3IK8A

Structure-based design of novel pin1 inhibitors (i)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
113
structure length
113
Chain Sequence
EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-based design of novel human Pin1 inhibitors (I).
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3ik8A00
3MDYB 3UQBA 4IQCA 1F8AB 2RURA 4DT4A 3KABA 4GIVA 2ZQTA 1Q1CA 3O5EA 4FAPA 2PV3A 3JYJA 2PPNA 2M08A 2XP7A 3O5FA 4DRMA 3NTPA 4DRNA 4DROA 2RUQA 4IPXA 1ZCNA 3O5LA 3UI6A 3O5DA 1YW5A 3KZ7A 4J4OA 2VN1A 2M2AA 2KE0A 1J4IA 3LUOA 3O5PA 2VCDA 4J4NA 1PINA 4O2TA 4GGQA 2OFNA 4DZ2A 3KAFA 5HT1A 1FKGA 5I98A 3O5MA 4ODMA 2ZR5A 3KACA 2LPVA 4G50A 4TYOA 3TDBA 1J6YA 1FKDA 3GPKA 1TCOC 3JYMA 4LAVA 3UI4A 4DRKA 1FKJA 2IF4A 1D7HA 4ODOA 5BXJA 1JVWA 3UQAA 2PV2A 2XP3A 3NI6A 1NMVA 1ROTA 2MLYA 3CGNA 2ZQSA 4JYSA 2MF9A 5HWBA 1W26A 2D9FA 1NSGA 3NRKA 4TW8A 3KADA 1FKIA 1KT1A 3WH0A 2KO7A 3VAWA 2LJ4A 1FAPA 1FKLA 1A7XA 3IKGA 2PV1A 2XP9A 2PBCA 2F4EA 5D75A 4C02B 1FKHA 4TW6A 4ODNA 2FKEA 2KGJA 4U86A 4DH0A 3IHZA 4LAXA 4IQ2A 3KCEA 4W9PA 1J4RA 1J4HA 2DG4A 2RUCA 1BKFA 2AWGA 2ZR4A 4DRQA 1FKRA 2F2DA 3B7XA 5B8IC 1FKTA 1FKFA 3I6CA 5DIUA 3EY6A 4TW7A 4JFMA 4DIPA 2PPPA 4MGVA 1C9HA 5HW8A 3JXVA 2N87A 1ROUA 1FKBA 5DIVA 3O5OA 2DG9A 4DRIA 3RGCA 4ITZA 1NMWA 1YATA 3O5KA 4JFKA 5HW6A 1M5YA 1PBKA 2XPBA 3IK8A 3ODKA 1KT0A 3TCZA 2JZVA 2MLZA 1QZ2A 2L2SA 2Q5AA 2XP5A 4N19A 1JNSA 4JFLA 2XP6A 2RQSA 4NNRA 2ITKA 5HW7A 3UF8A 2RUDA 4ODQA 1N1AA 4JFIA 2KFWA 2MPHA 4QT2A 4R0XA 4DRJA 3UQIA 1EQ3A 1FJDA 3H9RB 4DZ3A 2F21A 1U79A 1QPFA 1FKKA 3O5JA 1B6CA 5GPGA 2UZ5A 3OOBA 1HXVA 4U85A 3O5RA 1D7IA 1ZK6A 4LAWA 4ODRA 2LKNA 1F40A 3TC5A 1Q6UA 3UI5A 4ODKA 2LGOA 3O5QA 1EYMA 1QPLA 4U84A 2DG3A 2PPOA 1D7JA 5HWCA 2ZR6A 1Q6IA 4TNSA 4ODPA 2MLXA 3IKDA 4JFJA 3KAHA 1Q6HA 2XPAA 4DRHA 3CGMA 1FD9A 1R9HA 2M1IA 2ZQVA 3O5GA 1P5QA 1Y0OA 2KI3A 3PRBA 4W9OA 2KR7A 2FAPA 5HTGA 3RFWA 4FN2A 2K8IA 4G2PA 4MSPA 3PRDA 1BL4A 2RSEA 5DITA 4ODLA 1D6OA 2ZQUA 4W9QA 3FAPA 5HKGA 1JNTA 4DRPA 5J6EA 4TX0A 3KAIA 4QIBA 3KAGA 4LAYA 1T11A 2MNTA 1FKSA 2Y78A 1L1PA 2XP8A 4BF8A 5HUAA 4QT3A 3PA7A 2XP4A 3O5IA
chains in the Genus database with same CATH superfamily
1F8AB 4WIWA 3ARQA 4WKHA 3KABA 4GIVA 3ARXA 1WB0A 4PTMA 2PPNA 3O5FA 3NTPA 4DROA 4IPXA 3AQUA 3ARUA 2B5UB 1LL6A 2KE0A 3LUOA 3O5PA 2A3BA 3AS1A 3KACA 1FKDA 2A3AA 3ARRA 5DF0A 1WAWA 3AS2A 2IF4A 4QZVB 5BXJA 1JVWA 1ZBVA 2XP3A 1NMVA 1ROTA 2MLYA 2ZQSA 5HWBA 2D9FA 3NRKA 3ARSA 3CHCA 1A7XA 3OA5A 2PV1A 4P8XA 2PBCA 1GPFA 1NWSA 4ZPTR 1UR8A 4IQ2A 4URIA 3KCEA 4DRQA 1FKRA 1E44A 1FKTA 1FKFA 3I6CA 3EY6A 4TW7A 3G6LA 5HW8A 3PRAA 2N87A 3O5OA 4DRIA 4ITZA 2G41A 1M5YA 3IK8A 4DWSA 1ITXA 3B8SA 2JZVA 2MLZA 2PI6A 4N19A 3WQWA 4JFLA 2YBTA 4ODQA 3B9AA 3UQIA 1FJDA 3H9RB 2F21A 1U79A 1QPFA 3OOBA 4L72B 2AOSA 4ODRA 5GQBA 4DWSD 3UI5A 3CHEA 4NZCA 1QPLA 2DSWA 4ML4A 1IX5A 4ODPA 3IKDA 4JFJA 4DRHA 3CGMA 1ZB5A 2ZQVA 3ARZA 2WLYA 3PRBA 1XRVA 4FN2A 1JCHB 4G2PA 1BL4A 4ODLA 1D6OA 2PN0A 5J6EA 3AS3A 3KAIA 4UDMA 4HBEA 4LAYA 1HKJA 2Y78A 2MNTA 1FKSA 4MNMA 3RM4A 2XP8A 5HUAA 1LL7A 4IQCA 2DSZA 1H0IA 3O5EA 1E6NA 2XP7A 2M08A 1RD6A 2RUQA 1ZCNA 3O5LA 3O5DA 3KZ7A 4J4OA 4P8VA 2M2AA 3W4RA 1J4IA 2OFNA 3KAFA 4L3NA 4MNKA 4KR0B 5HT1A 5I98A 3CHFA 3O5MA 4ODMA 2ZR5A 4IT6A 3UI4A 3UQAA 2MF9A 1E15A 1JNEA 4TW8A 1FKIA 3VAWA 1FAPA 3ARYA 3IKGA 4C02B 1LL4A 2KGJA 3IHZA 2RUCA 2AWGA 3FY1A 1W1VA 2F2DA 3RM8A 1ZU8A 5DIUA 4JFMA 4DIPA 1X6NA 2B31A 3JXVA 1FKBA 5DIVA 3WL1A 4P8WA 1NMWA 1YATA 3WD4A 1W9UA 1PBKA 1NWTA 1SYTA 1KT0A 3TCZA 2XP5A 5JH8A 2DSVA 2RQSA 2ITKA 4DRJA 4QT2A 2MPHA 1E6ZA 4NSBA 1HKMA 4DZ3A 1NH6A 4Z2IA 2LGOA 3O5QA 1EYMA 3WIJA 2PPOA 1FFRA 1W9VA 2MLXA 1Q6HA 2XPAA 2A3CA 1SR0A 1UR9A 1ZL1A 1P5QA 1Y0OA 1FFQA 2ETNA 2KR7A 5GPRA 3RFWA 3PRDA 2RSEA 4HBOA 5DITA 3FAPA 5HKGA 3BMBA 4TX0A 1W9PA 1ZBCA 2DSUA 2QF8A 3GU0A 4QT3A 1W1TA 3MDYB 4Q7NA 3CH9A 3UQBA 2RURA 4DT4A 3CHDA 3EIPA 2ZQTA 2DT0A 1Q1CA 1TFVA 1H0GA 4FAPA 2EULA 3AROA 3JYJA 5HBFA 3UI6A 1LG2A 1YW5A 3ALGA 3WD0A 2VCDA 4J4NA 4O2TA 4DZ2A 3GTYX 1GOIA 3GPKA 3JYMA 1D7HA 1VF8A 4JYSA 4MTVA 4WK9A 3KADA 2LJ4A 4XAKA 4IT4A 3ARWA 4TW6A 4ODNA 2FKEA 4DH0A 4ZPWR 4LAXA 1LG1A 1J4HA 1BKFA 2G8ZA 2ZR4A 5B8IC 2PPPA 4MGVA 1C9HA 3PR9A 3WD2A 4ZPVR 2WM0A 2DG9A 4JFKA 1HJWA 3O5KA 4HARA 4Z2LA 1OGGA 5HW6A 1ZBWA 2XPBA 3ODKA 3ALFA 1GUVA 2L2SA 2Q5AA 1JNSA 3BXWA 1LQ0A 2O9OA 2F23A 1K9TA 4R5EA 3AS0A 2KFWA 1EQ3A 1FKKA 3O5JA 1B6CA 5GPGA 3O5RA 4P8UA 1ZK6A 1OGBA 3TC5A 1Q6UA 4ODKA 3ARTA 4U84A 2DG3A 1NWUA 2ZR6A 4TNSA 2IUZA 4LGXA 1FD9A 2M1IA 3O5GA 4W9OA 4AY1A 3ARVA 2FAPA 2FDMA 4S3KA 4MPKA 5HTGA 4MSPA 2ZQUA 4W9QA 3WD1A 1JNTA 4DRPA 3KAGA 1KFWA 3PA7A 3O5IA 2DPEA 3WKZA 4KQZA 2PV3A 5DEZA 2A3EA 4DRMA 4DRNA 1E9LA 1LJYA 2VN1A 1O6IA 3WQVA 1CTNA 1PINA 4Z2GA 4GGQA 1EDQA 1FKGA 2LPVA 4G50A 4TYOA 3B9EA 3TDBA 1J6YA 1TCOC 4LAVA 2DT2A 4DRKA 4DWSC 1FKJA 1HJXA 4ODOA 1ZBKA 2PV2A 3NI6A 3CGNA 1W1PA 2DT3A 1W26A 4Z2KA 1NSGA 4W5UA 3CZ8A 1KT1A 1W1YA 3WH0A 2KO7A 1HKIA 1FKLA 3RMEA 2XP9A 2F4EA 5D75A 1EHNA 1FKHA 4U86A 4W9PA 1J4RA 2DG4A 3B7XA 4MNLA 1X6LA 3WL0A 1XHGA 4MAVA 1ROUA 3WD3A 2P4VA 1EIBA 3B9DA 3RGCA 5DO2A 4MNJA 1QZ2A 1HJVA 4DWSB 2XP6A 4NNRA 5HW7A 1HKKA 4Q22A 3UF8A 2RUDA 4Z2HA 1N1AA 4JFIA 4R0XA 1GRJA 1OWQA 1NWRA 1HXVA 2UZ5A 4U85A 1D7IA 1E6PA 4LAWA 2OLHA 2LKNA 1JNDA 1F40A 4WKAA 2O92A 1E6RA 1D7JA 5HWCA 1Q6IA 4Z2JA 2ESCA 2YBUA 1D2KA 3KAHA 3RM9A 2DT1A 1R9HA 3QOKA 1WNOA 2KI3A 3FXYA 4WJXA 4WKFA 2K8IA 4S3JA 3ARPA 4QIBA 4ZS6A 1L1PA 1T11A 2WK2A 2WLZA 3G6MA 4BF8A 2XP4A
chains in the Genus database with same CATH topology
1F8AB 4WIWA 3ARQA 4WKHA 3KABA 4GIVA 3ARXA 1WB0A 4PTMA 2PPNA 3O5FA 3NTPA 4DROA 4IPXA 3AQUA 3ARUA 2KE0A 1LL6A 3LUOA 3O5PA 2A3BA 3AS1A 3KACA 1FKDA 2A3AA 3ARRA 5DF0A 1WAWA 3AS2A 2IF4A 4QZVB 5BXJA 1JVWA 1ZBVA 2XP3A 1NMVA 1ROTA 2MLYA 2ZQSA 5HWBA 2D9FA 3NRKA 3ARSA 3CHCA 1A7XA 3OA5A 2PV1A 4P8XA 2PBCA 1GPFA 1NWSA 4ZPTR 1UR8A 4IQ2A 4URIA 3KCEA 4DRQA 1FKRA 1FKTA 1FKFA 3I6CA 3EY6A 4TW7A 3G6LA 5HW8A 3PRAA 2N87A 3O5OA 4DRIA 4ITZA 2G41A 1M5YA 3IK8A 4DWSA 1ITXA 3B8SA 2JZVA 2MLZA 2PI6A 4N19A 3WQWA 4JFLA 2YBTA 4ODQA 3B9AA 3UQIA 1FJDA 3H9RB 2F21A 1U79A 1QPFA 3OOBA 4L72B 2AOSA 4ODRA 5GQBA 4DWSD 3UI5A 3CHEA 4NZCA 1QPLA 2DSWA 4ML4A 1IX5A 4ODPA 3IKDA 4JFJA 4DRHA 3CGMA 1ZB5A 2ZQVA 3ARZA 2WLYA 3PRBA 1XRVA 4FN2A 4G2PA 1BL4A 4ODLA 1D6OA 5J6EA 3AS3A 3KAIA 3RM4A 4HBEA 4LAYA 1HKJA 2Y78A 2MNTA 1FKSA 4MNMA 2XP8A 5HUAA 1LL7A 4IQCA 2DSZA 1H0IA 3O5EA 1E6NA 2XP7A 2M08A 1RD6A 2RUQA 1ZCNA 3O5LA 3O5DA 3KZ7A 4J4OA 4P8VA 2M2AA 3W4RA 1J4IA 2OFNA 3KAFA 4L3NA 4MNKA 4KR0B 5HT1A 5I98A 3CHFA 3O5MA 4ODMA 2ZR5A 4IT6A 3UI4A 3UQAA 2MF9A 1E15A 1JNEA 4TW8A 1FKIA 3VAWA 1FAPA 3ARYA 3IKGA 4C02B 1LL4A 2KGJA 3IHZA 2RUCA 2AWGA 3FY1A 1W1VA 2F2DA 3RM8A 1ZU8A 5DIUA 4JFMA 4DIPA 1X6NA 2B31A 3JXVA 1FKBA 5DIVA 3WL1A 4P8WA 1NMWA 1YATA 3WD4A 1W9UA 1PBKA 1NWTA 1SYTA 1KT0A 3TCZA 2XP5A 5JH8A 2DSVA 2RQSA 2ITKA 4DRJA 4QT2A 2MPHA 1E6ZA 4NSBA 1HKMA 4DZ3A 1NH6A 4Z2IA 2LGOA 3O5QA 1EYMA 3WIJA 2PPOA 1FFRA 1W9VA 2MLXA 1Q6HA 2XPAA 2A3CA 1SR0A 1UR9A 1ZL1A 1P5QA 1Y0OA 1FFQA 2KR7A 5GPRA 3RFWA 3PRDA 2RSEA 4HBOA 5DITA 3FAPA 5HKGA 4TX0A 1W9PA 1ZBCA 2DSUA 2QF8A 4QT3A 1W1TA 3MDYB 4Q7NA 3CH9A 3UQBA 2RURA 4DT4A 3CHDA 2ZQTA 2DT0A 1Q1CA 1TFVA 1H0GA 4FAPA 3AROA 3JYJA 5HBFA 3UI6A 1LG2A 1YW5A 3ALGA 3WD0A 2VCDA 4J4NA 4O2TA 4DZ2A 1GOIA 3GPKA 3JYMA 1D7HA 1VF8A 4JYSA 4MTVA 4WK9A 3KADA 2LJ4A 4XAKA 4IT4A 3ARWA 4TW6A 4ODNA 2FKEA 4DH0A 4ZPWR 4LAXA 1LG1A 1J4HA 1BKFA 2G8ZA 2ZR4A 5B8IC 2PPPA 4MGVA 1C9HA 3PR9A 3WD2A 4ZPVR 2WM0A 2DG9A 4JFKA 1HJWA 3O5KA 4HARA 4Z2LA 1OGGA 5HW6A 1ZBWA 2XPBA 3ODKA 3ALFA 1GUVA 2L2SA 2Q5AA 1JNSA 3BXWA 1LQ0A 2O9OA 1K9TA 4R5EA 3AS0A 2KFWA 1EQ3A 1FKKA 3O5JA 1B6CA 5GPGA 3O5RA 4P8UA 1ZK6A 1OGBA 3TC5A 1Q6UA 4ODKA 3ARTA 4U84A 2DG3A 1NWUA 2ZR6A 4TNSA 2IUZA 4LGXA 1FD9A 2M1IA 3O5GA 4W9OA 4AY1A 3ARVA 2FAPA 2FDMA 4S3KA 4MPKA 5HTGA 4MSPA 2ZQUA 4W9QA 3WD1A 1JNTA 4DRPA 3KAGA 1KFWA 3PA7A 3O5IA 2DPEA 3WKZA 4KQZA 2PV3A 5DEZA 2A3EA 4DRMA 4DRNA 1E9LA 1LJYA 2VN1A 1O6IA 3WQVA 1CTNA 1PINA 4Z2GA 4GGQA 1EDQA 1FKGA 2LPVA 4G50A 4TYOA 3B9EA 3TDBA 1J6YA 1TCOC 4LAVA 2DT2A 4DRKA 4DWSC 1FKJA 1HJXA 4ODOA 1ZBKA 2PV2A 3NI6A 3CGNA 1W1PA 2DT3A 1W26A 4Z2KA 1NSGA 4W5UA 3CZ8A 1KT1A 1W1YA 3WH0A 2KO7A 1HKIA 1FKLA 3RMEA 2XP9A 2F4EA 5D75A 1EHNA 1FKHA 4U86A 4W9PA 1J4RA 2DG4A 3B7XA 4MNLA 1X6LA 3WL0A 1XHGA 4MAVA 1ROUA 3WD3A 1EIBA 3B9DA 3RGCA 5DO2A 4MNJA 1QZ2A 1HJVA 4DWSB 2XP6A 4NNRA 5HW7A 1HKKA 4Q22A 3UF8A 2RUDA 4Z2HA 1N1AA 4JFIA 4R0XA 1OWQA 1NWRA 1HXVA 2UZ5A 4U85A 1D7IA 1E6PA 4LAWA 2OLHA 2LKNA 1JNDA 1F40A 4WKAA 2O92A 1E6RA 1D7JA 5HWCA 1Q6IA 4Z2JA 2ESCA 2YBUA 1D2KA 3KAHA 3RM9A 2DT1A 1R9HA 3QOKA 1WNOA 2KI3A 3FXYA 4WJXA 4WKFA 2K8IA 4S3JA 3ARPA 4QIBA 4ZS6A 1L1PA 1T11A 2WK2A 2WLZA 3G6MA 4BF8A 2XP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MDY B;  3UQB A;  4IQC A;  1F8A B;  2RUR A;  4DT4 A;  3KAB A;  4GIV A;  2ZQT A;  1Q1C A;  3O5E A;  4FAP A;  2PV3 A;  3JYJ A;  2PPN A;  2M08 A;  2XP7 A;  3O5F A;  4DRM A;  3NTP A;  4DRN A;  4DRO A;  2RUQ A;  4IPX A;  1ZCN A;  3O5L A;  3UI6 A;  3O5D A;  1YW5 A;  3KZ7 A;  4J4O A;  2VN1 A;  2M2A A;  2KE0 A;  1J4I A;  3LUO A;  3O5P A;  2VCD A;  4J4N A;  1PIN A;  4O2T A;  4GGQ A;  2OFN A;  4DZ2 A;  3KAF A;  5HT1 A;  1FKG A;  5I98 A;  3O5M A;  4ODM A;  2ZR5 A;  3KAC A;  2LPV A;  4G50 A;  4TYO A;  3TDB A;  1J6Y A;  1FKD A;  3GPK A;  1TCO C;  3JYM A;  4LAV A;  3UI4 A;  4DRK A;  1FKJ A;  2IF4 A;  1D7H A;  4ODO A;  5BXJ A;  1JVW A;  3UQA A;  2PV2 A;  2XP3 A;  3NI6 A;  1NMV A;  1ROT A;  2MLY A;  3CGN A;  2ZQS A;  4JYS A;  2MF9 A;  5HWB A;  1W26 A;  2D9F A;  1NSG A;  3NRK A;  4TW8 A;  3KAD A;  1FKI A;  1KT1 A;  3WH0 A;  2KO7 A;  3VAW A;  2LJ4 A;  1FAP A;  1FKL A;  1A7X A;  3IKG A;  2PV1 A;  2XP9 A;  2PBC A;  2F4E A;  5D75 A;  4C02 B;  1FKH A;  4TW6 A;  4ODN A;  2FKE A;  2KGJ A;  4U86 A;  4DH0 A;  3IHZ A;  4LAX A;  4IQ2 A;  3KCE A;  4W9P A;  1J4R A;  1J4H A;  2DG4 A;  2RUC A;  1BKF A;  2AWG A;  2ZR4 A;  4DRQ A;  1FKR A;  2F2D A;  3B7X A;  5B8I C;  1FKT A;  1FKF A;  3I6C A;  5DIU A;  3EY6 A;  4TW7 A;  4JFM A;  4DIP A;  2PPP A;  4MGV A;  1C9H A;  5HW8 A;  3JXV A;  2N87 A;  1ROU A;  1FKB A;  5DIV A;  3O5O A;  2DG9 A;  4DRI A;  3RGC A;  4ITZ A;  1NMW A;  1YAT A;  3O5K A;  4JFK A;  5HW6 A;  1M5Y A;  1PBK A;  2XPB A;  3IK8 A;  3ODK A;  1KT0 A;  3TCZ A;  2JZV A;  2MLZ A;  1QZ2 A;  2L2S A;  2Q5A A;  2XP5 A;  4N19 A;  1JNS A;  4JFL A;  2XP6 A;  2RQS A;  4NNR A;  2ITK A;  5HW7 A;  3UF8 A;  2RUD A;  4ODQ A;  1N1A A;  4JFI A;  2KFW A;  2MPH A;  4QT2 A;  4R0X A;  4DRJ A;  3UQI A;  1EQ3 A;  1FJD A;  3H9R B;  4DZ3 A;  2F21 A;  1U79 A;  1QPF A;  1FKK A;  3O5J A;  1B6C A;  5GPG A;  2UZ5 A;  3OOB A;  1HXV A;  4U85 A;  3O5R A;  1D7I A;  1ZK6 A;  4LAW A;  4ODR A;  2LKN A;  1F40 A;  3TC5 A;  1Q6U A;  3UI5 A;  4ODK A;  2LGO A;  3O5Q A;  1EYM A;  1QPL A;  4U84 A;  2DG3 A;  2PPO A;  1D7J A;  5HWC A;  2ZR6 A;  1Q6I A;  4TNS A;  4ODP A;  2MLX A;  3IKD A;  4JFJ A;  3KAH A;  1Q6H A;  2XPA A;  4DRH A;  3CGM A;  1FD9 A;  1R9H A;  2M1I A;  2ZQV A;  3O5G A;  1P5Q A;  1Y0O A;  2KI3 A;  3PRB A;  4W9O A;  2KR7 A;  2FAP A;  5HTG A;  3RFW A;  4FN2 A;  2K8I A;  4G2P A;  4MSP A;  3PRD A;  1BL4 A;  2RSE A;  5DIT A;  4ODL A;  1D6O A;  2ZQU A;  4W9Q A;  3FAP A;  5HKG A;  1JNT A;  4DRP A;  5J6E A;  4TX0 A;  3KAI A;  4QIB A;  3KAG A;  4LAY A;  1T11 A;  2MNT A;  1FKS A;  2Y78 A;  1L1P A;  2XP8 A;  4BF8 A;  5HUA A;  4QT3 A;  3PA7 A;  2XP4 A;  3O5I A; 
#chains in the Genus database with same CATH topology
 1F8A B;  4WIW A;  3ARQ A;  4WKH A;  3KAB A;  4GIV A;  3ARX A;  1WB0 A;  4PTM A;  2PPN A;  3O5F A;  3NTP A;  4DRO A;  4IPX A;  3AQU A;  3ARU A;  2B5U B;  1LL6 A;  2KE0 A;  3LUO A;  3O5P A;  2A3B A;  3AS1 A;  3KAC A;  1FKD A;  2A3A A;  3ARR A;  5DF0 A;  1WAW A;  3AS2 A;  2IF4 A;  4QZV B;  5BXJ A;  1JVW A;  1ZBV A;  2XP3 A;  1NMV A;  1ROT A;  2MLY A;  2ZQS A;  5HWB A;  2D9F A;  3NRK A;  3ARS A;  3CHC A;  1A7X A;  3OA5 A;  2PV1 A;  4P8X A;  2PBC A;  1GPF A;  1NWS A;  4ZPT R;  1UR8 A;  4IQ2 A;  4URI A;  3KCE A;  4DRQ A;  1FKR A;  1E44 A;  1FKT A;  1FKF A;  3I6C A;  3EY6 A;  4TW7 A;  3G6L A;  5HW8 A;  3PRA A;  2N87 A;  3O5O A;  4DRI A;  4ITZ A;  2G41 A;  1M5Y A;  3IK8 A;  4DWS A;  1ITX A;  3B8S A;  2JZV A;  2MLZ A;  2PI6 A;  4N19 A;  3WQW A;  4JFL A;  2YBT A;  4ODQ A;  3B9A A;  3UQI A;  1FJD A;  3H9R B;  2F21 A;  1U79 A;  1QPF A;  3OOB A;  4L72 B;  2AOS A;  4ODR A;  5GQB A;  4DWS D;  3UI5 A;  3CHE A;  4NZC A;  1QPL A;  2DSW A;  4ML4 A;  1IX5 A;  4ODP A;  3IKD A;  4JFJ A;  4DRH A;  3CGM A;  1ZB5 A;  2ZQV A;  3ARZ A;  2WLY A;  3PRB A;  1XRV A;  4FN2 A;  1JCH B;  4G2P A;  1BL4 A;  4ODL A;  1D6O A;  2PN0 A;  5J6E A;  3AS3 A;  3KAI A;  4UDM A;  4HBE A;  4LAY A;  1HKJ A;  2Y78 A;  2MNT A;  1FKS A;  4MNM A;  3RM4 A;  2XP8 A;  5HUA A;  1LL7 A;  4IQC A;  2DSZ A;  1H0I A;  3O5E A;  1E6N A;  2XP7 A;  2M08 A;  1RD6 A;  2RUQ A;  1ZCN A;  3O5L A;  3O5D A;  3KZ7 A;  4J4O A;  4P8V A;  2M2A A;  3W4R A;  1J4I A;  2OFN A;  3KAF A;  4L3N A;  4MNK A;  4KR0 B;  5HT1 A;  5I98 A;  3CHF A;  3O5M A;  4ODM A;  2ZR5 A;  4IT6 A;  3UI4 A;  3UQA A;  2MF9 A;  1E15 A;  1JNE A;  4TW8 A;  1FKI A;  3VAW A;  1FAP A;  3ARY A;  3IKG A;  4C02 B;  1LL4 A;  2KGJ A;  3IHZ A;  2RUC A;  2AWG A;  3FY1 A;  1W1V A;  2F2D A;  3RM8 A;  1ZU8 A;  5DIU A;  4JFM A;  4DIP A;  1X6N A;  2B31 A;  3JXV A;  1FKB A;  5DIV A;  3WL1 A;  4P8W A;  1NMW A;  1YAT A;  3WD4 A;  1W9U A;  1PBK A;  1NWT A;  1SYT A;  1KT0 A;  3TCZ A;  2XP5 A;  5JH8 A;  2DSV A;  2RQS A;  2ITK A;  4DRJ A;  4QT2 A;  2MPH A;  1E6Z A;  4NSB A;  1HKM A;  4DZ3 A;  1NH6 A;  4Z2I A;  2LGO A;  3O5Q A;  1EYM A;  3WIJ A;  2PPO A;  1FFR A;  1W9V A;  2MLX A;  1Q6H A;  2XPA A;  2A3C A;  1SR0 A;  1UR9 A;  1ZL1 A;  1P5Q A;  1Y0O A;  1FFQ A;  2ETN A;  2KR7 A;  5GPR A;  3RFW A;  3PRD A;  2RSE A;  4HBO A;  5DIT A;  3FAP A;  5HKG A;  3BMB A;  4TX0 A;  1W9P A;  1ZBC A;  2DSU A;  2QF8 A;  3GU0 A;  4QT3 A;  1W1T A;  3MDY B;  4Q7N A;  3CH9 A;  3UQB A;  2RUR A;  4DT4 A;  3CHD A;  3EIP A;  2ZQT A;  2DT0 A;  1Q1C A;  1TFV A;  1H0G A;  4FAP A;  2EUL A;  3ARO A;  3JYJ A;  5HBF A;  3UI6 A;  1LG2 A;  1YW5 A;  3ALG A;  3WD0 A;  2VCD A;  4J4N A;  4O2T A;  4DZ2 A;  3GTY X;  1GOI A;  3GPK A;  3JYM A;  1D7H A;  1VF8 A;  4JYS A;  4MTV A;  4WK9 A;  3KAD A;  2LJ4 A;  4XAK A;  4IT4 A;  3ARW A;  4TW6 A;  4ODN A;  2FKE A;  4DH0 A;  4ZPW R;  4LAX A;  1LG1 A;  1J4H A;  1BKF A;  2G8Z A;  2ZR4 A;  5B8I C;  2PPP A;  4MGV A;  1C9H A;  3PR9 A;  3WD2 A;  4ZPV R;  2WM0 A;  2DG9 A;  4JFK A;  1HJW A;  3O5K A;  4HAR A;  4Z2L A;  1OGG A;  5HW6 A;  1ZBW A;  2XPB A;  3ODK A;  3ALF A;  1GUV A;  2L2S A;  2Q5A A;  1JNS A;  3BXW A;  1LQ0 A;  2O9O A;  2F23 A;  1K9T A;  4R5E A;  3AS0 A;  2KFW A;  1EQ3 A;  1FKK A;  3O5J A;  1B6C A;  5GPG A;  3O5R A;  4P8U A;  1ZK6 A;  1OGB A;  3TC5 A;  1Q6U A;  4ODK A;  3ART A;  4U84 A;  2DG3 A;  1NWU A;  2ZR6 A;  4TNS A;  2IUZ A;  4LGX A;  1FD9 A;  2M1I A;  3O5G A;  4W9O A;  4AY1 A;  3ARV A;  2FAP A;  2FDM A;  4S3K A;  4MPK A;  5HTG A;  4MSP A;  2ZQU A;  4W9Q A;  3WD1 A;  1JNT A;  4DRP A;  3KAG A;  1KFW A;  3PA7 A;  3O5I A;  2DPE A;  3WKZ A;  4KQZ A;  2PV3 A;  5DEZ A;  2A3E A;  4DRM A;  4DRN A;  1E9L A;  1LJY A;  2VN1 A;  1O6I A;  3WQV A;  1CTN A;  1PIN A;  4Z2G A;  4GGQ A;  1EDQ A;  1FKG A;  2LPV A;  4G50 A;  4TYO A;  3B9E A;  3TDB A;  1J6Y A;  1TCO C;  4LAV A;  2DT2 A;  4DRK A;  4DWS C;  1FKJ A;  1HJX A;  4ODO A;  1ZBK A;  2PV2 A;  3NI6 A;  3CGN A;  1W1P A;  2DT3 A;  1W26 A;  4Z2K A;  1NSG A;  4W5U A;  3CZ8 A;  1KT1 A;  1W1Y A;  3WH0 A;  2KO7 A;  1HKI A;  1FKL A;  3RME A;  2XP9 A;  2F4E A;  5D75 A;  1EHN A;  1FKH A;  4U86 A;  4W9P A;  1J4R A;  2DG4 A;  3B7X A;  4MNL A;  1X6L A;  3WL0 A;  1XHG A;  4MAV A;  1ROU A;  3WD3 A;  2P4V A;  1EIB A;  3B9D A;  3RGC A;  5DO2 A;  4MNJ A;  1QZ2 A;  1HJV A;  4DWS B;  2XP6 A;  4NNR A;  5HW7 A;  1HKK A;  4Q22 A;  3UF8 A;  2RUD A;  4Z2H A;  1N1A A;  4JFI A;  4R0X A;  1GRJ A;  1OWQ A;  1NWR A;  1HXV A;  2UZ5 A;  4U85 A;  1D7I A;  1E6P A;  4LAW A;  2OLH A;  2LKN A;  1JND A;  1F40 A;  4WKA A;  2O92 A;  1E6R A;  1D7J A;  5HWC A;  1Q6I A;  4Z2J A;  2ESC A;  2YBU A;  1D2K A;  3KAH A;  3RM9 A;  2DT1 A;  1R9H A;  3QOK A;  1WNO A;  2KI3 A;  3FXY A;  4WJX A;  4WKF A;  2K8I A;  4S3J A;  3ARP A;  4QIB A;  4ZS6 A;  1L1P A;  1T11 A;  2WK2 A;  2WLZ A;  3G6M A;  4BF8 A;  2XP4 A; 
#chains in the Genus database with same CATH homology
 1F8A B;  4WIW A;  3ARQ A;  4WKH A;  3KAB A;  4GIV A;  3ARX A;  1WB0 A;  4PTM A;  2PPN A;  3O5F A;  3NTP A;  4DRO A;  4IPX A;  3AQU A;  3ARU A;  2KE0 A;  1LL6 A;  3LUO A;  3O5P A;  2A3B A;  3AS1 A;  3KAC A;  1FKD A;  2A3A A;  3ARR A;  5DF0 A;  1WAW A;  3AS2 A;  2IF4 A;  4QZV B;  5BXJ A;  1JVW A;  1ZBV A;  2XP3 A;  1NMV A;  1ROT A;  2MLY A;  2ZQS A;  5HWB A;  2D9F A;  3NRK A;  3ARS A;  3CHC A;  1A7X A;  3OA5 A;  2PV1 A;  4P8X A;  2PBC A;  1GPF A;  1NWS A;  4ZPT R;  1UR8 A;  4IQ2 A;  4URI A;  3KCE A;  4DRQ A;  1FKR A;  1FKT A;  1FKF A;  3I6C A;  3EY6 A;  4TW7 A;  3G6L A;  5HW8 A;  3PRA A;  2N87 A;  3O5O A;  4DRI A;  4ITZ A;  2G41 A;  1M5Y A;  3IK8 A;  4DWS A;  1ITX A;  3B8S A;  2JZV A;  2MLZ A;  2PI6 A;  4N19 A;  3WQW A;  4JFL A;  2YBT A;  4ODQ A;  3B9A A;  3UQI A;  1FJD A;  3H9R B;  2F21 A;  1U79 A;  1QPF A;  3OOB A;  4L72 B;  2AOS A;  4ODR A;  5GQB A;  4DWS D;  3UI5 A;  3CHE A;  4NZC A;  1QPL A;  2DSW A;  4ML4 A;  1IX5 A;  4ODP A;  3IKD A;  4JFJ A;  4DRH A;  3CGM A;  1ZB5 A;  2ZQV A;  3ARZ A;  2WLY A;  3PRB A;  1XRV A;  4FN2 A;  4G2P A;  1BL4 A;  4ODL A;  1D6O A;  5J6E A;  3AS3 A;  3KAI A;  3RM4 A;  4HBE A;  4LAY A;  1HKJ A;  2Y78 A;  2MNT A;  1FKS A;  4MNM A;  2XP8 A;  5HUA A;  1LL7 A;  4IQC A;  2DSZ A;  1H0I A;  3O5E A;  1E6N A;  2XP7 A;  2M08 A;  1RD6 A;  2RUQ A;  1ZCN A;  3O5L A;  3O5D A;  3KZ7 A;  4J4O A;  4P8V A;  2M2A A;  3W4R A;  1J4I A;  2OFN A;  3KAF A;  4L3N A;  4MNK A;  4KR0 B;  5HT1 A;  5I98 A;  3CHF A;  3O5M A;  4ODM A;  2ZR5 A;  4IT6 A;  3UI4 A;  3UQA A;  2MF9 A;  1E15 A;  1JNE A;  4TW8 A;  1FKI A;  3VAW A;  1FAP A;  3ARY A;  3IKG A;  4C02 B;  1LL4 A;  2KGJ A;  3IHZ A;  2RUC A;  2AWG A;  3FY1 A;  1W1V A;  2F2D A;  3RM8 A;  1ZU8 A;  5DIU A;  4JFM A;  4DIP A;  1X6N A;  2B31 A;  3JXV A;  1FKB A;  5DIV A;  3WL1 A;  4P8W A;  1NMW A;  1YAT A;  3WD4 A;  1W9U A;  1PBK A;  1NWT A;  1SYT A;  1KT0 A;  3TCZ A;  2XP5 A;  5JH8 A;  2DSV A;  2RQS A;  2ITK A;  4DRJ A;  4QT2 A;  2MPH A;  1E6Z A;  4NSB A;  1HKM A;  4DZ3 A;  1NH6 A;  4Z2I A;  2LGO A;  3O5Q A;  1EYM A;  3WIJ A;  2PPO A;  1FFR A;  1W9V A;  2MLX A;  1Q6H A;  2XPA A;  2A3C A;  1SR0 A;  1UR9 A;  1ZL1 A;  1P5Q A;  1Y0O A;  1FFQ A;  2KR7 A;  5GPR A;  3RFW A;  3PRD A;  2RSE A;  4HBO A;  5DIT A;  3FAP A;  5HKG A;  4TX0 A;  1W9P A;  1ZBC A;  2DSU A;  2QF8 A;  4QT3 A;  1W1T A;  3MDY B;  4Q7N A;  3CH9 A;  3UQB A;  2RUR A;  4DT4 A;  3CHD A;  2ZQT A;  2DT0 A;  1Q1C A;  1TFV A;  1H0G A;  4FAP A;  3ARO A;  3JYJ A;  5HBF A;  3UI6 A;  1LG2 A;  1YW5 A;  3ALG A;  3WD0 A;  2VCD A;  4J4N A;  4O2T A;  4DZ2 A;  1GOI A;  3GPK A;  3JYM A;  1D7H A;  1VF8 A;  4JYS A;  4MTV A;  4WK9 A;  3KAD A;  2LJ4 A;  4XAK A;  4IT4 A;  3ARW A;  4TW6 A;  4ODN A;  2FKE A;  4DH0 A;  4ZPW R;  4LAX A;  1LG1 A;  1J4H A;  1BKF A;  2G8Z A;  2ZR4 A;  5B8I C;  2PPP A;  4MGV A;  1C9H A;  3PR9 A;  3WD2 A;  4ZPV R;  2WM0 A;  2DG9 A;  4JFK A;  1HJW A;  3O5K A;  4HAR A;  4Z2L A;  1OGG A;  5HW6 A;  1ZBW A;  2XPB A;  3ODK A;  3ALF A;  1GUV A;  2L2S A;  2Q5A A;  1JNS A;  3BXW A;  1LQ0 A;  2O9O A;  1K9T A;  4R5E A;  3AS0 A;  2KFW A;  1EQ3 A;  1FKK A;  3O5J A;  1B6C A;  5GPG A;  3O5R A;  4P8U A;  1ZK6 A;  1OGB A;  3TC5 A;  1Q6U A;  4ODK A;  3ART A;  4U84 A;  2DG3 A;  1NWU A;  2ZR6 A;  4TNS A;  2IUZ A;  4LGX A;  1FD9 A;  2M1I A;  3O5G A;  4W9O A;  4AY1 A;  3ARV A;  2FAP A;  2FDM A;  4S3K A;  4MPK A;  5HTG A;  4MSP A;  2ZQU A;  4W9Q A;  3WD1 A;  1JNT A;  4DRP A;  3KAG A;  1KFW A;  3PA7 A;  3O5I A;  2DPE A;  3WKZ A;  4KQZ A;  2PV3 A;  5DEZ A;  2A3E A;  4DRM A;  4DRN A;  1E9L A;  1LJY A;  2VN1 A;  1O6I A;  3WQV A;  1CTN A;  1PIN A;  4Z2G A;  4GGQ A;  1EDQ A;  1FKG A;  2LPV A;  4G50 A;  4TYO A;  3B9E A;  3TDB A;  1J6Y A;  1TCO C;  4LAV A;  2DT2 A;  4DRK A;  4DWS C;  1FKJ A;  1HJX A;  4ODO A;  1ZBK A;  2PV2 A;  3NI6 A;  3CGN A;  1W1P A;  2DT3 A;  1W26 A;  4Z2K A;  1NSG A;  4W5U A;  3CZ8 A;  1KT1 A;  1W1Y A;  3WH0 A;  2KO7 A;  1HKI A;  1FKL A;  3RME A;  2XP9 A;  2F4E A;  5D75 A;  1EHN A;  1FKH A;  4U86 A;  4W9P A;  1J4R A;  2DG4 A;  3B7X A;  4MNL A;  1X6L A;  3WL0 A;  1XHG A;  4MAV A;  1ROU A;  3WD3 A;  1EIB A;  3B9D A;  3RGC A;  5DO2 A;  4MNJ A;  1QZ2 A;  1HJV A;  4DWS B;  2XP6 A;  4NNR A;  5HW7 A;  1HKK A;  4Q22 A;  3UF8 A;  2RUD A;  4Z2H A;  1N1A A;  4JFI A;  4R0X A;  1OWQ A;  1NWR A;  1HXV A;  2UZ5 A;  4U85 A;  1D7I A;  1E6P A;  4LAW A;  2OLH A;  2LKN A;  1JND A;  1F40 A;  4WKA A;  2O92 A;  1E6R A;  1D7J A;  5HWC A;  1Q6I A;  4Z2J A;  2ESC A;  2YBU A;  1D2K A;  3KAH A;  3RM9 A;  2DT1 A;  1R9H A;  3QOK A;  1WNO A;  2KI3 A;  3FXY A;  4WJX A;  4WKF A;  2K8I A;  4S3J A;  3ARP A;  4QIB A;  4ZS6 A;  1L1P A;  1T11 A;  2WK2 A;  2WLZ A;  3G6M A;  4BF8 A;  2XP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...