1FKRA

Solution structure of fkbp, a rotamase enzyme and receptor for fk506 and rapamycin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cis-trans isomerase
molecule keywords FK506 AND RAPAMYCIN-BINDING PROTEIN
publication title Solution structure of FKBP, a rotamase enzyme and receptor for FK506 and rapamycin.
pubmed rcsb
source organism Homo sapiens
total genus 13
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1992-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkrA00
1FKRA 3O5LA 2FAPA 4JFLA 1ROTA 2XPAA 2LKNA 4LAWA 4G50A 4LAXA 2VN1A 4QIBA 4DIPA 3UQIA 1L1PA 4ODRA 2L2SA 3VAWA 1FAPA 3TC5A 4TW6A 2PBCA 3O5EA 3H9RB 1NMVA 2KE0A 1QPFA 3RFWA 4TX0A 2AWGA 2XP3A 2XP5A 2LGOA 3TCZA 2KI3A 5J6EA 2XPBA 1FD9A 4ODPA 4JYSA 1D7IA 1TCOC 2RUQA 1M5YA 3KAHA 2DG9A 1F8AB 3KAIA 1Q1CA 2M2AA 1FKKA 4DRHA 1EQ3A 2D9FA 1ZK6A 2DG4A 2RQSA 4JFMA 4QT3A 1Q6HA 5HKGA 4J4OA 4ITZA 2KR7A 4IPXA 3UI4A 2MLZA 5DIVA 2ITKA 1KT0A 1N1AA 4R0XA 4BF8A 4FAPA 5BXJA 3KCEA 3NTPA 2FKEA 2RUDA 3IHZA 3O5MA 1U79A 4LAVA 4TW8A 3PA7A 5HT1A 1D7JA 4DZ3A 3KAGA 4MSPA 2KO7A 3KADA 3IKDA 1FKHA 2XP8A 4DRPA 3CGNA 2XP4A 4O2TA 1R9HA 5HW6A 2MF9A 4IQCA 4J4NA 2DG3A 4G2PA 1JNTA 1FKBA 3O5RA 1FKDA 2RUCA 2VCDA 5HWBA 3KAFA 5DITA 4N19A 2ZQTA 2ZQSA 4DRKA 3OOBA 4FN2A 4ODNA 2PV1A 4NNRA 3B7XA 1Y0OA 4DROA 2XP9A 2F21A 4JFIA 5HUAA 1T11A 5HTGA 3UQBA 3UF8A 1W26A 2PV2A 1BKFA 3O5PA 3WH0A 4DZ2A 1Q6UA 3KZ7A 4JFKA 2Q5AA 4W9PA 1HXVA 2XP7A 3JXVA 2OFNA 4IQ2A 2PPOA 4ODMA 1FKSA 1FKTA 3LUOA 3JYJA 3EY6A 1PBKA 1BL4A 3IK8A 3O5GA 1J6YA 2JZVA 2M1IA 1F40A 1D6OA 4JFJA 1YATA 4MGVA 2Y78A 5DIUA 3UI5A 4DH0A 4U85A 4DRJA 1J4HA 1J4IA 1C9HA 2KGJA 4TYOA 2ZQVA 1ZCNA 1KT1A 2ZR6A 4ODLA 1D7HA 5GPGA 4W9QA 2ZR4A 1P5QA 5D75A 5I98A 3UI6A 3FAPA 3PRDA 3KABA 3O5OA 2XP6A 3UQAA 2ZR5A 1J4RA 3PRBA 4W9OA 2MLYA 2PV3A 1JVWA 4ODKA 5HW7A 3CGMA 3O5JA 1A7XA 1NMWA 2PPPA 1JNSA 3I6CA 4QT2A 3O5FA 1YW5A 1FKLA 2ZQUA 3O5DA 4ODOA 2M08A 4C02B 4DT4A 2RURA 2KFWA 4LAYA 1FKFA 2F4EA 4DRMA 3KACA 1Q6IA 4GIVA 4ODQA 2MLXA 2MNTA 2MPHA 1QZ2A 3ODKA 2IF4A 2LPVA 1PINA 4GGQA 1ROUA 4U86A 4U84A 3TDBA 4DRIA 4DRNA 3NRKA 5B8IC 3JYMA 1NSGA 2RSEA 5HWCA 2UZ5A 2N87A 3O5QA 4TNSA 3RGCA 1EYMA 2LJ4A 1B6CA 3NI6A 3O5IA 2K8IA 3O5KA 4TW7A 4DRQA 5HW8A 3GPKA 3IKGA 1QPLA 1FKJA 1FJDA 1FKGA 2F2DA 3MDYB 2PPNA 1FKIA
chains in the Genus database with same CATH superfamily
3ARPA 1FKRA 4MTVA 4JFLA 4LAWA 4S3JA 3VAWA 1FAPA 1TFVA 2KE0A 2XP5A 4Z2KA 2DSVA 2RUQA 1M5YA 1O6IA 1F8AB 2D9FA 1E6ZA 4J4OA 1CTNA 2KR7A 3WQWA 1KT0A 4DWSD 4FAPA 4R0XA 4XAKA 3IHZA 2RUDA 5HT1A 1U79A 5JH8A 4DZ3A 2DT3A 3IKDA 2XP8A 2XP4A 4O2TA 5HW6A 4HBOA 4J4NA 4P8VA 1H0IA 3ARUA 4G2PA 1FKDA 4IT6A 1UR8A 2WK2A 4AY1A 4DROA 3CH9A 2F21A 4JFIA 5HUAA 4DZ2A 3WH0A 3CHFA 3KZ7A 4IQ2A 2PPOA 1FKSA 3FY1A 3WQVA 3JYJA 1F40A 4JFJA 3UI5A 5DIUA 4DH0A 1J4IA 2ZQVA 3WIJA 1KT1A 2ZR6A 4ODLA 1W1TA 5D75A 1ITXA 3O5OA 4IT4A 1JNEA 3UQAA 4MPKA 4MNMA 3WD4A 4L72B 3CGMA 3O5JA 4LGXA 1GOIA 4Z2HA 4C02B 1UR9A 4WKHA 2KFWA 1XRVA 3ARQA 1ROUA 4DRIA 1ZBKA 5DO2A 2UZ5A 2DSZA 3O5QA 4P8XA 4DRQA 4Z2GA 1OWQA 3GPKA 1QPLA 3MDYB 1E6PA 2FAPA 2G41A 1ROTA 4G50A 3ARYA 2ETNA 2A3AA 2XP3A 4W5UA 2LGOA 2KI3A 2XPBA 3AS3A 1D7IA 3RM9A 1TCOC 2DG9A 3KAIA 2M2AA 4QT3A 4JFMA 1Q6HA 5HKGA 1NWRA 4IPXA 2MLZA 4BF8A 2ITKA 1N1AA 3NTPA 4PTMA 1NWTA 2WLZA 4ZPWR 1GRJA 1D7JA 4MNKA 4MSPA 2DSWA 3G6LA 4HBEA 4DRPA 3CGNA 3ARTA 1NH6A 1LJYA 2A3BA 1JNTA 1FKBA 5GPRA 1IX5A 1HKMA 3KAFA 5DITA 2DT1A 2ZQTA 4DRKA 1HJXA 3ARWA 2XP9A 4WKAA 3UQBA 4ZPTR 4MAVA 3UF8A 1E9LA 3O5PA 1EDQA 4JFKA 2Q5AA 4W9PA 3JXVA 2OFNA 3PR9A 4KQZA 1FKTA 1BL4A 3O5GA 2JZVA 2M1IA 1E6NA 1YATA 3BXWA 4DRJA 1H0GA 1ZBCA 1E44A 3WD3A 5GPGA 4P8WA 2ZR4A 5I98A 3PRDA 3KABA 4QZVB 1J4RA 4ODKA 4MNJA 1ZBWA 1HJVA 4S3KA 1NMWA 3QOKA 3WKZA 3O5FA 3O5DA 4ODOA 2M08A 3B9EA 1SR0A 1Q6IA 4ODQA 3ODKA 2MPHA 1QZ2A 2IF4A 2LPVA 1NWUA 5B8IC 1HKKA 3JYMA 2N87A 4TNSA 3RGCA 1E6RA 3O5IA 3O5KA 5HW8A 2A3EA 2FDMA 4HARA 1NWSA 3OA5A 2F2DA 1GPFA 1LG2A 1K9TA 1FKIA 2DPEA 3O5LA 1HKIA 2LKNA 4DWSA 2VN1A 4DIPA 3UQIA 1X6NA 2B31A 1L1PA 4WK9A 1ZB5A 3B9DA 2P4VA 3O5EA 4UDMA 1QPFA 3RFWA 3B9AA 1RD6A 4TX0A 3ALFA 4P8UA 3ARZA 3ARVA 4JYSA 3KAHA 4DRHA 1WB0A 3RM4A 1FKKA 1ZK6A 2RQSA 4ITZA 3UI4A 1LQ0A 5DIVA 1WNOA 4LAVA 4TW8A 3ARXA 3ARRA 3PA7A 4DWSC 2YBTA 3KAGA 1EHNA 2KO7A 2IUZA 1FKHA 3G6MA 3GTYX 4NSBA 1ZL1A 3EIPA 5DF0A 2AOSA 3O5RA 5HWBA 1VF8A 4N19A 2ZQSA 3OOBA 4FN2A 4ODNA 3CHDA 4WJXA 4Q22A 1E15A 5HTGA 1W26A 1HXVA 3BMBA 5GQBA 1OGBA 3LUOA 4KR0B 2G8ZA 3IK8A 1J6YA 3PRAA 2F23A 4U85A 2PI6A 3RMEA 4TYOA 1LL7A 1ZCNA 3CZ8A 1D7HA 1XHGA 4W9QA 4DWSB 2O9OA 3UI6A 3FAPA 2XP6A 3PRBA 2MLYA 2YBUA 1JVWA 3GU0A 2EULA 3WD0A 5HW7A 1A7XA 2PPPA 3AQUA 3I6CA 4QT2A 1JNSA 4WIWA 2ZQUA 4Z2LA 4LAYA 1FKFA 2F4EA 2A3CA 1FFQA 3AS1A 1HJWA 4U84A 1KFWA 3NRKA 4L3NA 1NSGA 2DSUA 2K8IA 4ZS6A 2O92A 3WD2A 1FKGA 2PPNA 1W1VA 4MNLA 2XPAA 3WL1A 4LAXA 4QIBA 4ODRA 2L2SA 3TC5A 4NZCA 4TW6A 2PBCA 3H9RB 1NMVA 1ZU8A 1X6LA 2AWGA 3TCZA 5J6EA 4ODPA 1FD9A 3AROA 1W1PA 1EQ3A 1Q1CA 3ALGA 2DG4A 5HWCA 1JCHB 5BXJA 3KCEA 3O5MA 2FKEA 3ARSA 3KADA 2ESCA 4Z2IA 3RM8A 1HKJA 1R9HA 3W4RA 2MF9A 4IQCA 2DG3A 1LL6A 4Z2JA 2RUCA 2VCDA 4Q7NA 5DEZA 1FFRA 2PV1A 4NNRA 3B7XA 1Y0OA 1T11A 2WLYA 2PV2A 1BKFA 3FXYA 2OLHA 1Q6UA 1D2KA 2XP7A 4ODMA 3AS2A 1W1YA 3EY6A 1PBKA 1W9UA 4URIA 1D6OA 4MGVA 2Y78A 1J4HA 1C9HA 2KGJA 4R5EA 3B8SA 5HBFA 1W9PA 1P5QA 2ZR5A 4W9OA 4WKFA 2PV3A 3CHEA 1WAWA 1OGGA 2DT0A 1W9VA 1YW5A 3AS0A 3CHCA 1FKLA 4DT4A 2RURA 1LG1A 2PN0A 4DRMA 3KACA 4GIVA 1LL4A 2MLXA 2MNTA 4GGQA 4U86A 3WD1A 1PINA 3TDBA 4DRNA 2QF8A 2RSEA 1SYTA 3WL0A 1EIBA 4ML4A 1GUVA 1EYMA 2LJ4A 1B6CA 3NI6A 4TW7A 4ZPVR 2WM0A 3IKGA 2B5UB 2DT2A 1FJDA 1FKJA 1ZBVA 1JNDA
chains in the Genus database with same CATH topology
3ARPA 1FKRA 4MTVA 4JFLA 4LAWA 4S3JA 3VAWA 1FAPA 1TFVA 2KE0A 2XP5A 4Z2KA 2DSVA 2RUQA 1M5YA 1O6IA 1F8AB 2D9FA 1E6ZA 4J4OA 1CTNA 2KR7A 3WQWA 1KT0A 4DWSD 4FAPA 4R0XA 4XAKA 3IHZA 2RUDA 5HT1A 1U79A 5JH8A 4DZ3A 2DT3A 3IKDA 2XP8A 2XP4A 4O2TA 5HW6A 4HBOA 4J4NA 4P8VA 1H0IA 3ARUA 4G2PA 1FKDA 4IT6A 1UR8A 2WK2A 4AY1A 4DROA 3CH9A 2F21A 4JFIA 5HUAA 4DZ2A 3WH0A 3CHFA 3KZ7A 4IQ2A 2PPOA 1FKSA 3FY1A 3WQVA 3JYJA 1F40A 4JFJA 3UI5A 5DIUA 4DH0A 1J4IA 2ZQVA 3WIJA 1KT1A 2ZR6A 4ODLA 1W1TA 5D75A 1ITXA 3O5OA 4IT4A 1JNEA 3UQAA 4MPKA 4MNMA 3WD4A 4L72B 3CGMA 3O5JA 4LGXA 1GOIA 4Z2HA 4C02B 1UR9A 4WKHA 2KFWA 1XRVA 3ARQA 1ROUA 4DRIA 1ZBKA 5DO2A 2UZ5A 2DSZA 3O5QA 4P8XA 4DRQA 4Z2GA 1OWQA 3GPKA 1QPLA 3MDYB 1E6PA 2FAPA 2G41A 1ROTA 4G50A 3ARYA 2A3AA 2XP3A 4W5UA 2LGOA 2KI3A 2XPBA 3AS3A 1D7IA 3RM9A 1TCOC 2DG9A 3KAIA 2M2AA 4QT3A 4JFMA 1Q6HA 5HKGA 1NWRA 4IPXA 2MLZA 4BF8A 2ITKA 1N1AA 3NTPA 4PTMA 1NWTA 2WLZA 4ZPWR 1D7JA 4MNKA 4MSPA 2DSWA 3G6LA 4HBEA 4DRPA 3CGNA 3ARTA 1NH6A 1LJYA 2A3BA 1JNTA 1FKBA 5GPRA 1IX5A 1HKMA 3KAFA 5DITA 2DT1A 2ZQTA 4DRKA 1HJXA 3ARWA 2XP9A 4WKAA 3UQBA 4ZPTR 4MAVA 3UF8A 1E9LA 3O5PA 1EDQA 4JFKA 2Q5AA 4W9PA 3JXVA 2OFNA 3PR9A 4KQZA 1FKTA 1BL4A 3O5GA 2JZVA 2M1IA 1E6NA 1YATA 3BXWA 4DRJA 1H0GA 1ZBCA 3WD3A 5GPGA 4P8WA 2ZR4A 5I98A 3PRDA 3KABA 4QZVB 1J4RA 4ODKA 4MNJA 1ZBWA 1HJVA 4S3KA 1NMWA 3QOKA 3WKZA 3O5FA 3O5DA 4ODOA 2M08A 3B9EA 1SR0A 1Q6IA 4ODQA 3ODKA 2MPHA 1QZ2A 2IF4A 2LPVA 1NWUA 5B8IC 1HKKA 3JYMA 2N87A 4TNSA 3RGCA 1E6RA 3O5IA 3O5KA 5HW8A 2A3EA 2FDMA 4HARA 1NWSA 3OA5A 2F2DA 1GPFA 1LG2A 1K9TA 1FKIA 2DPEA 3O5LA 1HKIA 2LKNA 4DWSA 2VN1A 4DIPA 3UQIA 1X6NA 2B31A 1L1PA 4WK9A 1ZB5A 3B9DA 3O5EA 1QPFA 3RFWA 3B9AA 1RD6A 4TX0A 3ALFA 4P8UA 3ARZA 3ARVA 4JYSA 3KAHA 4DRHA 1WB0A 3RM4A 1FKKA 1ZK6A 2RQSA 4ITZA 3UI4A 1LQ0A 5DIVA 1WNOA 4LAVA 4TW8A 3ARXA 3ARRA 3PA7A 4DWSC 2YBTA 3KAGA 1EHNA 2KO7A 2IUZA 1FKHA 3G6MA 4NSBA 1ZL1A 5DF0A 2AOSA 3O5RA 5HWBA 1VF8A 4N19A 2ZQSA 3OOBA 4FN2A 4ODNA 3CHDA 4WJXA 4Q22A 1E15A 5HTGA 1W26A 1HXVA 5GQBA 1OGBA 3LUOA 4KR0B 2G8ZA 3IK8A 1J6YA 3PRAA 4U85A 2PI6A 3RMEA 4TYOA 1LL7A 1ZCNA 3CZ8A 1D7HA 1XHGA 4W9QA 4DWSB 2O9OA 3UI6A 3FAPA 2XP6A 3PRBA 2MLYA 2YBUA 1JVWA 5HW7A 3WD0A 1A7XA 2PPPA 3AQUA 3I6CA 4QT2A 1JNSA 4WIWA 2ZQUA 4Z2LA 4LAYA 1FKFA 2F4EA 2A3CA 1FFQA 3AS1A 1HJWA 4U84A 1KFWA 3NRKA 4L3NA 1NSGA 2DSUA 2K8IA 4ZS6A 2O92A 3WD2A 1FKGA 2PPNA 1W1VA 4MNLA 2XPAA 3WL1A 4LAXA 4QIBA 4ODRA 2L2SA 3TC5A 4NZCA 4TW6A 2PBCA 3H9RB 1NMVA 1ZU8A 1X6LA 2AWGA 3TCZA 5J6EA 4ODPA 1FD9A 3AROA 1W1PA 1EQ3A 1Q1CA 3ALGA 2DG4A 5HWCA 5BXJA 3O5MA 3KCEA 2FKEA 3ARSA 3KADA 2ESCA 4Z2IA 3RM8A 1HKJA 1R9HA 3W4RA 2MF9A 4IQCA 2DG3A 1LL6A 4Z2JA 2RUCA 2VCDA 4Q7NA 5DEZA 1FFRA 2PV1A 4NNRA 3B7XA 1Y0OA 1T11A 2WLYA 2PV2A 1BKFA 3FXYA 2OLHA 1Q6UA 1D2KA 2XP7A 4ODMA 3AS2A 1W1YA 3EY6A 1PBKA 1W9UA 4URIA 1D6OA 4MGVA 2Y78A 1J4HA 1C9HA 2KGJA 4R5EA 3B8SA 5HBFA 1W9PA 1P5QA 2ZR5A 4W9OA 4WKFA 2PV3A 3CHEA 1WAWA 1OGGA 2DT0A 1W9VA 1YW5A 3AS0A 3CHCA 1FKLA 4DT4A 2RURA 1LG1A 4DRMA 3KACA 4GIVA 1LL4A 2MLXA 2MNTA 4GGQA 4U86A 3WD1A 1PINA 3TDBA 4DRNA 2QF8A 2RSEA 1SYTA 3WL0A 1EIBA 4ML4A 1GUVA 1EYMA 2LJ4A 1B6CA 3NI6A 4TW7A 4ZPVR 2WM0A 3IKGA 2DT2A 1FJDA 1FKJA 1ZBVA 1JNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKR A;  3O5L A;  2FAP A;  4JFL A;  1ROT A;  2XPA A;  2LKN A;  4LAW A;  4G50 A;  4LAX A;  2VN1 A;  4QIB A;  4DIP A;  3UQI A;  1L1P A;  4ODR A;  2L2S A;  3VAW A;  1FAP A;  3TC5 A;  4TW6 A;  2PBC A;  3O5E A;  3H9R B;  1NMV A;  2KE0 A;  1QPF A;  3RFW A;  4TX0 A;  2AWG A;  2XP3 A;  2XP5 A;  2LGO A;  3TCZ A;  2KI3 A;  5J6E A;  2XPB A;  1FD9 A;  4ODP A;  4JYS A;  1D7I A;  1TCO C;  2RUQ A;  1M5Y A;  3KAH A;  2DG9 A;  1F8A B;  3KAI A;  1Q1C A;  2M2A A;  1FKK A;  4DRH A;  1EQ3 A;  2D9F A;  1ZK6 A;  2DG4 A;  2RQS A;  4JFM A;  4QT3 A;  1Q6H A;  5HKG A;  4J4O A;  4ITZ A;  2KR7 A;  4IPX A;  3UI4 A;  2MLZ A;  5DIV A;  2ITK A;  1KT0 A;  1N1A A;  4R0X A;  4BF8 A;  4FAP A;  5BXJ A;  3KCE A;  3NTP A;  2FKE A;  2RUD A;  3IHZ A;  3O5M A;  1U79 A;  4LAV A;  4TW8 A;  3PA7 A;  5HT1 A;  1D7J A;  4DZ3 A;  3KAG A;  4MSP A;  2KO7 A;  3KAD A;  3IKD A;  1FKH A;  2XP8 A;  4DRP A;  3CGN A;  2XP4 A;  4O2T A;  1R9H A;  5HW6 A;  2MF9 A;  4IQC A;  4J4N A;  2DG3 A;  4G2P A;  1JNT A;  1FKB A;  3O5R A;  1FKD A;  2RUC A;  2VCD A;  5HWB A;  3KAF A;  5DIT A;  4N19 A;  2ZQT A;  2ZQS A;  4DRK A;  3OOB A;  4FN2 A;  4ODN A;  2PV1 A;  4NNR A;  3B7X A;  1Y0O A;  4DRO A;  2XP9 A;  2F21 A;  4JFI A;  5HUA A;  1T11 A;  5HTG A;  3UQB A;  3UF8 A;  1W26 A;  2PV2 A;  1BKF A;  3O5P A;  3WH0 A;  4DZ2 A;  1Q6U A;  3KZ7 A;  4JFK A;  2Q5A A;  4W9P A;  1HXV A;  2XP7 A;  3JXV A;  2OFN A;  4IQ2 A;  2PPO A;  4ODM A;  1FKS A;  1FKT A;  3LUO A;  3JYJ A;  3EY6 A;  1PBK A;  1BL4 A;  3IK8 A;  3O5G A;  1J6Y A;  2JZV A;  2M1I A;  1F40 A;  1D6O A;  4JFJ A;  1YAT A;  4MGV A;  2Y78 A;  5DIU A;  3UI5 A;  4DH0 A;  4U85 A;  4DRJ A;  1J4H A;  1J4I A;  1C9H A;  2KGJ A;  4TYO A;  2ZQV A;  1ZCN A;  1KT1 A;  2ZR6 A;  4ODL A;  1D7H A;  5GPG A;  4W9Q A;  2ZR4 A;  1P5Q A;  5D75 A;  5I98 A;  3UI6 A;  3FAP A;  3PRD A;  3KAB A;  3O5O A;  2XP6 A;  3UQA A;  2ZR5 A;  1J4R A;  3PRB A;  4W9O A;  2MLY A;  2PV3 A;  1JVW A;  4ODK A;  5HW7 A;  3CGM A;  3O5J A;  1A7X A;  1NMW A;  2PPP A;  1JNS A;  3I6C A;  4QT2 A;  3O5F A;  1YW5 A;  1FKL A;  2ZQU A;  3O5D A;  4ODO A;  2M08 A;  4C02 B;  4DT4 A;  2RUR A;  2KFW A;  4LAY A;  1FKF A;  2F4E A;  4DRM A;  3KAC A;  1Q6I A;  4GIV A;  4ODQ A;  2MLX A;  2MNT A;  2MPH A;  1QZ2 A;  3ODK A;  2IF4 A;  2LPV A;  1PIN A;  4GGQ A;  1ROU A;  4U86 A;  4U84 A;  3TDB A;  4DRI A;  4DRN A;  3NRK A;  5B8I C;  3JYM A;  1NSG A;  2RSE A;  5HWC A;  2UZ5 A;  2N87 A;  3O5Q A;  4TNS A;  3RGC A;  1EYM A;  2LJ4 A;  1B6C A;  3NI6 A;  3O5I A;  2K8I A;  3O5K A;  4TW7 A;  4DRQ A;  5HW8 A;  3GPK A;  3IKG A;  1QPL A;  1FKJ A;  1FJD A;  1FKG A;  2F2D A;  3MDY B;  2PPN A;  1FKI A; 
#chains in the Genus database with same CATH topology
 3ARP A;  1FKR A;  4MTV A;  4JFL A;  4LAW A;  4S3J A;  3VAW A;  1FAP A;  1TFV A;  2KE0 A;  2XP5 A;  4Z2K A;  2DSV A;  2RUQ A;  1M5Y A;  1O6I A;  1F8A B;  2D9F A;  1E6Z A;  4J4O A;  1CTN A;  2KR7 A;  3WQW A;  1KT0 A;  4DWS D;  4FAP A;  4R0X A;  4XAK A;  3IHZ A;  2RUD A;  5HT1 A;  1U79 A;  5JH8 A;  4DZ3 A;  2DT3 A;  3IKD A;  2XP8 A;  2XP4 A;  4O2T A;  5HW6 A;  4HBO A;  4J4N A;  4P8V A;  1H0I A;  3ARU A;  4G2P A;  1FKD A;  4IT6 A;  1UR8 A;  2WK2 A;  4AY1 A;  4DRO A;  3CH9 A;  2F21 A;  4JFI A;  5HUA A;  4DZ2 A;  3WH0 A;  3CHF A;  3KZ7 A;  4IQ2 A;  2PPO A;  1FKS A;  3FY1 A;  3WQV A;  3JYJ A;  1F40 A;  4JFJ A;  3UI5 A;  5DIU A;  4DH0 A;  1J4I A;  2ZQV A;  3WIJ A;  1KT1 A;  2ZR6 A;  4ODL A;  1W1T A;  5D75 A;  1ITX A;  3O5O A;  4IT4 A;  1JNE A;  3UQA A;  4MPK A;  4MNM A;  3WD4 A;  4L72 B;  3CGM A;  3O5J A;  4LGX A;  1GOI A;  4Z2H A;  4C02 B;  1UR9 A;  4WKH A;  2KFW A;  1XRV A;  3ARQ A;  1ROU A;  4DRI A;  1ZBK A;  5DO2 A;  2UZ5 A;  2DSZ A;  3O5Q A;  4P8X A;  4DRQ A;  4Z2G A;  1OWQ A;  3GPK A;  1QPL A;  3MDY B;  1E6P A;  2FAP A;  2G41 A;  1ROT A;  4G50 A;  3ARY A;  2ETN A;  2A3A A;  2XP3 A;  4W5U A;  2LGO A;  2KI3 A;  2XPB A;  3AS3 A;  1D7I A;  3RM9 A;  1TCO C;  2DG9 A;  3KAI A;  2M2A A;  4QT3 A;  4JFM A;  1Q6H A;  5HKG A;  1NWR A;  4IPX A;  2MLZ A;  4BF8 A;  2ITK A;  1N1A A;  3NTP A;  4PTM A;  1NWT A;  2WLZ A;  4ZPW R;  1GRJ A;  1D7J A;  4MNK A;  4MSP A;  2DSW A;  3G6L A;  4HBE A;  4DRP A;  3CGN A;  3ART A;  1NH6 A;  1LJY A;  2A3B A;  1JNT A;  1FKB A;  5GPR A;  1IX5 A;  1HKM A;  3KAF A;  5DIT A;  2DT1 A;  2ZQT A;  4DRK A;  1HJX A;  3ARW A;  2XP9 A;  4WKA A;  3UQB A;  4ZPT R;  4MAV A;  3UF8 A;  1E9L A;  3O5P A;  1EDQ A;  4JFK A;  2Q5A A;  4W9P A;  3JXV A;  2OFN A;  3PR9 A;  4KQZ A;  1FKT A;  1BL4 A;  3O5G A;  2JZV A;  2M1I A;  1E6N A;  1YAT A;  3BXW A;  4DRJ A;  1H0G A;  1ZBC A;  1E44 A;  3WD3 A;  5GPG A;  4P8W A;  2ZR4 A;  5I98 A;  3PRD A;  3KAB A;  4QZV B;  1J4R A;  4ODK A;  4MNJ A;  1ZBW A;  1HJV A;  4S3K A;  1NMW A;  3QOK A;  3WKZ A;  3O5F A;  3O5D A;  4ODO A;  2M08 A;  3B9E A;  1SR0 A;  1Q6I A;  4ODQ A;  3ODK A;  2MPH A;  1QZ2 A;  2IF4 A;  2LPV A;  1NWU A;  5B8I C;  1HKK A;  3JYM A;  2N87 A;  4TNS A;  3RGC A;  1E6R A;  3O5I A;  3O5K A;  5HW8 A;  2A3E A;  2FDM A;  4HAR A;  1NWS A;  3OA5 A;  2F2D A;  1GPF A;  1LG2 A;  1K9T A;  1FKI A;  2DPE A;  3O5L A;  1HKI A;  2LKN A;  4DWS A;  2VN1 A;  4DIP A;  3UQI A;  1X6N A;  2B31 A;  1L1P A;  4WK9 A;  1ZB5 A;  3B9D A;  2P4V A;  3O5E A;  4UDM A;  1QPF A;  3RFW A;  3B9A A;  1RD6 A;  4TX0 A;  3ALF A;  4P8U A;  3ARZ A;  3ARV A;  4JYS A;  3KAH A;  4DRH A;  1WB0 A;  3RM4 A;  1FKK A;  1ZK6 A;  2RQS A;  4ITZ A;  3UI4 A;  1LQ0 A;  5DIV A;  1WNO A;  4LAV A;  4TW8 A;  3ARX A;  3ARR A;  3PA7 A;  4DWS C;  2YBT A;  3KAG A;  1EHN A;  2KO7 A;  2IUZ A;  1FKH A;  3G6M A;  3GTY X;  4NSB A;  1ZL1 A;  3EIP A;  5DF0 A;  2AOS A;  3O5R A;  5HWB A;  1VF8 A;  4N19 A;  2ZQS A;  3OOB A;  4FN2 A;  4ODN A;  3CHD A;  4WJX A;  4Q22 A;  1E15 A;  5HTG A;  1W26 A;  1HXV A;  3BMB A;  5GQB A;  1OGB A;  3LUO A;  4KR0 B;  2G8Z A;  3IK8 A;  1J6Y A;  3PRA A;  2F23 A;  4U85 A;  2PI6 A;  3RME A;  4TYO A;  1LL7 A;  1ZCN A;  3CZ8 A;  1D7H A;  1XHG A;  4W9Q A;  4DWS B;  2O9O A;  3UI6 A;  3FAP A;  2XP6 A;  3PRB A;  2MLY A;  2YBU A;  1JVW A;  3GU0 A;  2EUL A;  3WD0 A;  5HW7 A;  1A7X A;  2PPP A;  3AQU A;  3I6C A;  4QT2 A;  1JNS A;  4WIW A;  2ZQU A;  4Z2L A;  4LAY A;  1FKF A;  2F4E A;  2A3C A;  1FFQ A;  3AS1 A;  1HJW A;  4U84 A;  1KFW A;  3NRK A;  4L3N A;  1NSG A;  2DSU A;  2K8I A;  4ZS6 A;  2O92 A;  3WD2 A;  1FKG A;  2PPN A;  1W1V A;  4MNL A;  2XPA A;  3WL1 A;  4LAX A;  4QIB A;  4ODR A;  2L2S A;  3TC5 A;  4NZC A;  4TW6 A;  2PBC A;  3H9R B;  1NMV A;  1ZU8 A;  1X6L A;  2AWG A;  3TCZ A;  5J6E A;  4ODP A;  1FD9 A;  3ARO A;  1W1P A;  1EQ3 A;  1Q1C A;  3ALG A;  2DG4 A;  5HWC A;  1JCH B;  5BXJ A;  3KCE A;  3O5M A;  2FKE A;  3ARS A;  3KAD A;  2ESC A;  4Z2I A;  3RM8 A;  1HKJ A;  1R9H A;  3W4R A;  2MF9 A;  4IQC A;  2DG3 A;  1LL6 A;  4Z2J A;  2RUC A;  2VCD A;  4Q7N A;  5DEZ A;  1FFR A;  2PV1 A;  4NNR A;  3B7X A;  1Y0O A;  1T11 A;  2WLY A;  2PV2 A;  1BKF A;  3FXY A;  2OLH A;  1Q6U A;  1D2K A;  2XP7 A;  4ODM A;  3AS2 A;  1W1Y A;  3EY6 A;  1PBK A;  1W9U A;  4URI A;  1D6O A;  4MGV A;  2Y78 A;  1J4H A;  1C9H A;  2KGJ A;  4R5E A;  3B8S A;  5HBF A;  1W9P A;  1P5Q A;  2ZR5 A;  4W9O A;  4WKF A;  2PV3 A;  3CHE A;  1WAW A;  1OGG A;  2DT0 A;  1W9V A;  1YW5 A;  3AS0 A;  3CHC A;  1FKL A;  4DT4 A;  2RUR A;  1LG1 A;  2PN0 A;  4DRM A;  3KAC A;  4GIV A;  1LL4 A;  2MLX A;  2MNT A;  4GGQ A;  4U86 A;  3WD1 A;  1PIN A;  3TDB A;  4DRN A;  2QF8 A;  2RSE A;  1SYT A;  3WL0 A;  1EIB A;  4ML4 A;  1GUV A;  1EYM A;  2LJ4 A;  1B6C A;  3NI6 A;  4TW7 A;  4ZPV R;  2WM0 A;  3IKG A;  2B5U B;  2DT2 A;  1FJD A;  1FKJ A;  1ZBV A;  1JND A; 
#chains in the Genus database with same CATH homology
 3ARP A;  1FKR A;  4MTV A;  4JFL A;  4LAW A;  4S3J A;  3VAW A;  1FAP A;  1TFV A;  2KE0 A;  2XP5 A;  4Z2K A;  2DSV A;  2RUQ A;  1M5Y A;  1O6I A;  1F8A B;  2D9F A;  1E6Z A;  4J4O A;  1CTN A;  2KR7 A;  3WQW A;  1KT0 A;  4DWS D;  4FAP A;  4R0X A;  4XAK A;  3IHZ A;  2RUD A;  5HT1 A;  1U79 A;  5JH8 A;  4DZ3 A;  2DT3 A;  3IKD A;  2XP8 A;  2XP4 A;  4O2T A;  5HW6 A;  4HBO A;  4J4N A;  4P8V A;  1H0I A;  3ARU A;  4G2P A;  1FKD A;  4IT6 A;  1UR8 A;  2WK2 A;  4AY1 A;  4DRO A;  3CH9 A;  2F21 A;  4JFI A;  5HUA A;  4DZ2 A;  3WH0 A;  3CHF A;  3KZ7 A;  4IQ2 A;  2PPO A;  1FKS A;  3FY1 A;  3WQV A;  3JYJ A;  1F40 A;  4JFJ A;  3UI5 A;  5DIU A;  4DH0 A;  1J4I A;  2ZQV A;  3WIJ A;  1KT1 A;  2ZR6 A;  4ODL A;  1W1T A;  5D75 A;  1ITX A;  3O5O A;  4IT4 A;  1JNE A;  3UQA A;  4MPK A;  4MNM A;  3WD4 A;  4L72 B;  3CGM A;  3O5J A;  4LGX A;  1GOI A;  4Z2H A;  4C02 B;  1UR9 A;  4WKH A;  2KFW A;  1XRV A;  3ARQ A;  1ROU A;  4DRI A;  1ZBK A;  5DO2 A;  2UZ5 A;  2DSZ A;  3O5Q A;  4P8X A;  4DRQ A;  4Z2G A;  1OWQ A;  3GPK A;  1QPL A;  3MDY B;  1E6P A;  2FAP A;  2G41 A;  1ROT A;  4G50 A;  3ARY A;  2A3A A;  2XP3 A;  4W5U A;  2LGO A;  2KI3 A;  2XPB A;  3AS3 A;  1D7I A;  3RM9 A;  1TCO C;  2DG9 A;  3KAI A;  2M2A A;  4QT3 A;  4JFM A;  1Q6H A;  5HKG A;  1NWR A;  4IPX A;  2MLZ A;  4BF8 A;  2ITK A;  1N1A A;  3NTP A;  4PTM A;  1NWT A;  2WLZ A;  4ZPW R;  1D7J A;  4MNK A;  4MSP A;  2DSW A;  3G6L A;  4HBE A;  4DRP A;  3CGN A;  3ART A;  1NH6 A;  1LJY A;  2A3B A;  1JNT A;  1FKB A;  5GPR A;  1IX5 A;  1HKM A;  3KAF A;  5DIT A;  2DT1 A;  2ZQT A;  4DRK A;  1HJX A;  3ARW A;  2XP9 A;  4WKA A;  3UQB A;  4ZPT R;  4MAV A;  3UF8 A;  1E9L A;  3O5P A;  1EDQ A;  4JFK A;  2Q5A A;  4W9P A;  3JXV A;  2OFN A;  3PR9 A;  4KQZ A;  1FKT A;  1BL4 A;  3O5G A;  2JZV A;  2M1I A;  1E6N A;  1YAT A;  3BXW A;  4DRJ A;  1H0G A;  1ZBC A;  3WD3 A;  5GPG A;  4P8W A;  2ZR4 A;  5I98 A;  3PRD A;  3KAB A;  4QZV B;  1J4R A;  4ODK A;  4MNJ A;  1ZBW A;  1HJV A;  4S3K A;  1NMW A;  3QOK A;  3WKZ A;  3O5F A;  3O5D A;  4ODO A;  2M08 A;  3B9E A;  1SR0 A;  1Q6I A;  4ODQ A;  3ODK A;  2MPH A;  1QZ2 A;  2IF4 A;  2LPV A;  1NWU A;  5B8I C;  1HKK A;  3JYM A;  2N87 A;  4TNS A;  3RGC A;  1E6R A;  3O5I A;  3O5K A;  5HW8 A;  2A3E A;  2FDM A;  4HAR A;  1NWS A;  3OA5 A;  2F2D A;  1GPF A;  1LG2 A;  1K9T A;  1FKI A;  2DPE A;  3O5L A;  1HKI A;  2LKN A;  4DWS A;  2VN1 A;  4DIP A;  3UQI A;  1X6N A;  2B31 A;  1L1P A;  4WK9 A;  1ZB5 A;  3B9D A;  3O5E A;  1QPF A;  3RFW A;  3B9A A;  1RD6 A;  4TX0 A;  3ALF A;  4P8U A;  3ARZ A;  3ARV A;  4JYS A;  3KAH A;  4DRH A;  1WB0 A;  3RM4 A;  1FKK A;  1ZK6 A;  2RQS A;  4ITZ A;  3UI4 A;  1LQ0 A;  5DIV A;  1WNO A;  4LAV A;  4TW8 A;  3ARX A;  3ARR A;  3PA7 A;  4DWS C;  2YBT A;  3KAG A;  1EHN A;  2KO7 A;  2IUZ A;  1FKH A;  3G6M A;  4NSB A;  1ZL1 A;  5DF0 A;  2AOS A;  3O5R A;  5HWB A;  1VF8 A;  4N19 A;  2ZQS A;  3OOB A;  4FN2 A;  4ODN A;  3CHD A;  4WJX A;  4Q22 A;  1E15 A;  5HTG A;  1W26 A;  1HXV A;  5GQB A;  1OGB A;  3LUO A;  4KR0 B;  2G8Z A;  3IK8 A;  1J6Y A;  3PRA A;  4U85 A;  2PI6 A;  3RME A;  4TYO A;  1LL7 A;  1ZCN A;  3CZ8 A;  1D7H A;  1XHG A;  4W9Q A;  4DWS B;  2O9O A;  3UI6 A;  3FAP A;  2XP6 A;  3PRB A;  2MLY A;  2YBU A;  1JVW A;  5HW7 A;  3WD0 A;  1A7X A;  2PPP A;  3AQU A;  3I6C A;  4QT2 A;  1JNS A;  4WIW A;  2ZQU A;  4Z2L A;  4LAY A;  1FKF A;  2F4E A;  2A3C A;  1FFQ A;  3AS1 A;  1HJW A;  4U84 A;  1KFW A;  3NRK A;  4L3N A;  1NSG A;  2DSU A;  2K8I A;  4ZS6 A;  2O92 A;  3WD2 A;  1FKG A;  2PPN A;  1W1V A;  4MNL A;  2XPA A;  3WL1 A;  4LAX A;  4QIB A;  4ODR A;  2L2S A;  3TC5 A;  4NZC A;  4TW6 A;  2PBC A;  3H9R B;  1NMV A;  1ZU8 A;  1X6L A;  2AWG A;  3TCZ A;  5J6E A;  4ODP A;  1FD9 A;  3ARO A;  1W1P A;  1EQ3 A;  1Q1C A;  3ALG A;  2DG4 A;  5HWC A;  5BXJ A;  3O5M A;  3KCE A;  2FKE A;  3ARS A;  3KAD A;  2ESC A;  4Z2I A;  3RM8 A;  1HKJ A;  1R9H A;  3W4R A;  2MF9 A;  4IQC A;  2DG3 A;  1LL6 A;  4Z2J A;  2RUC A;  2VCD A;  4Q7N A;  5DEZ A;  1FFR A;  2PV1 A;  4NNR A;  3B7X A;  1Y0O A;  1T11 A;  2WLY A;  2PV2 A;  1BKF A;  3FXY A;  2OLH A;  1Q6U A;  1D2K A;  2XP7 A;  4ODM A;  3AS2 A;  1W1Y A;  3EY6 A;  1PBK A;  1W9U A;  4URI A;  1D6O A;  4MGV A;  2Y78 A;  1J4H A;  1C9H A;  2KGJ A;  4R5E A;  3B8S A;  5HBF A;  1W9P A;  1P5Q A;  2ZR5 A;  4W9O A;  4WKF A;  2PV3 A;  3CHE A;  1WAW A;  1OGG A;  2DT0 A;  1W9V A;  1YW5 A;  3AS0 A;  3CHC A;  1FKL A;  4DT4 A;  2RUR A;  1LG1 A;  4DRM A;  3KAC A;  4GIV A;  1LL4 A;  2MLX A;  2MNT A;  4GGQ A;  4U86 A;  3WD1 A;  1PIN A;  3TDB A;  4DRN A;  2QF8 A;  2RSE A;  1SYT A;  3WL0 A;  1EIB A;  4ML4 A;  1GUV A;  1EYM A;  2LJ4 A;  1B6C A;  3NI6 A;  4TW7 A;  4ZPV R;  2WM0 A;  3IKG A;  2DT2 A;  1FJD A;  1FKJ A;  1ZBV A;  1JND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...