4IQ2A

P21 crystal form of fkbp12.6
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
107
structure length
107
Chain Sequence
GVEIETISPGDGRTFPKKGQTVVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTITPDVAYGATGHPGVIPPNATLIFDVELLNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and conformational flexibility of the unligated FK506-binding protein FKBP12.6.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1B
total genus 21
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4iq2A00
3IK8A 1J4IA 1FKBA 1NMVA 2XP6A 3KAFA 4QT2A 2LKNA 1FKGA 2MLXA 1BL4A 1Q6HA 4LAWA 3UQAA 3GPKA 3CGMA 1QZ2A 2RQSA 1U79A 2VCDA 3KCEA 2N87A 4C02B 2D9FA 3O5RA 4QIBA 4JFIA 5BXJA 4MGVA 1M5YA 3TC5A 4TX0A 3H9RB 3UI6A 5HT1A 1FKDA 4TYOA 5HTGA 3UF8A 1Q6UA 3NRKA 3B7XA 4NNRA 2UZ5A 3PRDA 3JYJA 4R0XA 2ZR5A 2PV2A 2PV1A 2MLYA 1FD9A 2ZQSA 2K8IA 2KO7A 2XPBA 3IHZA 4DT4A 4BF8A 4DRQA 3O5LA 2XP7A 3KAHA 4G50A 3TCZA 4DZ2A 4FAPA 1L1PA 3JYMA 3KAGA 4W9PA 1J6YA 5HW7A 4G2PA 2XP4A 4U85A 2M2AA 2DG9A 4JFJA 2PPOA 2AWGA 3UI5A 3UQIA 2L2SA 2ITKA 2RUQA 4DRMA 5I98A 1FKJA 4ODPA 1JNTA 1QPFA 1T11A 3FAPA 4ODNA 1F8AB 4DRIA 4IQ2A 3IKDA 2F2DA 4TW8A 1YATA 1ZCNA 2MLZA 4N19A 2XP3A 3TDBA 2RURA 3O5FA 4DH0A 1D7IA 5HW6A 1FKLA 3ODKA 2PPNA 4LAYA 3VAWA 1F40A 1D7HA 1EYMA 2RUDA 3KZ7A 1ZK6A 4ODQA 1JVWA 2MPHA 4U86A 1ROUA 1Y0OA 4ITZA 1FKTA 1ROTA 2DG3A 2KFWA 4DRKA 3UI4A 3RFWA 1EQ3A 2DG4A 1JNSA 5DITA 2XPAA 3O5OA 5DIUA 3O5IA 4J4NA 3LUOA 4W9QA 5HWBA 4U84A 3PA7A 1A7XA 2XP5A 1P5QA 1NMWA 4DZ3A 2MNTA 4LAXA 3O5JA 2JZVA 3NI6A 4W9OA 3KABA 1FJDA 3OOBA 4JFKA 5B8IC 2KI3A 4QT3A 1J4RA 4TW7A 5HKGA 3EY6A 3PRBA 4JFMA 1BKFA 1FKSA 5J6EA 1W26A 1FAPA 2Q5AA 2ZQTA 4DROA 4DRHA 4J4OA 4O2TA 3MDYB 3O5EA 2XP9A 2ZQUA 2PBCA 4GGQA 3WH0A 5HWCA 4ODOA 2KR7A 3UQBA 4DRJA 2KE0A 2M08A 3JXVA 4JYSA 3I6CA 3KACA 3IKGA 1FKIA 2RUCA 1Q6IA 1J4HA 2Y78A 2LPVA 1TCOC 2ZR6A 3O5GA 1QPLA 3O5MA 4IQCA 4TNSA 2F4EA 2OFNA 3RGCA 1B6CA 3O5PA 1NSGA 2XP8A 4LAVA 1N1AA 4IPXA 5HUAA 1FKHA 4ODLA 2KGJA 4DIPA 2RSEA 2ZQVA 3O5DA 4DRNA 5D75A 3O5KA 4ODMA 1FKKA 2F21A 1KT0A 1Q1CA 2LJ4A 1C9HA 2PPPA 2ZR4A 2IF4A 3O5QA 4GIVA 4DRPA 3NTPA 2FKEA 4ODRA 5HW8A 2LGOA 5GPGA 4FN2A 1D6OA 1HXVA 2PV3A 5DIVA 2MF9A 3KADA 2FAPA 1R9HA 1FKRA 4JFLA 4ODKA 1D7JA 2VN1A 1PINA 1YW5A 3CGNA 4MSPA 4TW6A 2M1IA 1FKFA 1PBKA 3KAIA 1KT1A
chains in the Genus database with same CATH superfamily
3IK8A 1J4IA 2LKNA 3WD4A 4LAWA 4MAVA 3GPKA 4DWSD 4IT4A 2VCDA 4L72B 4QIBA 4MGVA 3TC5A 3WD1A 1E9LA 3BXWA 1E6NA 4TYOA 5HTGA 2DSWA 3B7XA 2ZR5A 2MLYA 2XPBA 1JNDA 4G50A 1L1PA 5GPRA 2XP4A 1LG2A 2DG9A 3UQIA 2AWGA 3UI5A 2L2SA 2P4VA 5I98A 1FKJA 4ODPA 3IKDA 2F2DA 2XP3A 2WM0A 3TDBA 4MNKA 1FKLA 4LAYA 4P8UA 2MPHA 1ZBCA 2DPEA 4ITZA 2KFWA 3UI4A 3O5OA 4W9QA 5HWBA 3WQVA 3PA7A 3EIPA 1FFRA 2JZVA 3NI6A 1ZBVA 3FXYA 3RM9A 2KI3A 2YBUA 1GPFA 1BKFA 2Q5AA 3CZ8A 4DROA 4DRHA 1NWTA 4J4OA 3W4RA 3MDYB 2ZQUA 2WLYA 1JNEA 4GGQA 4WKFA 4DRJA 5DEZA 3O5MA 5GQBA 1LJYA 3ARWA 3GTYX 3WD3A 4LAVA 4XAKA 5HUAA 3WL1A 4ODLA 3O5DA 3G6MA 2ZR4A 1KT0A 1C9HA 2PPPA 4GIVA 4L3NA 1X6NA 1LL6A 2PV3A 3ALFA 4HBEA 1D7JA 3CGNA 4QZVB 1FKFA 1PBKA 2IUZA 3KAFA 1UR9A 4QT2A 1H0IA 1FKGA 1BL4A 4Z2KA 3B8SA 3UQAA 1X6LA 1ITXA 1U79A 3KCEA 2N87A 4JFIA 1EIBA 5BXJA 3AS0A 2WLZA 2O92A 1FKDA 3UF8A 3OA5A 2UZ5A 3PRDA 1HKMA 1W1YA 2KO7A 1NWRA 2EULA 2YBTA 3G6LA 4Z2HA 4AY1A 3O5LA 3KAHA 1NH6A 3TCZA 1E15A 4FAPA 5HW7A 4G2PA 1KFWA 4Q7NA 4WJXA 1ZU8A 2RUQA 2QF8A 1JNTA 1QPFA 1T11A 2F23A 4TW8A 3WKZA 1FFQA 3RMEA 3O5FA 5HW6A 1HJXA 3KZ7A 1JVWA 1HJVA 1ROUA 1ROTA 1JNSA 3RFWA 3ARRA 5DITA 1W9UA 4IT6A 5DIUA 3CHFA 4J4NA 1W9PA 4P8WA 1LQ0A 3ARPA 2DT0A 2G41A 2MNTA 4W9OA 3OOBA 4QT3A 1J4RA 3EY6A 4URIA 1FKSA 5J6EA 1W26A 2ZQTA 4WK9A 4Z2IA 1EHNA 4P8XA 1ZB5A 4Z2JA 2XP9A 3WH0A 1GOIA 2KE0A 2M08A 2DSUA 3KACA 3WL0A 1Q6IA 2Y78A 3BMBA 3O5GA 1QPLA 1GRJA 1B6CA 3AS3A 4WKAA 1NSGA 2XP8A 4IPXA 1HKIA 2RSEA 4S3JA 5D75A 3O5KA 1FKKA 3O5QA 1EDQA 2IF4A 1HKJA 4ODRA 2ESCA 4FN2A 1D6OA 3ARQA 2MF9A 4R5EA 4ODKA 2VN1A 1YW5A 4TW6A 2M1IA 2PI6A 1FKBA 2DSZA 1O6IA 3CGMA 1QZ2A 4C02B 3O5RA 1TFVA 3B9DA 4TX0A 3H9RB 5HT1A 1E6RA 2PV2A 2PV1A 4KR0B 4DT4A 2XP7A 1ZL1A 4DZ2A 3KAGA 4W9PA 1WNOA 2M2AA 4JFJA 2ITKA 4DRMA 1NWSA 3QOKA 3WD0A 3FAPA 4DRIA 1F8AB 4IQ2A 4MTVA 1HJWA 1YATA 1ZCNA 2MLZA 2PN0A 2RURA 1XHGA 3ODKA 2PPNA 1ZBWA 2RUDA 4ODQA 1ZK6A 2O9OA 4U86A 2DT1A 5JH8A 1Y0OA 4HBOA 4MNJA 1EQ3A 2DG4A 2XPAA 4MNMA 3O5IA 3LUOA 3WD2A 1WB0A 4UDMA 4W5UA 1P5QA 1NMWA 2FDMA 4DZ3A 3ARTA 2AOSA 1W1VA 2B5UB 4Z2LA 2DT2A 3KABA 1WAWA 1FJDA 1LL4A 5B8IC 4TW7A 3PRBA 3RM4A 4JFMA 1FAPA 3O5EA 1E44A 4ODOA 3JXVA 4JYSA 3I6CA 2A3BA 1SR0A 3IKGA 1J4HA 2LPVA 2ZR6A 4IQCA 2F4EA 2OFNA 1XRVA 3AS1A 3PRAA 3RGCA 3O5PA 1FKHA 2KGJA 4DIPA 4MNLA 4DRNA 4ODMA 2F21A 1W9VA 2LJ4A 1Q1CA 2ETNA 4ZPVR 4DRPA 1LL7A 4Z2GA 5HW8A 2LGOA 5GPGA 1UR8A 1W1TA 3KADA 3AQUA 1OGGA 1FKRA 1PINA 3FY1A 2B31A 1IX5A 3KAIA 1KT1A 1NMVA 2XP6A 2MLXA 1Q6HA 1RD6A 3ARZA 2RQSA 1K9TA 3CHEA 1SYTA 3RM8A 2D9FA 1M5YA 4LGXA 3UI6A 4MPKA 2A3AA 4PTMA 2DSVA 1Q6UA 3NRKA 3B9EA 3GU0A 4NNRA 3B9AA 3JYJA 3ARUA 4R0XA 1FD9A 2ZQSA 2K8IA 3ARVA 3IHZA 4BF8A 4DRQA 5DO2A 3JYMA 4DWSC 1J6YA 1H0GA 3WIJA 4U85A 1GUVA 3CHCA 1OWQA 2G8ZA 1JCHB 4ODNA 4WIWA 4DWSB 4N19A 4S3KA 4DH0A 4NSBA 1D7IA 1F40A 1OGBA 3PR9A 3VAWA 1VF8A 1D7HA 1EYMA 1E6PA 2WK2A 1HKKA 1CTNA 1ZBKA 1FKTA 3CHDA 2DT3A 2DG3A 4DRKA 3AS2A 4U84A 1A7XA 2XP5A 4LAXA 3O5JA 3ARSA 4ML4A 1D2KA 4JFKA 5HKGA 1NWUA 4P8VA 4O2TA 3WQWA 2PBCA 3UQBA 5HWCA 2KR7A 1FKIA 2RUCA 1TCOC 4WKHA 4NZCA 1N1AA 3ALGA 3ARYA 2A3EA 2ZQVA 4ZPTR 3AROA 4KQZA 4DWSA 2OLHA 4HARA 5HBFA 3NTPA 2FKEA 4ZPWR 1HXVA 5DIVA 4Q22A 1LG1A 2A3CA 2FAPA 1R9HA 3ARXA 1W1PA 4JFLA 1E6ZA 5DF0A 4ZS6A 4MSPA 3CH9A 2PPOA 4TNSA
chains in the Genus database with same CATH topology
3IK8A 1J4IA 2LKNA 3WD4A 4LAWA 4MAVA 3GPKA 4DWSD 4IT4A 2VCDA 4L72B 4QIBA 4MGVA 3TC5A 3WD1A 1E9LA 3BXWA 1E6NA 4TYOA 5HTGA 2DSWA 3B7XA 2ZR5A 2MLYA 2XPBA 1JNDA 4G50A 1L1PA 5GPRA 2XP4A 1LG2A 2DG9A 3UQIA 2AWGA 3UI5A 2L2SA 5I98A 1FKJA 4ODPA 3IKDA 2F2DA 2XP3A 2WM0A 3TDBA 4MNKA 1FKLA 4LAYA 4P8UA 2MPHA 1ZBCA 2DPEA 4ITZA 2KFWA 3UI4A 3O5OA 4W9QA 5HWBA 3WQVA 3PA7A 1FFRA 2JZVA 3NI6A 1ZBVA 3FXYA 3RM9A 2KI3A 2YBUA 1GPFA 1BKFA 2Q5AA 3CZ8A 4DROA 4DRHA 1NWTA 4J4OA 3W4RA 3MDYB 2ZQUA 2WLYA 1JNEA 4GGQA 4WKFA 4DRJA 5DEZA 3O5MA 5GQBA 1LJYA 3ARWA 3WD3A 4LAVA 4XAKA 5HUAA 3WL1A 4ODLA 3O5DA 3G6MA 2ZR4A 1KT0A 1C9HA 2PPPA 4GIVA 4L3NA 1X6NA 1LL6A 2PV3A 3ALFA 4HBEA 1D7JA 3CGNA 4QZVB 1FKFA 1PBKA 2IUZA 3KAFA 1UR9A 4QT2A 1H0IA 1FKGA 1BL4A 4Z2KA 3B8SA 3UQAA 1X6LA 1ITXA 1U79A 3KCEA 2N87A 4JFIA 1EIBA 5BXJA 3AS0A 2WLZA 2O92A 1FKDA 3UF8A 3OA5A 2UZ5A 3PRDA 1HKMA 1W1YA 2KO7A 1NWRA 2YBTA 3G6LA 4Z2HA 4AY1A 3O5LA 3KAHA 1NH6A 3TCZA 1E15A 4FAPA 5HW7A 4G2PA 1KFWA 4Q7NA 4WJXA 1ZU8A 2RUQA 2QF8A 1JNTA 1QPFA 1T11A 4TW8A 3WKZA 1FFQA 3RMEA 3O5FA 5HW6A 1HJXA 3KZ7A 1JVWA 1HJVA 1ROUA 1ROTA 1JNSA 3RFWA 3ARRA 5DITA 1W9UA 4IT6A 5DIUA 3CHFA 4J4NA 1W9PA 4P8WA 1LQ0A 3ARPA 2DT0A 2G41A 2MNTA 4W9OA 3OOBA 4QT3A 1J4RA 3EY6A 4URIA 1FKSA 5J6EA 1W26A 2ZQTA 4WK9A 4Z2IA 1EHNA 4P8XA 1ZB5A 4Z2JA 2XP9A 3WH0A 1GOIA 2KE0A 2M08A 2DSUA 3KACA 3WL0A 1Q6IA 2Y78A 3O5GA 1QPLA 1B6CA 3AS3A 4WKAA 1NSGA 2XP8A 4IPXA 1HKIA 2RSEA 4S3JA 5D75A 3O5KA 1FKKA 3O5QA 1EDQA 2IF4A 1HKJA 4ODRA 2ESCA 4FN2A 1D6OA 3ARQA 2MF9A 4R5EA 4ODKA 2VN1A 1YW5A 4TW6A 2M1IA 2PI6A 1FKBA 2DSZA 1O6IA 3CGMA 1QZ2A 4C02B 3O5RA 1TFVA 3B9DA 4TX0A 3H9RB 5HT1A 1E6RA 2PV2A 2PV1A 4KR0B 4DT4A 2XP7A 1ZL1A 4DZ2A 3KAGA 4W9PA 1WNOA 2M2AA 4JFJA 2ITKA 4DRMA 1NWSA 3QOKA 3WD0A 3FAPA 4DRIA 1F8AB 4IQ2A 4MTVA 1HJWA 1YATA 1ZCNA 2MLZA 2RURA 1XHGA 3ODKA 2PPNA 1ZBWA 2RUDA 4ODQA 1ZK6A 2O9OA 4U86A 2DT1A 5JH8A 1Y0OA 4HBOA 4MNJA 1EQ3A 2DG4A 2XPAA 4MNMA 3O5IA 3LUOA 3WD2A 1WB0A 4W5UA 1P5QA 1NMWA 2FDMA 4DZ3A 3ARTA 2AOSA 1W1VA 4Z2LA 2DT2A 3KABA 1WAWA 1FJDA 1LL4A 5B8IC 4TW7A 3PRBA 3RM4A 4JFMA 1FAPA 3O5EA 4ODOA 3JXVA 4JYSA 3I6CA 2A3BA 1SR0A 3IKGA 1J4HA 2LPVA 2ZR6A 4IQCA 2F4EA 2OFNA 1XRVA 3AS1A 3PRAA 3RGCA 3O5PA 1FKHA 2KGJA 4DIPA 4MNLA 4DRNA 4ODMA 2F21A 1W9VA 2LJ4A 1Q1CA 4ZPVR 4DRPA 1LL7A 4Z2GA 5HW8A 2LGOA 5GPGA 1UR8A 1W1TA 3KADA 3AQUA 1OGGA 1FKRA 1PINA 3FY1A 2B31A 1IX5A 3KAIA 1KT1A 1NMVA 2XP6A 2MLXA 1Q6HA 1RD6A 3ARZA 2RQSA 1K9TA 3CHEA 1SYTA 3RM8A 2D9FA 1M5YA 4LGXA 3UI6A 4MPKA 2A3AA 4PTMA 2DSVA 1Q6UA 3NRKA 3B9EA 4NNRA 3B9AA 3JYJA 3ARUA 4R0XA 1FD9A 2ZQSA 2K8IA 3ARVA 3IHZA 4BF8A 4DRQA 5DO2A 3JYMA 4DWSC 1J6YA 1H0GA 3WIJA 4U85A 1GUVA 3CHCA 1OWQA 2G8ZA 4ODNA 4WIWA 4DWSB 4N19A 4S3KA 4DH0A 4NSBA 1D7IA 1F40A 1OGBA 3PR9A 3VAWA 1VF8A 1D7HA 1EYMA 1E6PA 2WK2A 1HKKA 1CTNA 1ZBKA 1FKTA 3CHDA 2DT3A 2DG3A 4DRKA 3AS2A 4U84A 1A7XA 2XP5A 4LAXA 3O5JA 3ARSA 4ML4A 1D2KA 4JFKA 5HKGA 1NWUA 4P8VA 4O2TA 3WQWA 2PBCA 3UQBA 5HWCA 2KR7A 1FKIA 2RUCA 1TCOC 4WKHA 4NZCA 1N1AA 3ALGA 3ARYA 2A3EA 2ZQVA 4ZPTR 3AROA 4KQZA 4DWSA 2OLHA 4HARA 5HBFA 3NTPA 2FKEA 4ZPWR 1HXVA 5DIVA 4Q22A 1LG1A 2A3CA 2FAPA 1R9HA 3ARXA 1W1PA 4JFLA 1E6ZA 5DF0A 4ZS6A 4MSPA 3CH9A 2PPOA 4TNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IK8 A;  1J4I A;  1FKB A;  1NMV A;  2XP6 A;  3KAF A;  4QT2 A;  2LKN A;  1FKG A;  2MLX A;  1BL4 A;  1Q6H A;  4LAW A;  3UQA A;  3GPK A;  3CGM A;  1QZ2 A;  2RQS A;  1U79 A;  2VCD A;  3KCE A;  2N87 A;  4C02 B;  2D9F A;  3O5R A;  4QIB A;  4JFI A;  5BXJ A;  4MGV A;  1M5Y A;  3TC5 A;  4TX0 A;  3H9R B;  3UI6 A;  5HT1 A;  1FKD A;  4TYO A;  5HTG A;  3UF8 A;  1Q6U A;  3NRK A;  3B7X A;  4NNR A;  2UZ5 A;  3PRD A;  3JYJ A;  4R0X A;  2ZR5 A;  2PV2 A;  2PV1 A;  2MLY A;  1FD9 A;  2ZQS A;  2K8I A;  2KO7 A;  2XPB A;  3IHZ A;  4DT4 A;  4BF8 A;  4DRQ A;  3O5L A;  2XP7 A;  3KAH A;  4G50 A;  3TCZ A;  4DZ2 A;  4FAP A;  1L1P A;  3JYM A;  3KAG A;  4W9P A;  1J6Y A;  5HW7 A;  4G2P A;  2XP4 A;  4U85 A;  2M2A A;  2DG9 A;  4JFJ A;  2PPO A;  2AWG A;  3UI5 A;  3UQI A;  2L2S A;  2ITK A;  2RUQ A;  4DRM A;  5I98 A;  1FKJ A;  4ODP A;  1JNT A;  1QPF A;  1T11 A;  3FAP A;  4ODN A;  1F8A B;  4DRI A;  4IQ2 A;  3IKD A;  2F2D A;  4TW8 A;  1YAT A;  1ZCN A;  2MLZ A;  4N19 A;  2XP3 A;  3TDB A;  2RUR A;  3O5F A;  4DH0 A;  1D7I A;  5HW6 A;  1FKL A;  3ODK A;  2PPN A;  4LAY A;  3VAW A;  1F40 A;  1D7H A;  1EYM A;  2RUD A;  3KZ7 A;  1ZK6 A;  4ODQ A;  1JVW A;  2MPH A;  4U86 A;  1ROU A;  1Y0O A;  4ITZ A;  1FKT A;  1ROT A;  2DG3 A;  2KFW A;  4DRK A;  3UI4 A;  3RFW A;  1EQ3 A;  2DG4 A;  1JNS A;  5DIT A;  2XPA A;  3O5O A;  5DIU A;  3O5I A;  4J4N A;  3LUO A;  4W9Q A;  5HWB A;  4U84 A;  3PA7 A;  1A7X A;  2XP5 A;  1P5Q A;  1NMW A;  4DZ3 A;  2MNT A;  4LAX A;  3O5J A;  2JZV A;  3NI6 A;  4W9O A;  3KAB A;  1FJD A;  3OOB A;  4JFK A;  5B8I C;  2KI3 A;  4QT3 A;  1J4R A;  4TW7 A;  5HKG A;  3EY6 A;  3PRB A;  4JFM A;  1BKF A;  1FKS A;  5J6E A;  1W26 A;  1FAP A;  2Q5A A;  2ZQT A;  4DRO A;  4DRH A;  4J4O A;  4O2T A;  3MDY B;  3O5E A;  2XP9 A;  2ZQU A;  2PBC A;  4GGQ A;  3WH0 A;  5HWC A;  4ODO A;  2KR7 A;  3UQB A;  4DRJ A;  2KE0 A;  2M08 A;  3JXV A;  4JYS A;  3I6C A;  3KAC A;  3IKG A;  1FKI A;  2RUC A;  1Q6I A;  1J4H A;  2Y78 A;  2LPV A;  1TCO C;  2ZR6 A;  3O5G A;  1QPL A;  3O5M A;  4IQC A;  4TNS A;  2F4E A;  2OFN A;  3RGC A;  1B6C A;  3O5P A;  1NSG A;  2XP8 A;  4LAV A;  1N1A A;  4IPX A;  5HUA A;  1FKH A;  4ODL A;  2KGJ A;  4DIP A;  2RSE A;  2ZQV A;  3O5D A;  4DRN A;  5D75 A;  3O5K A;  4ODM A;  1FKK A;  2F21 A;  1KT0 A;  1Q1C A;  2LJ4 A;  1C9H A;  2PPP A;  2ZR4 A;  2IF4 A;  3O5Q A;  4GIV A;  4DRP A;  3NTP A;  2FKE A;  4ODR A;  5HW8 A;  2LGO A;  5GPG A;  4FN2 A;  1D6O A;  1HXV A;  2PV3 A;  5DIV A;  2MF9 A;  3KAD A;  2FAP A;  1R9H A;  1FKR A;  4JFL A;  4ODK A;  1D7J A;  2VN1 A;  1PIN A;  1YW5 A;  3CGN A;  4MSP A;  4TW6 A;  2M1I A;  1FKF A;  1PBK A;  3KAI A;  1KT1 A; 
#chains in the Genus database with same CATH topology
 3IK8 A;  1J4I A;  2LKN A;  3WD4 A;  4LAW A;  4MAV A;  3GPK A;  4DWS D;  4IT4 A;  2VCD A;  4L72 B;  4QIB A;  4MGV A;  3TC5 A;  3WD1 A;  1E9L A;  3BXW A;  1E6N A;  4TYO A;  5HTG A;  2DSW A;  3B7X A;  2ZR5 A;  2MLY A;  2XPB A;  1JND A;  4G50 A;  1L1P A;  5GPR A;  2XP4 A;  1LG2 A;  2DG9 A;  3UQI A;  2AWG A;  3UI5 A;  2L2S A;  2P4V A;  5I98 A;  1FKJ A;  4ODP A;  3IKD A;  2F2D A;  2XP3 A;  2WM0 A;  3TDB A;  4MNK A;  1FKL A;  4LAY A;  4P8U A;  2MPH A;  1ZBC A;  2DPE A;  4ITZ A;  2KFW A;  3UI4 A;  3O5O A;  4W9Q A;  5HWB A;  3WQV A;  3PA7 A;  3EIP A;  1FFR A;  2JZV A;  3NI6 A;  1ZBV A;  3FXY A;  3RM9 A;  2KI3 A;  2YBU A;  1GPF A;  1BKF A;  2Q5A A;  3CZ8 A;  4DRO A;  4DRH A;  1NWT A;  4J4O A;  3W4R A;  3MDY B;  2ZQU A;  2WLY A;  1JNE A;  4GGQ A;  4WKF A;  4DRJ A;  5DEZ A;  3O5M A;  5GQB A;  1LJY A;  3ARW A;  3GTY X;  3WD3 A;  4LAV A;  4XAK A;  5HUA A;  3WL1 A;  4ODL A;  3O5D A;  3G6M A;  2ZR4 A;  1KT0 A;  1C9H A;  2PPP A;  4GIV A;  4L3N A;  1X6N A;  1LL6 A;  2PV3 A;  3ALF A;  4HBE A;  1D7J A;  3CGN A;  4QZV B;  1FKF A;  1PBK A;  2IUZ A;  3KAF A;  1UR9 A;  4QT2 A;  1H0I A;  1FKG A;  1BL4 A;  4Z2K A;  3B8S A;  3UQA A;  1X6L A;  1ITX A;  1U79 A;  3KCE A;  2N87 A;  4JFI A;  1EIB A;  5BXJ A;  3AS0 A;  2WLZ A;  2O92 A;  1FKD A;  3UF8 A;  3OA5 A;  2UZ5 A;  3PRD A;  1HKM A;  1W1Y A;  2KO7 A;  1NWR A;  2EUL A;  2YBT A;  3G6L A;  4Z2H A;  4AY1 A;  3O5L A;  3KAH A;  1NH6 A;  3TCZ A;  1E15 A;  4FAP A;  5HW7 A;  4G2P A;  1KFW A;  4Q7N A;  4WJX A;  1ZU8 A;  2RUQ A;  2QF8 A;  1JNT A;  1QPF A;  1T11 A;  2F23 A;  4TW8 A;  3WKZ A;  1FFQ A;  3RME A;  3O5F A;  5HW6 A;  1HJX A;  3KZ7 A;  1JVW A;  1HJV A;  1ROU A;  1ROT A;  1JNS A;  3RFW A;  3ARR A;  5DIT A;  1W9U A;  4IT6 A;  5DIU A;  3CHF A;  4J4N A;  1W9P A;  4P8W A;  1LQ0 A;  3ARP A;  2DT0 A;  2G41 A;  2MNT A;  4W9O A;  3OOB A;  4QT3 A;  1J4R A;  3EY6 A;  4URI A;  1FKS A;  5J6E A;  1W26 A;  2ZQT A;  4WK9 A;  4Z2I A;  1EHN A;  4P8X A;  1ZB5 A;  4Z2J A;  2XP9 A;  3WH0 A;  1GOI A;  2KE0 A;  2M08 A;  2DSU A;  3KAC A;  3WL0 A;  1Q6I A;  2Y78 A;  3BMB A;  3O5G A;  1QPL A;  1GRJ A;  1B6C A;  3AS3 A;  4WKA A;  1NSG A;  2XP8 A;  4IPX A;  1HKI A;  2RSE A;  4S3J A;  5D75 A;  3O5K A;  1FKK A;  3O5Q A;  1EDQ A;  2IF4 A;  1HKJ A;  4ODR A;  2ESC A;  4FN2 A;  1D6O A;  3ARQ A;  2MF9 A;  4R5E A;  4ODK A;  2VN1 A;  1YW5 A;  4TW6 A;  2M1I A;  2PI6 A;  1FKB A;  2DSZ A;  1O6I A;  3CGM A;  1QZ2 A;  4C02 B;  3O5R A;  1TFV A;  3B9D A;  4TX0 A;  3H9R B;  5HT1 A;  1E6R A;  2PV2 A;  2PV1 A;  4KR0 B;  4DT4 A;  2XP7 A;  1ZL1 A;  4DZ2 A;  3KAG A;  4W9P A;  1WNO A;  2M2A A;  4JFJ A;  2ITK A;  4DRM A;  1NWS A;  3QOK A;  3WD0 A;  3FAP A;  4DRI A;  1F8A B;  4IQ2 A;  4MTV A;  1HJW A;  1YAT A;  1ZCN A;  2MLZ A;  2PN0 A;  2RUR A;  1XHG A;  3ODK A;  2PPN A;  1ZBW A;  2RUD A;  4ODQ A;  1ZK6 A;  2O9O A;  4U86 A;  2DT1 A;  5JH8 A;  1Y0O A;  4HBO A;  4MNJ A;  1EQ3 A;  2DG4 A;  2XPA A;  4MNM A;  3O5I A;  3LUO A;  3WD2 A;  1WB0 A;  4UDM A;  4W5U A;  1P5Q A;  1NMW A;  2FDM A;  4DZ3 A;  3ART A;  2AOS A;  1W1V A;  2B5U B;  4Z2L A;  2DT2 A;  3KAB A;  1WAW A;  1FJD A;  1LL4 A;  5B8I C;  4TW7 A;  3PRB A;  3RM4 A;  4JFM A;  1FAP A;  3O5E A;  1E44 A;  4ODO A;  3JXV A;  4JYS A;  3I6C A;  2A3B A;  1SR0 A;  3IKG A;  1J4H A;  2LPV A;  2ZR6 A;  4IQC A;  2F4E A;  2OFN A;  1XRV A;  3AS1 A;  3PRA A;  3RGC A;  3O5P A;  1FKH A;  2KGJ A;  4DIP A;  4MNL A;  4DRN A;  4ODM A;  2F21 A;  1W9V A;  2LJ4 A;  1Q1C A;  2ETN A;  4ZPV R;  4DRP A;  1LL7 A;  4Z2G A;  5HW8 A;  2LGO A;  5GPG A;  1UR8 A;  1W1T A;  3KAD A;  3AQU A;  1OGG A;  1FKR A;  1PIN A;  3FY1 A;  2B31 A;  1IX5 A;  3KAI A;  1KT1 A;  1NMV A;  2XP6 A;  2MLX A;  1Q6H A;  1RD6 A;  3ARZ A;  2RQS A;  1K9T A;  3CHE A;  1SYT A;  3RM8 A;  2D9F A;  1M5Y A;  4LGX A;  3UI6 A;  4MPK A;  2A3A A;  4PTM A;  2DSV A;  1Q6U A;  3NRK A;  3B9E A;  3GU0 A;  4NNR A;  3B9A A;  3JYJ A;  3ARU A;  4R0X A;  1FD9 A;  2ZQS A;  2K8I A;  3ARV A;  3IHZ A;  4BF8 A;  4DRQ A;  5DO2 A;  3JYM A;  4DWS C;  1J6Y A;  1H0G A;  3WIJ A;  4U85 A;  1GUV A;  3CHC A;  1OWQ A;  2G8Z A;  1JCH B;  4ODN A;  4WIW A;  4DWS B;  4N19 A;  4S3K A;  4DH0 A;  4NSB A;  1D7I A;  1F40 A;  1OGB A;  3PR9 A;  3VAW A;  1VF8 A;  1D7H A;  1EYM A;  1E6P A;  2WK2 A;  1HKK A;  1CTN A;  1ZBK A;  1FKT A;  3CHD A;  2DT3 A;  2DG3 A;  4DRK A;  3AS2 A;  4U84 A;  1A7X A;  2XP5 A;  4LAX A;  3O5J A;  3ARS A;  4ML4 A;  1D2K A;  4JFK A;  5HKG A;  1NWU A;  4P8V A;  4O2T A;  3WQW A;  2PBC A;  3UQB A;  5HWC A;  2KR7 A;  1FKI A;  2RUC A;  1TCO C;  4WKH A;  4NZC A;  1N1A A;  3ALG A;  3ARY A;  2A3E A;  2ZQV A;  4ZPT R;  3ARO A;  4KQZ A;  4DWS A;  2OLH A;  4HAR A;  5HBF A;  3NTP A;  2FKE A;  4ZPW R;  1HXV A;  5DIV A;  4Q22 A;  1LG1 A;  2A3C A;  2FAP A;  1R9H A;  3ARX A;  1W1P A;  4JFL A;  1E6Z A;  5DF0 A;  4ZS6 A;  4MSP A;  3CH9 A;  2PPO A;  4TNS A; 
#chains in the Genus database with same CATH homology
 3IK8 A;  1J4I A;  2LKN A;  3WD4 A;  4LAW A;  4MAV A;  3GPK A;  4DWS D;  4IT4 A;  2VCD A;  4L72 B;  4QIB A;  4MGV A;  3TC5 A;  3WD1 A;  1E9L A;  3BXW A;  1E6N A;  4TYO A;  5HTG A;  2DSW A;  3B7X A;  2ZR5 A;  2MLY A;  2XPB A;  1JND A;  4G50 A;  1L1P A;  5GPR A;  2XP4 A;  1LG2 A;  2DG9 A;  3UQI A;  2AWG A;  3UI5 A;  2L2S A;  5I98 A;  1FKJ A;  4ODP A;  3IKD A;  2F2D A;  2XP3 A;  2WM0 A;  3TDB A;  4MNK A;  1FKL A;  4LAY A;  4P8U A;  2MPH A;  1ZBC A;  2DPE A;  4ITZ A;  2KFW A;  3UI4 A;  3O5O A;  4W9Q A;  5HWB A;  3WQV A;  3PA7 A;  1FFR A;  2JZV A;  3NI6 A;  1ZBV A;  3FXY A;  3RM9 A;  2KI3 A;  2YBU A;  1GPF A;  1BKF A;  2Q5A A;  3CZ8 A;  4DRO A;  4DRH A;  1NWT A;  4J4O A;  3W4R A;  3MDY B;  2ZQU A;  2WLY A;  1JNE A;  4GGQ A;  4WKF A;  4DRJ A;  5DEZ A;  3O5M A;  5GQB A;  1LJY A;  3ARW A;  3WD3 A;  4LAV A;  4XAK A;  5HUA A;  3WL1 A;  4ODL A;  3O5D A;  3G6M A;  2ZR4 A;  1KT0 A;  1C9H A;  2PPP A;  4GIV A;  4L3N A;  1X6N A;  1LL6 A;  2PV3 A;  3ALF A;  4HBE A;  1D7J A;  3CGN A;  4QZV B;  1FKF A;  1PBK A;  2IUZ A;  3KAF A;  1UR9 A;  4QT2 A;  1H0I A;  1FKG A;  1BL4 A;  4Z2K A;  3B8S A;  3UQA A;  1X6L A;  1ITX A;  1U79 A;  3KCE A;  2N87 A;  4JFI A;  1EIB A;  5BXJ A;  3AS0 A;  2WLZ A;  2O92 A;  1FKD A;  3UF8 A;  3OA5 A;  2UZ5 A;  3PRD A;  1HKM A;  1W1Y A;  2KO7 A;  1NWR A;  2YBT A;  3G6L A;  4Z2H A;  4AY1 A;  3O5L A;  3KAH A;  1NH6 A;  3TCZ A;  1E15 A;  4FAP A;  5HW7 A;  4G2P A;  1KFW A;  4Q7N A;  4WJX A;  1ZU8 A;  2RUQ A;  2QF8 A;  1JNT A;  1QPF A;  1T11 A;  4TW8 A;  3WKZ A;  1FFQ A;  3RME A;  3O5F A;  5HW6 A;  1HJX A;  3KZ7 A;  1JVW A;  1HJV A;  1ROU A;  1ROT A;  1JNS A;  3RFW A;  3ARR A;  5DIT A;  1W9U A;  4IT6 A;  5DIU A;  3CHF A;  4J4N A;  1W9P A;  4P8W A;  1LQ0 A;  3ARP A;  2DT0 A;  2G41 A;  2MNT A;  4W9O A;  3OOB A;  4QT3 A;  1J4R A;  3EY6 A;  4URI A;  1FKS A;  5J6E A;  1W26 A;  2ZQT A;  4WK9 A;  4Z2I A;  1EHN A;  4P8X A;  1ZB5 A;  4Z2J A;  2XP9 A;  3WH0 A;  1GOI A;  2KE0 A;  2M08 A;  2DSU A;  3KAC A;  3WL0 A;  1Q6I A;  2Y78 A;  3O5G A;  1QPL A;  1B6C A;  3AS3 A;  4WKA A;  1NSG A;  2XP8 A;  4IPX A;  1HKI A;  2RSE A;  4S3J A;  5D75 A;  3O5K A;  1FKK A;  3O5Q A;  1EDQ A;  2IF4 A;  1HKJ A;  4ODR A;  2ESC A;  4FN2 A;  1D6O A;  3ARQ A;  2MF9 A;  4R5E A;  4ODK A;  2VN1 A;  1YW5 A;  4TW6 A;  2M1I A;  2PI6 A;  1FKB A;  2DSZ A;  1O6I A;  3CGM A;  1QZ2 A;  4C02 B;  3O5R A;  1TFV A;  3B9D A;  4TX0 A;  3H9R B;  5HT1 A;  1E6R A;  2PV2 A;  2PV1 A;  4KR0 B;  4DT4 A;  2XP7 A;  1ZL1 A;  4DZ2 A;  3KAG A;  4W9P A;  1WNO A;  2M2A A;  4JFJ A;  2ITK A;  4DRM A;  1NWS A;  3QOK A;  3WD0 A;  3FAP A;  4DRI A;  1F8A B;  4IQ2 A;  4MTV A;  1HJW A;  1YAT A;  1ZCN A;  2MLZ A;  2RUR A;  1XHG A;  3ODK A;  2PPN A;  1ZBW A;  2RUD A;  4ODQ A;  1ZK6 A;  2O9O A;  4U86 A;  2DT1 A;  5JH8 A;  1Y0O A;  4HBO A;  4MNJ A;  1EQ3 A;  2DG4 A;  2XPA A;  4MNM A;  3O5I A;  3LUO A;  3WD2 A;  1WB0 A;  4W5U A;  1P5Q A;  1NMW A;  2FDM A;  4DZ3 A;  3ART A;  2AOS A;  1W1V A;  4Z2L A;  2DT2 A;  3KAB A;  1WAW A;  1FJD A;  1LL4 A;  5B8I C;  4TW7 A;  3PRB A;  3RM4 A;  4JFM A;  1FAP A;  3O5E A;  4ODO A;  3JXV A;  4JYS A;  3I6C A;  2A3B A;  1SR0 A;  3IKG A;  1J4H A;  2LPV A;  2ZR6 A;  4IQC A;  2F4E A;  2OFN A;  1XRV A;  3AS1 A;  3PRA A;  3RGC A;  3O5P A;  1FKH A;  2KGJ A;  4DIP A;  4MNL A;  4DRN A;  4ODM A;  2F21 A;  1W9V A;  2LJ4 A;  1Q1C A;  4ZPV R;  4DRP A;  1LL7 A;  4Z2G A;  5HW8 A;  2LGO A;  5GPG A;  1UR8 A;  1W1T A;  3KAD A;  3AQU A;  1OGG A;  1FKR A;  1PIN A;  3FY1 A;  2B31 A;  1IX5 A;  3KAI A;  1KT1 A;  1NMV A;  2XP6 A;  2MLX A;  1Q6H A;  1RD6 A;  3ARZ A;  2RQS A;  1K9T A;  3CHE A;  1SYT A;  3RM8 A;  2D9F A;  1M5Y A;  4LGX A;  3UI6 A;  4MPK A;  2A3A A;  4PTM A;  2DSV A;  1Q6U A;  3NRK A;  3B9E A;  4NNR A;  3B9A A;  3JYJ A;  3ARU A;  4R0X A;  1FD9 A;  2ZQS A;  2K8I A;  3ARV A;  3IHZ A;  4BF8 A;  4DRQ A;  5DO2 A;  3JYM A;  4DWS C;  1J6Y A;  1H0G A;  3WIJ A;  4U85 A;  1GUV A;  3CHC A;  1OWQ A;  2G8Z A;  4ODN A;  4WIW A;  4DWS B;  4N19 A;  4S3K A;  4DH0 A;  4NSB A;  1D7I A;  1F40 A;  1OGB A;  3PR9 A;  3VAW A;  1VF8 A;  1D7H A;  1EYM A;  1E6P A;  2WK2 A;  1HKK A;  1CTN A;  1ZBK A;  1FKT A;  3CHD A;  2DT3 A;  2DG3 A;  4DRK A;  3AS2 A;  4U84 A;  1A7X A;  2XP5 A;  4LAX A;  3O5J A;  3ARS A;  4ML4 A;  1D2K A;  4JFK A;  5HKG A;  1NWU A;  4P8V A;  4O2T A;  3WQW A;  2PBC A;  3UQB A;  5HWC A;  2KR7 A;  1FKI A;  2RUC A;  1TCO C;  4WKH A;  4NZC A;  1N1A A;  3ALG A;  3ARY A;  2A3E A;  2ZQV A;  4ZPT R;  3ARO A;  4KQZ A;  4DWS A;  2OLH A;  4HAR A;  5HBF A;  3NTP A;  2FKE A;  4ZPW R;  1HXV A;  5DIV A;  4Q22 A;  1LG1 A;  2A3C A;  2FAP A;  1R9H A;  3ARX A;  1W1P A;  4JFL A;  1E6Z A;  5DF0 A;  4ZS6 A;  4MSP A;  3CH9 A;  2PPO A;  4TNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...