4IQ2A

P21 crystal form of fkbp12.6
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
107
structure length
107
Chain Sequence
GVEIETISPGDGRTFPKKGQTVVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTITPDVAYGATGHPGVIPPNATLIFDVELLNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1B
publication title Crystal structure and conformational flexibility of the unligated FK506-binding protein FKBP12.6.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4iq2A00
1Q1CA 4GGQA 2XPBA 4TNSA 3KAGA 1JNSA 2VCDA 3RFWA 2MNTA 1N1AA 4R0XA 1NSGA 2MLYA 3KADA 5D75A 4DT4A 3O5FA 5DIUA 2PPNA 3EY6A 4JFJA 3KABA 1JVWA 2RURA 4LAXA 4ODRA 2DG3A 3IHZA 2FAPA 4ODOA 3UQAA 1Y0OA 3FAPA 3NTPA 4ODMA 1F40A 2M2AA 4N19A 4ODLA 3TC5A 3OOBA 3I6CA 5DITA 2XPAA 4DZ3A 2XP3A 4TX0A 1J4HA 2KO7A 3UQBA 2PV3A 3ODKA 4DRJA 4TW7A 3UI4A 2LKNA 1FKFA 4QIBA 2Q5AA 1ROUA 2FKEA 5HW6A 1D7IA 4ODQA 4W9PA 4JFKA 3KAFA 4MSPA 2DG9A 3WH0A 2LGOA 1A7XA 1TCOC 1D6OA 4W9OA 4DRMA 5B8IC 1J6YA 2L2SA 1J4IA 3O5DA 5HW8A 4LAYA 1EYMA 2XP4A 1Q6IA 2PPPA 4ODPA 2RUQA 3O5EA 4QT2A 4C02B 1M5YA 5HWBA 3O5GA 3NRKA 2ZR5A 4U86A 2PBCA 4FN2A 1JNTA 3O5LA 1FKJA 4DZ2A 4FAPA 3RGCA 2LJ4A 1HXVA 4BF8A 4DRHA 4NNRA 2XP8A 4QT3A 1R9HA 2M1IA 1J4RA 3UI6A 2UZ5A 3B7XA 1ZK6A 2LPVA 1T11A 2JZVA 4J4NA 2F4EA 2KFWA 2Y78A 1QPLA 1U79A 3KACA 3PA7A 4TW6A 4DIPA 5BXJA 1NMWA 1YW5A 2PV2A 4IQCA 4JYSA 3JYJA 4G50A 2PV1A 3MDYB 4DRKA 5I98A 1P5QA 1FD9A 1KT1A 2RQSA 1FKKA 1D7HA 4DRQA 2F2DA 2ITKA 4TW8A 2XP7A 4ITZA 4ODNA 4LAWA 2KR7A 1Q6HA 3UI5A 2ZQTA 1KT0A 1FKBA 2ZQSA 2ZR4A 2AWGA 1QZ2A 3IKDA 1FKLA 3IK8A 5DIVA 1PINA 1BKFA 2OFNA 3LUOA 2K8IA 2F21A 3H9RB 5HUAA 2XP5A 3UF8A 1PBKA 3O5JA 2RUDA 4G2PA 4IPXA 1L1PA 4ODKA 1EQ3A 3CGMA 1FAPA 1QPFA 5HWCA 4DRNA 3PRDA 2MLXA 1FKHA 4DROA 3CGNA 2M08A 3O5RA 4JFMA 2KE0A 3O5PA 3O5KA 5HTGA 4LAVA 5J6EA 1Q6UA 2PPOA 1FKGA 2VN1A 2ZQUA 1FKIA 3O5QA 4DH0A 1ROTA 1YATA 1D7JA 2D9FA 2ZR6A 3KZ7A 3TCZA 3UQIA 5HW7A 2XP6A 1B6CA 3O5IA 2MPHA 3IKGA 3JYMA 1NMVA 3O5MA 4W9QA 4GIVA 5HKGA 1W26A 2N87A 1FJDA 1FKTA 2KI3A 2MF9A 4IQ2A 4JFIA 1C9HA 4JFLA 3JXVA 4U85A 2KGJA 3GPKA 4DRIA 3KAIA 5HT1A 1FKRA 3VAWA 2RUCA 2DG4A 4TYOA 2RSEA 4U84A 1FKSA 3TDBA 4DRPA 1F8AB 1ZCNA 2IF4A 1FKDA 3KAHA 4MGVA 3O5OA 2XP9A 2MLZA 5GPGA 3PRBA 1BL4A 4J4OA 4O2TA 3KCEA 2ZQVA 3NI6A
chains in the Genus database with same CATH superfamily
1IX5A 1JNSA 4TNSA 1UR8A 2VCDA 3RFWA 4R0XA 2PPNA 1NWSA 3KABA 4ZS6A 4ODRA 4ODOA 3NTPA 4ODMA 1LL4A 4ODLA 3AS1A 3ARRA 5DITA 1EIBA 1X6NA 2XP3A 1J4HA 1ITXA 3WD4A 1W1TA 4Z2HA 3UI4A 4QIBA 1EDQA 2WM0A 2FKEA 5DO2A 1D7IA 4W9PA 3WH0A 4WKAA 1D6OA 1D2KA 4Z2LA 1EYMA 2XP4A 4PTMA 4ODPA 3O5EA 4C02B 1W9UA 2PBCA 3O5LA 1GPFA 2LJ4A 4QT3A 2UZ5A 4Q7NA 2Y78A 1QPLA 2PI6A 1U79A 3CHEA 3KACA 3PA7A 4WIWA 4DIPA 4MNMA 1NMWA 3B9AA 1KT1A 1D7HA 4ODNA 2KR7A 3UI5A 1LG2A 1KT0A 1FKBA 1TFVA 1BKFA 1E6ZA 1OWQA 1NH6A 3WL0A 1QPFA 1JCHB 2A3AA 4DROA 4JFMA 3O5RA 3O5KA 3RM4A 2ZQUA 2DT3A 2VN1A 4DH0A 2ZR6A 2O92A 3KZ7A 3JYMA 1ZBKA 5HKGA 2WLYA 3WIJA 2MF9A 4JFLA 1C9HA 2OLHA 5HBFA 1FKRA 3VAWA 2RSEA 4ZPVR 3TDBA 1ZCNA 4MTVA 2IF4A 3WQWA 4NZCA 2MLZA 3PRBA 4J4OA 4P8VA 1Q1CA 4GGQA 3KAGA 2MNTA 4HBEA 3KADA 4DT4A 5DIUA 3EY6A 1LL7A 2YBTA 1VF8A 4JFJA 4LAXA 2RURA 1HKJA 3IHZA 3UQAA 1Y0OA 2A3CA 4HBOA 1GUVA 4KR0B 4N19A 3TC5A 3BMBA 1WB0A 3EIPA 3UQBA 1NWRA 3PRAA 2DSWA 1X6LA 4ODQA 1GRJA 4JFKA 4MSPA 4WK9A 2DG9A 1A7XA 1TCOC 3OA5A 5B8IC 2DT2A 1J6YA 4R5EA 1W1VA 1LJYA 3ALGA 1KFWA 2RUQA 1W1PA 2ZR5A 2WK2A 4DWSD 3W4RA 1NWUA 4AY1A 3AS0A 1OGBA 1HKKA 4BF8A 4NNRA 4DRHA 1SYTA 1R9HA 2M1IA 1J4RA 4MNLA 1H0GA 3UI6A 2LPVA 4MNJA 1T11A 2KFWA 4JYSA 4ML4A 2PV1A 5DEZA 2P4VA 5DF0A 1FFQA 4DRQA 2F2DA 2ITKA 3CHCA 4TW8A 2ESCA 2XP7A 4ITZA 1Q6HA 3WD1A 2ZQTA 2WLZA 2ZQSA 2AWGA 4UDMA 4P8UA 5DIVA 3GU0A 3G6MA 2F21A 3H9RB 3AS2A 2RUDA 4DWSB 1L1PA 1W9PA 3CGMA 2ETNA 5HWCA 4MPKA 3AS3A 2KE0A 4Z2KA 4DWSA 5J6EA 3O5QA 1FKIA 4S3KA 5HW7A 2D9FA 4L3NA 3O5IA 3CZ8A 4IT6A 4GIVA 1W26A 2N87A 3CHFA 1ZU8A 1FJDA 4IQ2A 3RMEA 4WKHA 1OGGA 2KGJA 4ZPTR 4P8WA 3KAIA 4W5UA 4U84A 1FKSA 4HARA 1F8AB 1FKDA 3ARPA 3O5OA 2XP9A 2DSVA 4O2TA 3ARSA 2XPBA 3ARUA 1GOIA 5D75A 3O5FA 2AOSA 1JVWA 3PR9A 1LQ0A 1E9LA 4L72B 1F40A 1EHNA 3OOBA 4QZVB 3I6CA 2XPAA 3ARVA 4DZ3A 2KO7A 3WL1A 3AQUA 1FFRA 3WD0A 2PV3A 2LKNA 1FKFA 4Z2JA 3KAFA 3B8SA 4S3JA 2L2SA 1J4IA 3O5DA 5HW8A 4LAYA 1Q6IA 2DSUA 2O9OA 3BXWA 1E6NA 2DSZA 1M5YA 5HWBA 3O5GA 3NRKA 2EULA 4U86A 1FKJA 1JNDA 3WKZA 4FAPA 4Z2GA 3RGCA 1HXVA 1H0IA 2YBUA 2PN0A 4P8XA 3B7XA 4J4NA 2F4EA 3ARTA 1WNOA 1XRVA 5BXJA 1O6IA 3CHDA 1HJWA 1JNEA 1YW5A 4DRKA 5I98A 1FD9A 1ZBWA 1ZBVA 1WAWA 4LAWA 2B5UB 2ZR4A 1QZ2A 1FKLA 2DT1A 1E6RA 3WD2A 1E15A 3LUOA 1UR9A 2QF8A 5HUAA 4ZPWR 1PBKA 4G2PA 4IPXA 3GTYX 4ODKA 3B9DA 4DRNA 2MLXA 1FKHA 5HTGA 2M08A 4KQZA 1E44A 3O5PA 2B31A 4LAVA 1Q6UA 2PPOA 4Z2IA 1ZBCA 1XHGA 1ZL1A 1ROTA 1YATA 1D7JA 1B6CA 1NMVA 3O5MA 4W9QA 3G6LA 1FKTA 2KI3A 3GPKA 1NWTA 2RUCA 2DG4A 4TYOA 1RD6A 4DRPA 2G8ZA 1LL6A 2A3BA 5GPGA 2ZQVA 3NI6A 3UF8A 3B9EA 1N1AA 1NSGA 2MLYA 1HKIA 2DG3A 2FAPA 2G41A 3FAPA 2M2AA 4TX0A 3ODKA 4DRJA 3ARYA 1HJVA 4TW7A 1SR0A 4XAKA 2Q5AA 1ROUA 5HW6A 1W9VA 2A3EA 2LGOA 4W9OA 4WKFA 4DRMA 3AROA 3CH9A 3ARZA 3ARWA 3ARQA 2FDMA 3WQVA 2PPPA 3RM8A 4QT2A 4FN2A 1JNTA 1LG1A 3WD3A 5JH8A 3RM9A 2XP8A 1ZK6A 2JZVA 2IUZA 3ARXA 4TW6A 2DT0A 4IQCA 2PV2A 3JYJA 4G50A 3FY1A 3MDYB 1P5QA 2RQSA 1FKKA 3FXYA 4Q22A 4DWSC 3IKDA 3IK8A 1PINA 1E6PA 2OFNA 2K8IA 2XP5A 3O5JA 1W1YA 1EQ3A 1FAPA 3PRDA 4NSBA 4URIA 3CGNA 3ALFA 1FKGA 4IT4A 1HJXA 1HKMA 3UQIA 1K9TA 3TCZA 2XP6A 2MPHA 3IKGA 5GQBA 4DZ2A 4JFIA 1CTNA 4MAVA 2DPEA 1ZB5A 3JXVA 4U85A 4DRIA 5HT1A 4MNKA 5GPRA 2F23A 3KAHA 4MGVA 3QOKA 1BL4A 4LGXA 3KCEA 4WJXA
chains in the Genus database with same CATH topology
1IX5A 1JNSA 4TNSA 1UR8A 2VCDA 3RFWA 4R0XA 2PPNA 1NWSA 3KABA 4ZS6A 4ODRA 4ODOA 3NTPA 4ODMA 1LL4A 4ODLA 3AS1A 3ARRA 5DITA 1EIBA 1X6NA 2XP3A 1J4HA 1ITXA 3WD4A 1W1TA 4Z2HA 3UI4A 4QIBA 1EDQA 2WM0A 2FKEA 5DO2A 1D7IA 4W9PA 3WH0A 4WKAA 1D6OA 1D2KA 4Z2LA 1EYMA 2XP4A 4PTMA 4ODPA 3O5EA 4C02B 1W9UA 2PBCA 3O5LA 1GPFA 2LJ4A 4QT3A 2UZ5A 4Q7NA 2Y78A 1QPLA 2PI6A 1U79A 3CHEA 3KACA 3PA7A 4WIWA 4DIPA 4MNMA 1NMWA 3B9AA 1KT1A 1D7HA 4ODNA 2KR7A 3UI5A 1LG2A 1KT0A 1FKBA 1TFVA 1BKFA 1E6ZA 1OWQA 1NH6A 3WL0A 1QPFA 2A3AA 4DROA 4JFMA 3O5RA 3O5KA 3RM4A 2ZQUA 2DT3A 2VN1A 4DH0A 2ZR6A 2O92A 3KZ7A 3JYMA 1ZBKA 5HKGA 2WLYA 3WIJA 2MF9A 4JFLA 1C9HA 2OLHA 5HBFA 1FKRA 3VAWA 2RSEA 4ZPVR 3TDBA 1ZCNA 4MTVA 2IF4A 3WQWA 4NZCA 2MLZA 3PRBA 4J4OA 4P8VA 1Q1CA 4GGQA 3KAGA 2MNTA 4HBEA 3KADA 4DT4A 5DIUA 3EY6A 1LL7A 2YBTA 1VF8A 4JFJA 4LAXA 2RURA 1HKJA 3IHZA 3UQAA 1Y0OA 2A3CA 4HBOA 1GUVA 4KR0B 4N19A 3TC5A 1WB0A 3UQBA 1NWRA 3PRAA 2DSWA 1X6LA 4ODQA 4WK9A 4JFKA 4MSPA 2DG9A 1A7XA 1TCOC 3OA5A 5B8IC 2DT2A 1J6YA 4R5EA 1W1VA 1LJYA 3ALGA 1KFWA 2RUQA 1W1PA 2ZR5A 2WK2A 4DWSD 3W4RA 1NWUA 4AY1A 3AS0A 1OGBA 1HKKA 4BF8A 4NNRA 4DRHA 1SYTA 1R9HA 2M1IA 1J4RA 4MNLA 1H0GA 3UI6A 2LPVA 4MNJA 1T11A 2KFWA 4JYSA 4ML4A 2PV1A 5DEZA 5DF0A 1FFQA 4DRQA 2F2DA 2ITKA 3CHCA 4TW8A 2ESCA 2XP7A 4ITZA 1Q6HA 3WD1A 2ZQTA 2WLZA 2ZQSA 2AWGA 4P8UA 5DIVA 3G6MA 2F21A 3H9RB 3AS2A 2RUDA 4DWSB 1L1PA 1W9PA 3CGMA 5HWCA 4MPKA 3AS3A 2KE0A 4Z2KA 4DWSA 5J6EA 3O5QA 1FKIA 4S3KA 5HW7A 2D9FA 4L3NA 3O5IA 3CZ8A 4IT6A 4GIVA 1W26A 2N87A 3CHFA 1ZU8A 1FJDA 4IQ2A 3RMEA 4WKHA 1OGGA 2KGJA 4ZPTR 4P8WA 3KAIA 4W5UA 4U84A 1FKSA 4HARA 1F8AB 1FKDA 3ARPA 3O5OA 2XP9A 2DSVA 4O2TA 3ARSA 2XPBA 3ARUA 1GOIA 5D75A 3O5FA 2AOSA 1JVWA 3PR9A 1LQ0A 1E9LA 4L72B 1F40A 1EHNA 3OOBA 4QZVB 3I6CA 2XPAA 3ARVA 4DZ3A 2KO7A 3WL1A 3AQUA 1FFRA 3WD0A 2PV3A 2LKNA 1FKFA 4Z2JA 3KAFA 3B8SA 4S3JA 2L2SA 1J4IA 3O5DA 5HW8A 4LAYA 1Q6IA 2DSUA 2O9OA 3BXWA 1E6NA 2DSZA 1M5YA 5HWBA 3O5GA 3NRKA 4U86A 1FKJA 1JNDA 3WKZA 4FAPA 4Z2GA 3RGCA 1HXVA 1H0IA 2YBUA 4P8XA 3B7XA 4J4NA 2F4EA 3ARTA 1WNOA 1XRVA 5BXJA 1O6IA 3CHDA 1HJWA 1JNEA 1YW5A 4DRKA 5I98A 1FD9A 1ZBWA 1ZBVA 1WAWA 4LAWA 2ZR4A 1QZ2A 1FKLA 2DT1A 1E6RA 3WD2A 1E15A 3LUOA 1UR9A 2QF8A 5HUAA 4ZPWR 1PBKA 4G2PA 4IPXA 4ODKA 3B9DA 4DRNA 2MLXA 1FKHA 5HTGA 2M08A 4KQZA 3O5PA 2B31A 4LAVA 1Q6UA 2PPOA 4Z2IA 1ZBCA 1XHGA 1ZL1A 1ROTA 1YATA 1D7JA 1B6CA 1NMVA 3O5MA 4W9QA 3G6LA 1FKTA 2KI3A 3GPKA 1NWTA 2RUCA 2DG4A 4TYOA 1RD6A 4DRPA 2G8ZA 1LL6A 2A3BA 5GPGA 2ZQVA 3NI6A 3UF8A 3B9EA 1N1AA 1NSGA 2MLYA 1HKIA 2DG3A 2FAPA 2G41A 3FAPA 2M2AA 4TX0A 3ODKA 4DRJA 3ARYA 1HJVA 4TW7A 1SR0A 4XAKA 2Q5AA 1ROUA 5HW6A 1W9VA 2A3EA 2LGOA 4W9OA 4WKFA 4DRMA 3AROA 3CH9A 3ARZA 3ARWA 3ARQA 2FDMA 3WQVA 2PPPA 3RM8A 4QT2A 4FN2A 1JNTA 1LG1A 3WD3A 5JH8A 3RM9A 2XP8A 1ZK6A 2JZVA 2IUZA 3ARXA 4TW6A 2DT0A 4IQCA 2PV2A 3JYJA 4G50A 3FY1A 3MDYB 1P5QA 2RQSA 1FKKA 3FXYA 4Q22A 4DWSC 3IKDA 3IK8A 1PINA 1E6PA 2OFNA 2K8IA 2XP5A 3O5JA 1W1YA 1EQ3A 1FAPA 3PRDA 4NSBA 4URIA 3CGNA 3ALFA 1FKGA 4IT4A 1HJXA 1HKMA 3UQIA 1K9TA 3TCZA 2XP6A 2MPHA 3IKGA 5GQBA 4DZ2A 4JFIA 1CTNA 4MAVA 2DPEA 1ZB5A 3JXVA 4U85A 4DRIA 5HT1A 4MNKA 5GPRA 3KAHA 4MGVA 3QOKA 1BL4A 4LGXA 3KCEA 4WJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q1C A;  4GGQ A;  2XPB A;  4TNS A;  3KAG A;  1JNS A;  2VCD A;  3RFW A;  2MNT A;  1N1A A;  4R0X A;  1NSG A;  2MLY A;  3KAD A;  5D75 A;  4DT4 A;  3O5F A;  5DIU A;  2PPN A;  3EY6 A;  4JFJ A;  3KAB A;  1JVW A;  2RUR A;  4LAX A;  4ODR A;  2DG3 A;  3IHZ A;  2FAP A;  4ODO A;  3UQA A;  1Y0O A;  3FAP A;  3NTP A;  4ODM A;  1F40 A;  2M2A A;  4N19 A;  4ODL A;  3TC5 A;  3OOB A;  3I6C A;  5DIT A;  2XPA A;  4DZ3 A;  2XP3 A;  4TX0 A;  1J4H A;  2KO7 A;  3UQB A;  2PV3 A;  3ODK A;  4DRJ A;  4TW7 A;  3UI4 A;  2LKN A;  1FKF A;  4QIB A;  2Q5A A;  1ROU A;  2FKE A;  5HW6 A;  1D7I A;  4ODQ A;  4W9P A;  4JFK A;  3KAF A;  4MSP A;  2DG9 A;  3WH0 A;  2LGO A;  1A7X A;  1TCO C;  1D6O A;  4W9O A;  4DRM A;  5B8I C;  1J6Y A;  2L2S A;  1J4I A;  3O5D A;  5HW8 A;  4LAY A;  1EYM A;  2XP4 A;  1Q6I A;  2PPP A;  4ODP A;  2RUQ A;  3O5E A;  4QT2 A;  4C02 B;  1M5Y A;  5HWB A;  3O5G A;  3NRK A;  2ZR5 A;  4U86 A;  2PBC A;  4FN2 A;  1JNT A;  3O5L A;  1FKJ A;  4DZ2 A;  4FAP A;  3RGC A;  2LJ4 A;  1HXV A;  4BF8 A;  4DRH A;  4NNR A;  2XP8 A;  4QT3 A;  1R9H A;  2M1I A;  1J4R A;  3UI6 A;  2UZ5 A;  3B7X A;  1ZK6 A;  2LPV A;  1T11 A;  2JZV A;  4J4N A;  2F4E A;  2KFW A;  2Y78 A;  1QPL A;  1U79 A;  3KAC A;  3PA7 A;  4TW6 A;  4DIP A;  5BXJ A;  1NMW A;  1YW5 A;  2PV2 A;  4IQC A;  4JYS A;  3JYJ A;  4G50 A;  2PV1 A;  3MDY B;  4DRK A;  5I98 A;  1P5Q A;  1FD9 A;  1KT1 A;  2RQS A;  1FKK A;  1D7H A;  4DRQ A;  2F2D A;  2ITK A;  4TW8 A;  2XP7 A;  4ITZ A;  4ODN A;  4LAW A;  2KR7 A;  1Q6H A;  3UI5 A;  2ZQT A;  1KT0 A;  1FKB A;  2ZQS A;  2ZR4 A;  2AWG A;  1QZ2 A;  3IKD A;  1FKL A;  3IK8 A;  5DIV A;  1PIN A;  1BKF A;  2OFN A;  3LUO A;  2K8I A;  2F21 A;  3H9R B;  5HUA A;  2XP5 A;  3UF8 A;  1PBK A;  3O5J A;  2RUD A;  4G2P A;  4IPX A;  1L1P A;  4ODK A;  1EQ3 A;  3CGM A;  1FAP A;  1QPF A;  5HWC A;  4DRN A;  3PRD A;  2MLX A;  1FKH A;  4DRO A;  3CGN A;  2M08 A;  3O5R A;  4JFM A;  2KE0 A;  3O5P A;  3O5K A;  5HTG A;  4LAV A;  5J6E A;  1Q6U A;  2PPO A;  1FKG A;  2VN1 A;  2ZQU A;  1FKI A;  3O5Q A;  4DH0 A;  1ROT A;  1YAT A;  1D7J A;  2D9F A;  2ZR6 A;  3KZ7 A;  3TCZ A;  3UQI A;  5HW7 A;  2XP6 A;  1B6C A;  3O5I A;  2MPH A;  3IKG A;  3JYM A;  1NMV A;  3O5M A;  4W9Q A;  4GIV A;  5HKG A;  1W26 A;  2N87 A;  1FJD A;  1FKT A;  2KI3 A;  2MF9 A;  4IQ2 A;  4JFI A;  1C9H A;  4JFL A;  3JXV A;  4U85 A;  2KGJ A;  3GPK A;  4DRI A;  3KAI A;  5HT1 A;  1FKR A;  3VAW A;  2RUC A;  2DG4 A;  4TYO A;  2RSE A;  4U84 A;  1FKS A;  3TDB A;  4DRP A;  1F8A B;  1ZCN A;  2IF4 A;  1FKD A;  3KAH A;  4MGV A;  3O5O A;  2XP9 A;  2MLZ A;  5GPG A;  3PRB A;  1BL4 A;  4J4O A;  4O2T A;  3KCE A;  2ZQV A;  3NI6 A; 
#chains in the Genus database with same CATH topology
 1IX5 A;  1JNS A;  4TNS A;  1UR8 A;  2VCD A;  3RFW A;  4R0X A;  2PPN A;  1NWS A;  3KAB A;  4ZS6 A;  4ODR A;  4ODO A;  3NTP A;  4ODM A;  1LL4 A;  4ODL A;  3AS1 A;  3ARR A;  5DIT A;  1EIB A;  1X6N A;  2XP3 A;  1J4H A;  1ITX A;  3WD4 A;  1W1T A;  4Z2H A;  3UI4 A;  4QIB A;  1EDQ A;  2WM0 A;  2FKE A;  5DO2 A;  1D7I A;  4W9P A;  3WH0 A;  4WKA A;  1D6O A;  1D2K A;  4Z2L A;  1EYM A;  2XP4 A;  4PTM A;  4ODP A;  3O5E A;  4C02 B;  1W9U A;  2PBC A;  3O5L A;  1GPF A;  2LJ4 A;  4QT3 A;  2UZ5 A;  4Q7N A;  2Y78 A;  1QPL A;  2PI6 A;  1U79 A;  3CHE A;  3KAC A;  3PA7 A;  4WIW A;  4DIP A;  4MNM A;  1NMW A;  3B9A A;  1KT1 A;  1D7H A;  4ODN A;  2KR7 A;  3UI5 A;  1LG2 A;  1KT0 A;  1FKB A;  1TFV A;  1BKF A;  1E6Z A;  1OWQ A;  1NH6 A;  3WL0 A;  1QPF A;  1JCH B;  2A3A A;  4DRO A;  4JFM A;  3O5R A;  3O5K A;  3RM4 A;  2ZQU A;  2DT3 A;  2VN1 A;  4DH0 A;  2ZR6 A;  2O92 A;  3KZ7 A;  3JYM A;  1ZBK A;  5HKG A;  2WLY A;  3WIJ A;  2MF9 A;  4JFL A;  1C9H A;  2OLH A;  5HBF A;  1FKR A;  3VAW A;  2RSE A;  4ZPV R;  3TDB A;  1ZCN A;  4MTV A;  2IF4 A;  3WQW A;  4NZC A;  2MLZ A;  3PRB A;  4J4O A;  4P8V A;  1Q1C A;  4GGQ A;  3KAG A;  2MNT A;  4HBE A;  3KAD A;  4DT4 A;  5DIU A;  3EY6 A;  1LL7 A;  2YBT A;  1VF8 A;  4JFJ A;  4LAX A;  2RUR A;  1HKJ A;  3IHZ A;  3UQA A;  1Y0O A;  2A3C A;  4HBO A;  1GUV A;  4KR0 B;  4N19 A;  3TC5 A;  3BMB A;  1WB0 A;  3EIP A;  3UQB A;  1NWR A;  3PRA A;  2DSW A;  1X6L A;  4ODQ A;  1GRJ A;  4JFK A;  4MSP A;  4WK9 A;  2DG9 A;  1A7X A;  1TCO C;  3OA5 A;  5B8I C;  2DT2 A;  1J6Y A;  4R5E A;  1W1V A;  1LJY A;  3ALG A;  1KFW A;  2RUQ A;  1W1P A;  2ZR5 A;  2WK2 A;  4DWS D;  3W4R A;  1NWU A;  4AY1 A;  3AS0 A;  1OGB A;  1HKK A;  4BF8 A;  4NNR A;  4DRH A;  1SYT A;  1R9H A;  2M1I A;  1J4R A;  4MNL A;  1H0G A;  3UI6 A;  2LPV A;  4MNJ A;  1T11 A;  2KFW A;  4JYS A;  4ML4 A;  2PV1 A;  5DEZ A;  2P4V A;  5DF0 A;  1FFQ A;  4DRQ A;  2F2D A;  2ITK A;  3CHC A;  4TW8 A;  2ESC A;  2XP7 A;  4ITZ A;  1Q6H A;  3WD1 A;  2ZQT A;  2WLZ A;  2ZQS A;  2AWG A;  4UDM A;  4P8U A;  5DIV A;  3GU0 A;  3G6M A;  2F21 A;  3H9R B;  3AS2 A;  2RUD A;  4DWS B;  1L1P A;  1W9P A;  3CGM A;  2ETN A;  5HWC A;  4MPK A;  3AS3 A;  2KE0 A;  4Z2K A;  4DWS A;  5J6E A;  3O5Q A;  1FKI A;  4S3K A;  5HW7 A;  2D9F A;  4L3N A;  3O5I A;  3CZ8 A;  4IT6 A;  4GIV A;  1W26 A;  2N87 A;  3CHF A;  1ZU8 A;  1FJD A;  4IQ2 A;  3RME A;  4WKH A;  1OGG A;  2KGJ A;  4ZPT R;  4P8W A;  3KAI A;  4W5U A;  4U84 A;  1FKS A;  4HAR A;  1F8A B;  1FKD A;  3ARP A;  3O5O A;  2XP9 A;  2DSV A;  4O2T A;  3ARS A;  2XPB A;  3ARU A;  1GOI A;  5D75 A;  3O5F A;  2AOS A;  1JVW A;  3PR9 A;  1LQ0 A;  1E9L A;  4L72 B;  1F40 A;  1EHN A;  3OOB A;  4QZV B;  3I6C A;  2XPA A;  3ARV A;  4DZ3 A;  2KO7 A;  3WL1 A;  3AQU A;  1FFR A;  3WD0 A;  2PV3 A;  2LKN A;  1FKF A;  4Z2J A;  3KAF A;  3B8S A;  4S3J A;  2L2S A;  1J4I A;  3O5D A;  5HW8 A;  4LAY A;  1Q6I A;  2DSU A;  2O9O A;  3BXW A;  1E6N A;  2DSZ A;  1M5Y A;  5HWB A;  3O5G A;  3NRK A;  2EUL A;  4U86 A;  1FKJ A;  1JND A;  3WKZ A;  4FAP A;  4Z2G A;  3RGC A;  1HXV A;  1H0I A;  2YBU A;  2PN0 A;  4P8X A;  3B7X A;  4J4N A;  2F4E A;  3ART A;  1WNO A;  1XRV A;  5BXJ A;  1O6I A;  3CHD A;  1HJW A;  1JNE A;  1YW5 A;  4DRK A;  5I98 A;  1FD9 A;  1ZBW A;  1ZBV A;  1WAW A;  4LAW A;  2B5U B;  2ZR4 A;  1QZ2 A;  1FKL A;  2DT1 A;  1E6R A;  3WD2 A;  1E15 A;  3LUO A;  1UR9 A;  2QF8 A;  5HUA A;  4ZPW R;  1PBK A;  4G2P A;  4IPX A;  3GTY X;  4ODK A;  3B9D A;  4DRN A;  2MLX A;  1FKH A;  5HTG A;  2M08 A;  4KQZ A;  1E44 A;  3O5P A;  2B31 A;  4LAV A;  1Q6U A;  2PPO A;  4Z2I A;  1ZBC A;  1XHG A;  1ZL1 A;  1ROT A;  1YAT A;  1D7J A;  1B6C A;  1NMV A;  3O5M A;  4W9Q A;  3G6L A;  1FKT A;  2KI3 A;  3GPK A;  1NWT A;  2RUC A;  2DG4 A;  4TYO A;  1RD6 A;  4DRP A;  2G8Z A;  1LL6 A;  2A3B A;  5GPG A;  2ZQV A;  3NI6 A;  3UF8 A;  3B9E A;  1N1A A;  1NSG A;  2MLY A;  1HKI A;  2DG3 A;  2FAP A;  2G41 A;  3FAP A;  2M2A A;  4TX0 A;  3ODK A;  4DRJ A;  3ARY A;  1HJV A;  4TW7 A;  1SR0 A;  4XAK A;  2Q5A A;  1ROU A;  5HW6 A;  1W9V A;  2A3E A;  2LGO A;  4W9O A;  4WKF A;  4DRM A;  3ARO A;  3CH9 A;  3ARZ A;  3ARW A;  3ARQ A;  2FDM A;  3WQV A;  2PPP A;  3RM8 A;  4QT2 A;  4FN2 A;  1JNT A;  1LG1 A;  3WD3 A;  5JH8 A;  3RM9 A;  2XP8 A;  1ZK6 A;  2JZV A;  2IUZ A;  3ARX A;  4TW6 A;  2DT0 A;  4IQC A;  2PV2 A;  3JYJ A;  4G50 A;  3FY1 A;  3MDY B;  1P5Q A;  2RQS A;  1FKK A;  3FXY A;  4Q22 A;  4DWS C;  3IKD A;  3IK8 A;  1PIN A;  1E6P A;  2OFN A;  2K8I A;  2XP5 A;  3O5J A;  1W1Y A;  1EQ3 A;  1FAP A;  3PRD A;  4NSB A;  4URI A;  3CGN A;  3ALF A;  1FKG A;  4IT4 A;  1HJX A;  1HKM A;  3UQI A;  1K9T A;  3TCZ A;  2XP6 A;  2MPH A;  3IKG A;  5GQB A;  4DZ2 A;  4JFI A;  1CTN A;  4MAV A;  2DPE A;  1ZB5 A;  3JXV A;  4U85 A;  4DRI A;  5HT1 A;  4MNK A;  5GPR A;  2F23 A;  3KAH A;  4MGV A;  3QOK A;  1BL4 A;  4LGX A;  3KCE A;  4WJX A; 
#chains in the Genus database with same CATH homology
 1IX5 A;  1JNS A;  4TNS A;  1UR8 A;  2VCD A;  3RFW A;  4R0X A;  2PPN A;  1NWS A;  3KAB A;  4ZS6 A;  4ODR A;  4ODO A;  3NTP A;  4ODM A;  1LL4 A;  4ODL A;  3AS1 A;  3ARR A;  5DIT A;  1EIB A;  1X6N A;  2XP3 A;  1J4H A;  1ITX A;  3WD4 A;  1W1T A;  4Z2H A;  3UI4 A;  4QIB A;  1EDQ A;  2WM0 A;  2FKE A;  5DO2 A;  1D7I A;  4W9P A;  3WH0 A;  4WKA A;  1D6O A;  1D2K A;  4Z2L A;  1EYM A;  2XP4 A;  4PTM A;  4ODP A;  3O5E A;  4C02 B;  1W9U A;  2PBC A;  3O5L A;  1GPF A;  2LJ4 A;  4QT3 A;  2UZ5 A;  4Q7N A;  2Y78 A;  1QPL A;  2PI6 A;  1U79 A;  3CHE A;  3KAC A;  3PA7 A;  4WIW A;  4DIP A;  4MNM A;  1NMW A;  3B9A A;  1KT1 A;  1D7H A;  4ODN A;  2KR7 A;  3UI5 A;  1LG2 A;  1KT0 A;  1FKB A;  1TFV A;  1BKF A;  1E6Z A;  1OWQ A;  1NH6 A;  3WL0 A;  1QPF A;  2A3A A;  4DRO A;  4JFM A;  3O5R A;  3O5K A;  3RM4 A;  2ZQU A;  2DT3 A;  2VN1 A;  4DH0 A;  2ZR6 A;  2O92 A;  3KZ7 A;  3JYM A;  1ZBK A;  5HKG A;  2WLY A;  3WIJ A;  2MF9 A;  4JFL A;  1C9H A;  2OLH A;  5HBF A;  1FKR A;  3VAW A;  2RSE A;  4ZPV R;  3TDB A;  1ZCN A;  4MTV A;  2IF4 A;  3WQW A;  4NZC A;  2MLZ A;  3PRB A;  4J4O A;  4P8V A;  1Q1C A;  4GGQ A;  3KAG A;  2MNT A;  4HBE A;  3KAD A;  4DT4 A;  5DIU A;  3EY6 A;  1LL7 A;  2YBT A;  1VF8 A;  4JFJ A;  4LAX A;  2RUR A;  1HKJ A;  3IHZ A;  3UQA A;  1Y0O A;  2A3C A;  4HBO A;  1GUV A;  4KR0 B;  4N19 A;  3TC5 A;  1WB0 A;  3UQB A;  1NWR A;  3PRA A;  2DSW A;  1X6L A;  4ODQ A;  4WK9 A;  4JFK A;  4MSP A;  2DG9 A;  1A7X A;  1TCO C;  3OA5 A;  5B8I C;  2DT2 A;  1J6Y A;  4R5E A;  1W1V A;  1LJY A;  3ALG A;  1KFW A;  2RUQ A;  1W1P A;  2ZR5 A;  2WK2 A;  4DWS D;  3W4R A;  1NWU A;  4AY1 A;  3AS0 A;  1OGB A;  1HKK A;  4BF8 A;  4NNR A;  4DRH A;  1SYT A;  1R9H A;  2M1I A;  1J4R A;  4MNL A;  1H0G A;  3UI6 A;  2LPV A;  4MNJ A;  1T11 A;  2KFW A;  4JYS A;  4ML4 A;  2PV1 A;  5DEZ A;  5DF0 A;  1FFQ A;  4DRQ A;  2F2D A;  2ITK A;  3CHC A;  4TW8 A;  2ESC A;  2XP7 A;  4ITZ A;  1Q6H A;  3WD1 A;  2ZQT A;  2WLZ A;  2ZQS A;  2AWG A;  4P8U A;  5DIV A;  3G6M A;  2F21 A;  3H9R B;  3AS2 A;  2RUD A;  4DWS B;  1L1P A;  1W9P A;  3CGM A;  5HWC A;  4MPK A;  3AS3 A;  2KE0 A;  4Z2K A;  4DWS A;  5J6E A;  3O5Q A;  1FKI A;  4S3K A;  5HW7 A;  2D9F A;  4L3N A;  3O5I A;  3CZ8 A;  4IT6 A;  4GIV A;  1W26 A;  2N87 A;  3CHF A;  1ZU8 A;  1FJD A;  4IQ2 A;  3RME A;  4WKH A;  1OGG A;  2KGJ A;  4ZPT R;  4P8W A;  3KAI A;  4W5U A;  4U84 A;  1FKS A;  4HAR A;  1F8A B;  1FKD A;  3ARP A;  3O5O A;  2XP9 A;  2DSV A;  4O2T A;  3ARS A;  2XPB A;  3ARU A;  1GOI A;  5D75 A;  3O5F A;  2AOS A;  1JVW A;  3PR9 A;  1LQ0 A;  1E9L A;  4L72 B;  1F40 A;  1EHN A;  3OOB A;  4QZV B;  3I6C A;  2XPA A;  3ARV A;  4DZ3 A;  2KO7 A;  3WL1 A;  3AQU A;  1FFR A;  3WD0 A;  2PV3 A;  2LKN A;  1FKF A;  4Z2J A;  3KAF A;  3B8S A;  4S3J A;  2L2S A;  1J4I A;  3O5D A;  5HW8 A;  4LAY A;  1Q6I A;  2DSU A;  2O9O A;  3BXW A;  1E6N A;  2DSZ A;  1M5Y A;  5HWB A;  3O5G A;  3NRK A;  4U86 A;  1FKJ A;  1JND A;  3WKZ A;  4FAP A;  4Z2G A;  3RGC A;  1HXV A;  1H0I A;  2YBU A;  4P8X A;  3B7X A;  4J4N A;  2F4E A;  3ART A;  1WNO A;  1XRV A;  5BXJ A;  1O6I A;  3CHD A;  1HJW A;  1JNE A;  1YW5 A;  4DRK A;  5I98 A;  1FD9 A;  1ZBW A;  1ZBV A;  1WAW A;  4LAW A;  2ZR4 A;  1QZ2 A;  1FKL A;  2DT1 A;  1E6R A;  3WD2 A;  1E15 A;  3LUO A;  1UR9 A;  2QF8 A;  5HUA A;  4ZPW R;  1PBK A;  4G2P A;  4IPX A;  4ODK A;  3B9D A;  4DRN A;  2MLX A;  1FKH A;  5HTG A;  2M08 A;  4KQZ A;  3O5P A;  2B31 A;  4LAV A;  1Q6U A;  2PPO A;  4Z2I A;  1ZBC A;  1XHG A;  1ZL1 A;  1ROT A;  1YAT A;  1D7J A;  1B6C A;  1NMV A;  3O5M A;  4W9Q A;  3G6L A;  1FKT A;  2KI3 A;  3GPK A;  1NWT A;  2RUC A;  2DG4 A;  4TYO A;  1RD6 A;  4DRP A;  2G8Z A;  1LL6 A;  2A3B A;  5GPG A;  2ZQV A;  3NI6 A;  3UF8 A;  3B9E A;  1N1A A;  1NSG A;  2MLY A;  1HKI A;  2DG3 A;  2FAP A;  2G41 A;  3FAP A;  2M2A A;  4TX0 A;  3ODK A;  4DRJ A;  3ARY A;  1HJV A;  4TW7 A;  1SR0 A;  4XAK A;  2Q5A A;  1ROU A;  5HW6 A;  1W9V A;  2A3E A;  2LGO A;  4W9O A;  4WKF A;  4DRM A;  3ARO A;  3CH9 A;  3ARZ A;  3ARW A;  3ARQ A;  2FDM A;  3WQV A;  2PPP A;  3RM8 A;  4QT2 A;  4FN2 A;  1JNT A;  1LG1 A;  3WD3 A;  5JH8 A;  3RM9 A;  2XP8 A;  1ZK6 A;  2JZV A;  2IUZ A;  3ARX A;  4TW6 A;  2DT0 A;  4IQC A;  2PV2 A;  3JYJ A;  4G50 A;  3FY1 A;  3MDY B;  1P5Q A;  2RQS A;  1FKK A;  3FXY A;  4Q22 A;  4DWS C;  3IKD A;  3IK8 A;  1PIN A;  1E6P A;  2OFN A;  2K8I A;  2XP5 A;  3O5J A;  1W1Y A;  1EQ3 A;  1FAP A;  3PRD A;  4NSB A;  4URI A;  3CGN A;  3ALF A;  1FKG A;  4IT4 A;  1HJX A;  1HKM A;  3UQI A;  1K9T A;  3TCZ A;  2XP6 A;  2MPH A;  3IKG A;  5GQB A;  4DZ2 A;  4JFI A;  1CTN A;  4MAV A;  2DPE A;  1ZB5 A;  3JXV A;  4U85 A;  4DRI A;  5HT1 A;  4MNK A;  5GPR A;  3KAH A;  4MGV A;  3QOK A;  1BL4 A;  4LGX A;  3KCE A;  4WJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...