3IK8A

Structure-based design of novel pin1 inhibitors (i)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
113
structure length
113
Chain Sequence
b'EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-based design of novel human Pin1 inhibitors (I).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 37
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3ik8A00
1ROUA 1D7IA 2RURA 1U79A 3I6CA 1Q6UA 2PPNA 3O5PA 1W26A 1FJDA 1R9HA 1FD9A 3IHZA 2PPPA 4DZ3A 4J4OA 3KABA 2FAPA 1QPFA 2F2DA 3GPKA 3JYJA 3KAFA 1ZK6A 3CGNA 3EY6A 3KADA 1ZCNA 2MPHA 4U85A 4DZ2A 4DRNA 2ZQTA 1F40A 1Y0OA 3IK8A 2XP6A 1QZ2A 1YATA 4MSPA 2ZQVA 4DROA 4ODOA 4W9PA 2ZQSA 2N87A 2XP9A 3JYMA 4JFIA 5HTGA 3FAPA 4ODQA 2Q5AA 3UI4A 2KI3A 5HW8A 2IF4A 2KFWA 3NI6A 1EQ3A 1L1PA 2XP4A 3O5EA 5J6EA 5I98A 4MGVA 3CGMA 4ITZA 4U86A 5HWBA 2MNTA 3B7XA 2F21A 2MF9A 4JFKA 2JZVA 2VCDA 2FKEA 1FKGA 2RUDA 2XP8A 5HKGA 2DG9A 1J6YA 2Y78A 1B6CA 2KE0A 2RQSA 3KAIA 4C02B 4DH0A 1Q6IA 2D9FA 2RSEA 3O5IA 3TC5A 2MLYA 5HW7A 5HWCA 4BF8A 1FKKA 1N1AA 3O5KA 2XP7A 1FKHA 3NTPA 4LAXA 2M2AA 2RUQA 2ZQUA 3NRKA 4J4NA 4QIBA 1ROTA 4R0XA 4TW7A 5BXJA 1FKLA 4TW6A 3PRBA 4G2PA 5DIVA 2KO7A 3VAWA 1D6OA 4DT4A 4TW8A 1NMWA 1Q6HA 3KCEA 2ZR6A 3KACA 4JFMA 1T11A 3KAGA 5B8IC 4QT2A 3PA7A 3TDBA 2XPBA 3LUOA 3O5MA 2PV1A 4G50A 2UZ5A 2MLXA 2L2SA 2XP5A 5D75A 3O5FA 4IPXA 1FKBA 2PV2A 4DRQA 3O5RA 4DRHA 1JVWA 1KT0A 1A7XA 1M5YA 1NMVA 3O5DA 4DRPA 1PBKA 4ODKA 2ZR4A 4O2TA 3JXVA 3RFWA 4LAYA 2DG4A 4DRIA 3MDYB 1F8AB 1FKJA 1YW5A 2LGOA 2RUCA 2LJ4A 4NNRA 4ODRA 3O5JA 4U84A 1FKDA 3UF8A 2LPVA 4JYSA 1FKIA 1BKFA 1J4HA 1KT1A 1QPLA 3ODKA 4FN2A 4JFLA 3WH0A 2K8IA 5HUAA 1JNTA 4ODLA 1TCOC 2PPOA 4DIPA 4GIVA 1D7JA 1FKSA 3O5OA 5HW6A 1Q1CA 2MLZA 3KAHA 1C9HA 3IKGA 2AWGA 4IQ2A 2OFNA 1FKRA 4TX0A 1P5QA 3UQBA 3UQIA 1NSGA 1D7HA 3UI5A 4TNSA 4W9QA 4IQCA 4ODNA 2LKNA 4GGQA 4FAPA 4JFJA 4ODPA 1FKTA 1FKFA 2VN1A 4QT3A 4W9OA 1J4RA 2XP3A 5DIUA 5HT1A 3O5LA 3TCZA 1HXVA 2PBCA 3OOBA 4N19A 3UQAA 5DITA 4LAWA 1BL4A 2M1IA 2ZR5A 4DRKA 4DRMA 4DRJA 1EYMA 1JNSA 4ODMA 5GPGA 3IKDA 3PRDA 3RGCA 1PINA 4TYOA 2KGJA 3KZ7A 2DG3A 2ITKA 2KR7A 3H9RB 4LAVA 3UI6A 2PV3A 3O5QA 2XPAA 1J4IA 2M08A 3O5GA 1FAPA 2F4EA
chains in the Genus database with same CATH superfamily
4Z2KA 1U79A 4NZCA 2A3AA 4MTVA 1W26A 4J4OA 3GPKA 3EY6A 1NWRA 4S3KA 4Q7NA 4DZ2A 4QZVB 4HARA 2ZQVA 4P8UA 2O9OA 2XP4A 3FY1A 4WJXA 1LL6A 2A3CA 4L72B 2JZVA 2YBUA 2RUDA 2AOSA 2WM0A 4L3NA 1J6YA 4DH0A 1ZBVA 2YBTA 3O5IA 1ZBWA 2MLYA 4BF8A 3EIPA 1HKMA 2M2AA 4TW7A 1SYTA 2QF8A 1HJWA 3CHEA 4Z2GA 2KO7A 3VAWA 5GPRA 1D6OA 4WK9A 4DT4A 4TW8A 1NMWA 1E9LA 4JFMA 3ARXA 4QT2A 3TDBA 3LUOA 2ETNA 5D75A 4IPXA 3PRAA 5DO2A 1ITXA 4HBOA 4ODKA 4AY1A 1JNDA 2DSZA 3FXYA 2LJ4A 4S3JA 1J4HA 1KT1A 1W9UA 4JFLA 4ODLA 1EIBA 2F23A 4DIPA 1D7JA 1FKSA 3CHCA 2MLZA 3KAHA 1LG1A 1JNEA 4IQ2A 1FKRA 1P5QA 1WAWA 3ARYA 3UI5A 2LKNA 3ARUA 4GGQA 2DSWA 1FKFA 4W9OA 1HJXA 2XP3A 5DITA 3WL1A 1NWUA 2IUZA 4KR0B 4DWSD 3UI6A 4DWSC 2DG3A 2ITKA 1WB0A 1OWQA 3O5GA 2RURA 3BXWA 4WKHA 3O5PA 1OGGA 1CTNA 2F2DA 3JYJA 3KAFA 3CGNA 4MNLA 2DT0A 1E6NA 1Y0OA 3WQWA 3B8SA 2G8ZA 4IT6A 1NWTA 4ML4A 3AQUA 2XP9A 4ODOA 3FAPA 2WK2A 2Q5AA 3NI6A 1EQ3A 1L1PA 4MGVA 4ITZA 4UDMA 4XAKA 3B7XA 2F21A 4JFKA 2DG9A 1Q6IA 5HWCA 1TFVA 3O5KA 2ESCA 1FKHA 1LL4A 3RM8A 4J4NA 4LGXA 4QIBA 1EDQA 3CZ8A 2FDMA 1FKLA 4TW6A 3WD0A 1EHNA 1X6NA 1W9VA 2EULA 3WL0A 4P8XA 3ARTA 2WLYA 1FKBA 2PV2A 3B9DA 4DRQA 3ARWA 3ARQA 2P4VA 1NMVA 4DRPA 3ARRA 3ARVA 3ALFA 4LAYA 3AS2A 1F8AB 2RUCA 4ODRA 1ZL1A 3UF8A 4NNRA 3CH9A 1OGBA 5HBFA 1BKFA 4MNKA 1TCOC 2PPOA 2WLZA 4GIVA 3O5OA 3CHDA 5HW6A 1Q1CA 4P8WA 2AWGA 2OFNA 4TX0A 3UQBA 3UQIA 1NSGA 1D7HA 3WD1A 4ODNA 4FAPA 4P8VA 4URIA 1H0GA 5DIUA 1HXVA 3WIJA 3OOBA 3WD2A 1HKKA 1ZBCA 4ZS6A 4DRMA 1EYMA 3IKDA 1PINA 3KZ7A 4Q22A 4LAVA 2O92A 5HUAA 1ZB5A 1FAPA 2F4EA 2A3EA 1Q6UA 2PPNA 4NSBA 1FJDA 3AS3A 4IT4A 3IHZA 4DZ3A 2B5UB 1KFWA 4WIWA 1ZK6A 2MPHA 3W4RA 2OLHA 1UR8A 1F40A 1QZ2A 1E44A 4DROA 1SR0A 1LL7A 1GUVA 2ZQSA 2N87A 3GTYX 1W1YA 3AS1A 4MNMA 5HTGA 1NWSA 3ARSA 3UI4A 1ZU8A 2KFWA 3O5EA 4ZPWR 5I98A 5J6EA 4DWSA 3CGMA 5HWBA 2MNTA 2MF9A 4MPKA 2XP8A 1FKGA 3G6MA 1W1VA 2Y78A 1B6CA 3KAIA 4C02B 2RSEA 2D9FA 1E15A 1FKKA 1ZBKA 3G6LA 2XP7A 4Z2JA 3NTPA 4LAXA 1E6RA 1ROTA 4DWSB 5BXJA 3PRBA 1WNOA 4G2PA 1E6ZA 1W1PA 2PI6A 1Q6HA 3KCEA 2ZR6A 5JH8A 1T11A 3BMBA 3PA7A 2XPBA 3CHFA 3RM9A 2DT2A 1D2KA 4ZPTR 2PV1A 2MLXA 2L2SA 3ARPA 1NH6A 1JVWA 1A7XA 1M5YA 1RD6A 4R5EA 1PBKA 1X6LA 4WKFA 3RM4A 1JCHB 3JXVA 2DG4A 2G41A 1FKJA 2LGOA 4U84A 2LPVA 3ALGA 1IX5A 4Z2HA 3ODKA 2K8IA 3WKZA 1C9HA 3IKGA 1W1TA 4W9QA 1GPFA 4JFJA 5GQBA 2VN1A 1J4RA 4Z2IA 2PBCA 1VF8A 4DRJA 1JNSA 4ODMA 2KGJA 2KR7A 3H9RB 2PV3A 3O5QA 2XPAA 1J4IA 2M08A 5DEZA 4Z2LA 4ZPVR 1ROUA 1D7IA 3I6CA 2PN0A 1R9HA 1FD9A 2DT1A 2DPEA 2PPPA 1HKJA 3RMEA 3KABA 2FAPA 1QPFA 3KADA 3AROA 1ZCNA 4U85A 4DRNA 2ZQTA 3AS0A 3IK8A 2XP6A 1YATA 4MSPA 4W9PA 3JYMA 1LJYA 4JFIA 4ODQA 4MAVA 5HW8A 2KI3A 2IF4A 3B9EA 4U86A 4MNJA 2VCDA 2FKEA 5HKGA 2KE0A 2RQSA 1GOIA 5DF0A 3TC5A 5HW7A 1N1AA 2RUQA 2B31A 2ZQUA 3NRKA 4R0XA 5DIVA 3ARZA 2DSVA 1HKIA 3KACA 3KAGA 5B8IC 3WQVA 4PTMA 1H0IA 3O5MA 3WD4A 4G50A 3PR9A 2UZ5A 1XHGA 2XP5A 3O5FA 1UR9A 2A3BA 4KQZA 3O5RA 1XRVA 4DRHA 1KT0A 3O5DA 3GU0A 3WD3A 1FFQA 2ZR4A 3QOKA 1E6PA 4O2TA 1LG2A 3RFWA 4DRIA 1FFRA 3MDYB 1YW5A 2DT3A 3O5JA 1FKDA 4JYSA 1FKIA 1LQ0A 1QPLA 4HBEA 4FN2A 3WH0A 1JNTA 1K9TA 2DSUA 4TNSA 4IQCA 3B9AA 1GRJA 4ODPA 1FKTA 4QT3A 4WKAA 3TCZA 5HT1A 1HJVA 3O5LA 3UQAA 4N19A 4W5UA 3OA5A 4LAWA 1BL4A 2M1IA 2ZR5A 4DRKA 1O6IA 5GPGA 3PRDA 3RGCA 4TYOA 1W9PA
chains in the Genus database with same CATH topology
4Z2KA 1U79A 4NZCA 2A3AA 4MTVA 1W26A 4J4OA 3GPKA 3EY6A 1NWRA 4S3KA 4Q7NA 4DZ2A 4QZVB 4HARA 2ZQVA 4P8UA 2O9OA 2XP4A 3FY1A 4WJXA 1LL6A 2A3CA 4L72B 2JZVA 2YBUA 2RUDA 2AOSA 2WM0A 4L3NA 1J6YA 4DH0A 1ZBVA 2YBTA 3O5IA 1ZBWA 2MLYA 4BF8A 1HKMA 2M2AA 4TW7A 1SYTA 2QF8A 1HJWA 3CHEA 4Z2GA 2KO7A 3VAWA 5GPRA 1D6OA 4WK9A 4DT4A 4TW8A 1NMWA 1E9LA 4JFMA 3ARXA 4QT2A 3TDBA 3LUOA 5D75A 4IPXA 3PRAA 5DO2A 1ITXA 4HBOA 4ODKA 4AY1A 1JNDA 2DSZA 3FXYA 2LJ4A 4S3JA 1J4HA 1KT1A 1W9UA 4JFLA 4ODLA 1EIBA 4DIPA 1D7JA 1FKSA 3CHCA 2MLZA 3KAHA 1LG1A 1JNEA 4IQ2A 1FKRA 1P5QA 1WAWA 3ARYA 3UI5A 2LKNA 3ARUA 4GGQA 2DSWA 1FKFA 4W9OA 1HJXA 2XP3A 5DITA 3WL1A 1NWUA 2IUZA 4KR0B 4DWSD 3UI6A 4DWSC 2DG3A 2ITKA 1WB0A 1OWQA 3O5GA 2RURA 3BXWA 4WKHA 3O5PA 1OGGA 1CTNA 2F2DA 3JYJA 3KAFA 3CGNA 4MNLA 2DT0A 1E6NA 1Y0OA 3WQWA 3B8SA 2G8ZA 4IT6A 1NWTA 4ML4A 3AQUA 2XP9A 4ODOA 3FAPA 2WK2A 2Q5AA 3NI6A 1EQ3A 1L1PA 4MGVA 4ITZA 4XAKA 3B7XA 2F21A 4JFKA 2DG9A 1Q6IA 5HWCA 1TFVA 3O5KA 2ESCA 1FKHA 1LL4A 3RM8A 4J4NA 4LGXA 4QIBA 1EDQA 3CZ8A 2FDMA 1FKLA 4TW6A 3WD0A 1EHNA 1X6NA 1W9VA 3WL0A 4P8XA 3ARTA 2WLYA 1FKBA 2PV2A 3B9DA 4DRQA 3ARWA 3ARQA 1NMVA 4DRPA 3ARRA 3ARVA 3ALFA 4LAYA 3AS2A 1F8AB 2RUCA 4ODRA 1ZL1A 3UF8A 4NNRA 3CH9A 1OGBA 5HBFA 1BKFA 4MNKA 1TCOC 2PPOA 2WLZA 4GIVA 3O5OA 3CHDA 5HW6A 1Q1CA 4P8WA 2AWGA 2OFNA 4TX0A 3UQBA 3UQIA 1NSGA 1D7HA 3WD1A 4ODNA 4FAPA 4P8VA 4URIA 1H0GA 5DIUA 1HXVA 3WIJA 3OOBA 3WD2A 1HKKA 1ZBCA 4ZS6A 4DRMA 1EYMA 3IKDA 1PINA 3KZ7A 4Q22A 4LAVA 2O92A 5HUAA 1ZB5A 1FAPA 2F4EA 2A3EA 1Q6UA 2PPNA 4NSBA 1FJDA 3AS3A 4IT4A 3IHZA 4DZ3A 1KFWA 4WIWA 1ZK6A 2MPHA 3W4RA 2OLHA 1UR8A 1F40A 1QZ2A 4DROA 1SR0A 1LL7A 1GUVA 2ZQSA 2N87A 1W1YA 3AS1A 4MNMA 5HTGA 1NWSA 3ARSA 3UI4A 1ZU8A 2KFWA 3O5EA 4ZPWR 5I98A 5J6EA 4DWSA 3CGMA 5HWBA 2MNTA 2MF9A 4MPKA 2XP8A 1FKGA 3G6MA 1W1VA 2Y78A 1B6CA 3KAIA 4C02B 2RSEA 2D9FA 1E15A 1FKKA 1ZBKA 3G6LA 2XP7A 4Z2JA 3NTPA 4LAXA 1E6RA 1ROTA 4DWSB 5BXJA 3PRBA 1WNOA 4G2PA 1E6ZA 1W1PA 2PI6A 1Q6HA 3KCEA 2ZR6A 5JH8A 1T11A 3PA7A 2XPBA 3CHFA 3RM9A 2DT2A 1D2KA 4ZPTR 2PV1A 2MLXA 2L2SA 3ARPA 1NH6A 1JVWA 1A7XA 1M5YA 1RD6A 4R5EA 1PBKA 1X6LA 4WKFA 3RM4A 3JXVA 2DG4A 2G41A 1FKJA 2LGOA 4U84A 2LPVA 3ALGA 1IX5A 4Z2HA 3ODKA 2K8IA 3WKZA 1C9HA 3IKGA 1W1TA 4W9QA 1GPFA 4JFJA 5GQBA 2VN1A 1J4RA 4Z2IA 2PBCA 1VF8A 4DRJA 1JNSA 4ODMA 2KGJA 2KR7A 3H9RB 2PV3A 3O5QA 2XPAA 1J4IA 2M08A 5DEZA 4Z2LA 4ZPVR 1ROUA 1D7IA 3I6CA 1R9HA 1FD9A 2DT1A 2DPEA 2PPPA 1HKJA 3RMEA 3KABA 2FAPA 1QPFA 3KADA 3AROA 1ZCNA 4U85A 4DRNA 2ZQTA 3AS0A 3IK8A 2XP6A 1YATA 4MSPA 4W9PA 3JYMA 1LJYA 4JFIA 4ODQA 4MAVA 5HW8A 2KI3A 2IF4A 3B9EA 4U86A 4MNJA 2VCDA 2FKEA 5HKGA 2KE0A 2RQSA 1GOIA 5DF0A 3TC5A 5HW7A 1N1AA 2RUQA 2B31A 2ZQUA 3NRKA 4R0XA 5DIVA 3ARZA 2DSVA 1HKIA 3KACA 3KAGA 5B8IC 3WQVA 4PTMA 1H0IA 3O5MA 3WD4A 4G50A 3PR9A 2UZ5A 1XHGA 2XP5A 3O5FA 1UR9A 2A3BA 4KQZA 3O5RA 1XRVA 4DRHA 1KT0A 3O5DA 3WD3A 1FFQA 2ZR4A 3QOKA 1E6PA 4O2TA 1LG2A 3RFWA 4DRIA 1FFRA 3MDYB 1YW5A 2DT3A 3O5JA 1FKDA 4JYSA 1FKIA 1LQ0A 1QPLA 4HBEA 4FN2A 3WH0A 1JNTA 1K9TA 2DSUA 4TNSA 4IQCA 3B9AA 4ODPA 1FKTA 4QT3A 4WKAA 3TCZA 5HT1A 1HJVA 3O5LA 3UQAA 4N19A 4W5UA 3OA5A 4LAWA 1BL4A 2M1IA 2ZR5A 4DRKA 1O6IA 5GPGA 3PRDA 3RGCA 4TYOA 1W9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ROU A;  1D7I A;  2RUR A;  1U79 A;  3I6C A;  1Q6U A;  2PPN A;  3O5P A;  1W26 A;  1FJD A;  1R9H A;  1FD9 A;  3IHZ A;  2PPP A;  4DZ3 A;  4J4O A;  3KAB A;  2FAP A;  1QPF A;  2F2D A;  3GPK A;  3JYJ A;  3KAF A;  1ZK6 A;  3CGN A;  3EY6 A;  3KAD A;  1ZCN A;  2MPH A;  4U85 A;  4DZ2 A;  4DRN A;  2ZQT A;  1F40 A;  1Y0O A;  3IK8 A;  2XP6 A;  1QZ2 A;  1YAT A;  4MSP A;  2ZQV A;  4DRO A;  4ODO A;  4W9P A;  2ZQS A;  2N87 A;  2XP9 A;  3JYM A;  4JFI A;  5HTG A;  3FAP A;  4ODQ A;  2Q5A A;  3UI4 A;  2KI3 A;  5HW8 A;  2IF4 A;  2KFW A;  3NI6 A;  1EQ3 A;  1L1P A;  2XP4 A;  3O5E A;  5J6E A;  5I98 A;  4MGV A;  3CGM A;  4ITZ A;  4U86 A;  5HWB A;  2MNT A;  3B7X A;  2F21 A;  2MF9 A;  4JFK A;  2JZV A;  2VCD A;  2FKE A;  1FKG A;  2RUD A;  2XP8 A;  5HKG A;  2DG9 A;  1J6Y A;  2Y78 A;  1B6C A;  2KE0 A;  2RQS A;  3KAI A;  4C02 B;  4DH0 A;  1Q6I A;  2D9F A;  2RSE A;  3O5I A;  3TC5 A;  2MLY A;  5HW7 A;  5HWC A;  4BF8 A;  1FKK A;  1N1A A;  3O5K A;  2XP7 A;  1FKH A;  3NTP A;  4LAX A;  2M2A A;  2RUQ A;  2ZQU A;  3NRK A;  4J4N A;  4QIB A;  1ROT A;  4R0X A;  4TW7 A;  5BXJ A;  1FKL A;  4TW6 A;  3PRB A;  4G2P A;  5DIV A;  2KO7 A;  3VAW A;  1D6O A;  4DT4 A;  4TW8 A;  1NMW A;  1Q6H A;  3KCE A;  2ZR6 A;  3KAC A;  4JFM A;  1T11 A;  3KAG A;  5B8I C;  4QT2 A;  3PA7 A;  3TDB A;  2XPB A;  3LUO A;  3O5M A;  2PV1 A;  4G50 A;  2UZ5 A;  2MLX A;  2L2S A;  2XP5 A;  5D75 A;  3O5F A;  4IPX A;  1FKB A;  2PV2 A;  4DRQ A;  3O5R A;  4DRH A;  1JVW A;  1KT0 A;  1A7X A;  1M5Y A;  1NMV A;  3O5D A;  4DRP A;  1PBK A;  4ODK A;  2ZR4 A;  4O2T A;  3JXV A;  3RFW A;  4LAY A;  2DG4 A;  4DRI A;  3MDY B;  1F8A B;  1FKJ A;  1YW5 A;  2LGO A;  2RUC A;  2LJ4 A;  4NNR A;  4ODR A;  3O5J A;  4U84 A;  1FKD A;  3UF8 A;  2LPV A;  4JYS A;  1FKI A;  1BKF A;  1J4H A;  1KT1 A;  1QPL A;  3ODK A;  4FN2 A;  4JFL A;  3WH0 A;  2K8I A;  5HUA A;  1JNT A;  4ODL A;  1TCO C;  2PPO A;  4DIP A;  4GIV A;  1D7J A;  1FKS A;  3O5O A;  5HW6 A;  1Q1C A;  2MLZ A;  3KAH A;  1C9H A;  3IKG A;  2AWG A;  4IQ2 A;  2OFN A;  1FKR A;  4TX0 A;  1P5Q A;  3UQB A;  3UQI A;  1NSG A;  1D7H A;  3UI5 A;  4TNS A;  4W9Q A;  4IQC A;  4ODN A;  2LKN A;  4GGQ A;  4FAP A;  4JFJ A;  4ODP A;  1FKT A;  1FKF A;  2VN1 A;  4QT3 A;  4W9O A;  1J4R A;  2XP3 A;  5DIU A;  5HT1 A;  3O5L A;  3TCZ A;  1HXV A;  2PBC A;  3OOB A;  4N19 A;  3UQA A;  5DIT A;  4LAW A;  1BL4 A;  2M1I A;  2ZR5 A;  4DRK A;  4DRM A;  4DRJ A;  1EYM A;  1JNS A;  4ODM A;  5GPG A;  3IKD A;  3PRD A;  3RGC A;  1PIN A;  4TYO A;  2KGJ A;  3KZ7 A;  2DG3 A;  2ITK A;  2KR7 A;  3H9R B;  4LAV A;  3UI6 A;  2PV3 A;  3O5Q A;  2XPA A;  1J4I A;  2M08 A;  3O5G A;  1FAP A;  2F4E A; 
#chains in the Genus database with same CATH topology
 4Z2K A;  1U79 A;  4NZC A;  2A3A A;  4MTV A;  1W26 A;  4J4O A;  3GPK A;  3EY6 A;  1NWR A;  4S3K A;  4Q7N A;  4DZ2 A;  4QZV B;  4HAR A;  2ZQV A;  4P8U A;  2O9O A;  2XP4 A;  3FY1 A;  4WJX A;  1LL6 A;  2A3C A;  4L72 B;  2JZV A;  2YBU A;  2RUD A;  2AOS A;  2WM0 A;  4L3N A;  1J6Y A;  4DH0 A;  1ZBV A;  2YBT A;  3O5I A;  1ZBW A;  2MLY A;  4BF8 A;  3EIP A;  1HKM A;  2M2A A;  4TW7 A;  1SYT A;  2QF8 A;  1HJW A;  3CHE A;  4Z2G A;  2KO7 A;  3VAW A;  5GPR A;  1D6O A;  4WK9 A;  4DT4 A;  4TW8 A;  1NMW A;  1E9L A;  4JFM A;  3ARX A;  4QT2 A;  3TDB A;  3LUO A;  2ETN A;  5D75 A;  4IPX A;  3PRA A;  5DO2 A;  1ITX A;  4HBO A;  4ODK A;  4AY1 A;  1JND A;  2DSZ A;  3FXY A;  2LJ4 A;  4S3J A;  1J4H A;  1KT1 A;  1W9U A;  4JFL A;  4ODL A;  1EIB A;  2F23 A;  4DIP A;  1D7J A;  1FKS A;  3CHC A;  2MLZ A;  3KAH A;  1LG1 A;  1JNE A;  4IQ2 A;  1FKR A;  1P5Q A;  1WAW A;  3ARY A;  3UI5 A;  2LKN A;  3ARU A;  4GGQ A;  2DSW A;  1FKF A;  4W9O A;  1HJX A;  2XP3 A;  5DIT A;  3WL1 A;  1NWU A;  2IUZ A;  4KR0 B;  4DWS D;  3UI6 A;  4DWS C;  2DG3 A;  2ITK A;  1WB0 A;  1OWQ A;  3O5G A;  2RUR A;  3BXW A;  4WKH A;  3O5P A;  1OGG A;  1CTN A;  2F2D A;  3JYJ A;  3KAF A;  3CGN A;  4MNL A;  2DT0 A;  1E6N A;  1Y0O A;  3WQW A;  3B8S A;  2G8Z A;  4IT6 A;  1NWT A;  4ML4 A;  3AQU A;  2XP9 A;  4ODO A;  3FAP A;  2WK2 A;  2Q5A A;  3NI6 A;  1EQ3 A;  1L1P A;  4MGV A;  4ITZ A;  4UDM A;  4XAK A;  3B7X A;  2F21 A;  4JFK A;  2DG9 A;  1Q6I A;  5HWC A;  1TFV A;  3O5K A;  2ESC A;  1FKH A;  1LL4 A;  3RM8 A;  4J4N A;  4LGX A;  4QIB A;  1EDQ A;  3CZ8 A;  2FDM A;  1FKL A;  4TW6 A;  3WD0 A;  1EHN A;  1X6N A;  1W9V A;  2EUL A;  3WL0 A;  4P8X A;  3ART A;  2WLY A;  1FKB A;  2PV2 A;  3B9D A;  4DRQ A;  3ARW A;  3ARQ A;  2P4V A;  1NMV A;  4DRP A;  3ARR A;  3ARV A;  3ALF A;  4LAY A;  3AS2 A;  1F8A B;  2RUC A;  4ODR A;  1ZL1 A;  3UF8 A;  4NNR A;  3CH9 A;  1OGB A;  5HBF A;  1BKF A;  4MNK A;  1TCO C;  2PPO A;  2WLZ A;  4GIV A;  3O5O A;  3CHD A;  5HW6 A;  1Q1C A;  4P8W A;  2AWG A;  2OFN A;  4TX0 A;  3UQB A;  3UQI A;  1NSG A;  1D7H A;  3WD1 A;  4ODN A;  4FAP A;  4P8V A;  4URI A;  1H0G A;  5DIU A;  1HXV A;  3WIJ A;  3OOB A;  3WD2 A;  1HKK A;  1ZBC A;  4ZS6 A;  4DRM A;  1EYM A;  3IKD A;  1PIN A;  3KZ7 A;  4Q22 A;  4LAV A;  2O92 A;  5HUA A;  1ZB5 A;  1FAP A;  2F4E A;  2A3E A;  1Q6U A;  2PPN A;  4NSB A;  1FJD A;  3AS3 A;  4IT4 A;  3IHZ A;  4DZ3 A;  2B5U B;  1KFW A;  4WIW A;  1ZK6 A;  2MPH A;  3W4R A;  2OLH A;  1UR8 A;  1F40 A;  1QZ2 A;  1E44 A;  4DRO A;  1SR0 A;  1LL7 A;  1GUV A;  2ZQS A;  2N87 A;  3GTY X;  1W1Y A;  3AS1 A;  4MNM A;  5HTG A;  1NWS A;  3ARS A;  3UI4 A;  1ZU8 A;  2KFW A;  3O5E A;  4ZPW R;  5I98 A;  5J6E A;  4DWS A;  3CGM A;  5HWB A;  2MNT A;  2MF9 A;  4MPK A;  2XP8 A;  1FKG A;  3G6M A;  1W1V A;  2Y78 A;  1B6C A;  3KAI A;  4C02 B;  2RSE A;  2D9F A;  1E15 A;  1FKK A;  1ZBK A;  3G6L A;  2XP7 A;  4Z2J A;  3NTP A;  4LAX A;  1E6R A;  1ROT A;  4DWS B;  5BXJ A;  3PRB A;  1WNO A;  4G2P A;  1E6Z A;  1W1P A;  2PI6 A;  1Q6H A;  3KCE A;  2ZR6 A;  5JH8 A;  1T11 A;  3BMB A;  3PA7 A;  2XPB A;  3CHF A;  3RM9 A;  2DT2 A;  1D2K A;  4ZPT R;  2PV1 A;  2MLX A;  2L2S A;  3ARP A;  1NH6 A;  1JVW A;  1A7X A;  1M5Y A;  1RD6 A;  4R5E A;  1PBK A;  1X6L A;  4WKF A;  3RM4 A;  1JCH B;  3JXV A;  2DG4 A;  2G41 A;  1FKJ A;  2LGO A;  4U84 A;  2LPV A;  3ALG A;  1IX5 A;  4Z2H A;  3ODK A;  2K8I A;  3WKZ A;  1C9H A;  3IKG A;  1W1T A;  4W9Q A;  1GPF A;  4JFJ A;  5GQB A;  2VN1 A;  1J4R A;  4Z2I A;  2PBC A;  1VF8 A;  4DRJ A;  1JNS A;  4ODM A;  2KGJ A;  2KR7 A;  3H9R B;  2PV3 A;  3O5Q A;  2XPA A;  1J4I A;  2M08 A;  5DEZ A;  4Z2L A;  4ZPV R;  1ROU A;  1D7I A;  3I6C A;  2PN0 A;  1R9H A;  1FD9 A;  2DT1 A;  2DPE A;  2PPP A;  1HKJ A;  3RME A;  3KAB A;  2FAP A;  1QPF A;  3KAD A;  3ARO A;  1ZCN A;  4U85 A;  4DRN A;  2ZQT A;  3AS0 A;  3IK8 A;  2XP6 A;  1YAT A;  4MSP A;  4W9P A;  3JYM A;  1LJY A;  4JFI A;  4ODQ A;  4MAV A;  5HW8 A;  2KI3 A;  2IF4 A;  3B9E A;  4U86 A;  4MNJ A;  2VCD A;  2FKE A;  5HKG A;  2KE0 A;  2RQS A;  1GOI A;  5DF0 A;  3TC5 A;  5HW7 A;  1N1A A;  2RUQ A;  2B31 A;  2ZQU A;  3NRK A;  4R0X A;  5DIV A;  3ARZ A;  2DSV A;  1HKI A;  3KAC A;  3KAG A;  5B8I C;  3WQV A;  4PTM A;  1H0I A;  3O5M A;  3WD4 A;  4G50 A;  3PR9 A;  2UZ5 A;  1XHG A;  2XP5 A;  3O5F A;  1UR9 A;  2A3B A;  4KQZ A;  3O5R A;  1XRV A;  4DRH A;  1KT0 A;  3O5D A;  3GU0 A;  3WD3 A;  1FFQ A;  2ZR4 A;  3QOK A;  1E6P A;  4O2T A;  1LG2 A;  3RFW A;  4DRI A;  1FFR A;  3MDY B;  1YW5 A;  2DT3 A;  3O5J A;  1FKD A;  4JYS A;  1FKI A;  1LQ0 A;  1QPL A;  4HBE A;  4FN2 A;  3WH0 A;  1JNT A;  1K9T A;  2DSU A;  4TNS A;  4IQC A;  3B9A A;  1GRJ A;  4ODP A;  1FKT A;  4QT3 A;  4WKA A;  3TCZ A;  5HT1 A;  1HJV A;  3O5L A;  3UQA A;  4N19 A;  4W5U A;  3OA5 A;  4LAW A;  1BL4 A;  2M1I A;  2ZR5 A;  4DRK A;  1O6I A;  5GPG A;  3PRD A;  3RGC A;  4TYO A;  1W9P A; 
#chains in the Genus database with same CATH homology
 4Z2K A;  1U79 A;  4NZC A;  2A3A A;  4MTV A;  1W26 A;  4J4O A;  3GPK A;  3EY6 A;  1NWR A;  4S3K A;  4Q7N A;  4DZ2 A;  4QZV B;  4HAR A;  2ZQV A;  4P8U A;  2O9O A;  2XP4 A;  3FY1 A;  4WJX A;  1LL6 A;  2A3C A;  4L72 B;  2JZV A;  2YBU A;  2RUD A;  2AOS A;  2WM0 A;  4L3N A;  1J6Y A;  4DH0 A;  1ZBV A;  2YBT A;  3O5I A;  1ZBW A;  2MLY A;  4BF8 A;  1HKM A;  2M2A A;  4TW7 A;  1SYT A;  2QF8 A;  1HJW A;  3CHE A;  4Z2G A;  2KO7 A;  3VAW A;  5GPR A;  1D6O A;  4WK9 A;  4DT4 A;  4TW8 A;  1NMW A;  1E9L A;  4JFM A;  3ARX A;  4QT2 A;  3TDB A;  3LUO A;  5D75 A;  4IPX A;  3PRA A;  5DO2 A;  1ITX A;  4HBO A;  4ODK A;  4AY1 A;  1JND A;  2DSZ A;  3FXY A;  2LJ4 A;  4S3J A;  1J4H A;  1KT1 A;  1W9U A;  4JFL A;  4ODL A;  1EIB A;  4DIP A;  1D7J A;  1FKS A;  3CHC A;  2MLZ A;  3KAH A;  1LG1 A;  1JNE A;  4IQ2 A;  1FKR A;  1P5Q A;  1WAW A;  3ARY A;  3UI5 A;  2LKN A;  3ARU A;  4GGQ A;  2DSW A;  1FKF A;  4W9O A;  1HJX A;  2XP3 A;  5DIT A;  3WL1 A;  1NWU A;  2IUZ A;  4KR0 B;  4DWS D;  3UI6 A;  4DWS C;  2DG3 A;  2ITK A;  1WB0 A;  1OWQ A;  3O5G A;  2RUR A;  3BXW A;  4WKH A;  3O5P A;  1OGG A;  1CTN A;  2F2D A;  3JYJ A;  3KAF A;  3CGN A;  4MNL A;  2DT0 A;  1E6N A;  1Y0O A;  3WQW A;  3B8S A;  2G8Z A;  4IT6 A;  1NWT A;  4ML4 A;  3AQU A;  2XP9 A;  4ODO A;  3FAP A;  2WK2 A;  2Q5A A;  3NI6 A;  1EQ3 A;  1L1P A;  4MGV A;  4ITZ A;  4XAK A;  3B7X A;  2F21 A;  4JFK A;  2DG9 A;  1Q6I A;  5HWC A;  1TFV A;  3O5K A;  2ESC A;  1FKH A;  1LL4 A;  3RM8 A;  4J4N A;  4LGX A;  4QIB A;  1EDQ A;  3CZ8 A;  2FDM A;  1FKL A;  4TW6 A;  3WD0 A;  1EHN A;  1X6N A;  1W9V A;  3WL0 A;  4P8X A;  3ART A;  2WLY A;  1FKB A;  2PV2 A;  3B9D A;  4DRQ A;  3ARW A;  3ARQ A;  1NMV A;  4DRP A;  3ARR A;  3ARV A;  3ALF A;  4LAY A;  3AS2 A;  1F8A B;  2RUC A;  4ODR A;  1ZL1 A;  3UF8 A;  4NNR A;  3CH9 A;  1OGB A;  5HBF A;  1BKF A;  4MNK A;  1TCO C;  2PPO A;  2WLZ A;  4GIV A;  3O5O A;  3CHD A;  5HW6 A;  1Q1C A;  4P8W A;  2AWG A;  2OFN A;  4TX0 A;  3UQB A;  3UQI A;  1NSG A;  1D7H A;  3WD1 A;  4ODN A;  4FAP A;  4P8V A;  4URI A;  1H0G A;  5DIU A;  1HXV A;  3WIJ A;  3OOB A;  3WD2 A;  1HKK A;  1ZBC A;  4ZS6 A;  4DRM A;  1EYM A;  3IKD A;  1PIN A;  3KZ7 A;  4Q22 A;  4LAV A;  2O92 A;  5HUA A;  1ZB5 A;  1FAP A;  2F4E A;  2A3E A;  1Q6U A;  2PPN A;  4NSB A;  1FJD A;  3AS3 A;  4IT4 A;  3IHZ A;  4DZ3 A;  1KFW A;  4WIW A;  1ZK6 A;  2MPH A;  3W4R A;  2OLH A;  1UR8 A;  1F40 A;  1QZ2 A;  4DRO A;  1SR0 A;  1LL7 A;  1GUV A;  2ZQS A;  2N87 A;  1W1Y A;  3AS1 A;  4MNM A;  5HTG A;  1NWS A;  3ARS A;  3UI4 A;  1ZU8 A;  2KFW A;  3O5E A;  4ZPW R;  5I98 A;  5J6E A;  4DWS A;  3CGM A;  5HWB A;  2MNT A;  2MF9 A;  4MPK A;  2XP8 A;  1FKG A;  3G6M A;  1W1V A;  2Y78 A;  1B6C A;  3KAI A;  4C02 B;  2RSE A;  2D9F A;  1E15 A;  1FKK A;  1ZBK A;  3G6L A;  2XP7 A;  4Z2J A;  3NTP A;  4LAX A;  1E6R A;  1ROT A;  4DWS B;  5BXJ A;  3PRB A;  1WNO A;  4G2P A;  1E6Z A;  1W1P A;  2PI6 A;  1Q6H A;  3KCE A;  2ZR6 A;  5JH8 A;  1T11 A;  3PA7 A;  2XPB A;  3CHF A;  3RM9 A;  2DT2 A;  1D2K A;  4ZPT R;  2PV1 A;  2MLX A;  2L2S A;  3ARP A;  1NH6 A;  1JVW A;  1A7X A;  1M5Y A;  1RD6 A;  4R5E A;  1PBK A;  1X6L A;  4WKF A;  3RM4 A;  3JXV A;  2DG4 A;  2G41 A;  1FKJ A;  2LGO A;  4U84 A;  2LPV A;  3ALG A;  1IX5 A;  4Z2H A;  3ODK A;  2K8I A;  3WKZ A;  1C9H A;  3IKG A;  1W1T A;  4W9Q A;  1GPF A;  4JFJ A;  5GQB A;  2VN1 A;  1J4R A;  4Z2I A;  2PBC A;  1VF8 A;  4DRJ A;  1JNS A;  4ODM A;  2KGJ A;  2KR7 A;  3H9R B;  2PV3 A;  3O5Q A;  2XPA A;  1J4I A;  2M08 A;  5DEZ A;  4Z2L A;  4ZPV R;  1ROU A;  1D7I A;  3I6C A;  1R9H A;  1FD9 A;  2DT1 A;  2DPE A;  2PPP A;  1HKJ A;  3RME A;  3KAB A;  2FAP A;  1QPF A;  3KAD A;  3ARO A;  1ZCN A;  4U85 A;  4DRN A;  2ZQT A;  3AS0 A;  3IK8 A;  2XP6 A;  1YAT A;  4MSP A;  4W9P A;  3JYM A;  1LJY A;  4JFI A;  4ODQ A;  4MAV A;  5HW8 A;  2KI3 A;  2IF4 A;  3B9E A;  4U86 A;  4MNJ A;  2VCD A;  2FKE A;  5HKG A;  2KE0 A;  2RQS A;  1GOI A;  5DF0 A;  3TC5 A;  5HW7 A;  1N1A A;  2RUQ A;  2B31 A;  2ZQU A;  3NRK A;  4R0X A;  5DIV A;  3ARZ A;  2DSV A;  1HKI A;  3KAC A;  3KAG A;  5B8I C;  3WQV A;  4PTM A;  1H0I A;  3O5M A;  3WD4 A;  4G50 A;  3PR9 A;  2UZ5 A;  1XHG A;  2XP5 A;  3O5F A;  1UR9 A;  2A3B A;  4KQZ A;  3O5R A;  1XRV A;  4DRH A;  1KT0 A;  3O5D A;  3WD3 A;  1FFQ A;  2ZR4 A;  3QOK A;  1E6P A;  4O2T A;  1LG2 A;  3RFW A;  4DRI A;  1FFR A;  3MDY B;  1YW5 A;  2DT3 A;  3O5J A;  1FKD A;  4JYS A;  1FKI A;  1LQ0 A;  1QPL A;  4HBE A;  4FN2 A;  3WH0 A;  1JNT A;  1K9T A;  2DSU A;  4TNS A;  4IQC A;  3B9A A;  4ODP A;  1FKT A;  4QT3 A;  4WKA A;  3TCZ A;  5HT1 A;  1HJV A;  3O5L A;  3UQA A;  4N19 A;  4W5U A;  3OA5 A;  4LAW A;  1BL4 A;  2M1I A;  2ZR5 A;  4DRK A;  1O6I A;  5GPG A;  3PRD A;  3RGC A;  4TYO A;  1W9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...