J6Y A;  4P8V A;  3WD0 A;  1A7X A;  4WKF A;  2K8I A;  1FJD A;  5DEZ A;  1Q6U A;  1Q1C A;  2XPB A;  4MNJ A;  3NI6 A;  3O5M A;  4DRH A;  2F2D A;  1J4H A;  3WD3 A;  1WAW A;  1M5Y A;  1W9V A;  3FY1 A;  3KAB A;  3AQU A;  2A3B A;  4S3J A;  2ITK A;  2A3E A;  1QPF A;  4N19 A;  2DSZ A;  2AOS A;  2RUQ A;  3NTP A;  4DRM A;  2DG9 A;  2WM0 A;  5DO2 A;  3O5L A;  4S3K A;  3IHZ A;  4JFL A;  4JYS A;  3CZ8 A;  1GPF A;  1FKS A;  1HJV A;  2ZR5 A;  3KAI A;  2RSE A;  2MLX A;  1L1P A;  2WK2 A;  1KFW A;  1W1Y A;  4W9P A;  3ARY A;  5I98 A;  2O9O A;  4DH0 A;  3WKZ A;  4P8W A;  4ODM A;  1EQ3 A;  3ARR A;  2KFW A;  1QPL A;  3KZ7 A;  4MNM A;  4QIB A;  2EUL A;  4LAV A;  1JVW A;  2F21 A;  1FKL A;  4BF8 A;  4WIW A;  1B6C A;  2VCD A;  1E9L A;  1FKT A;  5HBF A;  1FKB A;  1SR0 A;  2PPP A;  4KR0 B;  2DT0 A;  2LKN A;  4LAW A;  1D7J A;  2A3A A;  1LG1 A;  3ARU A;  3O5J A;  1OWQ A;  1PBK A;  4P8X A;  1E44 A;  2PPO A;  1KT1 A;  3WQV A;  3UQA A;  5HUA A;  4QT2 A;  2LJ4 A;  1FKH A;  2YBU A;  3KAD A;  2UZ5 A;  1W1T A;  2DG4 A;  3KAH A;  3PA7 A;  1HJW A;  3JYM A;  2LPV A;  2IUZ A;  4W5U A;  2MLY A;  5GPG A;  1ROU A;  2KO7 A;  1J4I A;  1ZCN A;  2Y78 A;  4WKH A;  4DIP A;  1NWU A;  4MNK A;  3FXY A;  4W9O A;  4AY1 A;  4G2P A;  4LAX A;  4TW6 A;  3O5F A;  3IKD A;  3WQW A;  3ARO A;  3RM8 A;  5J6E A;  3BXW A;  5HWB A;  2M1I A;  5DIT A;  4JFI A;  1HJX A;  3B9E A;  2MLZ A;  3B9A A;  3IK8 A;  4TW7 A;  4DRN A;  2RUC A;  5HTG A;  1ZBV A;  2ZQU A;  1YAT A;  2PI6 A;  2ZQS A;  3KAF A;  3TCZ A;  1LJY A;  4NSB A;  3O5D A;  1RD6 A;  1FKR A;  3RM4 A;  1ZBC A;  1W9U A;  2N87 A;  5BXJ A;  1Y0O A;  5JH8 A;  2ESC A;  4Z2J A;  1HKM A;  1F8A B;  4JFJ A;  3ALG A;  3OA5 A;  1X6N A;  4XAK A;  4TYO A;  2KR7 A;  1W1V A;  4DWS C;  4TX0 A;  4DRO A;  3CHF A;  1ZBK A;  4DT4 A;  1ZK6 A;  2G41 A;  1ROT A;  2WLY A;  4ZS6 A;  4DRQ A;  4FN2 A;  4DWS B;  1FKK A;  1F40 A;  4QT3 A;  1FKI A;  4ODR A;  1XHG A;  2P4V A;  2PV1 A;  3B7X A;  4R5E A;  1XRV A;  1K9T A;  4IPX A;  2XP7 A;  1NMV A;  3O5I A;  3WL0 A;  3ARV A;  1T11 A;  3JYJ A;  1IX5 A;  3O5P A;  5HKG A;  3O5E A;  4MTV A;  3O5K A;  1QZ2 A;  2PPN A;  4IQ2 A;  1HXV A;  2PV3 A;  2DG3 A;  2AWG A;  4LGX A;  4MPK A;  1FD9 A;  5GPR A;  3AS1 A;  4DWS A;  3GTY X;  1NMW A;  2VN1 A;  3CH9 A;  4DRP A;  4DRI A;  2DSW A;  3VAW A;  5HW6 A;  3UI5 A;  1NWT A;  2KGJ A;  1JND A;  3QOK A;  2B5U B;  4U85 A;  4GGQ A;  2A3C A;  4NNR A;  5DIU A;  4Z2G A;  3CHD A;  4O2T A;  4MSP A;  3O5O A;  1FAP A;  2DSU A;  2O92 A;  5HW7 A;  3RGC A;  4Z2H A;  1LL6 A;  1D2K A;  4Z2K A;  3UQB A;  2PV2 A;  4JFK A;  1LQ0 A;  1Q6H A;  2ZQV A;  1E15 A;  3LUO A;  1TCO C;  1FKD A;  2MPH A;  3ODK A;  4MAV A;  1FKG A;  2DSV A;  1EYM A;  4DRK A;  3O5R A;  4HAR A;  1YW5 A;  2IF4 A;  2F23 A;  3GU0 A;  3CGM A;  3JXV A;  3EIP A; 
#chains in the Genus database with same CATH homology
 1NWR A;  3CHC A;  1FKJ A;  1SYT A;  2G8Z A;  4ZPW R;  3OOB A;  1GUV A;  1ZL1 A;  2OLH A;  2QF8 A;  1W9P A;  3ARZ A;  1VF8 A;  4Q22 A;  3WD4 A;  5B8I C;  3W4R A;  3O5G A;  4IQC A;  1P5Q A;  2L2S A;  1FFR A;  3H9R B;  3UI6 A;  1LL7 A;  3PRD A;  3CGN A;  3KAC A;  4DZ3 A;  2ZQT A;  4C02 B;  2M2A A;  4DWS D;  1NH6 A;  1NWS A;  4FAP A;  2DPE A;  3ART A;  3PRA A;  4HBO A;  1UR8 A;  3NRK A;  5HT1 A;  3RM9 A;  3TDB A;  3B8S A;  4U84 A;  1OGG A;  4ODO A;  2FAP A;  4KQZ A;  2RUD A;  4QZV B;  1EDQ A;  1W1P A;  4J4O A;  2LGO A;  4ODN A;  1PIN A;  1D7H A;  5HW8 A;  3UQI A;  4G50 A;  4WJX A;  2RQS A;  4ODP A;  1WNO A;  1ZBW A;  3O5Q A;  4WK9 A;  3PRB A;  3FAP A;  3ALF A;  4Q7N A;  2Q5A A;  4ODL A;  3WD1 A;  2ZR4 A;  1H0I A;  1EHN A;  3RFW A;  1LG2 A;  3WL1 A;  4IT6 A;  1R9H A;  1E6R A;  1JNT A;  5GQB A;  4GIV A;  3ARP A;  1Q6I A;  4Z2I A;  3AS3 A;  1KT0 A;  4ML4 A;  1U79 A;  1E6N A;  4TW8 A;  2PBC A;  2MF9 A;  3ARX A;  3ARQ A;  2MNT A;  4Z2L A;  3KAG A;  2JZV A;  4MNL A;  1C9H A;  1LL4 A;  3EY6 A;  4LAY A;  3ARW A;  1D6O A;  3UF8 A;  1CTN A;  4L3N A;  4TNS A;  2F4E A;  4DRJ A;  4DZ2 A;  4L72 B;  1E6Z A;  1N1A A;  1BL4 A;  2M08 A;  5DIV A;  3MDY B;  2XP4 A;  4ZPT R;  2FKE A;  1H0G A;  4U86 A;  1D7I A;  1NSG A;  4WKA A;  2KI3 A;  4P8U A;  2XPA A;  4ODK A;  5DF0 A;  2ZR6 A;  5HWC A;  4MGV A;  5D75 A;  3WD2 A;  1EIB A;  3WH0 A;  4ITZ A;  2FDM A;  1X6L A;  2XP8 A;  1FKF A;  3IKG A;  2OFN A;  4HBE A;  3PR9 A;  1ZB5 A;  2XP9 A;  4JFM A;  1ITX A;  4W9Q A;  3UI4 A;  2B31 A;  2DT1 A;  1FFQ A;  2XP5 A;  4R0X A;  1HKJ A;  1JNE A;  1HKI A;  3AS0 A;  3G6M A;  4NZC A;  3G6L A;  1UR9 A;  1E6P A;  1O6I A;  1ZU8 A;  1HKK A;  3KCE A;  3I6C A;  3CHE A;  4ZPV R;  1GOI A;  3GPK A;  3WIJ A;  2WLZ A;  4J4N A;  4ODQ A;  3TC5 A;  1OGB A;  2XP3 A;  1BKF A;  1JNS A;  2XP6 A;  1J4R A;  2KE0 A;  3B9D A;  2DT2 A;  3ARS A;  4URI A;  2DT3 A;  2RUR A;  4PTM A;  1WB0 A;  3RME A;  3AS2 A;  4IT4 A;  2D9F A;  1W26 A;  2YBT A;  1TFV A;  1J6Y A;  4P8V A;  3WD0 A;  1A7X A;  4WKF A;  2K8I A;  1FJD A;  5DEZ A;  1Q6U A;  1Q1C A;  2XPB A;  4MNJ A;  3NI6 A;  3O5M A;  4DRH A;  2F2D A;  1J4H A;  3WD3 A;  1WAW A;  1M5Y A;  1W9V A;  3FY1 A;  3KAB A;  3AQU A;  2A3B A;  4S3J A;  2ITK A;  2A3E A;  1QPF A;  4N19 A;  2DSZ A;  2AOS A;  2RUQ A;  3NTP A;  4DRM A;  2DG9 A;  2WM0 A;  5DO2 A;  3O5L A;  4S3K A;  3IHZ A;  4JFL A;  4JYS A;  3CZ8 A;  1GPF A;  1FKS A;  1HJV A;  2ZR5 A;  3KAI A;  2RSE A;  2MLX A;  1L1P A;  2WK2 A;  1KFW A;  1W1Y A;  4W9P A;  3ARY A;  5I98 A;  2O9O A;  4DH0 A;  3WKZ A;  4P8W A;  4ODM A;  1EQ3 A;  3ARR A;  2KFW A;  1QPL A;  3KZ7 A;  4MNM A;  4QIB A;  4LAV A;  1JVW A;  2F21 A;  1FKL A;  4BF8 A;  4WIW A;  1B6C A;  2VCD A;  1E9L A;  1FKT A;  5HBF A;  1FKB A;  1SR0 A;  2PPP A;  4KR0 B;  2DT0 A;  2LKN A;  4LAW A;  1D7J A;  2A3A A;  1LG1 A;  3ARU A;  3O5J A;  1OWQ A;  1PBK A;  4P8X A;  2PPO A;  1KT1 A;  3WQV A;  3UQA A;  5HUA A;  4QT2 A;  2LJ4 A;  1FKH A;  2YBU A;  3KAD A;  2UZ5 A;  1W1T A;  2DG4 A;  3KAH A;  3PA7 A;  1HJW A;  3JYM A;  2LPV A;  2IUZ A;  4W5U A;  2MLY A;  5GPG A;  1ROU A;  2KO7 A;  1J4I A;  1ZCN A;  2Y78 A;  4WKH A;  4DIP A;  1NWU A;  4MNK A;  3FXY A;  4W9O A;  4AY1 A;  4G2P A;  4LAX A;  4TW6 A;  3O5F A;  3IKD A;  3WQW A;  3ARO A;  3RM8 A;  5J6E A;  3BXW A;  5HWB A;  2M1I A;  5DIT A;  4JFI A;  1HJX A;  3B9E A;  2MLZ A;  3B9A A;  3IK8 A;  4TW7 A;  4DRN A;  2RUC A;  5HTG A;  1ZBV A;  2ZQU A;  1YAT A;  2PI6 A;  2ZQS A;  3KAF A;  3TCZ A;  1LJY A;  4NSB A;  3O5D A;  1RD6 A;  1FKR A;  3RM4 A;  1ZBC A;  1W9U A;  2N87 A;  5BXJ A;  1Y0O A;  5JH8 A;  2ESC A;  4Z2J A;  1HKM A;  1F8A B;  4JFJ A;  3ALG A;  3OA5 A;  1X6N A;  4XAK A;  4TYO A;  2KR7 A;  1W1V A;  4DWS C;  4TX0 A;  4DRO A;  3CHF A;  1ZBK A;  4DT4 A;  1ZK6 A;  2G41 A;  1ROT A;  2WLY A;  4ZS6 A;  4DRQ A;  4FN2 A;  4DWS B;  1FKK A;  1F40 A;  4QT3 A;  1FKI A;  4ODR A;  1XHG A;  4R5E A;  2PV1 A;  3B7X A;  1XRV A;  1K9T A;  4IPX A;  2XP7 A;  1NMV A;  3O5I A;  3WL0 A;  3ARV A;  1T11 A;  3JYJ A;  1IX5 A;  3O5P A;  5HKG A;  3O5E A;  4MTV A;  3O5K A;  1QZ2 A;  2PPN A;  4IQ2 A;  1HXV A;  2PV3 A;  2DG3 A;  2AWG A;  4LGX A;  4MPK A;  1FD9 A;  5GPR A;  3AS1 A;  4DWS A;  1NMW A;  2VN1 A;  3CH9 A;  4DRP A;  4DRI A;  2DSW A;  3VAW A;  5HW6 A;  3UI5 A;  1NWT A;  2KGJ A;  1JND A;  3QOK A;  4U85 A;  4GGQ A;  2A3C A;  4NNR A;  5DIU A;  4Z2G A;  3CHD A;  4O2T A;  4MSP A;  3O5O A;  1FAP A;  2DSU A;  2O92 A;  5HW7 A;  3RGC A;  4Z2H A;  1LL6 A;  1D2K A;  4Z2K A;  3UQB A;  2PV2 A;  4JFK A;  1LQ0 A;  1Q6H A;  2ZQV A;  1E15 A;  3LUO A;  1TCO C;  1FKD A;  2MPH A;  3ODK A;  4MAV A;  1FKG A;  2DSV A;  1EYM A;  4DRK A;  3O5R A;  4HAR A;  1YW5 A;  2IF4 A;  3CGM A;  3JXV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...