1J4IA

Crystal structure analysis of the fkbp12 complexed with 000308 small molecule
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP12
publication title Design and structure-based study of new potential FKBP12 inhibitors
pubmed rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 28
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1j4iA00
5HT1A 4LAVA 2PPPA 2ZQTA 1FKFA 3UF8A 2XP9A 1KT1A 2RSEA 3O5DA 4R0XA 3JXVA 4TNSA 5D75A 4DRJA 1EYMA 3IK8A 4LAWA 3KAHA 3TCZA 1EQ3A 2RUCA 2XP6A 3O5KA 3JYMA 5DITA 2KI3A 3KZ7A 3MDYB 5DIUA 5HW7A 4IQCA 4IQ2A 4DRHA 5BXJA 3KAGA 5HWBA 3UQAA 1F40A 1J4RA 2PBCA 1FKHA 2K8IA 4W9OA 4JFLA 4JFKA 2XP5A 3KAFA 3UI5A 3IKGA 4ODOA 4J4NA 1ZCNA 3O5EA 3NI6A 3H9RB 1JNSA 2RURA 2MPHA 1PINA 1KT0A 2VCDA 4QIBA 3O5JA 3O5PA 4ODNA 1N1AA 4N19A 3TDBA 3WH0A 4C02B 5J6EA 1ZK6A 4DROA 1M5YA 2M1IA 4NNRA 2XP3A 3TC5A 3B7XA 2PPNA 2ZR5A 4LAXA 4FAPA 2KR7A 2ZQVA 4TX0A 1Y0OA 2LGOA 4ODKA 1J4IA 2MNTA 5GPGA 4ODPA 3UQIA 4JFMA 1HXVA 3PRBA 1YATA 4DRQA 1FJDA 2MF9A 4DH0A 2KE0A 4G2PA 4JFIA 4DT4A 3IKDA 2F21A 4TYOA 4ITZA 1C9HA 5HWCA 2L2SA 3ODKA 4DRMA 3KCEA 2XP4A 2PPOA 3VAWA 2MLZA 4DZ2A 4DRKA 3KACA 3CGNA 3O5LA 1L1PA 4GIVA 2FKEA 4TW6A 2RUQA 1P5QA 2M08A 3O5QA 4JYSA 4MGVA 4TW7A 1QZ2A 1J4HA 1YW5A 2ZQSA 4W9PA 4DRNA 3O5IA 2ITKA 5HUAA 3I6CA 4JFJA 1D7JA 4W9QA 1FAPA 4ODLA 4J4OA 4IPXA 2ZR4A 2XPAA 1BKFA 3O5MA 2DG4A 4U86A 1FKDA 2VN1A 4G50A 1FKIA 2D9FA 1FKJA 1TCOC 1U79A 2N87A 3FAPA 2IF4A 1W26A 5HKGA 1Q6UA 5B8IC 2PV1A 3KAIA 3IHZA 1D7HA 2KFWA 1QPFA 3UI4A 4DRIA 2M2AA 2DG3A 3UQBA 2Q5AA 2LPVA 2RUDA 2ZQUA 5HW8A 2LJ4A 1FKTA 3O5RA 5HW6A 2ZR6A 2Y78A 1T11A 4BF8A 1Q6IA 1QPLA 3KADA 3LUOA 4ODRA 3RFWA 4FN2A 1JVWA 3CGMA 3NTPA 3O5OA 1B6CA 1R9HA 2F4EA 5DIVA 4MSPA 2PV2A 4DIPA 2JZVA 3UI6A 1FKGA 3O5GA 4DZ3A 1FKRA 1FKSA 2LKNA 1FKKA 2KO7A 2XPBA 3PA7A 2XP8A 1FKLA 4LAYA 1JNTA 1PBKA 2UZ5A 3OOBA 3O5FA 5I98A 1A7XA 4QT3A 3GPKA 1FD9A 3JYJA 1D6OA 4U84A 1ROTA 4DRPA 1ROUA 2FAPA 1NSGA 4ODMA 4QT2A 2KGJA 5HTGA 1BL4A 3RGCA 1FKBA 2DG9A 4O2TA 1J6YA 3KABA 3EY6A 2AWGA 1NMVA 2MLXA 1F8AB 4TW8A 4GGQA 3NRKA 1Q1CA 1Q6HA 2PV3A 3PRDA 4ODQA 4U85A 1D7IA 2MLYA 2F2DA 1NMWA 2OFNA 2XP7A 2RQSA
chains in the Genus database with same CATH superfamily
1E6RA 4WKHA 2ZQTA 1W1VA 2XP9A 4HBEA 2RSEA 3O5DA 1GOIA 3JXVA 4KQZA 4R0XA 2WLYA 4ML4A 1NH6A 3JYMA 5DITA 5HW7A 4IQ2A 3AS1A 1FKHA 3AS3A 2XP5A 3ARXA 3KAFA 3IKGA 1LG1A 3CZ8A 2MPHA 2VCDA 3AS2A 4QIBA 4ODNA 2B31A 4N19A 1NWSA 1ZK6A 1M5YA 2DT2A 2XP3A 4XAKA 3TC5A 2PPNA 2ZR5A 1W9UA 4FAPA 2ZQVA 1NWUA 4ODKA 1LG2A 5GPGA 4ODPA 4QZVB 1EIBA 1HXVA 3PRBA 1E15A 4G2PA 4DWSD 3G6LA 1C9HA 3ODKA 4KR0B 1H0IA 1HKIA 2XP4A 4DZ2A 4DRKA 2AOSA 2RUQA 2ZQSA 4DRNA 5HUAA 4MNMA 2ITKA 4LGXA 4ZPTR 1ITXA 3O5MA 4U86A 2VN1A 2D9FA 1TCOC 1U79A 2N87A 2IF4A 5HKGA 1W1PA 2PI6A 2M2AA 3UQBA 2Q5AA 2LJ4A 1FKTA 3O5RA 3ARTA 4Z2LA 1Q6IA 3LUOA 3RFWA 2G8ZA 1JVWA 3CGMA 3NTPA 3PRAA 4FN2A 4Q22A 1R9HA 2F4EA 3RMEA 2DSVA 2ESCA 2PV2A 4S3JA 1FKGA 1HKJA 3ALFA 1FKSA 1GUVA 1FKKA 2XP8A 1NWRA 3RM9A 1JNTA 1GPFA 3WQVA 1FD9A 1D6OA 2FDMA 2O92A 2FAPA 1UR8A 4QT2A 2KGJA 5DEZA 2DG9A 1HKMA 4UDMA 3KABA 1NMVA 1F8AB 1HJVA 4GGQA 3NRKA 1Q1CA 1VF8A 4LAVA 4TNSA 4DRJA 4PTMA 3TCZA 3KAHA 1EQ3A 2RUCA 2XP6A 3O5KA 1OGGA 3UQAA 5HWBA 4IQCA 5BXJA 2DSZA 3ARQA 3B9EA 4JFKA 2IUZA 4W5UA 3UI5A 1TFVA 3O5EA 2WM0A 3W4RA 1SYTA 1PINA 3WH0A 4C02B 2A3BA 4DROA 1LL7A 2DT3A 4NNRA 2DSWA 2ETNA 3B7XA 4LAXA 2KR7A 4P8VA 4P8XA 1ZBWA 4JFMA 3B9AA 4MNJA 3IKDA 3PR9A 2F21A 4ITZA 5HWCA 3AROA 1X6NA 2MLZA 2B5UB 3B8SA 3RM4A 4TW7A 3O5QA 1J4HA 1QZ2A 1YW5A 4W9PA 3WD0A 4L72B 1LL4A 1D7JA 3ARVA 4W9QA 1FAPA 1K9TA 1W1YA 1SR0A 2XPAA 3ARRA 1FKDA 1FKIA 4HARA 3FAPA 1ZBKA 1Q6UA 5B8IC 3KAIA 1ZU8A 1D7HA 2RUDA 2ZQUA 2ZR6A 1QPLA 4ZPVR 3FXYA 1EHNA 2KO7A 3QOKA 3PA7A 1UR9A 1PBKA 3G6MA 2QF8A 3OOBA 4QT3A 4IT4A 3GPKA 4DRPA 4U84A 1ROUA 1FFRA 1NSGA 4HBOA 1E44A 1H0GA 4O2TA 1LL6A 3EY6A 2AWGA 1CTNA 1XRVA 4TW8A 2WK2A 3WL1A 2PV3A 4U85A 1D7IA 3TDBA 2XP7A 3AS0A 4URIA 4MAVA 1HJWA 3UF8A 3CHCA 1KT1A 2A3CA 3B9DA 3CHFA 3GTYX 1GRJA 3KZ7A 3MDYB 3KAGA 2K8IA 4W9OA 5GPRA 4ODOA 3CHEA 3NI6A 2G41A 2RURA 1KT0A 1LQ0A 1N1AA 3AQUA 1OGBA 5J6EA 4MPKA 2M1IA 3UQIA 2YBTA 1FJDA 3GU0A 2KE0A 4WKFA 3OA5A 4ZPWR 5JH8A 2L2SA 3ARWA 3KCEA 4DRMA 4MTVA 2PPOA 3VAWA 3KACA 3CGNA 4GIVA 2FKEA 4TW6A 4JYSA 1WNOA 3BMBA 1WAWA 3O5IA 4NZCA 4ODLA 4IPXA 2ZR4A 1BKFA 2DG4A 4WJXA 1FKJA 2PV1A 3WD3A 4S3KA 3IHZA 2F23A 1O6IA 1QPFA 3UI4A 3FY1A 2DG3A 4WK9A 2Y78A 1T11A 3RM8A 3KADA 1B6CA 5DIVA 4DIPA 2JZVA 3CHDA 3O5GA 1JNEA 4LAYA 1FKLA 1ZBCA 3ARSA 5HBFA 5I98A 1A7XA 4DWSA 4Z2GA 3JYJA 4ODMA 2PN0A 5HTGA 1BL4A 1FFQA 3WD1A 4WKAA 4Z2IA 1J6YA 1Q6HA 3PRDA 1HJXA 4ODQA 2F2DA 2OFNA 2WLZA 3ARPA 5HT1A 2PPPA 1FKFA 1E6NA 5D75A 2DSUA 1EYMA 3IK8A 4LAWA 2KI3A 5DIUA 1F40A 1LJYA 2OLHA 4DRHA 2DT1A 1J4RA 2PBCA 3WQWA 4ZS6A 1E6ZA 4JFLA 3ARYA 4J4NA 1ZCNA 4Q7NA 3WD2A 2A3AA 4AY1A 3H9RB 1JNSA 3ARZA 5DO2A 3O5JA 3O5PA 1KFWA 4Z2JA 4MNLA 3WIJA 1NWTA 4Z2HA 1W9VA 1D2KA 3ARUA 4TX0A 1Y0OA 2LGOA 3ALGA 1J4IA 2MNTA 2A3EA 1X6LA 4WIWA 1YATA 4DRQA 1ZBVA 2MF9A 4DH0A 4DT4A 2EULA 4JFIA 4DWSB 4TYOA 1W9PA 1OWQA 4IT6A 3O5LA 1L1PA 1P5QA 2DT0A 2M08A 4MGVA 3CH9A 1JNDA 3I6CA 4JFJA 1HKKA 4J4OA 4G50A 2YBUA 1ZL1A 1W26A 5GQBA 2DPEA 4L3NA 2KFWA 4DRIA 1WB0A 2LPVA 5HW8A 1W1TA 1ZB5A 5DF0A 1E9LA 5HW6A 4BF8A 1JCHB 4ODRA 3O5OA 2P4VA 4MSPA 3UI6A 4DWSC 4DZ3A 3WD4A 1FKRA 2LKNA 2XPBA 1IX5A 4NSBA 2UZ5A 2O9OA 3O5FA 1RD6A 4P8WA 1ROTA 4P8UA 3EIPA 3RGCA 4MNKA 1FKBA 3WL0A 1EDQA 4R5EA 2MLXA 3WKZA 1XHGA 1E6PA 2MLYA 1NMWA 3BXWA 2RQSA 4Z2KA
chains in the Genus database with same CATH topology
1E6RA 4WKHA 2ZQTA 1W1VA 2XP9A 4HBEA 2RSEA 3O5DA 1GOIA 3JXVA 4KQZA 4R0XA 2WLYA 4ML4A 1NH6A 3JYMA 5DITA 5HW7A 4IQ2A 3AS1A 1FKHA 3AS3A 2XP5A 3ARXA 3KAFA 3IKGA 1LG1A 3CZ8A 2MPHA 2VCDA 3AS2A 4QIBA 4ODNA 2B31A 4N19A 1NWSA 1ZK6A 1M5YA 2DT2A 2XP3A 4XAKA 3TC5A 2PPNA 2ZR5A 1W9UA 4FAPA 2ZQVA 1NWUA 4ODKA 1LG2A 5GPGA 4ODPA 4QZVB 1EIBA 1HXVA 3PRBA 1E15A 4G2PA 4DWSD 3G6LA 1C9HA 3ODKA 4KR0B 1H0IA 1HKIA 2XP4A 4DZ2A 4DRKA 2AOSA 2RUQA 2ZQSA 4DRNA 5HUAA 4MNMA 2ITKA 4LGXA 4ZPTR 1ITXA 3O5MA 4U86A 2VN1A 2D9FA 1TCOC 1U79A 2N87A 2IF4A 5HKGA 1W1PA 2PI6A 2M2AA 3UQBA 2Q5AA 2LJ4A 1FKTA 3O5RA 3ARTA 4Z2LA 1Q6IA 3LUOA 3RFWA 2G8ZA 1JVWA 3CGMA 3NTPA 3PRAA 4FN2A 4Q22A 1R9HA 2F4EA 3RMEA 2DSVA 2ESCA 2PV2A 4S3JA 1FKGA 1HKJA 3ALFA 1FKSA 1GUVA 1FKKA 2XP8A 1NWRA 3RM9A 1JNTA 1GPFA 3WQVA 1FD9A 1D6OA 2FDMA 2O92A 2FAPA 1UR8A 4QT2A 2KGJA 5DEZA 2DG9A 1HKMA 3KABA 1NMVA 1F8AB 1HJVA 4GGQA 3NRKA 1Q1CA 1VF8A 4LAVA 4TNSA 4DRJA 4PTMA 3TCZA 3KAHA 1EQ3A 2RUCA 2XP6A 3O5KA 1OGGA 3UQAA 5HWBA 4IQCA 5BXJA 2DSZA 3ARQA 3B9EA 4JFKA 2IUZA 4W5UA 3UI5A 1TFVA 3O5EA 2WM0A 3W4RA 1SYTA 1PINA 3WH0A 4C02B 2A3BA 4DROA 1LL7A 2DT3A 4NNRA 2DSWA 3B7XA 4LAXA 2KR7A 4P8VA 4P8XA 1ZBWA 4JFMA 3B9AA 4MNJA 3IKDA 3PR9A 2F21A 4ITZA 5HWCA 3AROA 1X6NA 2MLZA 3B8SA 3RM4A 4TW7A 3O5QA 1J4HA 1QZ2A 1YW5A 4W9PA 3WD0A 4L72B 1LL4A 1D7JA 3ARVA 4W9QA 1FAPA 1K9TA 1W1YA 1SR0A 2XPAA 3ARRA 1FKDA 1FKIA 4HARA 3FAPA 1ZBKA 1Q6UA 5B8IC 3KAIA 1ZU8A 1D7HA 2RUDA 2ZQUA 2ZR6A 1QPLA 4ZPVR 3FXYA 1EHNA 2KO7A 3QOKA 3PA7A 1UR9A 1PBKA 3G6MA 2QF8A 3OOBA 4QT3A 4IT4A 3GPKA 4DRPA 4U84A 1ROUA 1FFRA 1NSGA 4HBOA 1H0GA 4O2TA 1LL6A 3EY6A 2AWGA 1CTNA 1XRVA 4TW8A 2WK2A 3WL1A 2PV3A 4U85A 1D7IA 3TDBA 2XP7A 3AS0A 4URIA 4MAVA 1HJWA 3UF8A 3CHCA 1KT1A 2A3CA 3B9DA 3CHFA 3KZ7A 3MDYB 3KAGA 2K8IA 4W9OA 5GPRA 4ODOA 3CHEA 3NI6A 2G41A 2RURA 1KT0A 1LQ0A 1N1AA 3AQUA 1OGBA 5J6EA 4MPKA 2M1IA 3UQIA 2YBTA 1FJDA 2KE0A 4WKFA 3OA5A 4ZPWR 5JH8A 2L2SA 3ARWA 3KCEA 4DRMA 4MTVA 2PPOA 3VAWA 3KACA 3CGNA 4GIVA 2FKEA 4TW6A 4JYSA 1WNOA 1WAWA 3O5IA 4NZCA 4ODLA 4IPXA 2ZR4A 1BKFA 2DG4A 4WJXA 1FKJA 2PV1A 3WD3A 4S3KA 3IHZA 1O6IA 1QPFA 3UI4A 3FY1A 2DG3A 4WK9A 2Y78A 1T11A 3RM8A 3KADA 1B6CA 5DIVA 4DIPA 2JZVA 3CHDA 3O5GA 1JNEA 4LAYA 1FKLA 1ZBCA 3ARSA 5HBFA 5I98A 1A7XA 4DWSA 4Z2GA 3JYJA 4ODMA 5HTGA 1BL4A 1FFQA 3WD1A 4WKAA 4Z2IA 1J6YA 1Q6HA 3PRDA 1HJXA 4ODQA 2F2DA 2OFNA 2WLZA 3ARPA 5HT1A 2PPPA 1FKFA 1E6NA 5D75A 2DSUA 1EYMA 3IK8A 4LAWA 2KI3A 5DIUA 1F40A 1LJYA 2OLHA 4DRHA 2DT1A 1J4RA 2PBCA 3WQWA 4ZS6A 1E6ZA 4JFLA 3ARYA 4J4NA 1ZCNA 4Q7NA 3WD2A 2A3AA 4AY1A 3H9RB 1JNSA 3ARZA 5DO2A 3O5JA 3O5PA 1KFWA 4Z2JA 4MNLA 3WIJA 1NWTA 4Z2HA 1W9VA 1D2KA 3ARUA 4TX0A 1Y0OA 2LGOA 3ALGA 1J4IA 2MNTA 2A3EA 1X6LA 4WIWA 1YATA 4DRQA 1ZBVA 2MF9A 4DH0A 4DT4A 4JFIA 4DWSB 4TYOA 1W9PA 1OWQA 4IT6A 3O5LA 1L1PA 1P5QA 2DT0A 2M08A 4MGVA 3CH9A 1JNDA 3I6CA 4JFJA 1HKKA 4J4OA 4G50A 2YBUA 1ZL1A 1W26A 5GQBA 2DPEA 4L3NA 2KFWA 4DRIA 1WB0A 2LPVA 5HW8A 1W1TA 1ZB5A 5DF0A 1E9LA 5HW6A 4BF8A 4ODRA 3O5OA 4MSPA 3UI6A 4DWSC 4DZ3A 3WD4A 1FKRA 2LKNA 2XPBA 1IX5A 4NSBA 2UZ5A 2O9OA 3O5FA 1RD6A 4P8WA 1ROTA 4P8UA 3RGCA 4MNKA 1FKBA 3WL0A 1EDQA 4R5EA 2MLXA 3WKZA 1XHGA 1E6PA 2MLYA 1NMWA 3BXWA 2RQSA 4Z2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HT1 A;  4LAV A;  2PPP A;  2ZQT A;  1FKF A;  3UF8 A;  2XP9 A;  1KT1 A;  2RSE A;  3O5D A;  4R0X A;  3JXV A;  4TNS A;  5D75 A;  4DRJ A;  1EYM A;  3IK8 A;  4LAW A;  3KAH A;  3TCZ A;  1EQ3 A;  2RUC A;  2XP6 A;  3O5K A;  3JYM A;  5DIT A;  2KI3 A;  3KZ7 A;  3MDY B;  5DIU A;  5HW7 A;  4IQC A;  4IQ2 A;  4DRH A;  5BXJ A;  3KAG A;  5HWB A;  3UQA A;  1F40 A;  1J4R A;  2PBC A;  1FKH A;  2K8I A;  4W9O A;  4JFL A;  4JFK A;  2XP5 A;  3KAF A;  3UI5 A;  3IKG A;  4ODO A;  4J4N A;  1ZCN A;  3O5E A;  3NI6 A;  3H9R B;  1JNS A;  2RUR A;  2MPH A;  1PIN A;  1KT0 A;  2VCD A;  4QIB A;  3O5J A;  3O5P A;  4ODN A;  1N1A A;  4N19 A;  3TDB A;  3WH0 A;  4C02 B;  5J6E A;  1ZK6 A;  4DRO A;  1M5Y A;  2M1I A;  4NNR A;  2XP3 A;  3TC5 A;  3B7X A;  2PPN A;  2ZR5 A;  4LAX A;  4FAP A;  2KR7 A;  2ZQV A;  4TX0 A;  1Y0O A;  2LGO A;  4ODK A;  1J4I A;  2MNT A;  5GPG A;  4ODP A;  3UQI A;  4JFM A;  1HXV A;  3PRB A;  1YAT A;  4DRQ A;  1FJD A;  2MF9 A;  4DH0 A;  2KE0 A;  4G2P A;  4JFI A;  4DT4 A;  3IKD A;  2F21 A;  4TYO A;  4ITZ A;  1C9H A;  5HWC A;  2L2S A;  3ODK A;  4DRM A;  3KCE A;  2XP4 A;  2PPO A;  3VAW A;  2MLZ A;  4DZ2 A;  4DRK A;  3KAC A;  3CGN A;  3O5L A;  1L1P A;  4GIV A;  2FKE A;  4TW6 A;  2RUQ A;  1P5Q A;  2M08 A;  3O5Q A;  4JYS A;  4MGV A;  4TW7 A;  1QZ2 A;  1J4H A;  1YW5 A;  2ZQS A;  4W9P A;  4DRN A;  3O5I A;  2ITK A;  5HUA A;  3I6C A;  4JFJ A;  1D7J A;  4W9Q A;  1FAP A;  4ODL A;  4J4O A;  4IPX A;  2ZR4 A;  2XPA A;  1BKF A;  3O5M A;  2DG4 A;  4U86 A;  1FKD A;  2VN1 A;  4G50 A;  1FKI A;  2D9F A;  1FKJ A;  1TCO C;  1U79 A;  2N87 A;  3FAP A;  2IF4 A;  1W26 A;  5HKG A;  1Q6U A;  5B8I C;  2PV1 A;  3KAI A;  3IHZ A;  1D7H A;  2KFW A;  1QPF A;  3UI4 A;  4DRI A;  2M2A A;  2DG3 A;  3UQB A;  2Q5A A;  2LPV A;  2RUD A;  2ZQU A;  5HW8 A;  2LJ4 A;  1FKT A;  3O5R A;  5HW6 A;  2ZR6 A;  2Y78 A;  1T11 A;  4BF8 A;  1Q6I A;  1QPL A;  3KAD A;  3LUO A;  4ODR A;  3RFW A;  4FN2 A;  1JVW A;  3CGM A;  3NTP A;  3O5O A;  1B6C A;  1R9H A;  2F4E A;  5DIV A;  4MSP A;  2PV2 A;  4DIP A;  2JZV A;  3UI6 A;  1FKG A;  3O5G A;  4DZ3 A;  1FKR A;  1FKS A;  2LKN A;  1FKK A;  2KO7 A;  2XPB A;  3PA7 A;  2XP8 A;  1FKL A;  4LAY A;  1JNT A;  1PBK A;  2UZ5 A;  3OOB A;  3O5F A;  5I98 A;  1A7X A;  4QT3 A;  3GPK A;  1FD9 A;  3JYJ A;  1D6O A;  4U84 A;  1ROT A;  4DRP A;  1ROU A;  2FAP A;  1NSG A;  4ODM A;  4QT2 A;  2KGJ A;  5HTG A;  1BL4 A;  3RGC A;  1FKB A;  2DG9 A;  4O2T A;  1J6Y A;  3KAB A;  3EY6 A;  2AWG A;  1NMV A;  2MLX A;  1F8A B;  4TW8 A;  4GGQ A;  3NRK A;  1Q1C A;  1Q6H A;  2PV3 A;  3PRD A;  4ODQ A;  4U85 A;  1D7I A;  2MLY A;  2F2D A;  1NMW A;  2OFN A;  2XP7 A;  2RQS A; 
#chains in the Genus database with same CATH topology
 1E6R A;  4WKH A;  2ZQT A;  1W1V A;  2XP9 A;  4HBE A;  2RSE A;  3O5D A;  1GOI A;  3JXV A;  4KQZ A;  4R0X A;  2WLY A;  4ML4 A;  1NH6 A;  3JYM A;  5DIT A;  5HW7 A;  4IQ2 A;  3AS1 A;  1FKH A;  3AS3 A;  2XP5 A;  3ARX A;  3KAF A;  3IKG A;  1LG1 A;  3CZ8 A;  2MPH A;  2VCD A;  3AS2 A;  4QIB A;  4ODN A;  2B31 A;  4N19 A;  1NWS A;  1ZK6 A;  1M5Y A;  2DT2 A;  2XP3 A;  4XAK A;  3TC5 A;  2PPN A;  2ZR5 A;  1W9U A;  4FAP A;  2ZQV A;  1NWU A;  4ODK A;  1LG2 A;  5GPG A;  4ODP A;  4QZV B;  1EIB A;  1HXV A;  3PRB A;  1E15 A;  4G2P A;  4DWS D;  3G6L A;  1C9H A;  3ODK A;  4KR0 B;  1H0I A;  1HKI A;  2XP4 A;  4DZ2 A;  4DRK A;  2AOS A;  2RUQ A;  2ZQS A;  4DRN A;  5HUA A;  4MNM A;  2ITK A;  4LGX A;  4ZPT R;  1ITX A;  3O5M A;  4U86 A;  2VN1 A;  2D9F A;  1TCO C;  1U79 A;  2N87 A;  2IF4 A;  5HKG A;  1W1P A;  2PI6 A;  2M2A A;  3UQB A;  2Q5A A;  2LJ4 A;  1FKT A;  3O5R A;  3ART A;  4Z2L A;  1Q6I A;  3LUO A;  3RFW A;  2G8Z A;  1JVW A;  3CGM A;  3NTP A;  3PRA A;  4FN2 A;  4Q22 A;  1R9H A;  2F4E A;  3RME A;  2DSV A;  2ESC A;  2PV2 A;  4S3J A;  1FKG A;  1HKJ A;  3ALF A;  1FKS A;  1GUV A;  1FKK A;  2XP8 A;  1NWR A;  3RM9 A;  1JNT A;  1GPF A;  3WQV A;  1FD9 A;  1D6O A;  2FDM A;  2O92 A;  2FAP A;  1UR8 A;  4QT2 A;  2KGJ A;  5DEZ A;  2DG9 A;  1HKM A;  4UDM A;  3KAB A;  1NMV A;  1F8A B;  1HJV A;  4GGQ A;  3NRK A;  1Q1C A;  1VF8 A;  4LAV A;  4TNS A;  4DRJ A;  4PTM A;  3TCZ A;  3KAH A;  1EQ3 A;  2RUC A;  2XP6 A;  3O5K A;  1OGG A;  3UQA A;  5HWB A;  4IQC A;  5BXJ A;  2DSZ A;  3ARQ A;  3B9E A;  4JFK A;  2IUZ A;  4W5U A;  3UI5 A;  1TFV A;  3O5E A;  2WM0 A;  3W4R A;  1SYT A;  1PIN A;  3WH0 A;  4C02 B;  2A3B A;  4DRO A;  1LL7 A;  2DT3 A;  4NNR A;  2DSW A;  2ETN A;  3B7X A;  4LAX A;  2KR7 A;  4P8V A;  4P8X A;  1ZBW A;  4JFM A;  3B9A A;  4MNJ A;  3IKD A;  3PR9 A;  2F21 A;  4ITZ A;  5HWC A;  3ARO A;  1X6N A;  2MLZ A;  2B5U B;  3B8S A;  3RM4 A;  4TW7 A;  3O5Q A;  1J4H A;  1QZ2 A;  1YW5 A;  4W9P A;  3WD0 A;  4L72 B;  1LL4 A;  1D7J A;  3ARV A;  4W9Q A;  1FAP A;  1K9T A;  1W1Y A;  1SR0 A;  2XPA A;  3ARR A;  1FKD A;  1FKI A;  4HAR A;  3FAP A;  1ZBK A;  1Q6U A;  5B8I C;  3KAI A;  1ZU8 A;  1D7H A;  2RUD A;  2ZQU A;  2ZR6 A;  1QPL A;  4ZPV R;  3FXY A;  1EHN A;  2KO7 A;  3QOK A;  3PA7 A;  1UR9 A;  1PBK A;  3G6M A;  2QF8 A;  3OOB A;  4QT3 A;  4IT4 A;  3GPK A;  4DRP A;  4U84 A;  1ROU A;  1FFR A;  1NSG A;  4HBO A;  1E44 A;  1H0G A;  4O2T A;  1LL6 A;  3EY6 A;  2AWG A;  1CTN A;  1XRV A;  4TW8 A;  2WK2 A;  3WL1 A;  2PV3 A;  4U85 A;  1D7I A;  3TDB A;  2XP7 A;  3AS0 A;  4URI A;  4MAV A;  1HJW A;  3UF8 A;  3CHC A;  1KT1 A;  2A3C A;  3B9D A;  3CHF A;  3GTY X;  1GRJ A;  3KZ7 A;  3MDY B;  3KAG A;  2K8I A;  4W9O A;  5GPR A;  4ODO A;  3CHE A;  3NI6 A;  2G41 A;  2RUR A;  1KT0 A;  1LQ0 A;  1N1A A;  3AQU A;  1OGB A;  5J6E A;  4MPK A;  2M1I A;  3UQI A;  2YBT A;  1FJD A;  3GU0 A;  2KE0 A;  4WKF A;  3OA5 A;  4ZPW R;  5JH8 A;  2L2S A;  3ARW A;  3KCE A;  4DRM A;  4MTV A;  2PPO A;  3VAW A;  3KAC A;  3CGN A;  4GIV A;  2FKE A;  4TW6 A;  4JYS A;  1WNO A;  3BMB A;  1WAW A;  3O5I A;  4NZC A;  4ODL A;  4IPX A;  2ZR4 A;  1BKF A;  2DG4 A;  4WJX A;  1FKJ A;  2PV1 A;  3WD3 A;  4S3K A;  3IHZ A;  2F23 A;  1O6I A;  1QPF A;  3UI4 A;  3FY1 A;  2DG3 A;  4WK9 A;  2Y78 A;  1T11 A;  3RM8 A;  3KAD A;  1B6C A;  5DIV A;  4DIP A;  2JZV A;  3CHD A;  3O5G A;  1JNE A;  4LAY A;  1FKL A;  1ZBC A;  3ARS A;  5HBF A;  5I98 A;  1A7X A;  4DWS A;  4Z2G A;  3JYJ A;  4ODM A;  2PN0 A;  5HTG A;  1BL4 A;  1FFQ A;  3WD1 A;  4WKA A;  4Z2I A;  1J6Y A;  1Q6H A;  3PRD A;  1HJX A;  4ODQ A;  2F2D A;  2OFN A;  2WLZ A;  3ARP A;  5HT1 A;  2PPP A;  1FKF A;  1E6N A;  5D75 A;  2DSU A;  1EYM A;  3IK8 A;  4LAW A;  2KI3 A;  5DIU A;  1F40 A;  1LJY A;  2OLH A;  4DRH A;  2DT1 A;  1J4R A;  2PBC A;  3WQW A;  4ZS6 A;  1E6Z A;  4JFL A;  3ARY A;  4J4N A;  1ZCN A;  4Q7N A;  3WD2 A;  2A3A A;  4AY1 A;  3H9R B;  1JNS A;  3ARZ A;  5DO2 A;  3O5J A;  3O5P A;  1KFW A;  4Z2J A;  4MNL A;  3WIJ A;  1NWT A;  4Z2H A;  1W9V A;  1D2K A;  3ARU A;  4TX0 A;  1Y0O A;  2LGO A;  3ALG A;  1J4I A;  2MNT A;  2A3E A;  1X6L A;  4WIW A;  1YAT A;  4DRQ A;  1ZBV A;  2MF9 A;  4DH0 A;  4DT4 A;  2EUL A;  4JFI A;  4DWS B;  4TYO A;  1W9P A;  1OWQ A;  4IT6 A;  3O5L A;  1L1P A;  1P5Q A;  2DT0 A;  2M08 A;  4MGV A;  3CH9 A;  1JND A;  3I6C A;  4JFJ A;  1HKK A;  4J4O A;  4G50 A;  2YBU A;  1ZL1 A;  1W26 A;  5GQB A;  2DPE A;  4L3N A;  2KFW A;  4DRI A;  1WB0 A;  2LPV A;  5HW8 A;  1W1T A;  1ZB5 A;  5DF0 A;  1E9L A;  5HW6 A;  4BF8 A;  1JCH B;  4ODR A;  3O5O A;  2P4V A;  4MSP A;  3UI6 A;  4DWS C;  4DZ3 A;  3WD4 A;  1FKR A;  2LKN A;  2XPB A;  1IX5 A;  4NSB A;  2UZ5 A;  2O9O A;  3O5F A;  1RD6 A;  4P8W A;  1ROT A;  4P8U A;  3EIP A;  3RGC A;  4MNK A;  1FKB A;  3WL0 A;  1EDQ A;  4R5E A;  2MLX A;  3WKZ A;  1XHG A;  1E6P A;  2MLY A;  1NMW A;  3BXW A;  2RQS A;  4Z2K A; 
#chains in the Genus database with same CATH homology
 1E6R A;  4WKH A;  2ZQT A;  1W1V A;  2XP9 A;  4HBE A;  2RSE A;  3O5D A;  1GOI A;  3JXV A;  4KQZ A;  4R0X A;  2WLY A;  4ML4 A;  1NH6 A;  3JYM A;  5DIT A;  5HW7 A;  4IQ2 A;  3AS1 A;  1FKH A;  3AS3 A;  2XP5 A;  3ARX A;  3KAF A;  3IKG A;  1LG1 A;  3CZ8 A;  2MPH A;  2VCD A;  3AS2 A;  4QIB A;  4ODN A;  2B31 A;  4N19 A;  1NWS A;  1ZK6 A;  1M5Y A;  2DT2 A;  2XP3 A;  4XAK A;  3TC5 A;  2PPN A;  2ZR5 A;  1W9U A;  4FAP A;  2ZQV A;  1NWU A;  4ODK A;  1LG2 A;  5GPG A;  4ODP A;  4QZV B;  1EIB A;  1HXV A;  3PRB A;  1E15 A;  4G2P A;  4DWS D;  3G6L A;  1C9H A;  3ODK A;  4KR0 B;  1H0I A;  1HKI A;  2XP4 A;  4DZ2 A;  4DRK A;  2AOS A;  2RUQ A;  2ZQS A;  4DRN A;  5HUA A;  4MNM A;  2ITK A;  4LGX A;  4ZPT R;  1ITX A;  3O5M A;  4U86 A;  2VN1 A;  2D9F A;  1TCO C;  1U79 A;  2N87 A;  2IF4 A;  5HKG A;  1W1P A;  2PI6 A;  2M2A A;  3UQB A;  2Q5A A;  2LJ4 A;  1FKT A;  3O5R A;  3ART A;  4Z2L A;  1Q6I A;  3LUO A;  3RFW A;  2G8Z A;  1JVW A;  3CGM A;  3NTP A;  3PRA A;  4FN2 A;  4Q22 A;  1R9H A;  2F4E A;  3RME A;  2DSV A;  2ESC A;  2PV2 A;  4S3J A;  1FKG A;  1HKJ A;  3ALF A;  1FKS A;  1GUV A;  1FKK A;  2XP8 A;  1NWR A;  3RM9 A;  1JNT A;  1GPF A;  3WQV A;  1FD9 A;  1D6O A;  2FDM A;  2O92 A;  2FAP A;  1UR8 A;  4QT2 A;  2KGJ A;  5DEZ A;  2DG9 A;  1HKM A;  3KAB A;  1NMV A;  1F8A B;  1HJV A;  4GGQ A;  3NRK A;  1Q1C A;  1VF8 A;  4LAV A;  4TNS A;  4DRJ A;  4PTM A;  3TCZ A;  3KAH A;  1EQ3 A;  2RUC A;  2XP6 A;  3O5K A;  1OGG A;  3UQA A;  5HWB A;  4IQC A;  5BXJ A;  2DSZ A;  3ARQ A;  3B9E A;  4JFK A;  2IUZ A;  4W5U A;  3UI5 A;  1TFV A;  3O5E A;  2WM0 A;  3W4R A;  1SYT A;  1PIN A;  3WH0 A;  4C02 B;  2A3B A;  4DRO A;  1LL7 A;  2DT3 A;  4NNR A;  2DSW A;  3B7X A;  4LAX A;  2KR7 A;  4P8V A;  4P8X A;  1ZBW A;  4JFM A;  3B9A A;  4MNJ A;  3IKD A;  3PR9 A;  2F21 A;  4ITZ A;  5HWC A;  3ARO A;  1X6N A;  2MLZ A;  3B8S A;  3RM4 A;  4TW7 A;  3O5Q A;  1J4H A;  1QZ2 A;  1YW5 A;  4W9P A;  3WD0 A;  4L72 B;  1LL4 A;  1D7J A;  3ARV A;  4W9Q A;  1FAP A;  1K9T A;  1W1Y A;  1SR0 A;  2XPA A;  3ARR A;  1FKD A;  1FKI A;  4HAR A;  3FAP A;  1ZBK A;  1Q6U A;  5B8I C;  3KAI A;  1ZU8 A;  1D7H A;  2RUD A;  2ZQU A;  2ZR6 A;  1QPL A;  4ZPV R;  3FXY A;  1EHN A;  2KO7 A;  3QOK A;  3PA7 A;  1UR9 A;  1PBK A;  3G6M A;  2QF8 A;  3OOB A;  4QT3 A;  4IT4 A;  3GPK A;  4DRP A;  4U84 A;  1ROU A;  1FFR A;  1NSG A;  4HBO A;  1H0G A;  4O2T A;  1LL6 A;  3EY6 A;  2AWG A;  1CTN A;  1XRV A;  4TW8 A;  2WK2 A;  3WL1 A;  2PV3 A;  4U85 A;  1D7I A;  3TDB A;  2XP7 A;  3AS0 A;  4URI A;  4MAV A;  1HJW A;  3UF8 A;  3CHC A;  1KT1 A;  2A3C A;  3B9D A;  3CHF A;  3KZ7 A;  3MDY B;  3KAG A;  2K8I A;  4W9O A;  5GPR A;  4ODO A;  3CHE A;  3NI6 A;  2G41 A;  2RUR A;  1KT0 A;  1LQ0 A;  1N1A A;  3AQU A;  1OGB A;  5J6E A;  4MPK A;  2M1I A;  3UQI A;  2YBT A;  1FJD A;  2KE0 A;  4WKF A;  3OA5 A;  4ZPW R;  5JH8 A;  2L2S A;  3ARW A;  3KCE A;  4DRM A;  4MTV A;  2PPO A;  3VAW A;  3KAC A;  3CGN A;  4GIV A;  2FKE A;  4TW6 A;  4JYS A;  1WNO A;  1WAW A;  3O5I A;  4NZC A;  4ODL A;  4IPX A;  2ZR4 A;  1BKF A;  2DG4 A;  4WJX A;  1FKJ A;  2PV1 A;  3WD3 A;  4S3K A;  3IHZ A;  1O6I A;  1QPF A;  3UI4 A;  3FY1 A;  2DG3 A;  4WK9 A;  2Y78 A;  1T11 A;  3RM8 A;  3KAD A;  1B6C A;  5DIV A;  4DIP A;  2JZV A;  3CHD A;  3O5G A;  1JNE A;  4LAY A;  1FKL A;  1ZBC A;  3ARS A;  5HBF A;  5I98 A;  1A7X A;  4DWS A;  4Z2G A;  3JYJ A;  4ODM A;  5HTG A;  1BL4 A;  1FFQ A;  3WD1 A;  4WKA A;  4Z2I A;  1J6Y A;  1Q6H A;  3PRD A;  1HJX A;  4ODQ A;  2F2D A;  2OFN A;  2WLZ A;  3ARP A;  5HT1 A;  2PPP A;  1FKF A;  1E6N A;  5D75 A;  2DSU A;  1EYM A;  3IK8 A;  4LAW A;  2KI3 A;  5DIU A;  1F40 A;  1LJY A;  2OLH A;  4DRH A;  2DT1 A;  1J4R A;  2PBC A;  3WQW A;  4ZS6 A;  1E6Z A;  4JFL A;  3ARY A;  4J4N A;  1ZCN A;  4Q7N A;  3WD2 A;  2A3A A;  4AY1 A;  3H9R B;  1JNS A;  3ARZ A;  5DO2 A;  3O5J A;  3O5P A;  1KFW A;  4Z2J A;  4MNL A;  3WIJ A;  1NWT A;  4Z2H A;  1W9V A;  1D2K A;  3ARU A;  4TX0 A;  1Y0O A;  2LGO A;  3ALG A;  1J4I A;  2MNT A;  2A3E A;  1X6L A;  4WIW A;  1YAT A;  4DRQ A;  1ZBV A;  2MF9 A;  4DH0 A;  4DT4 A;  4JFI A;  4DWS B;  4TYO A;  1W9P A;  1OWQ A;  4IT6 A;  3O5L A;  1L1P A;  1P5Q A;  2DT0 A;  2M08 A;  4MGV A;  3CH9 A;  1JND A;  3I6C A;  4JFJ A;  1HKK A;  4J4O A;  4G50 A;  2YBU A;  1ZL1 A;  1W26 A;  5GQB A;  2DPE A;  4L3N A;  2KFW A;  4DRI A;  1WB0 A;  2LPV A;  5HW8 A;  1W1T A;  1ZB5 A;  5DF0 A;  1E9L A;  5HW6 A;  4BF8 A;  4ODR A;  3O5O A;  4MSP A;  3UI6 A;  4DWS C;  4DZ3 A;  3WD4 A;  1FKR A;  2LKN A;  2XPB A;  1IX5 A;  4NSB A;  2UZ5 A;  2O9O A;  3O5F A;  1RD6 A;  4P8W A;  1ROT A;  4P8U A;  3RGC A;  4MNK A;  1FKB A;  3WL0 A;  1EDQ A;  4R5E A;  2MLX A;  3WKZ A;  1XHG A;  1E6P A;  2MLY A;  1NMW A;  3BXW A;  2RQS A;  4Z2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...