4IQ2A

P21 crystal form of fkbp12.6
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
107
structure length
107
Chain Sequence
b'GVEIETISPGDGRTFPKKGQTVVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTITPDVAYGATGHPGVIPPNATLIFDVELLNLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1B
publication title Crystal structure and conformational flexibility of the unligated FK506-binding protein FKBP12.6.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 21
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4iq2A00
5DIUA 1D7JA 1NMVA 3PA7A 4TW8A 4JFMA 4LAWA 4DRJA 2KE0A 3JYJA 2UZ5A 2F2DA 4LAVA 4NNRA 1W26A 2XP3A 4ODQA 4DRHA 4DRMA 3LUOA 5DIVA 2KFWA 3CGNA 2D9FA 4TX0A 4QT2A 1TCOC 2LPVA 1YW5A 4LAYA 3UF8A 5HW7A 1FKBA 3WH0A 1FKGA 2K8IA 4DRNA 3UQBA 3O5MA 4JFJA 2RUCA 1Q6UA 3PRBA 1NMWA 1FD9A 4JFIA 4TW7A 4W9OA 1J4IA 2Q5AA 3O5IA 2LGOA 3H9RB 3KAHA 4DT4A 4ODRA 4ODMA 1F8AB 2MPHA 2XP6A 5HKGA 4TW6A 2ZR5A 1BKFA 3TDBA 5HTGA 1FJDA 2RURA 2XP7A 4JFLA 3GPKA 3O5RA 1FKHA 2N87A 4W9QA 4C02B 1NSGA 2MLXA 2ZQTA 1R9HA 3O5KA 3O5FA 3RGCA 1P5QA 1PINA 1EYMA 1FKSA 3KADA 3NRKA 4BF8A 2DG4A 3O5OA 4ODLA 1C9HA 1A7XA 5D75A 2VCDA 3KABA 4R0XA 1BL4A 1FKDA 4DZ2A 2FKEA 2XPBA 3IHZA 3O5EA 4ODNA 1Q6HA 4FN2A 4GGQA 1J4HA 1Y0OA 2ITKA 1J4RA 1FKIA 1QPLA 2XP9A 2PV3A 3FAPA 3I6CA 2KO7A 2MLZA 3KCEA 5B8IC 4IPXA 4N19A 5HWCA 1ZCNA 4J4OA 4DRPA 5BXJA 4TYOA 4DIPA 5I98A 4ODPA 4DRKA 4O2TA 1EQ3A 2MF9A 4DZ3A 5J6EA 1ROUA 3MDYB 4ITZA 2PV2A 3O5LA 3PRDA 4DH0A 3ODKA 2RQSA 5HUAA 4U86A 2ZR6A 3UI5A 5GPGA 3UI4A 1B6CA 1FKJA 1Q1CA 2LKNA 2M2AA 2PPNA 2ZR4A 3KAIA 3KAFA 3IK8A 2XPAA 4IQ2A 4QIBA 3NTPA 4U84A 4U85A 5HT1A 4DROA 4DRQA 2PV1A 2XP8A 3O5JA 3O5DA 2Y78A 2L2SA 3KACA 1JNTA 1L1PA 4DRIA 1D7IA 1PBKA 2KGJA 1JVWA 4ODOA 1F40A 1FKFA 2RUDA 1J6YA 2RUQA 3OOBA 1FKKA 4QT3A 2ZQVA 3JYMA 2MLYA 1ROTA 2VN1A 2M08A 1FAPA 3VAWA 1Q6IA 1FKLA 5HW6A 2DG9A 4GIVA 2PPOA 3KAGA 2F4EA 4J4NA 1D6OA 1HXVA 4TNSA 3TC5A 2ZQUA 1U79A 4W9PA 2LJ4A 4MGVA 1FKTA 1ZK6A 3KZ7A 3IKDA 2JZVA 3O5QA 2RSEA 2XP5A 1QPFA 3CGMA 3EY6A 2F21A 3O5PA 1QZ2A 4JYSA 4JFKA 4MSPA 1FKRA 4G50A 1D7HA 1M5YA 3O5GA 2PBCA 4IQCA 1YATA 3UI6A 2MNTA 1T11A 2IF4A 1JNSA 2DG3A 1N1AA 2OFNA 4G2PA 1KT1A 2AWGA 3IKGA 5DITA 2PPPA 4ODKA 3TCZA 2KI3A 2ZQSA 2M1IA 3JXVA 3UQIA 3UQAA 2FAPA 3NI6A 4FAPA 5HWBA 2XP4A 3RFWA 3B7XA 1KT0A 4LAXA 2KR7A 5HW8A
chains in the Genus database with same CATH superfamily
1D7JA 3PA7A 3AS3A 4TW8A 2WLZA 4ZPVR 2DT3A 2QF8A 4KR0B 2UZ5A 1XRVA 1W26A 4DRMA 2A3EA 5GPRA 1YW5A 3AROA 2OLHA 3O5MA 2RUCA 3PRBA 1NMWA 4W9OA 3WL0A 3ARSA 3WD3A 1LL6A 4DT4A 1GOIA 1HKIA 2RURA 1E15A 3RM8A 2N87A 4HARA 3O5FA 1PINA 4W5UA 2G41A 4ODLA 1C9HA 1A7XA 3KABA 1FKDA 2XPBA 3O5EA 3FAPA 5B8IC 3KCEA 3ARUA 5HWCA 3AS2A 1W1TA 4J4OA 1ZBKA 3MDYB 4XAKA 5GPGA 1B6CA 2B31A 2LKNA 2PPNA 1EIBA 3WD4A 4DROA 4U84A 2XP8A 1LQ0A 4DRIA 1JVWA 4ODOA 1EDQA 2RUDA 2RUQA 3JYMA 1NH6A 3ARXA 1SR0A 4ZPWR 1WB0A 5DF0A 2M08A 2PN0A 3PR9A 1IX5A 4GIVA 2PPOA 4J4NA 1EHNA 2ZQUA 4MGVA 1FKTA 2RSEA 2XP5A 2F21A 4JFKA 1W9VA 2P4VA 3WKZA 2A3BA 3WD2A 4PTMA 2MNTA 2DG3A 5DITA 2PPPA 1O6IA 2DSZA 3JXVA 3AQUA 3UQIA 3B9EA 5HWBA 1OGBA 1KT0A 1FFRA 4ZS6A 3AS0A 2EULA 2YBTA 2KFWA 1HJVA 4TX0A 4QT2A 3B9DA 3ALGA 4LAYA 3WH0A 4DRNA 3G6LA 1GPFA 5HBFA 1HKJA 4JFIA 1FD9A 4TW7A 2Q5AA 3H9RB 4ODRA 1F8AB 2MPHA 3RMEA 2ZR5A 2A3CA 2XP7A 3O5RA 3RM9A 1W9PA 1P5QA 3B9AA 1EYMA 1FKSA 1WAWA 1BL4A 4DZ2A 2WK2A 3B8SA 3G6MA 4UDMA 1Q6HA 4FN2A 1J4HA 1Y0OA 1J4RA 2FDMA 3I6CA 2XP9A 4P8UA 2KO7A 1NWRA 1X6LA 1ZCNA 3CHEA 4DRPA 4TYOA 4ODPA 4DRKA 2MF9A 4DZ3A 4ITZA 4DH0A 3AS1A 2DSVA 4URIA 4IT6A 4S3KA 4QZVB 2ZR6A 3KAIA 2ZR4A 2DT2A 3FXYA 3IK8A 4MPKA 3NTPA 4U85A 4DRQA 4P8XA 2PI6A 3WQVA 1L1PA 1D7IA 1HKMA 1X6NA 1LJYA 1J6YA 4DWSC 1UR8A 3OOBA 4QT3A 1E6ZA 2MLYA 4ML4A 4MTVA 1HJXA 3VAWA 5HW6A 2DG9A 3W4RA 1H0IA 2F4EA 4TNSA 1OGGA 4Q7NA 1ZK6A 3O5QA 3EY6A 4Z2KA 4JYSA 1W1PA 2G8ZA 1D7HA 3O5GA 2PBCA 1H0GA 3UI6A 5DEZA 1T11A 2IF4A 1N1AA 1KT1A 4L3NA 1JCHB 2KI3A 2ZQSA 2M1IA 3B7XA 3ARPA 1ZBCA 1FFQA 3BXWA 2KE0A 4P8WA 4ODQA 2F2DA 4NNRA 3OA5A 2LPVA 3UF8A 1FKBA 1FKGA 4JFJA 3FY1A 1Q6UA 3O5IA 2LGOA 3ARVA 4TW6A 1BKFA 4L72B 5HTGA 1FJDA 1RD6A 4R5EA 4Z2GA 2WLYA 4S3JA 4W9QA 1GRJA 2DSUA 2MLXA 2ZQTA 4WJXA 3RGCA 3ARYA 3KADA 4BF8A 3O5OA 2F23A 4R0XA 3WIJA 1HJWA 3IHZA 4ODNA 2ITKA 1NWUA 2MLZA 1ZU8A 4IPXA 1LG2A 1ZBWA 4DWSD 5BXJA 4DIPA 1E6PA 1OWQA 1E6NA 3ARQA 3ALFA 5J6EA 1JNEA 1ROUA 3O5LA 3ARTA 1TFVA 3WQWA 3ARWA 3CZ8A 3UI4A 2M2AA 2DT1A 4QIBA 4MNLA 4HBEA 5HT1A 1LL4A 3O5DA 4WIWA 3ARZA 2L2SA 1JNTA 1XHGA 1F40A 1ZBVA 2A3AA 1FKKA 4Z2LA 1ROTA 1GUVA 1FAPA 1Q6IA 1NWSA 3KAGA 1D6OA 4MNKA 3PRAA 1K9TA 1U79A 3WL1A 3KZ7A 4Q22A 1QPFA 1FKRA 4LGXA 4MSPA 1QZ2A 4ZPTR 3WD1A 4MAVA 1M5YA 3CHDA 1HKKA 1YATA 2DT0A 3EIPA 2OFNA 4G2PA 1VF8A 4ODKA 3TCZA 4WKAA 1W1YA 3UQAA 3NI6A 2XP4A 1KFWA 4LAXA 2KR7A 4Z2JA 1WNOA 5DIUA 1NMVA 3WD0A 4JFMA 4LAWA 4DRJA 2O92A 3JYJA 2ESCA 4LAVA 4DRHA 2XP3A 3LUOA 4WKFA 5DIVA 2DPEA 3CGNA 2D9FA 1TCOC 3GTYX 5HW7A 4P8VA 4DWSA 2K8IA 3UQBA 1J4IA 2O9OA 4IT4A 3KAHA 2WM0A 3CHFA 1W1VA 4ODMA 2XP6A 5HKGA 1UR9A 1W9UA 1CTNA 4JFLA 3GPKA 5JH8A 1D2KA 1FKHA 4C02B 1NSGA 3O5KA 1R9HA 2AOSA 4HBOA 3NRKA 1E6RA 2DG4A 5D75A 2VCDA 2FKEA 1LG1A 4MNMA 3GU0A 4DWSB 3BMBA 3RM4A 4GGQA 4O2TA 3TDBA 1QPLA 1FKIA 2PV3A 4N19A 1E9LA 5I98A 3ARRA 1EQ3A 2IUZA 4Z2IA 1LL7A 2PV2A 3PRDA 3ODKA 2RQSA 5HUAA 4U86A 4WK9A 3UI5A 4Z2HA 2YBUA 1FKJA 3KAFA 1Q1CA 4NSBA 2XPAA 4IQ2A 1JNDA 2PV1A 3O5JA 2B5UB 2Y78A 3KACA 1PBKA 2KGJA 4KQZA 1FKFA 1ZB5A 2ZQVA 2ETNA 1SYTA 2VN1A 5DO2A 1FKLA 1ITXA 4MNJA 1HXVA 1NWTA 3TC5A 3QOKA 4W9PA 2DSWA 2LJ4A 3IKDA 2JZVA 4NZCA 3CGMA 3O5PA 3CHCA 4G50A 4IQCA 1JNSA 4AY1A 4WKHA 2AWGA 3IKGA 1ZL1A 5GQBA 3CH9A 1E44A 2FAPA 4FAPA 3RFWA 5HW8A
chains in the Genus database with same CATH topology
1D7JA 3PA7A 3AS3A 4TW8A 2WLZA 4ZPVR 2DT3A 2QF8A 4KR0B 2UZ5A 1XRVA 1W26A 4DRMA 2A3EA 5GPRA 1YW5A 3AROA 2OLHA 3O5MA 2RUCA 3PRBA 1NMWA 4W9OA 3WL0A 3ARSA 3WD3A 1LL6A 4DT4A 1GOIA 1HKIA 2RURA 1E15A 3RM8A 2N87A 4HARA 3O5FA 1PINA 4W5UA 2G41A 4ODLA 1C9HA 1A7XA 3KABA 1FKDA 2XPBA 3O5EA 3FAPA 5B8IC 3KCEA 3ARUA 5HWCA 3AS2A 1W1TA 4J4OA 1ZBKA 3MDYB 4XAKA 5GPGA 1B6CA 2B31A 2LKNA 2PPNA 1EIBA 3WD4A 4DROA 4U84A 2XP8A 1LQ0A 4DRIA 1JVWA 4ODOA 1EDQA 2RUDA 2RUQA 3JYMA 1NH6A 3ARXA 1SR0A 4ZPWR 1WB0A 5DF0A 2M08A 3PR9A 1IX5A 4GIVA 2PPOA 4J4NA 1EHNA 2ZQUA 4MGVA 1FKTA 2RSEA 2XP5A 2F21A 4JFKA 1W9VA 3WKZA 2A3BA 3WD2A 4PTMA 2MNTA 2DG3A 5DITA 2PPPA 1O6IA 2DSZA 3JXVA 3AQUA 3UQIA 3B9EA 5HWBA 1OGBA 1KT0A 1FFRA 4ZS6A 3AS0A 2YBTA 2KFWA 1HJVA 4TX0A 4QT2A 3B9DA 3ALGA 4LAYA 3WH0A 4DRNA 3G6LA 1GPFA 5HBFA 1HKJA 4JFIA 1FD9A 4TW7A 2Q5AA 3H9RB 4ODRA 1F8AB 2MPHA 3RMEA 2ZR5A 2A3CA 2XP7A 3O5RA 3RM9A 1W9PA 1P5QA 3B9AA 1EYMA 1FKSA 1WAWA 1BL4A 4DZ2A 2WK2A 3B8SA 3G6MA 1Q6HA 4FN2A 1J4HA 1Y0OA 1J4RA 2FDMA 3I6CA 2XP9A 4P8UA 2KO7A 1NWRA 1X6LA 1ZCNA 3CHEA 4DRPA 4TYOA 4ODPA 4DRKA 2MF9A 4DZ3A 4ITZA 4DH0A 3AS1A 2DSVA 4URIA 4IT6A 4S3KA 4QZVB 2ZR6A 3KAIA 2ZR4A 2DT2A 3FXYA 3IK8A 4MPKA 3NTPA 4U85A 4DRQA 4P8XA 2PI6A 3WQVA 1L1PA 1D7IA 1HKMA 1X6NA 1LJYA 1J6YA 4DWSC 1UR8A 3OOBA 4QT3A 1E6ZA 2MLYA 4ML4A 4MTVA 1HJXA 3VAWA 5HW6A 2DG9A 3W4RA 1H0IA 2F4EA 4TNSA 1OGGA 4Q7NA 1ZK6A 3O5QA 3EY6A 4Z2KA 4JYSA 1W1PA 2G8ZA 1D7HA 3O5GA 2PBCA 1H0GA 3UI6A 5DEZA 1T11A 2IF4A 1N1AA 1KT1A 4L3NA 2KI3A 2ZQSA 2M1IA 3B7XA 3ARPA 1ZBCA 1FFQA 3BXWA 2KE0A 4P8WA 4ODQA 2F2DA 4NNRA 3OA5A 2LPVA 3UF8A 1FKBA 1FKGA 4JFJA 3FY1A 1Q6UA 3O5IA 2LGOA 3ARVA 4TW6A 1BKFA 4L72B 5HTGA 1FJDA 1RD6A 4R5EA 4Z2GA 2WLYA 4S3JA 4W9QA 2DSUA 2MLXA 2ZQTA 4WJXA 3RGCA 3ARYA 3KADA 4BF8A 3O5OA 4R0XA 3WIJA 1HJWA 3IHZA 4ODNA 2ITKA 1NWUA 2MLZA 1ZU8A 4IPXA 1LG2A 1ZBWA 4DWSD 5BXJA 4DIPA 1E6PA 1OWQA 1E6NA 3ARQA 3ALFA 5J6EA 1JNEA 1ROUA 3O5LA 3ARTA 1TFVA 3WQWA 3ARWA 3CZ8A 3UI4A 2M2AA 2DT1A 4QIBA 4MNLA 4HBEA 5HT1A 1LL4A 3O5DA 4WIWA 3ARZA 2L2SA 1JNTA 1XHGA 1F40A 1ZBVA 2A3AA 1FKKA 4Z2LA 1ROTA 1GUVA 1FAPA 1Q6IA 1NWSA 3KAGA 1D6OA 4MNKA 3PRAA 1K9TA 1U79A 3WL1A 3KZ7A 4Q22A 1QPFA 1FKRA 4LGXA 4MSPA 1QZ2A 4ZPTR 3WD1A 4MAVA 1M5YA 3CHDA 1HKKA 1YATA 2DT0A 2OFNA 4G2PA 1VF8A 4ODKA 3TCZA 4WKAA 1W1YA 3UQAA 3NI6A 2XP4A 1KFWA 4LAXA 2KR7A 4Z2JA 1WNOA 5DIUA 1NMVA 3WD0A 4JFMA 4LAWA 4DRJA 2O92A 3JYJA 2ESCA 4LAVA 4DRHA 2XP3A 3LUOA 4WKFA 5DIVA 2DPEA 3CGNA 2D9FA 1TCOC 5HW7A 4P8VA 4DWSA 2K8IA 3UQBA 1J4IA 2O9OA 4IT4A 3KAHA 2WM0A 3CHFA 1W1VA 4ODMA 2XP6A 5HKGA 1UR9A 1W9UA 1CTNA 4JFLA 3GPKA 5JH8A 1D2KA 1FKHA 4C02B 1NSGA 3O5KA 1R9HA 2AOSA 4HBOA 3NRKA 1E6RA 2DG4A 5D75A 2VCDA 2FKEA 1LG1A 4MNMA 4DWSB 3RM4A 4GGQA 4O2TA 3TDBA 1QPLA 1FKIA 2PV3A 4N19A 1E9LA 5I98A 3ARRA 1EQ3A 2IUZA 4Z2IA 1LL7A 2PV2A 3PRDA 3ODKA 2RQSA 5HUAA 4U86A 4WK9A 3UI5A 4Z2HA 2YBUA 1FKJA 3KAFA 1Q1CA 4NSBA 2XPAA 4IQ2A 1JNDA 2PV1A 3O5JA 2Y78A 3KACA 1PBKA 2KGJA 4KQZA 1FKFA 1ZB5A 2ZQVA 1SYTA 2VN1A 5DO2A 1FKLA 1ITXA 4MNJA 1HXVA 1NWTA 3TC5A 3QOKA 4W9PA 2DSWA 2LJ4A 3IKDA 2JZVA 4NZCA 3CGMA 3O5PA 3CHCA 4G50A 4IQCA 1JNSA 4AY1A 4WKHA 2AWGA 3IKGA 1ZL1A 5GQBA 3CH9A 2FAPA 4FAPA 3RFWA 5HW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DIU A;  1D7J A;  1NMV A;  3PA7 A;  4TW8 A;  4JFM A;  4LAW A;  4DRJ A;  2KE0 A;  3JYJ A;  2UZ5 A;  2F2D A;  4LAV A;  4NNR A;  1W26 A;  2XP3 A;  4ODQ A;  4DRH A;  4DRM A;  3LUO A;  5DIV A;  2KFW A;  3CGN A;  2D9F A;  4TX0 A;  4QT2 A;  1TCO C;  2LPV A;  1YW5 A;  4LAY A;  3UF8 A;  5HW7 A;  1FKB A;  3WH0 A;  1FKG A;  2K8I A;  4DRN A;  3UQB A;  3O5M A;  4JFJ A;  2RUC A;  1Q6U A;  3PRB A;  1NMW A;  1FD9 A;  4JFI A;  4TW7 A;  4W9O A;  1J4I A;  2Q5A A;  3O5I A;  2LGO A;  3H9R B;  3KAH A;  4DT4 A;  4ODR A;  4ODM A;  1F8A B;  2MPH A;  2XP6 A;  5HKG A;  4TW6 A;  2ZR5 A;  1BKF A;  3TDB A;  5HTG A;  1FJD A;  2RUR A;  2XP7 A;  4JFL A;  3GPK A;  3O5R A;  1FKH A;  2N87 A;  4W9Q A;  4C02 B;  1NSG A;  2MLX A;  2ZQT A;  1R9H A;  3O5K A;  3O5F A;  3RGC A;  1P5Q A;  1PIN A;  1EYM A;  1FKS A;  3KAD A;  3NRK A;  4BF8 A;  2DG4 A;  3O5O A;  4ODL A;  1C9H A;  1A7X A;  5D75 A;  2VCD A;  3KAB A;  4R0X A;  1BL4 A;  1FKD A;  4DZ2 A;  2FKE A;  2XPB A;  3IHZ A;  3O5E A;  4ODN A;  1Q6H A;  4FN2 A;  4GGQ A;  1J4H A;  1Y0O A;  2ITK A;  1J4R A;  1FKI A;  1QPL A;  2XP9 A;  2PV3 A;  3FAP A;  3I6C A;  2KO7 A;  2MLZ A;  3KCE A;  5B8I C;  4IPX A;  4N19 A;  5HWC A;  1ZCN A;  4J4O A;  4DRP A;  5BXJ A;  4TYO A;  4DIP A;  5I98 A;  4ODP A;  4DRK A;  4O2T A;  1EQ3 A;  2MF9 A;  4DZ3 A;  5J6E A;  1ROU A;  3MDY B;  4ITZ A;  2PV2 A;  3O5L A;  3PRD A;  4DH0 A;  3ODK A;  2RQS A;  5HUA A;  4U86 A;  2ZR6 A;  3UI5 A;  5GPG A;  3UI4 A;  1B6C A;  1FKJ A;  1Q1C A;  2LKN A;  2M2A A;  2PPN A;  2ZR4 A;  3KAI A;  3KAF A;  3IK8 A;  2XPA A;  4IQ2 A;  4QIB A;  3NTP A;  4U84 A;  4U85 A;  5HT1 A;  4DRO A;  4DRQ A;  2PV1 A;  2XP8 A;  3O5J A;  3O5D A;  2Y78 A;  2L2S A;  3KAC A;  1JNT A;  1L1P A;  4DRI A;  1D7I A;  1PBK A;  2KGJ A;  1JVW A;  4ODO A;  1F40 A;  1FKF A;  2RUD A;  1J6Y A;  2RUQ A;  3OOB A;  1FKK A;  4QT3 A;  2ZQV A;  3JYM A;  2MLY A;  1ROT A;  2VN1 A;  2M08 A;  1FAP A;  3VAW A;  1Q6I A;  1FKL A;  5HW6 A;  2DG9 A;  4GIV A;  2PPO A;  3KAG A;  2F4E A;  4J4N A;  1D6O A;  1HXV A;  4TNS A;  3TC5 A;  2ZQU A;  1U79 A;  4W9P A;  2LJ4 A;  4MGV A;  1FKT A;  1ZK6 A;  3KZ7 A;  3IKD A;  2JZV A;  3O5Q A;  2RSE A;  2XP5 A;  1QPF A;  3CGM A;  3EY6 A;  2F21 A;  3O5P A;  1QZ2 A;  4JYS A;  4JFK A;  4MSP A;  1FKR A;  4G50 A;  1D7H A;  1M5Y A;  3O5G A;  2PBC A;  4IQC A;  1YAT A;  3UI6 A;  2MNT A;  1T11 A;  2IF4 A;  1JNS A;  2DG3 A;  1N1A A;  2OFN A;  4G2P A;  1KT1 A;  2AWG A;  3IKG A;  5DIT A;  2PPP A;  4ODK A;  3TCZ A;  2KI3 A;  2ZQS A;  2M1I A;  3JXV A;  3UQI A;  3UQA A;  2FAP A;  3NI6 A;  4FAP A;  5HWB A;  2XP4 A;  3RFW A;  3B7X A;  1KT0 A;  4LAX A;  2KR7 A;  5HW8 A; 
#chains in the Genus database with same CATH topology
 1D7J A;  3PA7 A;  3AS3 A;  4TW8 A;  2WLZ A;  4ZPV R;  2DT3 A;  2QF8 A;  4KR0 B;  2UZ5 A;  1XRV A;  1W26 A;  4DRM A;  2A3E A;  5GPR A;  1YW5 A;  3ARO A;  2OLH A;  3O5M A;  2RUC A;  3PRB A;  1NMW A;  4W9O A;  3WL0 A;  3ARS A;  3WD3 A;  1LL6 A;  4DT4 A;  1GOI A;  1HKI A;  2RUR A;  1E15 A;  3RM8 A;  2N87 A;  4HAR A;  3O5F A;  1PIN A;  4W5U A;  2G41 A;  4ODL A;  1C9H A;  1A7X A;  3KAB A;  1FKD A;  2XPB A;  3O5E A;  3FAP A;  5B8I C;  3KCE A;  3ARU A;  5HWC A;  3AS2 A;  1W1T A;  4J4O A;  1ZBK A;  3MDY B;  4XAK A;  5GPG A;  1B6C A;  2B31 A;  2LKN A;  2PPN A;  1EIB A;  3WD4 A;  4DRO A;  4U84 A;  2XP8 A;  1LQ0 A;  4DRI A;  1JVW A;  4ODO A;  1EDQ A;  2RUD A;  2RUQ A;  3JYM A;  1NH6 A;  3ARX A;  1SR0 A;  4ZPW R;  1WB0 A;  5DF0 A;  2M08 A;  2PN0 A;  3PR9 A;  1IX5 A;  4GIV A;  2PPO A;  4J4N A;  1EHN A;  2ZQU A;  4MGV A;  1FKT A;  2RSE A;  2XP5 A;  2F21 A;  4JFK A;  1W9V A;  2P4V A;  3WKZ A;  2A3B A;  3WD2 A;  4PTM A;  2MNT A;  2DG3 A;  5DIT A;  2PPP A;  1O6I A;  2DSZ A;  3JXV A;  3AQU A;  3UQI A;  3B9E A;  5HWB A;  1OGB A;  1KT0 A;  1FFR A;  4ZS6 A;  3AS0 A;  2EUL A;  2YBT A;  2KFW A;  1HJV A;  4TX0 A;  4QT2 A;  3B9D A;  3ALG A;  4LAY A;  3WH0 A;  4DRN A;  3G6L A;  1GPF A;  5HBF A;  1HKJ A;  4JFI A;  1FD9 A;  4TW7 A;  2Q5A A;  3H9R B;  4ODR A;  1F8A B;  2MPH A;  3RME A;  2ZR5 A;  2A3C A;  2XP7 A;  3O5R A;  3RM9 A;  1W9P A;  1P5Q A;  3B9A A;  1EYM A;  1FKS A;  1WAW A;  1BL4 A;  4DZ2 A;  2WK2 A;  3B8S A;  3G6M A;  4UDM A;  1Q6H A;  4FN2 A;  1J4H A;  1Y0O A;  1J4R A;  2FDM A;  3I6C A;  2XP9 A;  4P8U A;  2KO7 A;  1NWR A;  1X6L A;  1ZCN A;  3CHE A;  4DRP A;  4TYO A;  4ODP A;  4DRK A;  2MF9 A;  4DZ3 A;  4ITZ A;  4DH0 A;  3AS1 A;  2DSV A;  4URI A;  4IT6 A;  4S3K A;  4QZV B;  2ZR6 A;  3KAI A;  2ZR4 A;  2DT2 A;  3FXY A;  3IK8 A;  4MPK A;  3NTP A;  4U85 A;  4DRQ A;  4P8X A;  2PI6 A;  3WQV A;  1L1P A;  1D7I A;  1HKM A;  1X6N A;  1LJY A;  1J6Y A;  4DWS C;  1UR8 A;  3OOB A;  4QT3 A;  1E6Z A;  2MLY A;  4ML4 A;  4MTV A;  1HJX A;  3VAW A;  5HW6 A;  2DG9 A;  3W4R A;  1H0I A;  2F4E A;  4TNS A;  1OGG A;  4Q7N A;  1ZK6 A;  3O5Q A;  3EY6 A;  4Z2K A;  4JYS A;  1W1P A;  2G8Z A;  1D7H A;  3O5G A;  2PBC A;  1H0G A;  3UI6 A;  5DEZ A;  1T11 A;  2IF4 A;  1N1A A;  1KT1 A;  4L3N A;  1JCH B;  2KI3 A;  2ZQS A;  2M1I A;  3B7X A;  3ARP A;  1ZBC A;  1FFQ A;  3BXW A;  2KE0 A;  4P8W A;  4ODQ A;  2F2D A;  4NNR A;  3OA5 A;  2LPV A;  3UF8 A;  1FKB A;  1FKG A;  4JFJ A;  3FY1 A;  1Q6U A;  3O5I A;  2LGO A;  3ARV A;  4TW6 A;  1BKF A;  4L72 B;  5HTG A;  1FJD A;  1RD6 A;  4R5E A;  4Z2G A;  2WLY A;  4S3J A;  4W9Q A;  1GRJ A;  2DSU A;  2MLX A;  2ZQT A;  4WJX A;  3RGC A;  3ARY A;  3KAD A;  4BF8 A;  3O5O A;  2F23 A;  4R0X A;  3WIJ A;  1HJW A;  3IHZ A;  4ODN A;  2ITK A;  1NWU A;  2MLZ A;  1ZU8 A;  4IPX A;  1LG2 A;  1ZBW A;  4DWS D;  5BXJ A;  4DIP A;  1E6P A;  1OWQ A;  1E6N A;  3ARQ A;  3ALF A;  5J6E A;  1JNE A;  1ROU A;  3O5L A;  3ART A;  1TFV A;  3WQW A;  3ARW A;  3CZ8 A;  3UI4 A;  2M2A A;  2DT1 A;  4QIB A;  4MNL A;  4HBE A;  5HT1 A;  1LL4 A;  3O5D A;  4WIW A;  3ARZ A;  2L2S A;  1JNT A;  1XHG A;  1F40 A;  1ZBV A;  2A3A A;  1FKK A;  4Z2L A;  1ROT A;  1GUV A;  1FAP A;  1Q6I A;  1NWS A;  3KAG A;  1D6O A;  4MNK A;  3PRA A;  1K9T A;  1U79 A;  3WL1 A;  3KZ7 A;  4Q22 A;  1QPF A;  1FKR A;  4LGX A;  4MSP A;  1QZ2 A;  4ZPT R;  3WD1 A;  4MAV A;  1M5Y A;  3CHD A;  1HKK A;  1YAT A;  2DT0 A;  3EIP A;  2OFN A;  4G2P A;  1VF8 A;  4ODK A;  3TCZ A;  4WKA A;  1W1Y A;  3UQA A;  3NI6 A;  2XP4 A;  1KFW A;  4LAX A;  2KR7 A;  4Z2J A;  1WNO A;  5DIU A;  1NMV A;  3WD0 A;  4JFM A;  4LAW A;  4DRJ A;  2O92 A;  3JYJ A;  2ESC A;  4LAV A;  4DRH A;  2XP3 A;  3LUO A;  4WKF A;  5DIV A;  2DPE A;  3CGN A;  2D9F A;  1TCO C;  3GTY X;  5HW7 A;  4P8V A;  4DWS A;  2K8I A;  3UQB A;  1J4I A;  2O9O A;  4IT4 A;  3KAH A;  2WM0 A;  3CHF A;  1W1V A;  4ODM A;  2XP6 A;  5HKG A;  1UR9 A;  1W9U A;  1CTN A;  4JFL A;  3GPK A;  5JH8 A;  1D2K A;  1FKH A;  4C02 B;  1NSG A;  3O5K A;  1R9H A;  2AOS A;  4HBO A;  3NRK A;  1E6R A;  2DG4 A;  5D75 A;  2VCD A;  2FKE A;  1LG1 A;  4MNM A;  3GU0 A;  4DWS B;  3BMB A;  3RM4 A;  4GGQ A;  4O2T A;  3TDB A;  1QPL A;  1FKI A;  2PV3 A;  4N19 A;  1E9L A;  5I98 A;  3ARR A;  1EQ3 A;  2IUZ A;  4Z2I A;  1LL7 A;  2PV2 A;  3PRD A;  3ODK A;  2RQS A;  5HUA A;  4U86 A;  4WK9 A;  3UI5 A;  4Z2H A;  2YBU A;  1FKJ A;  3KAF A;  1Q1C A;  4NSB A;  2XPA A;  4IQ2 A;  1JND A;  2PV1 A;  3O5J A;  2B5U B;  2Y78 A;  3KAC A;  1PBK A;  2KGJ A;  4KQZ A;  1FKF A;  1ZB5 A;  2ZQV A;  2ETN A;  1SYT A;  2VN1 A;  5DO2 A;  1FKL A;  1ITX A;  4MNJ A;  1HXV A;  1NWT A;  3TC5 A;  3QOK A;  4W9P A;  2DSW A;  2LJ4 A;  3IKD A;  2JZV A;  4NZC A;  3CGM A;  3O5P A;  3CHC A;  4G50 A;  4IQC A;  1JNS A;  4AY1 A;  4WKH A;  2AWG A;  3IKG A;  1ZL1 A;  5GQB A;  3CH9 A;  1E44 A;  2FAP A;  4FAP A;  3RFW A;  5HW8 A; 
#chains in the Genus database with same CATH homology
 1D7J A;  3PA7 A;  3AS3 A;  4TW8 A;  2WLZ A;  4ZPV R;  2DT3 A;  2QF8 A;  4KR0 B;  2UZ5 A;  1XRV A;  1W26 A;  4DRM A;  2A3E A;  5GPR A;  1YW5 A;  3ARO A;  2OLH A;  3O5M A;  2RUC A;  3PRB A;  1NMW A;  4W9O A;  3WL0 A;  3ARS A;  3WD3 A;  1LL6 A;  4DT4 A;  1GOI A;  1HKI A;  2RUR A;  1E15 A;  3RM8 A;  2N87 A;  4HAR A;  3O5F A;  1PIN A;  4W5U A;  2G41 A;  4ODL A;  1C9H A;  1A7X A;  3KAB A;  1FKD A;  2XPB A;  3O5E A;  3FAP A;  5B8I C;  3KCE A;  3ARU A;  5HWC A;  3AS2 A;  1W1T A;  4J4O A;  1ZBK A;  3MDY B;  4XAK A;  5GPG A;  1B6C A;  2B31 A;  2LKN A;  2PPN A;  1EIB A;  3WD4 A;  4DRO A;  4U84 A;  2XP8 A;  1LQ0 A;  4DRI A;  1JVW A;  4ODO A;  1EDQ A;  2RUD A;  2RUQ A;  3JYM A;  1NH6 A;  3ARX A;  1SR0 A;  4ZPW R;  1WB0 A;  5DF0 A;  2M08 A;  3PR9 A;  1IX5 A;  4GIV A;  2PPO A;  4J4N A;  1EHN A;  2ZQU A;  4MGV A;  1FKT A;  2RSE A;  2XP5 A;  2F21 A;  4JFK A;  1W9V A;  3WKZ A;  2A3B A;  3WD2 A;  4PTM A;  2MNT A;  2DG3 A;  5DIT A;  2PPP A;  1O6I A;  2DSZ A;  3JXV A;  3AQU A;  3UQI A;  3B9E A;  5HWB A;  1OGB A;  1KT0 A;  1FFR A;  4ZS6 A;  3AS0 A;  2YBT A;  2KFW A;  1HJV A;  4TX0 A;  4QT2 A;  3B9D A;  3ALG A;  4LAY A;  3WH0 A;  4DRN A;  3G6L A;  1GPF A;  5HBF A;  1HKJ A;  4JFI A;  1FD9 A;  4TW7 A;  2Q5A A;  3H9R B;  4ODR A;  1F8A B;  2MPH A;  3RME A;  2ZR5 A;  2A3C A;  2XP7 A;  3O5R A;  3RM9 A;  1W9P A;  1P5Q A;  3B9A A;  1EYM A;  1FKS A;  1WAW A;  1BL4 A;  4DZ2 A;  2WK2 A;  3B8S A;  3G6M A;  1Q6H A;  4FN2 A;  1J4H A;  1Y0O A;  1J4R A;  2FDM A;  3I6C A;  2XP9 A;  4P8U A;  2KO7 A;  1NWR A;  1X6L A;  1ZCN A;  3CHE A;  4DRP A;  4TYO A;  4ODP A;  4DRK A;  2MF9 A;  4DZ3 A;  4ITZ A;  4DH0 A;  3AS1 A;  2DSV A;  4URI A;  4IT6 A;  4S3K A;  4QZV B;  2ZR6 A;  3KAI A;  2ZR4 A;  2DT2 A;  3FXY A;  3IK8 A;  4MPK A;  3NTP A;  4U85 A;  4DRQ A;  4P8X A;  2PI6 A;  3WQV A;  1L1P A;  1D7I A;  1HKM A;  1X6N A;  1LJY A;  1J6Y A;  4DWS C;  1UR8 A;  3OOB A;  4QT3 A;  1E6Z A;  2MLY A;  4ML4 A;  4MTV A;  1HJX A;  3VAW A;  5HW6 A;  2DG9 A;  3W4R A;  1H0I A;  2F4E A;  4TNS A;  1OGG A;  4Q7N A;  1ZK6 A;  3O5Q A;  3EY6 A;  4Z2K A;  4JYS A;  1W1P A;  2G8Z A;  1D7H A;  3O5G A;  2PBC A;  1H0G A;  3UI6 A;  5DEZ A;  1T11 A;  2IF4 A;  1N1A A;  1KT1 A;  4L3N A;  2KI3 A;  2ZQS A;  2M1I A;  3B7X A;  3ARP A;  1ZBC A;  1FFQ A;  3BXW A;  2KE0 A;  4P8W A;  4ODQ A;  2F2D A;  4NNR A;  3OA5 A;  2LPV A;  3UF8 A;  1FKB A;  1FKG A;  4JFJ A;  3FY1 A;  1Q6U A;  3O5I A;  2LGO A;  3ARV A;  4TW6 A;  1BKF A;  4L72 B;  5HTG A;  1FJD A;  1RD6 A;  4R5E A;  4Z2G A;  2WLY A;  4S3J A;  4W9Q A;  2DSU A;  2MLX A;  2ZQT A;  4WJX A;  3RGC A;  3ARY A;  3KAD A;  4BF8 A;  3O5O A;  4R0X A;  3WIJ A;  1HJW A;  3IHZ A;  4ODN A;  2ITK A;  1NWU A;  2MLZ A;  1ZU8 A;  4IPX A;  1LG2 A;  1ZBW A;  4DWS D;  5BXJ A;  4DIP A;  1E6P A;  1OWQ A;  1E6N A;  3ARQ A;  3ALF A;  5J6E A;  1JNE A;  1ROU A;  3O5L A;  3ART A;  1TFV A;  3WQW A;  3ARW A;  3CZ8 A;  3UI4 A;  2M2A A;  2DT1 A;  4QIB A;  4MNL A;  4HBE A;  5HT1 A;  1LL4 A;  3O5D A;  4WIW A;  3ARZ A;  2L2S A;  1JNT A;  1XHG A;  1F40 A;  1ZBV A;  2A3A A;  1FKK A;  4Z2L A;  1ROT A;  1GUV A;  1FAP A;  1Q6I A;  1NWS A;  3KAG A;  1D6O A;  4MNK A;  3PRA A;  1K9T A;  1U79 A;  3WL1 A;  3KZ7 A;  4Q22 A;  1QPF A;  1FKR A;  4LGX A;  4MSP A;  1QZ2 A;  4ZPT R;  3WD1 A;  4MAV A;  1M5Y A;  3CHD A;  1HKK A;  1YAT A;  2DT0 A;  2OFN A;  4G2P A;  1VF8 A;  4ODK A;  3TCZ A;  4WKA A;  1W1Y A;  3UQA A;  3NI6 A;  2XP4 A;  1KFW A;  4LAX A;  2KR7 A;  4Z2J A;  1WNO A;  5DIU A;  1NMV A;  3WD0 A;  4JFM A;  4LAW A;  4DRJ A;  2O92 A;  3JYJ A;  2ESC A;  4LAV A;  4DRH A;  2XP3 A;  3LUO A;  4WKF A;  5DIV A;  2DPE A;  3CGN A;  2D9F A;  1TCO C;  5HW7 A;  4P8V A;  4DWS A;  2K8I A;  3UQB A;  1J4I A;  2O9O A;  4IT4 A;  3KAH A;  2WM0 A;  3CHF A;  1W1V A;  4ODM A;  2XP6 A;  5HKG A;  1UR9 A;  1W9U A;  1CTN A;  4JFL A;  3GPK A;  5JH8 A;  1D2K A;  1FKH A;  4C02 B;  1NSG A;  3O5K A;  1R9H A;  2AOS A;  4HBO A;  3NRK A;  1E6R A;  2DG4 A;  5D75 A;  2VCD A;  2FKE A;  1LG1 A;  4MNM A;  4DWS B;  3RM4 A;  4GGQ A;  4O2T A;  3TDB A;  1QPL A;  1FKI A;  2PV3 A;  4N19 A;  1E9L A;  5I98 A;  3ARR A;  1EQ3 A;  2IUZ A;  4Z2I A;  1LL7 A;  2PV2 A;  3PRD A;  3ODK A;  2RQS A;  5HUA A;  4U86 A;  4WK9 A;  3UI5 A;  4Z2H A;  2YBU A;  1FKJ A;  3KAF A;  1Q1C A;  4NSB A;  2XPA A;  4IQ2 A;  1JND A;  2PV1 A;  3O5J A;  2Y78 A;  3KAC A;  1PBK A;  2KGJ A;  4KQZ A;  1FKF A;  1ZB5 A;  2ZQV A;  1SYT A;  2VN1 A;  5DO2 A;  1FKL A;  1ITX A;  4MNJ A;  1HXV A;  1NWT A;  3TC5 A;  3QOK A;  4W9P A;  2DSW A;  2LJ4 A;  3IKD A;  2JZV A;  4NZC A;  3CGM A;  3O5P A;  3CHC A;  4G50 A;  4IQC A;  1JNS A;  4AY1 A;  4WKH A;  2AWG A;  3IKG A;  1ZL1 A;  5GQB A;  3CH9 A;  2FAP A;  4FAP A;  3RFW A;  5HW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...