4C02B

Crystal structure of human acvr1 (alk2) in complex with fkbp12.6 and dorsomorphin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Acvr1 (Alk2) in Complex with Fkbp12.6 And Dorsomorphin
rcsb
source organism Homo sapiens
molecule tags Transferase/isomerase
molecule keywords ACTIVIN RECEPTOR TYPE-1
total genus 24
structure length 108
sequence length 108
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4c02B00
3OOBA 4G50A 5J6EA 2Q5AA 4W9OA 4DRIA 2N87A 1KT1A 2L2SA 4DRHA 1M5YA 2ZQUA 4DH0A 2LJ4A 4DRPA 3CGMA 3O5QA 1FKGA 2ZR6A 1FKBA 5HT1A 3FAPA 3UQIA 4NNRA 5I98A 3O5JA 5DIVA 4DZ3A 2MLXA 3TDBA 2PPOA 4MGVA 2JZVA 2KFWA 1BKFA 2PV2A 3O5PA 3O5IA 3KAFA 4ODKA 4IQCA 1NMWA 1A7XA 4DROA 1FKJA 3UQAA 5D75A 1KT0A 1D7HA 3NRKA 4C02B 3RFWA 3VAWA 4TX0A 3WH0A 5DIUA 1N1AA 2RSEA 1D6OA 2PPNA 4IQ2A 2M2AA 4JFLA 1FKTA 3PRDA 1ROUA 4J4NA 1Y0OA 3IK8A 4TW6A 3UI6A 2XP8A 3I6CA 1J4HA 1FKKA 4ODPA 3KAGA 1Q6UA 3H9RB 2K8IA 1EYMA 2XP9A 4JFIA 3ODKA 2ZQSA 3KADA 1D7IA 1JNTA 2XPAA 2LKNA 2Y78A 1QPFA 4ODQA 3KCEA 4DRQA 4LAWA 1PBKA 2UZ5A 1ROTA 2FKEA 5BXJA 4ODLA 3O5FA 4U86A 5HW6A 3TCZA 3O5DA 2MLZA 3KACA 1TCOC 2ZQVA 3JYMA 2LPVA 3IKGA 3RGCA 4DT4A 4DRMA 1YW5A 5GPGA 4TW7A 4TW8A 4W9PA 1FKRA 1QPLA 3GPKA 3KABA 2IF4A 2XP6A 5HW7A 1EQ3A 4FAPA 5HKGA 4U84A 2XP4A 4TYOA 1L1PA 1JNSA 1FD9A 3UI5A 1Q6HA 2DG3A 2F4EA 1PINA 3KAHA 4ODRA 2D9FA 4N19A 1ZK6A 4ODOA 3IHZA 1J4IA 2XP7A 3O5LA 1FKLA 5HW8A 1C9HA 2XPBA 1FAPA 3MDYB 4GIVA 3LUOA 4W9QA 1QZ2A 2F21A 4ITZA 4DIPA 2PPPA 3PRBA 1F40A 1FKFA 1Q6IA 3PA7A 2ITKA 4R0XA 1ZCNA 2OFNA 3KAIA 5HTGA 1BL4A 1NMVA 1HXVA 2MF9A 2RUQA 4FN2A 1FJDA 4JFJA 4DZ2A 3CGNA 3IKDA 3O5OA 4O2TA 2M1IA 2ZR5A 2DG4A 5HUAA 2PV3A 4ODNA 2ZR4A 1B6CA 2FAPA 3O5GA 3O5MA 4QT3A 4JYSA 4LAYA 2VN1A 2PBCA 2KE0A 3JYJA 5HWCA 2PV1A 3NI6A 1FKSA 4DRJA 4DRKA 2KGJA 4LAVA 3UF8A 4QT2A 1W26A 3EY6A 2LGOA 4DRNA 3NTPA 4IPXA 1J4RA 2ZQTA 4LAXA 1T11A 2RURA 3KZ7A 2DG9A 5HWBA 2KO7A 1FKIA 1FKDA 2F2DA 2KI3A 3B7XA 4BF8A 5B8IC 4QIBA 1U79A 4MSPA 1NSGA 1J6YA 3O5KA 4U85A 3O5EA 2AWGA 1JVWA 1R9HA 4GGQA 2MPHA 4ODMA 1FKHA 4JFKA 3UI4A 3UQBA 2XP3A 2MLYA 4J4OA 2MNTA 5DITA 2RQSA 1F8AB 1Q1CA 2M08A 3O5RA 1P5QA 2VCDA 1D7JA 2XP5A 4JFMA 2RUCA 3JXVA 4G2PA 2RUDA 4TNSA 2KR7A 3TC5A 1YATA
chains in the Genus database with same CATH superfamily
3OOBA 3WD3A 2Q5AA 4ZPWR 2G41A 3CGMA 3O5QA 5HT1A 5I98A 4DZ3A 3BMBA 2JZVA 1W1YA 2KFWA 4XAKA 3KAFA 3WIJA 1NMWA 3RMEA 1FKJA 3PR9A 3ARTA 1KT0A 3FXYA 1FKKA 1W1VA 2K8IA 3ARVA 4JFIA 3ARQA 4Q22A 4UDMA 2ZQSA 1JNTA 1IX5A 3WD1A 4MNKA 3KCEA 4LAWA 1PBKA 1LJYA 4Z2GA 3AS1A 2LPVA 1EDQA 3IKGA 3RGCA 1TFVA 4DRMA 4HARA 3B9AA 3AQUA 4PTMA 1EQ3A 5HKGA 2DSZA 4TYOA 1L1PA 5DEZA 3UI5A 1JNDA 1PINA 1Q6HA 2DG3A 3ALGA 4N19A 1J4IA 2XP7A 4WKHA 5HW8A 4IT6A 3LUOA 1QZ2A 3RM8A 4R0XA 3KAIA 4ZPTR 5HTGA 3BXWA 4P8WA 1ZBCA 4MPKA 2ZR4A 1B6CA 2FAPA 2VN1A 2A3AA 4DRKA 4DWSB 1JCHB 4DRJA 2KGJA 3UF8A 4QT2A 3OA5A 2O92A 4DRNA 3CHCA 4LAXA 1SR0A 1T11A 3KZ7A 1GRJA 2DG9A 2KO7A 4BF8A 1D2KA 3AROA 3B9EA 4JFKA 3UQBA 2XP3A 5DITA 4ZPVR 1H0IA 1P5QA 1D7JA 2XP5A 3AS0A 2KR7A 1YATA 4AY1A 4KQZA 4G50A 4DRIA 3ARYA 1KT1A 2L2SA 1GPFA 1M5YA 2ZQUA 4DRPA 1NWSA 1FKGA 2ZR6A 1FKBA 5DIVA 4ZS6A 3WD4A 2A3EA 2A3CA 3O5PA 1FFRA 3O5IA 4NZCA 1A7XA 4DROA 4Z2LA 5GPRA 2DPEA 2IUZA 2RSEA 2PPNA 3ARSA 2M2AA 2PI6A 3RM9A 2ETNA 1Y0OA 3IK8A 1HKMA 1O6IA 3I6CA 3ALFA 1EYMA 2XP9A 4DWSA 2B31A 1CTNA 2LKNA 1OWQA 3WQWA 1FFQA 1W9PA 3O5DA 3TCZA 2ZQVA 2WLZA 4URIA 4HBEA 5GPGA 4W9PA 1QPLA 4U84A 2EULA 2WK2A 3B9DA 2F4EA 3G6MA 3KAHA 4ODRA 1ZK6A 2WLYA 1C9HA 1FAPA 2DSUA 3PRBA 3PA7A 2ITKA 3G6LA 2RUQA 2AOSA 2DSVA 2YBTA 4FN2A 2A3BA 1E44A 4DZ2A 1K9TA 4O2TA 5HUAA 1SYTA 1HKKA 4JYSA 2PBCA 2KE0A 3NI6A 4MTVA 4LAVA 3CHFA 4IPXA 4Z2HA 2ZQTA 1UR8A 4L3NA 4WKAA 1FKIA 4QIBA 1W1PA 5HBFA 1NH6A 1U79A 3ARUA 1NSGA 1J6YA 1XHGA 4MNJA 2AWGA 1JVWA 1R9HA 2MPHA 4J4OA 1WAWA 3B8SA 2RQSA 1ZB5A 2VCDA 1E9LA 1LL7A 4JFMA 3JXVA 4G2PA 1E6NA 1OGGA 5J6EA 4W9OA 3GU0A 1LL4A 2OLHA 2G8ZA 4DRHA 2LJ4A 3FAPA 4S3KA 4DWSC 3O5JA 4MGVA 1EIBA 2PV2A 4ODKA 4S3JA 3UQAA 2B5UB 4IT4A 4TX0A 1N1AA 4JFLA 4IQ2A 3PRDA 1ROUA 4J4NA 4Z2IA 1RD6A 3UI6A 2XP8A 2DT0A 1J4HA 3WQVA 1KFWA 4ODPA 3KAGA 3RM4A 2O9OA 3ARXA 3ODKA 4QZVB 1D7IA 1ZU8A 2Y78A 4ODQA 4DRQA 1ROTA 1W9UA 1HJWA 4ODLA 4U86A 1JNEA 3JYMA 3AS3A 4DT4A 1YW5A 4TW7A 4TW8A 1HKIA 3AS2A 3KABA 5HW7A 1ITXA 4FAPA 2XP4A 3WD0A 1EHNA 4LGXA 2D9FA 4ODOA 3CZ8A 1FKLA 1ZBKA 1X6NA 4GIVA 5GQBA 1NWRA 2F21A 4ITZA 4Z2JA 1Q6IA 1BL4A 2PN0A 1HXVA 4R5EA 4JFJA 1GUVA 4MNLA 1E6ZA 3CGNA 3IKDA 3O5OA 2ZR5A 4MAVA 4Z2KA 1XRVA 2DT3A 2DSWA 2ESCA 3JYJA 5HWCA 2PV1A 4NSBA 4HBOA 1W26A 1J4RA 1W1TA 1ZL1A 3CH9A 4MNMA 4ML4A 3B7XA 1NWUA 1OGBA 1LL6A 3O5KA 3O5EA 5DF0A 1H0GA 4ODMA 1LG2A 1F8AB 1Q1CA 1WNOA 3O5RA 2RUCA 2N87A 2P4VA 4DH0A 3UQIA 4NNRA 2MLXA 3TDBA 2PPOA 1BKFA 3QOKA 3WL0A 4IQCA 1ZBVA 5D75A 4WKFA 1D7HA 3NRKA 5JH8A 3WD2A 4C02B 3RFWA 3VAWA 3WH0A 3WKZA 5DIUA 1D6OA 1FKTA 4TW6A 1E6RA 2DT2A 4L72B 2WM0A 1Q6UA 3ARPA 3H9RB 4WK9A 3CHDA 1X6LA 3KADA 2XPAA 1QPFA 1UR9A 2UZ5A 2FKEA 5BXJA 3O5FA 4WIWA 1E6PA 5HW6A 2MLZA 4P8UA 3KACA 1TCOC 3ARRA 2YBUA 3EIPA 1FKRA 3PRAA 2QF8A 2FDMA 3GPKA 1W9VA 2IF4A 2XP6A 5DO2A 1HJXA 1JNSA 1FD9A 3CHEA 1ZBWA 3W4RA 4P8VA 3ARWA 3IHZA 3GTYX 3O5LA 2XPBA 3MDYB 1E15A 4W9QA 1F40A 4DIPA 2PPPA 1FKFA 1ZCNA 2OFNA 1NMVA 2DT1A 1LQ0A 4Q7NA 4WJXA 2MF9A 1FJDA 4DWSD 1GOIA 1WB0A 1NWTA 2M1IA 4W5UA 2DG4A 2PV3A 4ODNA 3O5GA 3O5MA 4QT3A 4LAYA 1FKSA 3FY1A 4P8XA 3EY6A 2LGOA 3NTPA 1VF8A 2RURA 3WL1A 4KR0B 1HJVA 5HWBA 2F2DA 1FKDA 2KI3A 5B8IC 4MSPA 3ARZA 4U85A 4GGQA 1FKHA 3UI4A 2MLYA 2MNTA 2M08A 1LG1A 1HKJA 2F23A 2RUDA 4TNSA 3TC5A
chains in the Genus database with same CATH topology
3OOBA 3WD3A 2Q5AA 4ZPWR 2G41A 3CGMA 3O5QA 5HT1A 5I98A 4DZ3A 2JZVA 1W1YA 2KFWA 4XAKA 3KAFA 3WIJA 1NMWA 3RMEA 1FKJA 3PR9A 3ARTA 1KT0A 3FXYA 1FKKA 1W1VA 2K8IA 3ARVA 4JFIA 3ARQA 4Q22A 2ZQSA 1JNTA 1IX5A 3WD1A 4MNKA 3KCEA 4LAWA 1PBKA 1LJYA 4Z2GA 3AS1A 2LPVA 1EDQA 3IKGA 3RGCA 1TFVA 4DRMA 4HARA 3B9AA 3AQUA 4PTMA 1EQ3A 5HKGA 2DSZA 4TYOA 1L1PA 5DEZA 3UI5A 1JNDA 1PINA 1Q6HA 2DG3A 3ALGA 4N19A 1J4IA 2XP7A 4WKHA 5HW8A 4IT6A 3LUOA 1QZ2A 3RM8A 4R0XA 3KAIA 4ZPTR 5HTGA 3BXWA 4P8WA 1ZBCA 4MPKA 2ZR4A 1B6CA 2FAPA 2VN1A 2A3AA 4DRKA 4DWSB 4DRJA 2KGJA 3UF8A 4QT2A 3OA5A 2O92A 4DRNA 3CHCA 4LAXA 1SR0A 1T11A 3KZ7A 2DG9A 2KO7A 4BF8A 1D2KA 3AROA 3B9EA 4JFKA 3UQBA 2XP3A 5DITA 4ZPVR 1H0IA 1P5QA 1D7JA 2XP5A 3AS0A 2KR7A 1YATA 4AY1A 4KQZA 4G50A 4DRIA 3ARYA 1KT1A 2L2SA 1GPFA 1M5YA 2ZQUA 4DRPA 1NWSA 1FKGA 2ZR6A 1FKBA 5DIVA 4ZS6A 3WD4A 2A3EA 2A3CA 3O5PA 1FFRA 3O5IA 4NZCA 1A7XA 4DROA 4Z2LA 5GPRA 2DPEA 2IUZA 2RSEA 2PPNA 3ARSA 2M2AA 2PI6A 3RM9A 1Y0OA 3IK8A 1HKMA 1O6IA 3I6CA 3ALFA 1EYMA 2XP9A 4DWSA 2B31A 1CTNA 2LKNA 1OWQA 3WQWA 1FFQA 1W9PA 3O5DA 3TCZA 2ZQVA 2WLZA 4URIA 4HBEA 5GPGA 4W9PA 1QPLA 4U84A 2WK2A 3B9DA 2F4EA 3G6MA 3KAHA 4ODRA 1ZK6A 2WLYA 1C9HA 1FAPA 2DSUA 3PRBA 3PA7A 2ITKA 3G6LA 2RUQA 2AOSA 2DSVA 2YBTA 4FN2A 2A3BA 4DZ2A 1K9TA 4O2TA 5HUAA 1SYTA 1HKKA 4JYSA 2PBCA 2KE0A 3NI6A 4MTVA 4LAVA 3CHFA 4IPXA 4Z2HA 2ZQTA 1UR8A 4L3NA 4WKAA 1FKIA 4QIBA 1W1PA 5HBFA 1NH6A 1U79A 3ARUA 1NSGA 1J6YA 1XHGA 4MNJA 2AWGA 1JVWA 1R9HA 2MPHA 4J4OA 1WAWA 3B8SA 2RQSA 1ZB5A 2VCDA 1E9LA 1LL7A 4JFMA 3JXVA 4G2PA 1E6NA 1OGGA 5J6EA 4W9OA 1LL4A 2OLHA 2G8ZA 4DRHA 2LJ4A 3FAPA 4S3KA 4DWSC 3O5JA 4MGVA 1EIBA 2PV2A 4ODKA 4S3JA 3UQAA 4IT4A 4TX0A 1N1AA 4JFLA 4IQ2A 3PRDA 1ROUA 4J4NA 4Z2IA 1RD6A 3UI6A 2XP8A 2DT0A 1J4HA 3WQVA 1KFWA 4ODPA 3KAGA 3RM4A 2O9OA 3ARXA 3ODKA 4QZVB 1D7IA 1ZU8A 2Y78A 4ODQA 4DRQA 1ROTA 1W9UA 1HJWA 4ODLA 4U86A 1JNEA 3JYMA 3AS3A 4DT4A 1YW5A 4TW7A 4TW8A 1HKIA 3AS2A 3KABA 5HW7A 1ITXA 4FAPA 2XP4A 3WD0A 1EHNA 4LGXA 2D9FA 4ODOA 3CZ8A 1FKLA 1ZBKA 1X6NA 4GIVA 5GQBA 1NWRA 2F21A 4ITZA 4Z2JA 1Q6IA 1BL4A 1HXVA 4R5EA 4JFJA 1GUVA 4MNLA 1E6ZA 3CGNA 3IKDA 3O5OA 2ZR5A 4MAVA 4Z2KA 1XRVA 2DT3A 2DSWA 2ESCA 3JYJA 5HWCA 2PV1A 4NSBA 4HBOA 1W26A 1J4RA 1W1TA 1ZL1A 3CH9A 4MNMA 4ML4A 3B7XA 1NWUA 1OGBA 1LL6A 3O5KA 3O5EA 5DF0A 1H0GA 4ODMA 1LG2A 1F8AB 1Q1CA 1WNOA 3O5RA 2RUCA 2N87A 4DH0A 3UQIA 4NNRA 2MLXA 3TDBA 2PPOA 1BKFA 3QOKA 3WL0A 4IQCA 1ZBVA 5D75A 4WKFA 1D7HA 3NRKA 5JH8A 3WD2A 4C02B 3RFWA 3VAWA 3WH0A 3WKZA 5DIUA 1D6OA 1FKTA 4TW6A 1E6RA 2DT2A 4L72B 2WM0A 1Q6UA 3ARPA 3H9RB 4WK9A 3CHDA 1X6LA 3KADA 2XPAA 1QPFA 1UR9A 2UZ5A 2FKEA 5BXJA 3O5FA 4WIWA 1E6PA 5HW6A 2MLZA 4P8UA 3KACA 1TCOC 3ARRA 2YBUA 1FKRA 3PRAA 2QF8A 2FDMA 3GPKA 1W9VA 2IF4A 2XP6A 5DO2A 1HJXA 1JNSA 1FD9A 3CHEA 1ZBWA 3W4RA 4P8VA 3ARWA 3IHZA 3O5LA 2XPBA 3MDYB 1E15A 4W9QA 1F40A 4DIPA 2PPPA 1FKFA 1ZCNA 2OFNA 1NMVA 2DT1A 1LQ0A 4Q7NA 4WJXA 2MF9A 1FJDA 4DWSD 1GOIA 1WB0A 1NWTA 2M1IA 4W5UA 2DG4A 2PV3A 4ODNA 3O5GA 3O5MA 4QT3A 4LAYA 1FKSA 3FY1A 4P8XA 3EY6A 2LGOA 3NTPA 1VF8A 2RURA 3WL1A 4KR0B 1HJVA 5HWBA 2F2DA 1FKDA 2KI3A 5B8IC 4MSPA 3ARZA 4U85A 4GGQA 1FKHA 3UI4A 2MLYA 2MNTA 2M08A 1LG1A 1HKJA 2RUDA 4TNSA 3TC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OOB A;  4G50 A;  5J6E A;  2Q5A A;  4W9O A;  4DRI A;  2N87 A;  1KT1 A;  2L2S A;  4DRH A;  1M5Y A;  2ZQU A;  4DH0 A;  2LJ4 A;  4DRP A;  3CGM A;  3O5Q A;  1FKG A;  2ZR6 A;  1FKB A;  5HT1 A;  3FAP A;  3UQI A;  4NNR A;  5I98 A;  3O5J A;  5DIV A;  4DZ3 A;  2MLX A;  3TDB A;  2PPO A;  4MGV A;  2JZV A;  2KFW A;  1BKF A;  2PV2 A;  3O5P A;  3O5I A;  3KAF A;  4ODK A;  4IQC A;  1NMW A;  1A7X A;  4DRO A;  1FKJ A;  3UQA A;  5D75 A;  1KT0 A;  1D7H A;  3NRK A;  4C02 B;  3RFW A;  3VAW A;  4TX0 A;  3WH0 A;  5DIU A;  1N1A A;  2RSE A;  1D6O A;  2PPN A;  4IQ2 A;  2M2A A;  4JFL A;  1FKT A;  3PRD A;  1ROU A;  4J4N A;  1Y0O A;  3IK8 A;  4TW6 A;  3UI6 A;  2XP8 A;  3I6C A;  1J4H A;  1FKK A;  4ODP A;  3KAG A;  1Q6U A;  3H9R B;  2K8I A;  1EYM A;  2XP9 A;  4JFI A;  3ODK A;  2ZQS A;  3KAD A;  1D7I A;  1JNT A;  2XPA A;  2LKN A;  2Y78 A;  1QPF A;  4ODQ A;  3KCE A;  4DRQ A;  4LAW A;  1PBK A;  2UZ5 A;  1ROT A;  2FKE A;  5BXJ A;  4ODL A;  3O5F A;  4U86 A;  5HW6 A;  3TCZ A;  3O5D A;  2MLZ A;  3KAC A;  1TCO C;  2ZQV A;  3JYM A;  2LPV A;  3IKG A;  3RGC A;  4DT4 A;  4DRM A;  1YW5 A;  5GPG A;  4TW7 A;  4TW8 A;  4W9P A;  1FKR A;  1QPL A;  3GPK A;  3KAB A;  2IF4 A;  2XP6 A;  5HW7 A;  1EQ3 A;  4FAP A;  5HKG A;  4U84 A;  2XP4 A;  4TYO A;  1L1P A;  1JNS A;  1FD9 A;  3UI5 A;  1Q6H A;  2DG3 A;  2F4E A;  1PIN A;  3KAH A;  4ODR A;  2D9F A;  4N19 A;  1ZK6 A;  4ODO A;  3IHZ A;  1J4I A;  2XP7 A;  3O5L A;  1FKL A;  5HW8 A;  1C9H A;  2XPB A;  1FAP A;  3MDY B;  4GIV A;  3LUO A;  4W9Q A;  1QZ2 A;  2F21 A;  4ITZ A;  4DIP A;  2PPP A;  3PRB A;  1F40 A;  1FKF A;  1Q6I A;  3PA7 A;  2ITK A;  4R0X A;  1ZCN A;  2OFN A;  3KAI A;  5HTG A;  1BL4 A;  1NMV A;  1HXV A;  2MF9 A;  2RUQ A;  4FN2 A;  1FJD A;  4JFJ A;  4DZ2 A;  3CGN A;  3IKD A;  3O5O A;  4O2T A;  2M1I A;  2ZR5 A;  2DG4 A;  5HUA A;  2PV3 A;  4ODN A;  2ZR4 A;  1B6C A;  2FAP A;  3O5G A;  3O5M A;  4QT3 A;  4JYS A;  4LAY A;  2VN1 A;  2PBC A;  2KE0 A;  3JYJ A;  5HWC A;  2PV1 A;  3NI6 A;  1FKS A;  4DRJ A;  4DRK A;  2KGJ A;  4LAV A;  3UF8 A;  4QT2 A;  1W26 A;  3EY6 A;  2LGO A;  4DRN A;  3NTP A;  4IPX A;  1J4R A;  2ZQT A;  4LAX A;  1T11 A;  2RUR A;  3KZ7 A;  2DG9 A;  5HWB A;  2KO7 A;  1FKI A;  1FKD A;  2F2D A;  2KI3 A;  3B7X A;  4BF8 A;  5B8I C;  4QIB A;  1U79 A;  4MSP A;  1NSG A;  1J6Y A;  3O5K A;  4U85 A;  3O5E A;  2AWG A;  1JVW A;  1R9H A;  4GGQ A;  2MPH A;  4ODM A;  1FKH A;  4JFK A;  3UI4 A;  3UQB A;  2XP3 A;  2MLY A;  4J4O A;  2MNT A;  5DIT A;  2RQS A;  1F8A B;  1Q1C A;  2M08 A;  3O5R A;  1P5Q A;  2VCD A;  1D7J A;  2XP5 A;  4JFM A;  2RUC A;  3JXV A;  4G2P A;  2RUD A;  4TNS A;  2KR7 A;  3TC5 A;  1YAT A; 
#chains in the Genus database with same CATH topology
 3OOB A;  3WD3 A;  2Q5A A;  4ZPW R;  2G41 A;  3CGM A;  3O5Q A;  5HT1 A;  5I98 A;  4DZ3 A;  3BMB A;  2JZV A;  1W1Y A;  2KFW A;  4XAK A;  3KAF A;  3WIJ A;  1NMW A;  3RME A;  1FKJ A;  3PR9 A;  3ART A;  1KT0 A;  3FXY A;  1FKK A;  1W1V A;  2K8I A;  3ARV A;  4JFI A;  3ARQ A;  4Q22 A;  4UDM A;  2ZQS A;  1JNT A;  1IX5 A;  3WD1 A;  4MNK A;  3KCE A;  4LAW A;  1PBK A;  1LJY A;  4Z2G A;  3AS1 A;  2LPV A;  1EDQ A;  3IKG A;  3RGC A;  1TFV A;  4DRM A;  4HAR A;  3B9A A;  3AQU A;  4PTM A;  1EQ3 A;  5HKG A;  2DSZ A;  4TYO A;  1L1P A;  5DEZ A;  3UI5 A;  1JND A;  1PIN A;  1Q6H A;  2DG3 A;  3ALG A;  4N19 A;  1J4I A;  2XP7 A;  4WKH A;  5HW8 A;  4IT6 A;  3LUO A;  1QZ2 A;  3RM8 A;  4R0X A;  3KAI A;  4ZPT R;  5HTG A;  3BXW A;  4P8W A;  1ZBC A;  4MPK A;  2ZR4 A;  1B6C A;  2FAP A;  2VN1 A;  2A3A A;  4DRK A;  4DWS B;  1JCH B;  4DRJ A;  2KGJ A;  3UF8 A;  4QT2 A;  3OA5 A;  2O92 A;  4DRN A;  3CHC A;  4LAX A;  1SR0 A;  1T11 A;  3KZ7 A;  1GRJ A;  2DG9 A;  2KO7 A;  4BF8 A;  1D2K A;  3ARO A;  3B9E A;  4JFK A;  3UQB A;  2XP3 A;  5DIT A;  4ZPV R;  1H0I A;  1P5Q A;  1D7J A;  2XP5 A;  3AS0 A;  2KR7 A;  1YAT A;  4AY1 A;  4KQZ A;  4G50 A;  4DRI A;  3ARY A;  1KT1 A;  2L2S A;  1GPF A;  1M5Y A;  2ZQU A;  4DRP A;  1NWS A;  1FKG A;  2ZR6 A;  1FKB A;  5DIV A;  4ZS6 A;  3WD4 A;  2A3E A;  2A3C A;  3O5P A;  1FFR A;  3O5I A;  4NZC A;  1A7X A;  4DRO A;  4Z2L A;  5GPR A;  2DPE A;  2IUZ A;  2RSE A;  2PPN A;  3ARS A;  2M2A A;  2PI6 A;  3RM9 A;  2ETN A;  1Y0O A;  3IK8 A;  1HKM A;  1O6I A;  3I6C A;  3ALF A;  1EYM A;  2XP9 A;  4DWS A;  2B31 A;  1CTN A;  2LKN A;  1OWQ A;  3WQW A;  1FFQ A;  1W9P A;  3O5D A;  3TCZ A;  2ZQV A;  2WLZ A;  4URI A;  4HBE A;  5GPG A;  4W9P A;  1QPL A;  4U84 A;  2EUL A;  2WK2 A;  3B9D A;  2F4E A;  3G6M A;  3KAH A;  4ODR A;  1ZK6 A;  2WLY A;  1C9H A;  1FAP A;  2DSU A;  3PRB A;  3PA7 A;  2ITK A;  3G6L A;  2RUQ A;  2AOS A;  2DSV A;  2YBT A;  4FN2 A;  2A3B A;  1E44 A;  4DZ2 A;  1K9T A;  4O2T A;  5HUA A;  1SYT A;  1HKK A;  4JYS A;  2PBC A;  2KE0 A;  3NI6 A;  4MTV A;  4LAV A;  3CHF A;  4IPX A;  4Z2H A;  2ZQT A;  1UR8 A;  4L3N A;  4WKA A;  1FKI A;  4QIB A;  1W1P A;  5HBF A;  1NH6 A;  1U79 A;  3ARU A;  1NSG A;  1J6Y A;  1XHG A;  4MNJ A;  2AWG A;  1JVW A;  1R9H A;  2MPH A;  4J4O A;  1WAW A;  3B8S A;  2RQS A;  1ZB5 A;  2VCD A;  1E9L A;  1LL7 A;  4JFM A;  3JXV A;  4G2P A;  1E6N A;  1OGG A;  5J6E A;  4W9O A;  3GU0 A;  1LL4 A;  2OLH A;  2G8Z A;  4DRH A;  2LJ4 A;  3FAP A;  4S3K A;  4DWS C;  3O5J A;  4MGV A;  1EIB A;  2PV2 A;  4ODK A;  4S3J A;  3UQA A;  2B5U B;  4IT4 A;  4TX0 A;  1N1A A;  4JFL A;  4IQ2 A;  3PRD A;  1ROU A;  4J4N A;  4Z2I A;  1RD6 A;  3UI6 A;  2XP8 A;  2DT0 A;  1J4H A;  3WQV A;  1KFW A;  4ODP A;  3KAG A;  3RM4 A;  2O9O A;  3ARX A;  3ODK A;  4QZV B;  1D7I A;  1ZU8 A;  2Y78 A;  4ODQ A;  4DRQ A;  1ROT A;  1W9U A;  1HJW A;  4ODL A;  4U86 A;  1JNE A;  3JYM A;  3AS3 A;  4DT4 A;  1YW5 A;  4TW7 A;  4TW8 A;  1HKI A;  3AS2 A;  3KAB A;  5HW7 A;  1ITX A;  4FAP A;  2XP4 A;  3WD0 A;  1EHN A;  4LGX A;  2D9F A;  4ODO A;  3CZ8 A;  1FKL A;  1ZBK A;  1X6N A;  4GIV A;  5GQB A;  1NWR A;  2F21 A;  4ITZ A;  4Z2J A;  1Q6I A;  1BL4 A;  2PN0 A;  1HXV A;  4R5E A;  4JFJ A;  1GUV A;  4MNL A;  1E6Z A;  3CGN A;  3IKD A;  3O5O A;  2ZR5 A;  4MAV A;  4Z2K A;  1XRV A;  2DT3 A;  2DSW A;  2ESC A;  3JYJ A;  5HWC A;  2PV1 A;  4NSB A;  4HBO A;  1W26 A;  1J4R A;  1W1T A;  1ZL1 A;  3CH9 A;  4MNM A;  4ML4 A;  3B7X A;  1NWU A;  1OGB A;  1LL6 A;  3O5K A;  3O5E A;  5DF0 A;  1H0G A;  4ODM A;  1LG2 A;  1F8A B;  1Q1C A;  1WNO A;  3O5R A;  2RUC A;  2N87 A;  2P4V A;  4DH0 A;  3UQI A;  4NNR A;  2MLX A;  3TDB A;  2PPO A;  1BKF A;  3QOK A;  3WL0 A;  4IQC A;  1ZBV A;  5D75 A;  4WKF A;  1D7H A;  3NRK A;  5JH8 A;  3WD2 A;  4C02 B;  3RFW A;  3VAW A;  3WH0 A;  3WKZ A;  5DIU A;  1D6O A;  1FKT A;  4TW6 A;  1E6R A;  2DT2 A;  4L72 B;  2WM0 A;  1Q6U A;  3ARP A;  3H9R B;  4WK9 A;  3CHD A;  1X6L A;  3KAD A;  2XPA A;  1QPF A;  1UR9 A;  2UZ5 A;  2FKE A;  5BXJ A;  3O5F A;  4WIW A;  1E6P A;  5HW6 A;  2MLZ A;  4P8U A;  3KAC A;  1TCO C;  3ARR A;  2YBU A;  3EIP A;  1FKR A;  3PRA A;  2QF8 A;  2FDM A;  3GPK A;  1W9V A;  2IF4 A;  2XP6 A;  5DO2 A;  1HJX A;  1JNS A;  1FD9 A;  3CHE A;  1ZBW A;  3W4R A;  4P8V A;  3ARW A;  3IHZ A;  3GTY X;  3O5L A;  2XPB A;  3MDY B;  1E15 A;  4W9Q A;  1F40 A;  4DIP A;  2PPP A;  1FKF A;  1ZCN A;  2OFN A;  1NMV A;  2DT1 A;  1LQ0 A;  4Q7N A;  4WJX A;  2MF9 A;  1FJD A;  4DWS D;  1GOI A;  1WB0 A;  1NWT A;  2M1I A;  4W5U A;  2DG4 A;  2PV3 A;  4ODN A;  3O5G A;  3O5M A;  4QT3 A;  4LAY A;  1FKS A;  3FY1 A;  4P8X A;  3EY6 A;  2LGO A;  3NTP A;  1VF8 A;  2RUR A;  3WL1 A;  4KR0 B;  1HJV A;  5HWB A;  2F2D A;  1FKD A;  2KI3 A;  5B8I C;  4MSP A;  3ARZ A;  4U85 A;  4GGQ A;  1FKH A;  3UI4 A;  2MLY A;  2MNT A;  2M08 A;  1LG1 A;  1HKJ A;  2F23 A;  2RUD A;  4TNS A;  3TC5 A; 
#chains in the Genus database with same CATH homology
 3OOB A;  3WD3 A;  2Q5A A;  4ZPW R;  2G41 A;  3CGM A;  3O5Q A;  5HT1 A;  5I98 A;  4DZ3 A;  2JZV A;  1W1Y A;  2KFW A;  4XAK A;  3KAF A;  3WIJ A;  1NMW A;  3RME A;  1FKJ A;  3PR9 A;  3ART A;  1KT0 A;  3FXY A;  1FKK A;  1W1V A;  2K8I A;  3ARV A;  4JFI A;  3ARQ A;  4Q22 A;  2ZQS A;  1JNT A;  1IX5 A;  3WD1 A;  4MNK A;  3KCE A;  4LAW A;  1PBK A;  1LJY A;  4Z2G A;  3AS1 A;  2LPV A;  1EDQ A;  3IKG A;  3RGC A;  1TFV A;  4DRM A;  4HAR A;  3B9A A;  3AQU A;  4PTM A;  1EQ3 A;  5HKG A;  2DSZ A;  4TYO A;  1L1P A;  5DEZ A;  3UI5 A;  1JND A;  1PIN A;  1Q6H A;  2DG3 A;  3ALG A;  4N19 A;  1J4I A;  2XP7 A;  4WKH A;  5HW8 A;  4IT6 A;  3LUO A;  1QZ2 A;  3RM8 A;  4R0X A;  3KAI A;  4ZPT R;  5HTG A;  3BXW A;  4P8W A;  1ZBC A;  4MPK A;  2ZR4 A;  1B6C A;  2FAP A;  2VN1 A;  2A3A A;  4DRK A;  4DWS B;  4DRJ A;  2KGJ A;  3UF8 A;  4QT2 A;  3OA5 A;  2O92 A;  4DRN A;  3CHC A;  4LAX A;  1SR0 A;  1T11 A;  3KZ7 A;  2DG9 A;  2KO7 A;  4BF8 A;  1D2K A;  3ARO A;  3B9E A;  4JFK A;  3UQB A;  2XP3 A;  5DIT A;  4ZPV R;  1H0I A;  1P5Q A;  1D7J A;  2XP5 A;  3AS0 A;  2KR7 A;  1YAT A;  4AY1 A;  4KQZ A;  4G50 A;  4DRI A;  3ARY A;  1KT1 A;  2L2S A;  1GPF A;  1M5Y A;  2ZQU A;  4DRP A;  1NWS A;  1FKG A;  2ZR6 A;  1FKB A;  5DIV A;  4ZS6 A;  3WD4 A;  2A3E A;  2A3C A;  3O5P A;  1FFR A;  3O5I A;  4NZC A;  1A7X A;  4DRO A;  4Z2L A;  5GPR A;  2DPE A;  2IUZ A;  2RSE A;  2PPN A;  3ARS A;  2M2A A;  2PI6 A;  3RM9 A;  1Y0O A;  3IK8 A;  1HKM A;  1O6I A;  3I6C A;  3ALF A;  1EYM A;  2XP9 A;  4DWS A;  2B31 A;  1CTN A;  2LKN A;  1OWQ A;  3WQW A;  1FFQ A;  1W9P A;  3O5D A;  3TCZ A;  2ZQV A;  2WLZ A;  4URI A;  4HBE A;  5GPG A;  4W9P A;  1QPL A;  4U84 A;  2WK2 A;  3B9D A;  2F4E A;  3G6M A;  3KAH A;  4ODR A;  1ZK6 A;  2WLY A;  1C9H A;  1FAP A;  2DSU A;  3PRB A;  3PA7 A;  2ITK A;  3G6L A;  2RUQ A;  2AOS A;  2DSV A;  2YBT A;  4FN2 A;  2A3B A;  4DZ2 A;  1K9T A;  4O2T A;  5HUA A;  1SYT A;  1HKK A;  4JYS A;  2PBC A;  2KE0 A;  3NI6 A;  4MTV A;  4LAV A;  3CHF A;  4IPX A;  4Z2H A;  2ZQT A;  1UR8 A;  4L3N A;  4WKA A;  1FKI A;  4QIB A;  1W1P A;  5HBF A;  1NH6 A;  1U79 A;  3ARU A;  1NSG A;  1J6Y A;  1XHG A;  4MNJ A;  2AWG A;  1JVW A;  1R9H A;  2MPH A;  4J4O A;  1WAW A;  3B8S A;  2RQS A;  1ZB5 A;  2VCD A;  1E9L A;  1LL7 A;  4JFM A;  3JXV A;  4G2P A;  1E6N A;  1OGG A;  5J6E A;  4W9O A;  1LL4 A;  2OLH A;  2G8Z A;  4DRH A;  2LJ4 A;  3FAP A;  4S3K A;  4DWS C;  3O5J A;  4MGV A;  1EIB A;  2PV2 A;  4ODK A;  4S3J A;  3UQA A;  4IT4 A;  4TX0 A;  1N1A A;  4JFL A;  4IQ2 A;  3PRD A;  1ROU A;  4J4N A;  4Z2I A;  1RD6 A;  3UI6 A;  2XP8 A;  2DT0 A;  1J4H A;  3WQV A;  1KFW A;  4ODP A;  3KAG A;  3RM4 A;  2O9O A;  3ARX A;  3ODK A;  4QZV B;  1D7I A;  1ZU8 A;  2Y78 A;  4ODQ A;  4DRQ A;  1ROT A;  1W9U A;  1HJW A;  4ODL A;  4U86 A;  1JNE A;  3JYM A;  3AS3 A;  4DT4 A;  1YW5 A;  4TW7 A;  4TW8 A;  1HKI A;  3AS2 A;  3KAB A;  5HW7 A;  1ITX A;  4FAP A;  2XP4 A;  3WD0 A;  1EHN A;  4LGX A;  2D9F A;  4ODO A;  3CZ8 A;  1FKL A;  1ZBK A;  1X6N A;  4GIV A;  5GQB A;  1NWR A;  2F21 A;  4ITZ A;  4Z2J A;  1Q6I A;  1BL4 A;  1HXV A;  4R5E A;  4JFJ A;  1GUV A;  4MNL A;  1E6Z A;  3CGN A;  3IKD A;  3O5O A;  2ZR5 A;  4MAV A;  4Z2K A;  1XRV A;  2DT3 A;  2DSW A;  2ESC A;  3JYJ A;  5HWC A;  2PV1 A;  4NSB A;  4HBO A;  1W26 A;  1J4R A;  1W1T A;  1ZL1 A;  3CH9 A;  4MNM A;  4ML4 A;  3B7X A;  1NWU A;  1OGB A;  1LL6 A;  3O5K A;  3O5E A;  5DF0 A;  1H0G A;  4ODM A;  1LG2 A;  1F8A B;  1Q1C A;  1WNO A;  3O5R A;  2RUC A;  2N87 A;  4DH0 A;  3UQI A;  4NNR A;  2MLX A;  3TDB A;  2PPO A;  1BKF A;  3QOK A;  3WL0 A;  4IQC A;  1ZBV A;  5D75 A;  4WKF A;  1D7H A;  3NRK A;  5JH8 A;  3WD2 A;  4C02 B;  3RFW A;  3VAW A;  3WH0 A;  3WKZ A;  5DIU A;  1D6O A;  1FKT A;  4TW6 A;  1E6R A;  2DT2 A;  4L72 B;  2WM0 A;  1Q6U A;  3ARP A;  3H9R B;  4WK9 A;  3CHD A;  1X6L A;  3KAD A;  2XPA A;  1QPF A;  1UR9 A;  2UZ5 A;  2FKE A;  5BXJ A;  3O5F A;  4WIW A;  1E6P A;  5HW6 A;  2MLZ A;  4P8U A;  3KAC A;  1TCO C;  3ARR A;  2YBU A;  1FKR A;  3PRA A;  2QF8 A;  2FDM A;  3GPK A;  1W9V A;  2IF4 A;  2XP6 A;  5DO2 A;  1HJX A;  1JNS A;  1FD9 A;  3CHE A;  1ZBW A;  3W4R A;  4P8V A;  3ARW A;  3IHZ A;  3O5L A;  2XPB A;  3MDY B;  1E15 A;  4W9Q A;  1F40 A;  4DIP A;  2PPP A;  1FKF A;  1ZCN A;  2OFN A;  1NMV A;  2DT1 A;  1LQ0 A;  4Q7N A;  4WJX A;  2MF9 A;  1FJD A;  4DWS D;  1GOI A;  1WB0 A;  1NWT A;  2M1I A;  4W5U A;  2DG4 A;  2PV3 A;  4ODN A;  3O5G A;  3O5M A;  4QT3 A;  4LAY A;  1FKS A;  3FY1 A;  4P8X A;  3EY6 A;  2LGO A;  3NTP A;  1VF8 A;  2RUR A;  3WL1 A;  4KR0 B;  1HJV A;  5HWB A;  2F2D A;  1FKD A;  2KI3 A;  5B8I C;  4MSP A;  3ARZ A;  4U85 A;  4GGQ A;  1FKH A;  3UI4 A;  2MLY A;  2MNT A;  2M08 A;  1LG1 A;  1HKJ A;  2RUD A;  4TNS A;  3TC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...