4C02B

Crystal structure of human acvr1 (alk2) in complex with fkbp12.6 and dorsomorphin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/isomerase
molecule keywords ACTIVIN RECEPTOR TYPE-1
publication title Crystal Structure of Human Acvr1 (Alk2) in Complex with Fkbp12.6 And Dorsomorphin
rcsb
source organism Homo sapiens
total genus 24
structure length 108
sequence length 108
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4c02B00
3O5JA 4TNSA 4GIVA 3MDYB 4U86A 2PV2A 1N1AA 3KACA 4ODKA 5HTGA 3UI4A 4JFLA 2KI3A 1PINA 1M5YA 3O5RA 3EY6A 2PPNA 3WH0A 5HKGA 1NMVA 1Q6IA 3KCEA 4NNRA 4ODOA 2MNTA 4U85A 1FKRA 4W9PA 4TX0A 1P5QA 2XP8A 2RUQA 3CGNA 1FKHA 3IKDA 1ZCNA 2K8IA 4DRNA 2Q5AA 3CGMA 2DG9A 1QZ2A 3O5QA 4ODQA 1QPFA 3JYMA 1J6YA 3GPKA 3IK8A 2UZ5A 1NMWA 4QT2A 1FKIA 1NSGA 4MSPA 4DH0A 4LAWA 1J4IA 3O5PA 4BF8A 2XP9A 4TW8A 1YW5A 2M08A 4DZ3A 2AWGA 2XP4A 4ITZA 2MF9A 4FN2A 4R0XA 1BL4A 4LAXA 4DRMA 1EQ3A 3OOBA 2RUCA 4U84A 2XP6A 1HXVA 4GGQA 2XP5A 4J4OA 2LKNA 4JYSA 4DROA 4DRJA 1C9HA 1QPLA 2MLZA 2ZQVA 4ODNA 2M2AA 3O5FA 1FKFA 2F21A 3UI6A 1L1PA 3LUOA 4TW6A 2N87A 2XPBA 4JFIA 2F4EA 1FKKA 2IF4A 2DG3A 1R9HA 4DZ2A 3PRBA 3UQIA 4O2TA 1D7IA 3O5EA 1Q6HA 1U79A 3B7XA 3KAFA 4C02B 2JZVA 2F2DA 5D75A 2PPOA 4N19A 4TW7A 4G2PA 5DIVA 1FJDA 3O5IA 2ZR4A 1KT0A 4DRQA 3I6CA 4W9OA 1FKDA 1PBKA 2VN1A 3FAPA 1ROUA 1D7HA 3KAIA 3NTPA 4IQCA 4LAVA 4MGVA 5HWCA 2XP7A 3UI5A 3KADA 3RGCA 2VCDA 5I98A 3KZ7A 2LPVA 5HW8A 1A7XA 3KAHA 1J4HA 2ITKA 4DRIA 2KR7A 1J4RA 1JNSA 3TCZA 1W26A 1FKTA 2PBCA 2OFNA 1ROTA 2KGJA 3O5KA 2KE0A 4DIPA 5BXJA 4FAPA 2MPHA 4JFMA 1TCOC 3JXVA 4W9QA 5DIUA 4DRPA 2Y78A 3O5DA 1FD9A 3TC5A 2MLYA 3O5MA 4IPXA 4DT4A 1Y0OA 3ODKA 5DITA 2XP3A 2ZQUA 4JFJA 2ZQSA 4IQ2A 3UQBA 1FKBA 5GPGA 1D6OA 4J4NA 5HUAA 3KAGA 1D7JA 3JYJA 2MLXA 3IHZA 2RURA 2DG4A 2RSEA 2ZR5A 1FAPA 3O5LA 4ODMA 4DRKA 2KFWA 1Q6UA 2ZQTA 2KO7A 5HW6A 4JFKA 1F8AB 3UF8A 1T11A 1JVWA 5HW7A 5HWBA 1FKLA 3VAWA 4QIBA 3RFWA 4DRHA 2PV3A 3H9RB 2LJ4A 3KABA 4ODPA 2PV1A 4G50A 2L2SA 1BKFA 1YATA 2ZR6A 3O5OA 1ZK6A 1FKGA 1FKJA 1B6CA 3IKGA 2LGOA 4LAYA 4TYOA 4ODLA 2XPAA 5B8IC 5HT1A 1Q1CA 5J6EA 2FKEA 1F40A 2PPPA 2FAPA 4ODRA 3NI6A 3O5GA 4QT3A 3UQAA 2RUDA 1KT1A 3TDBA 2M1IA 3NRKA 1EYMA 1FKSA 1JNTA 3PRDA 2D9FA 2RQSA 3PA7A
chains in the Genus database with same CATH superfamily
3O5JA 3AROA 4U86A 2PV2A 3WD4A 5HTGA 4JFLA 1M5YA 3WH0A 1UR8A 4NNRA 4ODOA 2ETNA 1OGBA 4QZVB 2RUQA 3IKDA 1ZCNA 2DG9A 1QZ2A 3GPKA 2UZ5A 4QT2A 1FKIA 2DSZA 2F23A 3ARSA 2XP9A 3PRAA 4ITZA 1X6NA 2YBUA 4LAXA 4ML4A 3OOBA 2RUCA 3RM8A 4HBOA 1C9HA 2MLZA 2ZQVA 4ODNA 2G8ZA 1FKFA 1W9VA 2F21A 4L3NA 1E44A 1L1PA 1FKKA 4Z2GA 3WD0A 1U79A 2JZVA 1NWTA 1W1PA 4TW7A 1FJDA 1GOIA 1VF8A 1WAWA 4R5EA 3NTPA 4MGVA 3KADA 3KZ7A 1A7XA 1HKMA 5GQBA 4DRIA 2KR7A 3GU0A 2PBCA 2MPHA 3JXVA 1WB0A 1W1VA 5DEZA 3O5DA 1FD9A 2A3CA 2DSVA 4KQZA 1XRVA 2ZQSA 4IQ2A 4JFJA 3UQBA 4DWSC 3ARUA 4ZPTR 1E6NA 1D7JA 3JYJA 4ODMA 4IT4A 3AS0A 1JNDA 1JNEA 1Q6UA 2ZQTA 3FXYA 3UF8A 1ZBWA 2AOSA 3PR9A 3VAWA 1O6IA 3RFWA 4DRHA 4G50A 2L2SA 3O5OA 1ZK6A 1B6CA 1HJXA 2LGOA 2O92A 1LJYA 1LG2A 2XPAA 3RM9A 1Q1CA 5J6EA 2FKEA 1ZBCA 3W4RA 4NZCA 4QT3A 2O9OA 1KT1A 3CHCA 3PRDA 4DWSA 2DPEA 3PA7A 4GIVA 3KACA 1N1AA 4DWSD 3UI4A 2KI3A 3CZ8A 2PPNA 1E9LA 3ALGA 2IUZA 3KCEA 1FKRA 4W9PA 3WQVA 4TX0A 2XP8A 1FKHA 3GTYX 4Z2HA 1W9PA 4ODQA 1J6YA 3JYMA 5HBFA 3O5PA 4BF8A 3ARXA 4TW8A 1YW5A 2M08A 4DZ3A 2AWGA 3ARTA 3CHFA 2MF9A 4FN2A 1EQ3A 2XP6A 4IT6A 4GGQA 2XP5A 3ARWA 2LKNA 4JYSA 4DROA 2M2AA 2OLHA 3WIJA 3UI6A 2N87A 2F4EA 2IF4A 2WLZA 2DG3A 4DZ2A 4O2TA 4C02B 2A3AA 2F2DA 3B9AA 2PPOA 5DIVA 1H0GA 1HKJA 1KT0A 3FAPA 3KAIA 1D7HA 4IQCA 4LGXA 5I98A 3UI5A 2VCDA 5HW8A 1J4RA 1SR0A 2KGJA 3O5KA 2KE0A 5BXJA 4JFMA 1TCOC 5DIUA 4DRPA 2MLYA 5DF0A 4DT4A 1Y0OA 3ODKA 1D2KA 1FKBA 3OA5A 2DT1A 4MAVA 3KAGA 1ZBKA 3RM4A 2ESCA 3IHZA 2RURA 2DG4A 2KFWA 4HARA 5HW6A 1T11A 1JVWA 4XAKA 1E15A 1FKLA 4Z2IA 3KABA 2LJ4A 2PV1A 3AS2A 4TYOA 4LAYA 1F40A 2PPPA 4ODRA 4Z2LA 1KFWA 1EYMA 1JNTA 2D9FA 4R0XA 4TNSA 1GUVA 4MNMA 3WD1A 4ODKA 3O5RA 4WKHA 3EY6A 2DT3A 4ZPWR 3CHDA 1XHGA 1NMVA 3WD2A 4U85A 1H0IA 1W1YA 4Q7NA 1K9TA 3B9DA 1EHNA 2K8IA 3FY1A 3CGMA 4P8UA 4DRNA 4MNJA 2PN0A 1NSGA 4MSPA 5JH8A 1HKKA 4LAWA 4P8WA 1ZL1A 2XP4A 4Z2JA 1BL4A 1HXVA 2A3EA 3ARRA 3ARPA 4DRJA 1QPLA 3O5FA 1E6PA 2XPBA 4KR0B 3UQIA 2B5UB 1D7IA 1WNOA 1OGGA 1Q6HA 3O5EA 2EULA 1OWQA 5D75A 1NWRA 2P4VA 2ZR4A 1ITXA 4ZPVR 1FKDA 1ROUA 4LAVA 5HWCA 3AS3A 2XP7A 2LPVA 3KAHA 4P8VA 1JNSA 1HJWA 1E6RA 3TCZA 1LL7A 2OFNA 1ROTA 3ARZA 3EIPA 4WIWA 4DIPA 3BXWA 4W9QA 2Y78A 3RMEA 3TC5A 1FFRA 4P8XA 2FDMA 4IPXA 5DITA 3G6LA 2ZQUA 5GPGA 1D6OA 3AS1A 4J4NA 5HUAA 2B31A 2MLXA 2RSEA 2ZR5A 1FAPA 3BMBA 4AY1A 4DRKA 2PI6A 1FFQA 2KO7A 3ARVA 4QIBA 2PV3A 3H9RB 1LQ0A 1BKFA 2ZR6A 1FKGA 1FKJA 2WK2A 3IKGA 3WQWA 5B8IC 1LL6A 4WJXA 3NI6A 1EIBA 4Q22A 5GPRA 2M1IA 4NSBA 4L72B 2RQSA 3ARYA 3MDYB 1W9UA 3B8SA 1RD6A 1PINA 1SYTA 3WL0A 5HKGA 1Q6IA 1IX5A 3ARQA 3AQUA 2MNTA 4HBEA 3WKZA 1GRJA 1EDQA 3CH9A 1P5QA 3CGNA 4W5UA 2Q5AA 3O5QA 4MPKA 1QPFA 4Z2KA 3IK8A 4MTVA 1NMWA 4DH0A 3WL1A 1J4IA 1NWSA 4PTMA 4WKAA 4DRMA 1HJVA 1TFVA 1UR9A 4U84A 1ZU8A 4J4OA 3G6MA 3LUOA 4TW6A 4UDMA 4JFIA 1R9HA 3PRBA 2DSUA 2DT2A 2DSWA 1LL4A 1X6LA 3KAFA 3B7XA 4ZS6A 1W1TA 4N19A 4G2PA 3O5IA 4DRQA 2DT0A 3I6CA 3CHEA 4W9OA 1PBKA 2VN1A 4WK9A 3RGCA 1J4HA 2ITKA 1JCHB 1W26A 1FKTA 4WKFA 3ALFA 4S3KA 4FAPA 1E6ZA 2A3BA 3O5MA 2WLYA 2QF8A 2XP3A 5DO2A 2G41A 3WD3A 1NH6A 3O5LA 4DWSB 4JFKA 1F8AB 4URIA 5HWBA 5HW7A 3B9EA 2WM0A 1ZBVA 4ODPA 1ZB5A 4MNKA 1YATA 3QOKA 4ODLA 5HT1A 1CTNA 2FAPA 2YBTA 3O5GA 1HKIA 3UQAA 2RUDA 4S3JA 1NWUA 3TDBA 4MNLA 3NRKA 1LG1A 1FKSA 1GPFA
chains in the Genus database with same CATH topology
3O5JA 3AROA 4U86A 2PV2A 3WD4A 5HTGA 4JFLA 1M5YA 3WH0A 1UR8A 4NNRA 4ODOA 1OGBA 4QZVB 2RUQA 3IKDA 1ZCNA 2DG9A 1QZ2A 3GPKA 2UZ5A 4QT2A 1FKIA 2DSZA 3ARSA 2XP9A 3PRAA 4ITZA 1X6NA 2YBUA 4LAXA 4ML4A 3OOBA 2RUCA 3RM8A 4HBOA 1C9HA 2MLZA 2ZQVA 4ODNA 2G8ZA 1FKFA 1W9VA 2F21A 4L3NA 1L1PA 1FKKA 4Z2GA 3WD0A 1U79A 2JZVA 1NWTA 1W1PA 4TW7A 1FJDA 1GOIA 1VF8A 1WAWA 4R5EA 3NTPA 4MGVA 3KADA 3KZ7A 1A7XA 1HKMA 5GQBA 4DRIA 2KR7A 2PBCA 2MPHA 3JXVA 1WB0A 1W1VA 5DEZA 3O5DA 1FD9A 2A3CA 2DSVA 4KQZA 1XRVA 2ZQSA 4IQ2A 4JFJA 3UQBA 4DWSC 3ARUA 4ZPTR 1E6NA 1D7JA 3JYJA 4ODMA 4IT4A 3AS0A 1JNDA 1JNEA 1Q6UA 2ZQTA 3FXYA 3UF8A 1ZBWA 2AOSA 3PR9A 3VAWA 1O6IA 3RFWA 4DRHA 4G50A 2L2SA 3O5OA 1ZK6A 1B6CA 1HJXA 2LGOA 2O92A 1LJYA 1LG2A 2XPAA 3RM9A 1Q1CA 5J6EA 2FKEA 1ZBCA 3W4RA 4NZCA 4QT3A 2O9OA 1KT1A 3CHCA 3PRDA 4DWSA 2DPEA 3PA7A 4GIVA 3KACA 1N1AA 4DWSD 3UI4A 2KI3A 3CZ8A 2PPNA 1E9LA 3ALGA 2IUZA 3KCEA 1FKRA 4W9PA 3WQVA 4TX0A 2XP8A 1FKHA 4Z2HA 1W9PA 4ODQA 1J6YA 3JYMA 5HBFA 3O5PA 4BF8A 3ARXA 4TW8A 1YW5A 2M08A 4DZ3A 2AWGA 3ARTA 3CHFA 2MF9A 4FN2A 1EQ3A 2XP6A 4IT6A 4GGQA 2XP5A 3ARWA 2LKNA 4JYSA 4DROA 2M2AA 2OLHA 3WIJA 3UI6A 2N87A 2F4EA 2IF4A 2WLZA 2DG3A 4DZ2A 4O2TA 4C02B 2A3AA 2F2DA 3B9AA 2PPOA 5DIVA 1H0GA 1HKJA 1KT0A 3FAPA 3KAIA 1D7HA 4IQCA 4LGXA 5I98A 3UI5A 2VCDA 5HW8A 1J4RA 1SR0A 2KGJA 3O5KA 2KE0A 5BXJA 4JFMA 1TCOC 5DIUA 4DRPA 2MLYA 5DF0A 4DT4A 1Y0OA 3ODKA 1D2KA 1FKBA 3OA5A 2DT1A 4MAVA 3KAGA 1ZBKA 3RM4A 2ESCA 3IHZA 2RURA 2DG4A 2KFWA 4HARA 5HW6A 1T11A 1JVWA 4XAKA 1E15A 1FKLA 4Z2IA 3KABA 2LJ4A 2PV1A 3AS2A 4TYOA 4LAYA 1F40A 2PPPA 4ODRA 4Z2LA 1KFWA 1EYMA 1JNTA 2D9FA 4R0XA 4TNSA 1GUVA 4MNMA 3WD1A 4ODKA 3O5RA 4WKHA 3EY6A 2DT3A 4ZPWR 3CHDA 1XHGA 1NMVA 3WD2A 4U85A 1H0IA 1W1YA 4Q7NA 1K9TA 3B9DA 1EHNA 2K8IA 3FY1A 3CGMA 4P8UA 4DRNA 4MNJA 1NSGA 4MSPA 5JH8A 1HKKA 4LAWA 4P8WA 1ZL1A 2XP4A 4Z2JA 1BL4A 1HXVA 2A3EA 3ARRA 3ARPA 4DRJA 1QPLA 3O5FA 1E6PA 2XPBA 4KR0B 3UQIA 1D7IA 1WNOA 1OGGA 1Q6HA 3O5EA 1OWQA 5D75A 1NWRA 2ZR4A 1ITXA 4ZPVR 1FKDA 1ROUA 4LAVA 5HWCA 3AS3A 2XP7A 2LPVA 3KAHA 4P8VA 1JNSA 1HJWA 1E6RA 3TCZA 1LL7A 2OFNA 1ROTA 3ARZA 4WIWA 4DIPA 3BXWA 4W9QA 2Y78A 3RMEA 3TC5A 1FFRA 4P8XA 2FDMA 4IPXA 5DITA 3G6LA 2ZQUA 5GPGA 1D6OA 3AS1A 4J4NA 5HUAA 2B31A 2MLXA 2RSEA 2ZR5A 1FAPA 4AY1A 4DRKA 2PI6A 1FFQA 2KO7A 3ARVA 4QIBA 2PV3A 3H9RB 1LQ0A 1BKFA 2ZR6A 1FKGA 1FKJA 2WK2A 3IKGA 3WQWA 5B8IC 1LL6A 4WJXA 3NI6A 1EIBA 4Q22A 5GPRA 2M1IA 4NSBA 4L72B 2RQSA 3ARYA 3MDYB 1W9UA 3B8SA 1RD6A 1PINA 1SYTA 3WL0A 5HKGA 1Q6IA 1IX5A 3ARQA 3AQUA 2MNTA 4HBEA 3WKZA 1EDQA 3CH9A 1P5QA 3CGNA 4W5UA 2Q5AA 3O5QA 4MPKA 1QPFA 4Z2KA 3IK8A 4MTVA 1NMWA 4DH0A 3WL1A 1J4IA 1NWSA 4PTMA 4WKAA 4DRMA 1HJVA 1TFVA 1UR9A 4U84A 1ZU8A 4J4OA 3G6MA 3LUOA 4TW6A 4JFIA 1R9HA 3PRBA 2DSUA 2DT2A 2DSWA 1LL4A 1X6LA 3B7XA 3KAFA 4ZS6A 1W1TA 4N19A 4G2PA 3O5IA 4DRQA 2DT0A 3I6CA 3CHEA 4W9OA 1PBKA 2VN1A 4WK9A 3RGCA 1J4HA 2ITKA 1W26A 1FKTA 4WKFA 3ALFA 4S3KA 4FAPA 1E6ZA 2A3BA 3O5MA 2WLYA 2QF8A 2XP3A 5DO2A 2G41A 3WD3A 1NH6A 3O5LA 4DWSB 4JFKA 1F8AB 4URIA 5HWBA 5HW7A 3B9EA 2WM0A 1ZBVA 4ODPA 1ZB5A 4MNKA 1YATA 3QOKA 4ODLA 5HT1A 1CTNA 2FAPA 2YBTA 3O5GA 1HKIA 3UQAA 2RUDA 4S3JA 1NWUA 3TDBA 4MNLA 3NRKA 1LG1A 1FKSA 1GPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5J A;  4TNS A;  4GIV A;  3MDY B;  4U86 A;  2PV2 A;  1N1A A;  3KAC A;  4ODK A;  5HTG A;  3UI4 A;  4JFL A;  2KI3 A;  1PIN A;  1M5Y A;  3O5R A;  3EY6 A;  2PPN A;  3WH0 A;  5HKG A;  1NMV A;  1Q6I A;  3KCE A;  4NNR A;  4ODO A;  2MNT A;  4U85 A;  1FKR A;  4W9P A;  4TX0 A;  1P5Q A;  2XP8 A;  2RUQ A;  3CGN A;  1FKH A;  3IKD A;  1ZCN A;  2K8I A;  4DRN A;  2Q5A A;  3CGM A;  2DG9 A;  1QZ2 A;  3O5Q A;  4ODQ A;  1QPF A;  3JYM A;  1J6Y A;  3GPK A;  3IK8 A;  2UZ5 A;  1NMW A;  4QT2 A;  1FKI A;  1NSG A;  4MSP A;  4DH0 A;  4LAW A;  1J4I A;  3O5P A;  4BF8 A;  2XP9 A;  4TW8 A;  1YW5 A;  2M08 A;  4DZ3 A;  2AWG A;  2XP4 A;  4ITZ A;  2MF9 A;  4FN2 A;  4R0X A;  1BL4 A;  4LAX A;  4DRM A;  1EQ3 A;  3OOB A;  2RUC A;  4U84 A;  2XP6 A;  1HXV A;  4GGQ A;  2XP5 A;  4J4O A;  2LKN A;  4JYS A;  4DRO A;  4DRJ A;  1C9H A;  1QPL A;  2MLZ A;  2ZQV A;  4ODN A;  2M2A A;  3O5F A;  1FKF A;  2F21 A;  3UI6 A;  1L1P A;  3LUO A;  4TW6 A;  2N87 A;  2XPB A;  4JFI A;  2F4E A;  1FKK A;  2IF4 A;  2DG3 A;  1R9H A;  4DZ2 A;  3PRB A;  3UQI A;  4O2T A;  1D7I A;  3O5E A;  1Q6H A;  1U79 A;  3B7X A;  3KAF A;  4C02 B;  2JZV A;  2F2D A;  5D75 A;  2PPO A;  4N19 A;  4TW7 A;  4G2P A;  5DIV A;  1FJD A;  3O5I A;  2ZR4 A;  1KT0 A;  4DRQ A;  3I6C A;  4W9O A;  1FKD A;  1PBK A;  2VN1 A;  3FAP A;  1ROU A;  1D7H A;  3KAI A;  3NTP A;  4IQC A;  4LAV A;  4MGV A;  5HWC A;  2XP7 A;  3UI5 A;  3KAD A;  3RGC A;  2VCD A;  5I98 A;  3KZ7 A;  2LPV A;  5HW8 A;  1A7X A;  3KAH A;  1J4H A;  2ITK A;  4DRI A;  2KR7 A;  1J4R A;  1JNS A;  3TCZ A;  1W26 A;  1FKT A;  2PBC A;  2OFN A;  1ROT A;  2KGJ A;  3O5K A;  2KE0 A;  4DIP A;  5BXJ A;  4FAP A;  2MPH A;  4JFM A;  1TCO C;  3JXV A;  4W9Q A;  5DIU A;  4DRP A;  2Y78 A;  3O5D A;  1FD9 A;  3TC5 A;  2MLY A;  3O5M A;  4IPX A;  4DT4 A;  1Y0O A;  3ODK A;  5DIT A;  2XP3 A;  2ZQU A;  4JFJ A;  2ZQS A;  4IQ2 A;  3UQB A;  1FKB A;  5GPG A;  1D6O A;  4J4N A;  5HUA A;  3KAG A;  1D7J A;  3JYJ A;  2MLX A;  3IHZ A;  2RUR A;  2DG4 A;  2RSE A;  2ZR5 A;  1FAP A;  3O5L A;  4ODM A;  4DRK A;  2KFW A;  1Q6U A;  2ZQT A;  2KO7 A;  5HW6 A;  4JFK A;  1F8A B;  3UF8 A;  1T11 A;  1JVW A;  5HW7 A;  5HWB A;  1FKL A;  3VAW A;  4QIB A;  3RFW A;  4DRH A;  2PV3 A;  3H9R B;  2LJ4 A;  3KAB A;  4ODP A;  2PV1 A;  4G50 A;  2L2S A;  1BKF A;  1YAT A;  2ZR6 A;  3O5O A;  1ZK6 A;  1FKG A;  1FKJ A;  1B6C A;  3IKG A;  2LGO A;  4LAY A;  4TYO A;  4ODL A;  2XPA A;  5B8I C;  5HT1 A;  1Q1C A;  5J6E A;  2FKE A;  1F40 A;  2PPP A;  2FAP A;  4ODR A;  3NI6 A;  3O5G A;  4QT3 A;  3UQA A;  2RUD A;  1KT1 A;  3TDB A;  2M1I A;  3NRK A;  1EYM A;  1FKS A;  1JNT A;  3PRD A;  2D9F A;  2RQS A;  3PA7 A; 
#chains in the Genus database with same CATH topology
 3O5J A;  3ARO A;  4U86 A;  2PV2 A;  3WD4 A;  5HTG A;  4JFL A;  1M5Y A;  3WH0 A;  1UR8 A;  4NNR A;  4ODO A;  2ETN A;  1OGB A;  4QZV B;  2RUQ A;  3IKD A;  1ZCN A;  2DG9 A;  1QZ2 A;  3GPK A;  2UZ5 A;  4QT2 A;  1FKI A;  2DSZ A;  2F23 A;  3ARS A;  2XP9 A;  3PRA A;  4ITZ A;  1X6N A;  2YBU A;  4LAX A;  4ML4 A;  3OOB A;  2RUC A;  3RM8 A;  4HBO A;  1C9H A;  2MLZ A;  2ZQV A;  4ODN A;  2G8Z A;  1FKF A;  1W9V A;  2F21 A;  4L3N A;  1E44 A;  1L1P A;  1FKK A;  4Z2G A;  3WD0 A;  1U79 A;  2JZV A;  1NWT A;  1W1P A;  4TW7 A;  1FJD A;  1GOI A;  1VF8 A;  1WAW A;  4R5E A;  3NTP A;  4MGV A;  3KAD A;  3KZ7 A;  1A7X A;  1HKM A;  5GQB A;  4DRI A;  2KR7 A;  3GU0 A;  2PBC A;  2MPH A;  3JXV A;  1WB0 A;  1W1V A;  5DEZ A;  3O5D A;  1FD9 A;  2A3C A;  2DSV A;  4KQZ A;  1XRV A;  2ZQS A;  4IQ2 A;  4JFJ A;  3UQB A;  4DWS C;  3ARU A;  4ZPT R;  1E6N A;  1D7J A;  3JYJ A;  4ODM A;  4IT4 A;  3AS0 A;  1JND A;  1JNE A;  1Q6U A;  2ZQT A;  3FXY A;  3UF8 A;  1ZBW A;  2AOS A;  3PR9 A;  3VAW A;  1O6I A;  3RFW A;  4DRH A;  4G50 A;  2L2S A;  3O5O A;  1ZK6 A;  1B6C A;  1HJX A;  2LGO A;  2O92 A;  1LJY A;  1LG2 A;  2XPA A;  3RM9 A;  1Q1C A;  5J6E A;  2FKE A;  1ZBC A;  3W4R A;  4NZC A;  4QT3 A;  2O9O A;  1KT1 A;  3CHC A;  3PRD A;  4DWS A;  2DPE A;  3PA7 A;  4GIV A;  3KAC A;  1N1A A;  4DWS D;  3UI4 A;  2KI3 A;  3CZ8 A;  2PPN A;  1E9L A;  3ALG A;  2IUZ A;  3KCE A;  1FKR A;  4W9P A;  3WQV A;  4TX0 A;  2XP8 A;  1FKH A;  3GTY X;  4Z2H A;  1W9P A;  4ODQ A;  1J6Y A;  3JYM A;  5HBF A;  3O5P A;  4BF8 A;  3ARX A;  4TW8 A;  1YW5 A;  2M08 A;  4DZ3 A;  2AWG A;  3ART A;  3CHF A;  2MF9 A;  4FN2 A;  1EQ3 A;  2XP6 A;  4IT6 A;  4GGQ A;  2XP5 A;  3ARW A;  2LKN A;  4JYS A;  4DRO A;  2M2A A;  2OLH A;  3WIJ A;  3UI6 A;  2N87 A;  2F4E A;  2IF4 A;  2WLZ A;  2DG3 A;  4DZ2 A;  4O2T A;  4C02 B;  2A3A A;  2F2D A;  3B9A A;  2PPO A;  5DIV A;  1H0G A;  1HKJ A;  1KT0 A;  3FAP A;  3KAI A;  1D7H A;  4IQC A;  4LGX A;  5I98 A;  3UI5 A;  2VCD A;  5HW8 A;  1J4R A;  1SR0 A;  2KGJ A;  3O5K A;  2KE0 A;  5BXJ A;  4JFM A;  1TCO C;  5DIU A;  4DRP A;  2MLY A;  5DF0 A;  4DT4 A;  1Y0O A;  3ODK A;  1D2K A;  1FKB A;  3OA5 A;  2DT1 A;  4MAV A;  3KAG A;  1ZBK A;  3RM4 A;  2ESC A;  3IHZ A;  2RUR A;  2DG4 A;  2KFW A;  4HAR A;  5HW6 A;  1T11 A;  1JVW A;  4XAK A;  1E15 A;  1FKL A;  4Z2I A;  3KAB A;  2LJ4 A;  2PV1 A;  3AS2 A;  4TYO A;  4LAY A;  1F40 A;  2PPP A;  4ODR A;  4Z2L A;  1KFW A;  1EYM A;  1JNT A;  2D9F A;  4R0X A;  4TNS A;  1GUV A;  4MNM A;  3WD1 A;  4ODK A;  3O5R A;  4WKH A;  3EY6 A;  2DT3 A;  4ZPW R;  3CHD A;  1XHG A;  1NMV A;  3WD2 A;  4U85 A;  1H0I A;  1W1Y A;  4Q7N A;  1K9T A;  3B9D A;  1EHN A;  2K8I A;  3FY1 A;  3CGM A;  4P8U A;  4DRN A;  4MNJ A;  2PN0 A;  1NSG A;  4MSP A;  5JH8 A;  1HKK A;  4LAW A;  4P8W A;  1ZL1 A;  2XP4 A;  4Z2J A;  1BL4 A;  1HXV A;  2A3E A;  3ARR A;  3ARP A;  4DRJ A;  1QPL A;  3O5F A;  1E6P A;  2XPB A;  4KR0 B;  3UQI A;  2B5U B;  1D7I A;  1WNO A;  1OGG A;  1Q6H A;  3O5E A;  2EUL A;  1OWQ A;  5D75 A;  1NWR A;  2P4V A;  2ZR4 A;  1ITX A;  4ZPV R;  1FKD A;  1ROU A;  4LAV A;  5HWC A;  3AS3 A;  2XP7 A;  2LPV A;  3KAH A;  4P8V A;  1JNS A;  1HJW A;  1E6R A;  3TCZ A;  1LL7 A;  2OFN A;  1ROT A;  3ARZ A;  3EIP A;  4WIW A;  4DIP A;  3BXW A;  4W9Q A;  2Y78 A;  3RME A;  3TC5 A;  1FFR A;  4P8X A;  2FDM A;  4IPX A;  5DIT A;  3G6L A;  2ZQU A;  5GPG A;  1D6O A;  3AS1 A;  4J4N A;  5HUA A;  2B31 A;  2MLX A;  2RSE A;  2ZR5 A;  1FAP A;  3BMB A;  4AY1 A;  4DRK A;  2PI6 A;  1FFQ A;  2KO7 A;  3ARV A;  4QIB A;  2PV3 A;  3H9R B;  1LQ0 A;  1BKF A;  2ZR6 A;  1FKG A;  1FKJ A;  2WK2 A;  3IKG A;  3WQW A;  5B8I C;  1LL6 A;  4WJX A;  3NI6 A;  1EIB A;  4Q22 A;  5GPR A;  2M1I A;  4NSB A;  4L72 B;  2RQS A;  3ARY A;  3MDY B;  1W9U A;  3B8S A;  1RD6 A;  1PIN A;  1SYT A;  3WL0 A;  5HKG A;  1Q6I A;  1IX5 A;  3ARQ A;  3AQU A;  2MNT A;  4HBE A;  3WKZ A;  1GRJ A;  1EDQ A;  3CH9 A;  1P5Q A;  3CGN A;  4W5U A;  2Q5A A;  3O5Q A;  4MPK A;  1QPF A;  4Z2K A;  3IK8 A;  4MTV A;  1NMW A;  4DH0 A;  3WL1 A;  1J4I A;  1NWS A;  4PTM A;  4WKA A;  4DRM A;  1HJV A;  1TFV A;  1UR9 A;  4U84 A;  1ZU8 A;  4J4O A;  3G6M A;  3LUO A;  4TW6 A;  4UDM A;  4JFI A;  1R9H A;  3PRB A;  2DSU A;  2DT2 A;  2DSW A;  1LL4 A;  1X6L A;  3KAF A;  3B7X A;  4ZS6 A;  1W1T A;  4N19 A;  4G2P A;  3O5I A;  4DRQ A;  2DT0 A;  3I6C A;  3CHE A;  4W9O A;  1PBK A;  2VN1 A;  4WK9 A;  3RGC A;  1J4H A;  2ITK A;  1JCH B;  1W26 A;  1FKT A;  4WKF A;  3ALF A;  4S3K A;  4FAP A;  1E6Z A;  2A3B A;  3O5M A;  2WLY A;  2QF8 A;  2XP3 A;  5DO2 A;  2G41 A;  3WD3 A;  1NH6 A;  3O5L A;  4DWS B;  4JFK A;  1F8A B;  4URI A;  5HWB A;  5HW7 A;  3B9E A;  2WM0 A;  1ZBV A;  4ODP A;  1ZB5 A;  4MNK A;  1YAT A;  3QOK A;  4ODL A;  5HT1 A;  1CTN A;  2FAP A;  2YBT A;  3O5G A;  1HKI A;  3UQA A;  2RUD A;  4S3J A;  1NWU A;  3TDB A;  4MNL A;  3NRK A;  1LG1 A;  1FKS A;  1GPF A; 
#chains in the Genus database with same CATH homology
 3O5J A;  3ARO A;  4U86 A;  2PV2 A;  3WD4 A;  5HTG A;  4JFL A;  1M5Y A;  3WH0 A;  1UR8 A;  4NNR A;  4ODO A;  1OGB A;  4QZV B;  2RUQ A;  3IKD A;  1ZCN A;  2DG9 A;  1QZ2 A;  3GPK A;  2UZ5 A;  4QT2 A;  1FKI A;  2DSZ A;  3ARS A;  2XP9 A;  3PRA A;  4ITZ A;  1X6N A;  2YBU A;  4LAX A;  4ML4 A;  3OOB A;  2RUC A;  3RM8 A;  4HBO A;  1C9H A;  2MLZ A;  2ZQV A;  4ODN A;  2G8Z A;  1FKF A;  1W9V A;  2F21 A;  4L3N A;  1L1P A;  1FKK A;  4Z2G A;  3WD0 A;  1U79 A;  2JZV A;  1NWT A;  1W1P A;  4TW7 A;  1FJD A;  1GOI A;  1VF8 A;  1WAW A;  4R5E A;  3NTP A;  4MGV A;  3KAD A;  3KZ7 A;  1A7X A;  1HKM A;  5GQB A;  4DRI A;  2KR7 A;  2PBC A;  2MPH A;  3JXV A;  1WB0 A;  1W1V A;  5DEZ A;  3O5D A;  1FD9 A;  2A3C A;  2DSV A;  4KQZ A;  1XRV A;  2ZQS A;  4IQ2 A;  4JFJ A;  3UQB A;  4DWS C;  3ARU A;  4ZPT R;  1E6N A;  1D7J A;  3JYJ A;  4ODM A;  4IT4 A;  3AS0 A;  1JND A;  1JNE A;  1Q6U A;  2ZQT A;  3FXY A;  3UF8 A;  1ZBW A;  2AOS A;  3PR9 A;  3VAW A;  1O6I A;  3RFW A;  4DRH A;  4G50 A;  2L2S A;  3O5O A;  1ZK6 A;  1B6C A;  1HJX A;  2LGO A;  2O92 A;  1LJY A;  1LG2 A;  2XPA A;  3RM9 A;  1Q1C A;  5J6E A;  2FKE A;  1ZBC A;  3W4R A;  4NZC A;  4QT3 A;  2O9O A;  1KT1 A;  3CHC A;  3PRD A;  4DWS A;  2DPE A;  3PA7 A;  4GIV A;  3KAC A;  1N1A A;  4DWS D;  3UI4 A;  2KI3 A;  3CZ8 A;  2PPN A;  1E9L A;  3ALG A;  2IUZ A;  3KCE A;  1FKR A;  4W9P A;  3WQV A;  4TX0 A;  2XP8 A;  1FKH A;  4Z2H A;  1W9P A;  4ODQ A;  1J6Y A;  3JYM A;  5HBF A;  3O5P A;  4BF8 A;  3ARX A;  4TW8 A;  1YW5 A;  2M08 A;  4DZ3 A;  2AWG A;  3ART A;  3CHF A;  2MF9 A;  4FN2 A;  1EQ3 A;  2XP6 A;  4IT6 A;  4GGQ A;  2XP5 A;  3ARW A;  2LKN A;  4JYS A;  4DRO A;  2M2A A;  2OLH A;  3WIJ A;  3UI6 A;  2N87 A;  2F4E A;  2IF4 A;  2WLZ A;  2DG3 A;  4DZ2 A;  4O2T A;  4C02 B;  2A3A A;  2F2D A;  3B9A A;  2PPO A;  5DIV A;  1H0G A;  1HKJ A;  1KT0 A;  3FAP A;  3KAI A;  1D7H A;  4IQC A;  4LGX A;  5I98 A;  3UI5 A;  2VCD A;  5HW8 A;  1J4R A;  1SR0 A;  2KGJ A;  3O5K A;  2KE0 A;  5BXJ A;  4JFM A;  1TCO C;  5DIU A;  4DRP A;  2MLY A;  5DF0 A;  4DT4 A;  1Y0O A;  3ODK A;  1D2K A;  1FKB A;  3OA5 A;  2DT1 A;  4MAV A;  3KAG A;  1ZBK A;  3RM4 A;  2ESC A;  3IHZ A;  2RUR A;  2DG4 A;  2KFW A;  4HAR A;  5HW6 A;  1T11 A;  1JVW A;  4XAK A;  1E15 A;  1FKL A;  4Z2I A;  3KAB A;  2LJ4 A;  2PV1 A;  3AS2 A;  4TYO A;  4LAY A;  1F40 A;  2PPP A;  4ODR A;  4Z2L A;  1KFW A;  1EYM A;  1JNT A;  2D9F A;  4R0X A;  4TNS A;  1GUV A;  4MNM A;  3WD1 A;  4ODK A;  3O5R A;  4WKH A;  3EY6 A;  2DT3 A;  4ZPW R;  3CHD A;  1XHG A;  1NMV A;  3WD2 A;  4U85 A;  1H0I A;  1W1Y A;  4Q7N A;  1K9T A;  3B9D A;  1EHN A;  2K8I A;  3FY1 A;  3CGM A;  4P8U A;  4DRN A;  4MNJ A;  1NSG A;  4MSP A;  5JH8 A;  1HKK A;  4LAW A;  4P8W A;  1ZL1 A;  2XP4 A;  4Z2J A;  1BL4 A;  1HXV A;  2A3E A;  3ARR A;  3ARP A;  4DRJ A;  1QPL A;  3O5F A;  1E6P A;  2XPB A;  4KR0 B;  3UQI A;  1D7I A;  1WNO A;  1OGG A;  1Q6H A;  3O5E A;  1OWQ A;  5D75 A;  1NWR A;  2ZR4 A;  1ITX A;  4ZPV R;  1FKD A;  1ROU A;  4LAV A;  5HWC A;  3AS3 A;  2XP7 A;  2LPV A;  3KAH A;  4P8V A;  1JNS A;  1HJW A;  1E6R A;  3TCZ A;  1LL7 A;  2OFN A;  1ROT A;  3ARZ A;  4WIW A;  4DIP A;  3BXW A;  4W9Q A;  2Y78 A;  3RME A;  3TC5 A;  1FFR A;  4P8X A;  2FDM A;  4IPX A;  5DIT A;  3G6L A;  2ZQU A;  5GPG A;  1D6O A;  3AS1 A;  4J4N A;  5HUA A;  2B31 A;  2MLX A;  2RSE A;  2ZR5 A;  1FAP A;  4AY1 A;  4DRK A;  2PI6 A;  1FFQ A;  2KO7 A;  3ARV A;  4QIB A;  2PV3 A;  3H9R B;  1LQ0 A;  1BKF A;  2ZR6 A;  1FKG A;  1FKJ A;  2WK2 A;  3IKG A;  3WQW A;  5B8I C;  1LL6 A;  4WJX A;  3NI6 A;  1EIB A;  4Q22 A;  5GPR A;  2M1I A;  4NSB A;  4L72 B;  2RQS A;  3ARY A;  3MDY B;  1W9U A;  3B8S A;  1RD6 A;  1PIN A;  1SYT A;  3WL0 A;  5HKG A;  1Q6I A;  1IX5 A;  3ARQ A;  3AQU A;  2MNT A;  4HBE A;  3WKZ A;  1EDQ A;  3CH9 A;  1P5Q A;  3CGN A;  4W5U A;  2Q5A A;  3O5Q A;  4MPK A;  1QPF A;  4Z2K A;  3IK8 A;  4MTV A;  1NMW A;  4DH0 A;  3WL1 A;  1J4I A;  1NWS A;  4PTM A;  4WKA A;  4DRM A;  1HJV A;  1TFV A;  1UR9 A;  4U84 A;  1ZU8 A;  4J4O A;  3G6M A;  3LUO A;  4TW6 A;  4JFI A;  1R9H A;  3PRB A;  2DSU A;  2DT2 A;  2DSW A;  1LL4 A;  1X6L A;  3B7X A;  3KAF A;  4ZS6 A;  1W1T A;  4N19 A;  4G2P A;  3O5I A;  4DRQ A;  2DT0 A;  3I6C A;  3CHE A;  4W9O A;  1PBK A;  2VN1 A;  4WK9 A;  3RGC A;  1J4H A;  2ITK A;  1W26 A;  1FKT A;  4WKF A;  3ALF A;  4S3K A;  4FAP A;  1E6Z A;  2A3B A;  3O5M A;  2WLY A;  2QF8 A;  2XP3 A;  5DO2 A;  2G41 A;  3WD3 A;  1NH6 A;  3O5L A;  4DWS B;  4JFK A;  1F8A B;  4URI A;  5HWB A;  5HW7 A;  3B9E A;  2WM0 A;  1ZBV A;  4ODP A;  1ZB5 A;  4MNK A;  1YAT A;  3QOK A;  4ODL A;  5HT1 A;  1CTN A;  2FAP A;  2YBT A;  3O5G A;  1HKI A;  3UQA A;  2RUD A;  4S3J A;  1NWU A;  3TDB A;  4MNL A;  3NRK A;  1LG1 A;  1FKS A;  1GPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...