1J4IA

Crystal structure analysis of the fkbp12 complexed with 000308 small molecule
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FKBP12
publication title Design and structure-based study of new potential FKBP12 inhibitors
pubmed rcsb
source organism Homo sapiens
total genus 28
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1j4iA00
4JFJA 2XP6A 4JFLA 1C9HA 3JXVA 3OOBA 5HKGA 1FKJA 4G50A 1NMVA 3UI5A 3TCZA 1FKBA 1FKHA 1TCOC 1J6YA 2UZ5A 4TW6A 5B8IC 4DRJA 5J6EA 1FKDA 3WH0A 4IQCA 1QPLA 1KT1A 3O5EA 4J4NA 3FAPA 4TX0A 5DIUA 3TDBA 1JNSA 4TW8A 3CGMA 3B7XA 1FKLA 2F2DA 1F8AB 3KAIA 2K8IA 2PV1A 4DRQA 2PV3A 3KZ7A 5HT1A 2LKNA 4LAXA 5HW7A 4N19A 2KR7A 3KADA 3PA7A 4ITZA 3UI4A 3UQAA 1D7HA 2ZQVA 1EYMA 4ODKA 1PBKA 3CGNA 3O5IA 1ZCNA 2VN1A 2F21A 1FAPA 1BKFA 3NI6A 4GIVA 4U84A 3O5KA 2RQSA 4FN2A 1D7JA 1FKFA 4IQ2A 2XP8A 3I6CA 3UF8A 2MNTA 5I98A 4LAYA 3PRDA 4ODQA 4DZ3A 2XP5A 3NRKA 3O5RA 2LJ4A 3H9RB 4BF8A 2XP3A 2DG4A 1JVWA 4R0XA 2PPNA 2XP9A 3IK8A 1U79A 3KCEA 4G2PA 4ODLA 1J4HA 1Q6HA 3RFWA 2PBCA 1ROUA 2VCDA 4ODPA 3O5PA 1R9HA 4TNSA 3KABA 4DZ2A 2PPOA 4DRKA 2MLYA 1PINA 1T11A 2XP7A 3IKGA 2XP4A 2M2AA 3IHZA 2F4EA 2MLXA 3KAFA 4JFMA 2KGJA 5DITA 4TYOA 2LPVA 2ZQUA 2AWGA 1FKTA 3O5MA 3UQIA 3JYMA 1Q1CA 2ZR5A 4FAPA 1J4IA 4LAWA 3O5OA 2KI3A 1FD9A 1ZK6A 2LGOA 4QT2A 5HWBA 3O5FA 3O5JA 4DRIA 4QIBA 1W26A 2DG9A 2ITKA 2MF9A 1FKKA 2M1IA 2Y78A 4ODMA 4DIPA 1F40A 4C02B 4DRMA 5HWCA 4W9QA 5HW8A 2XPAA 2RUCA 3KAHA 4JFIA 2IF4A 1Q6IA 2DG3A 1Q6UA 4ODNA 4DH0A 1FKRA 2OFNA 4W9PA 4DRHA 4MGVA 2KFWA 2M08A 5GPGA 1ROTA 3PRBA 5HUAA 5D75A 1M5YA 2Q5AA 1FJDA 4TW7A 4J4OA 1D7IA 3NTPA 1FKSA 1QZ2A 3EY6A 3KACA 3O5LA 2ZQSA 1YW5A 1NMWA 4DROA 2RUQA 3UI6A 5BXJA 4GGQA 1HXVA 3IKDA 2L2SA 2ZR4A 4NNRA 2RURA 4O2TA 1P5QA 1EQ3A 2PPPA 4ODOA 5HTGA 3JYJA 1D6OA 1J4RA 2N87A 1KT0A 1YATA 2XPBA 4IPXA 4U85A 1Y0OA 3ODKA 4DT4A 2RSEA 2FKEA 4JFKA 1BL4A 3O5GA 1JNTA 1N1AA 3GPKA 3VAWA 2JZVA 2PV2A 4U86A 2KE0A 3TC5A 2ZR6A 5DIVA 1L1PA 2KO7A 2ZQTA 4JYSA 4DRPA 1FKIA 2D9FA 4LAVA 4ODRA 2MPHA 1QPFA 2RUDA 1NSGA 2MLZA 3UQBA 2FAPA 4QT3A 4W9OA 3O5QA 1B6CA 4MSPA 3LUOA 3MDYB 1A7XA 3KAGA 3RGCA 1FKGA 4DRNA 5HW6A 3O5DA
chains in the Genus database with same CATH superfamily
1ITXA 3PR9A 4JFLA 4Z2LA 3OOBA 5HKGA 4G50A 1NMVA 1OGBA 2AOSA 3WH0A 5J6EA 1QPLA 1KT1A 3WQVA 1LL7A 4TW8A 3CGMA 2IUZA 2DPEA 3PRAA 1D2KA 2K8IA 4DRQA 4URIA 1GUVA 5HT1A 3PA7A 4ITZA 4Z2KA 2ZQVA 2DSUA 2DSZA 2VN1A 2F21A 1FAPA 1BKFA 4MNJA 4U84A 2XP8A 4UDMA 5DO2A 1XHGA 4NZCA 1LQ0A 3O5RA 2WLYA 2FDMA 1HKKA 1U79A 4ODLA 1Q6HA 1HKMA 1ROUA 2VCDA 3O5PA 3ARXA 1PINA 2DSWA 3WL1A 2XP4A 2M2AA 3B9AA 4JFMA 1EDQA 1W1YA 3ARVA 3O5MA 3UQIA 3O5OA 2LGOA 1W26A 2ITKA 1HKIA 1OWQA 3FXYA 4DIPA 4DRMA 4JFIA 3ARPA 3ALGA 1W1PA 1Q6UA 4ODNA 4DH0A 4W9PA 2OLHA 4Z2HA 3CZ8A 4WK9A 1JCHB 5D75A 3FY1A 3WQWA 1IX5A 4TW7A 1X6NA 4WJXA 1FKSA 3EY6A 1YW5A 4GGQA 2RURA 4ODOA 4LGXA 1O6IA 1NWSA 3WD3A 3O5GA 1N1AA 3B9DA 1XRVA 1ZL1A 2KO7A 4JYSA 4IT4A 4LAVA 2MPHA 1E6ZA 1B6CA 4W5UA 4MSPA 3MDYB 1FKGA 4DRNA 4QZVB 3O5DA 4S3JA 4XAKA 4JFJA 1HJVA 1E6NA 4WIWA 1NWUA 3JXVA 1FKJA 1GPFA 1TCOC 1E44A 1EIBA 2UZ5A 5HBFA 4DRJA 4HBOA 1JNSA 3ARSA 2F2DA 1KFWA 2EULA 3AS3A 5HW7A 2KR7A 3NI6A 4GIVA 3WL0A 4L72B 4HBEA 3UF8A 3G6MA 4DZ3A 1GRJA 2XP3A 2DG4A 3ARZA 4P8UA 1JVWA 3IK8A 2XP9A 3KCEA 1HKJA 4HARA 3WIJA 1J4HA 3RFWA 3KABA 4DZ2A 4DRKA 1ZBWA 1CTNA 3IHZA 1E9LA 2MLXA 3KAFA 2ETNA 4P8VA 2AWGA 2WM0A 3WKZA 2YBTA 2ZR5A 4P8WA 4QT2A 1FD9A 1ZK6A 3RM4A 3O5JA 1F40A 4ODMA 1FKKA 4MNLA 5HWCA 4W9QA 1JNDA 1NH6A 4MAVA 1FKRA 2OFNA 4DRHA 4AY1A 2M08A 3GU0A 2QF8A 1FFQA 5HUAA 3ARRA 4J4OA 1D7IA 3O5LA 1QZ2A 4DROA 3WD1A 3UI6A 3GTYX 3IKDA 2ZR4A 4MTVA 1P5QA 1EQ3A 2PPPA 1D6OA 1J4RA 2N87A 2A3AA 1YATA 4U85A 1Y0OA 3ODKA 2RSEA 2B31A 1JNTA 5GQBA 2PV2A 4U86A 2KE0A 3TC5A 2ZR6A 3AS0A 1L1PA 4MNMA 4DRPA 2YBUA 1QPFA 2RUDA 1NSGA 2MLZA 2FAPA 4W9OA 3O5QA 1UR9A 3EIPA 3KAGA 3AS1A 2DT1A 3B9EA 1E15A 1C9HA 3CHCA 3UI5A 1J6YA 4TW6A 4ZPWR 3AROA 5B8IC 4IQCA 1HJWA 3O5EA 4J4NA 3FAPA 3TDBA 2G8ZA 2A3CA 3CH9A 1E6PA 3B8SA 1F8AB 2O9OA 2PV1A 3ARYA 2LKNA 2G41A 3QOKA 3UI4A 4R5EA 3UQAA 1LG1A 1D7HA 1EYMA 4ODKA 3O5IA 1ZCNA 3O5KA 2RQSA 4IQ2A 1WNOA 5I98A 4MPKA 4ODQA 2XP5A 3NRKA 3WD0A 2LJ4A 3H9RB 1W1VA 3CHEA 3RM8A 4S3KA 3AQUA 1NWTA 4ODPA 1R9HA 1W1TA 2WLZA 4DWSD 1T11A 1GOIA 2A3EA 3IKGA 4Z2GA 5DITA 2LPVA 2ZQUA 4ML4A 4P8XA 1ZBKA 1J4IA 4LAWA 5HWBA 2KI3A 3O5FA 4DRIA 4NSBA 4QIBA 1W9UA 3G6LA 5HW8A 3WD2A 3KAHA 1JNEA 1Q6IA 2DG3A 4Z2IA 3ARTA 2KFWA 1LJYA 1ROTA 3CHDA 3PRBA 1VF8A 1OGGA 4L3NA 2ZQSA 1NMWA 1HXVA 4WKHA 4O2TA 5HTGA 3JYJA 3ALFA 2B5UB 2WK2A 4DWSC 4DT4A 1H0IA 1BL4A 1X6LA 3GPKA 3VAWA 1ZBCA 2JZVA 5DIVA 3ARUA 2ZQTA 1FKIA 1SR0A 4ODRA 1WB0A 2PI6A 3W4RA 3UQBA 3LUOA 1A7XA 2DT0A 1SYTA 5HW6A 1LL6A 4ZPVR 2XP6A 4KQZA 1ZB5A 4DWSB 3TCZA 1FKBA 1FKHA 5DF0A 1FKDA 4TX0A 1LL4A 5DIUA 1W9PA 4Q22A 3B7XA 1FKLA 3KAIA 2DT3A 2PV3A 3KZ7A 4KR0B 4LAXA 4N19A 3KADA 3WD4A 4ZS6A 1PBKA 2DT2A 1RD6A 3CGNA 2P4VA 4ZPTR 1K9TA 4FN2A 1D7JA 1FKFA 3I6CA 2MNTA 1NWRA 4LAYA 3PRDA 4WKFA 4BF8A 4R0XA 2PPNA 4G2PA 3BXWA 4MNKA 2PBCA 4TNSA 2PPOA 2MLYA 3RMEA 2O92A 2XP7A 2F4EA 2KGJA 4TYOA 1FKTA 3JYMA 1Q1CA 4FAPA 1HJXA 1FFRA 3BMBA 1W9VA 2DG9A 1H0GA 2MF9A 2M1IA 2Y78A 1WAWA 4C02B 4PTMA 2DSVA 2XPAA 2RUCA 2IF4A 4WKAA 1LG2A 5JH8A 3ARWA 4MGVA 5GPGA 1E6RA 1TFVA 1ZBVA 1M5YA 4Q7NA 2Q5AA 1FJDA 3NTPA 3KACA 4IT6A 2PN0A 2RUQA 5BXJA 3RM9A 2L2SA 4NNRA 2ESCA 1EHNA 1KT0A 2F23A 2XPBA 3CHFA 4IPXA 2FKEA 4JFKA 1ZU8A 4Z2JA 3AS2A 4DWSA 2D9FA 5DEZA 5GPRA 1UR8A 4QT3A 3OA5A 3RGCA 3ARQA 2A3BA
chains in the Genus database with same CATH topology
1ITXA 3PR9A 4JFLA 4Z2LA 3OOBA 5HKGA 4G50A 1NMVA 1OGBA 2AOSA 3WH0A 5J6EA 1QPLA 1KT1A 3WQVA 1LL7A 4TW8A 3CGMA 2IUZA 2DPEA 3PRAA 1D2KA 2K8IA 4DRQA 4URIA 1GUVA 5HT1A 3PA7A 4ITZA 4Z2KA 2ZQVA 2DSUA 2DSZA 2VN1A 2F21A 1FAPA 1BKFA 4MNJA 4U84A 2XP8A 5DO2A 1XHGA 4NZCA 1LQ0A 3O5RA 2WLYA 2FDMA 1HKKA 1U79A 4ODLA 1Q6HA 1HKMA 1ROUA 2VCDA 3O5PA 3ARXA 1PINA 2DSWA 3WL1A 2XP4A 2M2AA 3B9AA 4JFMA 1EDQA 1W1YA 3ARVA 3O5MA 3UQIA 3O5OA 2LGOA 1W26A 2ITKA 1HKIA 1OWQA 3FXYA 4DIPA 4DRMA 4JFIA 3ARPA 3ALGA 1W1PA 1Q6UA 4ODNA 4DH0A 4W9PA 2OLHA 4Z2HA 3CZ8A 4WK9A 5D75A 3FY1A 3WQWA 1IX5A 4TW7A 1X6NA 4WJXA 1FKSA 3EY6A 1YW5A 4GGQA 2RURA 4ODOA 4LGXA 1O6IA 1NWSA 3WD3A 3O5GA 1N1AA 3B9DA 1XRVA 1ZL1A 2KO7A 4JYSA 4IT4A 4LAVA 2MPHA 1E6ZA 1B6CA 4W5UA 4MSPA 3MDYB 1FKGA 4DRNA 4QZVB 3O5DA 4S3JA 4XAKA 4JFJA 1HJVA 1E6NA 4WIWA 1NWUA 3JXVA 1FKJA 1GPFA 1TCOC 1EIBA 2UZ5A 5HBFA 4DRJA 4HBOA 1JNSA 3ARSA 2F2DA 1KFWA 3AS3A 5HW7A 2KR7A 3NI6A 4GIVA 3WL0A 4L72B 4HBEA 3UF8A 3G6MA 4DZ3A 2XP3A 2DG4A 3ARZA 4P8UA 1JVWA 3IK8A 2XP9A 3KCEA 1HKJA 4HARA 3WIJA 1J4HA 3RFWA 3KABA 4DZ2A 4DRKA 1ZBWA 1CTNA 3IHZA 1E9LA 2MLXA 3KAFA 4P8VA 2AWGA 2WM0A 3WKZA 2YBTA 2ZR5A 4P8WA 4QT2A 1FD9A 1ZK6A 3RM4A 3O5JA 1F40A 4ODMA 1FKKA 4MNLA 5HWCA 4W9QA 1JNDA 1NH6A 4MAVA 1FKRA 2OFNA 4DRHA 4AY1A 2M08A 2QF8A 1FFQA 5HUAA 3ARRA 4J4OA 1D7IA 3O5LA 1QZ2A 4DROA 3WD1A 3UI6A 3IKDA 2ZR4A 4MTVA 1P5QA 1EQ3A 2PPPA 1D6OA 1J4RA 2N87A 2A3AA 1YATA 4U85A 1Y0OA 3ODKA 2RSEA 2B31A 1JNTA 5GQBA 2PV2A 4U86A 2KE0A 3TC5A 2ZR6A 3AS0A 1L1PA 4MNMA 4DRPA 2YBUA 1QPFA 2RUDA 1NSGA 2MLZA 2FAPA 4W9OA 3O5QA 1UR9A 3KAGA 3AS1A 2DT1A 3B9EA 1E15A 1C9HA 3CHCA 3UI5A 1J6YA 4TW6A 4ZPWR 3AROA 5B8IC 4IQCA 1HJWA 3O5EA 4J4NA 3FAPA 3TDBA 2G8ZA 2A3CA 3CH9A 1E6PA 3B8SA 1F8AB 2O9OA 2PV1A 3ARYA 2LKNA 2G41A 3QOKA 3UI4A 4R5EA 3UQAA 1LG1A 1D7HA 1EYMA 4ODKA 3O5IA 1ZCNA 3O5KA 2RQSA 4IQ2A 1WNOA 5I98A 4MPKA 4ODQA 2XP5A 3NRKA 3WD0A 2LJ4A 3H9RB 1W1VA 3CHEA 3RM8A 4S3KA 3AQUA 1NWTA 4ODPA 1R9HA 1W1TA 2WLZA 4DWSD 1T11A 1GOIA 2A3EA 3IKGA 4Z2GA 5DITA 2LPVA 2ZQUA 4ML4A 4P8XA 1ZBKA 1J4IA 4LAWA 5HWBA 2KI3A 3O5FA 4DRIA 4NSBA 4QIBA 1W9UA 3G6LA 5HW8A 3WD2A 3KAHA 1JNEA 1Q6IA 2DG3A 4Z2IA 3ARTA 2KFWA 1LJYA 1ROTA 3CHDA 3PRBA 1VF8A 1OGGA 4L3NA 2ZQSA 1NMWA 1HXVA 4WKHA 4O2TA 5HTGA 3JYJA 3ALFA 2WK2A 4DWSC 4DT4A 1H0IA 1BL4A 1X6LA 3GPKA 3VAWA 1ZBCA 2JZVA 5DIVA 3ARUA 2ZQTA 1FKIA 1SR0A 4ODRA 1WB0A 2PI6A 3W4RA 3UQBA 3LUOA 1A7XA 2DT0A 1SYTA 5HW6A 1LL6A 4ZPVR 2XP6A 4KQZA 1ZB5A 4DWSB 3TCZA 1FKBA 1FKHA 5DF0A 1FKDA 4TX0A 1LL4A 5DIUA 1W9PA 4Q22A 3B7XA 1FKLA 3KAIA 2DT3A 2PV3A 3KZ7A 4KR0B 4LAXA 4N19A 3KADA 3WD4A 4ZS6A 1PBKA 2DT2A 1RD6A 3CGNA 4ZPTR 1K9TA 4FN2A 1D7JA 1FKFA 3I6CA 2MNTA 1NWRA 4LAYA 3PRDA 4WKFA 4BF8A 4R0XA 2PPNA 4G2PA 3BXWA 4MNKA 2PBCA 4TNSA 2PPOA 2MLYA 3RMEA 2O92A 2XP7A 2F4EA 2KGJA 4TYOA 1FKTA 3JYMA 1Q1CA 4FAPA 1HJXA 1FFRA 1W9VA 2DG9A 1H0GA 2MF9A 2M1IA 2Y78A 1WAWA 4C02B 4PTMA 2DSVA 2XPAA 2RUCA 2IF4A 4WKAA 1LG2A 5JH8A 3ARWA 4MGVA 5GPGA 1E6RA 1TFVA 1ZBVA 1M5YA 4Q7NA 2Q5AA 1FJDA 3NTPA 3KACA 4IT6A 2RUQA 5BXJA 3RM9A 2L2SA 4NNRA 2ESCA 1EHNA 1KT0A 2XPBA 3CHFA 4IPXA 2FKEA 4JFKA 1ZU8A 4Z2JA 3AS2A 4DWSA 2D9FA 5DEZA 5GPRA 1UR8A 4QT3A 3OA5A 3RGCA 3ARQA 2A3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JFJ A;  2XP6 A;  4JFL A;  1C9H A;  3JXV A;  3OOB A;  5HKG A;  1FKJ A;  4G50 A;  1NMV A;  3UI5 A;  3TCZ A;  1FKB A;  1FKH A;  1TCO C;  1J6Y A;  2UZ5 A;  4TW6 A;  5B8I C;  4DRJ A;  5J6E A;  1FKD A;  3WH0 A;  4IQC A;  1QPL A;  1KT1 A;  3O5E A;  4J4N A;  3FAP A;  4TX0 A;  5DIU A;  3TDB A;  1JNS A;  4TW8 A;  3CGM A;  3B7X A;  1FKL A;  2F2D A;  1F8A B;  3KAI A;  2K8I A;  2PV1 A;  4DRQ A;  2PV3 A;  3KZ7 A;  5HT1 A;  2LKN A;  4LAX A;  5HW7 A;  4N19 A;  2KR7 A;  3KAD A;  3PA7 A;  4ITZ A;  3UI4 A;  3UQA A;  1D7H A;  2ZQV A;  1EYM A;  4ODK A;  1PBK A;  3CGN A;  3O5I A;  1ZCN A;  2VN1 A;  2F21 A;  1FAP A;  1BKF A;  3NI6 A;  4GIV A;  4U84 A;  3O5K A;  2RQS A;  4FN2 A;  1D7J A;  1FKF A;  4IQ2 A;  2XP8 A;  3I6C A;  3UF8 A;  2MNT A;  5I98 A;  4LAY A;  3PRD A;  4ODQ A;  4DZ3 A;  2XP5 A;  3NRK A;  3O5R A;  2LJ4 A;  3H9R B;  4BF8 A;  2XP3 A;  2DG4 A;  1JVW A;  4R0X A;  2PPN A;  2XP9 A;  3IK8 A;  1U79 A;  3KCE A;  4G2P A;  4ODL A;  1J4H A;  1Q6H A;  3RFW A;  2PBC A;  1ROU A;  2VCD A;  4ODP A;  3O5P A;  1R9H A;  4TNS A;  3KAB A;  4DZ2 A;  2PPO A;  4DRK A;  2MLY A;  1PIN A;  1T11 A;  2XP7 A;  3IKG A;  2XP4 A;  2M2A A;  3IHZ A;  2F4E A;  2MLX A;  3KAF A;  4JFM A;  2KGJ A;  5DIT A;  4TYO A;  2LPV A;  2ZQU A;  2AWG A;  1FKT A;  3O5M A;  3UQI A;  3JYM A;  1Q1C A;  2ZR5 A;  4FAP A;  1J4I A;  4LAW A;  3O5O A;  2KI3 A;  1FD9 A;  1ZK6 A;  2LGO A;  4QT2 A;  5HWB A;  3O5F A;  3O5J A;  4DRI A;  4QIB A;  1W26 A;  2DG9 A;  2ITK A;  2MF9 A;  1FKK A;  2M1I A;  2Y78 A;  4ODM A;  4DIP A;  1F40 A;  4C02 B;  4DRM A;  5HWC A;  4W9Q A;  5HW8 A;  2XPA A;  2RUC A;  3KAH A;  4JFI A;  2IF4 A;  1Q6I A;  2DG3 A;  1Q6U A;  4ODN A;  4DH0 A;  1FKR A;  2OFN A;  4W9P A;  4DRH A;  4MGV A;  2KFW A;  2M08 A;  5GPG A;  1ROT A;  3PRB A;  5HUA A;  5D75 A;  1M5Y A;  2Q5A A;  1FJD A;  4TW7 A;  4J4O A;  1D7I A;  3NTP A;  1FKS A;  1QZ2 A;  3EY6 A;  3KAC A;  3O5L A;  2ZQS A;  1YW5 A;  1NMW A;  4DRO A;  2RUQ A;  3UI6 A;  5BXJ A;  4GGQ A;  1HXV A;  3IKD A;  2L2S A;  2ZR4 A;  4NNR A;  2RUR A;  4O2T A;  1P5Q A;  1EQ3 A;  2PPP A;  4ODO A;  5HTG A;  3JYJ A;  1D6O A;  1J4R A;  2N87 A;  1KT0 A;  1YAT A;  2XPB A;  4IPX A;  4U85 A;  1Y0O A;  3ODK A;  4DT4 A;  2RSE A;  2FKE A;  4JFK A;  1BL4 A;  3O5G A;  1JNT A;  1N1A A;  3GPK A;  3VAW A;  2JZV A;  2PV2 A;  4U86 A;  2KE0 A;  3TC5 A;  2ZR6 A;  5DIV A;  1L1P A;  2KO7 A;  2ZQT A;  4JYS A;  4DRP A;  1FKI A;  2D9F A;  4LAV A;  4ODR A;  2MPH A;  1QPF A;  2RUD A;  1NSG A;  2MLZ A;  3UQB A;  2FAP A;  4QT3 A;  4W9O A;  3O5Q A;  1B6C A;  4MSP A;  3LUO A;  3MDY B;  1A7X A;  3KAG A;  3RGC A;  1FKG A;  4DRN A;  5HW6 A;  3O5D A; 
#chains in the Genus database with same CATH topology
 1ITX A;  3PR9 A;  4JFL A;  4Z2L A;  3OOB A;  5HKG A;  4G50 A;  1NMV A;  1OGB A;  2AOS A;  3WH0 A;  5J6E A;  1QPL A;  1KT1 A;  3WQV A;  1LL7 A;  4TW8 A;  3CGM A;  2IUZ A;  2DPE A;  3PRA A;  1D2K A;  2K8I A;  4DRQ A;  4URI A;  1GUV A;  5HT1 A;  3PA7 A;  4ITZ A;  4Z2K A;  2ZQV A;  2DSU A;  2DSZ A;  2VN1 A;  2F21 A;  1FAP A;  1BKF A;  4MNJ A;  4U84 A;  2XP8 A;  4UDM A;  5DO2 A;  1XHG A;  4NZC A;  1LQ0 A;  3O5R A;  2WLY A;  2FDM A;  1HKK A;  1U79 A;  4ODL A;  1Q6H A;  1HKM A;  1ROU A;  2VCD A;  3O5P A;  3ARX A;  1PIN A;  2DSW A;  3WL1 A;  2XP4 A;  2M2A A;  3B9A A;  4JFM A;  1EDQ A;  1W1Y A;  3ARV A;  3O5M A;  3UQI A;  3O5O A;  2LGO A;  1W26 A;  2ITK A;  1HKI A;  1OWQ A;  3FXY A;  4DIP A;  4DRM A;  4JFI A;  3ARP A;  3ALG A;  1W1P A;  1Q6U A;  4ODN A;  4DH0 A;  4W9P A;  2OLH A;  4Z2H A;  3CZ8 A;  4WK9 A;  1JCH B;  5D75 A;  3FY1 A;  3WQW A;  1IX5 A;  4TW7 A;  1X6N A;  4WJX A;  1FKS A;  3EY6 A;  1YW5 A;  4GGQ A;  2RUR A;  4ODO A;  4LGX A;  1O6I A;  1NWS A;  3WD3 A;  3O5G A;  1N1A A;  3B9D A;  1XRV A;  1ZL1 A;  2KO7 A;  4JYS A;  4IT4 A;  4LAV A;  2MPH A;  1E6Z A;  1B6C A;  4W5U A;  4MSP A;  3MDY B;  1FKG A;  4DRN A;  4QZV B;  3O5D A;  4S3J A;  4XAK A;  4JFJ A;  1HJV A;  1E6N A;  4WIW A;  1NWU A;  3JXV A;  1FKJ A;  1GPF A;  1TCO C;  1E44 A;  1EIB A;  2UZ5 A;  5HBF A;  4DRJ A;  4HBO A;  1JNS A;  3ARS A;  2F2D A;  1KFW A;  2EUL A;  3AS3 A;  5HW7 A;  2KR7 A;  3NI6 A;  4GIV A;  3WL0 A;  4L72 B;  4HBE A;  3UF8 A;  3G6M A;  4DZ3 A;  1GRJ A;  2XP3 A;  2DG4 A;  3ARZ A;  4P8U A;  1JVW A;  3IK8 A;  2XP9 A;  3KCE A;  1HKJ A;  4HAR A;  3WIJ A;  1J4H A;  3RFW A;  3KAB A;  4DZ2 A;  4DRK A;  1ZBW A;  1CTN A;  3IHZ A;  1E9L A;  2MLX A;  3KAF A;  2ETN A;  4P8V A;  2AWG A;  2WM0 A;  3WKZ A;  2YBT A;  2ZR5 A;  4P8W A;  4QT2 A;  1FD9 A;  1ZK6 A;  3RM4 A;  3O5J A;  1F40 A;  4ODM A;  1FKK A;  4MNL A;  5HWC A;  4W9Q A;  1JND A;  1NH6 A;  4MAV A;  1FKR A;  2OFN A;  4DRH A;  4AY1 A;  2M08 A;  3GU0 A;  2QF8 A;  1FFQ A;  5HUA A;  3ARR A;  4J4O A;  1D7I A;  3O5L A;  1QZ2 A;  4DRO A;  3WD1 A;  3UI6 A;  3GTY X;  3IKD A;  2ZR4 A;  4MTV A;  1P5Q A;  1EQ3 A;  2PPP A;  1D6O A;  1J4R A;  2N87 A;  2A3A A;  1YAT A;  4U85 A;  1Y0O A;  3ODK A;  2RSE A;  2B31 A;  1JNT A;  5GQB A;  2PV2 A;  4U86 A;  2KE0 A;  3TC5 A;  2ZR6 A;  3AS0 A;  1L1P A;  4MNM A;  4DRP A;  2YBU A;  1QPF A;  2RUD A;  1NSG A;  2MLZ A;  2FAP A;  4W9O A;  3O5Q A;  1UR9 A;  3EIP A;  3KAG A;  3AS1 A;  2DT1 A;  3B9E A;  1E15 A;  1C9H A;  3CHC A;  3UI5 A;  1J6Y A;  4TW6 A;  4ZPW R;  3ARO A;  5B8I C;  4IQC A;  1HJW A;  3O5E A;  4J4N A;  3FAP A;  3TDB A;  2G8Z A;  2A3C A;  3CH9 A;  1E6P A;  3B8S A;  1F8A B;  2O9O A;  2PV1 A;  3ARY A;  2LKN A;  2G41 A;  3QOK A;  3UI4 A;  4R5E A;  3UQA A;  1LG1 A;  1D7H A;  1EYM A;  4ODK A;  3O5I A;  1ZCN A;  3O5K A;  2RQS A;  4IQ2 A;  1WNO A;  5I98 A;  4MPK A;  4ODQ A;  2XP5 A;  3NRK A;  3WD0 A;  2LJ4 A;  3H9R B;  1W1V A;  3CHE A;  3RM8 A;  4S3K A;  3AQU A;  1NWT A;  4ODP A;  1R9H A;  1W1T A;  2WLZ A;  4DWS D;  1T11 A;  1GOI A;  2A3E A;  3IKG A;  4Z2G A;  5DIT A;  2LPV A;  2ZQU A;  4ML4 A;  4P8X A;  1ZBK A;  1J4I A;  4LAW A;  5HWB A;  2KI3 A;  3O5F A;  4DRI A;  4NSB A;  4QIB A;  1W9U A;  3G6L A;  5HW8 A;  3WD2 A;  3KAH A;  1JNE A;  1Q6I A;  2DG3 A;  4Z2I A;  3ART A;  2KFW A;  1LJY A;  1ROT A;  3CHD A;  3PRB A;  1VF8 A;  1OGG A;  4L3N A;  2ZQS A;  1NMW A;  1HXV A;  4WKH A;  4O2T A;  5HTG A;  3JYJ A;  3ALF A;  2B5U B;  2WK2 A;  4DWS C;  4DT4 A;  1H0I A;  1BL4 A;  1X6L A;  3GPK A;  3VAW A;  1ZBC A;  2JZV A;  5DIV A;  3ARU A;  2ZQT A;  1FKI A;  1SR0 A;  4ODR A;  1WB0 A;  2PI6 A;  3W4R A;  3UQB A;  3LUO A;  1A7X A;  2DT0 A;  1SYT A;  5HW6 A;  1LL6 A;  4ZPV R;  2XP6 A;  4KQZ A;  1ZB5 A;  4DWS B;  3TCZ A;  1FKB A;  1FKH A;  5DF0 A;  1FKD A;  4TX0 A;  1LL4 A;  5DIU A;  1W9P A;  4Q22 A;  3B7X A;  1FKL A;  3KAI A;  2DT3 A;  2PV3 A;  3KZ7 A;  4KR0 B;  4LAX A;  4N19 A;  3KAD A;  3WD4 A;  4ZS6 A;  1PBK A;  2DT2 A;  1RD6 A;  3CGN A;  2P4V A;  4ZPT R;  1K9T A;  4FN2 A;  1D7J A;  1FKF A;  3I6C A;  2MNT A;  1NWR A;  4LAY A;  3PRD A;  4WKF A;  4BF8 A;  4R0X A;  2PPN A;  4G2P A;  3BXW A;  4MNK A;  2PBC A;  4TNS A;  2PPO A;  2MLY A;  3RME A;  2O92 A;  2XP7 A;  2F4E A;  2KGJ A;  4TYO A;  1FKT A;  3JYM A;  1Q1C A;  4FAP A;  1HJX A;  1FFR A;  3BMB A;  1W9V A;  2DG9 A;  1H0G A;  2MF9 A;  2M1I A;  2Y78 A;  1WAW A;  4C02 B;  4PTM A;  2DSV A;  2XPA A;  2RUC A;  2IF4 A;  4WKA A;  1LG2 A;  5JH8 A;  3ARW A;  4MGV A;  5GPG A;  1E6R A;  1TFV A;  1ZBV A;  1M5Y A;  4Q7N A;  2Q5A A;  1FJD A;  3NTP A;  3KAC A;  4IT6 A;  2PN0 A;  2RUQ A;  5BXJ A;  3RM9 A;  2L2S A;  4NNR A;  2ESC A;  1EHN A;  1KT0 A;  2F23 A;  2XPB A;  3CHF A;  4IPX A;  2FKE A;  4JFK A;  1ZU8 A;  4Z2J A;  3AS2 A;  4DWS A;  2D9F A;  5DEZ A;  5GPR A;  1UR8 A;  4QT3 A;  3OA5 A;  3RGC A;  3ARQ A;  2A3B A; 
#chains in the Genus database with same CATH homology
 1ITX A;  3PR9 A;  4JFL A;  4Z2L A;  3OOB A;  5HKG A;  4G50 A;  1NMV A;  1OGB A;  2AOS A;  3WH0 A;  5J6E A;  1QPL A;  1KT1 A;  3WQV A;  1LL7 A;  4TW8 A;  3CGM A;  2IUZ A;  2DPE A;  3PRA A;  1D2K A;  2K8I A;  4DRQ A;  4URI A;  1GUV A;  5HT1 A;  3PA7 A;  4ITZ A;  4Z2K A;  2ZQV A;  2DSU A;  2DSZ A;  2VN1 A;  2F21 A;  1FAP A;  1BKF A;  4MNJ A;  4U84 A;  2XP8 A;  5DO2 A;  1XHG A;  4NZC A;  1LQ0 A;  3O5R A;  2WLY A;  2FDM A;  1HKK A;  1U79 A;  4ODL A;  1Q6H A;  1HKM A;  1ROU A;  2VCD A;  3O5P A;  3ARX A;  1PIN A;  2DSW A;  3WL1 A;  2XP4 A;  2M2A A;  3B9A A;  4JFM A;  1EDQ A;  1W1Y A;  3ARV A;  3O5M A;  3UQI A;  3O5O A;  2LGO A;  1W26 A;  2ITK A;  1HKI A;  1OWQ A;  3FXY A;  4DIP A;  4DRM A;  4JFI A;  3ARP A;  3ALG A;  1W1P A;  1Q6U A;  4ODN A;  4DH0 A;  4W9P A;  2OLH A;  4Z2H A;  3CZ8 A;  4WK9 A;  5D75 A;  3FY1 A;  3WQW A;  1IX5 A;  4TW7 A;  1X6N A;  4WJX A;  1FKS A;  3EY6 A;  1YW5 A;  4GGQ A;  2RUR A;  4ODO A;  4LGX A;  1O6I A;  1NWS A;  3WD3 A;  3O5G A;  1N1A A;  3B9D A;  1XRV A;  1ZL1 A;  2KO7 A;  4JYS A;  4IT4 A;  4LAV A;  2MPH A;  1E6Z A;  1B6C A;  4W5U A;  4MSP A;  3MDY B;  1FKG A;  4DRN A;  4QZV B;  3O5D A;  4S3J A;  4XAK A;  4JFJ A;  1HJV A;  1E6N A;  4WIW A;  1NWU A;  3JXV A;  1FKJ A;  1GPF A;  1TCO C;  1EIB A;  2UZ5 A;  5HBF A;  4DRJ A;  4HBO A;  1JNS A;  3ARS A;  2F2D A;  1KFW A;  3AS3 A;  5HW7 A;  2KR7 A;  3NI6 A;  4GIV A;  3WL0 A;  4L72 B;  4HBE A;  3UF8 A;  3G6M A;  4DZ3 A;  2XP3 A;  2DG4 A;  3ARZ A;  4P8U A;  1JVW A;  3IK8 A;  2XP9 A;  3KCE A;  1HKJ A;  4HAR A;  3WIJ A;  1J4H A;  3RFW A;  3KAB A;  4DZ2 A;  4DRK A;  1ZBW A;  1CTN A;  3IHZ A;  1E9L A;  2MLX A;  3KAF A;  4P8V A;  2AWG A;  2WM0 A;  3WKZ A;  2YBT A;  2ZR5 A;  4P8W A;  4QT2 A;  1FD9 A;  1ZK6 A;  3RM4 A;  3O5J A;  1F40 A;  4ODM A;  1FKK A;  4MNL A;  5HWC A;  4W9Q A;  1JND A;  1NH6 A;  4MAV A;  1FKR A;  2OFN A;  4DRH A;  4AY1 A;  2M08 A;  2QF8 A;  1FFQ A;  5HUA A;  3ARR A;  4J4O A;  1D7I A;  3O5L A;  1QZ2 A;  4DRO A;  3WD1 A;  3UI6 A;  3IKD A;  2ZR4 A;  4MTV A;  1P5Q A;  1EQ3 A;  2PPP A;  1D6O A;  1J4R A;  2N87 A;  2A3A A;  1YAT A;  4U85 A;  1Y0O A;  3ODK A;  2RSE A;  2B31 A;  1JNT A;  5GQB A;  2PV2 A;  4U86 A;  2KE0 A;  3TC5 A;  2ZR6 A;  3AS0 A;  1L1P A;  4MNM A;  4DRP A;  2YBU A;  1QPF A;  2RUD A;  1NSG A;  2MLZ A;  2FAP A;  4W9O A;  3O5Q A;  1UR9 A;  3KAG A;  3AS1 A;  2DT1 A;  3B9E A;  1E15 A;  1C9H A;  3CHC A;  3UI5 A;  1J6Y A;  4TW6 A;  4ZPW R;  3ARO A;  5B8I C;  4IQC A;  1HJW A;  3O5E A;  4J4N A;  3FAP A;  3TDB A;  2G8Z A;  2A3C A;  3CH9 A;  1E6P A;  3B8S A;  1F8A B;  2O9O A;  2PV1 A;  3ARY A;  2LKN A;  2G41 A;  3QOK A;  3UI4 A;  4R5E A;  3UQA A;  1LG1 A;  1D7H A;  1EYM A;  4ODK A;  3O5I A;  1ZCN A;  3O5K A;  2RQS A;  4IQ2 A;  1WNO A;  5I98 A;  4MPK A;  4ODQ A;  2XP5 A;  3NRK A;  3WD0 A;  2LJ4 A;  3H9R B;  1W1V A;  3CHE A;  3RM8 A;  4S3K A;  3AQU A;  1NWT A;  4ODP A;  1R9H A;  1W1T A;  2WLZ A;  4DWS D;  1T11 A;  1GOI A;  2A3E A;  3IKG A;  4Z2G A;  5DIT A;  2LPV A;  2ZQU A;  4ML4 A;  4P8X A;  1ZBK A;  1J4I A;  4LAW A;  5HWB A;  2KI3 A;  3O5F A;  4DRI A;  4NSB A;  4QIB A;  1W9U A;  3G6L A;  5HW8 A;  3WD2 A;  3KAH A;  1JNE A;  1Q6I A;  2DG3 A;  4Z2I A;  3ART A;  2KFW A;  1LJY A;  1ROT A;  3CHD A;  3PRB A;  1VF8 A;  1OGG A;  4L3N A;  2ZQS A;  1NMW A;  1HXV A;  4WKH A;  4O2T A;  5HTG A;  3JYJ A;  3ALF A;  2WK2 A;  4DWS C;  4DT4 A;  1H0I A;  1BL4 A;  1X6L A;  3GPK A;  3VAW A;  1ZBC A;  2JZV A;  5DIV A;  3ARU A;  2ZQT A;  1FKI A;  1SR0 A;  4ODR A;  1WB0 A;  2PI6 A;  3W4R A;  3UQB A;  3LUO A;  1A7X A;  2DT0 A;  1SYT A;  5HW6 A;  1LL6 A;  4ZPV R;  2XP6 A;  4KQZ A;  1ZB5 A;  4DWS B;  3TCZ A;  1FKB A;  1FKH A;  5DF0 A;  1FKD A;  4TX0 A;  1LL4 A;  5DIU A;  1W9P A;  4Q22 A;  3B7X A;  1FKL A;  3KAI A;  2DT3 A;  2PV3 A;  3KZ7 A;  4KR0 B;  4LAX A;  4N19 A;  3KAD A;  3WD4 A;  4ZS6 A;  1PBK A;  2DT2 A;  1RD6 A;  3CGN A;  4ZPT R;  1K9T A;  4FN2 A;  1D7J A;  1FKF A;  3I6C A;  2MNT A;  1NWR A;  4LAY A;  3PRD A;  4WKF A;  4BF8 A;  4R0X A;  2PPN A;  4G2P A;  3BXW A;  4MNK A;  2PBC A;  4TNS A;  2PPO A;  2MLY A;  3RME A;  2O92 A;  2XP7 A;  2F4E A;  2KGJ A;  4TYO A;  1FKT A;  3JYM A;  1Q1C A;  4FAP A;  1HJX A;  1FFR A;  1W9V A;  2DG9 A;  1H0G A;  2MF9 A;  2M1I A;  2Y78 A;  1WAW A;  4C02 B;  4PTM A;  2DSV A;  2XPA A;  2RUC A;  2IF4 A;  4WKA A;  1LG2 A;  5JH8 A;  3ARW A;  4MGV A;  5GPG A;  1E6R A;  1TFV A;  1ZBV A;  1M5Y A;  4Q7N A;  2Q5A A;  1FJD A;  3NTP A;  3KAC A;  4IT6 A;  2RUQ A;  5BXJ A;  3RM9 A;  2L2S A;  4NNR A;  2ESC A;  1EHN A;  1KT0 A;  2XPB A;  3CHF A;  4IPX A;  2FKE A;  4JFK A;  1ZU8 A;  4Z2J A;  3AS2 A;  4DWS A;  2D9F A;  5DEZ A;  5GPR A;  1UR8 A;  4QT3 A;  3OA5 A;  3RGC A;  3ARQ A;  2A3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...