4C02B

Crystal structure of human acvr1 (alk2) in complex with fkbp12.6 and dorsomorphin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Acvr1 (Alk2) in Complex with Fkbp12.6 And Dorsomorphin
rcsb
source organism Homo sapiens
molecule tags Transferase/isomerase
molecule keywords ACTIVIN RECEPTOR TYPE-1
total genus 24
structure length 108
sequence length 108
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4c02B00
1D7IA 3TDBA 4DZ2A 2LKNA 1F40A 2PPNA 4O2TA 2PV1A 2M08A 5BXJA 3KAFA 3O5LA 1J4IA 1Q1CA 3O5EA 2LJ4A 4U85A 2MLYA 1ZCNA 2XP7A 3GPKA 1D7HA 4MGVA 2MF9A 2ZR4A 2MNTA 1Q6UA 5DIVA 1ROUA 5HKGA 3TCZA 3O5KA 1NMWA 1J6YA 4LAYA 2FAPA 4U86A 3O5MA 4N19A 3UQIA 2ZQVA 4IQ2A 3O5RA 2RSEA 5HW7A 2ZR5A 3O5OA 4ODMA 2M1IA 2KI3A 3JYJA 1FKBA 4G2PA 4ODLA 3WH0A 4BF8A 3O5GA 3PRBA 2ZQSA 1J4HA 1ROTA 4G50A 4JYSA 5B8IC 4ODRA 3RGCA 2XP8A 1QPLA 1ZK6A 2M2AA 4LAXA 2LGOA 2XP6A 3NTPA 5DITA 1FAPA 1JNSA 1J4RA 3UI5A 1JNTA 2KGJA 1EYMA 3O5DA 4QT3A 4TW6A 2XPBA 3LUOA 1Q6HA 3CGMA 3NRKA 1M5YA 2XP5A 4ODPA 4JFKA 2DG4A 1FKFA 3OOBA 5J6EA 2DG9A 2PPPA 3O5PA 3UI4A 3PRDA 4QT2A 2RQSA 4TX0A 3UQAA 1EQ3A 1F8AB 3KCEA 1FJDA 3IHZA 3JYMA 4TW8A 4IPXA 3FAPA 1A7XA 4C02B 2D9FA 3H9RB 4JFLA 3EY6A 4DT4A 3O5QA 4ITZA 2MPHA 2RUDA 4U84A 2PPOA 1FKJA 2AWGA 2L2SA 1B6CA 1FKKA 4LAWA 1P5QA 3KAGA 2ZQTA 5DIUA 3VAWA 3PA7A 1FKIA 1FKRA 1PINA 4TNSA 5HWBA 4JFMA 4GGQA 1KT1A 1YATA 4JFIA 4DRPA 5GPGA 2N87A 2MLZA 3KAHA 4W9PA 4J4NA 1D7JA 4DRMA 4IQCA 1FKDA 4QIBA 1FKGA 1FD9A 1KT0A 1BKFA 5HWCA 1L1PA 1R9HA 2KFWA 4LAVA 2F21A 2RUCA 3RFWA 3NI6A 4DROA 4FAPA 5HUAA 5HT1A 4DRHA 2XPAA 3IK8A 5HTGA 1FKLA 1JVWA 4DRIA 1T11A 2XP9A 5HW6A 3IKDA 1C9HA 2ITKA 2Q5AA 1QZ2A 1FKTA 2XP4A 3KADA 1NMVA 1W26A 4MSPA 4ODOA 3O5JA 2XP3A 4J4OA 4DH0A 4DZ3A 3MDYB 1N1AA 1QPFA 3KABA 3UI6A 5HW8A 4W9QA 2ZR6A 4DRNA 2PV2A 1U79A 1D6OA 2VN1A 4TW7A 1FKSA 1TCOC 4TYOA 5D75A 1BL4A 1HXVA 2KO7A 1FKHA 1Q6IA 2FKEA 2PV3A 1YW5A 2IF4A 3B7XA 4ODNA 4R0XA 4W9OA 2MLXA 3I6CA 1Y0OA 2F4EA 2UZ5A 1PBKA 2OFNA 2VCDA 2Y78A 2RUQA 4DIPA 4ODQA 3O5IA 3JXVA 4DRKA 5I98A 4ODKA 4JFJA 4FN2A 3KZ7A 1NSGA 2ZQUA 3O5FA 2F2DA 2DG3A 2RURA 3UF8A 2KE0A 3TC5A 4DRQA 4GIVA 4DRJA 2LPVA 3KAIA 3UQBA 2K8IA 3KACA 2PBCA 2JZVA 3ODKA 3IKGA 4NNRA 3CGNA 2KR7A
chains in the Genus database with same CATH superfamily
4DZ2A 3TDBA 2LKNA 2PPNA 4DWSB 3ARYA 4U85A 1HJWA 3GPKA 2OLHA 5DIVA 2B5UB 1ROUA 2WLZA 4U86A 4N19A 3UQIA 4Z2IA 3O5RA 2RSEA 5HW7A 2A3EA 2M1IA 2KI3A 4DWSA 3O5GA 2ZQSA 1ROTA 3B9AA 3AS0A 5B8IC 2YBTA 1QPLA 1J4RA 2KGJA 4TW6A 2XPBA 1M5YA 2XP5A 4ODPA 3ARWA 3FY1A 2DG4A 1FKFA 1E6NA 2PPPA 1CTNA 2WM0A 3ARTA 4MAVA 3ARVA 1EQ3A 4MNMA 4IPXA 4C02B 2D9FA 3ARPA 2MPHA 3G6MA 1K9TA 1B6CA 3GU0A 4DWSC 3KAGA 3VAWA 4TNSA 4UDMA 1W9UA 5HWBA 4GGQA 1YATA 3PRAA 4KR0B 2N87A 3KAHA 4QIBA 1BKFA 3RFWA 3ARRA 3NI6A 1GRJA 2PI6A 4WKAA 3QOKA 4MNLA 4DRIA 2P4VA 5HW6A 1T11A 2ITKA 2Q5AA 2XP4A 1NMVA 1W26A 3O5JA 5HW8A 1E6ZA 1HKIA 1D2KA 1HJXA 4Q22A 1E9LA 4MTVA 5JH8A 4TW7A 1U79A 4ZS6A 1BL4A 2DSUA 3B7XA 4HARA 2DT0A 3I6CA 2AOSA 2DSWA 2Y78A 2RUQA 4DIPA 4WKFA 3WQWA 1NSGA 1ZBCA 3O5FA 2RURA 2KE0A 3TC5A 4DRQA 2LPVA 1NWTA 2F23A 1NWRA 3KACA 2PBCA 3ODKA 3IKGA 4NNRA 2KR7A 1H0IA 1LL4A 1HKMA 2PV1A 5BXJA 3O5LA 5DF0A 2LJ4A 2XP7A 3GTYX 2WLYA 1E6RA 4S3KA 3TCZA 3O5KA 1J6YA 4LAYA 3CZ8A 1ZBWA 3O5MA 1EIBA 1NH6A 3O5OA 4HBEA 1XHGA 4ODLA 1WNOA 3ARSA 4BF8A 3PRBA 1W1VA 3ARQA 3WKZA 5DITA 1JNDA 2XP6A 1JNSA 3UI5A 4AY1A 1EYMA 2G41A 3AS3A 3O5DA 4QT3A 3CGMA 4DWSD 3AS2A 4JFKA 3O5PA 3PRDA 1OWQA 3UQAA 3KCEA 1FJDA 2O92A 3IHZA 3ARUA 4TW8A 1A7XA 3CHCA 3H9RB 4JFLA 2FDMA 4ITZA 2YBUA 4U84A 1ZBKA 2PPOA 4WKHA 1FKIA 4JFMA 4URIA 3RMEA 4JFIA 2MLZA 4W9PA 1LG1A 4ZPTR 4DRMA 1RD6A 1ZBVA 1FD9A 1L1PA 1R9HA 3WD0A 5HUAA 3CHFA 3ARZA 1SYTA 3IK8A 1NWUA 2XP9A 1C9HA 1QZ2A 3KADA 4QZVB 4ODOA 4DH0A 2XP3A 3MDYB 3ALFA 3UI6A 4W9QA 2VN1A 1JNEA 2PN0A 2FKEA 4PTMA 2IF4A 4W9OA 1ZU8A 2EULA 4Z2KA 2F4EA 1UR9A 2UZ5A 5GQBA 1PBKA 4ODQA 3RM9A 3O5IA 3JXVA 4DRKA 4MNKA 4P8WA 5I98A 4ODKA 1VF8A 4FN2A 3KZ7A 2ZQUA 2DG3A 4DRJA 1GUVA 4Z2HA 3KAIA 3UQBA 2K8IA 5DO2A 1E44A 4P8XA 5HBFA 1X6NA 4R5EA 1F40A 1EDQA 5DEZA 4L3NA 1J4IA 1Q1CA 1LL6A 2MLYA 4MGVA 2MF9A 2ZR4A 2MNTA 3G6LA 5HKGA 4WK9A 4Z2JA 3EIPA 3AS1A 2DSVA 2DT1A 3AROA 1FFRA 1OGGA 3WQVA 2ZR5A 3JYJA 1X6LA 1J4HA 3WD4A 3RGCA 1ZK6A 2M2AA 4LAXA 2LGOA 3NTPA 1FAPA 1W9VA 2A3CA 1JNTA 3LUOA 2O9OA 1O6IA 4NSBA 3OOBA 4QT2A 1F8AB 1WB0A 4L72B 3JYMA 1GOIA 3FAPA 4DT4A 1LQ0A 2RUDA 1FKJA 2AWGA 2A3BA 1FKKA 4LAWA 2ZQTA 3FXYA 5DIUA 1PINA 4HBOA 3B9EA 5GPGA 1W9PA 4J4NA 3RM8A 1FKDA 1KT0A 5HWCA 4LAVA 1ZB5A 4FAPA 5HT1A 2XPAA 1JVWA 3CH9A 3IKDA 3ALGA 3PR9A 4P8VA 1LG2A 4ML4A 2PV2A 1D6OA 1FKSA 2DT2A 1HXVA 1FKHA 1E6PA 4R0XA 4ZPWR 1H0GA 1Y0OA 2OFNA 3AQUA 1WAWA 1FFQA 3UF8A 2DSZA 4Q7NA 3RM4A 3WIJA 4GIVA 3BMBA 3OA5A 4WIWA 2ESCA 2JZVA 3CGNA 1D7IA 4O2TA 2M08A 3KAFA 3O5EA 1ZCNA 1D7HA 1LL7A 4S3JA 1Q6UA 3BXWA 1HKJA 1NMWA 2FAPA 3B8SA 3CHEA 2ZQVA 4IQ2A 1UR8A 1HJVA 4ODMA 3WH0A 1FKBA 1LJYA 1HKKA 4G2PA 4JYSA 4G50A 1GPFA 4ODRA 2XP8A 3WL0A 2DT3A 4MNJA 4P8UA 1E15A 2WK2A 1Q6HA 3NRKA 4Z2GA 4WJXA 1W1TA 1W1PA 3B9DA 4KQZA 5J6EA 2DG9A 3W4RA 1ITXA 4XAKA 3UI4A 1W1YA 2RQSA 2IUZA 4TX0A 3CHDA 2ETNA 3EY6A 3ARXA 3O5QA 3WD1A 4IT4A 2L2SA 1P5QA 1ZL1A 3PA7A 1FKRA 3WD3A 1KT1A 4DRPA 1NWSA 1D7JA 4Z2LA 4IQCA 4MPKA 1FKGA 2A3AA 2KFWA 2F21A 2RUCA 4DROA 1KFWA 4DRHA 5HTGA 1FKLA 4W5UA 4ZPVR 1FKTA 4DZ3A 4MSPA 4IT6A 1XRVA 4J4OA 1N1AA 1QPFA 3KABA 2ZR6A 4DRNA 5GPRA 1TCOC 4TYOA 5D75A 1EHNA 2B31A 2KO7A 1Q6IA 4ODNA 2PV3A 1SR0A 1YW5A 4NZCA 2MLXA 2VCDA 1IX5A 4JFJA 3WL1A 2F2DA 2G8ZA 1JCHB 1TFVA 2QF8A 1OGBA 3WD2A 2DPEA 4LGXA
chains in the Genus database with same CATH topology
4DZ2A 3TDBA 2LKNA 2PPNA 4DWSB 3ARYA 4U85A 1HJWA 3GPKA 2OLHA 5DIVA 1ROUA 2WLZA 4U86A 4N19A 3UQIA 4Z2IA 3O5RA 2RSEA 5HW7A 2A3EA 2M1IA 2KI3A 4DWSA 3O5GA 2ZQSA 1ROTA 3B9AA 3AS0A 5B8IC 2YBTA 1QPLA 1J4RA 2KGJA 4TW6A 2XPBA 1M5YA 2XP5A 4ODPA 3ARWA 3FY1A 2DG4A 1FKFA 1E6NA 2PPPA 1CTNA 2WM0A 3ARTA 4MAVA 3ARVA 1EQ3A 4MNMA 4IPXA 4C02B 2D9FA 3ARPA 2MPHA 3G6MA 1K9TA 1B6CA 4DWSC 3KAGA 3VAWA 4TNSA 5HWBA 1W9UA 4GGQA 1YATA 3PRAA 4KR0B 2N87A 3KAHA 4QIBA 1BKFA 3RFWA 3ARRA 3NI6A 2PI6A 4WKAA 3QOKA 4MNLA 4DRIA 5HW6A 1T11A 2ITKA 2Q5AA 2XP4A 1NMVA 1W26A 3O5JA 5HW8A 1E6ZA 1HKIA 1HJXA 1D2KA 4Q22A 1E9LA 4MTVA 5JH8A 4TW7A 1U79A 4ZS6A 1BL4A 2DSUA 3B7XA 4HARA 2DT0A 3I6CA 2AOSA 2DSWA 2Y78A 2RUQA 4DIPA 4WKFA 3WQWA 1NSGA 1ZBCA 3O5FA 2RURA 2KE0A 3TC5A 4DRQA 2LPVA 1NWTA 1NWRA 3KACA 2PBCA 3ODKA 3IKGA 4NNRA 2KR7A 1H0IA 1LL4A 1HKMA 2PV1A 5BXJA 3O5LA 5DF0A 2LJ4A 2XP7A 2WLYA 1E6RA 4S3KA 3TCZA 3O5KA 1J6YA 4LAYA 3CZ8A 1ZBWA 3O5MA 1EIBA 1NH6A 3O5OA 4HBEA 1XHGA 4ODLA 1WNOA 3ARSA 4BF8A 3PRBA 1W1VA 3ARQA 3WKZA 5DITA 1JNDA 2XP6A 1JNSA 3UI5A 4AY1A 1EYMA 2G41A 3AS3A 3O5DA 4QT3A 3CGMA 4DWSD 3AS2A 4JFKA 3O5PA 3PRDA 1OWQA 3UQAA 3KCEA 1FJDA 2O92A 3IHZA 3ARUA 4TW8A 1A7XA 3CHCA 3H9RB 4JFLA 2FDMA 4ITZA 2YBUA 4U84A 1ZBKA 2PPOA 4WKHA 1FKIA 4JFMA 4URIA 3RMEA 4JFIA 2MLZA 4W9PA 1LG1A 4ZPTR 4DRMA 1RD6A 1ZBVA 1FD9A 1L1PA 1R9HA 3WD0A 5HUAA 3CHFA 3ARZA 1SYTA 3IK8A 1NWUA 2XP9A 1C9HA 1QZ2A 3KADA 4QZVB 4ODOA 4DH0A 2XP3A 3MDYB 3ALFA 3UI6A 4W9QA 2VN1A 1JNEA 2FKEA 4PTMA 2IF4A 4W9OA 1ZU8A 4Z2KA 2F4EA 1UR9A 2UZ5A 5GQBA 1PBKA 4ODQA 3RM9A 3O5IA 3JXVA 4DRKA 4MNKA 4P8WA 5I98A 4ODKA 1VF8A 4FN2A 3KZ7A 2ZQUA 2DG3A 4DRJA 1GUVA 4Z2HA 3KAIA 3UQBA 2K8IA 5DO2A 4P8XA 5HBFA 1X6NA 4R5EA 1F40A 1EDQA 5DEZA 4L3NA 1J4IA 1Q1CA 1LL6A 2MLYA 4MGVA 2MF9A 2ZR4A 2MNTA 3G6LA 5HKGA 4WK9A 4Z2JA 3AS1A 2DSVA 2DT1A 3AROA 1FFRA 1OGGA 3WQVA 2ZR5A 3JYJA 1X6LA 1J4HA 3WD4A 3RGCA 1ZK6A 2M2AA 4LAXA 2LGOA 3NTPA 1FAPA 1W9VA 2A3CA 1JNTA 3LUOA 2O9OA 1O6IA 4NSBA 3OOBA 4QT2A 1F8AB 1WB0A 4L72B 3JYMA 1GOIA 3FAPA 4DT4A 1LQ0A 2RUDA 1FKJA 2AWGA 2A3BA 1FKKA 4LAWA 2ZQTA 3FXYA 5DIUA 1PINA 4HBOA 3B9EA 5GPGA 1W9PA 4J4NA 3RM8A 1FKDA 1KT0A 5HWCA 4LAVA 1ZB5A 4FAPA 5HT1A 2XPAA 1JVWA 3CH9A 3IKDA 3ALGA 3PR9A 4P8VA 1LG2A 4ML4A 2PV2A 1D6OA 1FKSA 2DT2A 1HXVA 1FKHA 1E6PA 4R0XA 4ZPWR 1H0GA 1Y0OA 2OFNA 3AQUA 1WAWA 1FFQA 3UF8A 2DSZA 4Q7NA 3RM4A 3WIJA 4GIVA 3OA5A 4WIWA 2ESCA 2JZVA 3CGNA 1D7IA 4O2TA 2M08A 3KAFA 3O5EA 1ZCNA 1D7HA 1LL7A 4S3JA 1Q6UA 3BXWA 1HKJA 1NMWA 2FAPA 3B8SA 3CHEA 2ZQVA 4IQ2A 1UR8A 1HJVA 4ODMA 3WH0A 1FKBA 1LJYA 1HKKA 4G2PA 4JYSA 4G50A 1GPFA 4ODRA 2XP8A 3WL0A 2DT3A 4MNJA 4P8UA 1E15A 2WK2A 1Q6HA 3NRKA 4Z2GA 4WJXA 1W1TA 1W1PA 3B9DA 4KQZA 5J6EA 2DG9A 3W4RA 1ITXA 4XAKA 3UI4A 1W1YA 2RQSA 2IUZA 4TX0A 3CHDA 3EY6A 3ARXA 3O5QA 3WD1A 4IT4A 2L2SA 1P5QA 1ZL1A 3PA7A 1FKRA 3WD3A 1KT1A 4DRPA 1NWSA 1D7JA 4Z2LA 4IQCA 4MPKA 1FKGA 2A3AA 2KFWA 2F21A 2RUCA 4DROA 1KFWA 4DRHA 5HTGA 1FKLA 4W5UA 4ZPVR 1FKTA 4DZ3A 4MSPA 4IT6A 1XRVA 4J4OA 1N1AA 1QPFA 3KABA 2ZR6A 4DRNA 5GPRA 1TCOC 4TYOA 5D75A 1EHNA 2B31A 2KO7A 1Q6IA 4ODNA 1SR0A 1YW5A 2PV3A 4NZCA 2MLXA 2VCDA 1IX5A 4JFJA 3WL1A 2F2DA 2G8ZA 1TFVA 2QF8A 1OGBA 3WD2A 2DPEA 4LGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D7I A;  3TDB A;  4DZ2 A;  2LKN A;  1F40 A;  2PPN A;  4O2T A;  2PV1 A;  2M08 A;  5BXJ A;  3KAF A;  3O5L A;  1J4I A;  1Q1C A;  3O5E A;  2LJ4 A;  4U85 A;  2MLY A;  1ZCN A;  2XP7 A;  3GPK A;  1D7H A;  4MGV A;  2MF9 A;  2ZR4 A;  2MNT A;  1Q6U A;  5DIV A;  1ROU A;  5HKG A;  3TCZ A;  3O5K A;  1NMW A;  1J6Y A;  4LAY A;  2FAP A;  4U86 A;  3O5M A;  4N19 A;  3UQI A;  2ZQV A;  4IQ2 A;  3O5R A;  2RSE A;  5HW7 A;  2ZR5 A;  3O5O A;  4ODM A;  2M1I A;  2KI3 A;  3JYJ A;  1FKB A;  4G2P A;  4ODL A;  3WH0 A;  4BF8 A;  3O5G A;  3PRB A;  2ZQS A;  1J4H A;  1ROT A;  4G50 A;  4JYS A;  5B8I C;  4ODR A;  3RGC A;  2XP8 A;  1QPL A;  1ZK6 A;  2M2A A;  4LAX A;  2LGO A;  2XP6 A;  3NTP A;  5DIT A;  1FAP A;  1JNS A;  1J4R A;  3UI5 A;  1JNT A;  2KGJ A;  1EYM A;  3O5D A;  4QT3 A;  4TW6 A;  2XPB A;  3LUO A;  1Q6H A;  3CGM A;  3NRK A;  1M5Y A;  2XP5 A;  4ODP A;  4JFK A;  2DG4 A;  1FKF A;  3OOB A;  5J6E A;  2DG9 A;  2PPP A;  3O5P A;  3UI4 A;  3PRD A;  4QT2 A;  2RQS A;  4TX0 A;  3UQA A;  1EQ3 A;  1F8A B;  3KCE A;  1FJD A;  3IHZ A;  3JYM A;  4TW8 A;  4IPX A;  3FAP A;  1A7X A;  4C02 B;  2D9F A;  3H9R B;  4JFL A;  3EY6 A;  4DT4 A;  3O5Q A;  4ITZ A;  2MPH A;  2RUD A;  4U84 A;  2PPO A;  1FKJ A;  2AWG A;  2L2S A;  1B6C A;  1FKK A;  4LAW A;  1P5Q A;  3KAG A;  2ZQT A;  5DIU A;  3VAW A;  3PA7 A;  1FKI A;  1FKR A;  1PIN A;  4TNS A;  5HWB A;  4JFM A;  4GGQ A;  1KT1 A;  1YAT A;  4JFI A;  4DRP A;  5GPG A;  2N87 A;  2MLZ A;  3KAH A;  4W9P A;  4J4N A;  1D7J A;  4DRM A;  4IQC A;  1FKD A;  4QIB A;  1FKG A;  1FD9 A;  1KT0 A;  1BKF A;  5HWC A;  1L1P A;  1R9H A;  2KFW A;  4LAV A;  2F21 A;  2RUC A;  3RFW A;  3NI6 A;  4DRO A;  4FAP A;  5HUA A;  5HT1 A;  4DRH A;  2XPA A;  3IK8 A;  5HTG A;  1FKL A;  1JVW A;  4DRI A;  1T11 A;  2XP9 A;  5HW6 A;  3IKD A;  1C9H A;  2ITK A;  2Q5A A;  1QZ2 A;  1FKT A;  2XP4 A;  3KAD A;  1NMV A;  1W26 A;  4MSP A;  4ODO A;  3O5J A;  2XP3 A;  4J4O A;  4DH0 A;  4DZ3 A;  3MDY B;  1N1A A;  1QPF A;  3KAB A;  3UI6 A;  5HW8 A;  4W9Q A;  2ZR6 A;  4DRN A;  2PV2 A;  1U79 A;  1D6O A;  2VN1 A;  4TW7 A;  1FKS A;  1TCO C;  4TYO A;  5D75 A;  1BL4 A;  1HXV A;  2KO7 A;  1FKH A;  1Q6I A;  2FKE A;  2PV3 A;  1YW5 A;  2IF4 A;  3B7X A;  4ODN A;  4R0X A;  4W9O A;  2MLX A;  3I6C A;  1Y0O A;  2F4E A;  2UZ5 A;  1PBK A;  2OFN A;  2VCD A;  2Y78 A;  2RUQ A;  4DIP A;  4ODQ A;  3O5I A;  3JXV A;  4DRK A;  5I98 A;  4ODK A;  4JFJ A;  4FN2 A;  3KZ7 A;  1NSG A;  2ZQU A;  3O5F A;  2F2D A;  2DG3 A;  2RUR A;  3UF8 A;  2KE0 A;  3TC5 A;  4DRQ A;  4GIV A;  4DRJ A;  2LPV A;  3KAI A;  3UQB A;  2K8I A;  3KAC A;  2PBC A;  2JZV A;  3ODK A;  3IKG A;  4NNR A;  3CGN A;  2KR7 A; 
#chains in the Genus database with same CATH topology
 4DZ2 A;  3TDB A;  2LKN A;  2PPN A;  4DWS B;  3ARY A;  4U85 A;  1HJW A;  3GPK A;  2OLH A;  5DIV A;  2B5U B;  1ROU A;  2WLZ A;  4U86 A;  4N19 A;  3UQI A;  4Z2I A;  3O5R A;  2RSE A;  5HW7 A;  2A3E A;  2M1I A;  2KI3 A;  4DWS A;  3O5G A;  2ZQS A;  1ROT A;  3B9A A;  3AS0 A;  5B8I C;  2YBT A;  1QPL A;  1J4R A;  2KGJ A;  4TW6 A;  2XPB A;  1M5Y A;  2XP5 A;  4ODP A;  3ARW A;  3FY1 A;  2DG4 A;  1FKF A;  1E6N A;  2PPP A;  1CTN A;  2WM0 A;  3ART A;  4MAV A;  3ARV A;  1EQ3 A;  4MNM A;  4IPX A;  4C02 B;  2D9F A;  3ARP A;  2MPH A;  3G6M A;  1K9T A;  1B6C A;  3GU0 A;  4DWS C;  3KAG A;  3VAW A;  4TNS A;  4UDM A;  1W9U A;  5HWB A;  4GGQ A;  1YAT A;  3PRA A;  4KR0 B;  2N87 A;  3KAH A;  4QIB A;  1BKF A;  3RFW A;  3ARR A;  3NI6 A;  1GRJ A;  2PI6 A;  4WKA A;  3QOK A;  4MNL A;  4DRI A;  2P4V A;  5HW6 A;  1T11 A;  2ITK A;  2Q5A A;  2XP4 A;  1NMV A;  1W26 A;  3O5J A;  5HW8 A;  1E6Z A;  1HKI A;  1D2K A;  1HJX A;  4Q22 A;  1E9L A;  4MTV A;  5JH8 A;  4TW7 A;  1U79 A;  4ZS6 A;  1BL4 A;  2DSU A;  3B7X A;  4HAR A;  2DT0 A;  3I6C A;  2AOS A;  2DSW A;  2Y78 A;  2RUQ A;  4DIP A;  4WKF A;  3WQW A;  1NSG A;  1ZBC A;  3O5F A;  2RUR A;  2KE0 A;  3TC5 A;  4DRQ A;  2LPV A;  1NWT A;  2F23 A;  1NWR A;  3KAC A;  2PBC A;  3ODK A;  3IKG A;  4NNR A;  2KR7 A;  1H0I A;  1LL4 A;  1HKM A;  2PV1 A;  5BXJ A;  3O5L A;  5DF0 A;  2LJ4 A;  2XP7 A;  3GTY X;  2WLY A;  1E6R A;  4S3K A;  3TCZ A;  3O5K A;  1J6Y A;  4LAY A;  3CZ8 A;  1ZBW A;  3O5M A;  1EIB A;  1NH6 A;  3O5O A;  4HBE A;  1XHG A;  4ODL A;  1WNO A;  3ARS A;  4BF8 A;  3PRB A;  1W1V A;  3ARQ A;  3WKZ A;  5DIT A;  1JND A;  2XP6 A;  1JNS A;  3UI5 A;  4AY1 A;  1EYM A;  2G41 A;  3AS3 A;  3O5D A;  4QT3 A;  3CGM A;  4DWS D;  3AS2 A;  4JFK A;  3O5P A;  3PRD A;  1OWQ A;  3UQA A;  3KCE A;  1FJD A;  2O92 A;  3IHZ A;  3ARU A;  4TW8 A;  1A7X A;  3CHC A;  3H9R B;  4JFL A;  2FDM A;  4ITZ A;  2YBU A;  4U84 A;  1ZBK A;  2PPO A;  4WKH A;  1FKI A;  4JFM A;  4URI A;  3RME A;  4JFI A;  2MLZ A;  4W9P A;  1LG1 A;  4ZPT R;  4DRM A;  1RD6 A;  1ZBV A;  1FD9 A;  1L1P A;  1R9H A;  3WD0 A;  5HUA A;  3CHF A;  3ARZ A;  1SYT A;  3IK8 A;  1NWU A;  2XP9 A;  1C9H A;  1QZ2 A;  3KAD A;  4QZV B;  4ODO A;  4DH0 A;  2XP3 A;  3MDY B;  3ALF A;  3UI6 A;  4W9Q A;  2VN1 A;  1JNE A;  2PN0 A;  2FKE A;  4PTM A;  2IF4 A;  4W9O A;  1ZU8 A;  2EUL A;  4Z2K A;  2F4E A;  1UR9 A;  2UZ5 A;  5GQB A;  1PBK A;  4ODQ A;  3RM9 A;  3O5I A;  3JXV A;  4DRK A;  4MNK A;  4P8W A;  5I98 A;  4ODK A;  1VF8 A;  4FN2 A;  3KZ7 A;  2ZQU A;  2DG3 A;  4DRJ A;  1GUV A;  4Z2H A;  3KAI A;  3UQB A;  2K8I A;  5DO2 A;  1E44 A;  4P8X A;  5HBF A;  1X6N A;  4R5E A;  1F40 A;  1EDQ A;  5DEZ A;  4L3N A;  1J4I A;  1Q1C A;  1LL6 A;  2MLY A;  4MGV A;  2MF9 A;  2ZR4 A;  2MNT A;  3G6L A;  5HKG A;  4WK9 A;  4Z2J A;  3EIP A;  3AS1 A;  2DSV A;  2DT1 A;  3ARO A;  1FFR A;  1OGG A;  3WQV A;  2ZR5 A;  3JYJ A;  1X6L A;  1J4H A;  3WD4 A;  3RGC A;  1ZK6 A;  2M2A A;  4LAX A;  2LGO A;  3NTP A;  1FAP A;  1W9V A;  2A3C A;  1JNT A;  3LUO A;  2O9O A;  1O6I A;  4NSB A;  3OOB A;  4QT2 A;  1F8A B;  1WB0 A;  4L72 B;  3JYM A;  1GOI A;  3FAP A;  4DT4 A;  1LQ0 A;  2RUD A;  1FKJ A;  2AWG A;  2A3B A;  1FKK A;  4LAW A;  2ZQT A;  3FXY A;  5DIU A;  1PIN A;  4HBO A;  3B9E A;  5GPG A;  1W9P A;  4J4N A;  3RM8 A;  1FKD A;  1KT0 A;  5HWC A;  4LAV A;  1ZB5 A;  4FAP A;  5HT1 A;  2XPA A;  1JVW A;  3CH9 A;  3IKD A;  3ALG A;  3PR9 A;  4P8V A;  1LG2 A;  4ML4 A;  2PV2 A;  1D6O A;  1FKS A;  2DT2 A;  1HXV A;  1FKH A;  1E6P A;  4R0X A;  4ZPW R;  1H0G A;  1Y0O A;  2OFN A;  3AQU A;  1WAW A;  1FFQ A;  3UF8 A;  2DSZ A;  4Q7N A;  3RM4 A;  3WIJ A;  4GIV A;  3BMB A;  3OA5 A;  4WIW A;  2ESC A;  2JZV A;  3CGN A;  1D7I A;  4O2T A;  2M08 A;  3KAF A;  3O5E A;  1ZCN A;  1D7H A;  1LL7 A;  4S3J A;  1Q6U A;  3BXW A;  1HKJ A;  1NMW A;  2FAP A;  3B8S A;  3CHE A;  2ZQV A;  4IQ2 A;  1UR8 A;  1HJV A;  4ODM A;  3WH0 A;  1FKB A;  1LJY A;  1HKK A;  4G2P A;  4JYS A;  4G50 A;  1GPF A;  4ODR A;  2XP8 A;  3WL0 A;  2DT3 A;  4MNJ A;  4P8U A;  1E15 A;  2WK2 A;  1Q6H A;  3NRK A;  4Z2G A;  4WJX A;  1W1T A;  1W1P A;  3B9D A;  4KQZ A;  5J6E A;  2DG9 A;  3W4R A;  1ITX A;  4XAK A;  3UI4 A;  1W1Y A;  2RQS A;  2IUZ A;  4TX0 A;  3CHD A;  2ETN A;  3EY6 A;  3ARX A;  3O5Q A;  3WD1 A;  4IT4 A;  2L2S A;  1P5Q A;  1ZL1 A;  3PA7 A;  1FKR A;  3WD3 A;  1KT1 A;  4DRP A;  1NWS A;  1D7J A;  4Z2L A;  4IQC A;  4MPK A;  1FKG A;  2A3A A;  2KFW A;  2F21 A;  2RUC A;  4DRO A;  1KFW A;  4DRH A;  5HTG A;  1FKL A;  4W5U A;  4ZPV R;  1FKT A;  4DZ3 A;  4MSP A;  4IT6 A;  1XRV A;  4J4O A;  1N1A A;  1QPF A;  3KAB A;  2ZR6 A;  4DRN A;  5GPR A;  1TCO C;  4TYO A;  5D75 A;  1EHN A;  2B31 A;  2KO7 A;  1Q6I A;  4ODN A;  2PV3 A;  1SR0 A;  1YW5 A;  4NZC A;  2MLX A;  2VCD A;  1IX5 A;  4JFJ A;  3WL1 A;  2F2D A;  2G8Z A;  1JCH B;  1TFV A;  2QF8 A;  1OGB A;  3WD2 A;  2DPE A;  4LGX A; 
#chains in the Genus database with same CATH homology
 4DZ2 A;  3TDB A;  2LKN A;  2PPN A;  4DWS B;  3ARY A;  4U85 A;  1HJW A;  3GPK A;  2OLH A;  5DIV A;  1ROU A;  2WLZ A;  4U86 A;  4N19 A;  3UQI A;  4Z2I A;  3O5R A;  2RSE A;  5HW7 A;  2A3E A;  2M1I A;  2KI3 A;  4DWS A;  3O5G A;  2ZQS A;  1ROT A;  3B9A A;  3AS0 A;  5B8I C;  2YBT A;  1QPL A;  1J4R A;  2KGJ A;  4TW6 A;  2XPB A;  1M5Y A;  2XP5 A;  4ODP A;  3ARW A;  3FY1 A;  2DG4 A;  1FKF A;  1E6N A;  2PPP A;  1CTN A;  2WM0 A;  3ART A;  4MAV A;  3ARV A;  1EQ3 A;  4MNM A;  4IPX A;  4C02 B;  2D9F A;  3ARP A;  2MPH A;  3G6M A;  1K9T A;  1B6C A;  4DWS C;  3KAG A;  3VAW A;  4TNS A;  5HWB A;  1W9U A;  4GGQ A;  1YAT A;  3PRA A;  4KR0 B;  2N87 A;  3KAH A;  4QIB A;  1BKF A;  3RFW A;  3ARR A;  3NI6 A;  2PI6 A;  4WKA A;  3QOK A;  4MNL A;  4DRI A;  5HW6 A;  1T11 A;  2ITK A;  2Q5A A;  2XP4 A;  1NMV A;  1W26 A;  3O5J A;  5HW8 A;  1E6Z A;  1HKI A;  1HJX A;  1D2K A;  4Q22 A;  1E9L A;  4MTV A;  5JH8 A;  4TW7 A;  1U79 A;  4ZS6 A;  1BL4 A;  2DSU A;  3B7X A;  4HAR A;  2DT0 A;  3I6C A;  2AOS A;  2DSW A;  2Y78 A;  2RUQ A;  4DIP A;  4WKF A;  3WQW A;  1NSG A;  1ZBC A;  3O5F A;  2RUR A;  2KE0 A;  3TC5 A;  4DRQ A;  2LPV A;  1NWT A;  1NWR A;  3KAC A;  2PBC A;  3ODK A;  3IKG A;  4NNR A;  2KR7 A;  1H0I A;  1LL4 A;  1HKM A;  2PV1 A;  5BXJ A;  3O5L A;  5DF0 A;  2LJ4 A;  2XP7 A;  2WLY A;  1E6R A;  4S3K A;  3TCZ A;  3O5K A;  1J6Y A;  4LAY A;  3CZ8 A;  1ZBW A;  3O5M A;  1EIB A;  1NH6 A;  3O5O A;  4HBE A;  1XHG A;  4ODL A;  1WNO A;  3ARS A;  4BF8 A;  3PRB A;  1W1V A;  3ARQ A;  3WKZ A;  5DIT A;  1JND A;  2XP6 A;  1JNS A;  3UI5 A;  4AY1 A;  1EYM A;  2G41 A;  3AS3 A;  3O5D A;  4QT3 A;  3CGM A;  4DWS D;  3AS2 A;  4JFK A;  3O5P A;  3PRD A;  1OWQ A;  3UQA A;  3KCE A;  1FJD A;  2O92 A;  3IHZ A;  3ARU A;  4TW8 A;  1A7X A;  3CHC A;  3H9R B;  4JFL A;  2FDM A;  4ITZ A;  2YBU A;  4U84 A;  1ZBK A;  2PPO A;  4WKH A;  1FKI A;  4JFM A;  4URI A;  3RME A;  4JFI A;  2MLZ A;  4W9P A;  1LG1 A;  4ZPT R;  4DRM A;  1RD6 A;  1ZBV A;  1FD9 A;  1L1P A;  1R9H A;  3WD0 A;  5HUA A;  3CHF A;  3ARZ A;  1SYT A;  3IK8 A;  1NWU A;  2XP9 A;  1C9H A;  1QZ2 A;  3KAD A;  4QZV B;  4ODO A;  4DH0 A;  2XP3 A;  3MDY B;  3ALF A;  3UI6 A;  4W9Q A;  2VN1 A;  1JNE A;  2FKE A;  4PTM A;  2IF4 A;  4W9O A;  1ZU8 A;  4Z2K A;  2F4E A;  1UR9 A;  2UZ5 A;  5GQB A;  1PBK A;  4ODQ A;  3RM9 A;  3O5I A;  3JXV A;  4DRK A;  4MNK A;  4P8W A;  5I98 A;  4ODK A;  1VF8 A;  4FN2 A;  3KZ7 A;  2ZQU A;  2DG3 A;  4DRJ A;  1GUV A;  4Z2H A;  3KAI A;  3UQB A;  2K8I A;  5DO2 A;  4P8X A;  5HBF A;  1X6N A;  4R5E A;  1F40 A;  1EDQ A;  5DEZ A;  4L3N A;  1J4I A;  1Q1C A;  1LL6 A;  2MLY A;  4MGV A;  2MF9 A;  2ZR4 A;  2MNT A;  3G6L A;  5HKG A;  4WK9 A;  4Z2J A;  3AS1 A;  2DSV A;  2DT1 A;  3ARO A;  1FFR A;  1OGG A;  3WQV A;  2ZR5 A;  3JYJ A;  1X6L A;  1J4H A;  3WD4 A;  3RGC A;  1ZK6 A;  2M2A A;  4LAX A;  2LGO A;  3NTP A;  1FAP A;  1W9V A;  2A3C A;  1JNT A;  3LUO A;  2O9O A;  1O6I A;  4NSB A;  3OOB A;  4QT2 A;  1F8A B;  1WB0 A;  4L72 B;  3JYM A;  1GOI A;  3FAP A;  4DT4 A;  1LQ0 A;  2RUD A;  1FKJ A;  2AWG A;  2A3B A;  1FKK A;  4LAW A;  2ZQT A;  3FXY A;  5DIU A;  1PIN A;  4HBO A;  3B9E A;  5GPG A;  1W9P A;  4J4N A;  3RM8 A;  1FKD A;  1KT0 A;  5HWC A;  4LAV A;  1ZB5 A;  4FAP A;  5HT1 A;  2XPA A;  1JVW A;  3CH9 A;  3IKD A;  3ALG A;  3PR9 A;  4P8V A;  1LG2 A;  4ML4 A;  2PV2 A;  1D6O A;  1FKS A;  2DT2 A;  1HXV A;  1FKH A;  1E6P A;  4R0X A;  4ZPW R;  1H0G A;  1Y0O A;  2OFN A;  3AQU A;  1WAW A;  1FFQ A;  3UF8 A;  2DSZ A;  4Q7N A;  3RM4 A;  3WIJ A;  4GIV A;  3OA5 A;  4WIW A;  2ESC A;  2JZV A;  3CGN A;  1D7I A;  4O2T A;  2M08 A;  3KAF A;  3O5E A;  1ZCN A;  1D7H A;  1LL7 A;  4S3J A;  1Q6U A;  3BXW A;  1HKJ A;  1NMW A;  2FAP A;  3B8S A;  3CHE A;  2ZQV A;  4IQ2 A;  1UR8 A;  1HJV A;  4ODM A;  3WH0 A;  1FKB A;  1LJY A;  1HKK A;  4G2P A;  4JYS A;  4G50 A;  1GPF A;  4ODR A;  2XP8 A;  3WL0 A;  2DT3 A;  4MNJ A;  4P8U A;  1E15 A;  2WK2 A;  1Q6H A;  3NRK A;  4Z2G A;  4WJX A;  1W1T A;  1W1P A;  3B9D A;  4KQZ A;  5J6E A;  2DG9 A;  3W4R A;  1ITX A;  4XAK A;  3UI4 A;  1W1Y A;  2RQS A;  2IUZ A;  4TX0 A;  3CHD A;  3EY6 A;  3ARX A;  3O5Q A;  3WD1 A;  4IT4 A;  2L2S A;  1P5Q A;  1ZL1 A;  3PA7 A;  1FKR A;  3WD3 A;  1KT1 A;  4DRP A;  1NWS A;  1D7J A;  4Z2L A;  4IQC A;  4MPK A;  1FKG A;  2A3A A;  2KFW A;  2F21 A;  2RUC A;  4DRO A;  1KFW A;  4DRH A;  5HTG A;  1FKL A;  4W5U A;  4ZPV R;  1FKT A;  4DZ3 A;  4MSP A;  4IT6 A;  1XRV A;  4J4O A;  1N1A A;  1QPF A;  3KAB A;  2ZR6 A;  4DRN A;  5GPR A;  1TCO C;  4TYO A;  5D75 A;  1EHN A;  2B31 A;  2KO7 A;  1Q6I A;  4ODN A;  1SR0 A;  1YW5 A;  2PV3 A;  4NZC A;  2MLX A;  2VCD A;  1IX5 A;  4JFJ A;  3WL1 A;  2F2D A;  2G8Z A;  1TFV A;  2QF8 A;  1OGB A;  3WD2 A;  2DPE A;  4LGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...