3IK8A

Structure-based design of novel pin1 inhibitors (i)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
113
structure length
113
Chain Sequence
EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of novel human Pin1 inhibitors (I).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 37
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3ik8A00
2ITKA 5HKGA 1JNTA 1QPLA 4TW6A 2IF4A 2XPAA 4ODNA 3UI6A 1TCOC 2UZ5A 4ODQA 4BF8A 4ODKA 3O5GA 1JVWA 4FAPA 5J6EA 3KABA 4DRMA 3PRDA 2KE0A 3O5KA 2PV1A 2MPHA 4MSPA 2RQSA 3IHZA 4DROA 1D7HA 3O5IA 5HTGA 3RFWA 3JYMA 4DRIA 1M5YA 4ODRA 2RSEA 2XP3A 1PBKA 1J4IA 2RUQA 4JFIA 3KADA 2ZQSA 3O5OA 5D75A 1FKKA 1ZCNA 2KGJA 2AWGA 2XPBA 3B7XA 2MLYA 3NI6A 4J4OA 4JFKA 2RUCA 2XP6A 2KO7A 3KAFA 4W9PA 1NSGA 4IPXA 4ODMA 1EQ3A 4ITZA 1D7IA 2VN1A 2N87A 4O2TA 4DRQA 1F8AB 3O5FA 3CGMA 3JXVA 1YATA 3H9RB 2F21A 2M1IA 3UF8A 3UI4A 1Y0OA 4C02B 4ODPA 4TW8A 5HUAA 2PV3A 2PBCA 1FKRA 2LJ4A 4DRPA 1QZ2A 1FKFA 2ZR5A 3IKGA 3O5JA 2LKNA 4JFMA 1FKJA 1T11A 1Q6IA 1FAPA 2Y78A 1J4HA 3O5MA 4DRJA 2RUDA 5DIVA 2LPVA 3O5EA 4MGVA 4TYOA 2KR7A 5GPGA 3IK8A 5HWBA 2PV2A 1U79A 1BL4A 1W26A 2DG9A 3GPKA 3O5LA 5HWCA 2OFNA 3KAHA 1KT1A 1F40A 2ZQTA 1R9HA 1FKSA 2M08A 2ZQVA 4G50A 4LAWA 4DIPA 4QT2A 2MF9A 1FKDA 2MLXA 2DG4A 1Q6HA 2F2DA 3KCEA 3PRBA 1QPFA 2MNTA 1A7XA 2XP5A 1ZK6A 3PA7A 5HW7A 1ROUA 2XP7A 5HT1A 4J4NA 4DT4A 3O5DA 4G2PA 4R0XA 1FKIA 2JZVA 1FKLA 5HW6A 1P5QA 1FKHA 3I6CA 4JYSA 1KT0A 2RURA 1NMVA 5HW8A 4ODOA 2PPPA 1C9HA 4JFJA 1J6YA 3NTPA 2PPNA 4U84A 3KACA 5DIUA 2M2AA 2L2SA 2KI3A 1ROTA 2FAPA 4DH0A 5BXJA 3UQAA 4DRKA 2VCDA 2FKEA 3O5QA 3EY6A 1FD9A 3LUOA 3FAPA 2ZR4A 3NRKA 3RGCA 3UQBA 1Q6UA 3MDYB 1B6CA 4IQCA 4DRNA 3UI5A 1D6OA 3TC5A 3CGNA 5DITA 1D7JA 1FKTA 2ZR6A 2LGOA 2Q5AA 1FKBA 3OOBA 3TCZA 3ODKA 2XP4A 3WH0A 2K8IA 3UQIA 2XP8A 1J4RA 3KAIA 1HXVA 4U85A 1FJDA 4TNSA 1BKFA 1NMWA 4GGQA 4TX0A 4DZ3A 4W9QA 2XP9A 4IQ2A 4LAVA 2MLZA 3O5RA 4N19A 3TDBA 4QT3A 2KFWA 4NNRA 4FN2A 4ODLA 4W9OA 3VAWA 3KZ7A 3O5PA 3JYJA 5I98A 4GIVA 3IKDA 1FKGA 1PINA 1Q1CA 1YW5A 4QIBA 2ZQUA 4DZ2A 4U86A 4DRHA 4LAYA 3KAGA 1EYMA 2F4EA 1JNSA 1N1AA 2D9FA 4TW7A 1L1PA 5B8IC 4JFLA 2PPOA 4LAXA 2DG3A
chains in the Genus database with same CATH superfamily
1IX5A 3AROA 2XPAA 1W1PA 3ARPA 4DWSA 3PRDA 2KE0A 3ALFA 3O5KA 4MSPA 2RQSA 3RFWA 3JYMA 2RSEA 2ZQSA 5D75A 4Z2IA 4WJXA 3WD3A 3BXWA 3B7XA 4W9PA 2RUCA 2XP6A 2O92A 4MNKA 4ODMA 1LQ0A 4ZPTR 1GOIA 4O2TA 4W5UA 3JXVA 2G41A 4C02B 5HUAA 2PV3A 2PBCA 1OWQA 3IKGA 4DWSB 1NWUA 2A3AA 1W9UA 1J4HA 1LG2A 2RUDA 2F23A 2LPVA 1RD6A 5HWBA 4Z2JA 2DG9A 2FDMA 3GPKA 5HWCA 3KAHA 1KT1A 4G50A 4DIPA 2MF9A 1ZBWA 1E6PA 1FKDA 1GRJA 4WKHA 2DG4A 2MNTA 3EIPA 3WD0A 1ZK6A 3PA7A 3PRAA 1HKMA 1FKIA 4AY1A 1E44A 5HW6A 1FKHA 5HW8A 3GU0A 1LL4A 4ODOA 4IT4A 2B5UB 1J6YA 3NTPA 2PI6A 1ROTA 5BXJA 3WKZA 2VCDA 3EY6A 3LUOA 3RMEA 3CH9A 3OA5A 4DRNA 3B8SA 3ARSA 3G6MA 3TC5A 3AS2A 1D7JA 1FKTA 2DT3A 1EDQA 1FKBA 2XP4A 4L72B 4L3NA 4U85A 4TX0A 4IT6A 4LAVA 3CHEA 4Z2HA 5DF0A 4ML4A 1ZU8A 1E9LA 3O5PA 3AS3A 5I98A 1ZBVA 1EHNA 1FKGA 3IKDA 1Q1CA 1YW5A 2ZQUA 4DZ2A 4U86A 1FFQA 1GPFA 1EYMA 2F4EA 1N1AA 5B8IC 3KACA 5HKGA 1JNTA 1QPLA 1ZL1A 2IF4A 3FY1A 1TCOC 4QZVB 2PN0A 5J6EA 1JNEA 1FFRA 3KABA 4HBOA 2PV1A 2MPHA 3O5IA 4P8UA 4ZPVR 2A3EA 1M5YA 4ODRA 1CTNA 2XP3A 1PBKA 1J4IA 3KADA 3O5OA 1H0GA 1ZCNA 3AS1A 4ZPWR 3NI6A 1ZB5A 2KO7A 3KAFA 1NSGA 4IPXA 4ITZA 2DSUA 5DO2A 2QF8A 4DRQA 3W4RA 3O5FA 1YATA 1K9TA 2F21A 3WD2A 1HJXA 3ALGA 3ARYA 1HJWA 1FKJA 3ARUA 4WIWA 4S3KA 3O5EA 5GPGA 3IK8A 4UDMA 3FXYA 4Q22A 1ZBKA 3O5LA 1X6NA 2OFNA 2WLZA 1R9HA 4LAWA 5HBFA 1Q6HA 2DT1A 2XP5A 4DT4A 3O5DA 1WB0A 2PPPA 4JFJA 1LG1A 1W1VA 2KI3A 2L2SA 3UQAA 1E15A 1KFWA 1GUVA 1LJYA 1W1YA 2FKEA 4KR0B 2DSWA 3NRKA 3UQBA 3MDYB 2IUZA 2LGOA 4P8VA 3TCZA 1J4RA 1W9PA 4TNSA 4DZ3A 4W9QA 2XP9A 2MLZA 1W1TA 3B9DA 3TDBA 4QT3A 2KFWA 4ODLA 4W9OA 3KZ7A 1E6ZA 1HKKA 3JYJA 4NSBA 2YBTA 4DWSC 4QIBA 1JCHB 3WIJA 1E6NA 4P8XA 1HKIA 2ESCA 1L1PA 3ARZA 2ITKA 2DT2A 4TW6A 4ODNA 4S3JA 2A3CA 2UZ5A 4BF8A 4ODKA 3O5GA 4DRMA 1JNDA 3RM9A 4DROA 4DRIA 2DSVA 1XRVA 4JFIA 1TFVA 1UR9A 1XHGA 2KGJA 2XPBA 4J4OA 2MLYA 4JFKA 4MTVA 5GPRA 3VAWA 3AS0A 1WAWA 3AQUA 2EULA 3WL1A 1F8AB 3WD4A 4Q7NA 1Y0OA 4ODPA 1OGBA 1SR0A 4TW8A 1FKRA 1EIBA 4XAKA 1QZ2A 2ZR5A 2LKNA 4JFMA 2Y78A 1Q6IA 1FAPA 2WK2A 2OLHA 3O5MA 4MGVA 2KR7A 1U79A 1W26A 1F40A 2ZQTA 1W9VA 4NZCA 3WL0A 4WKAA 3PRBA 1QPFA 1A7XA 5HW7A 3WQVA 1ROUA 2XP7A 4J4NA 3ARTA 4G2PA 1NWRA 2JZVA 4JYSA 2RURA 3B9EA 4URIA 1C9HA 4U84A 4Z2LA 2M2AA 4DH0A 2FAPA 4DRKA 4MNJA 3O5QA 4DWSD 3FAPA 4WKFA 1B6CA 3UI5A 3B9AA 1SYTA 2G8ZA 3ODKA 2YBUA 3WH0A 1FJDA 1NH6A 1D2KA 1WNOA 1O6IA 4WK9A 4NNRA 3ARVA 3ARXA 4Z2KA 4DRHA 1E6RA 4LAYA 1LL7A 2D9FA 3ARQA 1UR8A 2PPOA 4JFLA 3UI4A 4KQZA 3UI6A 4ODQA 2DPEA 1JVWA 4FAPA 4MNMA 2AOSA 5HTGA 2DT0A 3IHZA 1D7HA 4PTMA 4P8WA 1ITXA 2RUQA 1FKKA 1ZBCA 2AWGA 1OGGA 1EQ3A 5DEZA 1D7IA 2VN1A 1HJVA 4Z2GA 2N87A 2ETNA 2A3BA 3CGMA 1NWTA 3H9RB 3UF8A 2M1IA 3CZ8A 4MNLA 2LJ4A 3RM4A 4DRPA 2P4VA 1FKFA 3ARRA 2WLYA 3O5JA 3ARWA 1T11A 4LGXA 4DRJA 5DIVA 3CHFA 4ZS6A 1X6LA 4TYOA 2PV2A 1BL4A 3RM8A 2DSZA 1FKSA 2M08A 2ZQVA 4QT2A 4MPKA 2MLXA 2F2DA 3KCEA 1NWSA 5JH8A 5HT1A 3GTYX 3CHCA 4R0XA 1FKLA 1LL6A 1P5QA 3BMBA 3I6CA 1KT0A 1NMVA 1HKJA 3WQWA 4R5EA 3WD1A 2PPNA 5GQBA 5DIUA 1H0IA 1FD9A 2ZR4A 4HARA 3RGCA 1Q6UA 4IQCA 2B31A 1D6OA 3CGNA 5DITA 2ZR6A 3OOBA 1VF8A 2Q5AA 2K8IA 3UQIA 2XP8A 3KAIA 1HXVA 4MAVA 1BKFA 1NMWA 3QOKA 4GGQA 4IQ2A 3O5RA 2O9OA 3PR9A 4N19A 2WM0A 4FN2A 4GIVA 1PINA 3CHDA 3KAGA 4HBEA 1JNSA 4TW7A 3G6LA 4LAXA 2DG3A
chains in the Genus database with same CATH topology
1IX5A 3AROA 2XPAA 1W1PA 3ARPA 4DWSA 3PRDA 2KE0A 3ALFA 3O5KA 4MSPA 2RQSA 3RFWA 3JYMA 2RSEA 2ZQSA 5D75A 4Z2IA 4WJXA 3WD3A 3BXWA 3B7XA 4W9PA 2RUCA 2XP6A 2O92A 4MNKA 4ODMA 1LQ0A 4ZPTR 1GOIA 4O2TA 4W5UA 3JXVA 2G41A 4C02B 5HUAA 2PV3A 2PBCA 1OWQA 3IKGA 4DWSB 1NWUA 2A3AA 1W9UA 1J4HA 1LG2A 2RUDA 2LPVA 1RD6A 5HWBA 4Z2JA 2DG9A 2FDMA 3GPKA 5HWCA 3KAHA 1KT1A 4G50A 4DIPA 2MF9A 1ZBWA 1E6PA 1FKDA 4WKHA 2DG4A 2MNTA 3WD0A 1ZK6A 3PA7A 3PRAA 1HKMA 1FKIA 4AY1A 5HW6A 1FKHA 5HW8A 1LL4A 4ODOA 4IT4A 1J6YA 3NTPA 2PI6A 1ROTA 5BXJA 3WKZA 2VCDA 3EY6A 3LUOA 3RMEA 3CH9A 3OA5A 4DRNA 3B8SA 3ARSA 3G6MA 3TC5A 3AS2A 1D7JA 1FKTA 2DT3A 1EDQA 1FKBA 2XP4A 4L72B 4L3NA 4U85A 4TX0A 4IT6A 4LAVA 3CHEA 4Z2HA 5DF0A 4ML4A 1ZU8A 1E9LA 3O5PA 3AS3A 5I98A 1ZBVA 1EHNA 1FKGA 3IKDA 1Q1CA 1YW5A 2ZQUA 4DZ2A 4U86A 1FFQA 1GPFA 1EYMA 2F4EA 1N1AA 5B8IC 3KACA 5HKGA 1JNTA 1QPLA 1ZL1A 2IF4A 3FY1A 1TCOC 4QZVB 5J6EA 1JNEA 1FFRA 3KABA 4HBOA 2PV1A 2MPHA 3O5IA 4P8UA 4ZPVR 2A3EA 1M5YA 4ODRA 1CTNA 2XP3A 1PBKA 1J4IA 3KADA 3O5OA 1H0GA 1ZCNA 3AS1A 4ZPWR 3NI6A 1ZB5A 2KO7A 3KAFA 1NSGA 4IPXA 4ITZA 2DSUA 5DO2A 2QF8A 4DRQA 3W4RA 3O5FA 1YATA 1K9TA 2F21A 3WD2A 1HJXA 3ALGA 3ARYA 1HJWA 1FKJA 3ARUA 4WIWA 4S3KA 3O5EA 5GPGA 3IK8A 3FXYA 4Q22A 1ZBKA 3O5LA 1X6NA 2OFNA 2WLZA 1R9HA 4LAWA 5HBFA 1Q6HA 2DT1A 2XP5A 4DT4A 3O5DA 1WB0A 2PPPA 4JFJA 1LG1A 1W1VA 2KI3A 2L2SA 3UQAA 1E15A 1KFWA 1GUVA 1LJYA 1W1YA 2FKEA 4KR0B 2DSWA 3NRKA 3UQBA 3MDYB 2IUZA 2LGOA 4P8VA 3TCZA 1J4RA 1W9PA 4TNSA 4DZ3A 4W9QA 2XP9A 2MLZA 1W1TA 3B9DA 3TDBA 4QT3A 2KFWA 4ODLA 4W9OA 3KZ7A 1E6ZA 1HKKA 3JYJA 4NSBA 2YBTA 4DWSC 4QIBA 3WIJA 1E6NA 4P8XA 1HKIA 2ESCA 1L1PA 3ARZA 2ITKA 2DT2A 4TW6A 4ODNA 4S3JA 2A3CA 2UZ5A 4BF8A 4ODKA 3O5GA 4DRMA 1JNDA 3RM9A 4DROA 4DRIA 2DSVA 1XRVA 4JFIA 1TFVA 1UR9A 1XHGA 2KGJA 2XPBA 4J4OA 2MLYA 4JFKA 4MTVA 5GPRA 3VAWA 3AS0A 1WAWA 3AQUA 3WL1A 1F8AB 3WD4A 4Q7NA 1Y0OA 4ODPA 1OGBA 1SR0A 4TW8A 1FKRA 1EIBA 4XAKA 1QZ2A 2ZR5A 2LKNA 4JFMA 2Y78A 1Q6IA 1FAPA 2WK2A 2OLHA 3O5MA 4MGVA 2KR7A 1U79A 1W26A 1F40A 2ZQTA 1W9VA 4NZCA 3WL0A 4WKAA 3PRBA 1QPFA 1A7XA 5HW7A 3WQVA 1ROUA 2XP7A 4J4NA 3ARTA 4G2PA 1NWRA 2JZVA 4JYSA 2RURA 3B9EA 4URIA 1C9HA 4U84A 4Z2LA 2M2AA 4DH0A 2FAPA 4DRKA 4MNJA 3O5QA 4DWSD 3FAPA 4WKFA 1B6CA 3UI5A 3B9AA 1SYTA 2G8ZA 3ODKA 2YBUA 3WH0A 1FJDA 1NH6A 1D2KA 1WNOA 1O6IA 4WK9A 4NNRA 3ARVA 3ARXA 4Z2KA 4DRHA 1E6RA 4LAYA 1LL7A 2D9FA 3ARQA 4JFLA 1UR8A 2PPOA 3UI4A 4KQZA 3UI6A 4ODQA 2DPEA 1JVWA 4FAPA 4MNMA 2AOSA 5HTGA 2DT0A 3IHZA 1D7HA 4PTMA 4P8WA 1ITXA 2RUQA 1FKKA 1ZBCA 2AWGA 1OGGA 1EQ3A 5DEZA 1D7IA 2VN1A 1HJVA 4Z2GA 2N87A 2A3BA 3CGMA 1NWTA 3H9RB 3UF8A 2M1IA 3CZ8A 4MNLA 2LJ4A 3RM4A 4DRPA 1FKFA 3ARRA 2WLYA 3O5JA 3ARWA 1T11A 4LGXA 4DRJA 5DIVA 3CHFA 4ZS6A 1X6LA 4TYOA 2PV2A 1BL4A 3RM8A 2DSZA 1FKSA 2M08A 2ZQVA 4QT2A 4MPKA 2MLXA 2F2DA 3KCEA 1NWSA 5JH8A 5HT1A 3CHCA 4R0XA 1FKLA 1LL6A 1P5QA 3I6CA 1KT0A 1NMVA 1HKJA 3WQWA 4R5EA 3WD1A 2PPNA 5GQBA 5DIUA 1H0IA 1FD9A 2ZR4A 4HARA 3RGCA 1Q6UA 4IQCA 2B31A 1D6OA 3CGNA 5DITA 2ZR6A 3OOBA 1VF8A 2Q5AA 2K8IA 3UQIA 2XP8A 3KAIA 1HXVA 4MAVA 1BKFA 1NMWA 3QOKA 4GGQA 4IQ2A 3O5RA 2O9OA 3PR9A 4N19A 2WM0A 4FN2A 4GIVA 1PINA 3CHDA 3KAGA 4HBEA 1JNSA 4TW7A 3G6LA 4LAXA 2DG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ITK A;  5HKG A;  1JNT A;  1QPL A;  4TW6 A;  2IF4 A;  2XPA A;  4ODN A;  3UI6 A;  1TCO C;  2UZ5 A;  4ODQ A;  4BF8 A;  4ODK A;  3O5G A;  1JVW A;  4FAP A;  5J6E A;  3KAB A;  4DRM A;  3PRD A;  2KE0 A;  3O5K A;  2PV1 A;  2MPH A;  4MSP A;  2RQS A;  3IHZ A;  4DRO A;  1D7H A;  3O5I A;  5HTG A;  3RFW A;  3JYM A;  4DRI A;  1M5Y A;  4ODR A;  2RSE A;  2XP3 A;  1PBK A;  1J4I A;  2RUQ A;  4JFI A;  3KAD A;  2ZQS A;  3O5O A;  5D75 A;  1FKK A;  1ZCN A;  2KGJ A;  2AWG A;  2XPB A;  3B7X A;  2MLY A;  3NI6 A;  4J4O A;  4JFK A;  2RUC A;  2XP6 A;  2KO7 A;  3KAF A;  4W9P A;  1NSG A;  4IPX A;  4ODM A;  1EQ3 A;  4ITZ A;  1D7I A;  2VN1 A;  2N87 A;  4O2T A;  4DRQ A;  1F8A B;  3O5F A;  3CGM A;  3JXV A;  1YAT A;  3H9R B;  2F21 A;  2M1I A;  3UF8 A;  3UI4 A;  1Y0O A;  4C02 B;  4ODP A;  4TW8 A;  5HUA A;  2PV3 A;  2PBC A;  1FKR A;  2LJ4 A;  4DRP A;  1QZ2 A;  1FKF A;  2ZR5 A;  3IKG A;  3O5J A;  2LKN A;  4JFM A;  1FKJ A;  1T11 A;  1Q6I A;  1FAP A;  2Y78 A;  1J4H A;  3O5M A;  4DRJ A;  2RUD A;  5DIV A;  2LPV A;  3O5E A;  4MGV A;  4TYO A;  2KR7 A;  5GPG A;  3IK8 A;  5HWB A;  2PV2 A;  1U79 A;  1BL4 A;  1W26 A;  2DG9 A;  3GPK A;  3O5L A;  5HWC A;  2OFN A;  3KAH A;  1KT1 A;  1F40 A;  2ZQT A;  1R9H A;  1FKS A;  2M08 A;  2ZQV A;  4G50 A;  4LAW A;  4DIP A;  4QT2 A;  2MF9 A;  1FKD A;  2MLX A;  2DG4 A;  1Q6H A;  2F2D A;  3KCE A;  3PRB A;  1QPF A;  2MNT A;  1A7X A;  2XP5 A;  1ZK6 A;  3PA7 A;  5HW7 A;  1ROU A;  2XP7 A;  5HT1 A;  4J4N A;  4DT4 A;  3O5D A;  4G2P A;  4R0X A;  1FKI A;  2JZV A;  1FKL A;  5HW6 A;  1P5Q A;  1FKH A;  3I6C A;  4JYS A;  1KT0 A;  2RUR A;  1NMV A;  5HW8 A;  4ODO A;  2PPP A;  1C9H A;  4JFJ A;  1J6Y A;  3NTP A;  2PPN A;  4U84 A;  3KAC A;  5DIU A;  2M2A A;  2L2S A;  2KI3 A;  1ROT A;  2FAP A;  4DH0 A;  5BXJ A;  3UQA A;  4DRK A;  2VCD A;  2FKE A;  3O5Q A;  3EY6 A;  1FD9 A;  3LUO A;  3FAP A;  2ZR4 A;  3NRK A;  3RGC A;  3UQB A;  1Q6U A;  3MDY B;  1B6C A;  4IQC A;  4DRN A;  3UI5 A;  1D6O A;  3TC5 A;  3CGN A;  5DIT A;  1D7J A;  1FKT A;  2ZR6 A;  2LGO A;  2Q5A A;  1FKB A;  3OOB A;  3TCZ A;  3ODK A;  2XP4 A;  3WH0 A;  2K8I A;  3UQI A;  2XP8 A;  1J4R A;  3KAI A;  1HXV A;  4U85 A;  1FJD A;  4TNS A;  1BKF A;  1NMW A;  4GGQ A;  4TX0 A;  4DZ3 A;  4W9Q A;  2XP9 A;  4IQ2 A;  4LAV A;  2MLZ A;  3O5R A;  4N19 A;  3TDB A;  4QT3 A;  2KFW A;  4NNR A;  4FN2 A;  4ODL A;  4W9O A;  3VAW A;  3KZ7 A;  3O5P A;  3JYJ A;  5I98 A;  4GIV A;  3IKD A;  1FKG A;  1PIN A;  1Q1C A;  1YW5 A;  4QIB A;  2ZQU A;  4DZ2 A;  4U86 A;  4DRH A;  4LAY A;  3KAG A;  1EYM A;  2F4E A;  1JNS A;  1N1A A;  2D9F A;  4TW7 A;  1L1P A;  5B8I C;  4JFL A;  2PPO A;  4LAX A;  2DG3 A; 
#chains in the Genus database with same CATH topology
 1IX5 A;  3ARO A;  2XPA A;  1W1P A;  3ARP A;  4DWS A;  3PRD A;  2KE0 A;  3ALF A;  3O5K A;  4MSP A;  2RQS A;  3RFW A;  3JYM A;  2RSE A;  2ZQS A;  5D75 A;  4Z2I A;  4WJX A;  3WD3 A;  3BXW A;  3B7X A;  4W9P A;  2RUC A;  2XP6 A;  2O92 A;  4MNK A;  4ODM A;  1LQ0 A;  4ZPT R;  1GOI A;  4O2T A;  4W5U A;  3JXV A;  2G41 A;  4C02 B;  5HUA A;  2PV3 A;  2PBC A;  1OWQ A;  3IKG A;  4DWS B;  1NWU A;  2A3A A;  1W9U A;  1J4H A;  1LG2 A;  2RUD A;  2F23 A;  2LPV A;  1RD6 A;  5HWB A;  4Z2J A;  2DG9 A;  2FDM A;  3GPK A;  5HWC A;  3KAH A;  1KT1 A;  4G50 A;  4DIP A;  2MF9 A;  1ZBW A;  1E6P A;  1FKD A;  1GRJ A;  4WKH A;  2DG4 A;  2MNT A;  3EIP A;  3WD0 A;  1ZK6 A;  3PA7 A;  3PRA A;  1HKM A;  1FKI A;  4AY1 A;  1E44 A;  5HW6 A;  1FKH A;  5HW8 A;  3GU0 A;  1LL4 A;  4ODO A;  4IT4 A;  2B5U B;  1J6Y A;  3NTP A;  2PI6 A;  1ROT A;  5BXJ A;  3WKZ A;  2VCD A;  3EY6 A;  3LUO A;  3RME A;  3CH9 A;  3OA5 A;  4DRN A;  3B8S A;  3ARS A;  3G6M A;  3TC5 A;  3AS2 A;  1D7J A;  1FKT A;  2DT3 A;  1EDQ A;  1FKB A;  2XP4 A;  4L72 B;  4L3N A;  4U85 A;  4TX0 A;  4IT6 A;  4LAV A;  3CHE A;  4Z2H A;  5DF0 A;  4ML4 A;  1ZU8 A;  1E9L A;  3O5P A;  3AS3 A;  5I98 A;  1ZBV A;  1EHN A;  1FKG A;  3IKD A;  1Q1C A;  1YW5 A;  2ZQU A;  4DZ2 A;  4U86 A;  1FFQ A;  1GPF A;  1EYM A;  2F4E A;  1N1A A;  5B8I C;  3KAC A;  5HKG A;  1JNT A;  1QPL A;  1ZL1 A;  2IF4 A;  3FY1 A;  1TCO C;  4QZV B;  2PN0 A;  5J6E A;  1JNE A;  1FFR A;  3KAB A;  4HBO A;  2PV1 A;  2MPH A;  3O5I A;  4P8U A;  4ZPV R;  2A3E A;  1M5Y A;  4ODR A;  1CTN A;  2XP3 A;  1PBK A;  1J4I A;  3KAD A;  3O5O A;  1H0G A;  1ZCN A;  3AS1 A;  4ZPW R;  3NI6 A;  1ZB5 A;  2KO7 A;  3KAF A;  1NSG A;  4IPX A;  4ITZ A;  2DSU A;  5DO2 A;  2QF8 A;  4DRQ A;  3W4R A;  3O5F A;  1YAT A;  1K9T A;  2F21 A;  3WD2 A;  1HJX A;  3ALG A;  3ARY A;  1HJW A;  1FKJ A;  3ARU A;  4WIW A;  4S3K A;  3O5E A;  5GPG A;  3IK8 A;  4UDM A;  3FXY A;  4Q22 A;  1ZBK A;  3O5L A;  1X6N A;  2OFN A;  2WLZ A;  1R9H A;  4LAW A;  5HBF A;  1Q6H A;  2DT1 A;  2XP5 A;  4DT4 A;  3O5D A;  1WB0 A;  2PPP A;  4JFJ A;  1LG1 A;  1W1V A;  2KI3 A;  2L2S A;  3UQA A;  1E15 A;  1KFW A;  1GUV A;  1LJY A;  1W1Y A;  2FKE A;  4KR0 B;  2DSW A;  3NRK A;  3UQB A;  3MDY B;  2IUZ A;  2LGO A;  4P8V A;  3TCZ A;  1J4R A;  1W9P A;  4TNS A;  4DZ3 A;  4W9Q A;  2XP9 A;  2MLZ A;  1W1T A;  3B9D A;  3TDB A;  4QT3 A;  2KFW A;  4ODL A;  4W9O A;  3KZ7 A;  1E6Z A;  1HKK A;  3JYJ A;  4NSB A;  2YBT A;  4DWS C;  4QIB A;  1JCH B;  3WIJ A;  1E6N A;  4P8X A;  1HKI A;  2ESC A;  1L1P A;  3ARZ A;  2ITK A;  2DT2 A;  4TW6 A;  4ODN A;  4S3J A;  2A3C A;  2UZ5 A;  4BF8 A;  4ODK A;  3O5G A;  4DRM A;  1JND A;  3RM9 A;  4DRO A;  4DRI A;  2DSV A;  1XRV A;  4JFI A;  1TFV A;  1UR9 A;  1XHG A;  2KGJ A;  2XPB A;  4J4O A;  2MLY A;  4JFK A;  4MTV A;  5GPR A;  3VAW A;  3AS0 A;  1WAW A;  3AQU A;  2EUL A;  3WL1 A;  1F8A B;  3WD4 A;  4Q7N A;  1Y0O A;  4ODP A;  1OGB A;  1SR0 A;  4TW8 A;  1FKR A;  1EIB A;  4XAK A;  1QZ2 A;  2ZR5 A;  2LKN A;  4JFM A;  2Y78 A;  1Q6I A;  1FAP A;  2WK2 A;  2OLH A;  3O5M A;  4MGV A;  2KR7 A;  1U79 A;  1W26 A;  1F40 A;  2ZQT A;  1W9V A;  4NZC A;  3WL0 A;  4WKA A;  3PRB A;  1QPF A;  1A7X A;  5HW7 A;  3WQV A;  1ROU A;  2XP7 A;  4J4N A;  3ART A;  4G2P A;  1NWR A;  2JZV A;  4JYS A;  2RUR A;  3B9E A;  4URI A;  1C9H A;  4U84 A;  4Z2L A;  2M2A A;  4DH0 A;  2FAP A;  4DRK A;  4MNJ A;  3O5Q A;  4DWS D;  3FAP A;  4WKF A;  1B6C A;  3UI5 A;  3B9A A;  1SYT A;  2G8Z A;  3ODK A;  2YBU A;  3WH0 A;  1FJD A;  1NH6 A;  1D2K A;  1WNO A;  1O6I A;  4WK9 A;  4NNR A;  3ARV A;  3ARX A;  4Z2K A;  4DRH A;  1E6R A;  4LAY A;  1LL7 A;  2D9F A;  3ARQ A;  1UR8 A;  2PPO A;  4JFL A;  3UI4 A;  4KQZ A;  3UI6 A;  4ODQ A;  2DPE A;  1JVW A;  4FAP A;  4MNM A;  2AOS A;  5HTG A;  2DT0 A;  3IHZ A;  1D7H A;  4PTM A;  4P8W A;  1ITX A;  2RUQ A;  1FKK A;  1ZBC A;  2AWG A;  1OGG A;  1EQ3 A;  5DEZ A;  1D7I A;  2VN1 A;  1HJV A;  4Z2G A;  2N87 A;  2ETN A;  2A3B A;  3CGM A;  1NWT A;  3H9R B;  3UF8 A;  2M1I A;  3CZ8 A;  4MNL A;  2LJ4 A;  3RM4 A;  4DRP A;  2P4V A;  1FKF A;  3ARR A;  2WLY A;  3O5J A;  3ARW A;  1T11 A;  4LGX A;  4DRJ A;  5DIV A;  3CHF A;  4ZS6 A;  1X6L A;  4TYO A;  2PV2 A;  1BL4 A;  3RM8 A;  2DSZ A;  1FKS A;  2M08 A;  2ZQV A;  4QT2 A;  4MPK A;  2MLX A;  2F2D A;  3KCE A;  1NWS A;  5JH8 A;  5HT1 A;  3GTY X;  3CHC A;  4R0X A;  1FKL A;  1LL6 A;  1P5Q A;  3BMB A;  3I6C A;  1KT0 A;  1NMV A;  1HKJ A;  3WQW A;  4R5E A;  3WD1 A;  2PPN A;  5GQB A;  5DIU A;  1H0I A;  1FD9 A;  2ZR4 A;  4HAR A;  3RGC A;  1Q6U A;  4IQC A;  2B31 A;  1D6O A;  3CGN A;  5DIT A;  2ZR6 A;  3OOB A;  1VF8 A;  2Q5A A;  2K8I A;  3UQI A;  2XP8 A;  3KAI A;  1HXV A;  4MAV A;  1BKF A;  1NMW A;  3QOK A;  4GGQ A;  4IQ2 A;  3O5R A;  2O9O A;  3PR9 A;  4N19 A;  2WM0 A;  4FN2 A;  4GIV A;  1PIN A;  3CHD A;  3KAG A;  4HBE A;  1JNS A;  4TW7 A;  3G6L A;  4LAX A;  2DG3 A; 
#chains in the Genus database with same CATH homology
 1IX5 A;  3ARO A;  2XPA A;  1W1P A;  3ARP A;  4DWS A;  3PRD A;  2KE0 A;  3ALF A;  3O5K A;  4MSP A;  2RQS A;  3RFW A;  3JYM A;  2RSE A;  2ZQS A;  5D75 A;  4Z2I A;  4WJX A;  3WD3 A;  3BXW A;  3B7X A;  4W9P A;  2RUC A;  2XP6 A;  2O92 A;  4MNK A;  4ODM A;  1LQ0 A;  4ZPT R;  1GOI A;  4O2T A;  4W5U A;  3JXV A;  2G41 A;  4C02 B;  5HUA A;  2PV3 A;  2PBC A;  1OWQ A;  3IKG A;  4DWS B;  1NWU A;  2A3A A;  1W9U A;  1J4H A;  1LG2 A;  2RUD A;  2LPV A;  1RD6 A;  5HWB A;  4Z2J A;  2DG9 A;  2FDM A;  3GPK A;  5HWC A;  3KAH A;  1KT1 A;  4G50 A;  4DIP A;  2MF9 A;  1ZBW A;  1E6P A;  1FKD A;  4WKH A;  2DG4 A;  2MNT A;  3WD0 A;  1ZK6 A;  3PA7 A;  3PRA A;  1HKM A;  1FKI A;  4AY1 A;  5HW6 A;  1FKH A;  5HW8 A;  1LL4 A;  4ODO A;  4IT4 A;  1J6Y A;  3NTP A;  2PI6 A;  1ROT A;  5BXJ A;  3WKZ A;  2VCD A;  3EY6 A;  3LUO A;  3RME A;  3CH9 A;  3OA5 A;  4DRN A;  3B8S A;  3ARS A;  3G6M A;  3TC5 A;  3AS2 A;  1D7J A;  1FKT A;  2DT3 A;  1EDQ A;  1FKB A;  2XP4 A;  4L72 B;  4L3N A;  4U85 A;  4TX0 A;  4IT6 A;  4LAV A;  3CHE A;  4Z2H A;  5DF0 A;  4ML4 A;  1ZU8 A;  1E9L A;  3O5P A;  3AS3 A;  5I98 A;  1ZBV A;  1EHN A;  1FKG A;  3IKD A;  1Q1C A;  1YW5 A;  2ZQU A;  4DZ2 A;  4U86 A;  1FFQ A;  1GPF A;  1EYM A;  2F4E A;  1N1A A;  5B8I C;  3KAC A;  5HKG A;  1JNT A;  1QPL A;  1ZL1 A;  2IF4 A;  3FY1 A;  1TCO C;  4QZV B;  5J6E A;  1JNE A;  1FFR A;  3KAB A;  4HBO A;  2PV1 A;  2MPH A;  3O5I A;  4P8U A;  4ZPV R;  2A3E A;  1M5Y A;  4ODR A;  1CTN A;  2XP3 A;  1PBK A;  1J4I A;  3KAD A;  3O5O A;  1H0G A;  1ZCN A;  3AS1 A;  4ZPW R;  3NI6 A;  1ZB5 A;  2KO7 A;  3KAF A;  1NSG A;  4IPX A;  4ITZ A;  2DSU A;  5DO2 A;  2QF8 A;  4DRQ A;  3W4R A;  3O5F A;  1YAT A;  1K9T A;  2F21 A;  3WD2 A;  1HJX A;  3ALG A;  3ARY A;  1HJW A;  1FKJ A;  3ARU A;  4WIW A;  4S3K A;  3O5E A;  5GPG A;  3IK8 A;  3FXY A;  4Q22 A;  1ZBK A;  3O5L A;  1X6N A;  2OFN A;  2WLZ A;  1R9H A;  4LAW A;  5HBF A;  1Q6H A;  2DT1 A;  2XP5 A;  4DT4 A;  3O5D A;  1WB0 A;  2PPP A;  4JFJ A;  1LG1 A;  1W1V A;  2KI3 A;  2L2S A;  3UQA A;  1E15 A;  1KFW A;  1GUV A;  1LJY A;  1W1Y A;  2FKE A;  4KR0 B;  2DSW A;  3NRK A;  3UQB A;  3MDY B;  2IUZ A;  2LGO A;  4P8V A;  3TCZ A;  1J4R A;  1W9P A;  4TNS A;  4DZ3 A;  4W9Q A;  2XP9 A;  2MLZ A;  1W1T A;  3B9D A;  3TDB A;  4QT3 A;  2KFW A;  4ODL A;  4W9O A;  3KZ7 A;  1E6Z A;  1HKK A;  3JYJ A;  4NSB A;  2YBT A;  4DWS C;  4QIB A;  3WIJ A;  1E6N A;  4P8X A;  1HKI A;  2ESC A;  1L1P A;  3ARZ A;  2ITK A;  2DT2 A;  4TW6 A;  4ODN A;  4S3J A;  2A3C A;  2UZ5 A;  4BF8 A;  4ODK A;  3O5G A;  4DRM A;  1JND A;  3RM9 A;  4DRO A;  4DRI A;  2DSV A;  1XRV A;  4JFI A;  1TFV A;  1UR9 A;  1XHG A;  2KGJ A;  2XPB A;  4J4O A;  2MLY A;  4JFK A;  4MTV A;  5GPR A;  3VAW A;  3AS0 A;  1WAW A;  3AQU A;  3WL1 A;  1F8A B;  3WD4 A;  4Q7N A;  1Y0O A;  4ODP A;  1OGB A;  1SR0 A;  4TW8 A;  1FKR A;  1EIB A;  4XAK A;  1QZ2 A;  2ZR5 A;  2LKN A;  4JFM A;  2Y78 A;  1Q6I A;  1FAP A;  2WK2 A;  2OLH A;  3O5M A;  4MGV A;  2KR7 A;  1U79 A;  1W26 A;  1F40 A;  2ZQT A;  1W9V A;  4NZC A;  3WL0 A;  4WKA A;  3PRB A;  1QPF A;  1A7X A;  5HW7 A;  3WQV A;  1ROU A;  2XP7 A;  4J4N A;  3ART A;  4G2P A;  1NWR A;  2JZV A;  4JYS A;  2RUR A;  3B9E A;  4URI A;  1C9H A;  4U84 A;  4Z2L A;  2M2A A;  4DH0 A;  2FAP A;  4DRK A;  4MNJ A;  3O5Q A;  4DWS D;  3FAP A;  4WKF A;  1B6C A;  3UI5 A;  3B9A A;  1SYT A;  2G8Z A;  3ODK A;  2YBU A;  3WH0 A;  1FJD A;  1NH6 A;  1D2K A;  1WNO A;  1O6I A;  4WK9 A;  4NNR A;  3ARV A;  3ARX A;  4Z2K A;  4DRH A;  1E6R A;  4LAY A;  1LL7 A;  2D9F A;  3ARQ A;  4JFL A;  1UR8 A;  2PPO A;  3UI4 A;  4KQZ A;  3UI6 A;  4ODQ A;  2DPE A;  1JVW A;  4FAP A;  4MNM A;  2AOS A;  5HTG A;  2DT0 A;  3IHZ A;  1D7H A;  4PTM A;  4P8W A;  1ITX A;  2RUQ A;  1FKK A;  1ZBC A;  2AWG A;  1OGG A;  1EQ3 A;  5DEZ A;  1D7I A;  2VN1 A;  1HJV A;  4Z2G A;  2N87 A;  2A3B A;  3CGM A;  1NWT A;  3H9R B;  3UF8 A;  2M1I A;  3CZ8 A;  4MNL A;  2LJ4 A;  3RM4 A;  4DRP A;  1FKF A;  3ARR A;  2WLY A;  3O5J A;  3ARW A;  1T11 A;  4LGX A;  4DRJ A;  5DIV A;  3CHF A;  4ZS6 A;  1X6L A;  4TYO A;  2PV2 A;  1BL4 A;  3RM8 A;  2DSZ A;  1FKS A;  2M08 A;  2ZQV A;  4QT2 A;  4MPK A;  2MLX A;  2F2D A;  3KCE A;  1NWS A;  5JH8 A;  5HT1 A;  3CHC A;  4R0X A;  1FKL A;  1LL6 A;  1P5Q A;  3I6C A;  1KT0 A;  1NMV A;  1HKJ A;  3WQW A;  4R5E A;  3WD1 A;  2PPN A;  5GQB A;  5DIU A;  1H0I A;  1FD9 A;  2ZR4 A;  4HAR A;  3RGC A;  1Q6U A;  4IQC A;  2B31 A;  1D6O A;  3CGN A;  5DIT A;  2ZR6 A;  3OOB A;  1VF8 A;  2Q5A A;  2K8I A;  3UQI A;  2XP8 A;  3KAI A;  1HXV A;  4MAV A;  1BKF A;  1NMW A;  3QOK A;  4GGQ A;  4IQ2 A;  3O5R A;  2O9O A;  3PR9 A;  4N19 A;  2WM0 A;  4FN2 A;  4GIV A;  1PIN A;  3CHD A;  3KAG A;  4HBE A;  1JNS A;  4TW7 A;  3G6L A;  4LAX A;  2DG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...