3IK8A

Structure-based design of novel pin1 inhibitors (i)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
113
structure length
113
Chain Sequence
EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-based design of novel human Pin1 inhibitors (I).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 37
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3ik8A00
2M08A 2XP9A 3O5DA 2FKEA 1FD9A 2XP8A 2ZQTA 3O5LA 4W9OA 3O5JA 4LAXA 2JZVA 1FKSA 2MPHA 2XP3A 2XP4A 3UQAA 1FKIA 4J4OA 4MSPA 4C02B 3KAFA 2KR7A 2L2SA 1T11A 3IKGA 3TCZA 2N87A 2PPOA 4DROA 3UI5A 4DRPA 3KABA 1J4HA 2MLYA 2ZR5A 1TCOC 3O5MA 3VAWA 1U79A 1FKJA 3NRKA 5D75A 5HW8A 1EYMA 5HWCA 3KAGA 4DT4A 3O5OA 2MLZA 2PPPA 2K8IA 1Q1CA 1PBKA 1C9HA 4ODRA 5DIVA 1P5QA 1Q6HA 2D9FA 2ITKA 3JXVA 1YW5A 2MF9A 1KT1A 2LKNA 3KAHA 1ROUA 2Q5AA 3O5RA 4W9QA 2PPNA 3UQBA 3IK8A 1HXVA 2AWGA 3JYJA 1FKDA 2UZ5A 1KT0A 5GPGA 1A7XA 2XPAA 2ZQVA 4ODKA 2VCDA 3LUOA 4TX0A 4DRIA 3WH0A 1B6CA 3PA7A 4QT3A 1Y0OA 5DITA 1QPFA 1NMVA 3FAPA 2XP5A 3CGMA 4U84A 4DIPA 4DRMA 1Q6IA 5BXJA 3H9RB 4G2PA 3O5GA 2IF4A 2PBCA 1D6OA 4G50A 2KFWA 3PRDA 4ITZA 1EQ3A 3UI4A 4JFIA 5HUAA 4ODNA 4DRJA 4ODOA 4DRNA 1FKHA 3NI6A 1FJDA 1FKKA 2RURA 2M1IA 3EY6A 4ODPA 1D7IA 2DG4A 4QT2A 1J6YA 3O5KA 4BF8A 5HTGA 4J4NA 4IPXA 4LAWA 4TW6A 4GIVA 2F21A 5HKGA 2ZQUA 5HWBA 3OOBA 4DRKA 4JFMA 3O5EA 1FAPA 4TW8A 3UQIA 1ZK6A 2XP6A 2KI3A 3O5PA 1J4RA 3KADA 4JYSA 4TW7A 4W9PA 2RUDA 4JFLA 1J4IA 2FAPA 5HW7A 3KACA 3CGNA 4JFJA 1Q6UA 3ODKA 3JYMA 4FAPA 2KO7A 4FN2A 1FKFA 3TC5A 1QPLA 5B8IC 2LPVA 5HW6A 2KGJA 1W26A 2OFNA 1BL4A 1NSGA 2F2DA 2RSEA 4O2TA 4ODLA 2PV2A 2ZR4A 2PV3A 4R0XA 3RGCA 4DRQA 2MLXA 3O5QA 3KZ7A 2VN1A 4ODQA 1F40A 1M5YA 4IQ2A 4LAYA 5HT1A 4DZ2A 1D7HA 2MNTA 4TYOA 3UI6A 1L1PA 3O5IA 1BKFA 3IHZA 1NMWA 2Y78A 3B7XA 5DIUA 2DG3A 4JFKA 1ZCNA 2ZR6A 1FKTA 1N1AA 1D7JA 1FKLA 1R9HA 3TDBA 2F4EA 2RUQA 2RUCA 2LJ4A 3O5FA 3PRBA 4GGQA 1JNSA 3KCEA 5J6EA 3UF8A 3MDYB 4DH0A 4DZ3A 1ROTA 4QIBA 3RFWA 4LAVA 1JNTA 2DG9A 4NNRA 5I98A 1PINA 1YATA 4N19A 3KAIA 4U86A 2PV1A 2XPBA 1QZ2A 2LGOA 2XP7A 2ZQSA 2M2AA 2RQSA 1JVWA 4ODMA 2KE0A 3NTPA 3GPKA 3I6CA 4TNSA 4MGVA 1FKBA 4U85A 3IKDA 4IQCA 4DRHA 1F8AB 1FKRA 1FKGA
chains in the Genus database with same CATH superfamily
3CHFA 3ARRA 2XP8A 3B8SA 1FKSA 3AS3A 2L2SA 3KABA 1J4HA 2ZR5A 3O5MA 4MNMA 2ESCA 3VAWA 3ARPA 1U79A 3NRKA 5HW8A 3FXYA 3RM4A 3AS1A 1HKIA 2MLZA 1Q1CA 1PBKA 3B9EA 2ITKA 1KFWA 3JXVA 2A3AA 2G8ZA 1ROUA 2Q5AA 4W9QA 2PPNA 1GUVA 3JYJA 1O6IA 1X6NA 4Z2GA 2WK2A 3ARXA 5DITA 1JCHB 1Y0OA 2F23A 3FAPA 4NSBA 4DIPA 5BXJA 3H9RB 4G50A 4WIWA 4NZCA 4ODOA 4BF8A 4DWSC 4J4NA 4GIVA 2A3EA 3OOBA 4JFMA 1ZK6A 3QOKA 3WQWA 3PRAA 1W1YA 1W9VA 2A3BA 1LG1A 4MNLA 1W9UA 4FN2A 1FKFA 3WD0A 1LL6A 2OFNA 1W26A 2O9OA 4MNKA 4ZPWR 2F2DA 1E9LA 3PR9A 2PV3A 4HBEA 4DRQA 4XAKA 2IUZA 1F40A 3O5IA 1NMWA 2Y78A 3ARWA 3BMBA 2DG3A 4JFKA 3CHCA 2WLYA 3ARSA 1JNSA 3UF8A 4DZ3A 1ROTA 4LAVA 1NH6A 3WD4A 2RQSA 1FKBA 1ZU8A 2FKEA 2PI6A 3O5LA 2AOSA 2MPHA 3UQAA 4J4OA 4MSPA 2KR7A 1HKKA 2N87A 2PPOA 4DROA 3UI5A 2MLYA 4MTVA 1FKJA 4MPKA 1EYMA 5HWCA 3KAGA 2PPPA 2K8IA 1C9HA 2DSVA 1Q6HA 3RM8A 2MF9A 1KT1A 3O5RA 4KQZA 2AWGA 2WLZA 2DT3A 3WL0A 1KT0A 5GPGA 2XPAA 2ZQVA 4ODKA 2VCDA 3LUOA 3GTYX 4TX0A 4DRIA 1HJWA 4DWSB 4U84A 5GPRA 1Q6IA 1JNDA 2IF4A 3CHDA 3G6MA 1XRVA 3PRDA 4Q7NA 4QZVB 3RMEA 3NI6A 1FKKA 4W5UA 3WIJA 4ODPA 3O5KA 1GPFA 4LAWA 5HKGA 4WKAA 1HJVA 1FAPA 4TW8A 2XP6A 4URIA 4JYSA 4W9PA 2RUDA 5HW7A 2DT0A 2FAPA 4AY1A 1Q6UA 1ZBKA 3JYMA 3ODKA 2KO7A 4Q22A 4ML4A 4P8WA 2DT1A 3TC5A 1QPLA 2LPVA 4Z2KA 2O92A 4L3NA 1E6RA 1UR9A 3O5QA 4DZ2A 3UI6A 1EIBA 1ZBCA 5DIUA 1ZCNA 2ZR6A 1H0IA 2B31A 1SYTA 3CHEA 1D7JA 1FKLA 2RUCA 3O5FA 1H0GA 1UR8A 4MAVA 3MDYB 4DH0A 1NWUA 1JNTA 1OWQA 4NNRA 2B5UB 4N19A 4U86A 2XPBA 1K9TA 4HBOA 2LGOA 2ZQSA 4UDMA 1ZL1A 3GPKA 4TNSA 3IK8A 3WD1A 1F8AB 1FKGA 2M08A 2XP9A 3O5DA 1FD9A 2ZQTA 4W9OA 4LAXA 4ZPTR 2XP4A 4ZS6A 5GQBA 1HKMA 4IT6A 4L72B 1T11A 3TCZA 2FDMA 1FFRA 1NWRA 1LL7A 1TCOC 1RD6A 2DSZA 1HJXA 4S3KA 1VF8A 1W1PA 4ODRA 5DIVA 2EULA 1YW5A 1EDQA 1HKJA 2LKNA 3KAHA 1HXVA 2YBUA 4P8VA 1FKDA 4LGXA 1B6CA 3WQVA 4QT3A 1QPFA 1NMVA 2XP5A 3CGMA 1FFQA 4WK9A 4G2PA 3O5GA 2PBCA 1D6OA 4DRNA 1FKHA 1X6LA 1W1TA 3AROA 3EY6A 1D7IA 1TFVA 4QT2A 5HTGA 3AQUA 1WB0A 4TW6A 4IPXA 2F21A 2ZQUA 4DRKA 5DEZA 3O5EA 1ZBVA 3ALGA 3UQIA 1IX5A 2KI3A 3O5PA 3KADA 4JFLA 3B9AA 1J4IA 3KACA 3OA5A 4JFJA 3BXWA 3ARVA 3ARUA 3EIPA 4FAPA 5HW6A 1LG2A 2DSWA 1BL4A 1NSGA 2RSEA 4ODLA 1ITXA 4R0XA 3B9DA 3GU0A 1WNOA 1WAWA 2MLXA 3AS2A 3KZ7A 4S3JA 5HBFA 1M5YA 4LAYA 5HT1A 1E6PA 4TYOA 1BKFA 3IHZA 2OLHA 4KR0B 1N1AA 1R9HA 4GGQA 3PRBA 2LJ4A 3RFWA 2DG9A 5I98A 1NWSA 1YATA 1SR0A 2M2AA 1JVWA 4ODMA 1JNEA 4DWSA 4Z2HA 4R5EA 3NTPA 1CTNA 1FKRA 1E15A 4U85A 4DRHA 4Z2LA 1ZB5A 3O5JA 4HARA 2JZVA 2XP3A 2ETNA 1FKIA 4C02B 3KAFA 4PTMA 3IKGA 1GRJA 4DRPA 2G41A 1E6ZA 4IT4A 5D75A 4WKFA 4WJXA 3CH9A 4DT4A 1ZBWA 3O5OA 1LJYA 1P5QA 3ARTA 4P8UA 2D9FA 1XHGA 1E44A 3ARQA 2WM0A 4DWSD 3UQBA 1E6NA 4Z2JA 2UZ5A 1A7XA 3WH0A 3PA7A 1LQ0A 3WD2A 2PN0A 3ARZA 4DRMA 3ALFA 1OGBA 2KFWA 4ITZA 1EQ3A 3UI4A 4JFIA 5HUAA 4ODNA 4P8XA 4DRJA 3W4RA 1FJDA 2RURA 1NWTA 2M1IA 1J6YA 1W1VA 2DG4A 4ZPVR 1GOIA 2QF8A 1OGGA 5HWBA 2DSUA 1LL4A 4TW7A 1J4RA 5DF0A 3FY1A 1EHNA 2DPEA 3CGNA 2P4VA 4Z2IA 5B8IC 2KGJA 4O2TA 2PV2A 2ZR4A 3RGCA 2VN1A 4ODQA 4IQ2A 1L1PA 2DT2A 1D7HA 2MNTA 3WD3A 3B7XA 4MNJA 4WKHA 3CZ8A 1FKTA 3ARYA 3TDBA 2A3CA 2F4EA 2RUQA 3G6LA 3WL1A 1W9PA 3KCEA 5J6EA 5JH8A 4QIBA 1PINA 3KAIA 2PV1A 1QZ2A 1D2KA 2XP7A 3RM9A 3WKZA 3AS0A 2KE0A 5DO2A 3I6CA 4MGVA 2YBTA 3IKDA 4IQCA
chains in the Genus database with same CATH topology
3CHFA 3ARRA 2XP8A 3B8SA 1FKSA 3AS3A 2L2SA 3KABA 1J4HA 2ZR5A 3O5MA 4MNMA 2ESCA 3VAWA 3ARPA 1U79A 3NRKA 5HW8A 3FXYA 3RM4A 3AS1A 1HKIA 2MLZA 1Q1CA 1PBKA 3B9EA 2ITKA 1KFWA 3JXVA 2A3AA 2G8ZA 1ROUA 2Q5AA 4W9QA 2PPNA 1GUVA 3JYJA 1O6IA 1X6NA 4Z2GA 2WK2A 3ARXA 5DITA 1Y0OA 3FAPA 4NSBA 4DIPA 5BXJA 3H9RB 4G50A 4WIWA 4NZCA 4ODOA 4BF8A 4DWSC 4J4NA 4GIVA 2A3EA 3OOBA 4JFMA 1ZK6A 3QOKA 3WQWA 3PRAA 1W1YA 1W9VA 2A3BA 1LG1A 4MNLA 1W9UA 4FN2A 1FKFA 3WD0A 1LL6A 2OFNA 1W26A 2O9OA 4MNKA 4ZPWR 2F2DA 1E9LA 3PR9A 2PV3A 4HBEA 4DRQA 4XAKA 2IUZA 1F40A 3O5IA 1NMWA 2Y78A 3ARWA 2DG3A 4JFKA 3CHCA 2WLYA 3ARSA 1JNSA 3UF8A 4DZ3A 1ROTA 4LAVA 1NH6A 3WD4A 2RQSA 1FKBA 1ZU8A 2FKEA 2PI6A 3O5LA 2AOSA 2MPHA 3UQAA 4J4OA 4MSPA 2KR7A 1HKKA 2N87A 2PPOA 4DROA 3UI5A 2MLYA 4MTVA 1FKJA 4MPKA 1EYMA 5HWCA 3KAGA 2PPPA 2K8IA 1C9HA 2DSVA 1Q6HA 3RM8A 2MF9A 1KT1A 3O5RA 4KQZA 2AWGA 2WLZA 2DT3A 3WL0A 1KT0A 5GPGA 2XPAA 2ZQVA 4ODKA 2VCDA 3LUOA 4TX0A 4DRIA 1HJWA 4DWSB 4U84A 5GPRA 1Q6IA 1JNDA 2IF4A 3CHDA 3G6MA 1XRVA 3PRDA 4Q7NA 4QZVB 3RMEA 3NI6A 1FKKA 4W5UA 3WIJA 4ODPA 3O5KA 1GPFA 4LAWA 5HKGA 4WKAA 1HJVA 1FAPA 4TW8A 2XP6A 4URIA 4JYSA 4W9PA 2RUDA 5HW7A 2DT0A 2FAPA 4AY1A 1Q6UA 1ZBKA 3JYMA 3ODKA 2KO7A 4Q22A 4ML4A 4P8WA 2DT1A 3TC5A 1QPLA 2LPVA 4Z2KA 2O92A 4L3NA 1E6RA 1UR9A 3O5QA 4DZ2A 3UI6A 1EIBA 1ZBCA 5DIUA 1ZCNA 2ZR6A 1H0IA 2B31A 1SYTA 3CHEA 1D7JA 1FKLA 2RUCA 3O5FA 1H0GA 1UR8A 4MAVA 3MDYB 4DH0A 1NWUA 1JNTA 1OWQA 4NNRA 4N19A 4U86A 2XPBA 1K9TA 4HBOA 2LGOA 2ZQSA 1ZL1A 3GPKA 4TNSA 3IK8A 3WD1A 1F8AB 1FKGA 2M08A 2XP9A 3O5DA 1FD9A 2ZQTA 4W9OA 4LAXA 4ZPTR 2XP4A 4ZS6A 5GQBA 1HKMA 4IT6A 4L72B 1T11A 3TCZA 2FDMA 1FFRA 1NWRA 1LL7A 1TCOC 1RD6A 2DSZA 1HJXA 4S3KA 1VF8A 1W1PA 4ODRA 5DIVA 1YW5A 1EDQA 1HKJA 2LKNA 3KAHA 1HXVA 2YBUA 4P8VA 1FKDA 4LGXA 1B6CA 3WQVA 4QT3A 1QPFA 1NMVA 2XP5A 3CGMA 1FFQA 4WK9A 4G2PA 3O5GA 2PBCA 1D6OA 4DRNA 1FKHA 1X6LA 1W1TA 3AROA 3EY6A 1D7IA 1TFVA 4QT2A 5HTGA 3AQUA 1WB0A 4TW6A 4IPXA 2F21A 2ZQUA 4DRKA 5DEZA 3O5EA 1ZBVA 3ALGA 3UQIA 1IX5A 2KI3A 3O5PA 3KADA 4JFLA 3B9AA 1J4IA 3KACA 3OA5A 4JFJA 3BXWA 3ARVA 3ARUA 4FAPA 5HW6A 1LG2A 2DSWA 1BL4A 1NSGA 2RSEA 4ODLA 1ITXA 4R0XA 3B9DA 1WNOA 1WAWA 2MLXA 3AS2A 3KZ7A 4S3JA 5HBFA 1M5YA 4LAYA 5HT1A 1E6PA 4TYOA 1BKFA 3IHZA 2OLHA 4KR0B 1N1AA 1R9HA 4GGQA 3PRBA 2LJ4A 3RFWA 2DG9A 5I98A 1NWSA 1YATA 1SR0A 2M2AA 1JVWA 4ODMA 1JNEA 4DWSA 4Z2HA 4R5EA 3NTPA 1CTNA 1FKRA 1E15A 4U85A 4DRHA 4Z2LA 1ZB5A 3O5JA 4HARA 2JZVA 2XP3A 1FKIA 4C02B 3KAFA 4PTMA 3IKGA 4DRPA 2G41A 1E6ZA 4IT4A 5D75A 4WKFA 4WJXA 3CH9A 4DT4A 1ZBWA 3O5OA 1LJYA 1P5QA 3ARTA 4P8UA 2D9FA 1XHGA 3ARQA 2WM0A 4DWSD 3UQBA 1E6NA 4Z2JA 2UZ5A 1A7XA 3WH0A 3PA7A 1LQ0A 3WD2A 4DRMA 3ARZA 3ALFA 1OGBA 2KFWA 4ITZA 1EQ3A 3UI4A 4JFIA 5HUAA 4ODNA 4P8XA 4DRJA 3W4RA 1FJDA 2RURA 1NWTA 2M1IA 1J6YA 1W1VA 2DG4A 4ZPVR 1GOIA 2QF8A 1OGGA 5HWBA 2DSUA 1LL4A 4TW7A 1J4RA 5DF0A 3FY1A 1EHNA 2DPEA 3CGNA 4Z2IA 5B8IC 2KGJA 4O2TA 2PV2A 2ZR4A 3RGCA 2VN1A 4ODQA 4IQ2A 1L1PA 2DT2A 1D7HA 2MNTA 3WD3A 3B7XA 4MNJA 4WKHA 3CZ8A 1FKTA 3ARYA 3TDBA 2A3CA 2F4EA 2RUQA 3G6LA 3WL1A 1W9PA 3KCEA 5J6EA 5JH8A 4QIBA 1PINA 3KAIA 2PV1A 1QZ2A 1D2KA 2XP7A 3RM9A 3WKZA 3AS0A 2KE0A 5DO2A 3I6CA 4MGVA 2YBTA 3IKDA 4IQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M08 A;  2XP9 A;  3O5D A;  2FKE A;  1FD9 A;  2XP8 A;  2ZQT A;  3O5L A;  4W9O A;  3O5J A;  4LAX A;  2JZV A;  1FKS A;  2MPH A;  2XP3 A;  2XP4 A;  3UQA A;  1FKI A;  4J4O A;  4MSP A;  4C02 B;  3KAF A;  2KR7 A;  2L2S A;  1T11 A;  3IKG A;  3TCZ A;  2N87 A;  2PPO A;  4DRO A;  3UI5 A;  4DRP A;  3KAB A;  1J4H A;  2MLY A;  2ZR5 A;  1TCO C;  3O5M A;  3VAW A;  1U79 A;  1FKJ A;  3NRK A;  5D75 A;  5HW8 A;  1EYM A;  5HWC A;  3KAG A;  4DT4 A;  3O5O A;  2MLZ A;  2PPP A;  2K8I A;  1Q1C A;  1PBK A;  1C9H A;  4ODR A;  5DIV A;  1P5Q A;  1Q6H A;  2D9F A;  2ITK A;  3JXV A;  1YW5 A;  2MF9 A;  1KT1 A;  2LKN A;  3KAH A;  1ROU A;  2Q5A A;  3O5R A;  4W9Q A;  2PPN A;  3UQB A;  3IK8 A;  1HXV A;  2AWG A;  3JYJ A;  1FKD A;  2UZ5 A;  1KT0 A;  5GPG A;  1A7X A;  2XPA A;  2ZQV A;  4ODK A;  2VCD A;  3LUO A;  4TX0 A;  4DRI A;  3WH0 A;  1B6C A;  3PA7 A;  4QT3 A;  1Y0O A;  5DIT A;  1QPF A;  1NMV A;  3FAP A;  2XP5 A;  3CGM A;  4U84 A;  4DIP A;  4DRM A;  1Q6I A;  5BXJ A;  3H9R B;  4G2P A;  3O5G A;  2IF4 A;  2PBC A;  1D6O A;  4G50 A;  2KFW A;  3PRD A;  4ITZ A;  1EQ3 A;  3UI4 A;  4JFI A;  5HUA A;  4ODN A;  4DRJ A;  4ODO A;  4DRN A;  1FKH A;  3NI6 A;  1FJD A;  1FKK A;  2RUR A;  2M1I A;  3EY6 A;  4ODP A;  1D7I A;  2DG4 A;  4QT2 A;  1J6Y A;  3O5K A;  4BF8 A;  5HTG A;  4J4N A;  4IPX A;  4LAW A;  4TW6 A;  4GIV A;  2F21 A;  5HKG A;  2ZQU A;  5HWB A;  3OOB A;  4DRK A;  4JFM A;  3O5E A;  1FAP A;  4TW8 A;  3UQI A;  1ZK6 A;  2XP6 A;  2KI3 A;  3O5P A;  1J4R A;  3KAD A;  4JYS A;  4TW7 A;  4W9P A;  2RUD A;  4JFL A;  1J4I A;  2FAP A;  5HW7 A;  3KAC A;  3CGN A;  4JFJ A;  1Q6U A;  3ODK A;  3JYM A;  4FAP A;  2KO7 A;  4FN2 A;  1FKF A;  3TC5 A;  1QPL A;  5B8I C;  2LPV A;  5HW6 A;  2KGJ A;  1W26 A;  2OFN A;  1BL4 A;  1NSG A;  2F2D A;  2RSE A;  4O2T A;  4ODL A;  2PV2 A;  2ZR4 A;  2PV3 A;  4R0X A;  3RGC A;  4DRQ A;  2MLX A;  3O5Q A;  3KZ7 A;  2VN1 A;  4ODQ A;  1F40 A;  1M5Y A;  4IQ2 A;  4LAY A;  5HT1 A;  4DZ2 A;  1D7H A;  2MNT A;  4TYO A;  3UI6 A;  1L1P A;  3O5I A;  1BKF A;  3IHZ A;  1NMW A;  2Y78 A;  3B7X A;  5DIU A;  2DG3 A;  4JFK A;  1ZCN A;  2ZR6 A;  1FKT A;  1N1A A;  1D7J A;  1FKL A;  1R9H A;  3TDB A;  2F4E A;  2RUQ A;  2RUC A;  2LJ4 A;  3O5F A;  3PRB A;  4GGQ A;  1JNS A;  3KCE A;  5J6E A;  3UF8 A;  3MDY B;  4DH0 A;  4DZ3 A;  1ROT A;  4QIB A;  3RFW A;  4LAV A;  1JNT A;  2DG9 A;  4NNR A;  5I98 A;  1PIN A;  1YAT A;  4N19 A;  3KAI A;  4U86 A;  2PV1 A;  2XPB A;  1QZ2 A;  2LGO A;  2XP7 A;  2ZQS A;  2M2A A;  2RQS A;  1JVW A;  4ODM A;  2KE0 A;  3NTP A;  3GPK A;  3I6C A;  4TNS A;  4MGV A;  1FKB A;  4U85 A;  3IKD A;  4IQC A;  4DRH A;  1F8A B;  1FKR A;  1FKG A; 
#chains in the Genus database with same CATH topology
 3CHF A;  3ARR A;  2XP8 A;  3B8S A;  1FKS A;  3AS3 A;  2L2S A;  3KAB A;  1J4H A;  2ZR5 A;  3O5M A;  4MNM A;  2ESC A;  3VAW A;  3ARP A;  1U79 A;  3NRK A;  5HW8 A;  3FXY A;  3RM4 A;  3AS1 A;  1HKI A;  2MLZ A;  1Q1C A;  1PBK A;  3B9E A;  2ITK A;  1KFW A;  3JXV A;  2A3A A;  2G8Z A;  1ROU A;  2Q5A A;  4W9Q A;  2PPN A;  1GUV A;  3JYJ A;  1O6I A;  1X6N A;  4Z2G A;  2WK2 A;  3ARX A;  5DIT A;  1JCH B;  1Y0O A;  2F23 A;  3FAP A;  4NSB A;  4DIP A;  5BXJ A;  3H9R B;  4G50 A;  4WIW A;  4NZC A;  4ODO A;  4BF8 A;  4DWS C;  4J4N A;  4GIV A;  2A3E A;  3OOB A;  4JFM A;  1ZK6 A;  3QOK A;  3WQW A;  3PRA A;  1W1Y A;  1W9V A;  2A3B A;  1LG1 A;  4MNL A;  1W9U A;  4FN2 A;  1FKF A;  3WD0 A;  1LL6 A;  2OFN A;  1W26 A;  2O9O A;  4MNK A;  4ZPW R;  2F2D A;  1E9L A;  3PR9 A;  2PV3 A;  4HBE A;  4DRQ A;  4XAK A;  2IUZ A;  1F40 A;  3O5I A;  1NMW A;  2Y78 A;  3ARW A;  3BMB A;  2DG3 A;  4JFK A;  3CHC A;  2WLY A;  3ARS A;  1JNS A;  3UF8 A;  4DZ3 A;  1ROT A;  4LAV A;  1NH6 A;  3WD4 A;  2RQS A;  1FKB A;  1ZU8 A;  2FKE A;  2PI6 A;  3O5L A;  2AOS A;  2MPH A;  3UQA A;  4J4O A;  4MSP A;  2KR7 A;  1HKK A;  2N87 A;  2PPO A;  4DRO A;  3UI5 A;  2MLY A;  4MTV A;  1FKJ A;  4MPK A;  1EYM A;  5HWC A;  3KAG A;  2PPP A;  2K8I A;  1C9H A;  2DSV A;  1Q6H A;  3RM8 A;  2MF9 A;  1KT1 A;  3O5R A;  4KQZ A;  2AWG A;  2WLZ A;  2DT3 A;  3WL0 A;  1KT0 A;  5GPG A;  2XPA A;  2ZQV A;  4ODK A;  2VCD A;  3LUO A;  3GTY X;  4TX0 A;  4DRI A;  1HJW A;  4DWS B;  4U84 A;  5GPR A;  1Q6I A;  1JND A;  2IF4 A;  3CHD A;  3G6M A;  1XRV A;  3PRD A;  4Q7N A;  4QZV B;  3RME A;  3NI6 A;  1FKK A;  4W5U A;  3WIJ A;  4ODP A;  3O5K A;  1GPF A;  4LAW A;  5HKG A;  4WKA A;  1HJV A;  1FAP A;  4TW8 A;  2XP6 A;  4URI A;  4JYS A;  4W9P A;  2RUD A;  5HW7 A;  2DT0 A;  2FAP A;  4AY1 A;  1Q6U A;  1ZBK A;  3JYM A;  3ODK A;  2KO7 A;  4Q22 A;  4ML4 A;  4P8W A;  2DT1 A;  3TC5 A;  1QPL A;  2LPV A;  4Z2K A;  2O92 A;  4L3N A;  1E6R A;  1UR9 A;  3O5Q A;  4DZ2 A;  3UI6 A;  1EIB A;  1ZBC A;  5DIU A;  1ZCN A;  2ZR6 A;  1H0I A;  2B31 A;  1SYT A;  3CHE A;  1D7J A;  1FKL A;  2RUC A;  3O5F A;  1H0G A;  1UR8 A;  4MAV A;  3MDY B;  4DH0 A;  1NWU A;  1JNT A;  1OWQ A;  4NNR A;  2B5U B;  4N19 A;  4U86 A;  2XPB A;  1K9T A;  4HBO A;  2LGO A;  2ZQS A;  4UDM A;  1ZL1 A;  3GPK A;  4TNS A;  3IK8 A;  3WD1 A;  1F8A B;  1FKG A;  2M08 A;  2XP9 A;  3O5D A;  1FD9 A;  2ZQT A;  4W9O A;  4LAX A;  4ZPT R;  2XP4 A;  4ZS6 A;  5GQB A;  1HKM A;  4IT6 A;  4L72 B;  1T11 A;  3TCZ A;  2FDM A;  1FFR A;  1NWR A;  1LL7 A;  1TCO C;  1RD6 A;  2DSZ A;  1HJX A;  4S3K A;  1VF8 A;  1W1P A;  4ODR A;  5DIV A;  2EUL A;  1YW5 A;  1EDQ A;  1HKJ A;  2LKN A;  3KAH A;  1HXV A;  2YBU A;  4P8V A;  1FKD A;  4LGX A;  1B6C A;  3WQV A;  4QT3 A;  1QPF A;  1NMV A;  2XP5 A;  3CGM A;  1FFQ A;  4WK9 A;  4G2P A;  3O5G A;  2PBC A;  1D6O A;  4DRN A;  1FKH A;  1X6L A;  1W1T A;  3ARO A;  3EY6 A;  1D7I A;  1TFV A;  4QT2 A;  5HTG A;  3AQU A;  1WB0 A;  4TW6 A;  4IPX A;  2F21 A;  2ZQU A;  4DRK A;  5DEZ A;  3O5E A;  1ZBV A;  3ALG A;  3UQI A;  1IX5 A;  2KI3 A;  3O5P A;  3KAD A;  4JFL A;  3B9A A;  1J4I A;  3KAC A;  3OA5 A;  4JFJ A;  3BXW A;  3ARV A;  3ARU A;  3EIP A;  4FAP A;  5HW6 A;  1LG2 A;  2DSW A;  1BL4 A;  1NSG A;  2RSE A;  4ODL A;  1ITX A;  4R0X A;  3B9D A;  3GU0 A;  1WNO A;  1WAW A;  2MLX A;  3AS2 A;  3KZ7 A;  4S3J A;  5HBF A;  1M5Y A;  4LAY A;  5HT1 A;  1E6P A;  4TYO A;  1BKF A;  3IHZ A;  2OLH A;  4KR0 B;  1N1A A;  1R9H A;  4GGQ A;  3PRB A;  2LJ4 A;  3RFW A;  2DG9 A;  5I98 A;  1NWS A;  1YAT A;  1SR0 A;  2M2A A;  1JVW A;  4ODM A;  1JNE A;  4DWS A;  4Z2H A;  4R5E A;  3NTP A;  1CTN A;  1FKR A;  1E15 A;  4U85 A;  4DRH A;  4Z2L A;  1ZB5 A;  3O5J A;  4HAR A;  2JZV A;  2XP3 A;  2ETN A;  1FKI A;  4C02 B;  3KAF A;  4PTM A;  3IKG A;  1GRJ A;  4DRP A;  2G41 A;  1E6Z A;  4IT4 A;  5D75 A;  4WKF A;  4WJX A;  3CH9 A;  4DT4 A;  1ZBW A;  3O5O A;  1LJY A;  1P5Q A;  3ART A;  4P8U A;  2D9F A;  1XHG A;  1E44 A;  3ARQ A;  2WM0 A;  4DWS D;  3UQB A;  1E6N A;  4Z2J A;  2UZ5 A;  1A7X A;  3WH0 A;  3PA7 A;  1LQ0 A;  3WD2 A;  2PN0 A;  3ARZ A;  4DRM A;  3ALF A;  1OGB A;  2KFW A;  4ITZ A;  1EQ3 A;  3UI4 A;  4JFI A;  5HUA A;  4ODN A;  4P8X A;  4DRJ A;  3W4R A;  1FJD A;  2RUR A;  1NWT A;  2M1I A;  1J6Y A;  1W1V A;  2DG4 A;  4ZPV R;  1GOI A;  2QF8 A;  1OGG A;  5HWB A;  2DSU A;  1LL4 A;  4TW7 A;  1J4R A;  5DF0 A;  3FY1 A;  1EHN A;  2DPE A;  3CGN A;  2P4V A;  4Z2I A;  5B8I C;  2KGJ A;  4O2T A;  2PV2 A;  2ZR4 A;  3RGC A;  2VN1 A;  4ODQ A;  4IQ2 A;  1L1P A;  2DT2 A;  1D7H A;  2MNT A;  3WD3 A;  3B7X A;  4MNJ A;  4WKH A;  3CZ8 A;  1FKT A;  3ARY A;  3TDB A;  2A3C A;  2F4E A;  2RUQ A;  3G6L A;  3WL1 A;  1W9P A;  3KCE A;  5J6E A;  5JH8 A;  4QIB A;  1PIN A;  3KAI A;  2PV1 A;  1QZ2 A;  1D2K A;  2XP7 A;  3RM9 A;  3WKZ A;  3AS0 A;  2KE0 A;  5DO2 A;  3I6C A;  4MGV A;  2YBT A;  3IKD A;  4IQC A; 
#chains in the Genus database with same CATH homology
 3CHF A;  3ARR A;  2XP8 A;  3B8S A;  1FKS A;  3AS3 A;  2L2S A;  3KAB A;  1J4H A;  2ZR5 A;  3O5M A;  4MNM A;  2ESC A;  3VAW A;  3ARP A;  1U79 A;  3NRK A;  5HW8 A;  3FXY A;  3RM4 A;  3AS1 A;  1HKI A;  2MLZ A;  1Q1C A;  1PBK A;  3B9E A;  2ITK A;  1KFW A;  3JXV A;  2A3A A;  2G8Z A;  1ROU A;  2Q5A A;  4W9Q A;  2PPN A;  1GUV A;  3JYJ A;  1O6I A;  1X6N A;  4Z2G A;  2WK2 A;  3ARX A;  5DIT A;  1Y0O A;  3FAP A;  4NSB A;  4DIP A;  5BXJ A;  3H9R B;  4G50 A;  4WIW A;  4NZC A;  4ODO A;  4BF8 A;  4DWS C;  4J4N A;  4GIV A;  2A3E A;  3OOB A;  4JFM A;  1ZK6 A;  3QOK A;  3WQW A;  3PRA A;  1W1Y A;  1W9V A;  2A3B A;  1LG1 A;  4MNL A;  1W9U A;  4FN2 A;  1FKF A;  3WD0 A;  1LL6 A;  2OFN A;  1W26 A;  2O9O A;  4MNK A;  4ZPW R;  2F2D A;  1E9L A;  3PR9 A;  2PV3 A;  4HBE A;  4DRQ A;  4XAK A;  2IUZ A;  1F40 A;  3O5I A;  1NMW A;  2Y78 A;  3ARW A;  2DG3 A;  4JFK A;  3CHC A;  2WLY A;  3ARS A;  1JNS A;  3UF8 A;  4DZ3 A;  1ROT A;  4LAV A;  1NH6 A;  3WD4 A;  2RQS A;  1FKB A;  1ZU8 A;  2FKE A;  2PI6 A;  3O5L A;  2AOS A;  2MPH A;  3UQA A;  4J4O A;  4MSP A;  2KR7 A;  1HKK A;  2N87 A;  2PPO A;  4DRO A;  3UI5 A;  2MLY A;  4MTV A;  1FKJ A;  4MPK A;  1EYM A;  5HWC A;  3KAG A;  2PPP A;  2K8I A;  1C9H A;  2DSV A;  1Q6H A;  3RM8 A;  2MF9 A;  1KT1 A;  3O5R A;  4KQZ A;  2AWG A;  2WLZ A;  2DT3 A;  3WL0 A;  1KT0 A;  5GPG A;  2XPA A;  2ZQV A;  4ODK A;  2VCD A;  3LUO A;  4TX0 A;  4DRI A;  1HJW A;  4DWS B;  4U84 A;  5GPR A;  1Q6I A;  1JND A;  2IF4 A;  3CHD A;  3G6M A;  1XRV A;  3PRD A;  4Q7N A;  4QZV B;  3RME A;  3NI6 A;  1FKK A;  4W5U A;  3WIJ A;  4ODP A;  3O5K A;  1GPF A;  4LAW A;  5HKG A;  4WKA A;  1HJV A;  1FAP A;  4TW8 A;  2XP6 A;  4URI A;  4JYS A;  4W9P A;  2RUD A;  5HW7 A;  2DT0 A;  2FAP A;  4AY1 A;  1Q6U A;  1ZBK A;  3JYM A;  3ODK A;  2KO7 A;  4Q22 A;  4ML4 A;  4P8W A;  2DT1 A;  3TC5 A;  1QPL A;  2LPV A;  4Z2K A;  2O92 A;  4L3N A;  1E6R A;  1UR9 A;  3O5Q A;  4DZ2 A;  3UI6 A;  1EIB A;  1ZBC A;  5DIU A;  1ZCN A;  2ZR6 A;  1H0I A;  2B31 A;  1SYT A;  3CHE A;  1D7J A;  1FKL A;  2RUC A;  3O5F A;  1H0G A;  1UR8 A;  4MAV A;  3MDY B;  4DH0 A;  1NWU A;  1JNT A;  1OWQ A;  4NNR A;  4N19 A;  4U86 A;  2XPB A;  1K9T A;  4HBO A;  2LGO A;  2ZQS A;  1ZL1 A;  3GPK A;  4TNS A;  3IK8 A;  3WD1 A;  1F8A B;  1FKG A;  2M08 A;  2XP9 A;  3O5D A;  1FD9 A;  2ZQT A;  4W9O A;  4LAX A;  4ZPT R;  2XP4 A;  4ZS6 A;  5GQB A;  1HKM A;  4IT6 A;  4L72 B;  1T11 A;  3TCZ A;  2FDM A;  1FFR A;  1NWR A;  1LL7 A;  1TCO C;  1RD6 A;  2DSZ A;  1HJX A;  4S3K A;  1VF8 A;  1W1P A;  4ODR A;  5DIV A;  1YW5 A;  1EDQ A;  1HKJ A;  2LKN A;  3KAH A;  1HXV A;  2YBU A;  4P8V A;  1FKD A;  4LGX A;  1B6C A;  3WQV A;  4QT3 A;  1QPF A;  1NMV A;  2XP5 A;  3CGM A;  1FFQ A;  4WK9 A;  4G2P A;  3O5G A;  2PBC A;  1D6O A;  4DRN A;  1FKH A;  1X6L A;  1W1T A;  3ARO A;  3EY6 A;  1D7I A;  1TFV A;  4QT2 A;  5HTG A;  3AQU A;  1WB0 A;  4TW6 A;  4IPX A;  2F21 A;  2ZQU A;  4DRK A;  5DEZ A;  3O5E A;  1ZBV A;  3ALG A;  3UQI A;  1IX5 A;  2KI3 A;  3O5P A;  3KAD A;  4JFL A;  3B9A A;  1J4I A;  3KAC A;  3OA5 A;  4JFJ A;  3BXW A;  3ARV A;  3ARU A;  4FAP A;  5HW6 A;  1LG2 A;  2DSW A;  1BL4 A;  1NSG A;  2RSE A;  4ODL A;  1ITX A;  4R0X A;  3B9D A;  1WNO A;  1WAW A;  2MLX A;  3AS2 A;  3KZ7 A;  4S3J A;  5HBF A;  1M5Y A;  4LAY A;  5HT1 A;  1E6P A;  4TYO A;  1BKF A;  3IHZ A;  2OLH A;  4KR0 B;  1N1A A;  1R9H A;  4GGQ A;  3PRB A;  2LJ4 A;  3RFW A;  2DG9 A;  5I98 A;  1NWS A;  1YAT A;  1SR0 A;  2M2A A;  1JVW A;  4ODM A;  1JNE A;  4DWS A;  4Z2H A;  4R5E A;  3NTP A;  1CTN A;  1FKR A;  1E15 A;  4U85 A;  4DRH A;  4Z2L A;  1ZB5 A;  3O5J A;  4HAR A;  2JZV A;  2XP3 A;  1FKI A;  4C02 B;  3KAF A;  4PTM A;  3IKG A;  4DRP A;  2G41 A;  1E6Z A;  4IT4 A;  5D75 A;  4WKF A;  4WJX A;  3CH9 A;  4DT4 A;  1ZBW A;  3O5O A;  1LJY A;  1P5Q A;  3ART A;  4P8U A;  2D9F A;  1XHG A;  3ARQ A;  2WM0 A;  4DWS D;  3UQB A;  1E6N A;  4Z2J A;  2UZ5 A;  1A7X A;  3WH0 A;  3PA7 A;  1LQ0 A;  3WD2 A;  4DRM A;  3ARZ A;  3ALF A;  1OGB A;  2KFW A;  4ITZ A;  1EQ3 A;  3UI4 A;  4JFI A;  5HUA A;  4ODN A;  4P8X A;  4DRJ A;  3W4R A;  1FJD A;  2RUR A;  1NWT A;  2M1I A;  1J6Y A;  1W1V A;  2DG4 A;  4ZPV R;  1GOI A;  2QF8 A;  1OGG A;  5HWB A;  2DSU A;  1LL4 A;  4TW7 A;  1J4R A;  5DF0 A;  3FY1 A;  1EHN A;  2DPE A;  3CGN A;  4Z2I A;  5B8I C;  2KGJ A;  4O2T A;  2PV2 A;  2ZR4 A;  3RGC A;  2VN1 A;  4ODQ A;  4IQ2 A;  1L1P A;  2DT2 A;  1D7H A;  2MNT A;  3WD3 A;  3B7X A;  4MNJ A;  4WKH A;  3CZ8 A;  1FKT A;  3ARY A;  3TDB A;  2A3C A;  2F4E A;  2RUQ A;  3G6L A;  3WL1 A;  1W9P A;  3KCE A;  5J6E A;  5JH8 A;  4QIB A;  1PIN A;  3KAI A;  2PV1 A;  1QZ2 A;  1D2K A;  2XP7 A;  3RM9 A;  3WKZ A;  3AS0 A;  2KE0 A;  5DO2 A;  3I6C A;  4MGV A;  2YBT A;  3IKD A;  4IQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...