4C02B

Crystal structure of human acvr1 (alk2) in complex with fkbp12.6 and dorsomorphin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
b'MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACTIVIN RECEPTOR TYPE-1
publication title Crystal Structure of Human Acvr1 (Alk2) in Complex with Fkbp12.6 And Dorsomorphin
rcsb
source organism Homo sapiens
molecule tags Transferase/isomerase
total genus 24
structure length 108
sequence length 108
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4c02B00
3PRDA 1FD9A 4ODRA 2ITKA 4LAXA 1FKRA 1PBKA 1NSGA 3O5QA 2ZR5A 4W9QA 2RURA 3RGCA 2Y78A 2RUDA 3ODKA 4ODNA 4GGQA 2XP4A 2KE0A 3KZ7A 2FAPA 5DIUA 3IHZA 5J6EA 4NNRA 1D7IA 4IPXA 2MLXA 1FAPA 4U85A 3WH0A 1F40A 1FJDA 3NI6A 2F2DA 1J4IA 1QZ2A 1KT0A 2PPNA 1KT1A 1FKDA 3O5KA 3O5LA 2ZR6A 4TNSA 1TCOC 4TW8A 3O5EA 3FAPA 1Q1CA 4W9PA 3H9RB 1PINA 2PV2A 4DRKA 4U84A 1B6CA 2RUCA 4R0XA 3NTPA 2L2SA 4LAVA 1JVWA 1ROUA 2ZQTA 2ZQUA 2MLYA 4JFKA 2XP3A 4MSPA 4QT2A 4JFJA 1FKHA 2LPVA 4JFIA 4ODMA 5DITA 1D7JA 3O5IA 2LJ4A 1F8AB 1FKBA 1W26A 3O5FA 3VAWA 1J4RA 2Q5AA 1D7HA 2DG3A 2XP7A 3GPKA 3PA7A 5HW7A 1EQ3A 2XP6A 4ODPA 4JYSA 3KABA 4LAYA 1NMWA 1EYMA 3KAHA 3CGMA 4DROA 4JFLA 1L1PA 2PV1A 3TC5A 2MNTA 2K8IA 1A7XA 1T11A 2DG4A 2XP5A 2ZQSA 3KAIA 3NRKA 4FN2A 4G50A 5HWCA 3KAFA 4IQCA 1JNTA 3EY6A 2D9FA 2LKNA 2KFWA 4QIBA 2XP8A 1N1AA 4J4OA 1FKTA 4GIVA 3MDYB 4DRMA 1Y0OA 2AWGA 1Q6IA 4ODOA 5GPGA 3O5JA 4DH0A 4ODKA 1Q6HA 3KAGA 1FKSA 1FKFA 1YW5A 2VN1A 2XPAA 4FAPA 1HXVA 1BKFA 1YATA 1FKJA 5HTGA 1FKKA 1C9HA 1U79A 3O5GA 4G2PA 3UI5A 5DIVA 2M2AA 3UQIA 4DIPA 2DG9A 2MF9A 5HUAA 1FKGA 4DZ3A 3O5PA 3I6CA 2ZQVA 1ZK6A 3B7XA 3OOBA 4MGVA 4N19A 1ROTA 2PPOA 2MPHA 3IKDA 3KCEA 5HT1A 5B8IC 5I98A 1QPLA 2OFNA 3IKGA 3O5MA 5HW6A 3UQAA 1R9HA 1FKLA 4JFMA 1BL4A 4TX0A 5BXJA 4DRPA 3O5DA 4DRJA 3IK8A 1J6YA 3KADA 2KI3A 4O2TA 2KGJA 2XP9A 4C02B 2PV3A 4TW6A 3UI6A 2UZ5A 3CGNA 3KACA 2XPBA 4DRIA 3JXVA 3UQBA 3JYMA 4BF8A 2M1IA 1P5QA 2RSEA 4DRQA 1FKIA 4J4NA 2RQSA 4TYOA 4ODLA 4U86A 3UF8A 3O5OA 3O5RA 3PRBA 5HW8A 2F4EA 4LAWA 1J4HA 4IQ2A 2JZVA 3JYJA 1M5YA 4W9OA 3TDBA 4DZ2A 1QPFA 2KR7A 4QT3A 3UI4A 1ZCNA 1Q6UA 3RFWA 2PBCA 4DRHA 4DT4A 4TW7A 2F21A 1JNSA 2N87A 2IF4A 2ZR4A 1NMVA 4ODQA 5HKGA 3TCZA 1D6OA 5D75A 2LGOA 4ITZA 2FKEA 2M08A 2KO7A 2PPPA 3LUOA 2RUQA 2MLZA 4DRNA 5HWBA 2VCDA
chains in the Genus database with same CATH superfamily
4ODRA 2YBTA 3O5QA 2ZR5A 4W9QA 4ODNA 1WAWA 1JCHB 1H0IA 4U85A 1F40A 3B9AA 2PPNA 2DPEA 1O6IA 2F23A 3G6MA 3GU0A 3QOKA 3RMEA 3H9RB 1W9VA 4LAVA 1XRVA 4S3JA 1ROUA 2AOSA 4QT2A 1FKHA 2LPVA 1D7JA 3ARZA 2YBUA 1D7HA 2DG3A 4HARA 1EQ3A 1E6NA 1GRJA 3GTYX 4XAKA 3ALGA 4JYSA 3KABA 4LAYA 1HKKA 1NMWA 4P8VA 4DROA 5GPRA 2MNTA 1A7XA 4G50A 3KAIA 3NRKA 5HWCA 3KAFA 3WD2A 1N1AA 3WQVA 1WB0A 1GOIA 1W9PA 4Z2KA 1HKMA 4HBEA 3AQUA 1X6LA 3ARUA 4FAPA 1BKFA 1FKJA 1YATA 5HTGA 1C9HA 3FXYA 2A3EA 4WJXA 5DIVA 1NWUA 2DG9A 2O92A 1HKIA 4DZ3A 3O5PA 3OOBA 5HT1A 5DEZA 3O5MA 4JFMA 3IK8A 1NWTA 1W1VA 3KADA 4P8XA 2XP9A 4TW6A 3RM9A 1UR8A 4KQZA 1UR9A 1P5QA 4R5EA 1FKIA 2FDMA 4J4NA 2RQSA 4TYOA 4PTMA 3CHEA 3O5OA 3PRBA 5HW8A 4DWSB 2DT3A 2JZVA 3JYJA 1M5YA 3CHDA 1HJWA 4QT3A 1HJVA 2PBCA 4TW7A 1JNSA 5D75A 2LGOA 4MAVA 1KFWA 4DWSC 3B8SA 3PRAA 2VCDA 3PRDA 1FD9A 1SR0A 4LAXA 1W1PA 3ODKA 4GGQA 2XP4A 4P8UA 3AS3A 3IHZA 1D7IA 3WD3A 2MLXA 5GQBA 3NI6A 1QZ2A 1FKDA 3O5LA 2DT0A 4URIA 4TW8A 3O5EA 1Q1CA 2A3BA 4DRKA 4U84A 3RM4A 2L2SA 1JVWA 1LL7A 2ZQUA 3BMBA 2B31A 4ODMA 1FFQA 5JH8A 2PI6A 3VAWA 5HW7A 1JNEA 2DSUA 1OGBA 4QZVB 1W1YA 3OA5A 5HBFA 4DRJA 2ZQSA 1ZBVA 3EIPA 4IQCA 3EY6A 4MNKA 4QIBA 4J4OA 5DO2A 3MDYB 2AWGA 1Q6IA 4WIWA 4ODOA 5GPGA 3O5JA 1FKSA 2VN1A 4LGXA 2XPAA 1HXVA 4Z2LA 3ARVA 5HUAA 3WD4A 2G41A 3ARSA 1ZK6A 3B7XA 4N19A 2DSWA 5I98A 3UQAA 2P4VA 2A3AA 1BL4A 1VF8A 4ZPTR 3AS0A 4MPKA 4O2TA 3WL0A 3WD0A 2UZ5A 3CGNA 4WKAA 3JXVA 3ARPA 4WK9A 4U86A 3O5RA 2F4EA 1GPFA 2B5UB 2WK2A 1WNOA 3CHFA 4Q22A 4DZ2A 4HBOA 3UI4A 4Z2JA 1Q6UA 3WL1A 1ZU8A 2N87A 3ARRA 1OWQA 1LJYA 1NMVA 3TCZA 4MNLA 4L3NA 3LUOA 2RUQA 1FKRA 1NSGA 3RGCA 2Y78A 2RUDA 2PN0A 2KE0A 4ZS6A 2FAPA 5DIUA 5J6EA 2DT1A 1FFRA 3W4RA 2DT2A 3WH0A 1FJDA 3CHCA 1KT0A 1KT1A 3O5KA 3G6LA 4UDMA 1TCOC 3FAPA 1CTNA 4W9PA 2PV2A 4P8WA 4R0XA 3NTPA 4JFKA 2XP3A 2A3CA 4MNMA 1X6NA 5DITA 1XHGA 2O9OA 2Q5AA 2XP7A 3GPKA 3PA7A 2WM0A 1LL6A 2XP6A 4ODPA 2WLYA 1EDQA 4L72B 3KAHA 3CGMA 3TC5A 2QF8A 3WIJA 4Z2GA 2K8IA 2XP5A 4IT6A 4FN2A 1K9TA 2D9FA 2KFWA 3B9DA 2XP8A 4GIVA 1LQ0A 4DH0A 2IUZA 3KAGA 1OGGA 1FKKA 1U79A 3O5GA 4Z2IA 3UI5A 1E6PA 2M2AA 3ARTA 1FKGA 1ZBWA 3CZ8A 3I6CA 3IKDA 2DSVA 4NZCA 5B8IC 3FY1A 2OFNA 1FKLA 4TX0A 5BXJA 4MNJA 1SYTA 3AROA 1E9LA 2PV3A 2WLZA 1D2KA 2XPBA 3UQBA 3JYMA 4BF8A 2M1IA 4DRQA 1E44A 2G8ZA 4LAWA 3ALFA 4ML4A 4IQ2A 4W9OA 2EULA 3TDBA 1QPFA 2KR7A 1ZBCA 1ZCNA 3RFWA 2F21A 1E15A 5DF0A 2ZR4A 4ODQA 5HKGA 1D6OA 4ITZA 1JNDA 2M08A 2KO7A 2PPPA 3ARXA 2MLZA 4DRNA 5HWBA 2ITKA 1PBKA 2RURA 3KZ7A 4NSBA 3B9EA 4NNRA 4IPXA 1FAPA 2F2DA 1J4IA 3RM8A 3BXWA 2ZR6A 2ETNA 4TNSA 3WD1A 1W9UA 1EIBA 1PINA 4AY1A 1ZL1A 1B6CA 1H0GA 2RUCA 4ZPVR 1ZB5A 3PR9A 2ZQTA 3ARWA 2MLYA 4MSPA 4JFJA 3AS1A 4JFIA 3O5IA 2LJ4A 1LG1A 1F8AB 1FKBA 1W26A 3O5FA 1J4RA 4DWSD 1ZBKA 1EYMA 1L1PA 4JFLA 2PV1A 1T11A 2DG4A 1JNTA 2LKNA 1FKTA 4Z2HA 4IT4A 4DRMA 1Y0OA 1IX5A 4ODKA 1Q6HA 1YW5A 1FKFA 1NH6A 4ZPWR 4G2PA 3UQIA 4DIPA 2ESCA 2MF9A 3ARYA 4MTVA 4KR0B 2ZQVA 1EHNA 4MGVA 1GUVA 1ROTA 2PPOA 2MPHA 3KCEA 4W5UA 3AS2A 1QPLA 3IKGA 3WKZA 5HW6A 1NWSA 1R9HA 4S3KA 3ARQA 4DRPA 3O5DA 1HKJA 1J6YA 2KI3A 3CH9A 2KGJA 4C02B 1LL4A 3UI6A 1HJXA 3KACA 4DRIA 2DSZA 1RD6A 2RSEA 1W1TA 2OLHA 4ODLA 3UF8A 1J4HA 1LG2A 4WKFA 4WKHA 1NWRA 1E6RA 3WQWA 4DWSA 4DRHA 4DT4A 1TFVA 2IF4A 4Q7NA 2FKEA 1ITXA 1E6ZA
chains in the Genus database with same CATH topology
4ODRA 2YBTA 3O5QA 2ZR5A 4W9QA 4ODNA 1WAWA 1H0IA 4U85A 1F40A 3B9AA 2PPNA 2DPEA 1O6IA 3G6MA 3QOKA 3RMEA 3H9RB 1W9VA 4LAVA 1XRVA 4S3JA 1ROUA 2AOSA 4QT2A 1FKHA 2LPVA 1D7JA 3ARZA 2YBUA 1D7HA 2DG3A 4HARA 1EQ3A 1E6NA 4XAKA 3ALGA 4JYSA 3KABA 4LAYA 1HKKA 1NMWA 4P8VA 4DROA 5GPRA 2MNTA 1A7XA 4G50A 3KAIA 3NRKA 5HWCA 3KAFA 3WD2A 1N1AA 3WQVA 1WB0A 1GOIA 1W9PA 4Z2KA 1HKMA 4HBEA 3AQUA 1X6LA 3ARUA 4FAPA 1BKFA 1FKJA 1YATA 5HTGA 1C9HA 3FXYA 2A3EA 4WJXA 5DIVA 1NWUA 2DG9A 2O92A 1HKIA 4DZ3A 3O5PA 3OOBA 5HT1A 5DEZA 3O5MA 4JFMA 3IK8A 1NWTA 1W1VA 3KADA 4P8XA 2XP9A 4TW6A 3RM9A 1UR8A 4KQZA 1UR9A 1P5QA 4R5EA 1FKIA 2FDMA 4J4NA 2RQSA 4TYOA 4PTMA 3CHEA 3O5OA 3PRBA 5HW8A 4DWSB 2DT3A 2JZVA 3JYJA 1M5YA 3CHDA 1HJWA 4QT3A 1HJVA 2PBCA 4TW7A 1JNSA 5D75A 2LGOA 4MAVA 1KFWA 4DWSC 3B8SA 3PRAA 2VCDA 3PRDA 1FD9A 1SR0A 4LAXA 1W1PA 3ODKA 4GGQA 2XP4A 4P8UA 3AS3A 3IHZA 1D7IA 3WD3A 2MLXA 5GQBA 3NI6A 1QZ2A 1FKDA 3O5LA 2DT0A 4URIA 4TW8A 3O5EA 1Q1CA 2A3BA 4DRKA 4U84A 3RM4A 2L2SA 1JVWA 1LL7A 2ZQUA 2B31A 4ODMA 1FFQA 5JH8A 2PI6A 3VAWA 5HW7A 1JNEA 2DSUA 1OGBA 4QZVB 1W1YA 3OA5A 5HBFA 4DRJA 2ZQSA 1ZBVA 4IQCA 3EY6A 4MNKA 4QIBA 4J4OA 5DO2A 3MDYB 2AWGA 1Q6IA 4WIWA 4ODOA 5GPGA 3O5JA 1FKSA 2VN1A 4LGXA 2XPAA 1HXVA 4Z2LA 3ARVA 5HUAA 3WD4A 2G41A 3ARSA 1ZK6A 3B7XA 4N19A 2DSWA 5I98A 3UQAA 2A3AA 1BL4A 1VF8A 4ZPTR 3AS0A 4MPKA 4O2TA 3WL0A 3WD0A 2UZ5A 3CGNA 4WKAA 3JXVA 3ARPA 4WK9A 4U86A 3O5RA 2F4EA 1GPFA 2WK2A 1WNOA 3CHFA 4Q22A 4DZ2A 4HBOA 3UI4A 4Z2JA 1Q6UA 3WL1A 1ZU8A 2N87A 3ARRA 1OWQA 1LJYA 1NMVA 3TCZA 4MNLA 4L3NA 3LUOA 2RUQA 1FKRA 1NSGA 3RGCA 2Y78A 2RUDA 2KE0A 4ZS6A 2FAPA 5DIUA 5J6EA 2DT1A 1FFRA 3W4RA 2DT2A 3WH0A 1FJDA 3CHCA 1KT0A 1KT1A 3O5KA 3G6LA 1TCOC 3FAPA 1CTNA 4W9PA 2PV2A 4P8WA 4R0XA 3NTPA 4JFKA 2XP3A 2A3CA 4MNMA 1X6NA 5DITA 1XHGA 2O9OA 2Q5AA 2XP7A 3GPKA 3PA7A 2WM0A 1LL6A 2XP6A 4ODPA 2WLYA 1EDQA 4L72B 3KAHA 3CGMA 3TC5A 2QF8A 3WIJA 4Z2GA 2K8IA 2XP5A 4IT6A 4FN2A 1K9TA 2D9FA 2KFWA 3B9DA 2XP8A 4GIVA 1LQ0A 4DH0A 2IUZA 3KAGA 1OGGA 1FKKA 1U79A 3O5GA 4Z2IA 3UI5A 1E6PA 2M2AA 3ARTA 1FKGA 1ZBWA 3CZ8A 3I6CA 3IKDA 2DSVA 4NZCA 5B8IC 3FY1A 2OFNA 1FKLA 4TX0A 5BXJA 4MNJA 1SYTA 3AROA 1E9LA 2PV3A 2WLZA 1D2KA 2XPBA 3UQBA 3JYMA 4BF8A 2M1IA 4DRQA 2G8ZA 4LAWA 3ALFA 4ML4A 4IQ2A 4W9OA 3TDBA 1QPFA 2KR7A 1ZBCA 1ZCNA 3RFWA 2F21A 1E15A 5DF0A 2ZR4A 4ODQA 5HKGA 1D6OA 4ITZA 1JNDA 2M08A 2KO7A 2PPPA 3ARXA 2MLZA 4DRNA 5HWBA 2ITKA 1PBKA 2RURA 3KZ7A 4NSBA 3B9EA 4NNRA 4IPXA 1FAPA 2F2DA 1J4IA 3RM8A 3BXWA 2ZR6A 4TNSA 3WD1A 1W9UA 1EIBA 1PINA 4AY1A 1ZL1A 1B6CA 1H0GA 2RUCA 4ZPVR 1ZB5A 3PR9A 2ZQTA 3ARWA 2MLYA 4MSPA 4JFJA 3AS1A 4JFIA 3O5IA 2LJ4A 1LG1A 1F8AB 1FKBA 1W26A 3O5FA 1J4RA 4DWSD 1ZBKA 1EYMA 1L1PA 4JFLA 2PV1A 1T11A 2DG4A 1JNTA 2LKNA 1FKTA 4Z2HA 4IT4A 4DRMA 1Y0OA 1IX5A 4ODKA 1Q6HA 1YW5A 1FKFA 1NH6A 4ZPWR 4G2PA 3UQIA 4DIPA 2ESCA 2MF9A 3ARYA 4MTVA 4KR0B 2ZQVA 1EHNA 4MGVA 1GUVA 1ROTA 2PPOA 2MPHA 3KCEA 4W5UA 3AS2A 1QPLA 3IKGA 3WKZA 5HW6A 1NWSA 1R9HA 4S3KA 3ARQA 4DRPA 3O5DA 1HKJA 1J6YA 2KI3A 3CH9A 2KGJA 4C02B 1LL4A 3UI6A 1HJXA 3KACA 4DRIA 2DSZA 1RD6A 2RSEA 1W1TA 2OLHA 4ODLA 3UF8A 1J4HA 1LG2A 4WKFA 4WKHA 1NWRA 1E6RA 3WQWA 4DWSA 4DRHA 4DT4A 1TFVA 2IF4A 4Q7NA 2FKEA 1ITXA 1E6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PRD A;  1FD9 A;  4ODR A;  2ITK A;  4LAX A;  1FKR A;  1PBK A;  1NSG A;  3O5Q A;  2ZR5 A;  4W9Q A;  2RUR A;  3RGC A;  2Y78 A;  2RUD A;  3ODK A;  4ODN A;  4GGQ A;  2XP4 A;  2KE0 A;  3KZ7 A;  2FAP A;  5DIU A;  3IHZ A;  5J6E A;  4NNR A;  1D7I A;  4IPX A;  2MLX A;  1FAP A;  4U85 A;  3WH0 A;  1F40 A;  1FJD A;  3NI6 A;  2F2D A;  1J4I A;  1QZ2 A;  1KT0 A;  2PPN A;  1KT1 A;  1FKD A;  3O5K A;  3O5L A;  2ZR6 A;  4TNS A;  1TCO C;  4TW8 A;  3O5E A;  3FAP A;  1Q1C A;  4W9P A;  3H9R B;  1PIN A;  2PV2 A;  4DRK A;  4U84 A;  1B6C A;  2RUC A;  4R0X A;  3NTP A;  2L2S A;  4LAV A;  1JVW A;  1ROU A;  2ZQT A;  2ZQU A;  2MLY A;  4JFK A;  2XP3 A;  4MSP A;  4QT2 A;  4JFJ A;  1FKH A;  2LPV A;  4JFI A;  4ODM A;  5DIT A;  1D7J A;  3O5I A;  2LJ4 A;  1F8A B;  1FKB A;  1W26 A;  3O5F A;  3VAW A;  1J4R A;  2Q5A A;  1D7H A;  2DG3 A;  2XP7 A;  3GPK A;  3PA7 A;  5HW7 A;  1EQ3 A;  2XP6 A;  4ODP A;  4JYS A;  3KAB A;  4LAY A;  1NMW A;  1EYM A;  3KAH A;  3CGM A;  4DRO A;  4JFL A;  1L1P A;  2PV1 A;  3TC5 A;  2MNT A;  2K8I A;  1A7X A;  1T11 A;  2DG4 A;  2XP5 A;  2ZQS A;  3KAI A;  3NRK A;  4FN2 A;  4G50 A;  5HWC A;  3KAF A;  4IQC A;  1JNT A;  3EY6 A;  2D9F A;  2LKN A;  2KFW A;  4QIB A;  2XP8 A;  1N1A A;  4J4O A;  1FKT A;  4GIV A;  3MDY B;  4DRM A;  1Y0O A;  2AWG A;  1Q6I A;  4ODO A;  5GPG A;  3O5J A;  4DH0 A;  4ODK A;  1Q6H A;  3KAG A;  1FKS A;  1FKF A;  1YW5 A;  2VN1 A;  2XPA A;  4FAP A;  1HXV A;  1BKF A;  1YAT A;  1FKJ A;  5HTG A;  1FKK A;  1C9H A;  1U79 A;  3O5G A;  4G2P A;  3UI5 A;  5DIV A;  2M2A A;  3UQI A;  4DIP A;  2DG9 A;  2MF9 A;  5HUA A;  1FKG A;  4DZ3 A;  3O5P A;  3I6C A;  2ZQV A;  1ZK6 A;  3B7X A;  3OOB A;  4MGV A;  4N19 A;  1ROT A;  2PPO A;  2MPH A;  3IKD A;  3KCE A;  5HT1 A;  5B8I C;  5I98 A;  1QPL A;  2OFN A;  3IKG A;  3O5M A;  5HW6 A;  3UQA A;  1R9H A;  1FKL A;  4JFM A;  1BL4 A;  4TX0 A;  5BXJ A;  4DRP A;  3O5D A;  4DRJ A;  3IK8 A;  1J6Y A;  3KAD A;  2KI3 A;  4O2T A;  2KGJ A;  2XP9 A;  4C02 B;  2PV3 A;  4TW6 A;  3UI6 A;  2UZ5 A;  3CGN A;  3KAC A;  2XPB A;  4DRI A;  3JXV A;  3UQB A;  3JYM A;  4BF8 A;  2M1I A;  1P5Q A;  2RSE A;  4DRQ A;  1FKI A;  4J4N A;  2RQS A;  4TYO A;  4ODL A;  4U86 A;  3UF8 A;  3O5O A;  3O5R A;  3PRB A;  5HW8 A;  2F4E A;  4LAW A;  1J4H A;  4IQ2 A;  2JZV A;  3JYJ A;  1M5Y A;  4W9O A;  3TDB A;  4DZ2 A;  1QPF A;  2KR7 A;  4QT3 A;  3UI4 A;  1ZCN A;  1Q6U A;  3RFW A;  2PBC A;  4DRH A;  4DT4 A;  4TW7 A;  2F21 A;  1JNS A;  2N87 A;  2IF4 A;  2ZR4 A;  1NMV A;  4ODQ A;  5HKG A;  3TCZ A;  1D6O A;  5D75 A;  2LGO A;  4ITZ A;  2FKE A;  2M08 A;  2KO7 A;  2PPP A;  3LUO A;  2RUQ A;  2MLZ A;  4DRN A;  5HWB A;  2VCD A; 
#chains in the Genus database with same CATH topology
 4ODR A;  2YBT A;  3O5Q A;  2ZR5 A;  4W9Q A;  4ODN A;  1WAW A;  1JCH B;  1H0I A;  4U85 A;  1F40 A;  3B9A A;  2PPN A;  2DPE A;  1O6I A;  2F23 A;  3G6M A;  3GU0 A;  3QOK A;  3RME A;  3H9R B;  1W9V A;  4LAV A;  1XRV A;  4S3J A;  1ROU A;  2AOS A;  4QT2 A;  1FKH A;  2LPV A;  1D7J A;  3ARZ A;  2YBU A;  1D7H A;  2DG3 A;  4HAR A;  1EQ3 A;  1E6N A;  1GRJ A;  3GTY X;  4XAK A;  3ALG A;  4JYS A;  3KAB A;  4LAY A;  1HKK A;  1NMW A;  4P8V A;  4DRO A;  5GPR A;  2MNT A;  1A7X A;  4G50 A;  3KAI A;  3NRK A;  5HWC A;  3KAF A;  3WD2 A;  1N1A A;  3WQV A;  1WB0 A;  1GOI A;  1W9P A;  4Z2K A;  1HKM A;  4HBE A;  3AQU A;  1X6L A;  3ARU A;  4FAP A;  1BKF A;  1FKJ A;  1YAT A;  5HTG A;  1C9H A;  3FXY A;  2A3E A;  4WJX A;  5DIV A;  1NWU A;  2DG9 A;  2O92 A;  1HKI A;  4DZ3 A;  3O5P A;  3OOB A;  5HT1 A;  5DEZ A;  3O5M A;  4JFM A;  3IK8 A;  1NWT A;  1W1V A;  3KAD A;  4P8X A;  2XP9 A;  4TW6 A;  3RM9 A;  1UR8 A;  4KQZ A;  1UR9 A;  1P5Q A;  4R5E A;  1FKI A;  2FDM A;  4J4N A;  2RQS A;  4TYO A;  4PTM A;  3CHE A;  3O5O A;  3PRB A;  5HW8 A;  4DWS B;  2DT3 A;  2JZV A;  3JYJ A;  1M5Y A;  3CHD A;  1HJW A;  4QT3 A;  1HJV A;  2PBC A;  4TW7 A;  1JNS A;  5D75 A;  2LGO A;  4MAV A;  1KFW A;  4DWS C;  3B8S A;  3PRA A;  2VCD A;  3PRD A;  1FD9 A;  1SR0 A;  4LAX A;  1W1P A;  3ODK A;  4GGQ A;  2XP4 A;  4P8U A;  3AS3 A;  3IHZ A;  1D7I A;  3WD3 A;  2MLX A;  5GQB A;  3NI6 A;  1QZ2 A;  1FKD A;  3O5L A;  2DT0 A;  4URI A;  4TW8 A;  3O5E A;  1Q1C A;  2A3B A;  4DRK A;  4U84 A;  3RM4 A;  2L2S A;  1JVW A;  1LL7 A;  2ZQU A;  3BMB A;  2B31 A;  4ODM A;  1FFQ A;  5JH8 A;  2PI6 A;  3VAW A;  5HW7 A;  1JNE A;  2DSU A;  1OGB A;  4QZV B;  1W1Y A;  3OA5 A;  5HBF A;  4DRJ A;  2ZQS A;  1ZBV A;  3EIP A;  4IQC A;  3EY6 A;  4MNK A;  4QIB A;  4J4O A;  5DO2 A;  3MDY B;  2AWG A;  1Q6I A;  4WIW A;  4ODO A;  5GPG A;  3O5J A;  1FKS A;  2VN1 A;  4LGX A;  2XPA A;  1HXV A;  4Z2L A;  3ARV A;  5HUA A;  3WD4 A;  2G41 A;  3ARS A;  1ZK6 A;  3B7X A;  4N19 A;  2DSW A;  5I98 A;  3UQA A;  2P4V A;  2A3A A;  1BL4 A;  1VF8 A;  4ZPT R;  3AS0 A;  4MPK A;  4O2T A;  3WL0 A;  3WD0 A;  2UZ5 A;  3CGN A;  4WKA A;  3JXV A;  3ARP A;  4WK9 A;  4U86 A;  3O5R A;  2F4E A;  1GPF A;  2B5U B;  2WK2 A;  1WNO A;  3CHF A;  4Q22 A;  4DZ2 A;  4HBO A;  3UI4 A;  4Z2J A;  1Q6U A;  3WL1 A;  1ZU8 A;  2N87 A;  3ARR A;  1OWQ A;  1LJY A;  1NMV A;  3TCZ A;  4MNL A;  4L3N A;  3LUO A;  2RUQ A;  1FKR A;  1NSG A;  3RGC A;  2Y78 A;  2RUD A;  2PN0 A;  2KE0 A;  4ZS6 A;  2FAP A;  5DIU A;  5J6E A;  2DT1 A;  1FFR A;  3W4R A;  2DT2 A;  3WH0 A;  1FJD A;  3CHC A;  1KT0 A;  1KT1 A;  3O5K A;  3G6L A;  4UDM A;  1TCO C;  3FAP A;  1CTN A;  4W9P A;  2PV2 A;  4P8W A;  4R0X A;  3NTP A;  4JFK A;  2XP3 A;  2A3C A;  4MNM A;  1X6N A;  5DIT A;  1XHG A;  2O9O A;  2Q5A A;  2XP7 A;  3GPK A;  3PA7 A;  2WM0 A;  1LL6 A;  2XP6 A;  4ODP A;  2WLY A;  1EDQ A;  4L72 B;  3KAH A;  3CGM A;  3TC5 A;  2QF8 A;  3WIJ A;  4Z2G A;  2K8I A;  2XP5 A;  4IT6 A;  4FN2 A;  1K9T A;  2D9F A;  2KFW A;  3B9D A;  2XP8 A;  4GIV A;  1LQ0 A;  4DH0 A;  2IUZ A;  3KAG A;  1OGG A;  1FKK A;  1U79 A;  3O5G A;  4Z2I A;  3UI5 A;  1E6P A;  2M2A A;  3ART A;  1FKG A;  1ZBW A;  3CZ8 A;  3I6C A;  3IKD A;  2DSV A;  4NZC A;  5B8I C;  3FY1 A;  2OFN A;  1FKL A;  4TX0 A;  5BXJ A;  4MNJ A;  1SYT A;  3ARO A;  1E9L A;  2PV3 A;  2WLZ A;  1D2K A;  2XPB A;  3UQB A;  3JYM A;  4BF8 A;  2M1I A;  4DRQ A;  1E44 A;  2G8Z A;  4LAW A;  3ALF A;  4ML4 A;  4IQ2 A;  4W9O A;  2EUL A;  3TDB A;  1QPF A;  2KR7 A;  1ZBC A;  1ZCN A;  3RFW A;  2F21 A;  1E15 A;  5DF0 A;  2ZR4 A;  4ODQ A;  5HKG A;  1D6O A;  4ITZ A;  1JND A;  2M08 A;  2KO7 A;  2PPP A;  3ARX A;  2MLZ A;  4DRN A;  5HWB A;  2ITK A;  1PBK A;  2RUR A;  3KZ7 A;  4NSB A;  3B9E A;  4NNR A;  4IPX A;  1FAP A;  2F2D A;  1J4I A;  3RM8 A;  3BXW A;  2ZR6 A;  2ETN A;  4TNS A;  3WD1 A;  1W9U A;  1EIB A;  1PIN A;  4AY1 A;  1ZL1 A;  1B6C A;  1H0G A;  2RUC A;  4ZPV R;  1ZB5 A;  3PR9 A;  2ZQT A;  3ARW A;  2MLY A;  4MSP A;  4JFJ A;  3AS1 A;  4JFI A;  3O5I A;  2LJ4 A;  1LG1 A;  1F8A B;  1FKB A;  1W26 A;  3O5F A;  1J4R A;  4DWS D;  1ZBK A;  1EYM A;  1L1P A;  4JFL A;  2PV1 A;  1T11 A;  2DG4 A;  1JNT A;  2LKN A;  1FKT A;  4Z2H A;  4IT4 A;  4DRM A;  1Y0O A;  1IX5 A;  4ODK A;  1Q6H A;  1YW5 A;  1FKF A;  1NH6 A;  4ZPW R;  4G2P A;  3UQI A;  4DIP A;  2ESC A;  2MF9 A;  3ARY A;  4MTV A;  4KR0 B;  2ZQV A;  1EHN A;  4MGV A;  1GUV A;  1ROT A;  2PPO A;  2MPH A;  3KCE A;  4W5U A;  3AS2 A;  1QPL A;  3IKG A;  3WKZ A;  5HW6 A;  1NWS A;  1R9H A;  4S3K A;  3ARQ A;  4DRP A;  3O5D A;  1HKJ A;  1J6Y A;  2KI3 A;  3CH9 A;  2KGJ A;  4C02 B;  1LL4 A;  3UI6 A;  1HJX A;  3KAC A;  4DRI A;  2DSZ A;  1RD6 A;  2RSE A;  1W1T A;  2OLH A;  4ODL A;  3UF8 A;  1J4H A;  1LG2 A;  4WKF A;  4WKH A;  1NWR A;  1E6R A;  3WQW A;  4DWS A;  4DRH A;  4DT4 A;  1TFV A;  2IF4 A;  4Q7N A;  2FKE A;  1ITX A;  1E6Z A; 
#chains in the Genus database with same CATH homology
 4ODR A;  2YBT A;  3O5Q A;  2ZR5 A;  4W9Q A;  4ODN A;  1WAW A;  1H0I A;  4U85 A;  1F40 A;  3B9A A;  2PPN A;  2DPE A;  1O6I A;  3G6M A;  3QOK A;  3RME A;  3H9R B;  1W9V A;  4LAV A;  1XRV A;  4S3J A;  1ROU A;  2AOS A;  4QT2 A;  1FKH A;  2LPV A;  1D7J A;  3ARZ A;  2YBU A;  1D7H A;  2DG3 A;  4HAR A;  1EQ3 A;  1E6N A;  4XAK A;  3ALG A;  4JYS A;  3KAB A;  4LAY A;  1HKK A;  1NMW A;  4P8V A;  4DRO A;  5GPR A;  2MNT A;  1A7X A;  4G50 A;  3KAI A;  3NRK A;  5HWC A;  3KAF A;  3WD2 A;  1N1A A;  3WQV A;  1WB0 A;  1GOI A;  1W9P A;  4Z2K A;  1HKM A;  4HBE A;  3AQU A;  1X6L A;  3ARU A;  4FAP A;  1BKF A;  1FKJ A;  1YAT A;  5HTG A;  1C9H A;  3FXY A;  2A3E A;  4WJX A;  5DIV A;  1NWU A;  2DG9 A;  2O92 A;  1HKI A;  4DZ3 A;  3O5P A;  3OOB A;  5HT1 A;  5DEZ A;  3O5M A;  4JFM A;  3IK8 A;  1NWT A;  1W1V A;  3KAD A;  4P8X A;  2XP9 A;  4TW6 A;  3RM9 A;  1UR8 A;  4KQZ A;  1UR9 A;  1P5Q A;  4R5E A;  1FKI A;  2FDM A;  4J4N A;  2RQS A;  4TYO A;  4PTM A;  3CHE A;  3O5O A;  3PRB A;  5HW8 A;  4DWS B;  2DT3 A;  2JZV A;  3JYJ A;  1M5Y A;  3CHD A;  1HJW A;  4QT3 A;  1HJV A;  2PBC A;  4TW7 A;  1JNS A;  5D75 A;  2LGO A;  4MAV A;  1KFW A;  4DWS C;  3B8S A;  3PRA A;  2VCD A;  3PRD A;  1FD9 A;  1SR0 A;  4LAX A;  1W1P A;  3ODK A;  4GGQ A;  2XP4 A;  4P8U A;  3AS3 A;  3IHZ A;  1D7I A;  3WD3 A;  2MLX A;  5GQB A;  3NI6 A;  1QZ2 A;  1FKD A;  3O5L A;  2DT0 A;  4URI A;  4TW8 A;  3O5E A;  1Q1C A;  2A3B A;  4DRK A;  4U84 A;  3RM4 A;  2L2S A;  1JVW A;  1LL7 A;  2ZQU A;  2B31 A;  4ODM A;  1FFQ A;  5JH8 A;  2PI6 A;  3VAW A;  5HW7 A;  1JNE A;  2DSU A;  1OGB A;  4QZV B;  1W1Y A;  3OA5 A;  5HBF A;  4DRJ A;  2ZQS A;  1ZBV A;  4IQC A;  3EY6 A;  4MNK A;  4QIB A;  4J4O A;  5DO2 A;  3MDY B;  2AWG A;  1Q6I A;  4WIW A;  4ODO A;  5GPG A;  3O5J A;  1FKS A;  2VN1 A;  4LGX A;  2XPA A;  1HXV A;  4Z2L A;  3ARV A;  5HUA A;  3WD4 A;  2G41 A;  3ARS A;  1ZK6 A;  3B7X A;  4N19 A;  2DSW A;  5I98 A;  3UQA A;  2A3A A;  1BL4 A;  1VF8 A;  4ZPT R;  3AS0 A;  4MPK A;  4O2T A;  3WL0 A;  3WD0 A;  2UZ5 A;  3CGN A;  4WKA A;  3JXV A;  3ARP A;  4WK9 A;  4U86 A;  3O5R A;  2F4E A;  1GPF A;  2WK2 A;  1WNO A;  3CHF A;  4Q22 A;  4DZ2 A;  4HBO A;  3UI4 A;  4Z2J A;  1Q6U A;  3WL1 A;  1ZU8 A;  2N87 A;  3ARR A;  1OWQ A;  1LJY A;  1NMV A;  3TCZ A;  4MNL A;  4L3N A;  3LUO A;  2RUQ A;  1FKR A;  1NSG A;  3RGC A;  2Y78 A;  2RUD A;  2KE0 A;  4ZS6 A;  2FAP A;  5DIU A;  5J6E A;  2DT1 A;  1FFR A;  3W4R A;  2DT2 A;  3WH0 A;  1FJD A;  3CHC A;  1KT0 A;  1KT1 A;  3O5K A;  3G6L A;  1TCO C;  3FAP A;  1CTN A;  4W9P A;  2PV2 A;  4P8W A;  4R0X A;  3NTP A;  4JFK A;  2XP3 A;  2A3C A;  4MNM A;  1X6N A;  5DIT A;  1XHG A;  2O9O A;  2Q5A A;  2XP7 A;  3GPK A;  3PA7 A;  2WM0 A;  1LL6 A;  2XP6 A;  4ODP A;  2WLY A;  1EDQ A;  4L72 B;  3KAH A;  3CGM A;  3TC5 A;  2QF8 A;  3WIJ A;  4Z2G A;  2K8I A;  2XP5 A;  4IT6 A;  4FN2 A;  1K9T A;  2D9F A;  2KFW A;  3B9D A;  2XP8 A;  4GIV A;  1LQ0 A;  4DH0 A;  2IUZ A;  3KAG A;  1OGG A;  1FKK A;  1U79 A;  3O5G A;  4Z2I A;  3UI5 A;  1E6P A;  2M2A A;  3ART A;  1FKG A;  1ZBW A;  3CZ8 A;  3I6C A;  3IKD A;  2DSV A;  4NZC A;  5B8I C;  3FY1 A;  2OFN A;  1FKL A;  4TX0 A;  5BXJ A;  4MNJ A;  1SYT A;  3ARO A;  1E9L A;  2PV3 A;  2WLZ A;  1D2K A;  2XPB A;  3UQB A;  3JYM A;  4BF8 A;  2M1I A;  4DRQ A;  2G8Z A;  4LAW A;  3ALF A;  4ML4 A;  4IQ2 A;  4W9O A;  3TDB A;  1QPF A;  2KR7 A;  1ZBC A;  1ZCN A;  3RFW A;  2F21 A;  1E15 A;  5DF0 A;  2ZR4 A;  4ODQ A;  5HKG A;  1D6O A;  4ITZ A;  1JND A;  2M08 A;  2KO7 A;  2PPP A;  3ARX A;  2MLZ A;  4DRN A;  5HWB A;  2ITK A;  1PBK A;  2RUR A;  3KZ7 A;  4NSB A;  3B9E A;  4NNR A;  4IPX A;  1FAP A;  2F2D A;  1J4I A;  3RM8 A;  3BXW A;  2ZR6 A;  4TNS A;  3WD1 A;  1W9U A;  1EIB A;  1PIN A;  4AY1 A;  1ZL1 A;  1B6C A;  1H0G A;  2RUC A;  4ZPV R;  1ZB5 A;  3PR9 A;  2ZQT A;  3ARW A;  2MLY A;  4MSP A;  4JFJ A;  3AS1 A;  4JFI A;  3O5I A;  2LJ4 A;  1LG1 A;  1F8A B;  1FKB A;  1W26 A;  3O5F A;  1J4R A;  4DWS D;  1ZBK A;  1EYM A;  1L1P A;  4JFL A;  2PV1 A;  1T11 A;  2DG4 A;  1JNT A;  2LKN A;  1FKT A;  4Z2H A;  4IT4 A;  4DRM A;  1Y0O A;  1IX5 A;  4ODK A;  1Q6H A;  1YW5 A;  1FKF A;  1NH6 A;  4ZPW R;  4G2P A;  3UQI A;  4DIP A;  2ESC A;  2MF9 A;  3ARY A;  4MTV A;  4KR0 B;  2ZQV A;  1EHN A;  4MGV A;  1GUV A;  1ROT A;  2PPO A;  2MPH A;  3KCE A;  4W5U A;  3AS2 A;  1QPL A;  3IKG A;  3WKZ A;  5HW6 A;  1NWS A;  1R9H A;  4S3K A;  3ARQ A;  4DRP A;  3O5D A;  1HKJ A;  1J6Y A;  2KI3 A;  3CH9 A;  2KGJ A;  4C02 B;  1LL4 A;  3UI6 A;  1HJX A;  3KAC A;  4DRI A;  2DSZ A;  1RD6 A;  2RSE A;  1W1T A;  2OLH A;  4ODL A;  3UF8 A;  1J4H A;  1LG2 A;  4WKF A;  4WKH A;  1NWR A;  1E6R A;  3WQW A;  4DWS A;  4DRH A;  4DT4 A;  1TFV A;  2IF4 A;  4Q7N A;  2FKE A;  1ITX A;  1E6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...