3IK8A

Structure-based design of novel pin1 inhibitors (i)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
113
structure length
113
Chain Sequence
EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of novel human Pin1 inhibitors (I).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 37
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3ik8A00
4W9OA 4DRNA 2XP4A 4TX0A 2KE0A 3UF8A 4ODKA 2F4EA 5D75A 4N19A 1NMWA 3TCZA 3KCEA 2KFWA 2XP6A 2MLZA 4JFKA 4ODOA 4QIBA 4QT2A 3RFWA 1EQ3A 3PRBA 4U85A 2RSEA 1J4HA 1D7JA 3GPKA 1QZ2A 3O5MA 4J4OA 1FKLA 1EYMA 2VN1A 3KAIA 1D7HA 2JZVA 5DITA 4O2TA 1ZCNA 4JFMA 5DIUA 5BXJA 4ODNA 2VCDA 4IPXA 2AWGA 2PV2A 3I6CA 4IQ2A 5DIVA 3TDBA 2OFNA 3UI4A 1JVWA 4GGQA 5J6EA 2D9FA 4DRQA 2M08A 5HW8A 3O5FA 2XPBA 4G50A 3KAHA 1JNSA 1Q6UA 3NI6A 3O5PA 1J6YA 1L1PA 3JXVA 4IQCA 1FKSA 4ODRA 1HXVA 1FKFA 2F2DA 2Y78A 5I98A 2M2AA 1QPLA 4JFLA 4ODQA 3H9RB 2PPOA 3EY6A 4FAPA 2XP9A 3TC5A 1JNTA 2LJ4A 2FAPA 1P5QA 2MF9A 4MSPA 4U86A 4BF8A 5B8IC 2UZ5A 3RGCA 3B7XA 4TW7A 2KI3A 2F21A 2FKEA 3PRDA 3IHZA 3O5LA 3O5KA 4TW8A 3UQBA 3KABA 2RURA 4W9QA 4DT4A 2KR7A 1FKBA 2PPPA 1FKKA 2RQSA 4ITZA 4FN2A 1FKHA 1W26A 2XP8A 1KT1A 2PV1A 1F8AB 1QPFA 3O5QA 5GPGA 4ODMA 2Q5AA 2ZQSA 3NRKA 1FJDA 3O5JA 2MPHA 2PBCA 4DRPA 3PA7A 5HW7A 4LAWA 3UI5A 3JYMA 3CGMA 5HWBA 1C9HA 3IK8A 4JFIA 4DRKA 1U79A 1ZK6A 2ITKA 3O5IA 1BKFA 3MDYB 1PINA 1ROTA 2XP7A 3NTPA 4ODLA 3O5RA 2RUCA 1ROUA 4DIPA 2MLXA 4JFJA 1B6CA 3FAPA 2L2SA 2LKNA 3KAFA 4MGVA 1FKGA 3ODKA 5HT1A 2PV3A 1D6OA 3WH0A 4DRIA 4JYSA 2KGJA 1KT0A 2MNTA 3KADA 1FKTA 4DRMA 2N87A 2ZQVA 1FKJA 4LAXA 4R0XA 3KZ7A 4U84A 4W9PA 2ZR6A 3OOBA 3KACA 3UQIA 4DZ3A 1NMVA 3IKGA 2DG9A 2IF4A 1FAPA 4LAVA 2ZR5A 1A7XA 4C02B 5HW6A 1Y0OA 5HKGA 1PBKA 2LPVA 1FKDA 4TYOA 1R9HA 4ODPA 2K8IA 2DG3A 3O5GA 3O5OA 4GIVA 1J4RA 1BL4A 1FD9A 2ZQTA 3IKDA 4DROA 3LUOA 1Q1CA 1D7IA 4NNRA 2XP3A 1T11A 4DZ2A 1F40A 3O5DA 4TNSA 4G2PA 4J4NA 3UQAA 3JYJA 2RUQA 2LGOA 5HUAA 2RUDA 1M5YA 5HWCA 3VAWA 2DG4A 4DH0A 2PPNA 1NSGA 2XP5A 3CGNA 1FKRA 2ZR4A 2MLYA 4LAYA 5HTGA 1J4IA 3UI6A 2M1IA 1N1AA 4DRHA 3O5EA 1YW5A 3KAGA 4TW6A 1TCOC 4DRJA 2XPAA 1YATA 1FKIA 2KO7A 1Q6HA 2ZQUA 4QT3A 1Q6IA
chains in the Genus database with same CATH superfamily
3UF8A 4Z2GA 5GQBA 5D75A 4N19A 3TCZA 1W1TA 3ARVA 3PRBA 4U85A 2RSEA 1J4HA 1D7JA 1W1VA 3GPKA 1E9LA 3ARTA 1D7HA 5DITA 4O2TA 4JFMA 5DIUA 1NWUA 1CTNA 2ESCA 3I6CA 3FXYA 1ZU8A 3TDBA 2AOSA 3UI4A 5J6EA 5HW8A 3KAHA 4Z2HA 3QOKA 3O5PA 1J6YA 3ARRA 4WKFA 3JXVA 2WLZA 4MNMA 4IQCA 4ODRA 2A3CA 2F2DA 4PTMA 3RM9A 4WKAA 3WD3A 4JFLA 4ODQA 3H9RB 1H0IA 2PPOA 4FAPA 3TC5A 2LJ4A 2O92A 1LJYA 4U86A 4BF8A 2UZ5A 3RGCA 1ZBWA 1XRVA 2DSVA 2FKEA 3O5KA 4DWSD 2DSWA 2RURA 1FFRA 1FKKA 4ZPTR 4ITZA 2A3BA 3AS0A 2DT0A 5DF0A 3ARYA 5HWBA 1C9HA 1ZB5A 1ZK6A 3MDYB 1PINA 1W9UA 1XHGA 2L2SA 5HT1A 3WH0A 5GPRA 1JNEA 4MNLA 3KACA 3G6LA 1LL4A 3IKGA 4LAVA 5JH8A 1A7XA 4C02B 1Y0OA 1PBKA 1SYTA 4TYOA 1R9HA 4ODPA 2DG3A 2DT1A 3PRAA 4GIVA 1D7IA 3ARPA 4TNSA 3B9AA 1EHNA 1WB0A 2LGOA 2RUDA 4HARA 3VAWA 2XP5A 1NSGA 3CGNA 2DT3A 4UDMA 2F23A 2M1IA 4DRHA 3O5EA 3WD0A 1TCOC 3WQVA 1WAWA 3OA5A 4Z2IA 3WD4A 4P8UA 3ALGA 3PR9A 2ETNA 1RD6A 1NMWA 2B5UB 1HJWA 3KCEA 4P8WA 2XP6A 2MLZA 4JFKA 4ODOA 4QT2A 4MPKA 5HBFA 2FDMA 1FKLA 2VN1A 4S3JA 1ZCNA 4ODNA 2VCDA 4IPXA 1ITXA 4IQ2A 1VF8A 3ARUA 3ARXA 2DSUA 4KQZA 4G50A 1JNDA 1E6NA 1HXVA 1FKFA 4IT6A 1K9TA 1QPLA 1ZL1A 4Q7NA 3EY6A 2DPEA 1JNTA 3RM8A 4MTVA 4MSPA 1W9VA 4TW7A 2KI3A 1W1PA 3ARZA 4DT4A 4ZS6A 2DSZA 4FN2A 1W26A 1ZBCA 4HBOA 2PV1A 1F8AB 4ODMA 3O5JA 2O9OA 3PA7A 1U79A 1ROTA 2XP7A 1FFQA 4WIWA 3ARSA 1B6CA 2LKNA 2KGJA 4WKHA 3GU0A 4W9PA 1HJXA 3OOBA 1NMVA 3ALFA 3BMBA 3CHFA 2QF8A 4MNJA 1HJVA 1HKJA 4KR0B 3IKDA 1FD9A 3CH9A 2IUZA 3B8SA 3B9EA 1F40A 3JYJA 5HWCA 2DG4A 2PPNA 5DEZA 5HTGA 3UI6A 3W4RA 1OGBA 3AQUA 3CHCA 1HKIA 3ARWA 4TW6A 1E6ZA 1D2KA 1NWTA 1ZBVA 2ZQUA 1LQ0A 1LG1A 2KE0A 4ODKA 4P8VA 4W5UA 3O5MA 4J4OA 1UR9A 1LL7A 4WK9A 4DWSA 2AWGA 1IX5A 5DIVA 2OFNA 4GGQA 2D9FA 3CHEA 4MNKA 3O5FA 1Q6UA 3NI6A 2WK2A 5DO2A 1FKSA 2Y78A 2M2AA 1GPFA 3RM4A 3WKZA 2XP9A 1E15A 2FAPA 1P5QA 3AS2A 1KFWA 1H0GA 3B7XA 1EDQA 3IHZA 3ARQA 3UQBA 2RQSA 1HKMA 1KT1A 3B9DA 1QPFA 3CHDA 2A3AA 2Q5AA 2ZQSA 3NRKA 4L72B 1FJDA 4LAWA 3UI5A 4WJXA 3JYMA 3CGMA 4DWSB 2G8ZA 4DRKA 2ITKA 1BKFA 4ODLA 1ROUA 4DIPA 4DWSC 4Q22A 4URIA 3FAPA 1FKGA 4JYSA 1KT0A 3KADA 1ZBKA 2ZQVA 1FKJA 4U84A 4R5EA 4DZ3A 3UQIA 2DT2A 1FAPA 2LPVA 1E6RA 1LG2A 3O5GA 3WIJA 3O5OA 4Z2JA 1J4RA 4DROA 3LUOA 2XP3A 3O5DA 4G2PA 2B31A 1NH6A 1EIBA 5HUAA 1SR0A 1LL6A 1OGGA 3G6MA 2MLYA 4HBEA 1N1AA 1E44A 1YW5A 3KAGA 4NZCA 1FKIA 2KO7A 1Q6HA 4QT3A 1O6IA 4W9OA 4DRNA 2XP4A 4TX0A 4AY1A 2F4EA 4L3NA 2KFWA 4QIBA 4ML4A 3RFWA 1EQ3A 1QZ2A 4IT4A 4S3KA 1EYMA 3KAIA 2JZVA 3FY1A 2PI6A 3WL1A 5BXJA 2PV2A 1JVWA 1GRJA 4DRQA 2M08A 2XPBA 1JNSA 2EULA 4QZVB 4ZPWR 1L1PA 4P8XA 3WD2A 2WLYA 5I98A 2PN0A 4NSBA 3RMEA 3WQWA 2MF9A 3EIPA 2G41A 2F21A 1NWSA 3PRDA 1WNOA 3O5LA 1GUVA 1JCHB 4TW8A 3KABA 4W9QA 2KR7A 1FKBA 2PPPA 1FKHA 1E6PA 2XP8A 3AS3A 2WM0A 3O5QA 5GPGA 1X6NA 4MAVA 3GTYX 2MPHA 2PBCA 4DRPA 5HW7A 2OLHA 3IK8A 4JFIA 2YBTA 3O5IA 3NTPA 4Z2LA 3O5RA 2RUCA 3WL0A 2MLXA 2YBUA 4JFJA 3AROA 3CZ8A 4XAKA 4Z2KA 3KAFA 4MGVA 4DRIA 3ODKA 2PV3A 1D6OA 2MNTA 4DRMA 1FKTA 2N87A 4R0XA 4LAXA 5B8IC 3KZ7A 2ZR6A 2DG9A 2IF4A 2ZR5A 5HW6A 5HKGA 1FKDA 2K8IA 1OWQA 1BL4A 2ZQTA 1X6LA 3WD1A 1Q1CA 4LGXA 4NNRA 1T11A 4DZ2A 3AS1A 4J4NA 3UQAA 2RUQA 1M5YA 1GOIA 1HKKA 1W9PA 4DH0A 1UR8A 1FKRA 1TFVA 2ZR4A 4LAYA 1J4IA 1NWRA 1W1YA 4ZPVR 3BXWA 4DRJA 2XPAA 1YATA 2A3EA 1Q6IA 2P4VA
chains in the Genus database with same CATH topology
3UF8A 4Z2GA 5GQBA 5D75A 4N19A 3TCZA 1W1TA 3ARVA 3PRBA 4U85A 2RSEA 1J4HA 1D7JA 1W1VA 3GPKA 1E9LA 3ARTA 1D7HA 5DITA 4O2TA 4JFMA 5DIUA 1NWUA 1CTNA 2ESCA 3I6CA 3FXYA 1ZU8A 3TDBA 2AOSA 3UI4A 5J6EA 5HW8A 3KAHA 4Z2HA 3QOKA 3O5PA 1J6YA 3ARRA 4WKFA 3JXVA 2WLZA 4MNMA 4IQCA 4ODRA 2A3CA 2F2DA 4PTMA 3RM9A 4WKAA 3WD3A 4JFLA 4ODQA 3H9RB 1H0IA 2PPOA 4FAPA 3TC5A 2LJ4A 2O92A 1LJYA 4U86A 4BF8A 2UZ5A 3RGCA 1ZBWA 1XRVA 2DSVA 2FKEA 3O5KA 4DWSD 2DSWA 2RURA 1FFRA 1FKKA 4ZPTR 4ITZA 2A3BA 3AS0A 2DT0A 5DF0A 3ARYA 5HWBA 1C9HA 1ZB5A 1ZK6A 3MDYB 1PINA 1W9UA 1XHGA 2L2SA 5HT1A 3WH0A 5GPRA 1JNEA 4MNLA 3KACA 3G6LA 1LL4A 3IKGA 4LAVA 5JH8A 1A7XA 4C02B 1Y0OA 1PBKA 1SYTA 4TYOA 1R9HA 4ODPA 2DG3A 2DT1A 3PRAA 4GIVA 1D7IA 3ARPA 4TNSA 3B9AA 1EHNA 1WB0A 2LGOA 2RUDA 4HARA 3VAWA 2XP5A 1NSGA 3CGNA 2DT3A 2M1IA 4DRHA 3O5EA 3WD0A 1TCOC 3WQVA 1WAWA 3OA5A 4Z2IA 3WD4A 4P8UA 3ALGA 3PR9A 1RD6A 1NMWA 3KCEA 1HJWA 4P8WA 2XP6A 2MLZA 4JFKA 4ODOA 4QT2A 4MPKA 5HBFA 2FDMA 1FKLA 2VN1A 4S3JA 1ZCNA 4ODNA 2VCDA 4IPXA 1ITXA 4IQ2A 1VF8A 3ARUA 3ARXA 2DSUA 4KQZA 4G50A 1JNDA 1E6NA 1HXVA 1FKFA 4IT6A 1K9TA 1QPLA 1ZL1A 4Q7NA 3EY6A 2DPEA 1JNTA 3RM8A 4MTVA 4MSPA 1W9VA 4TW7A 2KI3A 1W1PA 3ARZA 4DT4A 4ZS6A 2DSZA 4FN2A 1W26A 1ZBCA 4HBOA 2PV1A 1F8AB 4ODMA 3O5JA 2O9OA 3PA7A 1U79A 1ROTA 2XP7A 1FFQA 4WIWA 3ARSA 1B6CA 2LKNA 2KGJA 4WKHA 4W9PA 1HJXA 3OOBA 1NMVA 3ALFA 3CHFA 2QF8A 4MNJA 1HJVA 1HKJA 4KR0B 3IKDA 1FD9A 3CH9A 2IUZA 3B8SA 3B9EA 1F40A 3JYJA 5HWCA 2DG4A 2PPNA 5DEZA 5HTGA 3UI6A 3W4RA 1OGBA 3AQUA 3CHCA 1HKIA 3ARWA 4TW6A 1E6ZA 1D2KA 1NWTA 1ZBVA 2ZQUA 1LQ0A 1LG1A 2KE0A 4ODKA 4P8VA 4W5UA 3O5MA 4J4OA 1UR9A 1LL7A 4WK9A 4DWSA 2AWGA 1IX5A 5DIVA 2OFNA 4GGQA 2D9FA 3CHEA 4MNKA 3O5FA 1Q6UA 3NI6A 2WK2A 5DO2A 1FKSA 2Y78A 2M2AA 1GPFA 3RM4A 3WKZA 2XP9A 1E15A 2FAPA 1P5QA 3AS2A 1KFWA 1H0GA 3B7XA 1EDQA 3IHZA 3ARQA 3UQBA 2RQSA 1HKMA 1KT1A 3B9DA 1QPFA 3CHDA 2A3AA 2Q5AA 2ZQSA 3NRKA 4L72B 1FJDA 4LAWA 3UI5A 4WJXA 3JYMA 3CGMA 4DWSB 2G8ZA 4DRKA 2ITKA 1BKFA 4ODLA 1ROUA 4DIPA 4DWSC 4Q22A 4URIA 3FAPA 1FKGA 4JYSA 1KT0A 3KADA 1ZBKA 2ZQVA 1FKJA 4U84A 4R5EA 4DZ3A 3UQIA 2DT2A 1FAPA 2LPVA 1E6RA 1LG2A 3O5GA 3WIJA 3O5OA 4Z2JA 1J4RA 4DROA 3LUOA 2XP3A 3O5DA 4G2PA 2B31A 1NH6A 1EIBA 5HUAA 1SR0A 1LL6A 1OGGA 3G6MA 2MLYA 4HBEA 1N1AA 1YW5A 3KAGA 4NZCA 1FKIA 2KO7A 1Q6HA 4QT3A 1O6IA 4W9OA 4DRNA 2XP4A 4TX0A 4AY1A 2F4EA 4L3NA 2KFWA 4QIBA 4ML4A 3RFWA 1EQ3A 1QZ2A 4IT4A 4S3KA 1EYMA 3KAIA 2JZVA 3FY1A 2PI6A 3WL1A 5BXJA 2PV2A 1JVWA 4DRQA 2M08A 2XPBA 1JNSA 4QZVB 4ZPWR 1L1PA 4P8XA 3WD2A 2WLYA 5I98A 4NSBA 3RMEA 3WQWA 2MF9A 2G41A 2F21A 1NWSA 1WNOA 3PRDA 3O5LA 1GUVA 4TW8A 3KABA 4W9QA 2KR7A 1FKBA 2PPPA 1FKHA 1E6PA 2XP8A 3AS3A 2WM0A 3O5QA 5GPGA 1X6NA 4MAVA 2MPHA 2PBCA 4DRPA 5HW7A 2OLHA 3IK8A 4JFIA 2YBTA 3O5IA 3NTPA 4Z2LA 3O5RA 2RUCA 3WL0A 2MLXA 2YBUA 4JFJA 3AROA 3CZ8A 4XAKA 4Z2KA 3KAFA 4MGVA 4DRIA 3ODKA 2PV3A 1D6OA 2MNTA 4DRMA 1FKTA 2N87A 4R0XA 4LAXA 5B8IC 3KZ7A 2ZR6A 2DG9A 2IF4A 2ZR5A 5HW6A 5HKGA 1FKDA 2K8IA 1OWQA 1BL4A 2ZQTA 1X6LA 3WD1A 1Q1CA 4LGXA 4NNRA 1T11A 4DZ2A 3AS1A 4J4NA 3UQAA 2RUQA 1M5YA 1GOIA 1HKKA 1W9PA 4DH0A 1UR8A 1FKRA 1TFVA 2ZR4A 4LAYA 1J4IA 1NWRA 1W1YA 4ZPVR 3BXWA 4DRJA 2XPAA 1YATA 2A3EA 1Q6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9O A;  4DRN A;  2XP4 A;  4TX0 A;  2KE0 A;  3UF8 A;  4ODK A;  2F4E A;  5D75 A;  4N19 A;  1NMW A;  3TCZ A;  3KCE A;  2KFW A;  2XP6 A;  2MLZ A;  4JFK A;  4ODO A;  4QIB A;  4QT2 A;  3RFW A;  1EQ3 A;  3PRB A;  4U85 A;  2RSE A;  1J4H A;  1D7J A;  3GPK A;  1QZ2 A;  3O5M A;  4J4O A;  1FKL A;  1EYM A;  2VN1 A;  3KAI A;  1D7H A;  2JZV A;  5DIT A;  4O2T A;  1ZCN A;  4JFM A;  5DIU A;  5BXJ A;  4ODN A;  2VCD A;  4IPX A;  2AWG A;  2PV2 A;  3I6C A;  4IQ2 A;  5DIV A;  3TDB A;  2OFN A;  3UI4 A;  1JVW A;  4GGQ A;  5J6E A;  2D9F A;  4DRQ A;  2M08 A;  5HW8 A;  3O5F A;  2XPB A;  4G50 A;  3KAH A;  1JNS A;  1Q6U A;  3NI6 A;  3O5P A;  1J6Y A;  1L1P A;  3JXV A;  4IQC A;  1FKS A;  4ODR A;  1HXV A;  1FKF A;  2F2D A;  2Y78 A;  5I98 A;  2M2A A;  1QPL A;  4JFL A;  4ODQ A;  3H9R B;  2PPO A;  3EY6 A;  4FAP A;  2XP9 A;  3TC5 A;  1JNT A;  2LJ4 A;  2FAP A;  1P5Q A;  2MF9 A;  4MSP A;  4U86 A;  4BF8 A;  5B8I C;  2UZ5 A;  3RGC A;  3B7X A;  4TW7 A;  2KI3 A;  2F21 A;  2FKE A;  3PRD A;  3IHZ A;  3O5L A;  3O5K A;  4TW8 A;  3UQB A;  3KAB A;  2RUR A;  4W9Q A;  4DT4 A;  2KR7 A;  1FKB A;  2PPP A;  1FKK A;  2RQS A;  4ITZ A;  4FN2 A;  1FKH A;  1W26 A;  2XP8 A;  1KT1 A;  2PV1 A;  1F8A B;  1QPF A;  3O5Q A;  5GPG A;  4ODM A;  2Q5A A;  2ZQS A;  3NRK A;  1FJD A;  3O5J A;  2MPH A;  2PBC A;  4DRP A;  3PA7 A;  5HW7 A;  4LAW A;  3UI5 A;  3JYM A;  3CGM A;  5HWB A;  1C9H A;  3IK8 A;  4JFI A;  4DRK A;  1U79 A;  1ZK6 A;  2ITK A;  3O5I A;  1BKF A;  3MDY B;  1PIN A;  1ROT A;  2XP7 A;  3NTP A;  4ODL A;  3O5R A;  2RUC A;  1ROU A;  4DIP A;  2MLX A;  4JFJ A;  1B6C A;  3FAP A;  2L2S A;  2LKN A;  3KAF A;  4MGV A;  1FKG A;  3ODK A;  5HT1 A;  2PV3 A;  1D6O A;  3WH0 A;  4DRI A;  4JYS A;  2KGJ A;  1KT0 A;  2MNT A;  3KAD A;  1FKT A;  4DRM A;  2N87 A;  2ZQV A;  1FKJ A;  4LAX A;  4R0X A;  3KZ7 A;  4U84 A;  4W9P A;  2ZR6 A;  3OOB A;  3KAC A;  3UQI A;  4DZ3 A;  1NMV A;  3IKG A;  2DG9 A;  2IF4 A;  1FAP A;  4LAV A;  2ZR5 A;  1A7X A;  4C02 B;  5HW6 A;  1Y0O A;  5HKG A;  1PBK A;  2LPV A;  1FKD A;  4TYO A;  1R9H A;  4ODP A;  2K8I A;  2DG3 A;  3O5G A;  3O5O A;  4GIV A;  1J4R A;  1BL4 A;  1FD9 A;  2ZQT A;  3IKD A;  4DRO A;  3LUO A;  1Q1C A;  1D7I A;  4NNR A;  2XP3 A;  1T11 A;  4DZ2 A;  1F40 A;  3O5D A;  4TNS A;  4G2P A;  4J4N A;  3UQA A;  3JYJ A;  2RUQ A;  2LGO A;  5HUA A;  2RUD A;  1M5Y A;  5HWC A;  3VAW A;  2DG4 A;  4DH0 A;  2PPN A;  1NSG A;  2XP5 A;  3CGN A;  1FKR A;  2ZR4 A;  2MLY A;  4LAY A;  5HTG A;  1J4I A;  3UI6 A;  2M1I A;  1N1A A;  4DRH A;  3O5E A;  1YW5 A;  3KAG A;  4TW6 A;  1TCO C;  4DRJ A;  2XPA A;  1YAT A;  1FKI A;  2KO7 A;  1Q6H A;  2ZQU A;  4QT3 A;  1Q6I A; 
#chains in the Genus database with same CATH topology
 3UF8 A;  4Z2G A;  5GQB A;  5D75 A;  4N19 A;  3TCZ A;  1W1T A;  3ARV A;  3PRB A;  4U85 A;  2RSE A;  1J4H A;  1D7J A;  1W1V A;  3GPK A;  1E9L A;  3ART A;  1D7H A;  5DIT A;  4O2T A;  4JFM A;  5DIU A;  1NWU A;  1CTN A;  2ESC A;  3I6C A;  3FXY A;  1ZU8 A;  3TDB A;  2AOS A;  3UI4 A;  5J6E A;  5HW8 A;  3KAH A;  4Z2H A;  3QOK A;  3O5P A;  1J6Y A;  3ARR A;  4WKF A;  3JXV A;  2WLZ A;  4MNM A;  4IQC A;  4ODR A;  2A3C A;  2F2D A;  4PTM A;  3RM9 A;  4WKA A;  3WD3 A;  4JFL A;  4ODQ A;  3H9R B;  1H0I A;  2PPO A;  4FAP A;  3TC5 A;  2LJ4 A;  2O92 A;  1LJY A;  4U86 A;  4BF8 A;  2UZ5 A;  3RGC A;  1ZBW A;  1XRV A;  2DSV A;  2FKE A;  3O5K A;  4DWS D;  2DSW A;  2RUR A;  1FFR A;  1FKK A;  4ZPT R;  4ITZ A;  2A3B A;  3AS0 A;  2DT0 A;  5DF0 A;  3ARY A;  5HWB A;  1C9H A;  1ZB5 A;  1ZK6 A;  3MDY B;  1PIN A;  1W9U A;  1XHG A;  2L2S A;  5HT1 A;  3WH0 A;  5GPR A;  1JNE A;  4MNL A;  3KAC A;  3G6L A;  1LL4 A;  3IKG A;  4LAV A;  5JH8 A;  1A7X A;  4C02 B;  1Y0O A;  1PBK A;  1SYT A;  4TYO A;  1R9H A;  4ODP A;  2DG3 A;  2DT1 A;  3PRA A;  4GIV A;  1D7I A;  3ARP A;  4TNS A;  3B9A A;  1EHN A;  1WB0 A;  2LGO A;  2RUD A;  4HAR A;  3VAW A;  2XP5 A;  1NSG A;  3CGN A;  2DT3 A;  4UDM A;  2F23 A;  2M1I A;  4DRH A;  3O5E A;  3WD0 A;  1TCO C;  3WQV A;  1WAW A;  3OA5 A;  4Z2I A;  3WD4 A;  4P8U A;  3ALG A;  3PR9 A;  2ETN A;  1RD6 A;  1NMW A;  2B5U B;  1HJW A;  3KCE A;  4P8W A;  2XP6 A;  2MLZ A;  4JFK A;  4ODO A;  4QT2 A;  4MPK A;  5HBF A;  2FDM A;  1FKL A;  2VN1 A;  4S3J A;  1ZCN A;  4ODN A;  2VCD A;  4IPX A;  1ITX A;  4IQ2 A;  1VF8 A;  3ARU A;  3ARX A;  2DSU A;  4KQZ A;  4G50 A;  1JND A;  1E6N A;  1HXV A;  1FKF A;  4IT6 A;  1K9T A;  1QPL A;  1ZL1 A;  4Q7N A;  3EY6 A;  2DPE A;  1JNT A;  3RM8 A;  4MTV A;  4MSP A;  1W9V A;  4TW7 A;  2KI3 A;  1W1P A;  3ARZ A;  4DT4 A;  4ZS6 A;  2DSZ A;  4FN2 A;  1W26 A;  1ZBC A;  4HBO A;  2PV1 A;  1F8A B;  4ODM A;  3O5J A;  2O9O A;  3PA7 A;  1U79 A;  1ROT A;  2XP7 A;  1FFQ A;  4WIW A;  3ARS A;  1B6C A;  2LKN A;  2KGJ A;  4WKH A;  3GU0 A;  4W9P A;  1HJX A;  3OOB A;  1NMV A;  3ALF A;  3BMB A;  3CHF A;  2QF8 A;  4MNJ A;  1HJV A;  1HKJ A;  4KR0 B;  3IKD A;  1FD9 A;  3CH9 A;  2IUZ A;  3B8S A;  3B9E A;  1F40 A;  3JYJ A;  5HWC A;  2DG4 A;  2PPN A;  5DEZ A;  5HTG A;  3UI6 A;  3W4R A;  1OGB A;  3AQU A;  3CHC A;  1HKI A;  3ARW A;  4TW6 A;  1E6Z A;  1D2K A;  1NWT A;  1ZBV A;  2ZQU A;  1LQ0 A;  1LG1 A;  2KE0 A;  4ODK A;  4P8V A;  4W5U A;  3O5M A;  4J4O A;  1UR9 A;  1LL7 A;  4WK9 A;  4DWS A;  2AWG A;  1IX5 A;  5DIV A;  2OFN A;  4GGQ A;  2D9F A;  3CHE A;  4MNK A;  3O5F A;  1Q6U A;  3NI6 A;  2WK2 A;  5DO2 A;  1FKS A;  2Y78 A;  2M2A A;  1GPF A;  3RM4 A;  3WKZ A;  2XP9 A;  1E15 A;  2FAP A;  1P5Q A;  3AS2 A;  1KFW A;  1H0G A;  3B7X A;  1EDQ A;  3IHZ A;  3ARQ A;  3UQB A;  2RQS A;  1HKM A;  1KT1 A;  3B9D A;  1QPF A;  3CHD A;  2A3A A;  2Q5A A;  2ZQS A;  3NRK A;  4L72 B;  1FJD A;  4LAW A;  3UI5 A;  4WJX A;  3JYM A;  3CGM A;  4DWS B;  2G8Z A;  4DRK A;  2ITK A;  1BKF A;  4ODL A;  1ROU A;  4DIP A;  4DWS C;  4Q22 A;  4URI A;  3FAP A;  1FKG A;  4JYS A;  1KT0 A;  3KAD A;  1ZBK A;  2ZQV A;  1FKJ A;  4U84 A;  4R5E A;  4DZ3 A;  3UQI A;  2DT2 A;  1FAP A;  2LPV A;  1E6R A;  1LG2 A;  3O5G A;  3WIJ A;  3O5O A;  4Z2J A;  1J4R A;  4DRO A;  3LUO A;  2XP3 A;  3O5D A;  4G2P A;  2B31 A;  1NH6 A;  1EIB A;  5HUA A;  1SR0 A;  1LL6 A;  1OGG A;  3G6M A;  2MLY A;  4HBE A;  1N1A A;  1E44 A;  1YW5 A;  3KAG A;  4NZC A;  1FKI A;  2KO7 A;  1Q6H A;  4QT3 A;  1O6I A;  4W9O A;  4DRN A;  2XP4 A;  4TX0 A;  4AY1 A;  2F4E A;  4L3N A;  2KFW A;  4QIB A;  4ML4 A;  3RFW A;  1EQ3 A;  1QZ2 A;  4IT4 A;  4S3K A;  1EYM A;  3KAI A;  2JZV A;  3FY1 A;  2PI6 A;  3WL1 A;  5BXJ A;  2PV2 A;  1JVW A;  1GRJ A;  4DRQ A;  2M08 A;  2XPB A;  1JNS A;  2EUL A;  4QZV B;  4ZPW R;  1L1P A;  4P8X A;  3WD2 A;  2WLY A;  5I98 A;  2PN0 A;  4NSB A;  3RME A;  3WQW A;  2MF9 A;  3EIP A;  2G41 A;  2F21 A;  1NWS A;  3PRD A;  1WNO A;  3O5L A;  1GUV A;  1JCH B;  4TW8 A;  3KAB A;  4W9Q A;  2KR7 A;  1FKB A;  2PPP A;  1FKH A;  1E6P A;  2XP8 A;  3AS3 A;  2WM0 A;  3O5Q A;  5GPG A;  1X6N A;  4MAV A;  3GTY X;  2MPH A;  2PBC A;  4DRP A;  5HW7 A;  2OLH A;  3IK8 A;  4JFI A;  2YBT A;  3O5I A;  3NTP A;  4Z2L A;  3O5R A;  2RUC A;  3WL0 A;  2MLX A;  2YBU A;  4JFJ A;  3ARO A;  3CZ8 A;  4XAK A;  4Z2K A;  3KAF A;  4MGV A;  4DRI A;  3ODK A;  2PV3 A;  1D6O A;  2MNT A;  4DRM A;  1FKT A;  2N87 A;  4R0X A;  4LAX A;  5B8I C;  3KZ7 A;  2ZR6 A;  2DG9 A;  2IF4 A;  2ZR5 A;  5HW6 A;  5HKG A;  1FKD A;  2K8I A;  1OWQ A;  1BL4 A;  2ZQT A;  1X6L A;  3WD1 A;  1Q1C A;  4LGX A;  4NNR A;  1T11 A;  4DZ2 A;  3AS1 A;  4J4N A;  3UQA A;  2RUQ A;  1M5Y A;  1GOI A;  1HKK A;  1W9P A;  4DH0 A;  1UR8 A;  1FKR A;  1TFV A;  2ZR4 A;  4LAY A;  1J4I A;  1NWR A;  1W1Y A;  4ZPV R;  3BXW A;  4DRJ A;  2XPA A;  1YAT A;  2A3E A;  1Q6I A;  2P4V A; 
#chains in the Genus database with same CATH homology
 3UF8 A;  4Z2G A;  5GQB A;  5D75 A;  4N19 A;  3TCZ A;  1W1T A;  3ARV A;  3PRB A;  4U85 A;  2RSE A;  1J4H A;  1D7J A;  1W1V A;  3GPK A;  1E9L A;  3ART A;  1D7H A;  5DIT A;  4O2T A;  4JFM A;  5DIU A;  1NWU A;  1CTN A;  2ESC A;  3I6C A;  3FXY A;  1ZU8 A;  3TDB A;  2AOS A;  3UI4 A;  5J6E A;  5HW8 A;  3KAH A;  4Z2H A;  3QOK A;  3O5P A;  1J6Y A;  3ARR A;  4WKF A;  3JXV A;  2WLZ A;  4MNM A;  4IQC A;  4ODR A;  2A3C A;  2F2D A;  4PTM A;  3RM9 A;  4WKA A;  3WD3 A;  4JFL A;  4ODQ A;  3H9R B;  1H0I A;  2PPO A;  4FAP A;  3TC5 A;  2LJ4 A;  2O92 A;  1LJY A;  4U86 A;  4BF8 A;  2UZ5 A;  3RGC A;  1ZBW A;  1XRV A;  2DSV A;  2FKE A;  3O5K A;  4DWS D;  2DSW A;  2RUR A;  1FFR A;  1FKK A;  4ZPT R;  4ITZ A;  2A3B A;  3AS0 A;  2DT0 A;  5DF0 A;  3ARY A;  5HWB A;  1C9H A;  1ZB5 A;  1ZK6 A;  3MDY B;  1PIN A;  1W9U A;  1XHG A;  2L2S A;  5HT1 A;  3WH0 A;  5GPR A;  1JNE A;  4MNL A;  3KAC A;  3G6L A;  1LL4 A;  3IKG A;  4LAV A;  5JH8 A;  1A7X A;  4C02 B;  1Y0O A;  1PBK A;  1SYT A;  4TYO A;  1R9H A;  4ODP A;  2DG3 A;  2DT1 A;  3PRA A;  4GIV A;  1D7I A;  3ARP A;  4TNS A;  3B9A A;  1EHN A;  1WB0 A;  2LGO A;  2RUD A;  4HAR A;  3VAW A;  2XP5 A;  1NSG A;  3CGN A;  2DT3 A;  2M1I A;  4DRH A;  3O5E A;  3WD0 A;  1TCO C;  3WQV A;  1WAW A;  3OA5 A;  4Z2I A;  3WD4 A;  4P8U A;  3ALG A;  3PR9 A;  1RD6 A;  1NMW A;  3KCE A;  1HJW A;  4P8W A;  2XP6 A;  2MLZ A;  4JFK A;  4ODO A;  4QT2 A;  4MPK A;  5HBF A;  2FDM A;  1FKL A;  2VN1 A;  4S3J A;  1ZCN A;  4ODN A;  2VCD A;  4IPX A;  1ITX A;  4IQ2 A;  1VF8 A;  3ARU A;  3ARX A;  2DSU A;  4KQZ A;  4G50 A;  1JND A;  1E6N A;  1HXV A;  1FKF A;  4IT6 A;  1K9T A;  1QPL A;  1ZL1 A;  4Q7N A;  3EY6 A;  2DPE A;  1JNT A;  3RM8 A;  4MTV A;  4MSP A;  1W9V A;  4TW7 A;  2KI3 A;  1W1P A;  3ARZ A;  4DT4 A;  4ZS6 A;  2DSZ A;  4FN2 A;  1W26 A;  1ZBC A;  4HBO A;  2PV1 A;  1F8A B;  4ODM A;  3O5J A;  2O9O A;  3PA7 A;  1U79 A;  1ROT A;  2XP7 A;  1FFQ A;  4WIW A;  3ARS A;  1B6C A;  2LKN A;  2KGJ A;  4WKH A;  4W9P A;  1HJX A;  3OOB A;  1NMV A;  3ALF A;  3CHF A;  2QF8 A;  4MNJ A;  1HJV A;  1HKJ A;  4KR0 B;  3IKD A;  1FD9 A;  3CH9 A;  2IUZ A;  3B8S A;  3B9E A;  1F40 A;  3JYJ A;  5HWC A;  2DG4 A;  2PPN A;  5DEZ A;  5HTG A;  3UI6 A;  3W4R A;  1OGB A;  3AQU A;  3CHC A;  1HKI A;  3ARW A;  4TW6 A;  1E6Z A;  1D2K A;  1NWT A;  1ZBV A;  2ZQU A;  1LQ0 A;  1LG1 A;  2KE0 A;  4ODK A;  4P8V A;  4W5U A;  3O5M A;  4J4O A;  1UR9 A;  1LL7 A;  4WK9 A;  4DWS A;  2AWG A;  1IX5 A;  5DIV A;  2OFN A;  4GGQ A;  2D9F A;  3CHE A;  4MNK A;  3O5F A;  1Q6U A;  3NI6 A;  2WK2 A;  5DO2 A;  1FKS A;  2Y78 A;  2M2A A;  1GPF A;  3RM4 A;  3WKZ A;  2XP9 A;  1E15 A;  2FAP A;  1P5Q A;  3AS2 A;  1KFW A;  1H0G A;  3B7X A;  1EDQ A;  3IHZ A;  3ARQ A;  3UQB A;  2RQS A;  1HKM A;  1KT1 A;  3B9D A;  1QPF A;  3CHD A;  2A3A A;  2Q5A A;  2ZQS A;  3NRK A;  4L72 B;  1FJD A;  4LAW A;  3UI5 A;  4WJX A;  3JYM A;  3CGM A;  4DWS B;  2G8Z A;  4DRK A;  2ITK A;  1BKF A;  4ODL A;  1ROU A;  4DIP A;  4DWS C;  4Q22 A;  4URI A;  3FAP A;  1FKG A;  4JYS A;  1KT0 A;  3KAD A;  1ZBK A;  2ZQV A;  1FKJ A;  4U84 A;  4R5E A;  4DZ3 A;  3UQI A;  2DT2 A;  1FAP A;  2LPV A;  1E6R A;  1LG2 A;  3O5G A;  3WIJ A;  3O5O A;  4Z2J A;  1J4R A;  4DRO A;  3LUO A;  2XP3 A;  3O5D A;  4G2P A;  2B31 A;  1NH6 A;  1EIB A;  5HUA A;  1SR0 A;  1LL6 A;  1OGG A;  3G6M A;  2MLY A;  4HBE A;  1N1A A;  1YW5 A;  3KAG A;  4NZC A;  1FKI A;  2KO7 A;  1Q6H A;  4QT3 A;  1O6I A;  4W9O A;  4DRN A;  2XP4 A;  4TX0 A;  4AY1 A;  2F4E A;  4L3N A;  2KFW A;  4QIB A;  4ML4 A;  3RFW A;  1EQ3 A;  1QZ2 A;  4IT4 A;  4S3K A;  1EYM A;  3KAI A;  2JZV A;  3FY1 A;  2PI6 A;  3WL1 A;  5BXJ A;  2PV2 A;  1JVW A;  4DRQ A;  2M08 A;  2XPB A;  1JNS A;  4QZV B;  4ZPW R;  1L1P A;  4P8X A;  3WD2 A;  2WLY A;  5I98 A;  4NSB A;  3RME A;  3WQW A;  2MF9 A;  2G41 A;  2F21 A;  1NWS A;  1WNO A;  3PRD A;  3O5L A;  1GUV A;  4TW8 A;  3KAB A;  4W9Q A;  2KR7 A;  1FKB A;  2PPP A;  1FKH A;  1E6P A;  2XP8 A;  3AS3 A;  2WM0 A;  3O5Q A;  5GPG A;  1X6N A;  4MAV A;  2MPH A;  2PBC A;  4DRP A;  5HW7 A;  2OLH A;  3IK8 A;  4JFI A;  2YBT A;  3O5I A;  3NTP A;  4Z2L A;  3O5R A;  2RUC A;  3WL0 A;  2MLX A;  2YBU A;  4JFJ A;  3ARO A;  3CZ8 A;  4XAK A;  4Z2K A;  3KAF A;  4MGV A;  4DRI A;  3ODK A;  2PV3 A;  1D6O A;  2MNT A;  4DRM A;  1FKT A;  2N87 A;  4R0X A;  4LAX A;  5B8I C;  3KZ7 A;  2ZR6 A;  2DG9 A;  2IF4 A;  2ZR5 A;  5HW6 A;  5HKG A;  1FKD A;  2K8I A;  1OWQ A;  1BL4 A;  2ZQT A;  1X6L A;  3WD1 A;  1Q1C A;  4LGX A;  4NNR A;  1T11 A;  4DZ2 A;  3AS1 A;  4J4N A;  3UQA A;  2RUQ A;  1M5Y A;  1GOI A;  1HKK A;  1W9P A;  4DH0 A;  1UR8 A;  1FKR A;  1TFV A;  2ZR4 A;  4LAY A;  1J4I A;  1NWR A;  1W1Y A;  4ZPV R;  3BXW A;  4DRJ A;  2XPA A;  1YAT A;  2A3E A;  1Q6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...