1FKRA

Solution structure of fkbp, a rotamase enzyme and receptor for fk506 and rapamycin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 AND RAPAMYCIN-BINDING PROTEIN
publication title Solution structure of FKBP, a rotamase enzyme and receptor for FK506 and rapamycin.
pubmed rcsb
source organism Homo sapiens
molecule tags Cis-trans isomerase
total genus 13
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1992-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkrA00
4ODLA 4TNSA 2PV1A 3UI4A 1FJDA 1FKRA 2KI3A 2M2AA 4U84A 2PBCA 4QT3A 3RGCA 4DRJA 3O5IA 5HWBA 2RURA 3O5FA 2LGOA 2KO7A 1P5QA 3KZ7A 1FKDA 4R0XA 3IHZA 3TDBA 1J4IA 1D6OA 4ODNA 3NI6A 4ITZA 3EY6A 4DRHA 1T11A 3KAHA 1FKHA 1D7JA 4IPXA 3TCZA 4DRIA 2KFWA 1W26A 3KAIA 2F21A 2ZQTA 3KAFA 3OOBA 4TW6A 1Y0OA 2RUQA 4DIPA 3UQAA 1EQ3A 1FAPA 2XP8A 2ZR4A 5HW8A 1U79A 3PA7A 3UI5A 3IKDA 2MNTA 3O5PA 1QPFA 5HT1A 3CGNA 2XP6A 3KADA 1FKLA 1BKFA 3O5RA 4LAVA 2XP3A 1FKBA 2ITKA 4TX0A 4LAXA 3TC5A 4DRMA 2FAPA 1FKTA 1FKJA 2MF9A 5DIUA 1FKSA 4JFMA 2LKNA 3O5JA 3O5DA 3O5LA 4J4NA 1Q6UA 2IF4A 1ROTA 4G2PA 3JYJA 1ROUA 5D75A 4C02B 1Q1CA 2XP7A 2VN1A 4U86A 1M5YA 4DRPA 2PPNA 3CGMA 4ODOA 2FKEA 3I6CA 2DG9A 4IQ2A 2XP9A 1J4RA 2F4EA 3PRBA 3O5QA 1D7HA 2XP4A 3PRDA 2MLYA 3LUOA 4IQCA 3WH0A 3O5GA 4W9PA 5DIVA 5B8IC 2RUDA 1D7IA 2M1IA 4N19A 4TYOA 1J6YA 1FKIA 1NSGA 2Y78A 4GGQA 3VAWA 1ZCNA 3UQBA 3KCEA 4TW8A 2XPAA 4JFLA 3UF8A 5HUAA 2AWGA 1KT1A 2K8IA 2LJ4A 4ODKA 4QT2A 3JYMA 1EYMA 4DRQA 4JFJA 3UQIA 3H9RB 5HTGA 2F2DA 4GIVA 4MGVA 1FKKA 1FKGA 2ZR6A 2KGJA 4G50A 2D9FA 1N1AA 4BF8A 3MDYB 2ZR5A 4DRKA 4DRNA 1YATA 1A7XA 2DG4A 2LPVA 4DZ3A 1FKFA 1YW5A 3KABA 4MSPA 4ODMA 2RQSA 2DG3A 3GPKA 4JFKA 1NMVA 4JFIA 4W9OA 1PINA 3IKGA 3RFWA 4FN2A 1JVWA 2Q5AA 2N87A 4W9QA 4FAPA 4ODRA 4O2TA 3O5EA 2JZVA 5DITA 4QIBA 2VCDA 5HW7A 2XPBA 3KACA 3FAPA 3O5MA 1BL4A 3O5KA 5J6EA 1F8AB 2XP5A 3ODKA 1QPLA 5I98A 4LAYA 1FD9A 3IK8A 3KAGA 4DROA 1F40A 4DH0A 1Q6IA 2OFNA 3NRKA 4LAWA 3UI6A 2PV3A 1PBKA 2RSEA 1HXVA 1NMWA 4DZ2A 2PV2A 5BXJA 5HW6A 2MPHA 5HWCA 2KR7A 2KE0A 1L1PA 2ZQVA 4J4OA 2PPPA 4U85A 5GPGA 4DT4A 4JYSA 1Q6HA 1B6CA 3O5OA 4NNRA 2M08A 4ODQA 1JNTA 1KT0A 1TCOC 2MLZA 4TW7A 1QZ2A 2MLXA 1JNSA 2UZ5A 2ZQUA 4ODPA 2PPOA 2L2SA 3B7XA 5HKGA 1C9HA 2ZQSA 1ZK6A 3NTPA 2RUCA 1J4HA 3JXVA 1R9HA
chains in the Genus database with same CATH superfamily
4ODLA 4P8VA 1FFRA 1XHGA 1FKRA 2M2AA 3RGCA 4QZVB 5HWBA 1W9VA 4DWSD 3IHZA 1ZBVA 3NI6A 3EY6A 4URIA 3KAHA 1D7JA 4IPXA 3WD1A 3GU0A 2ESCA 1EQ3A 2ZR4A 2PI6A 1HJVA 2AOSA 2DT2A 1HKJA 1EHNA 1FKBA 4LAXA 2FAPA 3O5LA 1Q6UA 1ROTA 4G2PA 3JYJA 1ROUA 2XP7A 2B31A 5DO2A 3ARQA 3AQUA 1J4RA 1HJWA 3WL0A 1WNOA 3O5GA 3EIPA 2RUDA 1H0GA 4N19A 1UR8A 1FKIA 4S3JA 1K9TA 4GGQA 3B9AA 1GOIA 1KT1A 1NH6A 2LJ4A 4QT2A 4WJXA 3JYMA 3AS3A 1FKKA 2ZR6A 2QF8A 4DRNA 1A7XA 2O92A 1YW5A 1E9LA 1XRVA 3KABA 4ODMA 1E15A 3G6LA 2DG3A 4JFKA 3ARUA 4IT4A 4JFIA 1PINA 2YBTA 1ZBKA 4W9QA 2JZVA 4Z2LA 4Z2JA 2VCDA 3AS2A 1BL4A 1F8AB 2DT3A 3IK8A 3KAGA 1F40A 3NRKA 3AS1A 2EULA 3ARSA 4LAWA 3UI6A 1HXVA 1W1VA 1OGGA 1SR0A 1HJXA 1NWTA 5HWCA 2ZQVA 4DT4A 1Q6HA 1B6CA 2M08A 3AS0A 1TCOC 1JNSA 1QZ2A 4XAKA 5HKGA 2O9OA 2RUCA 1R9HA 1CTNA 5DF0A 2PV1A 4U84A 2RURA 4ZS6A 2LGOA 2KO7A 3WQWA 1FKDA 3OA5A 4R0XA 1T11A 2G8ZA 3TCZA 1LG2A 1W1YA 4DRIA 5GPRA 3OOBA 4DIPA 4Z2IA 1RD6A 1GRJA 3CHCA 1U79A 1OWQA 2MNTA 1QPFA 2DPEA 3RM9A 3ARPA 1GPFA 4LAVA 4P8UA 4W5UA 1D2KA 1FKJA 1LQ0A 1FKSA 1HKIA 4JFMA 1ITXA 3O5DA 4J4NA 4KR0B 1OGBA 3ARXA 1M5YA 2FKEA 4IQ2A 4WKFA 1VF8A 2DSZA 1EIBA 3O5QA 3PRDA 2MLYA 3WH0A 2M1IA 4DWSA 2DSWA 2Y78A 2WLZA 3KCEA 2XPAA 4L3NA 4JFLA 3WL1A 2AWGA 2K8IA 4ZPTR 1EDQA 5HTGA 3PRAA 1ZL1A 2KGJA 1JNDA 1LL7A 4BF8A 2DSVA 1GUVA 2DG4A 1FKFA 4ZPVR 1KFWA 3GPKA 1E44A 1NMVA 2A3BA 3WD4A 4S3KA 1FFQA 4O2TA 4P8XA 5DITA 1LG1A 2G41A 1ZB5A 3WD0A 4WK9A 3QOKA 3FAPA 4LAYA 4WKHA 3PR9A 4HARA 4DH0A 1Q6IA 4Q7NA 1PBKA 2MPHA 2KR7A 3ARWA 4ML4A 4JYSA 1NWSA 1WAWA 4ODQA 1JNTA 4MNMA 2MLZA 3ARRA 2UZ5A 3G6MA 3FY1A 3B7XA 1C9HA 4TNSA 3WD3A 1E6ZA 2PBCA 4QT3A 1WB0A 4DWSB 4DRJA 3O5FA 3ALFA 4NSBA 1J4IA 1D6OA 4ODNA 4ITZA 1W9PA 4DRHA 2F21A 3KAFA 4TW6A 3PA7A 1JNEA 3O5PA 5HT1A 1JCHB 4IT6A 2XP6A 3O5RA 1BKFA 2XP3A 4DRMA 1FKTA 5DIUA 4L72B 4C02B 3ARYA 3CGMA 4ODOA 3I6CA 1ZBCA 1LL6A 2DG9A 2F4EA 3PRBA 1ZBWA 3LUOA 4IQCA 4W9PA 5B8IC 1D7IA 3BXWA 4TYOA 1J6YA 3VAWA 1ZCNA 3UQBA 1E6NA 4R5EA 1NWRA 3UF8A 4Z2KA 3WKZA 1EYMA 4JFJA 1IX5A 3H9RB 2WM0A 4MGVA 5JH8A 1UR9A 2ETNA 3CHEA 2D9FA 1N1AA 2ZR5A 4DRKA 1NWUA 4MSPA 2RQSA 3W4RA 3IKGA 3RFWA 1JVWA 4ODRA 3O5EA 4QIBA 2WK2A 3KACA 3O5KA 5J6EA 3CHDA 1FD9A 2A3CA 4MNJA 1H0IA 2OFNA 4WIWA 5DEZA 1E6RA 4NZCA 4DZ2A 2A3EA 5HW6A 3BMBA 4U85A 4AY1A 2WLYA 4NNRA 2IUZA 4TW7A 3RMEA 2MLXA 4Z2HA 2L2SA 2ZQSA 3NTPA 1O6IA 1J4HA 3JXVA 2FDMA 3UI4A 1FJDA 2KI3A 4Q22A 3B9EA 3O5IA 4UDMA 3RM4A 1P5QA 3KZ7A 3TDBA 4ZPWR 1FKHA 3RM8A 2KFWA 1W26A 3KAIA 2ZQTA 3UQAA 1Y0OA 2RUQA 2B5UB 1FAPA 2XP8A 5HW8A 1SYTA 3UI5A 1LL4A 3IKDA 3ALGA 2OLHA 3CGNA 3KADA 1FKLA 2PN0A 4HBOA 3ARZA 3GTYX 3CHFA 4TX0A 2ITKA 1LJYA 3TC5A 2F23A 4Z2GA 2MF9A 4DWSC 2LKNA 3O5JA 3WQVA 5D75A 1W1TA 2IF4A 1X6NA 1Q1CA 2VN1A 4U86A 4DRPA 2PPNA 4MNLA 1X6LA 3WD2A 2XP9A 4MTVA 1D7HA 2XP4A 3WIJA 5DIVA 4HBEA 3CH9A 1NSGA 3AROA 4P8WA 4TW8A 4MPKA 5GQBA 5HUAA 4ODKA 4DRQA 1W9UA 3UQIA 2F2DA 4GIVA 4LGXA 1FKGA 4G50A 3B8SA 3MDYB 3CZ8A 1YATA 2LPVA 4DZ3A 1HKKA 4KQZA 5HBFA 4W9OA 2P4VA 4FN2A 2Q5AA 2N87A 4FAPA 3ARVA 2YBUA 4PTMA 4MAVA 1W1PA 2XPBA 5HW7A 3B9DA 3O5MA 1ZU8A 1E6PA 2XP5A 1QPLA 3ODKA 5I98A 2DT1A 4DROA 3FXYA 2PV3A 2RSEA 1NMWA 2PV2A 4MNKA 5BXJA 2KE0A 1L1PA 4J4OA 2PPPA 5GPGA 2A3AA 3O5OA 1KT0A 1TFVA 2DSUA 2ZQUA 3ARTA 4ODPA 2PPOA 1HKMA 1ZK6A 4WKAA 2DT0A
chains in the Genus database with same CATH topology
4ODLA 4P8VA 1FFRA 1XHGA 1FKRA 2M2AA 3RGCA 4QZVB 5HWBA 1W9VA 4DWSD 3IHZA 1ZBVA 3NI6A 3EY6A 4URIA 3KAHA 1D7JA 4IPXA 3WD1A 2ESCA 1EQ3A 2ZR4A 2PI6A 1HJVA 2AOSA 2DT2A 1HKJA 1EHNA 1FKBA 4LAXA 2FAPA 3O5LA 1Q6UA 1ROTA 4G2PA 3JYJA 1ROUA 2XP7A 2B31A 5DO2A 3ARQA 3AQUA 1J4RA 1HJWA 3WL0A 1WNOA 3O5GA 2RUDA 1H0GA 4N19A 1UR8A 1FKIA 4S3JA 1K9TA 4GGQA 3B9AA 1GOIA 1KT1A 1NH6A 2LJ4A 4QT2A 4WJXA 3JYMA 3AS3A 1FKKA 2ZR6A 2QF8A 4DRNA 1A7XA 2O92A 1YW5A 1E9LA 1XRVA 3KABA 4ODMA 1E15A 3G6LA 2DG3A 4JFKA 3ARUA 4IT4A 4JFIA 1PINA 2YBTA 1ZBKA 4W9QA 2JZVA 4Z2LA 4Z2JA 2VCDA 3AS2A 1BL4A 1F8AB 2DT3A 3IK8A 3KAGA 1F40A 3NRKA 3AS1A 3ARSA 4LAWA 3UI6A 1HXVA 1W1VA 1OGGA 1SR0A 1HJXA 1NWTA 5HWCA 2ZQVA 4DT4A 1Q6HA 1B6CA 2M08A 3AS0A 1TCOC 1JNSA 1QZ2A 4XAKA 5HKGA 2O9OA 2RUCA 1R9HA 1CTNA 5DF0A 2PV1A 4U84A 2RURA 4ZS6A 2LGOA 2KO7A 3WQWA 1FKDA 3OA5A 4R0XA 1T11A 2G8ZA 3TCZA 1LG2A 1W1YA 4DRIA 5GPRA 3OOBA 4DIPA 4Z2IA 1RD6A 3CHCA 1U79A 1OWQA 2MNTA 1QPFA 2DPEA 3RM9A 3ARPA 1GPFA 4LAVA 4P8UA 4W5UA 1D2KA 1FKJA 1LQ0A 1FKSA 1HKIA 4JFMA 1ITXA 3O5DA 4J4NA 4KR0B 1OGBA 3ARXA 1M5YA 2FKEA 4IQ2A 4WKFA 1VF8A 2DSZA 1EIBA 3O5QA 3PRDA 2MLYA 3WH0A 2M1IA 4DWSA 2DSWA 2Y78A 2WLZA 3KCEA 2XPAA 4L3NA 4JFLA 3WL1A 2AWGA 2K8IA 4ZPTR 1EDQA 5HTGA 3PRAA 1ZL1A 2KGJA 1JNDA 1LL7A 4BF8A 2DSVA 1GUVA 2DG4A 1FKFA 4ZPVR 1KFWA 3GPKA 1NMVA 2A3BA 3WD4A 4S3KA 1FFQA 4O2TA 4P8XA 5DITA 1LG1A 2G41A 1ZB5A 3WD0A 4WK9A 3QOKA 3FAPA 4LAYA 4WKHA 3PR9A 4HARA 4DH0A 1Q6IA 4Q7NA 1PBKA 2MPHA 2KR7A 3ARWA 4ML4A 4JYSA 1NWSA 1WAWA 4ODQA 1JNTA 4MNMA 2MLZA 3ARRA 2UZ5A 3G6MA 3FY1A 3B7XA 1C9HA 4TNSA 3WD3A 1E6ZA 2PBCA 4QT3A 1WB0A 4DWSB 4DRJA 3O5FA 3ALFA 4NSBA 1J4IA 1D6OA 4ODNA 4ITZA 1W9PA 4DRHA 2F21A 3KAFA 4TW6A 3PA7A 1JNEA 3O5PA 5HT1A 4IT6A 2XP6A 3O5RA 1BKFA 2XP3A 4DRMA 1FKTA 5DIUA 4L72B 4C02B 3ARYA 3CGMA 4ODOA 3I6CA 1ZBCA 1LL6A 2DG9A 2F4EA 3PRBA 1ZBWA 3LUOA 4IQCA 4W9PA 5B8IC 1D7IA 3BXWA 4TYOA 1J6YA 3VAWA 1ZCNA 3UQBA 1E6NA 4R5EA 1NWRA 3UF8A 4Z2KA 3WKZA 1EYMA 4JFJA 1IX5A 3H9RB 2WM0A 4MGVA 5JH8A 1UR9A 3CHEA 2D9FA 1N1AA 2ZR5A 4DRKA 1NWUA 4MSPA 2RQSA 3W4RA 3IKGA 3RFWA 1JVWA 4ODRA 3O5EA 4QIBA 2WK2A 3KACA 3O5KA 5J6EA 3CHDA 1FD9A 2A3CA 4MNJA 1H0IA 2OFNA 4WIWA 5DEZA 1E6RA 4NZCA 4DZ2A 2A3EA 5HW6A 4U85A 4AY1A 2WLYA 4NNRA 2IUZA 4TW7A 3RMEA 2MLXA 4Z2HA 2L2SA 2ZQSA 3NTPA 1O6IA 1J4HA 3JXVA 2FDMA 3UI4A 1FJDA 2KI3A 4Q22A 3B9EA 3O5IA 3RM4A 1P5QA 3KZ7A 3TDBA 4ZPWR 1FKHA 3RM8A 2KFWA 1W26A 3KAIA 2ZQTA 3UQAA 1Y0OA 2RUQA 1FAPA 2XP8A 5HW8A 1SYTA 3UI5A 1LL4A 3IKDA 3ALGA 2OLHA 3CGNA 3KADA 1FKLA 4HBOA 3ARZA 3CHFA 4TX0A 2ITKA 1LJYA 3TC5A 4Z2GA 2MF9A 4DWSC 2LKNA 3O5JA 3WQVA 5D75A 1W1TA 2IF4A 1X6NA 1Q1CA 2VN1A 4U86A 4DRPA 2PPNA 4MNLA 1X6LA 3WD2A 2XP9A 4MTVA 1D7HA 2XP4A 3WIJA 5DIVA 4HBEA 3CH9A 1NSGA 3AROA 4P8WA 4TW8A 4MPKA 5GQBA 5HUAA 4ODKA 4DRQA 1W9UA 3UQIA 2F2DA 4GIVA 4LGXA 1FKGA 4G50A 3B8SA 3MDYB 3CZ8A 1YATA 2LPVA 4DZ3A 1HKKA 4KQZA 5HBFA 4W9OA 4FN2A 2Q5AA 2N87A 4FAPA 3ARVA 2YBUA 4PTMA 4MAVA 1W1PA 2XPBA 5HW7A 3B9DA 3O5MA 1ZU8A 1E6PA 2XP5A 1QPLA 3ODKA 5I98A 2DT1A 4DROA 3FXYA 2PV3A 2RSEA 1NMWA 2PV2A 4MNKA 5BXJA 2KE0A 1L1PA 4J4OA 2PPPA 5GPGA 2A3AA 3O5OA 1KT0A 1TFVA 2DSUA 2ZQUA 3ARTA 4ODPA 2PPOA 1HKMA 1ZK6A 4WKAA 2DT0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ODL A;  4TNS A;  2PV1 A;  3UI4 A;  1FJD A;  1FKR A;  2KI3 A;  2M2A A;  4U84 A;  2PBC A;  4QT3 A;  3RGC A;  4DRJ A;  3O5I A;  5HWB A;  2RUR A;  3O5F A;  2LGO A;  2KO7 A;  1P5Q A;  3KZ7 A;  1FKD A;  4R0X A;  3IHZ A;  3TDB A;  1J4I A;  1D6O A;  4ODN A;  3NI6 A;  4ITZ A;  3EY6 A;  4DRH A;  1T11 A;  3KAH A;  1FKH A;  1D7J A;  4IPX A;  3TCZ A;  4DRI A;  2KFW A;  1W26 A;  3KAI A;  2F21 A;  2ZQT A;  3KAF A;  3OOB A;  4TW6 A;  1Y0O A;  2RUQ A;  4DIP A;  3UQA A;  1EQ3 A;  1FAP A;  2XP8 A;  2ZR4 A;  5HW8 A;  1U79 A;  3PA7 A;  3UI5 A;  3IKD A;  2MNT A;  3O5P A;  1QPF A;  5HT1 A;  3CGN A;  2XP6 A;  3KAD A;  1FKL A;  1BKF A;  3O5R A;  4LAV A;  2XP3 A;  1FKB A;  2ITK A;  4TX0 A;  4LAX A;  3TC5 A;  4DRM A;  2FAP A;  1FKT A;  1FKJ A;  2MF9 A;  5DIU A;  1FKS A;  4JFM A;  2LKN A;  3O5J A;  3O5D A;  3O5L A;  4J4N A;  1Q6U A;  2IF4 A;  1ROT A;  4G2P A;  3JYJ A;  1ROU A;  5D75 A;  4C02 B;  1Q1C A;  2XP7 A;  2VN1 A;  4U86 A;  1M5Y A;  4DRP A;  2PPN A;  3CGM A;  4ODO A;  2FKE A;  3I6C A;  2DG9 A;  4IQ2 A;  2XP9 A;  1J4R A;  2F4E A;  3PRB A;  3O5Q A;  1D7H A;  2XP4 A;  3PRD A;  2MLY A;  3LUO A;  4IQC A;  3WH0 A;  3O5G A;  4W9P A;  5DIV A;  5B8I C;  2RUD A;  1D7I A;  2M1I A;  4N19 A;  4TYO A;  1J6Y A;  1FKI A;  1NSG A;  2Y78 A;  4GGQ A;  3VAW A;  1ZCN A;  3UQB A;  3KCE A;  4TW8 A;  2XPA A;  4JFL A;  3UF8 A;  5HUA A;  2AWG A;  1KT1 A;  2K8I A;  2LJ4 A;  4ODK A;  4QT2 A;  3JYM A;  1EYM A;  4DRQ A;  4JFJ A;  3UQI A;  3H9R B;  5HTG A;  2F2D A;  4GIV A;  4MGV A;  1FKK A;  1FKG A;  2ZR6 A;  2KGJ A;  4G50 A;  2D9F A;  1N1A A;  4BF8 A;  3MDY B;  2ZR5 A;  4DRK A;  4DRN A;  1YAT A;  1A7X A;  2DG4 A;  2LPV A;  4DZ3 A;  1FKF A;  1YW5 A;  3KAB A;  4MSP A;  4ODM A;  2RQS A;  2DG3 A;  3GPK A;  4JFK A;  1NMV A;  4JFI A;  4W9O A;  1PIN A;  3IKG A;  3RFW A;  4FN2 A;  1JVW A;  2Q5A A;  2N87 A;  4W9Q A;  4FAP A;  4ODR A;  4O2T A;  3O5E A;  2JZV A;  5DIT A;  4QIB A;  2VCD A;  5HW7 A;  2XPB A;  3KAC A;  3FAP A;  3O5M A;  1BL4 A;  3O5K A;  5J6E A;  1F8A B;  2XP5 A;  3ODK A;  1QPL A;  5I98 A;  4LAY A;  1FD9 A;  3IK8 A;  3KAG A;  4DRO A;  1F40 A;  4DH0 A;  1Q6I A;  2OFN A;  3NRK A;  4LAW A;  3UI6 A;  2PV3 A;  1PBK A;  2RSE A;  1HXV A;  1NMW A;  4DZ2 A;  2PV2 A;  5BXJ A;  5HW6 A;  2MPH A;  5HWC A;  2KR7 A;  2KE0 A;  1L1P A;  2ZQV A;  4J4O A;  2PPP A;  4U85 A;  5GPG A;  4DT4 A;  4JYS A;  1Q6H A;  1B6C A;  3O5O A;  4NNR A;  2M08 A;  4ODQ A;  1JNT A;  1KT0 A;  1TCO C;  2MLZ A;  4TW7 A;  1QZ2 A;  2MLX A;  1JNS A;  2UZ5 A;  2ZQU A;  4ODP A;  2PPO A;  2L2S A;  3B7X A;  5HKG A;  1C9H A;  2ZQS A;  1ZK6 A;  3NTP A;  2RUC A;  1J4H A;  3JXV A;  1R9H A; 
#chains in the Genus database with same CATH topology
 4ODL A;  4P8V A;  1FFR A;  1XHG A;  1FKR A;  2M2A A;  3RGC A;  4QZV B;  5HWB A;  1W9V A;  4DWS D;  3IHZ A;  1ZBV A;  3NI6 A;  3EY6 A;  4URI A;  3KAH A;  1D7J A;  4IPX A;  3WD1 A;  3GU0 A;  2ESC A;  1EQ3 A;  2ZR4 A;  2PI6 A;  1HJV A;  2AOS A;  2DT2 A;  1HKJ A;  1EHN A;  1FKB A;  4LAX A;  2FAP A;  3O5L A;  1Q6U A;  1ROT A;  4G2P A;  3JYJ A;  1ROU A;  2XP7 A;  2B31 A;  5DO2 A;  3ARQ A;  3AQU A;  1J4R A;  1HJW A;  3WL0 A;  1WNO A;  3O5G A;  3EIP A;  2RUD A;  1H0G A;  4N19 A;  1UR8 A;  1FKI A;  4S3J A;  1K9T A;  4GGQ A;  3B9A A;  1GOI A;  1KT1 A;  1NH6 A;  2LJ4 A;  4QT2 A;  4WJX A;  3JYM A;  3AS3 A;  1FKK A;  2ZR6 A;  2QF8 A;  4DRN A;  1A7X A;  2O92 A;  1YW5 A;  1E9L A;  1XRV A;  3KAB A;  4ODM A;  1E15 A;  3G6L A;  2DG3 A;  4JFK A;  3ARU A;  4IT4 A;  4JFI A;  1PIN A;  2YBT A;  1ZBK A;  4W9Q A;  2JZV A;  4Z2L A;  4Z2J A;  2VCD A;  3AS2 A;  1BL4 A;  1F8A B;  2DT3 A;  3IK8 A;  3KAG A;  1F40 A;  3NRK A;  3AS1 A;  2EUL A;  3ARS A;  4LAW A;  3UI6 A;  1HXV A;  1W1V A;  1OGG A;  1SR0 A;  1HJX A;  1NWT A;  5HWC A;  2ZQV A;  4DT4 A;  1Q6H A;  1B6C A;  2M08 A;  3AS0 A;  1TCO C;  1JNS A;  1QZ2 A;  4XAK A;  5HKG A;  2O9O A;  2RUC A;  1R9H A;  1CTN A;  5DF0 A;  2PV1 A;  4U84 A;  2RUR A;  4ZS6 A;  2LGO A;  2KO7 A;  3WQW A;  1FKD A;  3OA5 A;  4R0X A;  1T11 A;  2G8Z A;  3TCZ A;  1LG2 A;  1W1Y A;  4DRI A;  5GPR A;  3OOB A;  4DIP A;  4Z2I A;  1RD6 A;  1GRJ A;  3CHC A;  1U79 A;  1OWQ A;  2MNT A;  1QPF A;  2DPE A;  3RM9 A;  3ARP A;  1GPF A;  4LAV A;  4P8U A;  4W5U A;  1D2K A;  1FKJ A;  1LQ0 A;  1FKS A;  1HKI A;  4JFM A;  1ITX A;  3O5D A;  4J4N A;  4KR0 B;  1OGB A;  3ARX A;  1M5Y A;  2FKE A;  4IQ2 A;  4WKF A;  1VF8 A;  2DSZ A;  1EIB A;  3O5Q A;  3PRD A;  2MLY A;  3WH0 A;  2M1I A;  4DWS A;  2DSW A;  2Y78 A;  2WLZ A;  3KCE A;  2XPA A;  4L3N A;  4JFL A;  3WL1 A;  2AWG A;  2K8I A;  4ZPT R;  1EDQ A;  5HTG A;  3PRA A;  1ZL1 A;  2KGJ A;  1JND A;  1LL7 A;  4BF8 A;  2DSV A;  1GUV A;  2DG4 A;  1FKF A;  4ZPV R;  1KFW A;  3GPK A;  1E44 A;  1NMV A;  2A3B A;  3WD4 A;  4S3K A;  1FFQ A;  4O2T A;  4P8X A;  5DIT A;  1LG1 A;  2G41 A;  1ZB5 A;  3WD0 A;  4WK9 A;  3QOK A;  3FAP A;  4LAY A;  4WKH A;  3PR9 A;  4HAR A;  4DH0 A;  1Q6I A;  4Q7N A;  1PBK A;  2MPH A;  2KR7 A;  3ARW A;  4ML4 A;  4JYS A;  1NWS A;  1WAW A;  4ODQ A;  1JNT A;  4MNM A;  2MLZ A;  3ARR A;  2UZ5 A;  3G6M A;  3FY1 A;  3B7X A;  1C9H A;  4TNS A;  3WD3 A;  1E6Z A;  2PBC A;  4QT3 A;  1WB0 A;  4DWS B;  4DRJ A;  3O5F A;  3ALF A;  4NSB A;  1J4I A;  1D6O A;  4ODN A;  4ITZ A;  1W9P A;  4DRH A;  2F21 A;  3KAF A;  4TW6 A;  3PA7 A;  1JNE A;  3O5P A;  5HT1 A;  1JCH B;  4IT6 A;  2XP6 A;  3O5R A;  1BKF A;  2XP3 A;  4DRM A;  1FKT A;  5DIU A;  4L72 B;  4C02 B;  3ARY A;  3CGM A;  4ODO A;  3I6C A;  1ZBC A;  1LL6 A;  2DG9 A;  2F4E A;  3PRB A;  1ZBW A;  3LUO A;  4IQC A;  4W9P A;  5B8I C;  1D7I A;  3BXW A;  4TYO A;  1J6Y A;  3VAW A;  1ZCN A;  3UQB A;  1E6N A;  4R5E A;  1NWR A;  3UF8 A;  4Z2K A;  3WKZ A;  1EYM A;  4JFJ A;  1IX5 A;  3H9R B;  2WM0 A;  4MGV A;  5JH8 A;  1UR9 A;  2ETN A;  3CHE A;  2D9F A;  1N1A A;  2ZR5 A;  4DRK A;  1NWU A;  4MSP A;  2RQS A;  3W4R A;  3IKG A;  3RFW A;  1JVW A;  4ODR A;  3O5E A;  4QIB A;  2WK2 A;  3KAC A;  3O5K A;  5J6E A;  3CHD A;  1FD9 A;  2A3C A;  4MNJ A;  1H0I A;  2OFN A;  4WIW A;  5DEZ A;  1E6R A;  4NZC A;  4DZ2 A;  2A3E A;  5HW6 A;  3BMB A;  4U85 A;  4AY1 A;  2WLY A;  4NNR A;  2IUZ A;  4TW7 A;  3RME A;  2MLX A;  4Z2H A;  2L2S A;  2ZQS A;  3NTP A;  1O6I A;  1J4H A;  3JXV A;  2FDM A;  3UI4 A;  1FJD A;  2KI3 A;  4Q22 A;  3B9E A;  3O5I A;  4UDM A;  3RM4 A;  1P5Q A;  3KZ7 A;  3TDB A;  4ZPW R;  1FKH A;  3RM8 A;  2KFW A;  1W26 A;  3KAI A;  2ZQT A;  3UQA A;  1Y0O A;  2RUQ A;  2B5U B;  1FAP A;  2XP8 A;  5HW8 A;  1SYT A;  3UI5 A;  1LL4 A;  3IKD A;  3ALG A;  2OLH A;  3CGN A;  3KAD A;  1FKL A;  2PN0 A;  4HBO A;  3ARZ A;  3GTY X;  3CHF A;  4TX0 A;  2ITK A;  1LJY A;  3TC5 A;  2F23 A;  4Z2G A;  2MF9 A;  4DWS C;  2LKN A;  3O5J A;  3WQV A;  5D75 A;  1W1T A;  2IF4 A;  1X6N A;  1Q1C A;  2VN1 A;  4U86 A;  4DRP A;  2PPN A;  4MNL A;  1X6L A;  3WD2 A;  2XP9 A;  4MTV A;  1D7H A;  2XP4 A;  3WIJ A;  5DIV A;  4HBE A;  3CH9 A;  1NSG A;  3ARO A;  4P8W A;  4TW8 A;  4MPK A;  5GQB A;  5HUA A;  4ODK A;  4DRQ A;  1W9U A;  3UQI A;  2F2D A;  4GIV A;  4LGX A;  1FKG A;  4G50 A;  3B8S A;  3MDY B;  3CZ8 A;  1YAT A;  2LPV A;  4DZ3 A;  1HKK A;  4KQZ A;  5HBF A;  4W9O A;  2P4V A;  4FN2 A;  2Q5A A;  2N87 A;  4FAP A;  3ARV A;  2YBU A;  4PTM A;  4MAV A;  1W1P A;  2XPB A;  5HW7 A;  3B9D A;  3O5M A;  1ZU8 A;  1E6P A;  2XP5 A;  1QPL A;  3ODK A;  5I98 A;  2DT1 A;  4DRO A;  3FXY A;  2PV3 A;  2RSE A;  1NMW A;  2PV2 A;  4MNK A;  5BXJ A;  2KE0 A;  1L1P A;  4J4O A;  2PPP A;  5GPG A;  2A3A A;  3O5O A;  1KT0 A;  1TFV A;  2DSU A;  2ZQU A;  3ART A;  4ODP A;  2PPO A;  1HKM A;  1ZK6 A;  4WKA A;  2DT0 A; 
#chains in the Genus database with same CATH homology
 4ODL A;  4P8V A;  1FFR A;  1XHG A;  1FKR A;  2M2A A;  3RGC A;  4QZV B;  5HWB A;  1W9V A;  4DWS D;  3IHZ A;  1ZBV A;  3NI6 A;  3EY6 A;  4URI A;  3KAH A;  1D7J A;  4IPX A;  3WD1 A;  2ESC A;  1EQ3 A;  2ZR4 A;  2PI6 A;  1HJV A;  2AOS A;  2DT2 A;  1HKJ A;  1EHN A;  1FKB A;  4LAX A;  2FAP A;  3O5L A;  1Q6U A;  1ROT A;  4G2P A;  3JYJ A;  1ROU A;  2XP7 A;  2B31 A;  5DO2 A;  3ARQ A;  3AQU A;  1J4R A;  1HJW A;  3WL0 A;  1WNO A;  3O5G A;  2RUD A;  1H0G A;  4N19 A;  1UR8 A;  1FKI A;  4S3J A;  1K9T A;  4GGQ A;  3B9A A;  1GOI A;  1KT1 A;  1NH6 A;  2LJ4 A;  4QT2 A;  4WJX A;  3JYM A;  3AS3 A;  1FKK A;  2ZR6 A;  2QF8 A;  4DRN A;  1A7X A;  2O92 A;  1YW5 A;  1E9L A;  1XRV A;  3KAB A;  4ODM A;  1E15 A;  3G6L A;  2DG3 A;  4JFK A;  3ARU A;  4IT4 A;  4JFI A;  1PIN A;  2YBT A;  1ZBK A;  4W9Q A;  2JZV A;  4Z2L A;  4Z2J A;  2VCD A;  3AS2 A;  1BL4 A;  1F8A B;  2DT3 A;  3IK8 A;  3KAG A;  1F40 A;  3NRK A;  3AS1 A;  3ARS A;  4LAW A;  3UI6 A;  1HXV A;  1W1V A;  1OGG A;  1SR0 A;  1HJX A;  1NWT A;  5HWC A;  2ZQV A;  4DT4 A;  1Q6H A;  1B6C A;  2M08 A;  3AS0 A;  1TCO C;  1JNS A;  1QZ2 A;  4XAK A;  5HKG A;  2O9O A;  2RUC A;  1R9H A;  1CTN A;  5DF0 A;  2PV1 A;  4U84 A;  2RUR A;  4ZS6 A;  2LGO A;  2KO7 A;  3WQW A;  1FKD A;  3OA5 A;  4R0X A;  1T11 A;  2G8Z A;  3TCZ A;  1LG2 A;  1W1Y A;  4DRI A;  5GPR A;  3OOB A;  4DIP A;  4Z2I A;  1RD6 A;  3CHC A;  1U79 A;  1OWQ A;  2MNT A;  1QPF A;  2DPE A;  3RM9 A;  3ARP A;  1GPF A;  4LAV A;  4P8U A;  4W5U A;  1D2K A;  1FKJ A;  1LQ0 A;  1FKS A;  1HKI A;  4JFM A;  1ITX A;  3O5D A;  4J4N A;  4KR0 B;  1OGB A;  3ARX A;  1M5Y A;  2FKE A;  4IQ2 A;  4WKF A;  1VF8 A;  2DSZ A;  1EIB A;  3O5Q A;  3PRD A;  2MLY A;  3WH0 A;  2M1I A;  4DWS A;  2DSW A;  2Y78 A;  2WLZ A;  3KCE A;  2XPA A;  4L3N A;  4JFL A;  3WL1 A;  2AWG A;  2K8I A;  4ZPT R;  1EDQ A;  5HTG A;  3PRA A;  1ZL1 A;  2KGJ A;  1JND A;  1LL7 A;  4BF8 A;  2DSV A;  1GUV A;  2DG4 A;  1FKF A;  4ZPV R;  1KFW A;  3GPK A;  1NMV A;  2A3B A;  3WD4 A;  4S3K A;  1FFQ A;  4O2T A;  4P8X A;  5DIT A;  1LG1 A;  2G41 A;  1ZB5 A;  3WD0 A;  4WK9 A;  3QOK A;  3FAP A;  4LAY A;  4WKH A;  3PR9 A;  4HAR A;  4DH0 A;  1Q6I A;  4Q7N A;  1PBK A;  2MPH A;  2KR7 A;  3ARW A;  4ML4 A;  4JYS A;  1NWS A;  1WAW A;  4ODQ A;  1JNT A;  4MNM A;  2MLZ A;  3ARR A;  2UZ5 A;  3G6M A;  3FY1 A;  3B7X A;  1C9H A;  4TNS A;  3WD3 A;  1E6Z A;  2PBC A;  4QT3 A;  1WB0 A;  4DWS B;  4DRJ A;  3O5F A;  3ALF A;  4NSB A;  1J4I A;  1D6O A;  4ODN A;  4ITZ A;  1W9P A;  4DRH A;  2F21 A;  3KAF A;  4TW6 A;  3PA7 A;  1JNE A;  3O5P A;  5HT1 A;  4IT6 A;  2XP6 A;  3O5R A;  1BKF A;  2XP3 A;  4DRM A;  1FKT A;  5DIU A;  4L72 B;  4C02 B;  3ARY A;  3CGM A;  4ODO A;  3I6C A;  1ZBC A;  1LL6 A;  2DG9 A;  2F4E A;  3PRB A;  1ZBW A;  3LUO A;  4IQC A;  4W9P A;  5B8I C;  1D7I A;  3BXW A;  4TYO A;  1J6Y A;  3VAW A;  1ZCN A;  3UQB A;  1E6N A;  4R5E A;  1NWR A;  3UF8 A;  4Z2K A;  3WKZ A;  1EYM A;  4JFJ A;  1IX5 A;  3H9R B;  2WM0 A;  4MGV A;  5JH8 A;  1UR9 A;  3CHE A;  2D9F A;  1N1A A;  2ZR5 A;  4DRK A;  1NWU A;  4MSP A;  2RQS A;  3W4R A;  3IKG A;  3RFW A;  1JVW A;  4ODR A;  3O5E A;  4QIB A;  2WK2 A;  3KAC A;  3O5K A;  5J6E A;  3CHD A;  1FD9 A;  2A3C A;  4MNJ A;  1H0I A;  2OFN A;  4WIW A;  5DEZ A;  1E6R A;  4NZC A;  4DZ2 A;  2A3E A;  5HW6 A;  4U85 A;  4AY1 A;  2WLY A;  4NNR A;  2IUZ A;  4TW7 A;  3RME A;  2MLX A;  4Z2H A;  2L2S A;  2ZQS A;  3NTP A;  1O6I A;  1J4H A;  3JXV A;  2FDM A;  3UI4 A;  1FJD A;  2KI3 A;  4Q22 A;  3B9E A;  3O5I A;  3RM4 A;  1P5Q A;  3KZ7 A;  3TDB A;  4ZPW R;  1FKH A;  3RM8 A;  2KFW A;  1W26 A;  3KAI A;  2ZQT A;  3UQA A;  1Y0O A;  2RUQ A;  1FAP A;  2XP8 A;  5HW8 A;  1SYT A;  3UI5 A;  1LL4 A;  3IKD A;  3ALG A;  2OLH A;  3CGN A;  3KAD A;  1FKL A;  4HBO A;  3ARZ A;  3CHF A;  4TX0 A;  2ITK A;  1LJY A;  3TC5 A;  4Z2G A;  2MF9 A;  4DWS C;  2LKN A;  3O5J A;  3WQV A;  5D75 A;  1W1T A;  2IF4 A;  1X6N A;  1Q1C A;  2VN1 A;  4U86 A;  4DRP A;  2PPN A;  4MNL A;  1X6L A;  3WD2 A;  2XP9 A;  4MTV A;  1D7H A;  2XP4 A;  3WIJ A;  5DIV A;  4HBE A;  3CH9 A;  1NSG A;  3ARO A;  4P8W A;  4TW8 A;  4MPK A;  5GQB A;  5HUA A;  4ODK A;  4DRQ A;  1W9U A;  3UQI A;  2F2D A;  4GIV A;  4LGX A;  1FKG A;  4G50 A;  3B8S A;  3MDY B;  3CZ8 A;  1YAT A;  2LPV A;  4DZ3 A;  1HKK A;  4KQZ A;  5HBF A;  4W9O A;  4FN2 A;  2Q5A A;  2N87 A;  4FAP A;  3ARV A;  2YBU A;  4PTM A;  4MAV A;  1W1P A;  2XPB A;  5HW7 A;  3B9D A;  3O5M A;  1ZU8 A;  1E6P A;  2XP5 A;  1QPL A;  3ODK A;  5I98 A;  2DT1 A;  4DRO A;  3FXY A;  2PV3 A;  2RSE A;  1NMW A;  2PV2 A;  4MNK A;  5BXJ A;  2KE0 A;  1L1P A;  4J4O A;  2PPP A;  5GPG A;  2A3A A;  3O5O A;  1KT0 A;  1TFV A;  2DSU A;  2ZQU A;  3ART A;  4ODP A;  2PPO A;  1HKM A;  1ZK6 A;  4WKA A;  2DT0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...