4C02B

Crystal structure of human acvr1 (alk2) in complex with fkbp12.6 and dorsomorphin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACTIVIN RECEPTOR TYPE-1
publication title Crystal Structure of Human Acvr1 (Alk2) in Complex with Fkbp12.6 And Dorsomorphin
rcsb
source organism Homo sapiens
molecule tags Transferase/isomerase
total genus 24
structure length 108
sequence length 108
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4c02B00
4TX0A 3I6CA 3UQIA 4QT2A 2MLYA 3O5MA 4BF8A 2MF9A 3PRBA 2RSEA 2Q5AA 5HWCA 5HW8A 3O5PA 4JFMA 1FKIA 3O5DA 3UI5A 4MGVA 1Q1CA 2XPBA 2ZQSA 3IKGA 4GIVA 3CGMA 2RUQA 1FKLA 4U86A 3O5KA 1BL4A 5GPGA 3O5LA 1C9HA 1ROTA 3IKDA 4LAVA 1ZK6A 1FKKA 2MLZA 4DZ3A 4DIPA 1R9HA 1EQ3A 2DG4A 4ODMA 4R0XA 4JYSA 5B8IC 5DIVA 3JYMA 4DRKA 2PV2A 4O2TA 2FAPA 4LAXA 1FKSA 4W9QA 4ODKA 1KT1A 2MLXA 1D7HA 1NSGA 1F8AB 2XPAA 2DG9A 2PBCA 3KADA 4IQ2A 3TDBA 2LPVA 1P5QA 2KGJA 1FD9A 2D9FA 3KAFA 4TNSA 2RUDA 2ZQUA 2VCDA 2ZR6A 4U85A 1QPLA 4ODNA 4FN2A 1M5YA 1Q6UA 2M08A 1FAPA 1Y0OA 1PINA 4TW8A 3O5RA 3UF8A 2PPOA 5BXJA 1J4HA 4JFIA 4ODQA 2XP6A 4TW6A 1FKRA 2FKEA 1PBKA 3O5QA 3EY6A 4IPXA 1ZCNA 4DZ2A 1JNSA 2LKNA 2RURA 2PPPA 2OFNA 2ZQTA 4DRHA 4DRNA 3B7XA 5D75A 5HT1A 1ROUA 1J4IA 3KCEA 1FKJA 3VAWA 2N87A 4ITZA 1Q6HA 2VN1A 3O5JA 1F40A 3IK8A 1JNTA 3JXVA 4IQCA 4U84A 4N19A 1EYMA 3TCZA 2UZ5A 4LAYA 3KZ7A 1J4RA 2ITKA 2KE0A 2MPHA 1D7JA 2AWGA 2KO7A 2ZR5A 3FAPA 2RQSA 4QIBA 1J6YA 1HXVA 1QPFA 4TYOA 2ZR4A 1NMVA 4J4OA 4DT4A 2ZQVA 1FJDA 1FKDA 1NMWA 4ODOA 3JYJA 3LUOA 3UI4A 4QT3A 1FKGA 2MNTA 4DRQA 1A7XA 5HUAA 2IF4A 2KR7A 4FAPA 1FKFA 2DG3A 3TC5A 4DRJA 3O5EA 1FKBA 1D6OA 3WH0A 2XP8A 5HTGA 4NNRA 2K8IA 4ODPA 3UQAA 4W9PA 3PA7A 3KACA 3O5GA 4ODRA 2PV1A 4DRMA 1YW5A 1Q6IA 1KT0A 1YATA 4G2PA 3O5FA 3UI6A 2LGOA 2M2AA 2XP9A 1U79A 2XP7A 4G50A 4ODLA 2LJ4A 3UQBA 2F21A 4DH0A 4C02B 3GPKA 1TCOC 5HW6A 3OOBA 2F2DA 2L2SA 3KABA 1JVWA 3KAGA 3O5OA 1W26A 1D7IA 3PRDA 1FKTA 4DROA 2PV3A 3KAHA 2M1IA 5I98A 5J6EA 2XP4A 2XP5A 4W9OA 2KFWA 4J4NA 3H9RB 3KAIA 3NTPA 4GGQA 5DITA 5HWBA 5HKGA 3RFWA 4MSPA 2Y78A 2RUCA 1BKFA 2JZVA 3IHZA 4JFLA 3RGCA 3O5IA 5HW7A 2KI3A 4TW7A 5DIUA 1L1PA 2XP3A 1B6CA 1T11A 4DRPA 1FKHA 2F4EA 3CGNA 3NI6A 4JFKA 1N1AA 3NRKA 1QZ2A 4LAWA 3ODKA 4DRIA 2PPNA 3MDYB 4JFJA
chains in the Genus database with same CATH superfamily
2MLYA 2P4VA 4BF8A 3PRBA 1W9VA 2ZQSA 3AS1A 3CGMA 5GPGA 1ROTA 4LAVA 3CHCA 4NZCA 2ESCA 4Q7NA 3ARZA 4IQ2A 1NSGA 3PRAA 4UDMA 2YBTA 2LPVA 1HJXA 4MTVA 1EDQA 2ZQUA 2ZR6A 2F23A 3RM8A 2DT2A 4WK9A 4WKFA 5DO2A 2XP6A 1PBKA 3O5QA 3AS2A 5GQBA 1FFRA 2LKNA 2OFNA 4Z2GA 2ZQTA 4DRHA 1K9TA 4IT6A 1O6IA 4MNJA 3VAWA 2DSVA 3JXVA 4IQCA 1LL7A 3KZ7A 1J6YA 1XHGA 1WNOA 4WIWA 4Z2IA 3AS0A 1FKDA 3LUOA 2KR7A 1TFVA 4FAPA 2DSWA 1FKBA 3UQAA 4W9PA 3KACA 4P8WA 2PV1A 3W4RA 1E9LA 1YW5A 1KT0A 4G2PA 3UI6A 2LGOA 2XP9A 1U79A 2OLHA 4HBOA 2EULA 2A3CA 3KABA 1JVWA 1FKTA 4L72B 2WLZA 2A3BA 4DWSD 1CTNA 3CZ8A 3NTPA 5HWBA 2Y78A 1BKFA 4Z2JA 1HJVA 2XP3A 1H0IA 1QZ2A 4KQZA 4DRIA 2B31A 4JFJA 2G8ZA 3ALGA 3UQIA 4QT2A 3WD0A 2MF9A 5HWCA 4P8VA 5HW8A 4DWSA 4GIVA 1FKLA 4U86A 1BL4A 1ZK6A 1FKKA 3ALFA 2MLZA 4DZ3A 4WJXA 4R0XA 4JYSA 1ZL1A 5B8IC 5DIVA 3JYMA 4DRKA 4O2TA 4W9QA 1ZBKA 1FKSA 1GUVA 3RM9A 3KADA 2PBCA 1FD9A 4TNSA 1HKIA 3ARYA 1QPLA 4ODNA 4HBEA 2M08A 1FAPA 4ML4A 1Y0OA 1HJWA 2ETNA 3UF8A 5BXJA 4JFIA 4ODQA 4QZVB 1JNEA 2DT0A 1H0GA 3RM4A 5D75A 1KFWA 4Z2KA 5HT1A 3BMBA 4Z2LA 3KCEA 1FKJA 2DPEA 4ITZA 2VN1A 3WQVA 4U84A 1EYMA 4LAYA 2AWGA 3WD4A 3FAPA 1E6RA 2ZR4A 4J4OA 3JYJA 4QT3A 4URIA 2A3AA 2AOSA 2DG3A 1X6NA 3TC5A 3O5EA 1D6OA 4NNRA 2K8IA 2DSZA 3PA7A 3EIPA 3O5GA 1EIBA 4ODRA 1E44A 3ARSA 3ARXA 2YBUA 1EHNA 4ZS6A 4MAVA 4MNKA 2FDMA 2LJ4A 3ARWA 3GPKA 1TCOC 4WKAA 3WQWA 1WB0A 1D7IA 4ZPVR 3KAHA 1ZBVA 5J6EA 1NWRA 2KFWA 3WD3A 4S3KA 4GGQA 5DITA 1W9UA 5HKGA 3RFWA 4JFLA 3RGCA 3G6MA 1L1PA 3OA5A 3WD1A 1JCHB 1NWUA 2F4EA 1N1AA 3NRKA 4W5UA 1W1TA 4TX0A 3I6CA 4P8XA 3O5MA 2RSEA 1ZB5A 2Q5AA 3O5PA 1FKIA 3UI5A 4KR0B 4MGVA 2XPBA 4R5EA 1OWQA 2RUQA 5HBFA 3AROA 3O5LA 1E6ZA 1E6NA 4DIPA 1R9HA 4P8UA 5DEZA 1LG1A 2A3EA 2FAPA 1UR8A 3BXWA 2PN0A 3PR9A 2KGJA 2D9FA 1ZBCA 4XAKA 2VCDA 4PTMA 4ZPTR 4U85A 3CHDA 4FN2A 1M5YA 1Q6UA 1JNDA 2PI6A 1LL6A 3AQUA 3B9DA 4TW8A 2PPOA 1FKRA 1J4HA 3ARRA 2FKEA 1W1YA 4Z2HA 4DZ2A 4DRNA 3B7XA 1UR9A 4DWSC 1ITXA 1ROUA 3WIJA 2N87A 3ARUA 1F40A 3IK8A 1JNTA 1NWTA 4N19A 3TCZA 4WKHA 3WD2A 1J4RA 2ITKA 3ARPA 3G6LA 2KO7A 1GPFA 4QIBA 2RQSA 1NMVA 4DT4A 1FJDA 1NMWA 4ODOA 1FKGA 4DRQA 5HUAA 4DWSB 2XP8A 4ODPA 2DT1A 3ARVA 1D2KA 1HKMA 1VF8A 1Q6IA 1LL4A 2XP7A 2IUZA 3CHFA 2DSUA 4ODLA 1HKKA 3UQBA 4DH0A 4C02B 3WL0A 5HW6A 3OOBA 3KAGA 1W26A 4MPKA 2XP5A 4W9OA 4MNLA 3B8SA 3H9RB 3KAIA 4MSPA 5HW7A 3O5IA 2KI3A 5DIUA 1LG2A 1B6CA 1HKJA 1FKHA 4JFKA 4LGXA 4LAWA 3FXYA 2PPNA 5JH8A 3MDYB 2WLYA 3CHEA 4JFMA 3O5DA 1Q1CA 3IKGA 2O9OA 3O5KA 1WAWA 3B9EA 3GTYX 1C9HA 3IKDA 1NWSA 1EQ3A 2DG4A 4ODMA 1SR0A 1LQ0A 2PV2A 2G41A 4LAXA 4ODKA 1KT1A 2MLXA 2O92A 1D7HA 1F8AB 2XPAA 2QF8A 2DG9A 4HARA 3TDBA 1P5QA 3ARTA 3KAFA 2RUDA 1E15A 1PINA 3O5RA 1XRVA 1X6LA 3CH9A 2WM0A 4NSBA 4TW6A 4AY1A 3EY6A 4IPXA 1ZCNA 1JNSA 3GU0A 3ARQA 2B5UB 2PPPA 2RURA 4L3NA 1ZBWA 3WL1A 1J4IA 1Q6HA 2WK2A 3O5JA 2DT3A 1LJYA 1FFQA 2UZ5A 3AS3A 1OGBA 2KE0A 2MPHA 1D7JA 2ZR5A 4ZPWR 1HXVA 1QPFA 1ZU8A 4TYOA 2ZQVA 3WKZA 3UI4A 2MNTA 1A7XA 2IF4A 1FKFA 4DRJA 3WH0A 5HTGA 5GPRA 4Q22A 3B9AA 4MNMA 4DRMA 1YATA 3O5FA 4IT4A 2M2AA 4G50A 1GRJA 5DF0A 1GOIA 3FY1A 2F21A 2F2DA 2L2SA 3PRDA 3O5OA 4DROA 2PV3A 3RMEA 2M1IA 3QOKA 5I98A 2XP4A 1OGGA 1NH6A 4J4NA 1RD6A 1W9PA 2RUCA 2JZVA 3IHZA 4S3JA 4TW7A 1T11A 4DRPA 3CGNA 3NI6A 1IX5A 1E6PA 1SYTA 1W1VA 3ODKA 1W1PA
chains in the Genus database with same CATH topology
2MLYA 4BF8A 3PRBA 1W9VA 2ZQSA 3AS1A 3CGMA 5GPGA 1ROTA 4LAVA 3CHCA 4NZCA 2ESCA 4Q7NA 3ARZA 4IQ2A 1NSGA 3PRAA 2YBTA 2LPVA 1HJXA 4MTVA 1EDQA 2ZQUA 2ZR6A 3RM8A 2DT2A 4WK9A 4WKFA 5DO2A 2XP6A 1PBKA 3O5QA 3AS2A 5GQBA 1FFRA 2LKNA 2OFNA 4Z2GA 2ZQTA 4DRHA 1K9TA 4IT6A 1O6IA 4MNJA 3VAWA 2DSVA 3JXVA 4IQCA 1LL7A 3KZ7A 1J6YA 1XHGA 1WNOA 4WIWA 4Z2IA 3AS0A 1FKDA 3LUOA 2KR7A 1TFVA 4FAPA 2DSWA 1FKBA 3UQAA 4W9PA 3KACA 4P8WA 2PV1A 3W4RA 1E9LA 1YW5A 1KT0A 4G2PA 3UI6A 2LGOA 2XP9A 1U79A 2OLHA 4HBOA 2A3CA 3KABA 1JVWA 1FKTA 4L72B 2WLZA 2A3BA 4DWSD 1CTNA 3CZ8A 3NTPA 5HWBA 2Y78A 1BKFA 4Z2JA 1HJVA 2XP3A 1H0IA 1QZ2A 4KQZA 4DRIA 2B31A 4JFJA 2G8ZA 3ALGA 3UQIA 4QT2A 3WD0A 2MF9A 5HWCA 4P8VA 5HW8A 4DWSA 4GIVA 1FKLA 4U86A 1BL4A 1ZK6A 1FKKA 3ALFA 2MLZA 4DZ3A 4WJXA 4R0XA 4JYSA 1ZL1A 5B8IC 5DIVA 3JYMA 4DRKA 4O2TA 4W9QA 1ZBKA 1FKSA 1GUVA 3RM9A 3KADA 2PBCA 1FD9A 4TNSA 1HKIA 3ARYA 1QPLA 4ODNA 4HBEA 2M08A 1FAPA 4ML4A 1Y0OA 1HJWA 3UF8A 5BXJA 4JFIA 4ODQA 4QZVB 1JNEA 2DT0A 1H0GA 3RM4A 5D75A 1KFWA 4Z2KA 5HT1A 4Z2LA 3KCEA 1FKJA 2DPEA 4ITZA 2VN1A 3WQVA 4U84A 1EYMA 4LAYA 2AWGA 3WD4A 3FAPA 1E6RA 2ZR4A 4J4OA 3JYJA 4QT3A 4URIA 2A3AA 2AOSA 2DG3A 1X6NA 3TC5A 3O5EA 1D6OA 4NNRA 2K8IA 2DSZA 3PA7A 3O5GA 1EIBA 4ODRA 3ARSA 3ARXA 2YBUA 1EHNA 4ZS6A 4MAVA 4MNKA 2FDMA 2LJ4A 3ARWA 3GPKA 1TCOC 4WKAA 3WQWA 1WB0A 1D7IA 4ZPVR 3KAHA 1ZBVA 5J6EA 1NWRA 2KFWA 3WD3A 4S3KA 4GGQA 5DITA 1W9UA 5HKGA 3RFWA 4JFLA 3RGCA 3G6MA 1L1PA 3OA5A 3WD1A 1NWUA 2F4EA 1N1AA 3NRKA 4W5UA 1W1TA 4TX0A 3I6CA 4P8XA 3O5MA 2RSEA 1ZB5A 2Q5AA 3O5PA 1FKIA 3UI5A 4KR0B 4MGVA 2XPBA 4R5EA 1OWQA 2RUQA 5HBFA 3AROA 3O5LA 1E6ZA 1E6NA 4DIPA 1R9HA 4P8UA 5DEZA 1LG1A 2A3EA 2FAPA 1UR8A 3BXWA 3PR9A 2KGJA 2D9FA 1ZBCA 4XAKA 2VCDA 4PTMA 4ZPTR 4U85A 3CHDA 4FN2A 1M5YA 1Q6UA 1JNDA 2PI6A 1LL6A 3AQUA 3B9DA 4TW8A 2PPOA 1FKRA 1J4HA 3ARRA 2FKEA 1W1YA 4Z2HA 4DZ2A 4DRNA 3B7XA 1UR9A 4DWSC 1ITXA 1ROUA 3WIJA 2N87A 3ARUA 1F40A 3IK8A 1JNTA 1NWTA 4N19A 3TCZA 4WKHA 3WD2A 1J4RA 2ITKA 3ARPA 3G6LA 2KO7A 1GPFA 4QIBA 2RQSA 1NMVA 4DT4A 1FJDA 1NMWA 4ODOA 1FKGA 4DRQA 5HUAA 4DWSB 2XP8A 4ODPA 2DT1A 3ARVA 1D2KA 1HKMA 1VF8A 1Q6IA 1LL4A 2XP7A 2IUZA 3CHFA 2DSUA 4ODLA 1HKKA 3UQBA 4DH0A 4C02B 3WL0A 5HW6A 3OOBA 3KAGA 1W26A 4MPKA 2XP5A 4W9OA 4MNLA 3B8SA 3H9RB 3KAIA 4MSPA 5HW7A 3O5IA 2KI3A 5DIUA 1LG2A 1B6CA 1HKJA 1FKHA 4JFKA 4LGXA 4LAWA 3FXYA 2PPNA 5JH8A 3MDYB 2WLYA 3CHEA 4JFMA 3O5DA 1Q1CA 3IKGA 2O9OA 3O5KA 1WAWA 3B9EA 1C9HA 3IKDA 1NWSA 1EQ3A 2DG4A 4ODMA 1SR0A 1LQ0A 2PV2A 2G41A 4LAXA 4ODKA 1KT1A 2MLXA 2O92A 1D7HA 1F8AB 2XPAA 2QF8A 2DG9A 4HARA 3TDBA 1P5QA 3ARTA 3KAFA 2RUDA 1E15A 1PINA 3O5RA 1XRVA 1X6LA 3CH9A 2WM0A 4NSBA 4TW6A 4AY1A 3EY6A 4IPXA 1ZCNA 1JNSA 3ARQA 2RURA 2PPPA 4L3NA 1ZBWA 3WL1A 1J4IA 1Q6HA 2WK2A 3O5JA 2DT3A 1LJYA 1FFQA 2UZ5A 3AS3A 1OGBA 2KE0A 2MPHA 1D7JA 2ZR5A 4ZPWR 1HXVA 1QPFA 1ZU8A 4TYOA 2ZQVA 3WKZA 3UI4A 2MNTA 1A7XA 2IF4A 1FKFA 4DRJA 3WH0A 5HTGA 5GPRA 4Q22A 3B9AA 4MNMA 4DRMA 1YATA 3O5FA 4IT4A 2M2AA 4G50A 5DF0A 1GOIA 3FY1A 2F21A 2F2DA 2L2SA 3PRDA 3O5OA 4DROA 2PV3A 3RMEA 2M1IA 3QOKA 5I98A 2XP4A 1OGGA 1NH6A 4J4NA 1RD6A 1W9PA 2RUCA 2JZVA 3IHZA 4S3JA 4TW7A 1T11A 4DRPA 3CGNA 3NI6A 1IX5A 1E6PA 1SYTA 1W1VA 3ODKA 1W1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TX0 A;  3I6C A;  3UQI A;  4QT2 A;  2MLY A;  3O5M A;  4BF8 A;  2MF9 A;  3PRB A;  2RSE A;  2Q5A A;  5HWC A;  5HW8 A;  3O5P A;  4JFM A;  1FKI A;  3O5D A;  3UI5 A;  4MGV A;  1Q1C A;  2XPB A;  2ZQS A;  3IKG A;  4GIV A;  3CGM A;  2RUQ A;  1FKL A;  4U86 A;  3O5K A;  1BL4 A;  5GPG A;  3O5L A;  1C9H A;  1ROT A;  3IKD A;  4LAV A;  1ZK6 A;  1FKK A;  2MLZ A;  4DZ3 A;  4DIP A;  1R9H A;  1EQ3 A;  2DG4 A;  4ODM A;  4R0X A;  4JYS A;  5B8I C;  5DIV A;  3JYM A;  4DRK A;  2PV2 A;  4O2T A;  2FAP A;  4LAX A;  1FKS A;  4W9Q A;  4ODK A;  1KT1 A;  2MLX A;  1D7H A;  1NSG A;  1F8A B;  2XPA A;  2DG9 A;  2PBC A;  3KAD A;  4IQ2 A;  3TDB A;  2LPV A;  1P5Q A;  2KGJ A;  1FD9 A;  2D9F A;  3KAF A;  4TNS A;  2RUD A;  2ZQU A;  2VCD A;  2ZR6 A;  4U85 A;  1QPL A;  4ODN A;  4FN2 A;  1M5Y A;  1Q6U A;  2M08 A;  1FAP A;  1Y0O A;  1PIN A;  4TW8 A;  3O5R A;  3UF8 A;  2PPO A;  5BXJ A;  1J4H A;  4JFI A;  4ODQ A;  2XP6 A;  4TW6 A;  1FKR A;  2FKE A;  1PBK A;  3O5Q A;  3EY6 A;  4IPX A;  1ZCN A;  4DZ2 A;  1JNS A;  2LKN A;  2RUR A;  2PPP A;  2OFN A;  2ZQT A;  4DRH A;  4DRN A;  3B7X A;  5D75 A;  5HT1 A;  1ROU A;  1J4I A;  3KCE A;  1FKJ A;  3VAW A;  2N87 A;  4ITZ A;  1Q6H A;  2VN1 A;  3O5J A;  1F40 A;  3IK8 A;  1JNT A;  3JXV A;  4IQC A;  4U84 A;  4N19 A;  1EYM A;  3TCZ A;  2UZ5 A;  4LAY A;  3KZ7 A;  1J4R A;  2ITK A;  2KE0 A;  2MPH A;  1D7J A;  2AWG A;  2KO7 A;  2ZR5 A;  3FAP A;  2RQS A;  4QIB A;  1J6Y A;  1HXV A;  1QPF A;  4TYO A;  2ZR4 A;  1NMV A;  4J4O A;  4DT4 A;  2ZQV A;  1FJD A;  1FKD A;  1NMW A;  4ODO A;  3JYJ A;  3LUO A;  3UI4 A;  4QT3 A;  1FKG A;  2MNT A;  4DRQ A;  1A7X A;  5HUA A;  2IF4 A;  2KR7 A;  4FAP A;  1FKF A;  2DG3 A;  3TC5 A;  4DRJ A;  3O5E A;  1FKB A;  1D6O A;  3WH0 A;  2XP8 A;  5HTG A;  4NNR A;  2K8I A;  4ODP A;  3UQA A;  4W9P A;  3PA7 A;  3KAC A;  3O5G A;  4ODR A;  2PV1 A;  4DRM A;  1YW5 A;  1Q6I A;  1KT0 A;  1YAT A;  4G2P A;  3O5F A;  3UI6 A;  2LGO A;  2M2A A;  2XP9 A;  1U79 A;  2XP7 A;  4G50 A;  4ODL A;  2LJ4 A;  3UQB A;  2F21 A;  4DH0 A;  4C02 B;  3GPK A;  1TCO C;  5HW6 A;  3OOB A;  2F2D A;  2L2S A;  3KAB A;  1JVW A;  3KAG A;  3O5O A;  1W26 A;  1D7I A;  3PRD A;  1FKT A;  4DRO A;  2PV3 A;  3KAH A;  2M1I A;  5I98 A;  5J6E A;  2XP4 A;  2XP5 A;  4W9O A;  2KFW A;  4J4N A;  3H9R B;  3KAI A;  3NTP A;  4GGQ A;  5DIT A;  5HWB A;  5HKG A;  3RFW A;  4MSP A;  2Y78 A;  2RUC A;  1BKF A;  2JZV A;  3IHZ A;  4JFL A;  3RGC A;  3O5I A;  5HW7 A;  2KI3 A;  4TW7 A;  5DIU A;  1L1P A;  2XP3 A;  1B6C A;  1T11 A;  4DRP A;  1FKH A;  2F4E A;  3CGN A;  3NI6 A;  4JFK A;  1N1A A;  3NRK A;  1QZ2 A;  4LAW A;  3ODK A;  4DRI A;  2PPN A;  3MDY B;  4JFJ A; 
#chains in the Genus database with same CATH topology
 2MLY A;  2P4V A;  4BF8 A;  3PRB A;  1W9V A;  2ZQS A;  3AS1 A;  3CGM A;  5GPG A;  1ROT A;  4LAV A;  3CHC A;  4NZC A;  2ESC A;  4Q7N A;  3ARZ A;  4IQ2 A;  1NSG A;  3PRA A;  4UDM A;  2YBT A;  2LPV A;  1HJX A;  4MTV A;  1EDQ A;  2ZQU A;  2ZR6 A;  2F23 A;  3RM8 A;  2DT2 A;  4WK9 A;  4WKF A;  5DO2 A;  2XP6 A;  1PBK A;  3O5Q A;  3AS2 A;  5GQB A;  1FFR A;  2LKN A;  2OFN A;  4Z2G A;  2ZQT A;  4DRH A;  1K9T A;  4IT6 A;  1O6I A;  4MNJ A;  3VAW A;  2DSV A;  3JXV A;  4IQC A;  1LL7 A;  3KZ7 A;  1J6Y A;  1XHG A;  1WNO A;  4WIW A;  4Z2I A;  3AS0 A;  1FKD A;  3LUO A;  2KR7 A;  1TFV A;  4FAP A;  2DSW A;  1FKB A;  3UQA A;  4W9P A;  3KAC A;  4P8W A;  2PV1 A;  3W4R A;  1E9L A;  1YW5 A;  1KT0 A;  4G2P A;  3UI6 A;  2LGO A;  2XP9 A;  1U79 A;  2OLH A;  4HBO A;  2EUL A;  2A3C A;  3KAB A;  1JVW A;  1FKT A;  4L72 B;  2WLZ A;  2A3B A;  4DWS D;  1CTN A;  3CZ8 A;  3NTP A;  5HWB A;  2Y78 A;  1BKF A;  4Z2J A;  1HJV A;  2XP3 A;  1H0I A;  1QZ2 A;  4KQZ A;  4DRI A;  2B31 A;  4JFJ A;  2G8Z A;  3ALG A;  3UQI A;  4QT2 A;  3WD0 A;  2MF9 A;  5HWC A;  4P8V A;  5HW8 A;  4DWS A;  4GIV A;  1FKL A;  4U86 A;  1BL4 A;  1ZK6 A;  1FKK A;  3ALF A;  2MLZ A;  4DZ3 A;  4WJX A;  4R0X A;  4JYS A;  1ZL1 A;  5B8I C;  5DIV A;  3JYM A;  4DRK A;  4O2T A;  4W9Q A;  1ZBK A;  1FKS A;  1GUV A;  3RM9 A;  3KAD A;  2PBC A;  1FD9 A;  4TNS A;  1HKI A;  3ARY A;  1QPL A;  4ODN A;  4HBE A;  2M08 A;  1FAP A;  4ML4 A;  1Y0O A;  1HJW A;  2ETN A;  3UF8 A;  5BXJ A;  4JFI A;  4ODQ A;  4QZV B;  1JNE A;  2DT0 A;  1H0G A;  3RM4 A;  5D75 A;  1KFW A;  4Z2K A;  5HT1 A;  3BMB A;  4Z2L A;  3KCE A;  1FKJ A;  2DPE A;  4ITZ A;  2VN1 A;  3WQV A;  4U84 A;  1EYM A;  4LAY A;  2AWG A;  3WD4 A;  3FAP A;  1E6R A;  2ZR4 A;  4J4O A;  3JYJ A;  4QT3 A;  4URI A;  2A3A A;  2AOS A;  2DG3 A;  1X6N A;  3TC5 A;  3O5E A;  1D6O A;  4NNR A;  2K8I A;  2DSZ A;  3PA7 A;  3EIP A;  3O5G A;  1EIB A;  4ODR A;  1E44 A;  3ARS A;  3ARX A;  2YBU A;  1EHN A;  4ZS6 A;  4MAV A;  4MNK A;  2FDM A;  2LJ4 A;  3ARW A;  3GPK A;  1TCO C;  4WKA A;  3WQW A;  1WB0 A;  1D7I A;  4ZPV R;  3KAH A;  1ZBV A;  5J6E A;  1NWR A;  2KFW A;  3WD3 A;  4S3K A;  4GGQ A;  5DIT A;  1W9U A;  5HKG A;  3RFW A;  4JFL A;  3RGC A;  3G6M A;  1L1P A;  3OA5 A;  3WD1 A;  1JCH B;  1NWU A;  2F4E A;  1N1A A;  3NRK A;  4W5U A;  1W1T A;  4TX0 A;  3I6C A;  4P8X A;  3O5M A;  2RSE A;  1ZB5 A;  2Q5A A;  3O5P A;  1FKI A;  3UI5 A;  4KR0 B;  4MGV A;  2XPB A;  4R5E A;  1OWQ A;  2RUQ A;  5HBF A;  3ARO A;  3O5L A;  1E6Z A;  1E6N A;  4DIP A;  1R9H A;  4P8U A;  5DEZ A;  1LG1 A;  2A3E A;  2FAP A;  1UR8 A;  3BXW A;  2PN0 A;  3PR9 A;  2KGJ A;  2D9F A;  1ZBC A;  4XAK A;  2VCD A;  4PTM A;  4ZPT R;  4U85 A;  3CHD A;  4FN2 A;  1M5Y A;  1Q6U A;  1JND A;  2PI6 A;  1LL6 A;  3AQU A;  3B9D A;  4TW8 A;  2PPO A;  1FKR A;  1J4H A;  3ARR A;  2FKE A;  1W1Y A;  4Z2H A;  4DZ2 A;  4DRN A;  3B7X A;  1UR9 A;  4DWS C;  1ITX A;  1ROU A;  3WIJ A;  2N87 A;  3ARU A;  1F40 A;  3IK8 A;  1JNT A;  1NWT A;  4N19 A;  3TCZ A;  4WKH A;  3WD2 A;  1J4R A;  2ITK A;  3ARP A;  3G6L A;  2KO7 A;  1GPF A;  4QIB A;  2RQS A;  1NMV A;  4DT4 A;  1FJD A;  1NMW A;  4ODO A;  1FKG A;  4DRQ A;  5HUA A;  4DWS B;  2XP8 A;  4ODP A;  2DT1 A;  3ARV A;  1D2K A;  1HKM A;  1VF8 A;  1Q6I A;  1LL4 A;  2XP7 A;  2IUZ A;  3CHF A;  2DSU A;  4ODL A;  1HKK A;  3UQB A;  4DH0 A;  4C02 B;  3WL0 A;  5HW6 A;  3OOB A;  3KAG A;  1W26 A;  4MPK A;  2XP5 A;  4W9O A;  4MNL A;  3B8S A;  3H9R B;  3KAI A;  4MSP A;  5HW7 A;  3O5I A;  2KI3 A;  5DIU A;  1LG2 A;  1B6C A;  1HKJ A;  1FKH A;  4JFK A;  4LGX A;  4LAW A;  3FXY A;  2PPN A;  5JH8 A;  3MDY B;  2WLY A;  3CHE A;  4JFM A;  3O5D A;  1Q1C A;  3IKG A;  2O9O A;  3O5K A;  1WAW A;  3B9E A;  3GTY X;  1C9H A;  3IKD A;  1NWS A;  1EQ3 A;  2DG4 A;  4ODM A;  1SR0 A;  1LQ0 A;  2PV2 A;  2G41 A;  4LAX A;  4ODK A;  1KT1 A;  2MLX A;  2O92 A;  1D7H A;  1F8A B;  2XPA A;  2QF8 A;  2DG9 A;  4HAR A;  3TDB A;  1P5Q A;  3ART A;  3KAF A;  2RUD A;  1E15 A;  1PIN A;  3O5R A;  1XRV A;  1X6L A;  3CH9 A;  2WM0 A;  4NSB A;  4TW6 A;  4AY1 A;  3EY6 A;  4IPX A;  1ZCN A;  1JNS A;  3GU0 A;  3ARQ A;  2B5U B;  2PPP A;  2RUR A;  4L3N A;  1ZBW A;  3WL1 A;  1J4I A;  1Q6H A;  2WK2 A;  3O5J A;  2DT3 A;  1LJY A;  1FFQ A;  2UZ5 A;  3AS3 A;  1OGB A;  2KE0 A;  2MPH A;  1D7J A;  2ZR5 A;  4ZPW R;  1HXV A;  1QPF A;  1ZU8 A;  4TYO A;  2ZQV A;  3WKZ A;  3UI4 A;  2MNT A;  1A7X A;  2IF4 A;  1FKF A;  4DRJ A;  3WH0 A;  5HTG A;  5GPR A;  4Q22 A;  3B9A A;  4MNM A;  4DRM A;  1YAT A;  3O5F A;  4IT4 A;  2M2A A;  4G50 A;  1GRJ A;  5DF0 A;  1GOI A;  3FY1 A;  2F21 A;  2F2D A;  2L2S A;  3PRD A;  3O5O A;  4DRO A;  2PV3 A;  3RME A;  2M1I A;  3QOK A;  5I98 A;  2XP4 A;  1OGG A;  1NH6 A;  4J4N A;  1RD6 A;  1W9P A;  2RUC A;  2JZV A;  3IHZ A;  4S3J A;  4TW7 A;  1T11 A;  4DRP A;  3CGN A;  3NI6 A;  1IX5 A;  1E6P A;  1SYT A;  1W1V A;  3ODK A;  1W1P A; 
#chains in the Genus database with same CATH homology
 2MLY A;  4BF8 A;  3PRB A;  1W9V A;  2ZQS A;  3AS1 A;  3CGM A;  5GPG A;  1ROT A;  4LAV A;  3CHC A;  4NZC A;  2ESC A;  4Q7N A;  3ARZ A;  4IQ2 A;  1NSG A;  3PRA A;  2YBT A;  2LPV A;  1HJX A;  4MTV A;  1EDQ A;  2ZQU A;  2ZR6 A;  3RM8 A;  2DT2 A;  4WK9 A;  4WKF A;  5DO2 A;  2XP6 A;  1PBK A;  3O5Q A;  3AS2 A;  5GQB A;  1FFR A;  2LKN A;  2OFN A;  4Z2G A;  2ZQT A;  4DRH A;  1K9T A;  4IT6 A;  1O6I A;  4MNJ A;  3VAW A;  2DSV A;  3JXV A;  4IQC A;  1LL7 A;  3KZ7 A;  1J6Y A;  1XHG A;  1WNO A;  4WIW A;  4Z2I A;  3AS0 A;  1FKD A;  3LUO A;  2KR7 A;  1TFV A;  4FAP A;  2DSW A;  1FKB A;  3UQA A;  4W9P A;  3KAC A;  4P8W A;  2PV1 A;  3W4R A;  1E9L A;  1YW5 A;  1KT0 A;  4G2P A;  3UI6 A;  2LGO A;  2XP9 A;  1U79 A;  2OLH A;  4HBO A;  2A3C A;  3KAB A;  1JVW A;  1FKT A;  4L72 B;  2WLZ A;  2A3B A;  4DWS D;  1CTN A;  3CZ8 A;  3NTP A;  5HWB A;  2Y78 A;  1BKF A;  4Z2J A;  1HJV A;  2XP3 A;  1H0I A;  1QZ2 A;  4KQZ A;  4DRI A;  2B31 A;  4JFJ A;  2G8Z A;  3ALG A;  3UQI A;  4QT2 A;  3WD0 A;  2MF9 A;  5HWC A;  4P8V A;  5HW8 A;  4DWS A;  4GIV A;  1FKL A;  4U86 A;  1BL4 A;  1ZK6 A;  1FKK A;  3ALF A;  2MLZ A;  4DZ3 A;  4WJX A;  4R0X A;  4JYS A;  1ZL1 A;  5B8I C;  5DIV A;  3JYM A;  4DRK A;  4O2T A;  4W9Q A;  1ZBK A;  1FKS A;  1GUV A;  3RM9 A;  3KAD A;  2PBC A;  1FD9 A;  4TNS A;  1HKI A;  3ARY A;  1QPL A;  4ODN A;  4HBE A;  2M08 A;  1FAP A;  4ML4 A;  1Y0O A;  1HJW A;  3UF8 A;  5BXJ A;  4JFI A;  4ODQ A;  4QZV B;  1JNE A;  2DT0 A;  1H0G A;  3RM4 A;  5D75 A;  1KFW A;  4Z2K A;  5HT1 A;  4Z2L A;  3KCE A;  1FKJ A;  2DPE A;  4ITZ A;  2VN1 A;  3WQV A;  4U84 A;  1EYM A;  4LAY A;  2AWG A;  3WD4 A;  3FAP A;  1E6R A;  2ZR4 A;  4J4O A;  3JYJ A;  4QT3 A;  4URI A;  2A3A A;  2AOS A;  2DG3 A;  1X6N A;  3TC5 A;  3O5E A;  1D6O A;  4NNR A;  2K8I A;  2DSZ A;  3PA7 A;  3O5G A;  1EIB A;  4ODR A;  3ARS A;  3ARX A;  2YBU A;  1EHN A;  4ZS6 A;  4MAV A;  4MNK A;  2FDM A;  2LJ4 A;  3ARW A;  3GPK A;  1TCO C;  4WKA A;  3WQW A;  1WB0 A;  1D7I A;  4ZPV R;  3KAH A;  1ZBV A;  5J6E A;  1NWR A;  2KFW A;  3WD3 A;  4S3K A;  4GGQ A;  5DIT A;  1W9U A;  5HKG A;  3RFW A;  4JFL A;  3RGC A;  3G6M A;  1L1P A;  3OA5 A;  3WD1 A;  1NWU A;  2F4E A;  1N1A A;  3NRK A;  4W5U A;  1W1T A;  4TX0 A;  3I6C A;  4P8X A;  3O5M A;  2RSE A;  1ZB5 A;  2Q5A A;  3O5P A;  1FKI A;  3UI5 A;  4KR0 B;  4MGV A;  2XPB A;  4R5E A;  1OWQ A;  2RUQ A;  5HBF A;  3ARO A;  3O5L A;  1E6Z A;  1E6N A;  4DIP A;  1R9H A;  4P8U A;  5DEZ A;  1LG1 A;  2A3E A;  2FAP A;  1UR8 A;  3BXW A;  3PR9 A;  2KGJ A;  2D9F A;  1ZBC A;  4XAK A;  2VCD A;  4PTM A;  4ZPT R;  4U85 A;  3CHD A;  4FN2 A;  1M5Y A;  1Q6U A;  1JND A;  2PI6 A;  1LL6 A;  3AQU A;  3B9D A;  4TW8 A;  2PPO A;  1FKR A;  1J4H A;  3ARR A;  2FKE A;  1W1Y A;  4Z2H A;  4DZ2 A;  4DRN A;  3B7X A;  1UR9 A;  4DWS C;  1ITX A;  1ROU A;  3WIJ A;  2N87 A;  3ARU A;  1F40 A;  3IK8 A;  1JNT A;  1NWT A;  4N19 A;  3TCZ A;  4WKH A;  3WD2 A;  1J4R A;  2ITK A;  3ARP A;  3G6L A;  2KO7 A;  1GPF A;  4QIB A;  2RQS A;  1NMV A;  4DT4 A;  1FJD A;  1NMW A;  4ODO A;  1FKG A;  4DRQ A;  5HUA A;  4DWS B;  2XP8 A;  4ODP A;  2DT1 A;  3ARV A;  1D2K A;  1HKM A;  1VF8 A;  1Q6I A;  1LL4 A;  2XP7 A;  2IUZ A;  3CHF A;  2DSU A;  4ODL A;  1HKK A;  3UQB A;  4DH0 A;  4C02 B;  3WL0 A;  5HW6 A;  3OOB A;  3KAG A;  1W26 A;  4MPK A;  2XP5 A;  4W9O A;  4MNL A;  3B8S A;  3H9R B;  3KAI A;  4MSP A;  5HW7 A;  3O5I A;  2KI3 A;  5DIU A;  1LG2 A;  1B6C A;  1HKJ A;  1FKH A;  4JFK A;  4LGX A;  4LAW A;  3FXY A;  2PPN A;  5JH8 A;  3MDY B;  2WLY A;  3CHE A;  4JFM A;  3O5D A;  1Q1C A;  3IKG A;  2O9O A;  3O5K A;  1WAW A;  3B9E A;  1C9H A;  3IKD A;  1NWS A;  1EQ3 A;  2DG4 A;  4ODM A;  1SR0 A;  1LQ0 A;  2PV2 A;  2G41 A;  4LAX A;  4ODK A;  1KT1 A;  2MLX A;  2O92 A;  1D7H A;  1F8A B;  2XPA A;  2QF8 A;  2DG9 A;  4HAR A;  3TDB A;  1P5Q A;  3ART A;  3KAF A;  2RUD A;  1E15 A;  1PIN A;  3O5R A;  1XRV A;  1X6L A;  3CH9 A;  2WM0 A;  4NSB A;  4TW6 A;  4AY1 A;  3EY6 A;  4IPX A;  1ZCN A;  1JNS A;  3ARQ A;  2RUR A;  2PPP A;  4L3N A;  1ZBW A;  3WL1 A;  1J4I A;  1Q6H A;  2WK2 A;  3O5J A;  2DT3 A;  1LJY A;  1FFQ A;  2UZ5 A;  3AS3 A;  1OGB A;  2KE0 A;  2MPH A;  1D7J A;  2ZR5 A;  4ZPW R;  1HXV A;  1QPF A;  1ZU8 A;  4TYO A;  2ZQV A;  3WKZ A;  3UI4 A;  2MNT A;  1A7X A;  2IF4 A;  1FKF A;  4DRJ A;  3WH0 A;  5HTG A;  5GPR A;  4Q22 A;  3B9A A;  4MNM A;  4DRM A;  1YAT A;  3O5F A;  4IT4 A;  2M2A A;  4G50 A;  5DF0 A;  1GOI A;  3FY1 A;  2F21 A;  2F2D A;  2L2S A;  3PRD A;  3O5O A;  4DRO A;  2PV3 A;  3RME A;  2M1I A;  3QOK A;  5I98 A;  2XP4 A;  1OGG A;  1NH6 A;  4J4N A;  1RD6 A;  1W9P A;  2RUC A;  2JZV A;  3IHZ A;  4S3J A;  4TW7 A;  1T11 A;  4DRP A;  3CGN A;  3NI6 A;  1IX5 A;  1E6P A;  1SYT A;  1W1V A;  3ODK A;  1W1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...