4C02B

Crystal structure of human acvr1 (alk2) in complex with fkbp12.6 and dorsomorphin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACTIVIN RECEPTOR TYPE-1
publication title Crystal Structure of Human Acvr1 (Alk2) in Complex with Fkbp12.6 And Dorsomorphin
rcsb
source organism Homo sapiens
molecule tags Transferase/isomerase
total genus 24
structure length 108
sequence length 108
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4c02B00
1BL4A 2KGJA 2LPVA 3O5OA 1T11A 3O5FA 5HW7A 3B7XA 5I98A 3UQAA 1L1PA 4W9PA 5B8IC 2F2DA 1J4RA 2DG9A 3IKGA 3RFWA 4MGVA 4J4NA 4IQCA 1D7JA 3EY6A 3IHZA 1F8AB 4FN2A 2RUDA 3KAGA 4ODNA 5DIVA 3MDYB 2ZQSA 2RUCA 5HT1A 4ODKA 1FKJA 2OFNA 3KAFA 4LAYA 2PPNA 2RSEA 3CGNA 2MLXA 4NNRA 4TYOA 4W9QA 4C02B 4QT3A 3TCZA 4IQ2A 2N87A 3O5IA 4G2PA 5BXJA 3O5MA 2ZR4A 2XP7A 4J4OA 2DG3A 4DT4A 5GPGA 2PV3A 5DIUA 2D9FA 2M08A 4ITZA 4DRMA 3JXVA 1FKDA 4N19A 3RGCA 3O5JA 1U79A 2LJ4A 3O5DA 1FKKA 2L2SA 2RUQA 3PA7A 2PV2A 2XP8A 4DIPA 4DRJA 5HKGA 1QPFA 4ODMA 2PV1A 3TC5A 1FKTA 2MLYA 3O5LA 4JYSA 4JFKA 2ZQVA 3KAHA 1FJDA 4TX0A 1ZCNA 1KT0A 3OOBA 3UQBA 1J4IA 3IKDA 1W26A 4DZ3A 4MSPA 1ROUA 2MPHA 3KAIA 3O5EA 4R0XA 2DG4A 2Q5AA 3PRBA 1F40A 2MF9A 4TW6A 4TW7A 5J6EA 1FKFA 1JNTA 3UF8A 1J6YA 2XP4A 3KZ7A 1FKHA 4DRNA 1KT1A 3PRDA 1QPLA 1PBKA 1JNSA 3O5GA 1M5YA 2RQSA 4ODQA 1N1AA 1TCOC 3UQIA 1JVWA 1YATA 2LGOA 4QIBA 4DZ2A 5HTGA 1FKIA 4LAXA 2F4EA 3H9RB 4JFLA 2RURA 4IPXA 3O5KA 3WH0A 2XP9A 4G50A 4LAVA 5HWBA 3IK8A 1A7XA 1FKLA 1Q6HA 3KABA 4O2TA 1NMVA 2K8IA 1D7HA 3I6CA 3NI6A 2PPOA 1D7IA 3LUOA 3ODKA 2KE0A 4ODLA 1Y0OA 1R9HA 5HW8A 5HW6A 3JYJA 2M1IA 1NMWA 1EYMA 1FAPA 3CGMA 3GPKA 2Y78A 3UI4A 2JZVA 2PPPA 4JFJA 2UZ5A 3NTPA 3JYMA 4DRIA 2IF4A 4DRQA 1HXVA 3TDBA 2LKNA 2MLZA 3O5QA 2M2AA 2KI3A 3UI5A 2FKEA 2ITKA 2XPAA 2KR7A 1B6CA 5DITA 4JFIA 4JFMA 1Q6UA 4DRKA 2XPBA 1C9HA 1FKBA 1PINA 2KO7A 2ZQUA 4W9OA 1FKRA 1FKSA 1ROTA 4ODPA 1ZK6A 2PBCA 3KADA 3NRKA 4FAPA 5D75A 3O5RA 4LAWA 4U86A 4DRHA 1BKFA 5HUAA 1FD9A 3UI6A 1YW5A 5HWCA 1Q1CA 1Q6IA 2KFWA 3VAWA 3FAPA 2XP6A 4ODRA 2AWGA 2ZR6A 4QT2A 4TNSA 1EQ3A 2XP3A 2XP5A 4DH0A 1NSGA 4DRPA 1J4HA 4GGQA 1P5QA 4ODOA 2FAPA 2F21A 1D6OA 4BF8A 3O5PA 1QZ2A 2ZQTA 4U84A 4DROA 2VCDA 4U85A 2VN1A 4GIVA 3KACA 4TW8A 3KCEA 2MNTA 2ZR5A 1FKGA
chains in the Genus database with same CATH superfamily
1UR8A 1BL4A 2KGJA 1FFRA 3AS3A 1ZBVA 1OWQA 2DSWA 1UR9A 1HKKA 1L1PA 3WD0A 4MGVA 2WM0A 2WLYA 3IHZA 3KAGA 5DIVA 2ZQSA 1JNEA 4LAYA 4NNRA 2A3AA 2MLXA 4C02B 4QT3A 2N87A 3BMBA 5BXJA 4MNKA 3ALGA 1LL7A 4DT4A 5GPGA 1U79A 4Z2HA 1FKKA 2L2SA 4P8XA 2RUQA 1LG2A 2XP8A 5HKGA 3W4RA 3ARTA 3B8SA 1FKTA 2B31A 1NWUA 4TX0A 1J4IA 1ROUA 3O5EA 4PTMA 4S3JA 4AY1A 2MF9A 4TW6A 1E15A 5DF0A 3KZ7A 4DRNA 3WL0A 3EIPA 3PRDA 1PBKA 1EDQA 2RQSA 4ODQA 2A3BA 1D2KA 4DZ2A 3H9RB 1E9LA 2RURA 4IPXA 2XP9A 4LAVA 2G8ZA 1A7XA 2K8IA 4WKFA 1D7HA 5HW8A 5HW6A 3JYJA 1NMWA 3CGMA 5HBFA 2UZ5A 3JYMA 3TDBA 2LKNA 4IT6A 3UI5A 4L3NA 2B5UB 5DITA 1Q6UA 4DRKA 4W9OA 1FKSA 3OA5A 2PBCA 3BXWA 1E6NA 3PRAA 1TFVA 1CTNA 1FD9A 5HWCA 3FAPA 2AWGA 4QT2A 4TNSA 2XP5A 4DH0A 1J4HA 1LL6A 4KR0B 4GGQA 4P8UA 1GRJA 4BF8A 2PI6A 3KACA 4TW8A 5GPRA 2LPVA 3ARZA 1W9UA 4Q22A 3O5FA 4IT4A 5I98A 3UQAA 4W9PA 1J4RA 1H0GA 3RFWA 2AOSA 1NWTA 4J4NA 4WJXA 3FXYA 2DT0A 3RMEA 1KFWA 4FN2A 4ODNA 3MDYB 5HT1A 3CGNA 4W9QA 4P8WA 3TCZA 3CH9A 4G2PA 5DEZA 1RD6A 2ZR4A 3O5MA 2XP7A 2PV3A 4DRMA 4DWSD 1NWRA 2EULA 2PV2A 3CZ8A 3ARXA 1HJXA 3O5LA 1LG1A 4JFKA 1ZCNA 1FFQA 1W26A 4DZ3A 4MSPA 3KAIA 4URIA 3CHEA 2QF8A 4Z2LA 2DSZA 2IUZA 2XP4A 2DT2A 3PR9A 1JVWA 4QIBA 2LGOA 2YBTA 1FKIA 2F4EA 5HWBA 5JH8A 3IK8A 1FKLA 4W5UA 3WQWA 1LJYA 1NMVA 3AS1A 3UI4A 3I6CA 3WH0A 1D7IA 1OGGA 2ETNA 2KE0A 1R9HA 1HKJA 2DSUA 4ZPTR 1EYMA 4R5EA 3ARUA 2Y78A 2JZVA 1HXVA 1E6PA 2DSVA 2ITKA 2XPAA 3CHFA 1EIBA 3ARWA 1B6CA 1X6LA 1C9HA 3WD4A 2F23A 1ROTA 1ZK6A 1X6NA 5D75A 4LAWA 4HBEA 3ALFA 3QOKA 1Q1CA 2KFWA 1WAWA 2O92A 1EQ3A 1O6IA 1H0IA 1E6RA 4ODOA 3ARQA 1QZ2A 4ZS6A 4DROA 1JNDA 1ZBCA 3KCEA 4MTVA 1ZBKA 4MAVA 5HTGA 1ZBWA 1HKIA 2YBUA 2FDMA 5HW7A 3B7XA 4P8VA 1XHGA 4IQCA 3WD3A 3EY6A 1F8AB 1FKJA 2ESCA 2PPNA 1E6ZA 4IQ2A 3O5IA 3AS0A 3G6LA 3RM8A 4J4OA 1VF8A 5DIUA 2D9FA 2M08A 4ITZA 3JXVA 1FKDA 4N19A 3O5JA 1SYTA 3GU0A 2A3EA 1W1PA 3PA7A 1LQ0A 4DRJA 1QPFA 4ODMA 2PV1A 3G6MA 2ZQVA 1KT0A 3UQBA 4L72B 3CHCA 4XAKA 1K9TA 3IKDA 4MNLA 1HJVA 2MPHA 4R0XA 2Q5AA 3PRBA 4TW7A 1ITXA 3WQVA 1KT1A 1ZU8A 4S3KA 1QPLA 1JNSA 4UDMA 1M5YA 3UQIA 1TCOC 4LAXA 4MNJA 1W9VA 1W1YA 4NSBA 4G50A 1W9PA 4O2TA 1Q6HA 3KABA 1GOIA 4QZVB 4ODLA 2PPOA 3AROA 2DPEA 4JFJA 3NTPA 4DRIA 2IF4A 4DRQA 2MLZA 3O5QA 2M2AA 3CHDA 2FKEA 1WB0A 1LL4A 4JFMA 2XPBA 1PINA 2KO7A 4ODPA 4DWSA 2A3CA 3NRKA 4FAPA 4Z2KA 4U86A 5HUAA 3UI6A 1YW5A 1Q6IA 3VAWA 4ODRA 2ZR6A 1P5QA 2FAPA 1D6OA 2ZQTA 4Q7NA 4U84A 3AQUA 3B9DA 3ARSA 4U85A 4ZPVR 2WLZA 1OGBA 3ARVA 4NZCA 1NH6A 3RM4A 4WIWA 3O5OA 1T11A 4ZPWR 3WD2A 5B8IC 2F2DA 2DG9A 3IKGA 4MNMA 1D7JA 2RUDA 3ARRA 1GUVA 2RUCA 4ODKA 4TYOA 2OFNA 3ARPA 3KAFA 2RSEA 4LGXA 3FY1A 2WK2A 2DG3A 3RGCA 3O5DA 2LJ4A 4KQZA 4DIPA 2OLHA 3TC5A 2MLYA 4JYSA 3KAHA 5GQBA 1W1TA 1FJDA 3OOBA 1ZB5A 3RM9A 3GTYX 4WKAA 1HKMA 4WKHA 3B9EA 1XRVA 1E44A 2DG4A 3ARYA 2G41A 1F40A 5J6EA 1FKFA 1JNTA 3UF8A 1J6YA 1FKHA 3O5GA 1NWSA 1N1AA 1YATA 4Z2JA 4JFLA 3O5KA 4Z2IA 1IX5A 3ODKA 3NI6A 3LUOA 1Y0OA 2M1IA 3GPKA 1FAPA 4MPKA 1EHNA 3AS2A 1ZL1A 2PPPA 4Z2GA 2PN0A 2KI3A 2DT3A 4HARA 2P4VA 1WNOA 2KR7A 4JFIA 1FKBA 4DWSB 2ZQUA 1FKRA 3B9AA 3WL1A 1HJWA 1GPFA 4DWSC 3KADA 3O5RA 4DRHA 1BKFA 4WK9A 1JCHB 3WIJA 2XP6A 3WKZA 2O9OA 2XP3A 1W1VA 4HBOA 1NSGA 2DT1A 4DRPA 2F21A 3O5PA 3WD1A 1SR0A 2VCDA 2VN1A 4GIVA 5DO2A 2MNTA 2ZR5A 1FKGA 4ML4A
chains in the Genus database with same CATH topology
1UR8A 1BL4A 2KGJA 1FFRA 3AS3A 1ZBVA 1OWQA 2DSWA 1UR9A 1HKKA 1L1PA 3WD0A 4MGVA 2WM0A 2WLYA 3IHZA 3KAGA 5DIVA 2ZQSA 1JNEA 4LAYA 4NNRA 2A3AA 2MLXA 4C02B 4QT3A 2N87A 5BXJA 4MNKA 3ALGA 1LL7A 4DT4A 5GPGA 1U79A 4Z2HA 1FKKA 2L2SA 4P8XA 2RUQA 1LG2A 2XP8A 5HKGA 3W4RA 3ARTA 3B8SA 1FKTA 2B31A 1NWUA 4TX0A 1J4IA 1ROUA 3O5EA 4PTMA 4S3JA 4AY1A 2MF9A 4TW6A 1E15A 5DF0A 3KZ7A 4DRNA 3WL0A 3PRDA 1PBKA 1EDQA 2RQSA 4ODQA 2A3BA 1D2KA 4DZ2A 3H9RB 1E9LA 2RURA 4IPXA 2XP9A 4LAVA 2G8ZA 1A7XA 2K8IA 4WKFA 1D7HA 5HW8A 5HW6A 3JYJA 1NMWA 3CGMA 5HBFA 2UZ5A 3JYMA 3TDBA 2LKNA 4IT6A 3UI5A 4L3NA 5DITA 1Q6UA 4DRKA 4W9OA 1FKSA 3OA5A 2PBCA 3BXWA 1E6NA 3PRAA 1TFVA 1CTNA 1FD9A 5HWCA 3FAPA 2AWGA 4QT2A 4TNSA 2XP5A 4DH0A 1J4HA 1LL6A 4KR0B 4GGQA 4P8UA 4BF8A 2PI6A 3KACA 4TW8A 5GPRA 2LPVA 3ARZA 1W9UA 4Q22A 3O5FA 4IT4A 5I98A 3UQAA 4W9PA 1J4RA 1H0GA 3RFWA 2AOSA 1NWTA 4J4NA 4WJXA 3FXYA 2DT0A 3RMEA 1KFWA 4FN2A 4ODNA 3MDYB 5HT1A 3CGNA 4W9QA 4P8WA 3TCZA 3CH9A 4G2PA 5DEZA 1RD6A 2ZR4A 3O5MA 2XP7A 2PV3A 4DRMA 4DWSD 1NWRA 2PV2A 3CZ8A 3ARXA 1HJXA 3O5LA 1LG1A 4JFKA 1ZCNA 1FFQA 1W26A 4DZ3A 4MSPA 3KAIA 4URIA 3CHEA 2QF8A 4Z2LA 2DSZA 2IUZA 2XP4A 2DT2A 3PR9A 1JVWA 4QIBA 2LGOA 2YBTA 1FKIA 2F4EA 5HWBA 5JH8A 3IK8A 1FKLA 4W5UA 3WQWA 1LJYA 1NMVA 3AS1A 3UI4A 3I6CA 3WH0A 1D7IA 1OGGA 2KE0A 1R9HA 1HKJA 2DSUA 4ZPTR 1EYMA 4R5EA 3ARUA 2Y78A 2JZVA 1HXVA 1E6PA 2DSVA 2ITKA 2XPAA 3CHFA 1EIBA 3ARWA 1B6CA 1X6LA 1C9HA 3WD4A 1ROTA 1ZK6A 1X6NA 5D75A 4LAWA 4HBEA 3ALFA 3QOKA 1Q1CA 2KFWA 1WAWA 2O92A 1EQ3A 1O6IA 1H0IA 1E6RA 4ODOA 3ARQA 1QZ2A 4ZS6A 4DROA 1JNDA 1ZBCA 3KCEA 4MTVA 1ZBKA 4MAVA 5HTGA 1ZBWA 1HKIA 2YBUA 2FDMA 5HW7A 3B7XA 4P8VA 1XHGA 4IQCA 3WD3A 3EY6A 1F8AB 1FKJA 2ESCA 2PPNA 1E6ZA 4IQ2A 3O5IA 3AS0A 3G6LA 3RM8A 4J4OA 1VF8A 5DIUA 2D9FA 2M08A 4ITZA 3JXVA 1FKDA 4N19A 3O5JA 1SYTA 2A3EA 1W1PA 3PA7A 1LQ0A 4DRJA 1QPFA 4ODMA 2PV1A 3G6MA 2ZQVA 1KT0A 3UQBA 4L72B 3CHCA 4XAKA 1K9TA 3IKDA 4MNLA 1HJVA 2MPHA 4R0XA 2Q5AA 3PRBA 4TW7A 1ITXA 3WQVA 1KT1A 1ZU8A 4S3KA 1QPLA 1JNSA 1M5YA 3UQIA 1TCOC 4LAXA 4MNJA 1W9VA 1W1YA 4NSBA 4G50A 1W9PA 4O2TA 1Q6HA 3KABA 1GOIA 4QZVB 4ODLA 2PPOA 3AROA 2DPEA 4JFJA 3NTPA 4DRIA 2IF4A 4DRQA 2MLZA 3O5QA 2M2AA 3CHDA 2FKEA 1WB0A 1LL4A 4JFMA 2XPBA 1PINA 2KO7A 4ODPA 4DWSA 2A3CA 3NRKA 4FAPA 4Z2KA 4U86A 5HUAA 3UI6A 1YW5A 1Q6IA 3VAWA 4ODRA 2ZR6A 1P5QA 2FAPA 1D6OA 2ZQTA 4Q7NA 4U84A 3AQUA 3B9DA 3ARSA 4U85A 4ZPVR 2WLZA 1OGBA 3ARVA 4NZCA 1NH6A 3RM4A 4WIWA 3O5OA 1T11A 4ZPWR 3WD2A 5B8IC 2F2DA 2DG9A 3IKGA 4MNMA 1D7JA 2RUDA 3ARRA 1GUVA 2RUCA 4ODKA 4TYOA 2OFNA 3ARPA 3KAFA 2RSEA 4LGXA 3FY1A 2WK2A 2DG3A 3RGCA 3O5DA 2LJ4A 4KQZA 4DIPA 2OLHA 3TC5A 2MLYA 4JYSA 3KAHA 5GQBA 1W1TA 1FJDA 3OOBA 1ZB5A 3RM9A 4WKAA 1HKMA 4WKHA 3B9EA 1XRVA 2DG4A 3ARYA 2G41A 1F40A 5J6EA 1FKFA 1JNTA 3UF8A 1J6YA 1FKHA 3O5GA 1NWSA 1N1AA 1YATA 4Z2JA 4JFLA 3O5KA 4Z2IA 1IX5A 3ODKA 3NI6A 3LUOA 1Y0OA 2M1IA 3GPKA 1FAPA 4MPKA 1EHNA 3AS2A 1ZL1A 2PPPA 4Z2GA 2KI3A 2DT3A 4HARA 1WNOA 2KR7A 4JFIA 1FKBA 4DWSB 2ZQUA 1FKRA 3B9AA 3WL1A 1HJWA 1GPFA 4DWSC 3KADA 3O5RA 4DRHA 1BKFA 4WK9A 3WIJA 2XP6A 3WKZA 2O9OA 2XP3A 1W1VA 4HBOA 1NSGA 2DT1A 4DRPA 2F21A 3O5PA 3WD1A 1SR0A 2VCDA 2VN1A 4GIVA 5DO2A 2MNTA 2ZR5A 1FKGA 4ML4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BL4 A;  2KGJ A;  2LPV A;  3O5O A;  1T11 A;  3O5F A;  5HW7 A;  3B7X A;  5I98 A;  3UQA A;  1L1P A;  4W9P A;  5B8I C;  2F2D A;  1J4R A;  2DG9 A;  3IKG A;  3RFW A;  4MGV A;  4J4N A;  4IQC A;  1D7J A;  3EY6 A;  3IHZ A;  1F8A B;  4FN2 A;  2RUD A;  3KAG A;  4ODN A;  5DIV A;  3MDY B;  2ZQS A;  2RUC A;  5HT1 A;  4ODK A;  1FKJ A;  2OFN A;  3KAF A;  4LAY A;  2PPN A;  2RSE A;  3CGN A;  2MLX A;  4NNR A;  4TYO A;  4W9Q A;  4C02 B;  4QT3 A;  3TCZ A;  4IQ2 A;  2N87 A;  3O5I A;  4G2P A;  5BXJ A;  3O5M A;  2ZR4 A;  2XP7 A;  4J4O A;  2DG3 A;  4DT4 A;  5GPG A;  2PV3 A;  5DIU A;  2D9F A;  2M08 A;  4ITZ A;  4DRM A;  3JXV A;  1FKD A;  4N19 A;  3RGC A;  3O5J A;  1U79 A;  2LJ4 A;  3O5D A;  1FKK A;  2L2S A;  2RUQ A;  3PA7 A;  2PV2 A;  2XP8 A;  4DIP A;  4DRJ A;  5HKG A;  1QPF A;  4ODM A;  2PV1 A;  3TC5 A;  1FKT A;  2MLY A;  3O5L A;  4JYS A;  4JFK A;  2ZQV A;  3KAH A;  1FJD A;  4TX0 A;  1ZCN A;  1KT0 A;  3OOB A;  3UQB A;  1J4I A;  3IKD A;  1W26 A;  4DZ3 A;  4MSP A;  1ROU A;  2MPH A;  3KAI A;  3O5E A;  4R0X A;  2DG4 A;  2Q5A A;  3PRB A;  1F40 A;  2MF9 A;  4TW6 A;  4TW7 A;  5J6E A;  1FKF A;  1JNT A;  3UF8 A;  1J6Y A;  2XP4 A;  3KZ7 A;  1FKH A;  4DRN A;  1KT1 A;  3PRD A;  1QPL A;  1PBK A;  1JNS A;  3O5G A;  1M5Y A;  2RQS A;  4ODQ A;  1N1A A;  1TCO C;  3UQI A;  1JVW A;  1YAT A;  2LGO A;  4QIB A;  4DZ2 A;  5HTG A;  1FKI A;  4LAX A;  2F4E A;  3H9R B;  4JFL A;  2RUR A;  4IPX A;  3O5K A;  3WH0 A;  2XP9 A;  4G50 A;  4LAV A;  5HWB A;  3IK8 A;  1A7X A;  1FKL A;  1Q6H A;  3KAB A;  4O2T A;  1NMV A;  2K8I A;  1D7H A;  3I6C A;  3NI6 A;  2PPO A;  1D7I A;  3LUO A;  3ODK A;  2KE0 A;  4ODL A;  1Y0O A;  1R9H A;  5HW8 A;  5HW6 A;  3JYJ A;  2M1I A;  1NMW A;  1EYM A;  1FAP A;  3CGM A;  3GPK A;  2Y78 A;  3UI4 A;  2JZV A;  2PPP A;  4JFJ A;  2UZ5 A;  3NTP A;  3JYM A;  4DRI A;  2IF4 A;  4DRQ A;  1HXV A;  3TDB A;  2LKN A;  2MLZ A;  3O5Q A;  2M2A A;  2KI3 A;  3UI5 A;  2FKE A;  2ITK A;  2XPA A;  2KR7 A;  1B6C A;  5DIT A;  4JFI A;  4JFM A;  1Q6U A;  4DRK A;  2XPB A;  1C9H A;  1FKB A;  1PIN A;  2KO7 A;  2ZQU A;  4W9O A;  1FKR A;  1FKS A;  1ROT A;  4ODP A;  1ZK6 A;  2PBC A;  3KAD A;  3NRK A;  4FAP A;  5D75 A;  3O5R A;  4LAW A;  4U86 A;  4DRH A;  1BKF A;  5HUA A;  1FD9 A;  3UI6 A;  1YW5 A;  5HWC A;  1Q1C A;  1Q6I A;  2KFW A;  3VAW A;  3FAP A;  2XP6 A;  4ODR A;  2AWG A;  2ZR6 A;  4QT2 A;  4TNS A;  1EQ3 A;  2XP3 A;  2XP5 A;  4DH0 A;  1NSG A;  4DRP A;  1J4H A;  4GGQ A;  1P5Q A;  4ODO A;  2FAP A;  2F21 A;  1D6O A;  4BF8 A;  3O5P A;  1QZ2 A;  2ZQT A;  4U84 A;  4DRO A;  2VCD A;  4U85 A;  2VN1 A;  4GIV A;  3KAC A;  4TW8 A;  3KCE A;  2MNT A;  2ZR5 A;  1FKG A; 
#chains in the Genus database with same CATH topology
 1UR8 A;  1BL4 A;  2KGJ A;  1FFR A;  3AS3 A;  1ZBV A;  1OWQ A;  2DSW A;  1UR9 A;  1HKK A;  1L1P A;  3WD0 A;  4MGV A;  2WM0 A;  2WLY A;  3IHZ A;  3KAG A;  5DIV A;  2ZQS A;  1JNE A;  4LAY A;  4NNR A;  2A3A A;  2MLX A;  4C02 B;  4QT3 A;  2N87 A;  3BMB A;  5BXJ A;  4MNK A;  3ALG A;  1LL7 A;  4DT4 A;  5GPG A;  1U79 A;  4Z2H A;  1FKK A;  2L2S A;  4P8X A;  2RUQ A;  1LG2 A;  2XP8 A;  5HKG A;  3W4R A;  3ART A;  3B8S A;  1FKT A;  2B31 A;  1NWU A;  4TX0 A;  1J4I A;  1ROU A;  3O5E A;  4PTM A;  4S3J A;  4AY1 A;  2MF9 A;  4TW6 A;  1E15 A;  5DF0 A;  3KZ7 A;  4DRN A;  3WL0 A;  3EIP A;  3PRD A;  1PBK A;  1EDQ A;  2RQS A;  4ODQ A;  2A3B A;  1D2K A;  4DZ2 A;  3H9R B;  1E9L A;  2RUR A;  4IPX A;  2XP9 A;  4LAV A;  2G8Z A;  1A7X A;  2K8I A;  4WKF A;  1D7H A;  5HW8 A;  5HW6 A;  3JYJ A;  1NMW A;  3CGM A;  5HBF A;  2UZ5 A;  3JYM A;  3TDB A;  2LKN A;  4IT6 A;  3UI5 A;  4L3N A;  2B5U B;  5DIT A;  1Q6U A;  4DRK A;  4W9O A;  1FKS A;  3OA5 A;  2PBC A;  3BXW A;  1E6N A;  3PRA A;  1TFV A;  1CTN A;  1FD9 A;  5HWC A;  3FAP A;  2AWG A;  4QT2 A;  4TNS A;  2XP5 A;  4DH0 A;  1J4H A;  1LL6 A;  4KR0 B;  4GGQ A;  4P8U A;  1GRJ A;  4BF8 A;  2PI6 A;  3KAC A;  4TW8 A;  5GPR A;  2LPV A;  3ARZ A;  1W9U A;  4Q22 A;  3O5F A;  4IT4 A;  5I98 A;  3UQA A;  4W9P A;  1J4R A;  1H0G A;  3RFW A;  2AOS A;  1NWT A;  4J4N A;  4WJX A;  3FXY A;  2DT0 A;  3RME A;  1KFW A;  4FN2 A;  4ODN A;  3MDY B;  5HT1 A;  3CGN A;  4W9Q A;  4P8W A;  3TCZ A;  3CH9 A;  4G2P A;  5DEZ A;  1RD6 A;  2ZR4 A;  3O5M A;  2XP7 A;  2PV3 A;  4DRM A;  4DWS D;  1NWR A;  2EUL A;  2PV2 A;  3CZ8 A;  3ARX A;  1HJX A;  3O5L A;  1LG1 A;  4JFK A;  1ZCN A;  1FFQ A;  1W26 A;  4DZ3 A;  4MSP A;  3KAI A;  4URI A;  3CHE A;  2QF8 A;  4Z2L A;  2DSZ A;  2IUZ A;  2XP4 A;  2DT2 A;  3PR9 A;  1JVW A;  4QIB A;  2LGO A;  2YBT A;  1FKI A;  2F4E A;  5HWB A;  5JH8 A;  3IK8 A;  1FKL A;  4W5U A;  3WQW A;  1LJY A;  1NMV A;  3AS1 A;  3UI4 A;  3I6C A;  3WH0 A;  1D7I A;  1OGG A;  2ETN A;  2KE0 A;  1R9H A;  1HKJ A;  2DSU A;  4ZPT R;  1EYM A;  4R5E A;  3ARU A;  2Y78 A;  2JZV A;  1HXV A;  1E6P A;  2DSV A;  2ITK A;  2XPA A;  3CHF A;  1EIB A;  3ARW A;  1B6C A;  1X6L A;  1C9H A;  3WD4 A;  2F23 A;  1ROT A;  1ZK6 A;  1X6N A;  5D75 A;  4LAW A;  4HBE A;  3ALF A;  3QOK A;  1Q1C A;  2KFW A;  1WAW A;  2O92 A;  1EQ3 A;  1O6I A;  1H0I A;  1E6R A;  4ODO A;  3ARQ A;  1QZ2 A;  4ZS6 A;  4DRO A;  1JND A;  1ZBC A;  3KCE A;  4MTV A;  1ZBK A;  4MAV A;  5HTG A;  1ZBW A;  1HKI A;  2YBU A;  2FDM A;  5HW7 A;  3B7X A;  4P8V A;  1XHG A;  4IQC A;  3WD3 A;  3EY6 A;  1F8A B;  1FKJ A;  2ESC A;  2PPN A;  1E6Z A;  4IQ2 A;  3O5I A;  3AS0 A;  3G6L A;  3RM8 A;  4J4O A;  1VF8 A;  5DIU A;  2D9F A;  2M08 A;  4ITZ A;  3JXV A;  1FKD A;  4N19 A;  3O5J A;  1SYT A;  3GU0 A;  2A3E A;  1W1P A;  3PA7 A;  1LQ0 A;  4DRJ A;  1QPF A;  4ODM A;  2PV1 A;  3G6M A;  2ZQV A;  1KT0 A;  3UQB A;  4L72 B;  3CHC A;  4XAK A;  1K9T A;  3IKD A;  4MNL A;  1HJV A;  2MPH A;  4R0X A;  2Q5A A;  3PRB A;  4TW7 A;  1ITX A;  3WQV A;  1KT1 A;  1ZU8 A;  4S3K A;  1QPL A;  1JNS A;  4UDM A;  1M5Y A;  3UQI A;  1TCO C;  4LAX A;  4MNJ A;  1W9V A;  1W1Y A;  4NSB A;  4G50 A;  1W9P A;  4O2T A;  1Q6H A;  3KAB A;  1GOI A;  4QZV B;  4ODL A;  2PPO A;  3ARO A;  2DPE A;  4JFJ A;  3NTP A;  4DRI A;  2IF4 A;  4DRQ A;  2MLZ A;  3O5Q A;  2M2A A;  3CHD A;  2FKE A;  1WB0 A;  1LL4 A;  4JFM A;  2XPB A;  1PIN A;  2KO7 A;  4ODP A;  4DWS A;  2A3C A;  3NRK A;  4FAP A;  4Z2K A;  4U86 A;  5HUA A;  3UI6 A;  1YW5 A;  1Q6I A;  3VAW A;  4ODR A;  2ZR6 A;  1P5Q A;  2FAP A;  1D6O A;  2ZQT A;  4Q7N A;  4U84 A;  3AQU A;  3B9D A;  3ARS A;  4U85 A;  4ZPV R;  2WLZ A;  1OGB A;  3ARV A;  4NZC A;  1NH6 A;  3RM4 A;  4WIW A;  3O5O A;  1T11 A;  4ZPW R;  3WD2 A;  5B8I C;  2F2D A;  2DG9 A;  3IKG A;  4MNM A;  1D7J A;  2RUD A;  3ARR A;  1GUV A;  2RUC A;  4ODK A;  4TYO A;  2OFN A;  3ARP A;  3KAF A;  2RSE A;  4LGX A;  3FY1 A;  2WK2 A;  2DG3 A;  3RGC A;  3O5D A;  2LJ4 A;  4KQZ A;  4DIP A;  2OLH A;  3TC5 A;  2MLY A;  4JYS A;  3KAH A;  5GQB A;  1W1T A;  1FJD A;  3OOB A;  1ZB5 A;  3RM9 A;  3GTY X;  4WKA A;  1HKM A;  4WKH A;  3B9E A;  1XRV A;  1E44 A;  2DG4 A;  3ARY A;  2G41 A;  1F40 A;  5J6E A;  1FKF A;  1JNT A;  3UF8 A;  1J6Y A;  1FKH A;  3O5G A;  1NWS A;  1N1A A;  1YAT A;  4Z2J A;  4JFL A;  3O5K A;  4Z2I A;  1IX5 A;  3ODK A;  3NI6 A;  3LUO A;  1Y0O A;  2M1I A;  3GPK A;  1FAP A;  4MPK A;  1EHN A;  3AS2 A;  1ZL1 A;  2PPP A;  4Z2G A;  2PN0 A;  2KI3 A;  2DT3 A;  4HAR A;  2P4V A;  1WNO A;  2KR7 A;  4JFI A;  1FKB A;  4DWS B;  2ZQU A;  1FKR A;  3B9A A;  3WL1 A;  1HJW A;  1GPF A;  4DWS C;  3KAD A;  3O5R A;  4DRH A;  1BKF A;  4WK9 A;  1JCH B;  3WIJ A;  2XP6 A;  3WKZ A;  2O9O A;  2XP3 A;  1W1V A;  4HBO A;  1NSG A;  2DT1 A;  4DRP A;  2F21 A;  3O5P A;  3WD1 A;  1SR0 A;  2VCD A;  2VN1 A;  4GIV A;  5DO2 A;  2MNT A;  2ZR5 A;  1FKG A;  4ML4 A; 
#chains in the Genus database with same CATH homology
 1UR8 A;  1BL4 A;  2KGJ A;  1FFR A;  3AS3 A;  1ZBV A;  1OWQ A;  2DSW A;  1UR9 A;  1HKK A;  1L1P A;  3WD0 A;  4MGV A;  2WM0 A;  2WLY A;  3IHZ A;  3KAG A;  5DIV A;  2ZQS A;  1JNE A;  4LAY A;  4NNR A;  2A3A A;  2MLX A;  4C02 B;  4QT3 A;  2N87 A;  5BXJ A;  4MNK A;  3ALG A;  1LL7 A;  4DT4 A;  5GPG A;  1U79 A;  4Z2H A;  1FKK A;  2L2S A;  4P8X A;  2RUQ A;  1LG2 A;  2XP8 A;  5HKG A;  3W4R A;  3ART A;  3B8S A;  1FKT A;  2B31 A;  1NWU A;  4TX0 A;  1J4I A;  1ROU A;  3O5E A;  4PTM A;  4S3J A;  4AY1 A;  2MF9 A;  4TW6 A;  1E15 A;  5DF0 A;  3KZ7 A;  4DRN A;  3WL0 A;  3PRD A;  1PBK A;  1EDQ A;  2RQS A;  4ODQ A;  2A3B A;  1D2K A;  4DZ2 A;  3H9R B;  1E9L A;  2RUR A;  4IPX A;  2XP9 A;  4LAV A;  2G8Z A;  1A7X A;  2K8I A;  4WKF A;  1D7H A;  5HW8 A;  5HW6 A;  3JYJ A;  1NMW A;  3CGM A;  5HBF A;  2UZ5 A;  3JYM A;  3TDB A;  2LKN A;  4IT6 A;  3UI5 A;  4L3N A;  5DIT A;  1Q6U A;  4DRK A;  4W9O A;  1FKS A;  3OA5 A;  2PBC A;  3BXW A;  1E6N A;  3PRA A;  1TFV A;  1CTN A;  1FD9 A;  5HWC A;  3FAP A;  2AWG A;  4QT2 A;  4TNS A;  2XP5 A;  4DH0 A;  1J4H A;  1LL6 A;  4KR0 B;  4GGQ A;  4P8U A;  4BF8 A;  2PI6 A;  3KAC A;  4TW8 A;  5GPR A;  2LPV A;  3ARZ A;  1W9U A;  4Q22 A;  3O5F A;  4IT4 A;  5I98 A;  3UQA A;  4W9P A;  1J4R A;  1H0G A;  3RFW A;  2AOS A;  1NWT A;  4J4N A;  4WJX A;  3FXY A;  2DT0 A;  3RME A;  1KFW A;  4FN2 A;  4ODN A;  3MDY B;  5HT1 A;  3CGN A;  4W9Q A;  4P8W A;  3TCZ A;  3CH9 A;  4G2P A;  5DEZ A;  1RD6 A;  2ZR4 A;  3O5M A;  2XP7 A;  2PV3 A;  4DRM A;  4DWS D;  1NWR A;  2PV2 A;  3CZ8 A;  3ARX A;  1HJX A;  3O5L A;  1LG1 A;  4JFK A;  1ZCN A;  1FFQ A;  1W26 A;  4DZ3 A;  4MSP A;  3KAI A;  4URI A;  3CHE A;  2QF8 A;  4Z2L A;  2DSZ A;  2IUZ A;  2XP4 A;  2DT2 A;  3PR9 A;  1JVW A;  4QIB A;  2LGO A;  2YBT A;  1FKI A;  2F4E A;  5HWB A;  5JH8 A;  3IK8 A;  1FKL A;  4W5U A;  3WQW A;  1LJY A;  1NMV A;  3AS1 A;  3UI4 A;  3I6C A;  3WH0 A;  1D7I A;  1OGG A;  2KE0 A;  1R9H A;  1HKJ A;  2DSU A;  4ZPT R;  1EYM A;  4R5E A;  3ARU A;  2Y78 A;  2JZV A;  1HXV A;  1E6P A;  2DSV A;  2ITK A;  2XPA A;  3CHF A;  1EIB A;  3ARW A;  1B6C A;  1X6L A;  1C9H A;  3WD4 A;  1ROT A;  1ZK6 A;  1X6N A;  5D75 A;  4LAW A;  4HBE A;  3ALF A;  3QOK A;  1Q1C A;  2KFW A;  1WAW A;  2O92 A;  1EQ3 A;  1O6I A;  1H0I A;  1E6R A;  4ODO A;  3ARQ A;  1QZ2 A;  4ZS6 A;  4DRO A;  1JND A;  1ZBC A;  3KCE A;  4MTV A;  1ZBK A;  4MAV A;  5HTG A;  1ZBW A;  1HKI A;  2YBU A;  2FDM A;  5HW7 A;  3B7X A;  4P8V A;  1XHG A;  4IQC A;  3WD3 A;  3EY6 A;  1F8A B;  1FKJ A;  2ESC A;  2PPN A;  1E6Z A;  4IQ2 A;  3O5I A;  3AS0 A;  3G6L A;  3RM8 A;  4J4O A;  1VF8 A;  5DIU A;  2D9F A;  2M08 A;  4ITZ A;  3JXV A;  1FKD A;  4N19 A;  3O5J A;  1SYT A;  2A3E A;  1W1P A;  3PA7 A;  1LQ0 A;  4DRJ A;  1QPF A;  4ODM A;  2PV1 A;  3G6M A;  2ZQV A;  1KT0 A;  3UQB A;  4L72 B;  3CHC A;  4XAK A;  1K9T A;  3IKD A;  4MNL A;  1HJV A;  2MPH A;  4R0X A;  2Q5A A;  3PRB A;  4TW7 A;  1ITX A;  3WQV A;  1KT1 A;  1ZU8 A;  4S3K A;  1QPL A;  1JNS A;  1M5Y A;  3UQI A;  1TCO C;  4LAX A;  4MNJ A;  1W9V A;  1W1Y A;  4NSB A;  4G50 A;  1W9P A;  4O2T A;  1Q6H A;  3KAB A;  1GOI A;  4QZV B;  4ODL A;  2PPO A;  3ARO A;  2DPE A;  4JFJ A;  3NTP A;  4DRI A;  2IF4 A;  4DRQ A;  2MLZ A;  3O5Q A;  2M2A A;  3CHD A;  2FKE A;  1WB0 A;  1LL4 A;  4JFM A;  2XPB A;  1PIN A;  2KO7 A;  4ODP A;  4DWS A;  2A3C A;  3NRK A;  4FAP A;  4Z2K A;  4U86 A;  5HUA A;  3UI6 A;  1YW5 A;  1Q6I A;  3VAW A;  4ODR A;  2ZR6 A;  1P5Q A;  2FAP A;  1D6O A;  2ZQT A;  4Q7N A;  4U84 A;  3AQU A;  3B9D A;  3ARS A;  4U85 A;  4ZPV R;  2WLZ A;  1OGB A;  3ARV A;  4NZC A;  1NH6 A;  3RM4 A;  4WIW A;  3O5O A;  1T11 A;  4ZPW R;  3WD2 A;  5B8I C;  2F2D A;  2DG9 A;  3IKG A;  4MNM A;  1D7J A;  2RUD A;  3ARR A;  1GUV A;  2RUC A;  4ODK A;  4TYO A;  2OFN A;  3ARP A;  3KAF A;  2RSE A;  4LGX A;  3FY1 A;  2WK2 A;  2DG3 A;  3RGC A;  3O5D A;  2LJ4 A;  4KQZ A;  4DIP A;  2OLH A;  3TC5 A;  2MLY A;  4JYS A;  3KAH A;  5GQB A;  1W1T A;  1FJD A;  3OOB A;  1ZB5 A;  3RM9 A;  4WKA A;  1HKM A;  4WKH A;  3B9E A;  1XRV A;  2DG4 A;  3ARY A;  2G41 A;  1F40 A;  5J6E A;  1FKF A;  1JNT A;  3UF8 A;  1J6Y A;  1FKH A;  3O5G A;  1NWS A;  1N1A A;  1YAT A;  4Z2J A;  4JFL A;  3O5K A;  4Z2I A;  1IX5 A;  3ODK A;  3NI6 A;  3LUO A;  1Y0O A;  2M1I A;  3GPK A;  1FAP A;  4MPK A;  1EHN A;  3AS2 A;  1ZL1 A;  2PPP A;  4Z2G A;  2KI3 A;  2DT3 A;  4HAR A;  1WNO A;  2KR7 A;  4JFI A;  1FKB A;  4DWS B;  2ZQU A;  1FKR A;  3B9A A;  3WL1 A;  1HJW A;  1GPF A;  4DWS C;  3KAD A;  3O5R A;  4DRH A;  1BKF A;  4WK9 A;  3WIJ A;  2XP6 A;  3WKZ A;  2O9O A;  2XP3 A;  1W1V A;  4HBO A;  1NSG A;  2DT1 A;  4DRP A;  2F21 A;  3O5P A;  3WD1 A;  1SR0 A;  2VCD A;  2VN1 A;  4GIV A;  5DO2 A;  2MNT A;  2ZR5 A;  1FKG A;  4ML4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...