4IQ2A

P21 crystal form of fkbp12.6
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
107
structure length
107
Chain Sequence
GVEIETISPGDGRTFPKKGQTVVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTITPDVAYGATGHPGVIPPNATLIFDVELLNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and conformational flexibility of the unligated FK506-binding protein FKBP12.6.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1B
total genus 21
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4iq2A00
3KAGA 4DRNA 2RUDA 1PBKA 2KO7A 3O5PA 1KT1A 3NTPA 2XP4A 1BKFA 4JFMA 2M08A 3JYJA 3JYMA 3O5OA 4LAVA 2ZR6A 2LPVA 3H9RB 3KAFA 1YW5A 5DIVA 2XP8A 4JFJA 2PPPA 4ITZA 4U84A 2D9FA 1KT0A 4ODNA 4QIBA 3NI6A 1FKIA 4DZ2A 3RFWA 2MPHA 4NNRA 1L1PA 1FKJA 2VN1A 5HTGA 4W9OA 1FKFA 4DIPA 1P5QA 2LGOA 3O5RA 4J4NA 2M1IA 3O5QA 2KI3A 1R9HA 4ODLA 1EYMA 4LAXA 4BF8A 1NMVA 1FD9A 3O5DA 1F40A 2KE0A 1ROUA 2OFNA 4DRMA 1FKBA 2ZR5A 4JFIA 5D75A 5HT1A 2F4EA 2ITKA 1FKDA 2KGJA 1FAPA 2XP5A 3O5KA 4IQ2A 4DRQA 5B8IC 5BXJA 3UQBA 1W26A 4TW8A 2N87A 2XPBA 3TC5A 4DROA 3PRDA 2MNTA 4DT4A 1M5YA 1JVWA 2L2SA 1YATA 2PV2A 4MSPA 1D6OA 1PINA 4DRIA 3KAIA 1NMWA 2ZR4A 4ODOA 1J6YA 2ZQVA 3EY6A 4JFKA 1FKKA 3CGMA 4ODQA 2XP3A 3UF8A 5DIUA 1C9HA 1ZCNA 2LKNA 1Q6IA 4G50A 3O5EA 3KACA 3O5FA 3IK8A 3KCEA 2JZVA 1HXVA 1FKLA 3I6CA 2XP6A 4G2PA 4O2TA 4JYSA 1J4IA 2ZQSA 2RURA 3B7XA 4QT3A 3VAWA 3MDYB 3O5IA 1JNSA 2IF4A 4LAYA 1FKGA 4TW7A 2MF9A 5HW8A 5I98A 2PV3A 3PRBA 3UQAA 3IKGA 2DG4A 1F8AB 1J4RA 2MLYA 1D7IA 1J4HA 3FAPA 3O5LA 2FKEA 3O5MA 3UI4A 4DRKA 3NRKA 2PPOA 5GPGA 1JNTA 2PV1A 2DG9A 2UZ5A 3KADA 4N19A 4ODPA 3KABA 4DRPA 1FKSA 2AWGA 4GIVA 1NSGA 2F21A 2RQSA 4JFLA 2KR7A 2KFWA 5J6EA 1Y0OA 1D7JA 2XP7A 4ODMA 1EQ3A 4IPXA 3KAHA 3RGCA 5HUAA 1TCOC 3TCZA 2RUCA 4QT2A 4TX0A 2Y78A 4C02B 1Q6HA 3PA7A 4DRJA 5HKGA 4MGVA 3IHZA 1QPFA 4U86A 1BL4A 2M2AA 3WH0A 4DRHA 2DG3A 2RUQA 1D7HA 3UI6A 3IKDA 3KZ7A 4GGQA 2PPNA 5HWBA 5HW7A 1FKRA 4LAWA 3OOBA 2XP9A 4TYOA 2F2DA 3O5JA 4ODKA 3LUOA 1FKTA 5DITA 1Q1CA 1FJDA 2K8IA 2ZQUA 1Q6UA 2XPAA 4W9QA 4W9PA 4DH0A 1A7XA 2LJ4A 3UI5A 2MLXA 1ROTA 3TDBA 1QZ2A 4FAPA 1QPLA 3GPKA 1B6CA 4U85A 3UQIA 2ZQTA 2VCDA 3CGNA 4R0XA 1U79A 1ZK6A 2FAPA 5HWCA 4ODRA 3O5GA 1FKHA 2PBCA 4TNSA 3JXVA 2MLZA 2Q5AA 4J4OA 2RSEA 4TW6A 4DZ3A 4IQCA 1T11A 5HW6A 1N1AA 3ODKA 4FN2A
chains in the Genus database with same CATH superfamily
4DRNA 1HJWA 1W1VA 4QZVB 2XP4A 1LL7A 3JYMA 2B31A 2ZR6A 3CHFA 3KAFA 5DIVA 4U84A 1ZB5A 3NI6A 1FKIA 3ARYA 1H0IA 2MPHA 1FKJA 5GPRA 2DT0A 1NWSA 4W9OA 2LGOA 4S3JA 4BF8A 4LAXA 1NMVA 5DO2A 3RMEA 3CH9A 1VF8A 2ZR5A 5DEZA 1RD6A 5B8IC 3O5KA 5BXJA 4DWSC 1W26A 2PV2A 1D6OA 3PRAA 1OGBA 4ODOA 4JFKA 1SYTA 1FKKA 3CGMA 2LKNA 1UR9A 2A3BA 3O5FA 2JZVA 4G2PA 2RURA 2IF4A 1FKGA 2YBUA 3PR9A 2A3AA 4TYOA 2MLYA 1D7IA 1NH6A 2WLYA 3CHCA 3UI4A 1EHNA 5GPGA 2P4VA 1JNTA 3ARQA 1NWUA 3ARPA 4Z2KA 1W9VA 3KAHA 3WIJA 2A3CA 1Q6HA 3RM8A 4DRJA 4KR0B 1QPFA 1BL4A 1JCHB 4MAVA 5HWBA 3GU0A 1ZBCA 4L3NA 1HJXA 3O5JA 3ARWA 4ODKA 1W1YA 1FJDA 4L72B 2ZQUA 1A7XA 4ZPWR 3UI5A 2WM0A 1ROTA 4P8XA 1U79A 2FAPA 2PI6A 5HWCA 2DT3A 4R5EA 2PBCA 4ML4A 4TNSA 4J4OA 2MLZA 2Q5AA 2RSEA 1JNDA 2AOSA 4IQCA 1T11A 3ODKA 3KAGA 4MSPA 2KO7A 2O92A 3O5PA 3NTPA 1BKFA 3O5OA 3H9RB 4Z2GA 1YW5A 2PPPA 4ITZA 2D9FA 4NNRA 4HBOA 3B8SA 1P5QA 4J4NA 3O5RA 2M1IA 1R9HA 2G41A 4IT6A 4Q22A 3G6MA 1WB0A 1ROUA 4WJXA 2DSUA 4XAKA 1FKBA 3B9EA 4JFIA 4W5UA 4DRMA 2EULA 2F4EA 2KGJA 1FKDA 3WD0A 4DRQA 3UQBA 2N87A 4NZCA 3ARRA 4DT4A 1JVWA 2L2SA 1WAWA 4P8VA 4HBEA 4Q7NA 1NMWA 1FFRA 2ZR4A 1HKJA 1H0GA 3BMBA 3KACA 1CTNA 3IK8A 3O5EA 1HXVA 3I6CA 3WD3A 2XP6A 5HBFA 2ZQSA 3G6LA 3VAWA 1E6RA 3EIPA 3MDYB 3ALFA 5I98A 2PV3A 3IKGA 2ETNA 1J4RA 1J4HA 2QF8A 1W9UA 2FKEA 3NRKA 4DRPA 2PV1A 2DG9A 1E6ZA 2UZ5A 3KADA 4N19A 1HKMA 3KABA 1FKSA 3WQWA 2AWGA 4GIVA 2RQSA 2KR7A 1ZBKA 2XP7A 1EQ3A 3ARVA 3B9AA 1TCOC 1LG2A 3PA7A 3IHZA 3WKZA 2DT2A 4DRHA 2RUQA 1D7HA 3IKDA 3AS3A 1FKRA 4LAWA 2ESCA 3LUOA 2WLZA 4WIWA 3WL0A 1FKTA 5DITA 3GTYX 2K8IA 2XPAA 2MLXA 2O9OA 3TDBA 3GPKA 2DSWA 4U85A 4Z2LA 1JNEA 4ODRA 3O5GA 1FKHA 3ARSA 3JXVA 3CZ8A 4NSBA 3ALGA 3AROA 3ARTA 5HW6A 1K9TA 4ZPTR 1WNOA 2M08A 2YBTA 4LAVA 1ZBVA 2LPVA 2DT1A 2XP8A 4JFJA 3OA5A 4WKHA 1IX5A 1KT0A 4ODNA 4QIBA 1OWQA 1L1PA 2VN1A 5JH8A 1XHGA 3B9DA 1FKFA 3O5QA 2KI3A 1EYMA 4S3KA 1GOIA 2FDMA 4ZPVR 4HARA 2OFNA 1LJYA 4P8UA 3WD1A 2ITKA 2XP5A 4IQ2A 1EIBA 1X6LA 4DROA 2XPBA 3TC5A 4DWSA 3BXWA 3WD2A 1PINA 4DRIA 4MPKA 1HKIA 3EY6A 1E6PA 4ODQA 5DIUA 2G8ZA 3KCEA 4O2TA 3B7XA 4QT3A 1JNSA 4TW7A 5HW8A 3PRBA 2DPEA 1F8AB 3O5LA 4DRKA 1LG1A 3FY1A 2F23A 3FXYA 3ARXA 5GQBA 1NSGA 1HKKA 2KFWA 5J6EA 1Y0OA 4ODMA 3CHEA 1LQ0A 1W9PA 2B5UB 3RGCA 1EDQA 1TFVA 2RUCA 4QT2A 2Y78A 1W1PA 4TX0A 4C02B 3AS1A 2DG3A 1GPFA 3UI6A 1LL4A 3ARUA 3ARZA 2PPNA 4GGQA 4DWSD 1E44A 3OOBA 2XP9A 4Z2HA 2F2DA 4MNKA 1Q1CA 4WKFA 1X6NA 1UR8A 1Q6UA 1W1TA 4DWSB 4W9QA 4W9PA 2LJ4A 1QZ2A 1QPLA 3CHDA 3UQIA 2ZQTA 1HJVA 2IUZA 4TW6A 4PTMA 1SR0A 2RUDA 1PBKA 1KT1A 4JFMA 3JYJA 4MNLA 1NWRA 3WQVA 1GRJA 2PN0A 3RFWA 5HTGA 1KFWA 4UDMA 4DIPA 5DF0A 4ODLA 4MNMA 1ZU8A 1FD9A 3AQUA 3O5DA 1O6IA 1F40A 2KE0A 1FFQA 5D75A 5HT1A 4ZS6A 1FAPA 4TW8A 3PRDA 1E6NA 2MNTA 1M5YA 1YATA 1ITXA 3WD4A 1OGGA 3KAIA 4P8WA 2ZQVA 1J6YA 4Z2JA 1ZL1A 2XP3A 3UF8A 1C9HA 1ZCNA 4G50A 1Q6IA 4Z2IA 1XRVA 1FKLA 2A3EA 4JYSA 1J4IA 3O5IA 4LAYA 3UQAA 2MF9A 1ZBWA 1GUVA 4DZ2A 2DG4A 3FAPA 3O5MA 1E9LA 2WK2A 2PPOA 4ODPA 3W4RA 3AS0A 3QOKA 2F21A 4JFLA 4MNJA 1D7JA 4IPXA 1LL6A 3WL1A 5HUAA 3TCZA 4AY1A 5HKGA 4WKAA 4MTVA 4MGVA 4U86A 2OLHA 2M2AA 3WH0A 3KZ7A 5HW7A 1E15A 4LGXA 4URIA 4WK9A 4DH0A 1D2KA 4FAPA 4KQZA 1B6CA 1NWTA 2VCDA 3CGNA 4R0XA 3RM4A 4IT4A 1ZK6A 3RM9A 2DSZA 3AS2A 4DZ3A 2DSVA 1N1AA 4FN2A
chains in the Genus database with same CATH topology
4DRNA 1HJWA 1W1VA 4QZVB 2XP4A 1LL7A 3JYMA 2B31A 2ZR6A 3CHFA 3KAFA 5DIVA 4U84A 1ZB5A 3NI6A 1FKIA 3ARYA 1H0IA 2MPHA 1FKJA 5GPRA 2DT0A 1NWSA 4W9OA 2LGOA 4S3JA 4BF8A 4LAXA 1NMVA 5DO2A 3RMEA 3CH9A 1VF8A 2ZR5A 5DEZA 1RD6A 5B8IC 3O5KA 5BXJA 4DWSC 1W26A 2PV2A 1D6OA 3PRAA 1OGBA 4ODOA 4JFKA 1SYTA 1FKKA 3CGMA 2LKNA 1UR9A 2A3BA 3O5FA 2JZVA 4G2PA 2RURA 2IF4A 1FKGA 2YBUA 3PR9A 2A3AA 4TYOA 2MLYA 1D7IA 1NH6A 2WLYA 3CHCA 3UI4A 1EHNA 5GPGA 1JNTA 3ARQA 1NWUA 3ARPA 4Z2KA 1W9VA 3KAHA 3WIJA 2A3CA 1Q6HA 3RM8A 4DRJA 4KR0B 1QPFA 1BL4A 4MAVA 5HWBA 1ZBCA 4L3NA 1HJXA 3O5JA 3ARWA 4ODKA 1W1YA 1FJDA 4L72B 2ZQUA 1A7XA 4ZPWR 3UI5A 2WM0A 1ROTA 4P8XA 1U79A 2FAPA 2PI6A 5HWCA 2DT3A 4R5EA 2PBCA 4ML4A 4TNSA 4J4OA 2MLZA 2Q5AA 2RSEA 1JNDA 2AOSA 4IQCA 1T11A 3ODKA 3KAGA 4MSPA 2KO7A 2O92A 3O5PA 3NTPA 1BKFA 3O5OA 3H9RB 4Z2GA 1YW5A 2PPPA 4ITZA 2D9FA 4NNRA 4HBOA 3B8SA 1P5QA 4J4NA 3O5RA 2M1IA 1R9HA 2G41A 4IT6A 4Q22A 3G6MA 1WB0A 1ROUA 4WJXA 2DSUA 4XAKA 1FKBA 3B9EA 4JFIA 4W5UA 4DRMA 2F4EA 2KGJA 1FKDA 3WD0A 4DRQA 3UQBA 2N87A 4NZCA 3ARRA 4DT4A 1JVWA 2L2SA 1WAWA 4P8VA 4HBEA 4Q7NA 1NMWA 1FFRA 2ZR4A 1HKJA 1H0GA 3KACA 3O5EA 1CTNA 3IK8A 1HXVA 3I6CA 3WD3A 2XP6A 5HBFA 2ZQSA 3G6LA 3VAWA 1E6RA 3MDYB 3ALFA 5I98A 2PV3A 3IKGA 1J4RA 1J4HA 1W9UA 2QF8A 2FKEA 3NRKA 4DRPA 2PV1A 2DG9A 1E6ZA 2UZ5A 3KADA 4N19A 1HKMA 3KABA 1FKSA 3WQWA 2AWGA 4GIVA 2RQSA 2KR7A 1ZBKA 2XP7A 1EQ3A 3ARVA 3B9AA 1TCOC 1LG2A 3PA7A 3IHZA 3WKZA 2DT2A 4DRHA 2RUQA 1D7HA 3IKDA 3AS3A 1FKRA 4LAWA 2ESCA 3LUOA 2WLZA 4WIWA 3WL0A 1FKTA 5DITA 2K8IA 2XPAA 2MLXA 2O9OA 3TDBA 3GPKA 2DSWA 4U85A 4Z2LA 1JNEA 4ODRA 3O5GA 1FKHA 3ARSA 3JXVA 3CZ8A 4NSBA 3ALGA 3AROA 3ARTA 5HW6A 1K9TA 4ZPTR 1WNOA 2M08A 2YBTA 4LAVA 1ZBVA 2LPVA 2DT1A 2XP8A 4JFJA 3OA5A 4WKHA 1IX5A 1KT0A 4ODNA 4QIBA 1OWQA 1L1PA 2VN1A 5JH8A 1XHGA 3B9DA 1FKFA 3O5QA 2KI3A 1EYMA 4S3KA 1GOIA 2FDMA 4ZPVR 4HARA 2OFNA 1LJYA 4P8UA 3WD1A 2ITKA 2XP5A 4IQ2A 1EIBA 1X6LA 4DROA 2XPBA 3TC5A 4DWSA 3BXWA 3WD2A 1PINA 4DRIA 4MPKA 1HKIA 3EY6A 1E6PA 4ODQA 5DIUA 2G8ZA 3KCEA 4O2TA 3B7XA 4QT3A 1JNSA 4TW7A 5HW8A 3PRBA 2DPEA 1F8AB 3O5LA 4DRKA 1LG1A 3FY1A 3FXYA 3ARXA 5GQBA 1NSGA 1HKKA 2KFWA 5J6EA 1Y0OA 4ODMA 3CHEA 1LQ0A 1W9PA 3RGCA 1EDQA 1TFVA 2RUCA 4QT2A 2Y78A 1W1PA 4TX0A 4C02B 3AS1A 2DG3A 1GPFA 3UI6A 1LL4A 3ARUA 3ARZA 2PPNA 4GGQA 4DWSD 3OOBA 2XP9A 4Z2HA 2F2DA 4MNKA 1Q1CA 4WKFA 1X6NA 1UR8A 1Q6UA 1W1TA 4DWSB 4W9QA 4W9PA 2LJ4A 1QZ2A 1QPLA 3CHDA 3UQIA 2ZQTA 1HJVA 2IUZA 4TW6A 4PTMA 1SR0A 2RUDA 1PBKA 1KT1A 4JFMA 3JYJA 4MNLA 1NWRA 3WQVA 3RFWA 5HTGA 1KFWA 4DIPA 5DF0A 4ODLA 4MNMA 1ZU8A 1FD9A 3AQUA 3O5DA 1O6IA 1F40A 2KE0A 1FFQA 5D75A 5HT1A 4ZS6A 1FAPA 4TW8A 3PRDA 1E6NA 2MNTA 1M5YA 1YATA 1ITXA 3WD4A 1OGGA 3KAIA 4P8WA 2ZQVA 1J6YA 4Z2JA 1ZL1A 2XP3A 3UF8A 1C9HA 1ZCNA 4G50A 1Q6IA 4Z2IA 1XRVA 1FKLA 2A3EA 4JYSA 1J4IA 3O5IA 4LAYA 3UQAA 2MF9A 1ZBWA 1GUVA 4DZ2A 2DG4A 3FAPA 3O5MA 1E9LA 2WK2A 2PPOA 4ODPA 3W4RA 3AS0A 3QOKA 2F21A 4JFLA 4MNJA 1D7JA 4IPXA 1LL6A 3WL1A 5HUAA 3TCZA 4AY1A 5HKGA 4WKAA 4MTVA 4MGVA 4U86A 2OLHA 2M2AA 3WH0A 3KZ7A 5HW7A 1E15A 4LGXA 4URIA 4WK9A 4DH0A 1D2KA 4FAPA 4KQZA 1B6CA 1NWTA 2VCDA 3CGNA 4R0XA 3RM4A 4IT4A 1ZK6A 3RM9A 2DSZA 3AS2A 4DZ3A 2DSVA 1N1AA 4FN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KAG A;  4DRN A;  2RUD A;  1PBK A;  2KO7 A;  3O5P A;  1KT1 A;  3NTP A;  2XP4 A;  1BKF A;  4JFM A;  2M08 A;  3JYJ A;  3JYM A;  3O5O A;  4LAV A;  2ZR6 A;  2LPV A;  3H9R B;  3KAF A;  1YW5 A;  5DIV A;  2XP8 A;  4JFJ A;  2PPP A;  4ITZ A;  4U84 A;  2D9F A;  1KT0 A;  4ODN A;  4QIB A;  3NI6 A;  1FKI A;  4DZ2 A;  3RFW A;  2MPH A;  4NNR A;  1L1P A;  1FKJ A;  2VN1 A;  5HTG A;  4W9O A;  1FKF A;  4DIP A;  1P5Q A;  2LGO A;  3O5R A;  4J4N A;  2M1I A;  3O5Q A;  2KI3 A;  1R9H A;  4ODL A;  1EYM A;  4LAX A;  4BF8 A;  1NMV A;  1FD9 A;  3O5D A;  1F40 A;  2KE0 A;  1ROU A;  2OFN A;  4DRM A;  1FKB A;  2ZR5 A;  4JFI A;  5D75 A;  5HT1 A;  2F4E A;  2ITK A;  1FKD A;  2KGJ A;  1FAP A;  2XP5 A;  3O5K A;  4IQ2 A;  4DRQ A;  5B8I C;  5BXJ A;  3UQB A;  1W26 A;  4TW8 A;  2N87 A;  2XPB A;  3TC5 A;  4DRO A;  3PRD A;  2MNT A;  4DT4 A;  1M5Y A;  1JVW A;  2L2S A;  1YAT A;  2PV2 A;  4MSP A;  1D6O A;  1PIN A;  4DRI A;  3KAI A;  1NMW A;  2ZR4 A;  4ODO A;  1J6Y A;  2ZQV A;  3EY6 A;  4JFK A;  1FKK A;  3CGM A;  4ODQ A;  2XP3 A;  3UF8 A;  5DIU A;  1C9H A;  1ZCN A;  2LKN A;  1Q6I A;  4G50 A;  3O5E A;  3KAC A;  3O5F A;  3IK8 A;  3KCE A;  2JZV A;  1HXV A;  1FKL A;  3I6C A;  2XP6 A;  4G2P A;  4O2T A;  4JYS A;  1J4I A;  2ZQS A;  2RUR A;  3B7X A;  4QT3 A;  3VAW A;  3MDY B;  3O5I A;  1JNS A;  2IF4 A;  4LAY A;  1FKG A;  4TW7 A;  2MF9 A;  5HW8 A;  5I98 A;  2PV3 A;  3PRB A;  3UQA A;  3IKG A;  2DG4 A;  1F8A B;  1J4R A;  2MLY A;  1D7I A;  1J4H A;  3FAP A;  3O5L A;  2FKE A;  3O5M A;  3UI4 A;  4DRK A;  3NRK A;  2PPO A;  5GPG A;  1JNT A;  2PV1 A;  2DG9 A;  2UZ5 A;  3KAD A;  4N19 A;  4ODP A;  3KAB A;  4DRP A;  1FKS A;  2AWG A;  4GIV A;  1NSG A;  2F21 A;  2RQS A;  4JFL A;  2KR7 A;  2KFW A;  5J6E A;  1Y0O A;  1D7J A;  2XP7 A;  4ODM A;  1EQ3 A;  4IPX A;  3KAH A;  3RGC A;  5HUA A;  1TCO C;  3TCZ A;  2RUC A;  4QT2 A;  4TX0 A;  2Y78 A;  4C02 B;  1Q6H A;  3PA7 A;  4DRJ A;  5HKG A;  4MGV A;  3IHZ A;  1QPF A;  4U86 A;  1BL4 A;  2M2A A;  3WH0 A;  4DRH A;  2DG3 A;  2RUQ A;  1D7H A;  3UI6 A;  3IKD A;  3KZ7 A;  4GGQ A;  2PPN A;  5HWB A;  5HW7 A;  1FKR A;  4LAW A;  3OOB A;  2XP9 A;  4TYO A;  2F2D A;  3O5J A;  4ODK A;  3LUO A;  1FKT A;  5DIT A;  1Q1C A;  1FJD A;  2K8I A;  2ZQU A;  1Q6U A;  2XPA A;  4W9Q A;  4W9P A;  4DH0 A;  1A7X A;  2LJ4 A;  3UI5 A;  2MLX A;  1ROT A;  3TDB A;  1QZ2 A;  4FAP A;  1QPL A;  3GPK A;  1B6C A;  4U85 A;  3UQI A;  2ZQT A;  2VCD A;  3CGN A;  4R0X A;  1U79 A;  1ZK6 A;  2FAP A;  5HWC A;  4ODR A;  3O5G A;  1FKH A;  2PBC A;  4TNS A;  3JXV A;  2MLZ A;  2Q5A A;  4J4O A;  2RSE A;  4TW6 A;  4DZ3 A;  4IQC A;  1T11 A;  5HW6 A;  1N1A A;  3ODK A;  4FN2 A; 
#chains in the Genus database with same CATH topology
 4DRN A;  1HJW A;  1W1V A;  4QZV B;  2XP4 A;  1LL7 A;  3JYM A;  2B31 A;  2ZR6 A;  3CHF A;  3KAF A;  5DIV A;  4U84 A;  1ZB5 A;  3NI6 A;  1FKI A;  3ARY A;  1H0I A;  2MPH A;  1FKJ A;  5GPR A;  2DT0 A;  1NWS A;  4W9O A;  2LGO A;  4S3J A;  4BF8 A;  4LAX A;  1NMV A;  5DO2 A;  3RME A;  3CH9 A;  1VF8 A;  2ZR5 A;  5DEZ A;  1RD6 A;  5B8I C;  3O5K A;  5BXJ A;  4DWS C;  1W26 A;  2PV2 A;  1D6O A;  3PRA A;  1OGB A;  4ODO A;  4JFK A;  1SYT A;  1FKK A;  3CGM A;  2LKN A;  1UR9 A;  2A3B A;  3O5F A;  2JZV A;  4G2P A;  2RUR A;  2IF4 A;  1FKG A;  2YBU A;  3PR9 A;  2A3A A;  4TYO A;  2MLY A;  1D7I A;  1NH6 A;  2WLY A;  3CHC A;  3UI4 A;  1EHN A;  5GPG A;  2P4V A;  1JNT A;  3ARQ A;  1NWU A;  3ARP A;  4Z2K A;  1W9V A;  3KAH A;  3WIJ A;  2A3C A;  1Q6H A;  3RM8 A;  4DRJ A;  4KR0 B;  1QPF A;  1BL4 A;  1JCH B;  4MAV A;  5HWB A;  3GU0 A;  1ZBC A;  4L3N A;  1HJX A;  3O5J A;  3ARW A;  4ODK A;  1W1Y A;  1FJD A;  4L72 B;  2ZQU A;  1A7X A;  4ZPW R;  3UI5 A;  2WM0 A;  1ROT A;  4P8X A;  1U79 A;  2FAP A;  2PI6 A;  5HWC A;  2DT3 A;  4R5E A;  2PBC A;  4ML4 A;  4TNS A;  4J4O A;  2MLZ A;  2Q5A A;  2RSE A;  1JND A;  2AOS A;  4IQC A;  1T11 A;  3ODK A;  3KAG A;  4MSP A;  2KO7 A;  2O92 A;  3O5P A;  3NTP A;  1BKF A;  3O5O A;  3H9R B;  4Z2G A;  1YW5 A;  2PPP A;  4ITZ A;  2D9F A;  4NNR A;  4HBO A;  3B8S A;  1P5Q A;  4J4N A;  3O5R A;  2M1I A;  1R9H A;  2G41 A;  4IT6 A;  4Q22 A;  3G6M A;  1WB0 A;  1ROU A;  4WJX A;  2DSU A;  4XAK A;  1FKB A;  3B9E A;  4JFI A;  4W5U A;  4DRM A;  2EUL A;  2F4E A;  2KGJ A;  1FKD A;  3WD0 A;  4DRQ A;  3UQB A;  2N87 A;  4NZC A;  3ARR A;  4DT4 A;  1JVW A;  2L2S A;  1WAW A;  4P8V A;  4HBE A;  4Q7N A;  1NMW A;  1FFR A;  2ZR4 A;  1HKJ A;  1H0G A;  3BMB A;  3KAC A;  1CTN A;  3IK8 A;  3O5E A;  1HXV A;  3I6C A;  3WD3 A;  2XP6 A;  5HBF A;  2ZQS A;  3G6L A;  3VAW A;  1E6R A;  3EIP A;  3MDY B;  3ALF A;  5I98 A;  2PV3 A;  3IKG A;  2ETN A;  1J4R A;  1J4H A;  2QF8 A;  1W9U A;  2FKE A;  3NRK A;  4DRP A;  2PV1 A;  2DG9 A;  1E6Z A;  2UZ5 A;  3KAD A;  4N19 A;  1HKM A;  3KAB A;  1FKS A;  3WQW A;  2AWG A;  4GIV A;  2RQS A;  2KR7 A;  1ZBK A;  2XP7 A;  1EQ3 A;  3ARV A;  3B9A A;  1TCO C;  1LG2 A;  3PA7 A;  3IHZ A;  3WKZ A;  2DT2 A;  4DRH A;  2RUQ A;  1D7H A;  3IKD A;  3AS3 A;  1FKR A;  4LAW A;  2ESC A;  3LUO A;  2WLZ A;  4WIW A;  3WL0 A;  1FKT A;  5DIT A;  3GTY X;  2K8I A;  2XPA A;  2MLX A;  2O9O A;  3TDB A;  3GPK A;  2DSW A;  4U85 A;  4Z2L A;  1JNE A;  4ODR A;  3O5G A;  1FKH A;  3ARS A;  3JXV A;  3CZ8 A;  4NSB A;  3ALG A;  3ARO A;  3ART A;  5HW6 A;  1K9T A;  4ZPT R;  1WNO A;  2M08 A;  2YBT A;  4LAV A;  1ZBV A;  2LPV A;  2DT1 A;  2XP8 A;  4JFJ A;  3OA5 A;  4WKH A;  1IX5 A;  1KT0 A;  4ODN A;  4QIB A;  1OWQ A;  1L1P A;  2VN1 A;  5JH8 A;  1XHG A;  3B9D A;  1FKF A;  3O5Q A;  2KI3 A;  1EYM A;  4S3K A;  1GOI A;  2FDM A;  4ZPV R;  4HAR A;  2OFN A;  1LJY A;  4P8U A;  3WD1 A;  2ITK A;  2XP5 A;  4IQ2 A;  1EIB A;  1X6L A;  4DRO A;  2XPB A;  3TC5 A;  4DWS A;  3BXW A;  3WD2 A;  1PIN A;  4DRI A;  4MPK A;  1HKI A;  3EY6 A;  1E6P A;  4ODQ A;  5DIU A;  2G8Z A;  3KCE A;  4O2T A;  3B7X A;  4QT3 A;  1JNS A;  4TW7 A;  5HW8 A;  3PRB A;  2DPE A;  1F8A B;  3O5L A;  4DRK A;  1LG1 A;  3FY1 A;  2F23 A;  3FXY A;  3ARX A;  5GQB A;  1NSG A;  1HKK A;  2KFW A;  5J6E A;  1Y0O A;  4ODM A;  3CHE A;  1LQ0 A;  1W9P A;  2B5U B;  3RGC A;  1EDQ A;  1TFV A;  2RUC A;  4QT2 A;  2Y78 A;  1W1P A;  4TX0 A;  4C02 B;  3AS1 A;  2DG3 A;  1GPF A;  3UI6 A;  1LL4 A;  3ARU A;  3ARZ A;  2PPN A;  4GGQ A;  4DWS D;  1E44 A;  3OOB A;  2XP9 A;  4Z2H A;  2F2D A;  4MNK A;  1Q1C A;  4WKF A;  1X6N A;  1UR8 A;  1Q6U A;  1W1T A;  4DWS B;  4W9Q A;  4W9P A;  2LJ4 A;  1QZ2 A;  1QPL A;  3CHD A;  3UQI A;  2ZQT A;  1HJV A;  2IUZ A;  4TW6 A;  4PTM A;  1SR0 A;  2RUD A;  1PBK A;  1KT1 A;  4JFM A;  3JYJ A;  4MNL A;  1NWR A;  3WQV A;  1GRJ A;  2PN0 A;  3RFW A;  5HTG A;  1KFW A;  4UDM A;  4DIP A;  5DF0 A;  4ODL A;  4MNM A;  1ZU8 A;  1FD9 A;  3AQU A;  3O5D A;  1O6I A;  1F40 A;  2KE0 A;  1FFQ A;  5D75 A;  5HT1 A;  4ZS6 A;  1FAP A;  4TW8 A;  3PRD A;  1E6N A;  2MNT A;  1M5Y A;  1YAT A;  1ITX A;  3WD4 A;  1OGG A;  3KAI A;  4P8W A;  2ZQV A;  1J6Y A;  4Z2J A;  1ZL1 A;  2XP3 A;  3UF8 A;  1C9H A;  1ZCN A;  4G50 A;  1Q6I A;  4Z2I A;  1XRV A;  1FKL A;  2A3E A;  4JYS A;  1J4I A;  3O5I A;  4LAY A;  3UQA A;  2MF9 A;  1ZBW A;  1GUV A;  4DZ2 A;  2DG4 A;  3FAP A;  3O5M A;  1E9L A;  2WK2 A;  2PPO A;  4ODP A;  3W4R A;  3AS0 A;  3QOK A;  2F21 A;  4JFL A;  4MNJ A;  1D7J A;  4IPX A;  1LL6 A;  3WL1 A;  5HUA A;  3TCZ A;  4AY1 A;  5HKG A;  4WKA A;  4MTV A;  4MGV A;  4U86 A;  2OLH A;  2M2A A;  3WH0 A;  3KZ7 A;  5HW7 A;  1E15 A;  4LGX A;  4URI A;  4WK9 A;  4DH0 A;  1D2K A;  4FAP A;  4KQZ A;  1B6C A;  1NWT A;  2VCD A;  3CGN A;  4R0X A;  3RM4 A;  4IT4 A;  1ZK6 A;  3RM9 A;  2DSZ A;  3AS2 A;  4DZ3 A;  2DSV A;  1N1A A;  4FN2 A; 
#chains in the Genus database with same CATH homology
 4DRN A;  1HJW A;  1W1V A;  4QZV B;  2XP4 A;  1LL7 A;  3JYM A;  2B31 A;  2ZR6 A;  3CHF A;  3KAF A;  5DIV A;  4U84 A;  1ZB5 A;  3NI6 A;  1FKI A;  3ARY A;  1H0I A;  2MPH A;  1FKJ A;  5GPR A;  2DT0 A;  1NWS A;  4W9O A;  2LGO A;  4S3J A;  4BF8 A;  4LAX A;  1NMV A;  5DO2 A;  3RME A;  3CH9 A;  1VF8 A;  2ZR5 A;  5DEZ A;  1RD6 A;  5B8I C;  3O5K A;  5BXJ A;  4DWS C;  1W26 A;  2PV2 A;  1D6O A;  3PRA A;  1OGB A;  4ODO A;  4JFK A;  1SYT A;  1FKK A;  3CGM A;  2LKN A;  1UR9 A;  2A3B A;  3O5F A;  2JZV A;  4G2P A;  2RUR A;  2IF4 A;  1FKG A;  2YBU A;  3PR9 A;  2A3A A;  4TYO A;  2MLY A;  1D7I A;  1NH6 A;  2WLY A;  3CHC A;  3UI4 A;  1EHN A;  5GPG A;  1JNT A;  3ARQ A;  1NWU A;  3ARP A;  4Z2K A;  1W9V A;  3KAH A;  3WIJ A;  2A3C A;  1Q6H A;  3RM8 A;  4DRJ A;  4KR0 B;  1QPF A;  1BL4 A;  4MAV A;  5HWB A;  1ZBC A;  4L3N A;  1HJX A;  3O5J A;  3ARW A;  4ODK A;  1W1Y A;  1FJD A;  4L72 B;  2ZQU A;  1A7X A;  4ZPW R;  3UI5 A;  2WM0 A;  1ROT A;  4P8X A;  1U79 A;  2FAP A;  2PI6 A;  5HWC A;  2DT3 A;  4R5E A;  2PBC A;  4ML4 A;  4TNS A;  4J4O A;  2MLZ A;  2Q5A A;  2RSE A;  1JND A;  2AOS A;  4IQC A;  1T11 A;  3ODK A;  3KAG A;  4MSP A;  2KO7 A;  2O92 A;  3O5P A;  3NTP A;  1BKF A;  3O5O A;  3H9R B;  4Z2G A;  1YW5 A;  2PPP A;  4ITZ A;  2D9F A;  4NNR A;  4HBO A;  3B8S A;  1P5Q A;  4J4N A;  3O5R A;  2M1I A;  1R9H A;  2G41 A;  4IT6 A;  4Q22 A;  3G6M A;  1WB0 A;  1ROU A;  4WJX A;  2DSU A;  4XAK A;  1FKB A;  3B9E A;  4JFI A;  4W5U A;  4DRM A;  2F4E A;  2KGJ A;  1FKD A;  3WD0 A;  4DRQ A;  3UQB A;  2N87 A;  4NZC A;  3ARR A;  4DT4 A;  1JVW A;  2L2S A;  1WAW A;  4P8V A;  4HBE A;  4Q7N A;  1NMW A;  1FFR A;  2ZR4 A;  1HKJ A;  1H0G A;  3KAC A;  3O5E A;  1CTN A;  3IK8 A;  1HXV A;  3I6C A;  3WD3 A;  2XP6 A;  5HBF A;  2ZQS A;  3G6L A;  3VAW A;  1E6R A;  3MDY B;  3ALF A;  5I98 A;  2PV3 A;  3IKG A;  1J4R A;  1J4H A;  1W9U A;  2QF8 A;  2FKE A;  3NRK A;  4DRP A;  2PV1 A;  2DG9 A;  1E6Z A;  2UZ5 A;  3KAD A;  4N19 A;  1HKM A;  3KAB A;  1FKS A;  3WQW A;  2AWG A;  4GIV A;  2RQS A;  2KR7 A;  1ZBK A;  2XP7 A;  1EQ3 A;  3ARV A;  3B9A A;  1TCO C;  1LG2 A;  3PA7 A;  3IHZ A;  3WKZ A;  2DT2 A;  4DRH A;  2RUQ A;  1D7H A;  3IKD A;  3AS3 A;  1FKR A;  4LAW A;  2ESC A;  3LUO A;  2WLZ A;  4WIW A;  3WL0 A;  1FKT A;  5DIT A;  2K8I A;  2XPA A;  2MLX A;  2O9O A;  3TDB A;  3GPK A;  2DSW A;  4U85 A;  4Z2L A;  1JNE A;  4ODR A;  3O5G A;  1FKH A;  3ARS A;  3JXV A;  3CZ8 A;  4NSB A;  3ALG A;  3ARO A;  3ART A;  5HW6 A;  1K9T A;  4ZPT R;  1WNO A;  2M08 A;  2YBT A;  4LAV A;  1ZBV A;  2LPV A;  2DT1 A;  2XP8 A;  4JFJ A;  3OA5 A;  4WKH A;  1IX5 A;  1KT0 A;  4ODN A;  4QIB A;  1OWQ A;  1L1P A;  2VN1 A;  5JH8 A;  1XHG A;  3B9D A;  1FKF A;  3O5Q A;  2KI3 A;  1EYM A;  4S3K A;  1GOI A;  2FDM A;  4ZPV R;  4HAR A;  2OFN A;  1LJY A;  4P8U A;  3WD1 A;  2ITK A;  2XP5 A;  4IQ2 A;  1EIB A;  1X6L A;  4DRO A;  2XPB A;  3TC5 A;  4DWS A;  3BXW A;  3WD2 A;  1PIN A;  4DRI A;  4MPK A;  1HKI A;  3EY6 A;  1E6P A;  4ODQ A;  5DIU A;  2G8Z A;  3KCE A;  4O2T A;  3B7X A;  4QT3 A;  1JNS A;  4TW7 A;  5HW8 A;  3PRB A;  2DPE A;  1F8A B;  3O5L A;  4DRK A;  1LG1 A;  3FY1 A;  3FXY A;  3ARX A;  5GQB A;  1NSG A;  1HKK A;  2KFW A;  5J6E A;  1Y0O A;  4ODM A;  3CHE A;  1LQ0 A;  1W9P A;  3RGC A;  1EDQ A;  1TFV A;  2RUC A;  4QT2 A;  2Y78 A;  1W1P A;  4TX0 A;  4C02 B;  3AS1 A;  2DG3 A;  1GPF A;  3UI6 A;  1LL4 A;  3ARU A;  3ARZ A;  2PPN A;  4GGQ A;  4DWS D;  3OOB A;  2XP9 A;  4Z2H A;  2F2D A;  4MNK A;  1Q1C A;  4WKF A;  1X6N A;  1UR8 A;  1Q6U A;  1W1T A;  4DWS B;  4W9Q A;  4W9P A;  2LJ4 A;  1QZ2 A;  1QPL A;  3CHD A;  3UQI A;  2ZQT A;  1HJV A;  2IUZ A;  4TW6 A;  4PTM A;  1SR0 A;  2RUD A;  1PBK A;  1KT1 A;  4JFM A;  3JYJ A;  4MNL A;  1NWR A;  3WQV A;  3RFW A;  5HTG A;  1KFW A;  4DIP A;  5DF0 A;  4ODL A;  4MNM A;  1ZU8 A;  1FD9 A;  3AQU A;  3O5D A;  1O6I A;  1F40 A;  2KE0 A;  1FFQ A;  5D75 A;  5HT1 A;  4ZS6 A;  1FAP A;  4TW8 A;  3PRD A;  1E6N A;  2MNT A;  1M5Y A;  1YAT A;  1ITX A;  3WD4 A;  1OGG A;  3KAI A;  4P8W A;  2ZQV A;  1J6Y A;  4Z2J A;  1ZL1 A;  2XP3 A;  3UF8 A;  1C9H A;  1ZCN A;  4G50 A;  1Q6I A;  4Z2I A;  1XRV A;  1FKL A;  2A3E A;  4JYS A;  1J4I A;  3O5I A;  4LAY A;  3UQA A;  2MF9 A;  1ZBW A;  1GUV A;  4DZ2 A;  2DG4 A;  3FAP A;  3O5M A;  1E9L A;  2WK2 A;  2PPO A;  4ODP A;  3W4R A;  3AS0 A;  3QOK A;  2F21 A;  4JFL A;  4MNJ A;  1D7J A;  4IPX A;  1LL6 A;  3WL1 A;  5HUA A;  3TCZ A;  4AY1 A;  5HKG A;  4WKA A;  4MTV A;  4MGV A;  4U86 A;  2OLH A;  2M2A A;  3WH0 A;  3KZ7 A;  5HW7 A;  1E15 A;  4LGX A;  4URI A;  4WK9 A;  4DH0 A;  1D2K A;  4FAP A;  4KQZ A;  1B6C A;  1NWT A;  2VCD A;  3CGN A;  4R0X A;  3RM4 A;  4IT4 A;  1ZK6 A;  3RM9 A;  2DSZ A;  3AS2 A;  4DZ3 A;  2DSV A;  1N1A A;  4FN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...