1J4IA

Crystal structure analysis of the fkbp12 complexed with 000308 small molecule
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP12
publication title Design and structure-based study of new potential FKBP12 inhibitors
pubmed rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 28
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1j4iA00
5HUAA 1NMWA 3O5OA 3IKGA 2PV3A 1P5QA 4MGVA 1ZK6A 2KFWA 4QT2A 2ZR6A 1QPLA 4R0XA 2KGJA 2ZQSA 4U86A 3H9RB 4W9PA 1YW5A 2AWGA 3KACA 4JFKA 5HT1A 1FKKA 2MLXA 4DZ3A 1Q1CA 1EYMA 3I6CA 3O5GA 4LAWA 2FAPA 3PA7A 4NNRA 1T11A 4IQ2A 4FAPA 1L1PA 2MLYA 2JZVA 3KADA 3O5LA 4DRIA 2RUDA 4MSPA 4DRKA 1NSGA 2F2DA 3O5FA 2KE0A 2KI3A 5HW7A 1N1AA 1ROTA 5GPGA 3UQIA 3O5RA 4JFLA 3UQBA 2XP7A 1TCOC 5HWBA 2L2SA 1M5YA 1ROUA 3KAIA 3TDBA 5HWCA 4W9QA 1U79A 5B8IC 1FKGA 2IF4A 1FKTA 1KT0A 1C9HA 4GIVA 4IQCA 4TW6A 3UI4A 1BL4A 3NTPA 2RURA 4J4OA 4C02B 2M2AA 1QPFA 1JNTA 4GGQA 4QIBA 2XPAA 2PV1A 3NRKA 1FKIA 2ZQVA 3JYJA 1EQ3A 4DIPA 3KAGA 3PRDA 1J4RA 4JFJA 2RQSA 3UI6A 1PBKA 2LJ4A 2OFNA 1A7XA 3O5KA 3OOBA 5HW8A 4FN2A 4DH0A 3IKDA 1FKFA 4DT4A 2XP6A 3O5IA 2PPNA 4DRJA 3EY6A 2PPOA 2PBCA 3JYMA 3IK8A 3O5PA 2RUQA 2N87A 2F21A 3JXVA 2FKEA 3CGMA 5DIUA 4U85A 4ODKA 4TW7A 3PRBA 3O5QA 4LAXA 2MNTA 3KZ7A 1FKDA 4JFIA 5DITA 2XP4A 4ITZA 2RUCA 2KO7A 1FKSA 1ZCNA 5I98A 1D7HA 1QZ2A 4ODNA 1D6OA 1FKBA 4ODOA 3UI5A 3O5EA 3LUOA 2MPHA 1W26A 2UZ5A 1FAPA 1Y0OA 1J4IA 2D9FA 3O5DA 5D75A 4TYOA 3WH0A 2DG3A 1FKRA 2ZR5A 3KCEA 3UF8A 1J4HA 1F8AB 2XP8A 3RFWA 4ODRA 4J4NA 4DZ2A 4W9OA 2Q5AA 4DRMA 4DRNA 1JVWA 2ITKA 2KR7A 4N19A 3IHZA 5HW6A 2XP9A 2LKNA 3O5MA 3ODKA 4ODLA 1Q6UA 2LGOA 4JYSA 5DIVA 2RSEA 5HKGA 1JNSA 3FAPA 2LPVA 1Q6HA 1FKLA 3GPKA 4QT3A 1B6CA 2PPPA 3RGCA 1D7IA 1BKFA 5HTGA 3B7XA 3VAWA 2M1IA 4G50A 1FKJA 3KABA 2DG9A 2ZR4A 2DG4A 2ZQTA 2PV2A 3CGNA 3UQAA 1D7JA 2MLZA 4ODMA 4LAVA 1PINA 4TNSA 4DRHA 4O2TA 4JFMA 1FKHA 4U84A 1FJDA 2ZQUA 2XPBA 4BF8A 5J6EA 3TCZA 1R9HA 2K8IA 1HXVA 2MF9A 4LAYA 2XP5A 4ODQA 1J6YA 2VCDA 2Y78A 4TX0A 4DRQA 3TC5A 2XP3A 4G2PA 4TW8A 1NMVA 2F4EA 4DROA 4DRPA 3MDYB 2M08A 3KAHA 2VN1A 3O5JA 1Q6IA 1FD9A 4IPXA 4ODPA 1YATA 3KAFA 5BXJA 3NI6A 1F40A 1KT1A
chains in the Genus database with same CATH superfamily
1ZB5A 1NMWA 5GQBA 3B9DA 4Z2LA 2ZQSA 1WAWA 3O5GA 3PA7A 4FAPA 1L1PA 1LL6A 3ARSA 2JZVA 4DRIA 1ZL1A 4DRKA 2F2DA 1ROTA 4JFLA 2XP7A 1TCOC 2L2SA 4W9QA 3PR9A 3WL0A 1XRVA 1E6ZA 4J4OA 4IT4A 4C02B 1QPFA 2XPAA 3AROA 3KAGA 1ZBKA 2G41A 2OFNA 1A7XA 4P8XA 4L72B 5DO2A 3IKDA 1UR8A 1HKIA 1KFWA 2PBCA 5BXJA 4P8WA 1ZU8A 3ALFA 3JXVA 2DT2A 3PRAA 5DITA 2A3BA 2WLZA 1E44A 2DSVA 4ITZA 4WIWA 4QZVB 4ODNA 4ODOA 1D6OA 1X6LA 1NH6A 2MPHA 1FKRA 2DG3A 3WIJA 2ZR5A 3UF8A 1J4HA 1LG2A 1OGGA 3RMEA 4DZ2A 1GPFA 4W9OA 2ITKA 2LKNA 5HBFA 3GPKA 4QT3A 1B6CA 1HKMA 2WLYA 2YBUA 3B7XA 3VAWA 2ZR4A 4MAVA 3RM8A 4ODMA 4LAVA 3WQWA 4Z2HA 4DRHA 2ZQUA 2XPBA 1R9HA 1J6YA 4ODQA 1NWUA 2VCDA 4DRPA 3MDYB 3CHFA 1D2KA 3O5JA 3EIPA 1YATA 3KAFA 3CZ8A 4IT6A 1ZK6A 4MGVA 4R0XA 4U86A 3KACA 4JFKA 2PN0A 4DZ3A 2MLXA 1FFRA 1EYMA 1Q1CA 1HKKA 2MLYA 4Z2GA 3AS0A 4MSPA 3WKZA 4DWSC 3O5FA 4WK9A 5GPGA 4PTMA 3UQBA 1HJWA 3B9AA 3G6LA 1E9LA 1FKGA 4P8VA 4IQCA 1XHGA 3CHCA 1BL4A 3AS3A 2RURA 3NTPA 3AS2A 1GOIA 1E6NA 4GGQA 4QIBA 2DT1A 1JCHB 2PV1A 1FKIA 2ZQVA 3JYJA 3NRKA 1J4RA 2B5UB 2RQSA 1PBKA 3OOBA 1HKJA 1FFQA 3W4RA 3O5IA 4DRJA 1SR0A 3EY6A 3AS1A 2F21A 2DSWA 4ODKA 1NWSA 1NWRA 4S3JA 3BMBA 3O5QA 3B8SA 1O6IA 1FKDA 4JFIA 2KO7A 1QZ2A 3O5EA 1Y0OA 2D9FA 3WH0A 4TYOA 4ML4A 1F8AB 2XP8A 1W1VA 5GPRA 1W9UA 4J4NA 4Z2KA 4DRMA 3GTYX 4DRNA 4N19A 2DSZA 3IHZA 5HW6A 3WD2A 4ZPVR 4AY1A 4JYSA 2RSEA 1JNSA 1FKLA 1LL4A 3RGCA 1D7IA 4G50A 4NSBA 4WKHA 2DG4A 3CGNA 2MLZA 1PINA 1JNDA 4L3NA 4JFMA 1FKHA 1E15A 4U84A 5J6EA 2O92A 1SYTA 4LAYA 2DSUA 1K9TA 3ARWA 2Y78A 3TC5A 1ZBWA 4TW8A 4DROA 4LGXA 2A3AA 1Q6IA 3ARXA 4ODPA 1W1YA 1ZBCA 1F40A 4ZS6A 1KT1A 5HUAA 3O5OA 3GU0A 3IKGA 1P5QA 2KFWA 2ZR6A 1QPLA 5HT1A 4W9PA 1YW5A 3I6CA 4LAWA 2FAPA 4IQ2A 4Z2IA 1EHNA 3O5LA 2RUDA 2KE0A 2KI3A 3B9EA 1N1AA 5HW7A 2A3CA 4DWSD 2IUZA 4XAKA 3KAIA 5HWCA 1WNOA 1WB0A 2QF8A 2IF4A 4GIVA 4KQZA 4TW6A 2O9OA 1JNTA 4NZCA 2DT3A 1EQ3A 4DIPA 3PRDA 2PI6A 4JFJA 2LJ4A 3O5KA 1H0GA 5HW8A 4FN2A 4DH0A 1EIBA 2F23A 4WJXA 4Q7NA 1JNEA 2PPOA 5DIUA 3IK8A 2N87A 4U85A 3ARPA 3PRBA 1ZBVA 1NWTA 3KZ7A 4KR0B 2XP4A 2RUCA 2FDMA 1ZCNA 4MNLA 3WD0A 2P4VA 4DWSA 5I98A 3QOKA 1D7HA 1FKBA 3UI5A 3LUOA 1W26A 1FAPA 5D75A 3KCEA 4S3KA 3RFWA 4ODRA 4ZPTR 3ARVA 3FXYA 1RD6A 3WD3A 2KR7A 3FY1A 1Q6UA 3WD1A 5HKGA 3RM9A 3FAPA 1VF8A 1GRJA 2PPPA 1BKFA 2DG9A 2PV2A 3UQAA 1W1PA 1W1TA 1LQ0A 4TNSA 1OGBA 4O2TA 4MNKA 4WKAA 1LL7A 3TCZA 2K8IA 1HXVA 5DF0A 2XP5A 4ZPWR 4DRQA 2XP3A 5DEZA 1NMVA 1LG1A 2YBTA 4IPXA 3AQUA 3ARTA 4HBEA 3NI6A 2PV3A 3G6MA 3ARUA 4QT2A 2KGJA 3H9RB 2AWGA 4MNJA 3CH9A 4NNRA 1T11A 3ARQA 3KADA 3BXWA 1NSGA 1HJXA 2EULA 3UQIA 3O5RA 5HWBA 1M5YA 1ROUA 3TDBA 2ETNA 1U79A 2DPEA 4Z2JA 1IX5A 5B8IC 1FKTA 1KT0A 1C9HA 1TFVA 2WM0A 4R5EA 4DWSB 3UI4A 2B31A 1EDQA 2M2AA 1H0IA 1W9PA 4MNMA 4HARA 1ITXA 3UI6A 4P8UA 1FKFA 4DT4A 2XP6A 3ARZA 3CHDA 2PPNA 1X6NA 1OWQA 3JYMA 3O5PA 3WD4A 2RUQA 2FKEA 3CGMA 4HBOA 2AOSA 2G8ZA 3OA5A 4TW7A 3ARRA 4LAXA 2MNTA 3WL1A 1FKSA 2DT0A 1W9VA 4URIA 2OLHA 2UZ5A 3O5DA 1J4IA 3WQVA 1UR9A 4WKFA 1GUVA 2Q5AA 1JVWA 1LJYA 2XP9A 3O5MA 3ODKA 4ODLA 5DIVA 2LGOA 3ALGA 2LPVA 1Q6HA 2WK2A 2A3EA 1HJVA 1E6RA 4Q22A 5HTGA 2M1IA 2ESCA 1FKJA 3KABA 4MTVA 2ZQTA 1D7JA 4MPKA 3ARYA 4W5UA 1FJDA 4BF8A 3CHEA 4UDMA 2MF9A 3RM4A 4TX0A 4G2PA 5JH8A 2F4EA 2M08A 3KAHA 1E6PA 1CTNA 2VN1A 1FD9A 1FKKA
chains in the Genus database with same CATH topology
1ZB5A 1NMWA 5GQBA 3B9DA 4Z2LA 2ZQSA 1WAWA 3O5GA 3PA7A 4FAPA 1L1PA 1LL6A 3ARSA 2JZVA 4DRIA 1ZL1A 4DRKA 2F2DA 1ROTA 4JFLA 2XP7A 1TCOC 2L2SA 4W9QA 3PR9A 3WL0A 1XRVA 1E6ZA 4J4OA 4IT4A 4C02B 1QPFA 2XPAA 3AROA 3KAGA 1ZBKA 2G41A 2OFNA 1A7XA 4P8XA 4L72B 5DO2A 3IKDA 1UR8A 1HKIA 1KFWA 2PBCA 5BXJA 4P8WA 1ZU8A 3ALFA 3JXVA 2DT2A 3PRAA 5DITA 2A3BA 2WLZA 2DSVA 4ITZA 4WIWA 4QZVB 4ODNA 4ODOA 1D6OA 1X6LA 1NH6A 2MPHA 1FKRA 2DG3A 3WIJA 2ZR5A 3UF8A 1J4HA 1LG2A 1OGGA 3RMEA 4DZ2A 1GPFA 4W9OA 2ITKA 2LKNA 5HBFA 3GPKA 4QT3A 1B6CA 1HKMA 2WLYA 2YBUA 3B7XA 3VAWA 2ZR4A 4MAVA 3RM8A 4ODMA 4LAVA 3WQWA 4Z2HA 4DRHA 2ZQUA 2XPBA 1R9HA 1J6YA 4ODQA 1NWUA 2VCDA 4DRPA 3MDYB 3CHFA 1D2KA 3O5JA 1YATA 3KAFA 3CZ8A 4IT6A 1ZK6A 4MGVA 4R0XA 4U86A 3KACA 4JFKA 4DZ3A 2MLXA 1FFRA 1EYMA 1Q1CA 1HKKA 2MLYA 4Z2GA 3AS0A 4MSPA 3WKZA 4DWSC 3O5FA 4WK9A 5GPGA 4PTMA 3UQBA 1HJWA 3B9AA 3G6LA 1E9LA 1FKGA 4P8VA 4IQCA 1XHGA 3CHCA 1BL4A 3AS3A 2RURA 3NTPA 3AS2A 1GOIA 1E6NA 4GGQA 4QIBA 2DT1A 2PV1A 3NRKA 1FKIA 2ZQVA 3JYJA 1J4RA 2RQSA 1PBKA 3OOBA 1HKJA 1FFQA 3W4RA 3O5IA 4DRJA 1SR0A 3EY6A 3AS1A 2F21A 2DSWA 4ODKA 1NWSA 1NWRA 4S3JA 3O5QA 3B8SA 1O6IA 1FKDA 4JFIA 2KO7A 1QZ2A 3O5EA 1Y0OA 2D9FA 3WH0A 4TYOA 4ML4A 1F8AB 2XP8A 1W1VA 5GPRA 1W9UA 4J4NA 4Z2KA 4DRMA 4DRNA 4N19A 2DSZA 3IHZA 5HW6A 3WD2A 4ZPVR 4AY1A 4JYSA 2RSEA 1JNSA 1FKLA 1LL4A 3RGCA 1D7IA 4G50A 4NSBA 4WKHA 2DG4A 3CGNA 2MLZA 1PINA 1JNDA 4L3NA 4JFMA 1FKHA 1E15A 4U84A 5J6EA 2O92A 1SYTA 4LAYA 2DSUA 1K9TA 3ARWA 2Y78A 3TC5A 1ZBWA 4TW8A 4DROA 4LGXA 2A3AA 1Q6IA 3ARXA 4ODPA 1W1YA 1ZBCA 1F40A 4ZS6A 1KT1A 5HUAA 3O5OA 3IKGA 1P5QA 2KFWA 2ZR6A 1QPLA 5HT1A 4W9PA 1YW5A 3I6CA 4LAWA 2FAPA 4IQ2A 4Z2IA 1EHNA 3O5LA 2RUDA 2KE0A 2KI3A 3B9EA 1N1AA 5HW7A 2A3CA 4DWSD 2IUZA 4XAKA 3KAIA 5HWCA 1WNOA 1WB0A 2QF8A 2IF4A 4GIVA 4KQZA 4TW6A 2O9OA 1JNTA 4NZCA 2DT3A 1EQ3A 4DIPA 3PRDA 2PI6A 4JFJA 2LJ4A 3O5KA 1H0GA 5HW8A 4FN2A 4DH0A 1EIBA 4WJXA 4Q7NA 1JNEA 2PPOA 5DIUA 3IK8A 2N87A 4U85A 3ARPA 3PRBA 1ZBVA 1NWTA 3KZ7A 4KR0B 2XP4A 2RUCA 2FDMA 1ZCNA 4MNLA 3WD0A 4DWSA 5I98A 3QOKA 1D7HA 1FKBA 3UI5A 3LUOA 1W26A 1FAPA 5D75A 3KCEA 4S3KA 3RFWA 4ODRA 4ZPTR 3ARVA 3FXYA 1RD6A 3WD3A 2KR7A 3FY1A 1Q6UA 3WD1A 5HKGA 3RM9A 3FAPA 1VF8A 2PPPA 1BKFA 2DG9A 2PV2A 3UQAA 1W1PA 1W1TA 1LQ0A 4TNSA 1OGBA 4O2TA 4MNKA 4WKAA 1LL7A 3TCZA 2K8IA 1HXVA 5DF0A 2XP5A 4ZPWR 4DRQA 2XP3A 5DEZA 1NMVA 1LG1A 2YBTA 4IPXA 3AQUA 3ARTA 4HBEA 3NI6A 2PV3A 3G6MA 3ARUA 4QT2A 2KGJA 3H9RB 2AWGA 4MNJA 3CH9A 4NNRA 1T11A 3ARQA 3KADA 3BXWA 1NSGA 1HJXA 3UQIA 3O5RA 5HWBA 1M5YA 1ROUA 3TDBA 1U79A 2DPEA 4Z2JA 1IX5A 5B8IC 1FKTA 1KT0A 1C9HA 1TFVA 2WM0A 4R5EA 4DWSB 3UI4A 2B31A 1EDQA 2M2AA 1H0IA 1W9PA 4MNMA 4HARA 1ITXA 3UI6A 4P8UA 1FKFA 4DT4A 2XP6A 3ARZA 3CHDA 2PPNA 1X6NA 1OWQA 3O5PA 3JYMA 3WD4A 2RUQA 2FKEA 3CGMA 4HBOA 2AOSA 2G8ZA 3OA5A 4TW7A 3ARRA 4LAXA 2MNTA 3WL1A 1FKSA 2DT0A 1W9VA 4URIA 2OLHA 2UZ5A 3O5DA 1J4IA 3WQVA 1UR9A 4WKFA 1GUVA 2Q5AA 1JVWA 1LJYA 2XP9A 3O5MA 3ODKA 4ODLA 5DIVA 2LGOA 3ALGA 2LPVA 1Q6HA 2WK2A 2A3EA 1HJVA 1E6RA 4Q22A 5HTGA 2M1IA 2ESCA 1FKJA 3KABA 4MTVA 2ZQTA 1D7JA 4MPKA 3ARYA 4W5UA 1FJDA 4BF8A 3CHEA 2MF9A 3RM4A 4TX0A 4G2PA 5JH8A 2F4EA 2M08A 3KAHA 1E6PA 1CTNA 2VN1A 1FD9A 1FKKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HUA A;  1NMW A;  3O5O A;  3IKG A;  2PV3 A;  1P5Q A;  4MGV A;  1ZK6 A;  2KFW A;  4QT2 A;  2ZR6 A;  1QPL A;  4R0X A;  2KGJ A;  2ZQS A;  4U86 A;  3H9R B;  4W9P A;  1YW5 A;  2AWG A;  3KAC A;  4JFK A;  5HT1 A;  1FKK A;  2MLX A;  4DZ3 A;  1Q1C A;  1EYM A;  3I6C A;  3O5G A;  4LAW A;  2FAP A;  3PA7 A;  4NNR A;  1T11 A;  4IQ2 A;  4FAP A;  1L1P A;  2MLY A;  2JZV A;  3KAD A;  3O5L A;  4DRI A;  2RUD A;  4MSP A;  4DRK A;  1NSG A;  2F2D A;  3O5F A;  2KE0 A;  2KI3 A;  5HW7 A;  1N1A A;  1ROT A;  5GPG A;  3UQI A;  3O5R A;  4JFL A;  3UQB A;  2XP7 A;  1TCO C;  5HWB A;  2L2S A;  1M5Y A;  1ROU A;  3KAI A;  3TDB A;  5HWC A;  4W9Q A;  1U79 A;  5B8I C;  1FKG A;  2IF4 A;  1FKT A;  1KT0 A;  1C9H A;  4GIV A;  4IQC A;  4TW6 A;  3UI4 A;  1BL4 A;  3NTP A;  2RUR A;  4J4O A;  4C02 B;  2M2A A;  1QPF A;  1JNT A;  4GGQ A;  4QIB A;  2XPA A;  2PV1 A;  3NRK A;  1FKI A;  2ZQV A;  3JYJ A;  1EQ3 A;  4DIP A;  3KAG A;  3PRD A;  1J4R A;  4JFJ A;  2RQS A;  3UI6 A;  1PBK A;  2LJ4 A;  2OFN A;  1A7X A;  3O5K A;  3OOB A;  5HW8 A;  4FN2 A;  4DH0 A;  3IKD A;  1FKF A;  4DT4 A;  2XP6 A;  3O5I A;  2PPN A;  4DRJ A;  3EY6 A;  2PPO A;  2PBC A;  3JYM A;  3IK8 A;  3O5P A;  2RUQ A;  2N87 A;  2F21 A;  3JXV A;  2FKE A;  3CGM A;  5DIU A;  4U85 A;  4ODK A;  4TW7 A;  3PRB A;  3O5Q A;  4LAX A;  2MNT A;  3KZ7 A;  1FKD A;  4JFI A;  5DIT A;  2XP4 A;  4ITZ A;  2RUC A;  2KO7 A;  1FKS A;  1ZCN A;  5I98 A;  1D7H A;  1QZ2 A;  4ODN A;  1D6O A;  1FKB A;  4ODO A;  3UI5 A;  3O5E A;  3LUO A;  2MPH A;  1W26 A;  2UZ5 A;  1FAP A;  1Y0O A;  1J4I A;  2D9F A;  3O5D A;  5D75 A;  4TYO A;  3WH0 A;  2DG3 A;  1FKR A;  2ZR5 A;  3KCE A;  3UF8 A;  1J4H A;  1F8A B;  2XP8 A;  3RFW A;  4ODR A;  4J4N A;  4DZ2 A;  4W9O A;  2Q5A A;  4DRM A;  4DRN A;  1JVW A;  2ITK A;  2KR7 A;  4N19 A;  3IHZ A;  5HW6 A;  2XP9 A;  2LKN A;  3O5M A;  3ODK A;  4ODL A;  1Q6U A;  2LGO A;  4JYS A;  5DIV A;  2RSE A;  5HKG A;  1JNS A;  3FAP A;  2LPV A;  1Q6H A;  1FKL A;  3GPK A;  4QT3 A;  1B6C A;  2PPP A;  3RGC A;  1D7I A;  1BKF A;  5HTG A;  3B7X A;  3VAW A;  2M1I A;  4G50 A;  1FKJ A;  3KAB A;  2DG9 A;  2ZR4 A;  2DG4 A;  2ZQT A;  2PV2 A;  3CGN A;  3UQA A;  1D7J A;  2MLZ A;  4ODM A;  4LAV A;  1PIN A;  4TNS A;  4DRH A;  4O2T A;  4JFM A;  1FKH A;  4U84 A;  1FJD A;  2ZQU A;  2XPB A;  4BF8 A;  5J6E A;  3TCZ A;  1R9H A;  2K8I A;  1HXV A;  2MF9 A;  4LAY A;  2XP5 A;  4ODQ A;  1J6Y A;  2VCD A;  2Y78 A;  4TX0 A;  4DRQ A;  3TC5 A;  2XP3 A;  4G2P A;  4TW8 A;  1NMV A;  2F4E A;  4DRO A;  4DRP A;  3MDY B;  2M08 A;  3KAH A;  2VN1 A;  3O5J A;  1Q6I A;  1FD9 A;  4IPX A;  4ODP A;  1YAT A;  3KAF A;  5BXJ A;  3NI6 A;  1F40 A;  1KT1 A; 
#chains in the Genus database with same CATH topology
 1ZB5 A;  1NMW A;  5GQB A;  3B9D A;  4Z2L A;  2ZQS A;  1WAW A;  3O5G A;  3PA7 A;  4FAP A;  1L1P A;  1LL6 A;  3ARS A;  2JZV A;  4DRI A;  1ZL1 A;  4DRK A;  2F2D A;  1ROT A;  4JFL A;  2XP7 A;  1TCO C;  2L2S A;  4W9Q A;  3PR9 A;  3WL0 A;  1XRV A;  1E6Z A;  4J4O A;  4IT4 A;  4C02 B;  1QPF A;  2XPA A;  3ARO A;  3KAG A;  1ZBK A;  2G41 A;  2OFN A;  1A7X A;  4P8X A;  4L72 B;  5DO2 A;  3IKD A;  1UR8 A;  1HKI A;  1KFW A;  2PBC A;  5BXJ A;  4P8W A;  1ZU8 A;  3ALF A;  3JXV A;  2DT2 A;  3PRA A;  5DIT A;  2A3B A;  2WLZ A;  1E44 A;  2DSV A;  4ITZ A;  4WIW A;  4QZV B;  4ODN A;  4ODO A;  1D6O A;  1X6L A;  1NH6 A;  2MPH A;  1FKR A;  2DG3 A;  3WIJ A;  2ZR5 A;  3UF8 A;  1J4H A;  1LG2 A;  1OGG A;  3RME A;  4DZ2 A;  1GPF A;  4W9O A;  2ITK A;  2LKN A;  5HBF A;  3GPK A;  4QT3 A;  1B6C A;  1HKM A;  2WLY A;  2YBU A;  3B7X A;  3VAW A;  2ZR4 A;  4MAV A;  3RM8 A;  4ODM A;  4LAV A;  3WQW A;  4Z2H A;  4DRH A;  2ZQU A;  2XPB A;  1R9H A;  1J6Y A;  4ODQ A;  1NWU A;  2VCD A;  4DRP A;  3MDY B;  3CHF A;  1D2K A;  3O5J A;  3EIP A;  1YAT A;  3KAF A;  3CZ8 A;  4IT6 A;  1ZK6 A;  4MGV A;  4R0X A;  4U86 A;  3KAC A;  4JFK A;  2PN0 A;  4DZ3 A;  2MLX A;  1FFR A;  1EYM A;  1Q1C A;  1HKK A;  2MLY A;  4Z2G A;  3AS0 A;  4MSP A;  3WKZ A;  4DWS C;  3O5F A;  4WK9 A;  5GPG A;  4PTM A;  3UQB A;  1HJW A;  3B9A A;  3G6L A;  1E9L A;  1FKG A;  4P8V A;  4IQC A;  1XHG A;  3CHC A;  1BL4 A;  3AS3 A;  2RUR A;  3NTP A;  3AS2 A;  1GOI A;  1E6N A;  4GGQ A;  4QIB A;  2DT1 A;  1JCH B;  2PV1 A;  1FKI A;  2ZQV A;  3JYJ A;  3NRK A;  1J4R A;  2B5U B;  2RQS A;  1PBK A;  3OOB A;  1HKJ A;  1FFQ A;  3W4R A;  3O5I A;  4DRJ A;  1SR0 A;  3EY6 A;  3AS1 A;  2F21 A;  2DSW A;  4ODK A;  1NWS A;  1NWR A;  4S3J A;  3BMB A;  3O5Q A;  3B8S A;  1O6I A;  1FKD A;  4JFI A;  2KO7 A;  1QZ2 A;  3O5E A;  1Y0O A;  2D9F A;  3WH0 A;  4TYO A;  4ML4 A;  1F8A B;  2XP8 A;  1W1V A;  5GPR A;  1W9U A;  4J4N A;  4Z2K A;  4DRM A;  3GTY X;  4DRN A;  4N19 A;  2DSZ A;  3IHZ A;  5HW6 A;  3WD2 A;  4ZPV R;  4AY1 A;  4JYS A;  2RSE A;  1JNS A;  1FKL A;  1LL4 A;  3RGC A;  1D7I A;  4G50 A;  4NSB A;  4WKH A;  2DG4 A;  3CGN A;  2MLZ A;  1PIN A;  1JND A;  4L3N A;  4JFM A;  1FKH A;  1E15 A;  4U84 A;  5J6E A;  2O92 A;  1SYT A;  4LAY A;  2DSU A;  1K9T A;  3ARW A;  2Y78 A;  3TC5 A;  1ZBW A;  4TW8 A;  4DRO A;  4LGX A;  2A3A A;  1Q6I A;  3ARX A;  4ODP A;  1W1Y A;  1ZBC A;  1F40 A;  4ZS6 A;  1KT1 A;  5HUA A;  3O5O A;  3GU0 A;  3IKG A;  1P5Q A;  2KFW A;  2ZR6 A;  1QPL A;  5HT1 A;  4W9P A;  1YW5 A;  3I6C A;  4LAW A;  2FAP A;  4IQ2 A;  4Z2I A;  1EHN A;  3O5L A;  2RUD A;  2KE0 A;  2KI3 A;  3B9E A;  1N1A A;  5HW7 A;  2A3C A;  4DWS D;  2IUZ A;  4XAK A;  3KAI A;  5HWC A;  1WNO A;  1WB0 A;  2QF8 A;  2IF4 A;  4GIV A;  4KQZ A;  4TW6 A;  2O9O A;  1JNT A;  4NZC A;  2DT3 A;  1EQ3 A;  4DIP A;  3PRD A;  2PI6 A;  4JFJ A;  2LJ4 A;  3O5K A;  1H0G A;  5HW8 A;  4FN2 A;  4DH0 A;  1EIB A;  2F23 A;  4WJX A;  4Q7N A;  1JNE A;  2PPO A;  5DIU A;  3IK8 A;  2N87 A;  4U85 A;  3ARP A;  3PRB A;  1ZBV A;  1NWT A;  3KZ7 A;  4KR0 B;  2XP4 A;  2RUC A;  2FDM A;  1ZCN A;  4MNL A;  3WD0 A;  2P4V A;  4DWS A;  5I98 A;  3QOK A;  1D7H A;  1FKB A;  3UI5 A;  3LUO A;  1W26 A;  1FAP A;  5D75 A;  3KCE A;  4S3K A;  3RFW A;  4ODR A;  4ZPT R;  3ARV A;  3FXY A;  1RD6 A;  3WD3 A;  2KR7 A;  3FY1 A;  1Q6U A;  3WD1 A;  5HKG A;  3RM9 A;  3FAP A;  1VF8 A;  1GRJ A;  2PPP A;  1BKF A;  2DG9 A;  2PV2 A;  3UQA A;  1W1P A;  1W1T A;  1LQ0 A;  4TNS A;  1OGB A;  4O2T A;  4MNK A;  4WKA A;  1LL7 A;  3TCZ A;  2K8I A;  1HXV A;  5DF0 A;  2XP5 A;  4ZPW R;  4DRQ A;  2XP3 A;  5DEZ A;  1NMV A;  1LG1 A;  2YBT A;  4IPX A;  3AQU A;  3ART A;  4HBE A;  3NI6 A;  2PV3 A;  3G6M A;  3ARU A;  4QT2 A;  2KGJ A;  3H9R B;  2AWG A;  4MNJ A;  3CH9 A;  4NNR A;  1T11 A;  3ARQ A;  3KAD A;  3BXW A;  1NSG A;  1HJX A;  2EUL A;  3UQI A;  3O5R A;  5HWB A;  1M5Y A;  1ROU A;  3TDB A;  2ETN A;  1U79 A;  2DPE A;  4Z2J A;  1IX5 A;  5B8I C;  1FKT A;  1KT0 A;  1C9H A;  1TFV A;  2WM0 A;  4R5E A;  4DWS B;  3UI4 A;  2B31 A;  1EDQ A;  2M2A A;  1H0I A;  1W9P A;  4MNM A;  4HAR A;  1ITX A;  3UI6 A;  4P8U A;  1FKF A;  4DT4 A;  2XP6 A;  3ARZ A;  3CHD A;  2PPN A;  1X6N A;  1OWQ A;  3JYM A;  3O5P A;  3WD4 A;  2RUQ A;  2FKE A;  3CGM A;  4HBO A;  2AOS A;  2G8Z A;  3OA5 A;  4TW7 A;  3ARR A;  4LAX A;  2MNT A;  3WL1 A;  1FKS A;  2DT0 A;  1W9V A;  4URI A;  2OLH A;  2UZ5 A;  3O5D A;  1J4I A;  3WQV A;  1UR9 A;  4WKF A;  1GUV A;  2Q5A A;  1JVW A;  1LJY A;  2XP9 A;  3O5M A;  3ODK A;  4ODL A;  5DIV A;  2LGO A;  3ALG A;  2LPV A;  1Q6H A;  2WK2 A;  2A3E A;  1HJV A;  1E6R A;  4Q22 A;  5HTG A;  2M1I A;  2ESC A;  1FKJ A;  3KAB A;  4MTV A;  2ZQT A;  1D7J A;  4MPK A;  3ARY A;  4W5U A;  1FJD A;  4BF8 A;  3CHE A;  4UDM A;  2MF9 A;  3RM4 A;  4TX0 A;  4G2P A;  5JH8 A;  2F4E A;  2M08 A;  3KAH A;  1E6P A;  1CTN A;  2VN1 A;  1FD9 A;  1FKK A; 
#chains in the Genus database with same CATH homology
 1ZB5 A;  1NMW A;  5GQB A;  3B9D A;  4Z2L A;  2ZQS A;  1WAW A;  3O5G A;  3PA7 A;  4FAP A;  1L1P A;  1LL6 A;  3ARS A;  2JZV A;  4DRI A;  1ZL1 A;  4DRK A;  2F2D A;  1ROT A;  4JFL A;  2XP7 A;  1TCO C;  2L2S A;  4W9Q A;  3PR9 A;  3WL0 A;  1XRV A;  1E6Z A;  4J4O A;  4IT4 A;  4C02 B;  1QPF A;  2XPA A;  3ARO A;  3KAG A;  1ZBK A;  2G41 A;  2OFN A;  1A7X A;  4P8X A;  4L72 B;  5DO2 A;  3IKD A;  1UR8 A;  1HKI A;  1KFW A;  2PBC A;  5BXJ A;  4P8W A;  1ZU8 A;  3ALF A;  3JXV A;  2DT2 A;  3PRA A;  5DIT A;  2A3B A;  2WLZ A;  2DSV A;  4ITZ A;  4WIW A;  4QZV B;  4ODN A;  4ODO A;  1D6O A;  1X6L A;  1NH6 A;  2MPH A;  1FKR A;  2DG3 A;  3WIJ A;  2ZR5 A;  3UF8 A;  1J4H A;  1LG2 A;  1OGG A;  3RME A;  4DZ2 A;  1GPF A;  4W9O A;  2ITK A;  2LKN A;  5HBF A;  3GPK A;  4QT3 A;  1B6C A;  1HKM A;  2WLY A;  2YBU A;  3B7X A;  3VAW A;  2ZR4 A;  4MAV A;  3RM8 A;  4ODM A;  4LAV A;  3WQW A;  4Z2H A;  4DRH A;  2ZQU A;  2XPB A;  1R9H A;  1J6Y A;  4ODQ A;  1NWU A;  2VCD A;  4DRP A;  3MDY B;  3CHF A;  1D2K A;  3O5J A;  1YAT A;  3KAF A;  3CZ8 A;  4IT6 A;  1ZK6 A;  4MGV A;  4R0X A;  4U86 A;  3KAC A;  4JFK A;  4DZ3 A;  2MLX A;  1FFR A;  1EYM A;  1Q1C A;  1HKK A;  2MLY A;  4Z2G A;  3AS0 A;  4MSP A;  3WKZ A;  4DWS C;  3O5F A;  4WK9 A;  5GPG A;  4PTM A;  3UQB A;  1HJW A;  3B9A A;  3G6L A;  1E9L A;  1FKG A;  4P8V A;  4IQC A;  1XHG A;  3CHC A;  1BL4 A;  3AS3 A;  2RUR A;  3NTP A;  3AS2 A;  1GOI A;  1E6N A;  4GGQ A;  4QIB A;  2DT1 A;  2PV1 A;  3NRK A;  1FKI A;  2ZQV A;  3JYJ A;  1J4R A;  2RQS A;  1PBK A;  3OOB A;  1HKJ A;  1FFQ A;  3W4R A;  3O5I A;  4DRJ A;  1SR0 A;  3EY6 A;  3AS1 A;  2F21 A;  2DSW A;  4ODK A;  1NWS A;  1NWR A;  4S3J A;  3O5Q A;  3B8S A;  1O6I A;  1FKD A;  4JFI A;  2KO7 A;  1QZ2 A;  3O5E A;  1Y0O A;  2D9F A;  3WH0 A;  4TYO A;  4ML4 A;  1F8A B;  2XP8 A;  1W1V A;  5GPR A;  1W9U A;  4J4N A;  4Z2K A;  4DRM A;  4DRN A;  4N19 A;  2DSZ A;  3IHZ A;  5HW6 A;  3WD2 A;  4ZPV R;  4AY1 A;  4JYS A;  2RSE A;  1JNS A;  1FKL A;  1LL4 A;  3RGC A;  1D7I A;  4G50 A;  4NSB A;  4WKH A;  2DG4 A;  3CGN A;  2MLZ A;  1PIN A;  1JND A;  4L3N A;  4JFM A;  1FKH A;  1E15 A;  4U84 A;  5J6E A;  2O92 A;  1SYT A;  4LAY A;  2DSU A;  1K9T A;  3ARW A;  2Y78 A;  3TC5 A;  1ZBW A;  4TW8 A;  4DRO A;  4LGX A;  2A3A A;  1Q6I A;  3ARX A;  4ODP A;  1W1Y A;  1ZBC A;  1F40 A;  4ZS6 A;  1KT1 A;  5HUA A;  3O5O A;  3IKG A;  1P5Q A;  2KFW A;  2ZR6 A;  1QPL A;  5HT1 A;  4W9P A;  1YW5 A;  3I6C A;  4LAW A;  2FAP A;  4IQ2 A;  4Z2I A;  1EHN A;  3O5L A;  2RUD A;  2KE0 A;  2KI3 A;  3B9E A;  1N1A A;  5HW7 A;  2A3C A;  4DWS D;  2IUZ A;  4XAK A;  3KAI A;  5HWC A;  1WNO A;  1WB0 A;  2QF8 A;  2IF4 A;  4GIV A;  4KQZ A;  4TW6 A;  2O9O A;  1JNT A;  4NZC A;  2DT3 A;  1EQ3 A;  4DIP A;  3PRD A;  2PI6 A;  4JFJ A;  2LJ4 A;  3O5K A;  1H0G A;  5HW8 A;  4FN2 A;  4DH0 A;  1EIB A;  4WJX A;  4Q7N A;  1JNE A;  2PPO A;  5DIU A;  3IK8 A;  2N87 A;  4U85 A;  3ARP A;  3PRB A;  1ZBV A;  1NWT A;  3KZ7 A;  4KR0 B;  2XP4 A;  2RUC A;  2FDM A;  1ZCN A;  4MNL A;  3WD0 A;  4DWS A;  5I98 A;  3QOK A;  1D7H A;  1FKB A;  3UI5 A;  3LUO A;  1W26 A;  1FAP A;  5D75 A;  3KCE A;  4S3K A;  3RFW A;  4ODR A;  4ZPT R;  3ARV A;  3FXY A;  1RD6 A;  3WD3 A;  2KR7 A;  3FY1 A;  1Q6U A;  3WD1 A;  5HKG A;  3RM9 A;  3FAP A;  1VF8 A;  2PPP A;  1BKF A;  2DG9 A;  2PV2 A;  3UQA A;  1W1P A;  1W1T A;  1LQ0 A;  4TNS A;  1OGB A;  4O2T A;  4MNK A;  4WKA A;  1LL7 A;  3TCZ A;  2K8I A;  1HXV A;  5DF0 A;  2XP5 A;  4ZPW R;  4DRQ A;  2XP3 A;  5DEZ A;  1NMV A;  1LG1 A;  2YBT A;  4IPX A;  3AQU A;  3ART A;  4HBE A;  3NI6 A;  2PV3 A;  3G6M A;  3ARU A;  4QT2 A;  2KGJ A;  3H9R B;  2AWG A;  4MNJ A;  3CH9 A;  4NNR A;  1T11 A;  3ARQ A;  3KAD A;  3BXW A;  1NSG A;  1HJX A;  3UQI A;  3O5R A;  5HWB A;  1M5Y A;  1ROU A;  3TDB A;  1U79 A;  2DPE A;  4Z2J A;  1IX5 A;  5B8I C;  1FKT A;  1KT0 A;  1C9H A;  1TFV A;  2WM0 A;  4R5E A;  4DWS B;  3UI4 A;  2B31 A;  1EDQ A;  2M2A A;  1H0I A;  1W9P A;  4MNM A;  4HAR A;  1ITX A;  3UI6 A;  4P8U A;  1FKF A;  4DT4 A;  2XP6 A;  3ARZ A;  3CHD A;  2PPN A;  1X6N A;  1OWQ A;  3O5P A;  3JYM A;  3WD4 A;  2RUQ A;  2FKE A;  3CGM A;  4HBO A;  2AOS A;  2G8Z A;  3OA5 A;  4TW7 A;  3ARR A;  4LAX A;  2MNT A;  3WL1 A;  1FKS A;  2DT0 A;  1W9V A;  4URI A;  2OLH A;  2UZ5 A;  3O5D A;  1J4I A;  3WQV A;  1UR9 A;  4WKF A;  1GUV A;  2Q5A A;  1JVW A;  1LJY A;  2XP9 A;  3O5M A;  3ODK A;  4ODL A;  5DIV A;  2LGO A;  3ALG A;  2LPV A;  1Q6H A;  2WK2 A;  2A3E A;  1HJV A;  1E6R A;  4Q22 A;  5HTG A;  2M1I A;  2ESC A;  1FKJ A;  3KAB A;  4MTV A;  2ZQT A;  1D7J A;  4MPK A;  3ARY A;  4W5U A;  1FJD A;  4BF8 A;  3CHE A;  2MF9 A;  3RM4 A;  4TX0 A;  4G2P A;  5JH8 A;  2F4E A;  2M08 A;  3KAH A;  1E6P A;  1CTN A;  2VN1 A;  1FD9 A;  1FKK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...