1FKRA

Solution structure of fkbp, a rotamase enzyme and receptor for fk506 and rapamycin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of FKBP, a rotamase enzyme and receptor for FK506 and rapamycin.
pubmed rcsb
source organism Homo sapiens
molecule tags Cis-trans isomerase
molecule keywords FK506 AND RAPAMYCIN-BINDING PROTEIN
total genus 13
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1992-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkrA00
2PV3A 1FKFA 2LPVA 2XP8A 3O5OA 3KAGA 3KACA 4DRJA 1D7HA 1PBKA 4DIPA 3O5IA 3GPKA 2LJ4A 4JFJA 4ODLA 2DG9A 4DRHA 4TX0A 3H9RB 2RUDA 3KADA 3WH0A 5HWCA 4TW8A 4ODOA 4LAYA 3PRDA 2FAPA 2XPAA 2MNTA 3O5JA 2KGJA 5D75A 4IPXA 3NTPA 1NMVA 4N19A 2KR7A 5HW6A 5DITA 4QIBA 1FKJA 3O5DA 1NMWA 1JNSA 1D6OA 3TC5A 3O5MA 1HXVA 1FKGA 4JFIA 3UQAA 4DRQA 3O5LA 1BKFA 3IHZA 4TW6A 2L2SA 4MSPA 1FAPA 1Q1CA 4R0XA 3IKDA 4NNRA 1JNTA 3I6CA 3UI5A 4ODNA 5HW8A 2VN1A 3FAPA 1B6CA 3JYJA 4IQCA 5HTGA 4DH0A 2F2DA 4W9PA 4IQ2A 3CGMA 4LAWA 1BL4A 4W9OA 5DIVA 3O5EA 2OFNA 1J4RA 2K8IA 3KZ7A 3O5FA 4GIVA 4ITZA 5HKGA 2DG4A 3KCEA 3B7XA 1FKHA 2PV2A 1FKDA 1W26A 2N87A 1FKIA 1FKBA 1FKSA 2DG3A 2IF4A 1PINA 1J4HA 2AWGA 2ZQUA 3JXVA 3JYMA 3PRBA 4GGQA 3VAWA 2FKEA 4ODMA 1U79A 5I98A 1NSGA 1FKLA 3IKGA 4LAVA 4ODPA 4DRPA 2JZVA 3ODKA 5BXJA 1A7XA 3EY6A 5J6EA 1QPFA 1ZK6A 2MPHA 2XP3A 3LUOA 2ZQVA 4G50A 1ZCNA 2XP4A 4ODQA 1KT1A 3NI6A 1Q6UA 4DRNA 2VCDA 3PA7A 4TW7A 2UZ5A 3RGCA 1D7JA 2MLZA 3IK8A 1YW5A 4FN2A 4G2PA 1ROTA 2RUCA 3O5KA 3UF8A 1D7IA 2XPBA 2ZQSA 2MLYA 4DRKA 2Y78A 4DT4A 2F4EA 4DZ2A 1P5QA 1FKRA 3MDYB 4U86A 1EYMA 2XP7A 1Q6HA 3O5RA 3TDBA 4FAPA 2PBCA 3UQIA 3KAIA 4DRMA 2RURA 4DROA 3NRKA 3OOBA 1F40A 2KFWA 1YATA 2F21A 3CGNA 3KAHA 4J4OA 5DIUA 2KE0A 1QPLA 2ZQTA 4LAXA 2M1IA 2XP5A 1EQ3A 4QT3A 2MF9A 5HWBA 1T11A 1J4IA 1FKTA 3O5PA 1KT0A 2PPPA 1J6YA 2M08A 5HUAA 1ROUA 2M2AA 2RUQA 4U84A 2ITKA 4W9QA 4DZ3A 2LGOA 1FD9A 2PPNA 2RQSA 1R9HA 2XP6A 3O5QA 2ZR5A 1JVWA 5GPGA 3UI4A 4JYSA 1FKKA 4O2TA 2XP9A 4ODRA 4J4NA 1Y0OA 2D9FA 3KAFA 4TYOA 3TCZA 1M5YA 4JFMA 4JFLA 4ODKA 2MLXA 2PV1A 1FJDA 1Q6IA 5B8IC 1L1PA 5HW7A 1TCOC 4U85A 4JFKA 4DRIA 4QT2A 2LKNA 1F8AB 2KI3A 3UQBA 1N1AA 3UI6A 2ZR4A 3KABA 3RFWA 4C02B 2ZR6A 2KO7A 1C9HA 2PPOA 3O5GA 2RSEA 4MGVA 5HT1A 4BF8A 2Q5AA 1QZ2A 4TNSA
chains in the Genus database with same CATH superfamily
3CH9A 3KAGA 4DRJA 1PBKA 1W9VA 3O5IA 4JFJA 4ZPVR 2G41A 5DO2A 3KADA 5HWCA 3FY1A 4ODOA 3CHFA 2A3BA 4IPXA 3NTPA 4P8XA 1D6OA 1SR0A 3AROA 1LL6A 1NH6A 3IHZA 2L2SA 4MSPA 3ARYA 4UDMA 1Q1CA 1JNTA 3UI5A 2VN1A 1ITXA 3FAPA 4DWSD 5HBFA 2P4VA 3AS1A 4LAWA 1BL4A 3O5EA 2OFNA 1HKKA 4G2PA 3JXVA 1OWQA 1L1PA 1E6RA 1FKLA 1E44A 4DRPA 4Z2LA 2JZVA 5BXJA 3EY6A 1ZK6A 2XP3A 1ZCNA 2XP4A 4ODQA 1KT1A 1LL4A 1LQ0A 3WD3A 4DRNA 2WK2A 3RGCA 3ARPA 4PTMA 2RUCA 3WKZA 1D7IA 2XPBA 2ZQSA 4DRKA 3MDYB 1EYMA 2B5UB 4ZS6A 3UQIA 2RURA 3NRKA 1F40A 5DIUA 1QPLA 4WKAA 1NWUA 4Z2JA 1EQ3A 2MF9A 1T11A 2F23A 4U84A 2LGOA 2PPNA 3VAWA 1JVWA 3WIJA 2XP9A 1HJWA 4J4NA 1Y0OA 3KAFA 3AQUA 4JFLA 5B8IC 1TCOC 3B9AA 3BMBA 1EIBA 4QT2A 1N1AA 2ZR4A 1E6PA 3RFWA 1LG2A 2ZR6A 4BF8A 2B31A 2PV3A 3O5OA 4ODLA 2A3AA 3ARSA 2FDMA 4LAYA 1ZU8A 4KR0B 2XPAA 5D75A 2KGJA 4N19A 4Q7NA 1E6ZA 2DPEA 1XHGA 1ZL1A 4MNJA 1LL7A 4JFIA 1GUVA 4DRQA 1GRJA 3B9DA 4TW6A 1FAPA 1VF8A 4R0XA 4ODNA 1W1TA 3CHCA 1E15A 4W9PA 3WD1A 3GU0A 4W9OA 4WKHA 1J4RA 1O6IA 3KZ7A 5GQBA 4AY1A 3PRDA 1W26A 4WK9A 1FKIA 1FKSA 2IF4A 1PINA 2AWGA 4P8VA 2FKEA 3IKGA 1X6LA 1HKMA 5DEZA 2DT0A 1A7XA 5J6EA 4G50A 4XAKA 3ARXA 3NI6A 1LG1A 3PA7A 4Z2KA 3CHEA 4P8UA 2DT2A 1ROTA 4DT4A 1P5QA 4HARA 2A3CA 1Q6HA 4L72B 5DF0A 3KAIA 4URIA 3CHDA 1YATA 2F21A 3G6MA 3CZ8A 1WAWA 2M1IA 2XP5A 3AS3A 4QT3A 1HJVA 5HWBA 1J4IA 1FKTA 3O5PA 3B9EA 1KT0A 2PPPA 1J6YA 2M08A 1ROUA 4WJXA 1FD9A 4Q22A 2ZR5A 4JYSA 1FKKA 3WQVA 4QZVB 1ZBVA 1M5YA 3B8SA 1EHNA 2ETNA 2PV1A 1Q6IA 2DSZA 1UR8A 2LKNA 1F8AB 3G6LA 4MPKA 3WD0A 3UI6A 3KABA 4C02B 1JNEA 3ALGA 2DSUA 3O5GA 3QOKA 1W1YA 1SYTA 1FKFA 4DIPA 3GPKA 2LJ4A 2PI6A 2YBTA 3ALFA 3RM4A 4DRHA 3H9RB 2RUDA 1ZBCA 4TW8A 4DWSA 2MNTA 3O5JA 4S3JA 4IT6A 4MTVA 3ARWA 5DITA 5HW6A 1FKJA 2DSWA 3O5DA 1FKGA 1ZBKA 4P8WA 3O5LA 1BKFA 3OA5A 2DT3A 3ARQA 3IKDA 3WD4A 3I6CA 5HW8A 1W9PA 4HBOA 3JYJA 5HTGA 2F2DA 2ESCA 3CGMA 1W9UA 2K8IA 2G8ZA 3O5FA 4ITZA 5HKGA 2DG4A 3KCEA 1CTNA 3ARTA 3B7XA 2N87A 1FKBA 4DH0A 1X6NA 1NWRA 3PRBA 4HBEA 4GGQA 1U79A 1H0IA 4LAVA 4ODPA 3EIPA 3ODKA 1ZBWA 1QPFA 4R5EA 2MPHA 2PN0A 2WLYA 4MNMA 4Z2GA 4TW7A 3O5KA 3GTYX 1D2KA 1KFWA 2Y78A 1FKRA 1IX5A 2XP7A 3O5RA 4FAPA 3AS0A 4WIWA 4DRMA 2KFWA 3KAHA 3CGNA 4J4OA 3RMEA 2KE0A 2ZQTA 4LAXA 2OLHA 2WM0A 3WQWA 2O9OA 5HUAA 1E9LA 2M2AA 4W9QA 2EULA 5GPGA 1R9HA 3O5QA 4ZPWR 4ODRA 3PR9A 3BXWA 2D9FA 3WL0A 3WD2A 2YBUA 4DWSB 4JFMA 4L3NA 4ODKA 4NZCA 5HW7A 4JFKA 4NSBA 1HKIA 4MAVA 3UQBA 1HJXA 1NWSA 4Z2HA 2AOSA 1W1VA 2PPOA 5HT1A 2RSEA 1FFRA 1QZ2A 2LPVA 2XP8A 4ML4A 3KACA 1LJYA 1D7HA 4KQZA 3W4RA 1UR9A 2DG9A 4TX0A 3WH0A 4Z2IA 4LGXA 2WLZA 2FAPA 3ARUA 1NMVA 1H0GA 2KR7A 4MNKA 4QIBA 3ARRA 1NMWA 3AS2A 1JNSA 4ZPTR 3O5MA 3RM9A 3TC5A 1OGGA 1HXVA 1JNDA 3UQAA 3WL1A 1FFQA 1TFVA 4NNRA 1B6CA 4IQCA 1XRVA 4IQ2A 4S3KA 5DIVA 4GIVA 5JH8A 1FKHA 1GPFA 1FKDA 2PV2A 2RQSA 2DG3A 4WKFA 3JYMA 2O92A 1W1PA 1J4HA 2ZQUA 4ODMA 5I98A 1NSGA 1K9TA 1EDQA 3LUOA 2ZQVA 1Q6UA 1WNOA 2VCDA 2UZ5A 1D7JA 2MLZA 3IK8A 1YW5A 4FN2A 4DWSC 3UF8A 4DZ2A 2MLYA 2QF8A 1WB0A 2F4EA 4U86A 3TDBA 2PBCA 2IUZA 2A3EA 4DROA 3OOBA 1GOIA 3ARZA 3FXYA 3PRAA 1RD6A 3ARVA 1ZB5A 3RM8A 2RUQA 4DZ3A 2ITKA 2XP6A 2DSVA 2DT1A 1JCHB 3UI4A 4O2TA 4IT4A 4TYOA 3TCZA 2MLXA 1FJDA 1OGBA 4U85A 4DRIA 1HKJA 1E6NA 2KI3A 4W5UA 5GPRA 2KO7A 1C9HA 4MGVA 4MNLA 1NWTA 2Q5AA 4TNSA
chains in the Genus database with same CATH topology
3CH9A 3KAGA 4DRJA 1PBKA 1W9VA 3O5IA 4JFJA 4ZPVR 2G41A 5DO2A 3KADA 5HWCA 3FY1A 4ODOA 3CHFA 2A3BA 4IPXA 3NTPA 4P8XA 1D6OA 1SR0A 3AROA 1LL6A 1NH6A 3IHZA 2L2SA 4MSPA 3ARYA 1Q1CA 1JNTA 3UI5A 2VN1A 1ITXA 3FAPA 4DWSD 5HBFA 3AS1A 4LAWA 1BL4A 3O5EA 2OFNA 1HKKA 4G2PA 3JXVA 1OWQA 1L1PA 1E6RA 1FKLA 4DRPA 4Z2LA 2JZVA 5BXJA 3EY6A 1ZK6A 2XP3A 1ZCNA 2XP4A 4ODQA 1KT1A 1LL4A 1LQ0A 3WD3A 4DRNA 2WK2A 3RGCA 3ARPA 4PTMA 2RUCA 3WKZA 1D7IA 2XPBA 2ZQSA 4DRKA 3MDYB 1EYMA 4ZS6A 3UQIA 2RURA 3NRKA 1F40A 5DIUA 1QPLA 4WKAA 1NWUA 4Z2JA 1EQ3A 2MF9A 1T11A 4U84A 2LGOA 2PPNA 3VAWA 1JVWA 3WIJA 2XP9A 1HJWA 4J4NA 1Y0OA 3KAFA 3AQUA 4JFLA 5B8IC 1TCOC 3B9AA 1EIBA 4QT2A 1N1AA 2ZR4A 1E6PA 3RFWA 1LG2A 2ZR6A 4BF8A 2B31A 2PV3A 3O5OA 4ODLA 2A3AA 3ARSA 2FDMA 4LAYA 1ZU8A 4KR0B 2XPAA 5D75A 2KGJA 4N19A 4Q7NA 1E6ZA 2DPEA 1XHGA 1ZL1A 4MNJA 1LL7A 4JFIA 1GUVA 4DRQA 3B9DA 4TW6A 1FAPA 1VF8A 4R0XA 4ODNA 1W1TA 3CHCA 1E15A 4W9PA 3WD1A 4W9OA 4WKHA 1J4RA 1O6IA 3KZ7A 5GQBA 4AY1A 3PRDA 1W26A 4WK9A 1FKIA 1FKSA 2IF4A 1PINA 2AWGA 4P8VA 2FKEA 3IKGA 1X6LA 1HKMA 5DEZA 2DT0A 1A7XA 5J6EA 4G50A 4XAKA 3ARXA 3NI6A 1LG1A 3PA7A 4Z2KA 3CHEA 4P8UA 2DT2A 1ROTA 4DT4A 1P5QA 4HARA 2A3CA 1Q6HA 4L72B 5DF0A 3KAIA 4URIA 3CHDA 1YATA 2F21A 3G6MA 3CZ8A 1WAWA 2M1IA 2XP5A 3AS3A 4QT3A 1HJVA 5HWBA 1J4IA 1FKTA 3O5PA 3B9EA 1KT0A 2PPPA 1J6YA 2M08A 1ROUA 4WJXA 1FD9A 4Q22A 2ZR5A 4JYSA 1FKKA 3WQVA 4QZVB 1ZBVA 1M5YA 3B8SA 1EHNA 2PV1A 1Q6IA 2DSZA 1UR8A 2LKNA 1F8AB 3G6LA 4MPKA 3WD0A 3UI6A 3KABA 4C02B 1JNEA 3ALGA 2DSUA 3O5GA 3QOKA 1W1YA 1SYTA 1FKFA 4DIPA 3GPKA 2LJ4A 2PI6A 2YBTA 3ALFA 3RM4A 4DRHA 3H9RB 2RUDA 1ZBCA 4TW8A 4DWSA 2MNTA 3O5JA 4S3JA 4IT6A 4MTVA 3ARWA 5DITA 5HW6A 1FKJA 2DSWA 3O5DA 1FKGA 1ZBKA 4P8WA 3O5LA 1BKFA 3OA5A 2DT3A 3ARQA 3IKDA 3WD4A 3I6CA 5HW8A 1W9PA 4HBOA 3JYJA 5HTGA 2F2DA 2ESCA 3CGMA 1W9UA 2K8IA 2G8ZA 3O5FA 4ITZA 5HKGA 2DG4A 3KCEA 1CTNA 3ARTA 3B7XA 2N87A 1FKBA 4DH0A 1X6NA 1NWRA 3PRBA 4HBEA 4GGQA 1U79A 1H0IA 4LAVA 4ODPA 3ODKA 1ZBWA 1QPFA 4R5EA 2MPHA 2WLYA 4MNMA 4Z2GA 4TW7A 3O5KA 1D2KA 1KFWA 2Y78A 1FKRA 1IX5A 2XP7A 3O5RA 4FAPA 3AS0A 4WIWA 4DRMA 2KFWA 3KAHA 3CGNA 4J4OA 3RMEA 2KE0A 2ZQTA 4LAXA 2OLHA 2WM0A 3WQWA 2O9OA 5HUAA 1E9LA 2M2AA 4W9QA 5GPGA 1R9HA 3O5QA 4ZPWR 4ODRA 3PR9A 3BXWA 2D9FA 3WL0A 3WD2A 2YBUA 4DWSB 4JFMA 4L3NA 4ODKA 4NZCA 5HW7A 4JFKA 4NSBA 1HKIA 4MAVA 3UQBA 1HJXA 1NWSA 4Z2HA 2AOSA 1W1VA 2PPOA 5HT1A 2RSEA 1FFRA 1QZ2A 2LPVA 2XP8A 4ML4A 3KACA 1LJYA 1D7HA 4KQZA 3W4RA 1UR9A 2DG9A 4TX0A 3WH0A 4Z2IA 4LGXA 2WLZA 2FAPA 3ARUA 1NMVA 1H0GA 2KR7A 4MNKA 4QIBA 3ARRA 1NMWA 3AS2A 1JNSA 4ZPTR 3O5MA 3RM9A 3TC5A 1OGGA 1HXVA 1JNDA 3UQAA 3WL1A 1FFQA 1TFVA 4NNRA 1B6CA 4IQCA 1XRVA 4IQ2A 4S3KA 5DIVA 4GIVA 5JH8A 1FKHA 1GPFA 1FKDA 2PV2A 2RQSA 2DG3A 4WKFA 3JYMA 2O92A 1W1PA 1J4HA 2ZQUA 4ODMA 5I98A 1NSGA 1K9TA 1EDQA 3LUOA 2ZQVA 1Q6UA 1WNOA 2VCDA 2UZ5A 1D7JA 2MLZA 3IK8A 1YW5A 4FN2A 4DWSC 3UF8A 4DZ2A 2MLYA 2QF8A 1WB0A 2F4EA 4U86A 3TDBA 2PBCA 2IUZA 2A3EA 4DROA 3OOBA 1GOIA 3ARZA 3FXYA 3PRAA 1RD6A 3ARVA 1ZB5A 3RM8A 2RUQA 4DZ3A 2ITKA 2XP6A 2DSVA 2DT1A 3UI4A 4O2TA 4IT4A 4TYOA 3TCZA 2MLXA 1FJDA 1OGBA 4U85A 4DRIA 1HKJA 1E6NA 2KI3A 4W5UA 5GPRA 2KO7A 1C9HA 4MGVA 4MNLA 1NWTA 2Q5AA 4TNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PV3 A;  1FKF A;  2LPV A;  2XP8 A;  3O5O A;  3KAG A;  3KAC A;  4DRJ A;  1D7H A;  1PBK A;  4DIP A;  3O5I A;  3GPK A;  2LJ4 A;  4JFJ A;  4ODL A;  2DG9 A;  4DRH A;  4TX0 A;  3H9R B;  2RUD A;  3KAD A;  3WH0 A;  5HWC A;  4TW8 A;  4ODO A;  4LAY A;  3PRD A;  2FAP A;  2XPA A;  2MNT A;  3O5J A;  2KGJ A;  5D75 A;  4IPX A;  3NTP A;  1NMV A;  4N19 A;  2KR7 A;  5HW6 A;  5DIT A;  4QIB A;  1FKJ A;  3O5D A;  1NMW A;  1JNS A;  1D6O A;  3TC5 A;  3O5M A;  1HXV A;  1FKG A;  4JFI A;  3UQA A;  4DRQ A;  3O5L A;  1BKF A;  3IHZ A;  4TW6 A;  2L2S A;  4MSP A;  1FAP A;  1Q1C A;  4R0X A;  3IKD A;  4NNR A;  1JNT A;  3I6C A;  3UI5 A;  4ODN A;  5HW8 A;  2VN1 A;  3FAP A;  1B6C A;  3JYJ A;  4IQC A;  5HTG A;  4DH0 A;  2F2D A;  4W9P A;  4IQ2 A;  3CGM A;  4LAW A;  1BL4 A;  4W9O A;  5DIV A;  3O5E A;  2OFN A;  1J4R A;  2K8I A;  3KZ7 A;  3O5F A;  4GIV A;  4ITZ A;  5HKG A;  2DG4 A;  3KCE A;  3B7X A;  1FKH A;  2PV2 A;  1FKD A;  1W26 A;  2N87 A;  1FKI A;  1FKB A;  1FKS A;  2DG3 A;  2IF4 A;  1PIN A;  1J4H A;  2AWG A;  2ZQU A;  3JXV A;  3JYM A;  3PRB A;  4GGQ A;  3VAW A;  2FKE A;  4ODM A;  1U79 A;  5I98 A;  1NSG A;  1FKL A;  3IKG A;  4LAV A;  4ODP A;  4DRP A;  2JZV A;  3ODK A;  5BXJ A;  1A7X A;  3EY6 A;  5J6E A;  1QPF A;  1ZK6 A;  2MPH A;  2XP3 A;  3LUO A;  2ZQV A;  4G50 A;  1ZCN A;  2XP4 A;  4ODQ A;  1KT1 A;  3NI6 A;  1Q6U A;  4DRN A;  2VCD A;  3PA7 A;  4TW7 A;  2UZ5 A;  3RGC A;  1D7J A;  2MLZ A;  3IK8 A;  1YW5 A;  4FN2 A;  4G2P A;  1ROT A;  2RUC A;  3O5K A;  3UF8 A;  1D7I A;  2XPB A;  2ZQS A;  2MLY A;  4DRK A;  2Y78 A;  4DT4 A;  2F4E A;  4DZ2 A;  1P5Q A;  1FKR A;  3MDY B;  4U86 A;  1EYM A;  2XP7 A;  1Q6H A;  3O5R A;  3TDB A;  4FAP A;  2PBC A;  3UQI A;  3KAI A;  4DRM A;  2RUR A;  4DRO A;  3NRK A;  3OOB A;  1F40 A;  2KFW A;  1YAT A;  2F21 A;  3CGN A;  3KAH A;  4J4O A;  5DIU A;  2KE0 A;  1QPL A;  2ZQT A;  4LAX A;  2M1I A;  2XP5 A;  1EQ3 A;  4QT3 A;  2MF9 A;  5HWB A;  1T11 A;  1J4I A;  1FKT A;  3O5P A;  1KT0 A;  2PPP A;  1J6Y A;  2M08 A;  5HUA A;  1ROU A;  2M2A A;  2RUQ A;  4U84 A;  2ITK A;  4W9Q A;  4DZ3 A;  2LGO A;  1FD9 A;  2PPN A;  2RQS A;  1R9H A;  2XP6 A;  3O5Q A;  2ZR5 A;  1JVW A;  5GPG A;  3UI4 A;  4JYS A;  1FKK A;  4O2T A;  2XP9 A;  4ODR A;  4J4N A;  1Y0O A;  2D9F A;  3KAF A;  4TYO A;  3TCZ A;  1M5Y A;  4JFM A;  4JFL A;  4ODK A;  2MLX A;  2PV1 A;  1FJD A;  1Q6I A;  5B8I C;  1L1P A;  5HW7 A;  1TCO C;  4U85 A;  4JFK A;  4DRI A;  4QT2 A;  2LKN A;  1F8A B;  2KI3 A;  3UQB A;  1N1A A;  3UI6 A;  2ZR4 A;  3KAB A;  3RFW A;  4C02 B;  2ZR6 A;  2KO7 A;  1C9H A;  2PPO A;  3O5G A;  2RSE A;  4MGV A;  5HT1 A;  4BF8 A;  2Q5A A;  1QZ2 A;  4TNS A; 
#chains in the Genus database with same CATH topology
 3CH9 A;  3KAG A;  4DRJ A;  1PBK A;  1W9V A;  3O5I A;  4JFJ A;  4ZPV R;  2G41 A;  5DO2 A;  3KAD A;  5HWC A;  3FY1 A;  4ODO A;  3CHF A;  2A3B A;  4IPX A;  3NTP A;  4P8X A;  1D6O A;  1SR0 A;  3ARO A;  1LL6 A;  1NH6 A;  3IHZ A;  2L2S A;  4MSP A;  3ARY A;  4UDM A;  1Q1C A;  1JNT A;  3UI5 A;  2VN1 A;  1ITX A;  3FAP A;  4DWS D;  5HBF A;  2P4V A;  3AS1 A;  4LAW A;  1BL4 A;  3O5E A;  2OFN A;  1HKK A;  4G2P A;  3JXV A;  1OWQ A;  1L1P A;  1E6R A;  1FKL A;  1E44 A;  4DRP A;  4Z2L A;  2JZV A;  5BXJ A;  3EY6 A;  1ZK6 A;  2XP3 A;  1ZCN A;  2XP4 A;  4ODQ A;  1KT1 A;  1LL4 A;  1LQ0 A;  3WD3 A;  4DRN A;  2WK2 A;  3RGC A;  3ARP A;  4PTM A;  2RUC A;  3WKZ A;  1D7I A;  2XPB A;  2ZQS A;  4DRK A;  3MDY B;  1EYM A;  2B5U B;  4ZS6 A;  3UQI A;  2RUR A;  3NRK A;  1F40 A;  5DIU A;  1QPL A;  4WKA A;  1NWU A;  4Z2J A;  1EQ3 A;  2MF9 A;  1T11 A;  2F23 A;  4U84 A;  2LGO A;  2PPN A;  3VAW A;  1JVW A;  3WIJ A;  2XP9 A;  1HJW A;  4J4N A;  1Y0O A;  3KAF A;  3AQU A;  4JFL A;  5B8I C;  1TCO C;  3B9A A;  3BMB A;  1EIB A;  4QT2 A;  1N1A A;  2ZR4 A;  1E6P A;  3RFW A;  1LG2 A;  2ZR6 A;  4BF8 A;  2B31 A;  2PV3 A;  3O5O A;  4ODL A;  2A3A A;  3ARS A;  2FDM A;  4LAY A;  1ZU8 A;  4KR0 B;  2XPA A;  5D75 A;  2KGJ A;  4N19 A;  4Q7N A;  1E6Z A;  2DPE A;  1XHG A;  1ZL1 A;  4MNJ A;  1LL7 A;  4JFI A;  1GUV A;  4DRQ A;  1GRJ A;  3B9D A;  4TW6 A;  1FAP A;  1VF8 A;  4R0X A;  4ODN A;  1W1T A;  3CHC A;  1E15 A;  4W9P A;  3WD1 A;  3GU0 A;  4W9O A;  4WKH A;  1J4R A;  1O6I A;  3KZ7 A;  5GQB A;  4AY1 A;  3PRD A;  1W26 A;  4WK9 A;  1FKI A;  1FKS A;  2IF4 A;  1PIN A;  2AWG A;  4P8V A;  2FKE A;  3IKG A;  1X6L A;  1HKM A;  5DEZ A;  2DT0 A;  1A7X A;  5J6E A;  4G50 A;  4XAK A;  3ARX A;  3NI6 A;  1LG1 A;  3PA7 A;  4Z2K A;  3CHE A;  4P8U A;  2DT2 A;  1ROT A;  4DT4 A;  1P5Q A;  4HAR A;  2A3C A;  1Q6H A;  4L72 B;  5DF0 A;  3KAI A;  4URI A;  3CHD A;  1YAT A;  2F21 A;  3G6M A;  3CZ8 A;  1WAW A;  2M1I A;  2XP5 A;  3AS3 A;  4QT3 A;  1HJV A;  5HWB A;  1J4I A;  1FKT A;  3O5P A;  3B9E A;  1KT0 A;  2PPP A;  1J6Y A;  2M08 A;  1ROU A;  4WJX A;  1FD9 A;  4Q22 A;  2ZR5 A;  4JYS A;  1FKK A;  3WQV A;  4QZV B;  1ZBV A;  1M5Y A;  3B8S A;  1EHN A;  2ETN A;  2PV1 A;  1Q6I A;  2DSZ A;  1UR8 A;  2LKN A;  1F8A B;  3G6L A;  4MPK A;  3WD0 A;  3UI6 A;  3KAB A;  4C02 B;  1JNE A;  3ALG A;  2DSU A;  3O5G A;  3QOK A;  1W1Y A;  1SYT A;  1FKF A;  4DIP A;  3GPK A;  2LJ4 A;  2PI6 A;  2YBT A;  3ALF A;  3RM4 A;  4DRH A;  3H9R B;  2RUD A;  1ZBC A;  4TW8 A;  4DWS A;  2MNT A;  3O5J A;  4S3J A;  4IT6 A;  4MTV A;  3ARW A;  5DIT A;  5HW6 A;  1FKJ A;  2DSW A;  3O5D A;  1FKG A;  1ZBK A;  4P8W A;  3O5L A;  1BKF A;  3OA5 A;  2DT3 A;  3ARQ A;  3IKD A;  3WD4 A;  3I6C A;  5HW8 A;  1W9P A;  4HBO A;  3JYJ A;  5HTG A;  2F2D A;  2ESC A;  3CGM A;  1W9U A;  2K8I A;  2G8Z A;  3O5F A;  4ITZ A;  5HKG A;  2DG4 A;  3KCE A;  1CTN A;  3ART A;  3B7X A;  2N87 A;  1FKB A;  4DH0 A;  1X6N A;  1NWR A;  3PRB A;  4HBE A;  4GGQ A;  1U79 A;  1H0I A;  4LAV A;  4ODP A;  3EIP A;  3ODK A;  1ZBW A;  1QPF A;  4R5E A;  2MPH A;  2PN0 A;  2WLY A;  4MNM A;  4Z2G A;  4TW7 A;  3O5K A;  3GTY X;  1D2K A;  1KFW A;  2Y78 A;  1FKR A;  1IX5 A;  2XP7 A;  3O5R A;  4FAP A;  3AS0 A;  4WIW A;  4DRM A;  2KFW A;  3KAH A;  3CGN A;  4J4O A;  3RME A;  2KE0 A;  2ZQT A;  4LAX A;  2OLH A;  2WM0 A;  3WQW A;  2O9O A;  5HUA A;  1E9L A;  2M2A A;  4W9Q A;  2EUL A;  5GPG A;  1R9H A;  3O5Q A;  4ZPW R;  4ODR A;  3PR9 A;  3BXW A;  2D9F A;  3WL0 A;  3WD2 A;  2YBU A;  4DWS B;  4JFM A;  4L3N A;  4ODK A;  4NZC A;  5HW7 A;  4JFK A;  4NSB A;  1HKI A;  4MAV A;  3UQB A;  1HJX A;  1NWS A;  4Z2H A;  2AOS A;  1W1V A;  2PPO A;  5HT1 A;  2RSE A;  1FFR A;  1QZ2 A;  2LPV A;  2XP8 A;  4ML4 A;  3KAC A;  1LJY A;  1D7H A;  4KQZ A;  3W4R A;  1UR9 A;  2DG9 A;  4TX0 A;  3WH0 A;  4Z2I A;  4LGX A;  2WLZ A;  2FAP A;  3ARU A;  1NMV A;  1H0G A;  2KR7 A;  4MNK A;  4QIB A;  3ARR A;  1NMW A;  3AS2 A;  1JNS A;  4ZPT R;  3O5M A;  3RM9 A;  3TC5 A;  1OGG A;  1HXV A;  1JND A;  3UQA A;  3WL1 A;  1FFQ A;  1TFV A;  4NNR A;  1B6C A;  4IQC A;  1XRV A;  4IQ2 A;  4S3K A;  5DIV A;  4GIV A;  5JH8 A;  1FKH A;  1GPF A;  1FKD A;  2PV2 A;  2RQS A;  2DG3 A;  4WKF A;  3JYM A;  2O92 A;  1W1P A;  1J4H A;  2ZQU A;  4ODM A;  5I98 A;  1NSG A;  1K9T A;  1EDQ A;  3LUO A;  2ZQV A;  1Q6U A;  1WNO A;  2VCD A;  2UZ5 A;  1D7J A;  2MLZ A;  3IK8 A;  1YW5 A;  4FN2 A;  4DWS C;  3UF8 A;  4DZ2 A;  2MLY A;  2QF8 A;  1WB0 A;  2F4E A;  4U86 A;  3TDB A;  2PBC A;  2IUZ A;  2A3E A;  4DRO A;  3OOB A;  1GOI A;  3ARZ A;  3FXY A;  3PRA A;  1RD6 A;  3ARV A;  1ZB5 A;  3RM8 A;  2RUQ A;  4DZ3 A;  2ITK A;  2XP6 A;  2DSV A;  2DT1 A;  1JCH B;  3UI4 A;  4O2T A;  4IT4 A;  4TYO A;  3TCZ A;  2MLX A;  1FJD A;  1OGB A;  4U85 A;  4DRI A;  1HKJ A;  1E6N A;  2KI3 A;  4W5U A;  5GPR A;  2KO7 A;  1C9H A;  4MGV A;  4MNL A;  1NWT A;  2Q5A A;  4TNS A; 
#chains in the Genus database with same CATH homology
 3CH9 A;  3KAG A;  4DRJ A;  1PBK A;  1W9V A;  3O5I A;  4JFJ A;  4ZPV R;  2G41 A;  5DO2 A;  3KAD A;  5HWC A;  3FY1 A;  4ODO A;  3CHF A;  2A3B A;  4IPX A;  3NTP A;  4P8X A;  1D6O A;  1SR0 A;  3ARO A;  1LL6 A;  1NH6 A;  3IHZ A;  2L2S A;  4MSP A;  3ARY A;  1Q1C A;  1JNT A;  3UI5 A;  2VN1 A;  1ITX A;  3FAP A;  4DWS D;  5HBF A;  3AS1 A;  4LAW A;  1BL4 A;  3O5E A;  2OFN A;  1HKK A;  4G2P A;  3JXV A;  1OWQ A;  1L1P A;  1E6R A;  1FKL A;  4DRP A;  4Z2L A;  2JZV A;  5BXJ A;  3EY6 A;  1ZK6 A;  2XP3 A;  1ZCN A;  2XP4 A;  4ODQ A;  1KT1 A;  1LL4 A;  1LQ0 A;  3WD3 A;  4DRN A;  2WK2 A;  3RGC A;  3ARP A;  4PTM A;  2RUC A;  3WKZ A;  1D7I A;  2XPB A;  2ZQS A;  4DRK A;  3MDY B;  1EYM A;  4ZS6 A;  3UQI A;  2RUR A;  3NRK A;  1F40 A;  5DIU A;  1QPL A;  4WKA A;  1NWU A;  4Z2J A;  1EQ3 A;  2MF9 A;  1T11 A;  4U84 A;  2LGO A;  2PPN A;  3VAW A;  1JVW A;  3WIJ A;  2XP9 A;  1HJW A;  4J4N A;  1Y0O A;  3KAF A;  3AQU A;  4JFL A;  5B8I C;  1TCO C;  3B9A A;  1EIB A;  4QT2 A;  1N1A A;  2ZR4 A;  1E6P A;  3RFW A;  1LG2 A;  2ZR6 A;  4BF8 A;  2B31 A;  2PV3 A;  3O5O A;  4ODL A;  2A3A A;  3ARS A;  2FDM A;  4LAY A;  1ZU8 A;  4KR0 B;  2XPA A;  5D75 A;  2KGJ A;  4N19 A;  4Q7N A;  1E6Z A;  2DPE A;  1XHG A;  1ZL1 A;  4MNJ A;  1LL7 A;  4JFI A;  1GUV A;  4DRQ A;  3B9D A;  4TW6 A;  1FAP A;  1VF8 A;  4R0X A;  4ODN A;  1W1T A;  3CHC A;  1E15 A;  4W9P A;  3WD1 A;  4W9O A;  4WKH A;  1J4R A;  1O6I A;  3KZ7 A;  5GQB A;  4AY1 A;  3PRD A;  1W26 A;  4WK9 A;  1FKI A;  1FKS A;  2IF4 A;  1PIN A;  2AWG A;  4P8V A;  2FKE A;  3IKG A;  1X6L A;  1HKM A;  5DEZ A;  2DT0 A;  1A7X A;  5J6E A;  4G50 A;  4XAK A;  3ARX A;  3NI6 A;  1LG1 A;  3PA7 A;  4Z2K A;  3CHE A;  4P8U A;  2DT2 A;  1ROT A;  4DT4 A;  1P5Q A;  4HAR A;  2A3C A;  1Q6H A;  4L72 B;  5DF0 A;  3KAI A;  4URI A;  3CHD A;  1YAT A;  2F21 A;  3G6M A;  3CZ8 A;  1WAW A;  2M1I A;  2XP5 A;  3AS3 A;  4QT3 A;  1HJV A;  5HWB A;  1J4I A;  1FKT A;  3O5P A;  3B9E A;  1KT0 A;  2PPP A;  1J6Y A;  2M08 A;  1ROU A;  4WJX A;  1FD9 A;  4Q22 A;  2ZR5 A;  4JYS A;  1FKK A;  3WQV A;  4QZV B;  1ZBV A;  1M5Y A;  3B8S A;  1EHN A;  2PV1 A;  1Q6I A;  2DSZ A;  1UR8 A;  2LKN A;  1F8A B;  3G6L A;  4MPK A;  3WD0 A;  3UI6 A;  3KAB A;  4C02 B;  1JNE A;  3ALG A;  2DSU A;  3O5G A;  3QOK A;  1W1Y A;  1SYT A;  1FKF A;  4DIP A;  3GPK A;  2LJ4 A;  2PI6 A;  2YBT A;  3ALF A;  3RM4 A;  4DRH A;  3H9R B;  2RUD A;  1ZBC A;  4TW8 A;  4DWS A;  2MNT A;  3O5J A;  4S3J A;  4IT6 A;  4MTV A;  3ARW A;  5DIT A;  5HW6 A;  1FKJ A;  2DSW A;  3O5D A;  1FKG A;  1ZBK A;  4P8W A;  3O5L A;  1BKF A;  3OA5 A;  2DT3 A;  3ARQ A;  3IKD A;  3WD4 A;  3I6C A;  5HW8 A;  1W9P A;  4HBO A;  3JYJ A;  5HTG A;  2F2D A;  2ESC A;  3CGM A;  1W9U A;  2K8I A;  2G8Z A;  3O5F A;  4ITZ A;  5HKG A;  2DG4 A;  3KCE A;  1CTN A;  3ART A;  3B7X A;  2N87 A;  1FKB A;  4DH0 A;  1X6N A;  1NWR A;  3PRB A;  4HBE A;  4GGQ A;  1U79 A;  1H0I A;  4LAV A;  4ODP A;  3ODK A;  1ZBW A;  1QPF A;  4R5E A;  2MPH A;  2WLY A;  4MNM A;  4Z2G A;  4TW7 A;  3O5K A;  1D2K A;  1KFW A;  2Y78 A;  1FKR A;  1IX5 A;  2XP7 A;  3O5R A;  4FAP A;  3AS0 A;  4WIW A;  4DRM A;  2KFW A;  3KAH A;  3CGN A;  4J4O A;  3RME A;  2KE0 A;  2ZQT A;  4LAX A;  2OLH A;  2WM0 A;  3WQW A;  2O9O A;  5HUA A;  1E9L A;  2M2A A;  4W9Q A;  5GPG A;  1R9H A;  3O5Q A;  4ZPW R;  4ODR A;  3PR9 A;  3BXW A;  2D9F A;  3WL0 A;  3WD2 A;  2YBU A;  4DWS B;  4JFM A;  4L3N A;  4ODK A;  4NZC A;  5HW7 A;  4JFK A;  4NSB A;  1HKI A;  4MAV A;  3UQB A;  1HJX A;  1NWS A;  4Z2H A;  2AOS A;  1W1V A;  2PPO A;  5HT1 A;  2RSE A;  1FFR A;  1QZ2 A;  2LPV A;  2XP8 A;  4ML4 A;  3KAC A;  1LJY A;  1D7H A;  4KQZ A;  3W4R A;  1UR9 A;  2DG9 A;  4TX0 A;  3WH0 A;  4Z2I A;  4LGX A;  2WLZ A;  2FAP A;  3ARU A;  1NMV A;  1H0G A;  2KR7 A;  4MNK A;  4QIB A;  3ARR A;  1NMW A;  3AS2 A;  1JNS A;  4ZPT R;  3O5M A;  3RM9 A;  3TC5 A;  1OGG A;  1HXV A;  1JND A;  3UQA A;  3WL1 A;  1FFQ A;  1TFV A;  4NNR A;  1B6C A;  4IQC A;  1XRV A;  4IQ2 A;  4S3K A;  5DIV A;  4GIV A;  5JH8 A;  1FKH A;  1GPF A;  1FKD A;  2PV2 A;  2RQS A;  2DG3 A;  4WKF A;  3JYM A;  2O92 A;  1W1P A;  1J4H A;  2ZQU A;  4ODM A;  5I98 A;  1NSG A;  1K9T A;  1EDQ A;  3LUO A;  2ZQV A;  1Q6U A;  1WNO A;  2VCD A;  2UZ5 A;  1D7J A;  2MLZ A;  3IK8 A;  1YW5 A;  4FN2 A;  4DWS C;  3UF8 A;  4DZ2 A;  2MLY A;  2QF8 A;  1WB0 A;  2F4E A;  4U86 A;  3TDB A;  2PBC A;  2IUZ A;  2A3E A;  4DRO A;  3OOB A;  1GOI A;  3ARZ A;  3FXY A;  3PRA A;  1RD6 A;  3ARV A;  1ZB5 A;  3RM8 A;  2RUQ A;  4DZ3 A;  2ITK A;  2XP6 A;  2DSV A;  2DT1 A;  3UI4 A;  4O2T A;  4IT4 A;  4TYO A;  3TCZ A;  2MLX A;  1FJD A;  1OGB A;  4U85 A;  4DRI A;  1HKJ A;  1E6N A;  2KI3 A;  4W5U A;  5GPR A;  2KO7 A;  1C9H A;  4MGV A;  4MNL A;  1NWT A;  2Q5A A;  4TNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...