2IF4A

Crystal structure of a multi-domain immunophilin from arabidopsis thaliana
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
258
structure length
258
Chain Sequence
NVPPKVDSEAEVLDEKVSKQIIKEGHGSKPSKYSTCFLHYRAWTKNSQHKFEDTWHEQQPIELVLGKEKKELAGLAIGVASMKSGERALVHVGWELAYGKEGNFSFPNVPPMADLLYEVEVIGFDETKEGKARSDMTVEERIGAADRRKMDGNSLFKEEKLEEAMQQYEMAIAYMGDDFMFQLYGKYQDMALAVKNPCHLNIAACLIKLKRYDEAIGHCNIVLTEEEKNPKALFRRGKAKAELGQMDSARDDFRKAQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATFKBP42
publication title Crystal Structure of a Multi-domain Immunophilin from Arabidopsis thaliana: A Paradigm for Regulation of Plant ABC Transporters.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein
total genus 70
structure length 258
sequence length 258
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2if4A02
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2if4A01
4LAWA 4O2TA 5FZRA 3S7FA 3ASDA 1J4IA 4GGQA 3U4TA 1D6OA 5J6EA 4J4OA 3HYMB 5FJYA 4TW7A 5B8IC 2ZR6A 4G26A 3O5MA 3UQIA 3KD7A 3LYAA 3KABA 2RUCA 4IPXA 2M2AA 4GCOA 3OOBA 3NF1A 2ZQSA 2ZQTA 5ARGA 5EKQD 4HOTA 4XI0A 1M5YA 2GW1A 1BKFA 4GA0A 5D75A 2KE0A 3K9IA 4J4NA 3ASHA 4NRHB 1FKLA 1F40A 2XP3A 3CGNA 4ODMA 4WUYA 3H9RB 3CK7A 4ITZA 1FKJA 2LSUA 3BEEA 5DIVA 5I98A 3S7JA 2PQRA 4MGVA 1FKBA 2VSNA 3KACA 3KAFA 1FCHA 2KATA 3EY6A 4LEUA 2HYZA 4GZ6A 4KBQA 4J8DA 2RSEA 2PQNA 3FWVA 2WPVA 5LCWJ 3TGOA 2PZIA 5G05C 3GZ1A 1EYMA 3LY9A 2LKNA 3IKGA 1HH8A 1XNFA 3N71A 2FF4A 2QFCA 2RUDA 5HWBA 4RG6A 1T11A 2DG9A 4BTBA 1KT1A 1Y0OA 2LPVA 4WNGA 1NMWA 4G50A 3CVQA 2ONDA 1P5QA 3IHZA 4DZ2A 3QKYA 2VGXB 3R9AB 4CGWA 3NI6A 4JYSA 2Y4TA 4DRKA 1W26A 1FKTA 5HWCA 5EX0A 3PRDA 4IQ2A 3VTXA 2HR2A 5HW8A 1IHGA 3GPKA 3I6CA 2E2EA 2V5FA 1B6CA 4O6FA 5HTGA 3Q4AB 1YW5A 3RJVA 3ASGA 4ODRA 4GZ5A 4G1TA 4KYOB 1J4HA 4BF8A 4U0SA 4JFKA 1HXVA 3O5GA 2FEZA 2PL2A 2UWJG 4N5CA 5FZQA 4UQZA 1QQEA 5HT1A 5FZSA 3UQBA 3TDBA 2KCLA 3SF4A 4JA7A 4IN3B 2D9FA 3JXVA 4YNDA 3RO3A 4HOSA 1FKGA 2F4EA 2AWGA 2OOEA 3PE3A 2XCBA 3LPZA 4ME2A 4LAXA 2MLZA 3ZFWA 5C1DA 2XP8A 1J6YA 3ESKA 2XPAA 1L1PA 2VGXA 4N3BA 5JJ7A 2I6HA 3ZGQA 2L2SA 3O5RA 2J9QA 4G24A 4ABNA 1QZ2A 3CK8A 1OUVA 3IEGA 5FTPA 2PPPA 4TW6A 4TYOA 2C2LA 3MV2B 3SZ7A 4ODPA 3NTPA 2PV2A 4TW8A 3GYZA 4MSPA 2XP5A 3KCEA 4Y6WA 2XGMA 2AVPA 2Q5AA 5HW6A 4ODNA 3IKDA 1ZK6A 5LCWC 4BT9A 4GIVA 4C02B 5ARFA 1FKKA 3ULQA 4UQXA 1FJDA 4CDRA 3PRBA 3UI6A 5HI7A 2XPIA 1FD9A 1FAPA 3RKVA 3O5IA 1F8AB 3IK8A 1FKHA 4LAVA 2ZR5A 2L6JA 5CHEE 4N2SA 3CKCA 4EQFA 1ELRA 5HUAA 5AYWD 2RQSA 1Q6HA 4I17A 5DBKA 1A17A 2F21A 3RIBA 1B89A 4APOA 2PV3A 1HXIA 2UY1B 3MV3B 4LAYA 4BT8A 4UI9C 5G04J 3AS4A 2M1IA 4N3AA 4GYOA 5GPGA 2XGSA 4H7YA 2FI7A 2KCVA 1Q6UA 4YVOA 1PC2A 2DG3A 1WM5A 3CKBA 5KJKA 4ODQA 3CK9A 4DRIA 3WXXA 4DRJA 3VTYA 3GZ2A 5HW7A 4U0ZA 3KAGA 3MA5A 1JNSA 2XP6A 2RURA 1Q6IA 4JFJA 5CCMA 4DH0A 4N19A 3E4BA 2FO7A 1PINA 4H7XA 2HO1A 5DITA 1FKFA 5CCLA 2NC9A 4JA9A 2P58C 4GYWA 4G23A 2PV1A 4ODKA 1IYGA 3ZHEB 2FAPA 3LKUA 3ZN3A 2N87A 2VSYA 3Q47B 3TG5A 2ITKA 4WNEA 3GW4A 3LY8A 2OFNA 5A7DB 4XI9A 3Q5MA 2DBAA 5D0OD 3S7BA 2Y78A 3QDNA 4QT2A 2LNIA 3WH0A 4N39A 5BW8C 4JHRA 2MNTA 4FAPA 1KLXA 4I1AA 2IFUA 4J8EA 2JLBA 1Q1CA 4ODLA 1NA0A 1WAO1 3QWVA 4I2ZA 3PA7A 4WNDA 1U79A 2PPOA 1NZNA 3NRKA 3PE4A 2KCKA 3MDYB 3UF8A 5EX3A 3U3WA 4CGVA 4DRMA 4QT3A 4DRPA 3S7DA 2XEVA 4XIFA 1YATA 1ZU2A 3O5OA 3OXGA 3O5FA 4IQCA 4WNFA 3O5EA 4W9PA 3TG4A 3O5LA 2JZVA 3MEKA 3UQ3A 5DIUA 4KXKB 3ZHEA 4DZ3A 1FKDA 4F3VA 1EQ3A 3TC5A 3Q15A 5G04C 1FKSA 3QOUA 2C0LA 4UQYA 3RO2A 3ZPJA 3RGCA 2RUQA 4U86A 2VGYA 3QWWA 4JFMA 3B7XA 2LGOA 4JFLA 3AS8A 4Y6CA 2K8IA 4W9QA 2FBNA 3O5DA 1ROUA 5KJLA 5JJ6A 1J4RA 3FFLA 2XPBA 1ZBPA 2IF4A 4NNRA 2LSVA 1TJCA 3LUOA 3CGMA 2BUGA 1JNTA 2UZ5A 1W3BA 4YVQC 2FKEA 2YHCA 5BT1A 2KC7A 4J8FA 3O5QA 3CV0A 4J0UA 3UPVA 4G25A 2M08A 3CVLA 5BXJA 1QPFA 4AM9A 2MPHA 2KI3A 3RU0A 2KO7A 4U0UA 4ODOA 4TNSA 3CEQA 5KJMA 1D7HA 4AIFA 2YQ8A 5M72A 3PDNA 4I9EA 5DIZA 4JFIA 3CVPA 4U07A 4W9RA 1A7XA 2LJ4A 5FT9A 2VCDA 4W9OA 5HKGA 2R5SA 2VN1A 3O5PA 3JYMA 4GCNA 1HZ4A 4DIPA 3AS5A 2DG4A 4DRNA 1TCOC 4GZ3A 1JVWA 2MF9A 4DRHA 2PPNA 3LY7A 2KGJA 4U04A 4RG9A 3QWPA 4G2VA 2Y4UA 2VYIA 3FP3A 1D7JA 5A6CA 1NMVA 2PBCA 3LCAA 4GA1A 3TCZA 2MLYA 4N2QA 2XP4A 2ZR4A 2MLXA 1Y8MA 1R9HA 2XP9A 4I2WA 2XCCA 2F2DA 2C0MA 2ZQVA 4DROA 4QIBA 2UY1A 2Q7FA 3VAWA 1C9HA 2XGOA 4B94A 3ASFA 3O5KA 1PBKA 4GYYA 4U85A 4HOUA 3UUXA 5KJNA 3KZ7A 4U84A 3FAPA 3TAXA 5JJTA 4UI9K 1NSGA 4UI9J 2ZQUA 4HORA 3UI4A 1ELWA 4GA2A 3UQAA 4JL0A 5G05J 4AY6A 5BNWA 4G2PA 4BTAA 1ZCNA 3JYJA 2WQHA 4AY5A 4BWRA 1YA0A 3JYSA 3KAIA 3Q49B 3RFWA 2KR7A 3ODKA 5D0QD 3UI5A 1D7IA 1FKRA 4DT4A 3O5JA 3KS2A 3MKRA 3CVNA 1BL4A 2MHKA 4HOQA 3URZA 1E96B 3O48A 4FN2A 4R0XA 2XP7A 2KFWA 3OXLA 4I9CA 1KT0A 2VQ2A 1QPLA 3OXFA 1NA3A 4A1SA 4GPKA 1FKIA 1N1AA 1ROTA 3EDTB 4NQ0A 4N3CA 3KADA 5HQ8A 4TX0A 3KAHA 4DRQA 3KAEA
chains in the Genus database with same CATH superfamily
5CRUA 5FZRA 3S7FA 1J4IA 5J6EA 2OV8A 1XHGA 2FULA 1N0QA 3WD0A 2XENA 5G55A 2WXOA 4FU3A 3OOBA 1HU3A 2ZQTA 4B0ZA 3WKZA 1M5YA 3DPDA 2GW1A 1LF8A 4G8KA 4HBEA 3ALFA 3IHVA 4HRMB 3Q9UC 4P8XA 1V54E 5ENOD 3CK7A 3BEEA 4R7LA 3CHEA 1OT8A 2H6IA 4ANXA 2PQRA 4K0RA 4ACLA 4MGVA 1WY6A 3KACA 1HKJA 2Y69E 3UTMA 3EY6A 4XZ4A 4LEUA 4CCAA 3EHQA 2CG3A 4J8DA 2RSEA 3ARYA 2J07A 3DBSA 5JHAA 5FQ6A 3B7RL 3QC1A 1HH8A 1XNFA 3DRAA 4DX1A 2QFCA 5HWBA 4MPKA 1E8ZA 4WNGA 1QBQA 1K3ZD 4MRUA 4BFRA 3Q73A 2VGXB 3R9AB 3FH5A 1UJKA 4CGWA 3FDHA 3RMEA 1BU9A 1DCEA 3L08A 1W26A 2X38A 4W5UA 1K9TA 2DSWA 5HW8A 2M63A 2AW6A 5FQ7A 3HXEA 3SFZA 3U66A 3SBSA 4KYOB 3FH7A 4HNAD 1FFRA 1OGBA 4DRXE 4DRQA 1FT1A 5AARA 3ASOE 1OY3D 4PS3A 3TDBA 3BXWA 2WXKA 4DX5D 2D9FA 2FDMA 4O60A 4EZLA 2F4EA 1FKGA 4CEMA 1H2VC 2DT1A 2GRLA 3ZFWA 2GRRB 1Q2ZA 5C1DA 1L1PA 3NZUA 4MKTA 2VGXA 5FWQA 3UXGA 3IHYA 3FU6A 1NL4A 1LD8A 3ZKJA 1EYHA 4G24A 4Z2JA 3FUHA 4ABNA 1QZ2A 4IT6A 2AXUA 4GU5A 1LL4A 4TYOA 1TN8A 2PV2A 1BI8B 4LRZA 2XP5A 3KCEA 2X6IA 4GTTA 5HW6A 2LAIA 3U9WA 3IKDA 4L2YA 1JWFA 4KZCA 2OLHA 1FKKA 2IY0C 4G8LA 2XPIA 3KEZA 1FAPA 2P9UG 4LAVA 3AS1A 5CHEE 4N2SA 1TYQG 2XPYA 4LG6A 4S3JA 2F8YA 3GTYX 4P8VA 5AYWD 2XQ0A 2XZDG 2RQSA 5JMND 1E8XA 1N4PA 4AV7A 1EIBA 3IXEA 3MV3B 1SVXA 5G04J 3PZ4A 1H2UA 3ISMC 1UN8A 3UT7A 2QZAA 4FHJA 3RM4A 4U8YD 2KCVA 1E15A 2PM6A 1W9VA 2R05A 2OVBA 4HLEA 3CKBA 4DRIA 3AG2E 1JUQA 2YHEA 1HFAA 2XP6A 1Q6IA 2RG8A 3ENEA 2NYJA 3PRAA 1FKFA 4K5AB 3AS3A 4PTMA 4G23A 3CVUA 2PV1A 3O4ZA 2IO3C 5C2YA 3ZHEB 2PI6A 3TG5A 1TNBA 1S64A 3FEYA 2P9SG 4L3NA 2LXLA 1LG1A 2DBAA 3QDNA 2WM9A 3WH0A 4N39A 4JHRA 2QYUA 4FAPA 4LSZE 3D9JA 1KLXA 4I1MA 5CERB 4J8EA 1NA0A 4I2ZA 5G2NA 4WNDA 2ZU6B 4DWSB 4LERA 1HF8A 4IYPA 3U3WA 5FINA 4DRMA 4QT3A 3ONLA 2DIWA 2XEVA 2RFAA 3I4GA 4U8VD 5IY5E 4ILGA 4J6IA 1D2KA 4IQCA 4WNFA 2KZTB 2GRMA 3TG4A 5AQAA 2EULA 5DIUA 1ZBCA 4KXKB 3ZHEA 1FKDA 5ENTD 3PUKA 3V79K 5J08A 1MX2A 3L22A 3TC5A 5AJDA 3WQWA 1FKSA 5BXUA 2LXMA 4R5EA 3I3NA 3CQGB 2DT3A 3FTYA 3B7XA 3NB2A 2LGOA 2WXFA 4Y6CA 3R7RA 3WQVA 2KM4A 3AU4A 3VLFA 3SNXA 3HXDA 1EDUA 2XPBA 4WWOA 2IF4A 2I2OA 1TJCA 1JNTA 1X6LA 1TN7A 4DWSA 2KC7A 4J8FA 3O5QA 1W9PA 2M08A 3C72A 2WQ6A 1QPFA 4AM9A 2MPHA 2KI3A 5AAOA 3CVYA 2F23A 4ODOA 1N4QA 4G11A 4AIFA 3FUEA 3R9MA 2YQ8A 1OWLA 3PDNA 1VF8A 4I9EA 5DIZA 4W9RA 4GCNA 4UDMA 1HZ4A 4F1PA 4A1GA 2V5QC 3JUEA 4TUUA 5KBAA 2DG4A 3Q7FA 3C3RA 1Z6TA 1TCOC 4YDWA 4C48B 2PPNA 3LY7A 2KGJA 4U04A 3ASNE 5JHBA 4WWPA 1ZB1A 1FT2A 4XKBA 4HARA 3EU9A 1D7JA 3LCAA 2X6HA 2HE0A 2XP4A 4N2QA 2MLXA 4IRUA 5CEAA 2BEDA 4IULA 1R9HA 2XP9A 4K5CA 4MNKA 4Z68A 2WVIA 2F2DA 1JNDA 4DROA 4MNMA 3G2WA 1HJXA 1C9HA 3NOCD 1N52A 2XGOA 4B94A 1PBKA 4GYYA 4NURA 4HOUA 3KZ7A 1ELKA 5JH8A 1FFQA 4U84A 1TJFA 4U8HA 3WD1A 3HVEB 5JJTA 3ARSA 1O5MA 4M3OA 4JL0A 4AY6A 1EHNA 2AWIA 2RKKA 3RFWA 2KR7A 3ODKA 3CVXA 3O5JA 3MKRA 3CVNA 2IOLA 2P9NG 1E96B 4YDOA 3O48A 3QNKA 4O1PA 4FN2A 4HXIA 4Q22A 1QPLA 1H6KA 4A1SA 3TXMA 3AAAC 4N3CA 5DO2A 4UWFA 4TXRA 4TX0A 1O1SA 2V4HC 2PM7A 3ASDA 2EILE 3U4TA 3W4RA 1EF1C 2QC9A 2CG2A 1WAWA 3ZXPA 3O5MA 1NP7A 2WB2A 2M2AA 2WMNA 3PZ1A 2ZQSA 5CMWA 4QZVB 4GMLA 4DUIA 4HOTA 4Q96A 2EQXA 3CHCA 1HG2A 1ITXA 1S70B 1HS6A 3ASHA 4NRHB 4ODMA 4Z2HA 5I98A 4ZHBA 3PREA 1VDYA 3S7JA 1FKBA 3V2XA 4HBOA 2DT0A 1HJWA 4KBQA 3TWSA 3GZ1A 4J8YA 3LY9A 4KVMA 3UKUG 3UIPC 3ZYKA 1T11A 2LPVA 1Z3YA 3FUNA 3B9DA 3CVQA 4EZJA 3ALGA 2ONDA 1P5QA 1MZCA 5FQ4A 4BETA 4JYSA 2Y4TA 5HWCA 3FEXA 3WD2A 3B7SA 1B6CA 4GTPA 4YDYA 4HFGA 4GZ5A 4ODRA 3SY2A 4JEUA 2WXHA 4G1TA 1IQRA 3E34A 4KQZA 3DXKG 4FJYA 2BF0X 3C5RA 1BI7B 3TL5A 4FJZA 2P9LG 3LS8A 4CT4A 2UWJG 3D3MA 4UQZA 1EPUA 1QQEA 5HT1A 5FZSA 3SF4A 4JA7A 4IN3B 5ANRA 3RO3A 1OWNA 1QYMA 2AWGA 3RSEG 2OOEA 1N54A 3LPZA 4LAXA 5DEZA 1N95A 2RD0A 2DZNA 3FUIA 5JJ7A 2WXQA 3O5RA 2WMOA 5LX8A 1OUVA 4UWHA 2J4BA 5FTPA 3WG7E 4TW6A 4AVXA 3MV2B 2KXPC 3SZ7A 4TW8A 3S2AA 2Q5AA 2DVWA 4PH4B 2VSOE 4Z2KA 1IX5A 1ZK6A 4LUNU 3SHFA 3U64A 4B8AA 4L2LA 4BT9A 2ZGDA 2X6JA 3ULEG 2XHEA 3ULQA 4UQXA 2VGEA 3JCKC 3HXCA 5CBOA 3CIAA 3PRBA 1FD9A 2BKKB 1H6OA 3O5IA 2J8SD 4Q94A 4UWGA 4B93B 3ZUVB 4EQFA 5D2MC 4GZCA 4K5BA 5HUAA 1Q6HA 3FTVA 3QARA 5DBKA 1A17A 3JUIA 1YCSB 3RIBA 5A23A 4APOA 3SD5A 2PV3A 4OAUC 1DC2A 1ZBVA 3MKQB 2AXVA 4BT8A 3AS4A 2M1IA 1U3CA 1W9UA 4N3AA 2XEEA 3TWWA 1KPSB 1TEZA 2XGSA 4H7YA 4ILIA 2FI7A 3T9KA 1EDQA 1Q6UA 4WKAA 2DG3A 1WM5A 4ODQA 3FTWA 3HHMA 3P2BA 3V31A 3FHEA 1X6NA 3GZ2A 3TWVA 5HW7A 3MA5A 3D9NA 4AXHA 5CCMA 4DH0A 1PINA 3CZ8A 1E9LA 2HO1A 4J8SA 2NC9A 5KWDA 2A5UA 2P58C 4GYWA 3NBNB 1H0GA 4FULA 1IYGA 1IKND 4EPZA 2VSYA 2ESCA 1PY1A 3ARVA 4TUMA 4OVUA 3Q5MA 4CYMD 2Y78A 5EIBE 5DF0A 3UM2A 5BW8C 4MLPA 3AU5A 3BUAA 2DYSE 1WAO1 4GMRA 5EYPF 5HBFA 2J08A 3PA7A 1HKIA 5T3RA 3PE4A 3MDYB 1MQSA 2F0YA 4BY6A 4HLLA 3DSXA 3UT4A 1ZU2A 3O5OA 5ENSD 3C98A 3OXGA 1HO8A 4W9PA 4DLQA 3O5LA 3MEKA 4F3VA 1W1YA 1Z3XA 3QOUA 1U3DA 2X3MA 1HKKA 2GRQB 3EHRA 3NOGD 3RGCA 2RUQA 4U86A 4NIKA 3APFA 2IJGX 3GU0A 4JFLA 2XS8A 2K8IA 2FBNA 3O5DA 1ROUA 1AWCB 5KJLA 3FFLA 3JXJA 1GUVA 4NNRA 2YINA 2LSVA 1D9SA 4P29A 2BUGA 2WXIA 1W3BA 2YHCA 1LD7A 5BT1A 3KSQA 3EU5A 4G25A 2WK2A 3CVLA 3FUJA 2KO7A 4M7CA 4A3VA 1IXVA 1X5BA 2CHZA 2P9IG 4I6GA 1W1PA 2EINE 3CVPA 4BEPA 4U07A 1A7XA 3O5PA 3QJZA 3SFYA 4DIPA 1SZ9A 3T8KA 4DRNA 2YNQA 3DSVA 3AG3E 1JVWA 2H6HA 1YMPA 3ARZA 4APFA 3JQ1A 2DSUA 3QWPA 4WK9A 3LJ3A 2ETNA 3EUVA 2Y4UA 3BG1B 3DEOA 3FP3A 5CMYA 4PS8A 4PUCA 4BSZB 1HKMA 3L6AA 3TWQA 3TCZA 2ETCA 2MLYA 4JHJA 2NXPA 1D8EA 3Q75A 5BPPA 4URKA 4I2WA 4L9PA 2XCCA 4RLYA 2C0MA 1JCQA 2WXMA 3TXNA 4F53A 2WXLA 4HB5A 3Q79A 1G3NB 3O5KA 1LL6A 1ZBKA 4Z2IA 2P4VA 1QNFA 3W9FA 4EECA 1NSGA 4HORA 2CHWA 4C9BB 1L5JA 4CT0A 4L72B 2O9OA 2IUZA 4RQIA 3CHMA 4TXPA 4O1OA 1ZCNA 3LEWA 2WQHA 2XS1A 1YA0A 1TR4A 3KAIA 3Q49B 5E75A 4K03A 5D0QD 1MX6A 3L82A 1D7IA 2QF8A 2YBUA 1SYTA 1UW4B 3WIJA 1K1AA 4XKCA 3KS2A 4HOQA 1DNPA 2OCCE 2G41A 2OEWA 2KFWA 3EHNA 1HX8A 3OXLA 1OCCE 5HS0A 3PEUB 1ZL1A 3B7UX 3OXFA 1NA3A 1OWMA 3EDTB 4NQ0A 3L13A 1ROTA 3KEAA 1OWPA 1LQ0A 3T5VA 4O2TA 3X2QE 2LUHA 4J4OA 3HYMB 5FJYA 4Z2LA 3LXUX 4TW7A 2ZR6A 2WXGA 4MNJA 2ETBA 4G26A 2BTDA 5AJLA 3ARQA 3UQIA 3KABA 4LCTA 3D9KA 4MS6A 4IPXA 2O92A 4GCOA 3NF1A 5D66A 3CHFA 5ARGA 5EKQD 3E30A 3UX4A 4XI0A 1E6ZA 2WXNA 2QYJA 3FH8A 1RD6A 4LNBA 3G2VA 2X6FA 2KZTA 3ZEFA 1FKLA 1F40A 3CGNA 4WUYA 3H9RB 4MAVA 4ITZA 1FKJA 2LSUA 4AY1A 4DK5A 1BD8A 3ONKA 5ENRD 3B8SA 3HDXA 1NWTA 5ITZF 2A3CA 2KATA 2HYZA 2WLYA 4GZ6A 3B95A 3BQOA 2PQNA 1OCOE 3FWVA 3TGOA 5G05C 3IKGA 3N71A 3PH0C 4EZKA 2RUDA 4RG6A 2DG9A 2Y1LE 1KT1A 4A3TA 2KBXA 4G50A 5T8IA 4DZ2A 4MTVA 3NI6A 3CHPA 3FTXA 3GZSA 4L7TA 3ABKE 1JCHB 1FKTA 2YBTA 3CLJA 3SFXA 1MJ0A 5EX0A 3PRDA 3FTZA 3J5PA 3WD4A 4A55A 3ZIMA 2I9CA 4ACKA 4AEZC 2E2EA 4O6FA 5HTGA 1CTNA 1UR9A 1MHQA 3PS6A 4D10C 5LFAA 2WM0A 3RJVA 3ASGA 4JHKA 2H6FA 1J4HA 3P1UA 5KNGA 3L9TA 5HRYA 4YDEA 4BESA 1WDYA 3O5GA 1TN6A 5FZQA 4N5CA 3IV0A 1OWQA 2B5UB 4GTVA 3UQBA 2KCLA 3LVQE 3JXVA 4HOSA 2VTBB 1E7UA 2XCBA 3ZU7B 1FVFA 2XP8A 1H6PA 1J6YA 2XPAA 2J09A 1JPLA 2A5EA 3UKRG 1Y6IA 2VJ8A 2ZXWE 3D9IA 3ESLA 4N3BA 2H6GA 2I6HA 2OEVA 3ZGQA 4FC8A 3W9GA 1GOIA 3CK8A 1OXJA 3IEGA 2PPPA 1HE8A 5KCMA 2C2LA 4Z2GA 3HVEA 4MSPA 4LNUD 4WKFA 2AVPA 4F1SA 2GROB 4ODNA 4ILHB 5B3SE 5LCWC 3ARPA 1NI1A 3AJIA 5ARFA 3L16A 3ULYA 2DT2A 5HI7A 3UI6A 2V8SE 5ENQD 5T4YA 1W1TA 4CRWA 3RKVA 1FKHA 2L6JA 2R59A 3CSFA 3Q7AA 2A4ZA 4JXTA 3BU8A 2B6CA 4CDMA 4DX7D 1NH6A 3ZNGA 3EIJA 2UY1B 3ARXA 4LAYA 4GZDA 3PZ2A 4GYOA 5GPGA 5FQ8A 3EIPA 3D9HA 1PC2A 1INZA 4MBGA 4BX9A 3CGHA 5KJKA 1SZAA 4DRJA 3PVLA 4JPSA 3VTYA 3FUKA 4C0MA 4B89A 4JW1A 3KAGA 1IHBA 3CH9A 2RURA 3TWTA 3APCA 2B0OE 3E4BA 2BKGA 3F6QA 3B9EA 4H7XA 2R2LA 3FTUA 5H7PA 5DITA 4JA9A 1WNOA 3CSTA 5BV0A 2FAPA 2N87A 2ITKA 2OFNA 4XAKA 3VLEA 4XI9A 1S63A 5JA4D 5D0OD 2E0IA 3S7BA 4XE0A 4U7EB 4QT2A 2LNIA 5CEDB 4L23A 5LP0A 5CRVA 4CZ2D 4DWSC 4FADA 3V30A 3I5PA 3ARWA 3J5QB 3AROA 1KZPA 3DPYA 3PNLB 4I1AA 3WD3A 2IFUA 3LVRE 2JLBA 2A3EA 2HM8A 3QWVA 2XEHA 4WJXA 2IO2C 2GGFA 1UG3A 1NZNA 3NRKA 2KCKA 1TNYA 5EX3A 1WG0A 4CGVA 4KT6B 4HRLA 3S7DA 3NAWA 4XIFA 3RRMB 4L1BA 1TFVA 2ZIRA 2Y0BG 1DVPA 2AOSA 2XRYA 4ML4A 3DXMG 3ZYMA 3O5FA 4LGXA 4ZPVR 3UQ3A 4FLBA 1EQ3A 3Q15A 2X6KA 3APDA 3LJNA 2C0LA 4P8UA 4UQYA 3ZPJA 3HXBA 5BUZA 3T5XA 3QWWA 3ZXSA 1E6PA 1LJYA 1LL7A 3AS8A 3TWUA 2WLZA 3D9LA 5JJ6A 4A63B 2A3AA 2Y3AA 1E90A 3LUOA 3CGMA 2DWZA 1NFIE 1E7VA 4YVQC 3DSSA 1D8DA 3CV0A 3MZLB 4XEIG 1JWGA 3RU0A 5FIOA 4U0UA 4U63A 3FU0A 4TNSA 5ANLA 1D7HA 3RM9A 4KVOA 4FP7A 4JFIA 1OGGA 4HBDA 2LJ4A 2OVFA 3JQ0A 3JYMA 3T8MA 4URIA 4EHMA 3VLDA 3AS5A 2NSZA 5AN8A 3L54A 1JCRA 2MF9A 4DRHA 2IONA 2IU1A 3HXFA 4G2VA 5HKPA 4E6HA 1Z5SC 2DPEA 2DYRE 1NMVA 2PBCA 3TWXA 4GA1A 3HRAA 1Y8MA 5B1BE 3SQVA 4JEHA 1MYOA 4ANUA 1ZU8A 2ZQVA 1K1BA 2Q7FA 3EHMA 3FUFA 3MKQA 4DLOA 3ML9A 3ASFA 2MYOA 4U85A 3UUXA 5KJNA 1N11A 4OAVB 4DWSD 3G2TA 3TAXA 3FU5A 4Q7NA 4EBAG 4UI9J 3QB2A 1H0IA 2ZQUA 3FXYA 3UM0A 4GA2A 3D9MA 3UQAA 4P8WA 1E8WA 4BERA 5G05J 5BNWA 3V2OA 3JYJA 3SI5A 3JXIA 4BWRA 3JYSA 5AENA 3FULA 5KNHD 3KSLA 3D9OA 4DT4A 4AP2A 3URZA 2FO1E 2XP7A 2JABA 1KT0A 2VQ2A 4GPKA 1N1AA 1FKIA 3KADA 4JD2G 4DI3A 1N0RA 3HIZA 3KAHA 3AG1E 3KAEA 3RK6A 4LAWA 3G2SA 4GGQA 1D6OA 1GPFA 1HJVA 3G2UA 1V55E 5B8IC 2V4LA 4HI8A 5BV1A 4UWKA 3KD7A 3LYAA 2RUCA 2V0PA 3QOKA 3TJPA 3UIOC 2WXPA 2P2CP 3PR9A 4DX2A 1BKFA 4GA0A 1OCZE 5D75A 1FVHA 2KE0A 3K9IA 4DI4A 3DWLG 1UR8A 4JC8A 2J49A 4NZCA 4J4NA 4KR0B 5E76A 4ATGA 4EBAA 1N4RA 2XP3A 1TNZA 5BXOA 2QY7A 1U2VG 5DIVA 4OVVA 1N9AA 5GPRA 4HQDA 2LAHA 5EIDA 2DZOA 4FA6A 2DCPA 5EYLA 3RRUA 4TRQA 2VSNA 2WXJA 2I1KA 1TNUA 3KAFA 1FCHA 2F8XK 4F6RD 4J7WA 3UI2A 3CVWA 2WPVA 5LCWJ 2PZIA 2CFUA 1EYMA 5EILA 2LKNA 1H19A 1E6RA 3UMVA 2WQ7A 4TXQA 4BSXA 2FF4A 2JEKA 5LOZA 4BTBA 1Y0OA 3ARTA 2LO6A 3B7TA 1NMWA 2GRNB 3IHZA 1YYHA 2L6BA 3QKYA 2XRZA 3E33A 4DRKA 1MX4A 4LNGA 4ZFHA 4IQ2A 4WAFA 2HR2A 3VTXA 3CHDA 1IHGA 4PS7A 3GPKA 3I6CA 2WXRA 2V5FA 3Q4AB 1YW5A 2ETAA 4BF8A 4CDNA 4U0SA 4JFKA 1HXVA 2FEZA 2PL2A 1AP7A 3CVVA 4YNDA 4F7AA 3BG0B 3PE3A 4ME2A 3MGBA 1IQUA 1SA4A 2A3BA 3E37A 2MLZA 3ESKA 4RSYA 1NWSA 1SA5A 4WIWA 2AJAA 3SGHA 1A5EA 1X81A 5ENPD 2L2SA 2J9QA 3EIQC 3SO8A 3CHRA 4WKHA 1OWOA 3FU3A 3WL1A 2L0TB 3B7BA 4I1OB 2IEJA 2CHXA 2RFMA 4GAAA 4ODPA 1O1TA 3NTPA 1O6IA 1NWRA 3GYZA 3OA5A 4Y6WA 2XGMA 3ARUA 3B9AA 2DSVA 5B1AE 1W1VA 3UT8A 4GIVA 2L0IA 3PZDA 4C02B 4RVBA 3CQCB 1FJDA 4CDRA 3NZSA 3AS0A 4ATZD 4GTOA 1BLXB 3BMBA 1TNOA 5J90A 2EIKE 1F8AB 2I1JA 4U95D 3IK8A 3RRNB 2ZR5A 2EIJE 3CKCA 1ELRA 1H0AA 5ENNA 4I17A 2F21A 4DPRA 1B89A 1KZOA 1HXIA 4C0EA 4ZPWR 4UI9C 1H2TC 3C3QA 3PNTB 2MOWA 3MYVA 4ANWA 4V3IA 1RZ4A 3ABME 3ZVVA 3QAQA 1DCQA 3PZ3A 4TV3A 4YVOA 4GTQA 4GMJA 1LG2A 2J4DA 3CK9A 3WXXA 3Q9NC 3CR3A 3OAWA 4U0ZA 3FUDA 1FPPA 1JNSA 2L9BA 2PNNA 4JFJA 4Q69A 1OCRE 2DSZA 2P9PG 4N19A 2FO7A 2ZGGA 1ZBWA 5CCLA 3PUJA 4ODKA 4KMOA 3PRZA 3LKUA 3ZN3A 3Q47B 1K8KG 1UJJA 4WNEA 3ZYQA 3GW4A 1UOHA 3ZW3A 1SR0A 1XRVA 4S3KA 3LY8A 5A7DB 3B13A 2GRPB 3ZRHA 2R17C 3L17A 4QQIA 2PN0A 4I6EA 3NQPA 3D9PA 4GB9A 1SQMA 2MNTA 3UM3A 3RM8A 3G6LA 3ABLE 3MCXA 1Q1CA 3AQUA 4ODLA 5AIJA 1U79A 2PPOA 3CHQA 3UF8A 4DRPA 2VSXE 4MNLA 4FLHA 3SBTB 3PEVB 1YATA 3DSUA 1GW6A 2B31A 3Q78A 3DEPA 3DSWA 4GTSA 4HI9A 4QFVA 4UWLA 3O5EA 4JVSA 4IT4A 2JZVA 5AQBA 4HVBA 4DZ3A 1XGWA 5G04C 3WL0A 4JB8P 3RO2A 3UINC 4GPMA 4U96D 1N94A 2IQCA 2VGYA 4JFMA 5AQ7A 3I4RB 4W9QA 1WB0A 3MJWA 1BPOA 1N4SA 4GTMA 1GRJA 1J4RA 4AJWA 1ZBPA 2VTBA 1KFWA 1ZB5A 2IOSA 3HG0D 3RAUA 2UZ5A 4ZS6A 2FKEA 3G6MA 2G8ZA 4J0UA 3UPVA 5BXJA 4OYSA 3CEQA 5KJMA 3FTSA 5M72A 1E6NA 3UM1A 2VCDA 5FT9A 2XPZA 4WWNA 3ARRA 4W9OA 2R5SA 5HKGA 3FY4A 4X8QA 2VN1A 4JZYA 3LDZA 4N5QA 2XZTG 1SW6A 4I6JA 3AS2A 4FHKA 3FUMA 4GZ3A 4UUCA 5EDSA 2MRIA 3FY1A 3IKOB 5CBNA 4I43A 4RG9A 2VYIA 5GQBA 2ILRA 2CFZA 5A6CA 3IBEA 1E8YA 3CHSA 1S0PA 2P9KG 2ZR4A 5AQ9A 4HS2A 3R7QA 1JNEA 3AG4E 4AOFA 2UY1A 4QIBA 1PAQA 3CHOA 3VAWA 4PDXA 1NWUA 4XX5A 2F37A 2AXZA 3OTNA 5EN5D 3EJNA 1LTXA 1HG5A 3FAPA 4UI9K 4B8CB 3UI4A 1ELWA 4GTRA 4NACA 4E85A 3ML8A 1UN9A 4G2PA 2R02A 4BTAA 4ZPTR 2R03A 3MX3A 4AY5A 1E44A 3DSTA 3UI5A 1FKRA 5CECB 3C3OA 4ANVA 1BL4A 2MHKA 2EIME 1O1RA 4R0XA 3ZYLA 4DJAA 3TWRA 4BX8A 1JCSA 4I9CA 2ZISA 4HRNA 3QK0A 4DX6D 5HQ8A 1RW2A 4NSBA 3E32A 4KZ0A
chains in the Genus database with same CATH topology
5FZRA 3S7FA 1J4IA 5J6EA 2OV8A 1XHGA 2FULA 3WD0A 5G55A 2WXOA 4FU3A 3OOBA 1HU3A 2ZQTA 4B0ZA 3WKZA 1M5YA 3DPDA 2GW1A 1LF8A 4HBEA 3ALFA 3IHVA 4P8XA 3CK7A 3BEEA 4R7LA 3CHEA 4ANXA 2PQRA 4K0RA 4ACLA 4MGVA 1WY6A 3KACA 1HKJA 3EY6A 4XZ4A 4LEUA 4CCAA 2CG3A 4J8DA 2RSEA 3ARYA 2J07A 3DBSA 5JHAA 5FQ6A 3B7RL 3QC1A 1HH8A 1XNFA 2QFCA 5HWBA 4MPKA 1E8ZA 4WNGA 4MRUA 4BFRA 2VGXB 3R9AB 3FH5A 1UJKA 4CGWA 3FDHA 3RMEA 3L08A 1W26A 2X38A 4W5UA 1K9TA 2DSWA 5HW8A 2M63A 2AW6A 5FQ7A 3SFZA 3U66A 3SBSA 4KYOB 3FH7A 1FFRA 1OGBA 4PS3A 3TDBA 3BXWA 2WXKA 2D9FA 2FDMA 4EZLA 2F4EA 1FKGA 4CEMA 1H2VC 2DT1A 2GRLA 3ZFWA 5C1DA 1L1PA 3NZUA 4MKTA 2VGXA 5FWQA 3IHYA 3FU6A 1EYHA 4G24A 4Z2JA 3FUHA 4ABNA 1QZ2A 4IT6A 2AXUA 4GU5A 1LL4A 4TYOA 2PV2A 4LRZA 2XP5A 3KCEA 2X6IA 5HW6A 2LAIA 3U9WA 3IKDA 4L2YA 1JWFA 4KZCA 2OLHA 1FKKA 2XPIA 3KEZA 1FAPA 4LAVA 3AS1A 5CHEE 4N2SA 2XPYA 4S3JA 4P8VA 5AYWD 2XQ0A 2RQSA 1E8XA 4AV7A 1EIBA 3MV3B 5G04J 1H2UA 1UN8A 3UT7A 4FHJA 3RM4A 2KCVA 1E15A 2PM6A 1W9VA 2OVBA 4HLEA 3CKBA 4DRIA 1JUQA 2YHEA 1HFAA 2XP6A 1Q6IA 2RG8A 3ENEA 3PRAA 1FKFA 3AS3A 4PTMA 4G23A 3CVUA 2PV1A 3O4ZA 5C2YA 3ZHEB 2PI6A 3TG5A 3FEYA 4L3NA 1LG1A 2DBAA 3QDNA 2WM9A 3WH0A 4N39A 4JHRA 4FAPA 3D9JA 1KLXA 4I1MA 4J8EA 1NA0A 4I2ZA 5G2NA 4WNDA 2ZU6B 4DWSB 4LERA 1HF8A 4IYPA 3U3WA 4DRMA 4QT3A 3ONLA 2DIWA 2XEVA 3I4GA 4ILGA 4J6IA 1D2KA 4IQCA 4WNFA 2KZTB 2GRMA 3TG4A 5DIUA 1ZBCA 4KXKB 3ZHEA 1FKDA 3PUKA 3TC5A 5J08A 3WQWA 3L22A 5AJDA 1FKSA 4R5EA 3I3NA 3CQGB 2DT3A 3FTYA 3B7XA 2LGOA 2WXFA 4Y6CA 3R7RA 3WQVA 2KM4A 3AU4A 3VLFA 3SNXA 1EDUA 2XPBA 4WWOA 2IF4A 2I2OA 1TJCA 1JNTA 1X6LA 4DWSA 2KC7A 4J8FA 3O5QA 1W9PA 2M08A 2WQ6A 1QPFA 4AM9A 2MPHA 2KI3A 3CVYA 4ODOA 4G11A 4AIFA 3FUEA 2YQ8A 1OWLA 3PDNA 1VF8A 4I9EA 5DIZA 4W9RA 4GCNA 1HZ4A 4A1GA 4TUUA 2DG4A 1Z6TA 1TCOC 2PPNA 3LY7A 2KGJA 4U04A 5JHBA 4WWPA 4XKBA 4HARA 1D7JA 3LCAA 2X6HA 2XP4A 4N2QA 2MLXA 4IRUA 4IULA 1R9HA 2XP9A 4MNKA 2WVIA 2F2DA 1JNDA 4DROA 4MNMA 3G2WA 1HJXA 1C9HA 1N52A 2XGOA 4B94A 1PBKA 4GYYA 4NURA 4HOUA 3KZ7A 1ELKA 5JH8A 1FFQA 4U84A 1TJFA 4U8HA 3WD1A 3HVEB 5JJTA 3ARSA 4M3OA 4JL0A 4AY6A 1EHNA 2AWIA 3RFWA 2KR7A 3ODKA 3CVXA 3O5JA 3MKRA 3CVNA 2IOLA 1E96B 3O48A 3QNKA 4FN2A 4HXIA 4Q22A 1QPLA 1H6KA 4A1SA 4N3CA 3TXMA 5DO2A 4UWFA 4TX0A 2PM7A 3ASDA 3U4TA 3W4RA 1EF1C 2CG2A 1WAWA 3O5MA 1NP7A 2WB2A 2M2AA 2WMNA 2ZQSA 5CMWA 4QZVB 4GMLA 4HOTA 4Q96A 2EQXA 3CHCA 1HG2A 1ITXA 1HS6A 3ASHA 4NRHB 4ODMA 4Z2HA 5I98A 3PREA 1VDYA 3S7JA 1FKBA 4HBOA 2DT0A 1HJWA 4KBQA 3GZ1A 4KVMA 3LY9A 3ZYKA 1T11A 2LPVA 1Z3YA 3FUNA 3B9DA 3CVQA 4EZJA 3ALGA 2ONDA 1P5QA 5FQ4A 4JYSA 2Y4TA 5HWCA 3FEXA 3WD2A 3B7SA 1B6CA 4ODRA 4HFGA 4GZ5A 4JEUA 2WXHA 4G1TA 1IQRA 4KQZA 4FJYA 2BF0X 3TL5A 4FJZA 3LS8A 4CT4A 2UWJG 3D3MA 4UQZA 1EPUA 1QQEA 5HT1A 5FZSA 3SF4A 4JA7A 4IN3B 5ANRA 3RO3A 1OWNA 2AWGA 2OOEA 4LAXA 1N54A 3LPZA 5DEZA 2RD0A 3FUIA 5JJ7A 2WXQA 3O5RA 2WMOA 5LX8A 1OUVA 4UWHA 2J4BA 5FTPA 4TW6A 4AVXA 3MV2B 3SZ7A 4TW8A 3S2AA 2Q5AA 4PH4B 2VSOE 4Z2KA 1IX5A 1ZK6A 4LUNU 3SHFA 3U64A 4B8AA 4L2LA 4BT9A 2X6JA 2XHEA 3ULQA 4UQXA 3JCKC 3CIAA 3PRBA 1FD9A 3O5IA 4Q94A 4UWGA 4EQFA 4GZCA 5HUAA 1Q6HA 3FTVA 3QARA 5DBKA 1A17A 3JUIA 3RIBA 5A23A 4APOA 3SD5A 2PV3A 1ZBVA 3MKQB 2AXVA 4BT8A 3AS4A 2M1IA 1U3CA 1W9UA 4N3AA 1TEZA 2XGSA 4H7YA 4ILIA 2FI7A 1EDQA 1Q6UA 4WKAA 2DG3A 1WM5A 4ODQA 3FTWA 3HHMA 3P2BA 3FHEA 1X6NA 3GZ2A 5HW7A 3MA5A 3D9NA 4AXHA 5CCMA 4DH0A 1PINA 3CZ8A 1E9LA 2HO1A 4J8SA 2NC9A 2A5UA 2P58C 4GYWA 1H0GA 4FULA 1IYGA 4EPZA 2VSYA 2ESCA 1PY1A 3ARVA 4OVUA 3Q5MA 2Y78A 5DF0A 5BW8C 4MLPA 3AU5A 1WAO1 5HBFA 2J08A 3PA7A 1HKIA 5T3RA 3PE4A 3MDYB 1MQSA 4BY6A 3UT4A 1ZU2A 3O5OA 3OXGA 3C98A 1HO8A 4W9PA 4DLQA 3O5LA 3MEKA 4F3VA 1W1YA 1Z3XA 3QOUA 1U3DA 2X3MA 1HKKA 3RGCA 2RUQA 4U86A 3APFA 2IJGX 4JFLA 2K8IA 2FBNA 3O5DA 1ROUA 5KJLA 3FFLA 1GUVA 4NNRA 2YINA 2LSVA 4P29A 2BUGA 2WXIA 1W3BA 2YHCA 5BT1A 4G25A 2WK2A 3CVLA 3FUJA 2KO7A 4A3VA 1X5BA 2CHZA 4I6GA 1W1PA 3CVPA 4U07A 1A7XA 3O5PA 3QJZA 4DIPA 1SZ9A 4DRNA 2YNQA 1JVWA 3ARZA 4APFA 3JQ1A 2DSUA 3QWPA 4WK9A 3LJ3A 2Y4UA 3BG1B 3FP3A 5CMYA 4PS8A 4PUCA 1HKMA 3L6AA 3TCZA 2MLYA 4JHJA 2NXPA 5BPPA 4URKA 4I2WA 2XCCA 2C0MA 2WXMA 3TXNA 4F53A 2WXLA 3O5KA 1LL6A 1ZBKA 4Z2IA 1QNFA 1NSGA 4EECA 4HORA 2CHWA 4C9BB 1L5JA 4CT0A 4L72B 2O9OA 2IUZA 3CHMA 1ZCNA 3LEWA 2WQHA 1YA0A 3KAIA 3Q49B 5E75A 4K03A 5D0QD 1D7IA 2QF8A 2YBUA 1SYTA 1UW4B 3WIJA 4XKCA 3KS2A 4HOQA 1DNPA 2G41A 2KFWA 3EHNA 1HX8A 3OXLA 3PEUB 1ZL1A 3B7UX 3OXFA 1NA3A 1ROTA 1OWMA 3EDTB 4NQ0A 3L13A 1OWPA 1LQ0A 3T5VA 4O2TA 4J4OA 3HYMB 5FJYA 4Z2LA 3LXUX 4TW7A 2ZR6A 2WXGA 4MNJA 4G26A 2BTDA 5AJLA 3ARQA 3UQIA 3KABA 4LCTA 3D9KA 4MS6A 4IPXA 2O92A 4GCOA 3NF1A 3CHFA 5ARGA 5EKQD 3UX4A 4XI0A 1E6ZA 2WXNA 3FH8A 1RD6A 3G2VA 2X6FA 2KZTA 3ZEFA 1FKLA 1F40A 3CGNA 4WUYA 3H9RB 4MAVA 4ITZA 1FKJA 2LSUA 4AY1A 4DK5A 3ONKA 3B8SA 3HDXA 1NWTA 2A3CA 2KATA 2HYZA 2WLYA 4GZ6A 2PQNA 3FWVA 3TGOA 5G05C 3IKGA 3N71A 3PH0C 4EZKA 2RUDA 2DG9A 4RG6A 1KT1A 4A3TA 4G50A 5T8IA 4DZ2A 4MTVA 3NI6A 3CHPA 3FTXA 3GZSA 4L7TA 1FKTA 2YBTA 3CLJA 5EX0A 3PRDA 3FTZA 3WD4A 4A55A 3ZIMA 2I9CA 4ACKA 4AEZC 2E2EA 4O6FA 5HTGA 1CTNA 1UR9A 1MHQA 3PS6A 4D10C 5LFAA 2WM0A 3RJVA 3ASGA 4JHKA 1J4HA 3P1UA 3O5GA 5FZQA 4N5CA 3IV0A 1OWQA 3UQBA 2KCLA 3LVQE 3JXVA 4HOSA 2VTBB 1E7UA 2XCBA 1FVFA 2XP8A 1J6YA 2XPAA 2J09A 1JPLA 1Y6IA 2VJ8A 3D9IA 3ESLA 4N3BA 2I6HA 3ZGQA 4FC8A 1GOIA 3CK8A 3IEGA 2PPPA 1HE8A 5KCMA 2C2LA 4Z2GA 3HVEA 4MSPA 4WKFA 2AVPA 4F1SA 4ODNA 4ILHB 5LCWC 3ARPA 5ARFA 3L16A 2DT2A 5HI7A 3UI6A 2V8SE 5T4YA 1W1TA 4CRWA 3RKVA 1FKHA 2L6JA 2R59A 3CSFA 2A4ZA 4JXTA 4CDMA 1NH6A 3EIJA 2UY1B 3ARXA 4LAYA 4GZDA 4GYOA 5GPGA 5FQ8A 1PC2A 1INZA 4BX9A 3CGHA 5KJKA 1SZAA 4DRJA 3PVLA 4JPSA 3VTYA 3FUKA 4C0MA 4B89A 4JW1A 3KAGA 3CH9A 2RURA 3APCA 3E4BA 3B9EA 4H7XA 3FTUA 5DITA 4JA9A 1WNOA 3CSTA 5BV0A 2FAPA 2N87A 2ITKA 2OFNA 4XAKA 3VLEA 4XI9A 5D0OD 2E0IA 3S7BA 4XE0A 4QT2A 2LNIA 4L23A 5LP0A 4DWSC 4FADA 3I5PA 3ARWA 3AROA 3PNLB 3WD3A 4I1AA 2IFUA 3LVRE 2JLBA 2A3EA 2HM8A 3QWVA 4WJXA 2GGFA 1UG3A 1NZNA 3NRKA 2KCKA 5EX3A 4CGVA 4KT6B 3S7DA 4XIFA 3RRMB 4L1BA 1TFVA 1DVPA 2AOSA 2XRYA 4ML4A 3ZYMA 3O5FA 4LGXA 4ZPVR 3UQ3A 4FLBA 1EQ3A 3Q15A 2X6KA 3APDA 2C0LA 4P8UA 4UQYA 3ZPJA 5BUZA 3T5XA 3QWWA 3ZXSA 1E6PA 1LJYA 1LL7A 3AS8A 2WLZA 3D9LA 5JJ6A 2A3AA 2Y3AA 1E90A 3LUOA 3CGMA 1E7VA 4YVQC 3CV0A 3MZLB 1JWGA 3RU0A 4U0UA 4U63A 3FU0A 4TNSA 5ANLA 1D7HA 3RM9A 4KVOA 4FP7A 4JFIA 1OGGA 2LJ4A 2OVFA 3JQ0A 3JYMA 3T8MA 4URIA 3VLDA 3AS5A 2NSZA 3L54A 2MF9A 4DRHA 2IONA 2IU1A 4G2VA 4E6HA 2DPEA 1NMVA 2PBCA 4GA1A 1Y8MA 4JEHA 4ANUA 1ZU8A 2ZQVA 2Q7FA 3EHMA 3FUFA 3MKQA 4DLOA 3ML9A 3ASFA 4U85A 3UUXA 5KJNA 4DWSD 3G2TA 3TAXA 3FU5A 4Q7NA 4EBAG 4UI9J 3QB2A 1H0IA 2ZQUA 3FXYA 4GA2A 3D9MA 3UQAA 4P8WA 1E8WA 5G05J 5BNWA 3JYJA 3SI5A 4BWRA 3JYSA 5AENA 3FULA 3D9OA 4DT4A 4AP2A 3URZA 2XP7A 1KT0A 2VQ2A 4GPKA 1N1AA 1FKIA 3KADA 4DI3A 3HIZA 3KAHA 3KAEA 3RK6A 4LAWA 3G2SA 4GGQA 1D6OA 1GPFA 1HJVA 3G2UA 5B8IC 2V4LA 5BV1A 4UWKA 3KD7A 3LYAA 2RUCA 2V0PA 3QOKA 3TJPA 2WXPA 3PR9A 1BKFA 4GA0A 5D75A 1FVHA 2KE0A 3K9IA 4DI4A 1UR8A 4JC8A 2J49A 4NZCA 4J4NA 4KR0B 5E76A 4ATGA 4EBAA 2XP3A 2QY7A 5DIVA 4OVVA 5GPRA 2LAHA 4FA6A 2DCPA 3RRUA 4TRQA 2VSNA 2WXJA 2I1KA 3KAFA 1FCHA 3CVWA 2WPVA 5LCWJ 2PZIA 2CFUA 1EYMA 2LKNA 1H19A 1E6RA 3UMVA 2WQ7A 4BSXA 2FF4A 2JEKA 5LOZA 4BTBA 1Y0OA 3ARTA 2LO6A 3B7TA 1NMWA 3IHZA 3QKYA 2XRZA 4DRKA 4IQ2A 4WAFA 2HR2A 3VTXA 3CHDA 1IHGA 4PS7A 3GPKA 3I6CA 2WXRA 2V5FA 3Q4AB 1YW5A 4BF8A 4CDNA 4U0SA 4JFKA 1HXVA 2FEZA 2PL2A 3CVVA 4YNDA 4F7AA 3BG0B 3PE3A 4ME2A 3MGBA 1IQUA 2A3BA 2MLZA 3ESKA 4RSYA 1NWSA 4WIWA 3SGHA 2L2SA 2J9QA 3EIQC 3CHRA 4WKHA 1OWOA 3FU3A 3WL1A 2L0TB 4I1OB 2CHXA 4GAAA 4ODPA 3NTPA 1O6IA 1NWRA 3GYZA 3OA5A 4Y6WA 2XGMA 3ARUA 3B9AA 2DSVA 1W1VA 3UT8A 4GIVA 2L0IA 3PZDA 4C02B 4RVBA 3CQCB 1FJDA 4CDRA 3NZSA 3AS0A 5J90A 1F8AB 2I1JA 3IK8A 3RRNB 2ZR5A 3CKCA 1ELRA 1H0AA 5ENNA 4I17A 2F21A 4DPRA 1B89A 1HXIA 4C0EA 4ZPWR 4UI9C 1H2TC 3PNTB 2MOWA 3MYVA 4ANWA 4V3IA 3ZVVA 3QAQA 4YVOA 4TV3A 4GMJA 1LG2A 2J4DA 3CK9A 3WXXA 3CR3A 3OAWA 4U0ZA 3FUDA 1JNSA 2L9BA 4JFJA 4Q69A 2DSZA 4N19A 2FO7A 1ZBWA 5CCLA 3PUJA 4ODKA 4KMOA 3PRZA 3LKUA 3ZN3A 3Q47B 1UJJA 4WNEA 3ZYQA 3GW4A 3ZW3A 1SR0A 1XRVA 4S3KA 3LY8A 5A7DB 3B13A 3ZRHA 2R17C 3L17A 4I6EA 3NQPA 3D9PA 4GB9A 1SQMA 2MNTA 3RM8A 3G6LA 3MCXA 1Q1CA 3AQUA 4ODLA 5AIJA 1U79A 2PPOA 3CHQA 3UF8A 4DRPA 2VSXE 4MNLA 4FLHA 3SBTB 3PEVB 1YATA 1GW6A 2B31A 4UWLA 4QFVA 3O5EA 4JVSA 4IT4A 2JZVA 4HVBA 4DZ3A 1XGWA 5G04C 3WL0A 3RO2A 2IQCA 2VGYA 4JFMA 3I4RB 4W9QA 1WB0A 3MJWA 1BPOA 1J4RA 4AJWA 1ZBPA 2VTBA 1KFWA 1ZB5A 2IOSA 2UZ5A 4ZS6A 2FKEA 3G6MA 2G8ZA 4J0UA 3UPVA 5BXJA 4OYSA 3CEQA 5KJMA 3FTSA 5M72A 1E6NA 2VCDA 5FT9A 2XPZA 4WWNA 3ARRA 4W9OA 2R5SA 5HKGA 3FY4A 2VN1A 4JZYA 3LDZA 4I6JA 3AS2A 4FHKA 3FUMA 4GZ3A 5EDSA 2MRIA 3FY1A 3IKOB 4I43A 4RG9A 2VYIA 5GQBA 2ILRA 2CFZA 5A6CA 3IBEA 1E8YA 3CHSA 1S0PA 2ZR4A 4HS2A 3R7QA 1JNEA 4AOFA 2UY1A 4QIBA 1PAQA 3CHOA 3VAWA 4PDXA 1NWUA 4XX5A 2AXZA 3OTNA 3EJNA 1HG5A 3FAPA 4UI9K 4B8CB 3UI4A 1ELWA 4NACA 4E85A 3ML8A 1UN9A 4G2PA 4BTAA 4ZPTR 3MX3A 4AY5A 3UI5A 1FKRA 4ANVA 1BL4A 2MHKA 4R0XA 3ZYLA 4DJAA 4BX8A 4I9CA 3QK0A 5HQ8A 4NSBA 4DRQA 4KZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LAW A;  4O2T A;  5FZR A;  3S7F A;  3ASD A;  1J4I A;  4GGQ A;  3U4T A;  1D6O A;  5J6E A;  4J4O A;  3HYM B;  5FJY A;  4TW7 A;  5B8I C;  2ZR6 A;  4G26 A;  3O5M A;  3UQI A;  3KD7 A;  3LYA A;  3KAB A;  2RUC A;  4IPX A;  2M2A A;  4GCO A;  3OOB A;  3NF1 A;  2ZQS A;  2ZQT A;  5ARG A;  5EKQ D;  4HOT A;  4XI0 A;  1M5Y A;  2GW1 A;  1BKF A;  4GA0 A;  5D75 A;  2KE0 A;  3K9I A;  4J4N A;  3ASH A;  4NRH B;  1FKL A;  1F40 A;  2XP3 A;  3CGN A;  4ODM A;  4WUY A;  3H9R B;  3CK7 A;  4ITZ A;  1FKJ A;  2LSU A;  3BEE A;  5DIV A;  5I98 A;  3S7J A;  2PQR A;  4MGV A;  1FKB A;  2VSN A;  3KAC A;  3KAF A;  1FCH A;  2KAT A;  3EY6 A;  4LEU A;  2HYZ A;  4GZ6 A;  4KBQ A;  4J8D A;  2RSE A;  2PQN A;  3FWV A;  2WPV A;  5LCW J;  3TGO A;  2PZI A;  5G05 C;  3GZ1 A;  1EYM A;  3LY9 A;  2LKN A;  3IKG A;  1HH8 A;  1XNF A;  3N71 A;  2FF4 A;  2QFC A;  2RUD A;  5HWB A;  4RG6 A;  1T11 A;  2DG9 A;  4BTB A;  1KT1 A;  1Y0O A;  2LPV A;  4WNG A;  1NMW A;  4G50 A;  3CVQ A;  2OND A;  1P5Q A;  3IHZ A;  4DZ2 A;  3QKY A;  2VGX B;  3R9A B;  4CGW A;  3NI6 A;  4JYS A;  2Y4T A;  4DRK A;  1W26 A;  1FKT A;  5HWC A;  5EX0 A;  3PRD A;  4IQ2 A;  3VTX A;  2HR2 A;  5HW8 A;  1IHG A;  3GPK A;  3I6C A;  2E2E A;  2V5F A;  1B6C A;  4O6F A;  5HTG A;  3Q4A B;  1YW5 A;  3RJV A;  3ASG A;  4ODR A;  4GZ5 A;  4G1T A;  4KYO B;  1J4H A;  4BF8 A;  4U0S A;  4JFK A;  1HXV A;  3O5G A;  2FEZ A;  2PL2 A;  2UWJ G;  4N5C A;  5FZQ A;  4UQZ A;  1QQE A;  5HT1 A;  5FZS A;  3UQB A;  3TDB A;  2KCL A;  3SF4 A;  4JA7 A;  4IN3 B;  2D9F A;  3JXV A;  4YND A;  3RO3 A;  4HOS A;  1FKG A;  2F4E A;  2AWG A;  2OOE A;  3PE3 A;  2XCB A;  3LPZ A;  4ME2 A;  4LAX A;  2MLZ A;  3ZFW A;  5C1D A;  2XP8 A;  1J6Y A;  3ESK A;  2XPA A;  1L1P A;  2VGX A;  4N3B A;  5JJ7 A;  2I6H A;  3ZGQ A;  2L2S A;  3O5R A;  2J9Q A;  4G24 A;  4ABN A;  1QZ2 A;  3CK8 A;  1OUV A;  3IEG A;  5FTP A;  2PPP A;  4TW6 A;  4TYO A;  2C2L A;  3MV2 B;  3SZ7 A;  4ODP A;  3NTP A;  2PV2 A;  4TW8 A;  3GYZ A;  4MSP A;  2XP5 A;  3KCE A;  4Y6W A;  2XGM A;  2AVP A;  2Q5A A;  5HW6 A;  4ODN A;  3IKD A;  1ZK6 A;  5LCW C;  4BT9 A;  4GIV A;  4C02 B;  5ARF A;  1FKK A;  3ULQ A;  4UQX A;  1FJD A;  4CDR A;  3PRB A;  3UI6 A;  5HI7 A;  2XPI A;  1FD9 A;  1FAP A;  3RKV A;  3O5I A;  1F8A B;  3IK8 A;  1FKH A;  4LAV A;  2ZR5 A;  2L6J A;  5CHE E;  4N2S A;  3CKC A;  4EQF A;  1ELR A;  5HUA A;  5AYW D;  2RQS A;  1Q6H A;  4I17 A;  5DBK A;  1A17 A;  2F21 A;  3RIB A;  1B89 A;  4APO A;  2PV3 A;  1HXI A;  2UY1 B;  3MV3 B;  4LAY A;  4BT8 A;  4UI9 C;  5G04 J;  3AS4 A;  2M1I A;  4N3A A;  4GYO A;  5GPG A;  2XGS A;  4H7Y A;  2FI7 A;  2KCV A;  1Q6U A;  4YVO A;  1PC2 A;  2DG3 A;  1WM5 A;  3CKB A;  5KJK A;  4ODQ A;  3CK9 A;  4DRI A;  3WXX A;  4DRJ A;  3VTY A;  3GZ2 A;  5HW7 A;  4U0Z A;  3KAG A;  3MA5 A;  1JNS A;  2XP6 A;  2RUR A;  1Q6I A;  4JFJ A;  5CCM A;  4DH0 A;  4N19 A;  3E4B A;  2FO7 A;  1PIN A;  4H7X A;  2HO1 A;  5DIT A;  1FKF A;  5CCL A;  2NC9 A;  4JA9 A;  2P58 C;  4GYW A;  4G23 A;  2PV1 A;  4ODK A;  1IYG A;  3ZHE B;  2FAP A;  3LKU A;  3ZN3 A;  2N87 A;  2VSY A;  3Q47 B;  3TG5 A;  2ITK A;  4WNE A;  3GW4 A;  3LY8 A;  2OFN A;  5A7D B;  4XI9 A;  3Q5M A;  2DBA A;  5D0O D;  3S7B A;  2Y78 A;  3QDN A;  4QT2 A;  2LNI A;  3WH0 A;  4N39 A;  5BW8 C;  4JHR A;  2MNT A;  4FAP A;  1KLX A;  4I1A A;  2IFU A;  4J8E A;  2JLB A;  1Q1C A;  4ODL A;  1NA0 A;  1WAO 1;  3QWV A;  4I2Z A;  3PA7 A;  4WND A;  1U79 A;  2PPO A;  1NZN A;  3NRK A;  3PE4 A;  2KCK A;  3MDY B;  3UF8 A;  5EX3 A;  3U3W A;  4CGV A;  4DRM A;  4QT3 A;  4DRP A;  3S7D A;  2XEV A;  4XIF A;  1YAT A;  1ZU2 A;  3O5O A;  3OXG A;  3O5F A;  4IQC A;  4WNF A;  3O5E A;  4W9P A;  3TG4 A;  3O5L A;  2JZV A;  3MEK A;  3UQ3 A;  5DIU A;  4KXK B;  3ZHE A;  4DZ3 A;  1FKD A;  4F3V A;  1EQ3 A;  3TC5 A;  3Q15 A;  5G04 C;  1FKS A;  3QOU A;  2C0L A;  4UQY A;  3RO2 A;  3ZPJ A;  3RGC A;  2RUQ A;  4U86 A;  2VGY A;  3QWW A;  4JFM A;  3B7X A;  2LGO A;  4JFL A;  3AS8 A;  4Y6C A;  2K8I A;  4W9Q A;  2FBN A;  3O5D A;  1ROU A;  5KJL A;  5JJ6 A;  1J4R A;  3FFL A;  2XPB A;  1ZBP A;  2IF4 A;  4NNR A;  2LSV A;  1TJC A;  3LUO A;  3CGM A;  2BUG A;  1JNT A;  2UZ5 A;  1W3B A;  4YVQ C;  2FKE A;  2YHC A;  5BT1 A;  2KC7 A;  4J8F A;  3O5Q A;  3CV0 A;  4J0U A;  3UPV A;  4G25 A;  2M08 A;  3CVL A;  5BXJ A;  1QPF A;  4AM9 A;  2MPH A;  2KI3 A;  3RU0 A;  2KO7 A;  4U0U A;  4ODO A;  4TNS A;  3CEQ A;  5KJM A;  1D7H A;  4AIF A;  2YQ8 A;  5M72 A;  3PDN A;  4I9E A;  5DIZ A;  4JFI A;  3CVP A;  4U07 A;  4W9R A;  1A7X A;  2LJ4 A;  5FT9 A;  2VCD A;  4W9O A;  5HKG A;  2R5S A;  2VN1 A;  3O5P A;  3JYM A;  4GCN A;  1HZ4 A;  4DIP A;  3AS5 A;  2DG4 A;  4DRN A;  1TCO C;  4GZ3 A;  1JVW A;  2MF9 A;  4DRH A;  2PPN A;  3LY7 A;  2KGJ A;  4U04 A;  4RG9 A;  3QWP A;  4G2V A;  2Y4U A;  2VYI A;  3FP3 A;  1D7J A;  5A6C A;  1NMV A;  2PBC A;  3LCA A;  4GA1 A;  3TCZ A;  2MLY A;  4N2Q A;  2XP4 A;  2ZR4 A;  2MLX A;  1Y8M A;  1R9H A;  2XP9 A;  4I2W A;  2XCC A;  2F2D A;  2C0M A;  2ZQV A;  4DRO A;  4QIB A;  2UY1 A;  2Q7F A;  3VAW A;  1C9H A;  2XGO A;  4B94 A;  3ASF A;  3O5K A;  1PBK A;  4GYY A;  4U85 A;  4HOU A;  3UUX A;  5KJN A;  3KZ7 A;  4U84 A;  3FAP A;  3TAX A;  5JJT A;  4UI9 K;  1NSG A;  4UI9 J;  2ZQU A;  4HOR A;  3UI4 A;  1ELW A;  4GA2 A;  3UQA A;  4JL0 A;  5G05 J;  4AY6 A;  5BNW A;  4G2P A;  4BTA A;  1ZCN A;  3JYJ A;  2WQH A;  4AY5 A;  4BWR A;  1YA0 A;  3JYS A;  3KAI A;  3Q49 B;  3RFW A;  2KR7 A;  3ODK A;  5D0Q D;  3UI5 A;  1D7I A;  1FKR A;  4DT4 A;  3O5J A;  3KS2 A;  3MKR A;  3CVN A;  1BL4 A;  2MHK A;  4HOQ A;  3URZ A;  1E96 B;  3O48 A;  4FN2 A;  4R0X A;  2XP7 A;  2KFW A;  3OXL A;  4I9C A;  1KT0 A;  2VQ2 A;  1QPL A;  3OXF A;  1NA3 A;  4A1S A;  4GPK A;  1FKI A;  1N1A A;  1ROT A;  3EDT B;  4NQ0 A;  4N3C A;  3KAD A;  5HQ8 A;  4TX0 A;  3KAH A;  4DRQ A;  3KAE A; 
#chains in the Genus database with same CATH topology
 5CRU A;  5FZR A;  3S7F A;  1J4I A;  5J6E A;  2OV8 A;  1XHG A;  2FUL A;  1N0Q A;  3WD0 A;  2XEN A;  5G55 A;  2WXO A;  4FU3 A;  3OOB A;  1HU3 A;  2ZQT A;  4B0Z A;  3WKZ A;  1M5Y A;  3DPD A;  2GW1 A;  1LF8 A;  4G8K A;  4HBE A;  3ALF A;  3IHV A;  4HRM B;  3Q9U C;  4P8X A;  1V54 E;  5ENO D;  3CK7 A;  3BEE A;  4R7L A;  3CHE A;  1OT8 A;  2H6I A;  4ANX A;  2PQR A;  4K0R A;  4ACL A;  4MGV A;  1WY6 A;  3KAC A;  1HKJ A;  2Y69 E;  3UTM A;  3EY6 A;  4XZ4 A;  4LEU A;  4CCA A;  3EHQ A;  2CG3 A;  4J8D A;  2RSE A;  3ARY A;  2J07 A;  3DBS A;  5JHA A;  5FQ6 A;  3B7R L;  3QC1 A;  1HH8 A;  1XNF A;  3DRA A;  4DX1 A;  2QFC A;  5HWB A;  4MPK A;  1E8Z A;  4WNG A;  1QBQ A;  1K3Z D;  4MRU A;  4BFR A;  3Q73 A;  2VGX B;  3R9A B;  3FH5 A;  1UJK A;  4CGW A;  3FDH A;  3RME A;  1BU9 A;  1DCE A;  3L08 A;  1W26 A;  2X38 A;  4W5U A;  1K9T A;  2DSW A;  5HW8 A;  2M63 A;  2AW6 A;  5FQ7 A;  3HXE A;  3SFZ A;  3U66 A;  3SBS A;  4KYO B;  3FH7 A;  4HNA D;  1FFR A;  1OGB A;  4DRX E;  4DRQ A;  1FT1 A;  5AAR A;  3ASO E;  1OY3 D;  4PS3 A;  3TDB A;  3BXW A;  2WXK A;  4DX5 D;  2D9F A;  2FDM A;  4O60 A;  4EZL A;  2F4E A;  1FKG A;  4CEM A;  1H2V C;  2DT1 A;  2GRL A;  3ZFW A;  2GRR B;  1Q2Z A;  5C1D A;  1L1P A;  3NZU A;  4MKT A;  2VGX A;  5FWQ A;  3UXG A;  3IHY A;  3FU6 A;  1NL4 A;  1LD8 A;  3ZKJ A;  1EYH A;  4G24 A;  4Z2J A;  3FUH A;  4ABN A;  1QZ2 A;  4IT6 A;  2AXU A;  4GU5 A;  1LL4 A;  4TYO A;  1TN8 A;  2PV2 A;  1BI8 B;  4LRZ A;  2XP5 A;  3KCE A;  2X6I A;  4GTT A;  5HW6 A;  2LAI A;  3U9W A;  3IKD A;  4L2Y A;  1JWF A;  4KZC A;  2OLH A;  1FKK A;  2IY0 C;  4G8L A;  2XPI A;  3KEZ A;  1FAP A;  2P9U G;  4LAV A;  3AS1 A;  5CHE E;  4N2S A;  1TYQ G;  2XPY A;  4LG6 A;  4S3J A;  2F8Y A;  3GTY X;  4P8V A;  5AYW D;  2XQ0 A;  2XZD G;  2RQS A;  5JMN D;  1E8X A;  1N4P A;  4AV7 A;  1EIB A;  3IXE A;  3MV3 B;  1SVX A;  5G04 J;  3PZ4 A;  1H2U A;  3ISM C;  1UN8 A;  3UT7 A;  2QZA A;  4FHJ A;  3RM4 A;  4U8Y D;  2KCV A;  1E15 A;  2PM6 A;  1W9V A;  2R05 A;  2OVB A;  4HLE A;  3CKB A;  4DRI A;  3AG2 E;  1JUQ A;  2YHE A;  1HFA A;  2XP6 A;  1Q6I A;  2RG8 A;  3ENE A;  2NYJ A;  3PRA A;  1FKF A;  4K5A B;  3AS3 A;  4PTM A;  4G23 A;  3CVU A;  2PV1 A;  3O4Z A;  2IO3 C;  5C2Y A;  3ZHE B;  2PI6 A;  3TG5 A;  1TNB A;  1S64 A;  3FEY A;  2P9S G;  4L3N A;  2LXL A;  1LG1 A;  2DBA A;  3QDN A;  2WM9 A;  3WH0 A;  4N39 A;  4JHR A;  2QYU A;  4FAP A;  4LSZ E;  3D9J A;  1KLX A;  4I1M A;  5CER B;  4J8E A;  1NA0 A;  4I2Z A;  5G2N A;  4WND A;  2ZU6 B;  4DWS B;  4LER A;  1HF8 A;  4IYP A;  3U3W A;  5FIN A;  4DRM A;  4QT3 A;  3ONL A;  2DIW A;  2XEV A;  2RFA A;  3I4G A;  4U8V D;  5IY5 E;  4ILG A;  4J6I A;  1D2K A;  4IQC A;  4WNF A;  2KZT B;  2GRM A;  3TG4 A;  5AQA A;  2EUL A;  5DIU A;  1ZBC A;  4KXK B;  3ZHE A;  1FKD A;  5ENT D;  3PUK A;  3V79 K;  5J08 A;  1MX2 A;  3L22 A;  3TC5 A;  5AJD A;  3WQW A;  1FKS A;  5BXU A;  2LXM A;  4R5E A;  3I3N A;  3CQG B;  2DT3 A;  3FTY A;  3B7X A;  3NB2 A;  2LGO A;  2WXF A;  4Y6C A;  3R7R A;  3WQV A;  2KM4 A;  3AU4 A;  3VLF A;  3SNX A;  3HXD A;  1EDU A;  2XPB A;  4WWO A;  2IF4 A;  2I2O A;  1TJC A;  1JNT A;  1X6L A;  1TN7 A;  4DWS A;  2KC7 A;  4J8F A;  3O5Q A;  1W9P A;  2M08 A;  3C72 A;  2WQ6 A;  1QPF A;  4AM9 A;  2MPH A;  2KI3 A;  5AAO A;  3CVY A;  2F23 A;  4ODO A;  1N4Q A;  4G11 A;  4AIF A;  3FUE A;  3R9M A;  2YQ8 A;  1OWL A;  3PDN A;  1VF8 A;  4I9E A;  5DIZ A;  4W9R A;  4GCN A;  4UDM A;  1HZ4 A;  4F1P A;  4A1G A;  2V5Q C;  3JUE A;  4TUU A;  5KBA A;  2DG4 A;  3Q7F A;  3C3R A;  1Z6T A;  1TCO C;  4YDW A;  4C48 B;  2PPN A;  3LY7 A;  2KGJ A;  4U04 A;  3ASN E;  5JHB A;  4WWP A;  1ZB1 A;  1FT2 A;  4XKB A;  4HAR A;  3EU9 A;  1D7J A;  3LCA A;  2X6H A;  2HE0 A;  2XP4 A;  4N2Q A;  2MLX A;  4IRU A;  5CEA A;  2BED A;  4IUL A;  1R9H A;  2XP9 A;  4K5C A;  4MNK A;  4Z68 A;  2WVI A;  2F2D A;  1JND A;  4DRO A;  4MNM A;  3G2W A;  1HJX A;  1C9H A;  3NOC D;  1N52 A;  2XGO A;  4B94 A;  1PBK A;  4GYY A;  4NUR A;  4HOU A;  3KZ7 A;  1ELK A;  5JH8 A;  1FFQ A;  4U84 A;  1TJF A;  4U8H A;  3WD1 A;  3HVE B;  5JJT A;  3ARS A;  1O5M A;  4M3O A;  4JL0 A;  4AY6 A;  1EHN A;  2AWI A;  2RKK A;  3RFW A;  2KR7 A;  3ODK A;  3CVX A;  3O5J A;  3MKR A;  3CVN A;  2IOL A;  2P9N G;  1E96 B;  4YDO A;  3O48 A;  3QNK A;  4O1P A;  4FN2 A;  4HXI A;  4Q22 A;  1QPL A;  1H6K A;  4A1S A;  3TXM A;  3AAA C;  4N3C A;  5DO2 A;  4UWF A;  4TXR A;  4TX0 A;  1O1S A;  2V4H C;  2PM7 A;  3ASD A;  2EIL E;  3U4T A;  3W4R A;  1EF1 C;  2QC9 A;  2CG2 A;  1WAW A;  3ZXP A;  3O5M A;  1NP7 A;  2WB2 A;  2M2A A;  2WMN A;  3PZ1 A;  2ZQS A;  5CMW A;  4QZV B;  4GML A;  4DUI A;  4HOT A;  4Q96 A;  2EQX A;  3CHC A;  1HG2 A;  1ITX A;  1S70 B;  1HS6 A;  3ASH A;  4NRH B;  4ODM A;  4Z2H A;  5I98 A;  4ZHB A;  3PRE A;  1VDY A;  3S7J A;  1FKB A;  3V2X A;  4HBO A;  2DT0 A;  1HJW A;  4KBQ A;  3TWS A;  3GZ1 A;  4J8Y A;  3LY9 A;  4KVM A;  3UKU G;  3UIP C;  3ZYK A;  1T11 A;  2LPV A;  1Z3Y A;  3FUN A;  3B9D A;  3CVQ A;  4EZJ A;  3ALG A;  2OND A;  1P5Q A;  1MZC A;  5FQ4 A;  4BET A;  4JYS A;  2Y4T A;  5HWC A;  3FEX A;  3WD2 A;  3B7S A;  1B6C A;  4GTP A;  4YDY A;  4HFG A;  4GZ5 A;  4ODR A;  3SY2 A;  4JEU A;  2WXH A;  4G1T A;  1IQR A;  3E34 A;  4KQZ A;  3DXK G;  4FJY A;  2BF0 X;  3C5R A;  1BI7 B;  3TL5 A;  4FJZ A;  2P9L G;  3LS8 A;  4CT4 A;  2UWJ G;  3D3M A;  4UQZ A;  1EPU A;  1QQE A;  5HT1 A;  5FZS A;  3SF4 A;  4JA7 A;  4IN3 B;  5ANR A;  3RO3 A;  1OWN A;  1QYM A;  2AWG A;  3RSE G;  2OOE A;  1N54 A;  3LPZ A;  4LAX A;  5DEZ A;  1N95 A;  2RD0 A;  2DZN A;  3FUI A;  5JJ7 A;  2WXQ A;  3O5R A;  2WMO A;  5LX8 A;  1OUV A;  4UWH A;  2J4B A;  5FTP A;  3WG7 E;  4TW6 A;  4AVX A;  3MV2 B;  2KXP C;  3SZ7 A;  4TW8 A;  3S2A A;  2Q5A A;  2DVW A;  4PH4 B;  2VSO E;  4Z2K A;  1IX5 A;  1ZK6 A;  4LUN U;  3SHF A;  3U64 A;  4B8A A;  4L2L A;  4BT9 A;  2ZGD A;  2X6J A;  3ULE G;  2XHE A;  3ULQ A;  4UQX A;  2VGE A;  3JCK C;  3HXC A;  5CBO A;  3CIA A;  3PRB A;  1FD9 A;  2BKK B;  1H6O A;  3O5I A;  2J8S D;  4Q94 A;  4UWG A;  4B93 B;  3ZUV B;  4EQF A;  5D2M C;  4GZC A;  4K5B A;  5HUA A;  1Q6H A;  3FTV A;  3QAR A;  5DBK A;  1A17 A;  3JUI A;  1YCS B;  3RIB A;  5A23 A;  4APO A;  3SD5 A;  2PV3 A;  4OAU C;  1DC2 A;  1ZBV A;  3MKQ B;  2AXV A;  4BT8 A;  3AS4 A;  2M1I A;  1U3C A;  1W9U A;  4N3A A;  2XEE A;  3TWW A;  1KPS B;  1TEZ A;  2XGS A;  4H7Y A;  4ILI A;  2FI7 A;  3T9K A;  1EDQ A;  1Q6U A;  4WKA A;  2DG3 A;  1WM5 A;  4ODQ A;  3FTW A;  3HHM A;  3P2B A;  3V31 A;  3FHE A;  1X6N A;  3GZ2 A;  3TWV A;  5HW7 A;  3MA5 A;  3D9N A;  4AXH A;  5CCM A;  4DH0 A;  1PIN A;  3CZ8 A;  1E9L A;  2HO1 A;  4J8S A;  2NC9 A;  5KWD A;  2A5U A;  2P58 C;  4GYW A;  3NBN B;  1H0G A;  4FUL A;  1IYG A;  1IKN D;  4EPZ A;  2VSY A;  2ESC A;  1PY1 A;  3ARV A;  4TUM A;  4OVU A;  3Q5M A;  4CYM D;  2Y78 A;  5EIB E;  5DF0 A;  3UM2 A;  5BW8 C;  4MLP A;  3AU5 A;  3BUA A;  2DYS E;  1WAO 1;  4GMR A;  5EYP F;  5HBF A;  2J08 A;  3PA7 A;  1HKI A;  5T3R A;  3PE4 A;  3MDY B;  1MQS A;  2F0Y A;  4BY6 A;  4HLL A;  3DSX A;  3UT4 A;  1ZU2 A;  3O5O A;  5ENS D;  3C98 A;  3OXG A;  1HO8 A;  4W9P A;  4DLQ A;  3O5L A;  3MEK A;  4F3V A;  1W1Y A;  1Z3X A;  3QOU A;  1U3D A;  2X3M A;  1HKK A;  2GRQ B;  3EHR A;  3NOG D;  3RGC A;  2RUQ A;  4U86 A;  4NIK A;  3APF A;  2IJG X;  3GU0 A;  4JFL A;  2XS8 A;  2K8I A;  2FBN A;  3O5D A;  1ROU A;  1AWC B;  5KJL A;  3FFL A;  3JXJ A;  1GUV A;  4NNR A;  2YIN A;  2LSV A;  1D9S A;  4P29 A;  2BUG A;  2WXI A;  1W3B A;  2YHC A;  1LD7 A;  5BT1 A;  3KSQ A;  3EU5 A;  4G25 A;  2WK2 A;  3CVL A;  3FUJ A;  2KO7 A;  4M7C A;  4A3V A;  1IXV A;  1X5B A;  2CHZ A;  2P9I G;  4I6G A;  1W1P A;  2EIN E;  3CVP A;  4BEP A;  4U07 A;  1A7X A;  3O5P A;  3QJZ A;  3SFY A;  4DIP A;  1SZ9 A;  3T8K A;  4DRN A;  2YNQ A;  3DSV A;  3AG3 E;  1JVW A;  2H6H A;  1YMP A;  3ARZ A;  4APF A;  3JQ1 A;  2DSU A;  3QWP A;  4WK9 A;  3LJ3 A;  2ETN A;  3EUV A;  2Y4U A;  3BG1 B;  3DEO A;  3FP3 A;  5CMY A;  4PS8 A;  4PUC A;  4BSZ B;  1HKM A;  3L6A A;  3TWQ A;  3TCZ A;  2ETC A;  2MLY A;  4JHJ A;  2NXP A;  1D8E A;  3Q75 A;  5BPP A;  4URK A;  4I2W A;  4L9P A;  2XCC A;  4RLY A;  2C0M A;  1JCQ A;  2WXM A;  3TXN A;  4F53 A;  2WXL A;  4HB5 A;  3Q79 A;  1G3N B;  3O5K A;  1LL6 A;  1ZBK A;  4Z2I A;  2P4V A;  1QNF A;  3W9F A;  4EEC A;  1NSG A;  4HOR A;  2CHW A;  4C9B B;  1L5J A;  4CT0 A;  4L72 B;  2O9O A;  2IUZ A;  4RQI A;  3CHM A;  4TXP A;  4O1O A;  1ZCN A;  3LEW A;  2WQH A;  2XS1 A;  1YA0 A;  1TR4 A;  3KAI A;  3Q49 B;  5E75 A;  4K03 A;  5D0Q D;  1MX6 A;  3L82 A;  1D7I A;  2QF8 A;  2YBU A;  1SYT A;  1UW4 B;  3WIJ A;  1K1A A;  4XKC A;  3KS2 A;  4HOQ A;  1DNP A;  2OCC E;  2G41 A;  2OEW A;  2KFW A;  3EHN A;  1HX8 A;  3OXL A;  1OCC E;  5HS0 A;  3PEU B;  1ZL1 A;  3B7U X;  3OXF A;  1NA3 A;  1OWM A;  3EDT B;  4NQ0 A;  3L13 A;  1ROT A;  3KEA A;  1OWP A;  1LQ0 A;  3T5V A;  4O2T A;  3X2Q E;  2LUH A;  4J4O A;  3HYM B;  5FJY A;  4Z2L A;  3LXU X;  4TW7 A;  2ZR6 A;  2WXG A;  4MNJ A;  2ETB A;  4G26 A;  2BTD A;  5AJL A;  3ARQ A;  3UQI A;  3KAB A;  4LCT A;  3D9K A;  4MS6 A;  4IPX A;  2O92 A;  4GCO A;  3NF1 A;  5D66 A;  3CHF A;  5ARG A;  5EKQ D;  3E30 A;  3UX4 A;  4XI0 A;  1E6Z A;  2WXN A;  2QYJ A;  3FH8 A;  1RD6 A;  4LNB A;  3G2V A;  2X6F A;  2KZT A;  3ZEF A;  1FKL A;  1F40 A;  3CGN A;  4WUY A;  3H9R B;  4MAV A;  4ITZ A;  1FKJ A;  2LSU A;  4AY1 A;  4DK5 A;  1BD8 A;  3ONK A;  5ENR D;  3B8S A;  3HDX A;  1NWT A;  5ITZ F;  2A3C A;  2KAT A;  2HYZ A;  2WLY A;  4GZ6 A;  3B95 A;  3BQO A;  2PQN A;  1OCO E;  3FWV A;  3TGO A;  5G05 C;  3IKG A;  3N71 A;  3PH0 C;  4EZK A;  2RUD A;  4RG6 A;  2DG9 A;  2Y1L E;  1KT1 A;  4A3T A;  2KBX A;  4G50 A;  5T8I A;  4DZ2 A;  4MTV A;  3NI6 A;  3CHP A;  3FTX A;  3GZS A;  4L7T A;  3ABK E;  1JCH B;  1FKT A;  2YBT A;  3CLJ A;  3SFX A;  1MJ0 A;  5EX0 A;  3PRD A;  3FTZ A;  3J5P A;  3WD4 A;  4A55 A;  3ZIM A;  2I9C A;  4ACK A;  4AEZ C;  2E2E A;  4O6F A;  5HTG A;  1CTN A;  1UR9 A;  1MHQ A;  3PS6 A;  4D10 C;  5LFA A;  2WM0 A;  3RJV A;  3ASG A;  4JHK A;  2H6F A;  1J4H A;  3P1U A;  5KNG A;  3L9T A;  5HRY A;  4YDE A;  4BES A;  1WDY A;  3O5G A;  1TN6 A;  5FZQ A;  4N5C A;  3IV0 A;  1OWQ A;  2B5U B;  4GTV A;  3UQB A;  2KCL A;  3LVQ E;  3JXV A;  4HOS A;  2VTB B;  1E7U A;  2XCB A;  3ZU7 B;  1FVF A;  2XP8 A;  1H6P A;  1J6Y A;  2XPA A;  2J09 A;  1JPL A;  2A5E A;  3UKR G;  1Y6I A;  2VJ8 A;  2ZXW E;  3D9I A;  3ESL A;  4N3B A;  2H6G A;  2I6H A;  2OEV A;  3ZGQ A;  4FC8 A;  3W9G A;  1GOI A;  3CK8 A;  1OXJ A;  3IEG A;  2PPP A;  1HE8 A;  5KCM A;  2C2L A;  4Z2G A;  3HVE A;  4MSP A;  4LNU D;  4WKF A;  2AVP A;  4F1S A;  2GRO B;  4ODN A;  4ILH B;  5B3S E;  5LCW C;  3ARP A;  1NI1 A;  3AJI A;  5ARF A;  3L16 A;  3ULY A;  2DT2 A;  5HI7 A;  3UI6 A;  2V8S E;  5ENQ D;  5T4Y A;  1W1T A;  4CRW A;  3RKV A;  1FKH A;  2L6J A;  2R59 A;  3CSF A;  3Q7A A;  2A4Z A;  4JXT A;  3BU8 A;  2B6C A;  4CDM A;  4DX7 D;  1NH6 A;  3ZNG A;  3EIJ A;  2UY1 B;  3ARX A;  4LAY A;  4GZD A;  3PZ2 A;  4GYO A;  5GPG A;  5FQ8 A;  3EIP A;  3D9H A;  1PC2 A;  1INZ A;  4MBG A;  4BX9 A;  3CGH A;  5KJK A;  1SZA A;  4DRJ A;  3PVL A;  4JPS A;  3VTY A;  3FUK A;  4C0M A;  4B89 A;  4JW1 A;  3KAG A;  1IHB A;  3CH9 A;  2RUR A;  3TWT A;  3APC A;  2B0O E;  3E4B A;  2BKG A;  3F6Q A;  3B9E A;  4H7X A;  2R2L A;  3FTU A;  5H7P A;  5DIT A;  4JA9 A;  1WNO A;  3CST A;  5BV0 A;  2FAP A;  2N87 A;  2ITK A;  2OFN A;  4XAK A;  3VLE A;  4XI9 A;  1S63 A;  5JA4 D;  5D0O D;  2E0I A;  3S7B A;  4XE0 A;  4U7E B;  4QT2 A;  2LNI A;  5CED B;  4L23 A;  5LP0 A;  5CRV A;  4CZ2 D;  4DWS C;  4FAD A;  3V30 A;  3I5P A;  3ARW A;  3J5Q B;  3ARO A;  1KZP A;  3DPY A;  3PNL B;  4I1A A;  3WD3 A;  2IFU A;  3LVR E;  2JLB A;  2A3E A;  2HM8 A;  3QWV A;  2XEH A;  4WJX A;  2IO2 C;  2GGF A;  1UG3 A;  1NZN A;  3NRK A;  2KCK A;  1TNY A;  5EX3 A;  1WG0 A;  4CGV A;  4KT6 B;  4HRL A;  3S7D A;  3NAW A;  4XIF A;  3RRM B;  4L1B A;  1TFV A;  2ZIR A;  2Y0B G;  1DVP A;  2AOS A;  2XRY A;  4ML4 A;  3DXM G;  3ZYM A;  3O5F A;  4LGX A;  4ZPV R;  3UQ3 A;  4FLB A;  1EQ3 A;  3Q15 A;  2X6K A;  3APD A;  3LJN A;  2C0L A;  4P8U A;  4UQY A;  3ZPJ A;  3HXB A;  5BUZ A;  3T5X A;  3QWW A;  3ZXS A;  1E6P A;  1LJY A;  1LL7 A;  3AS8 A;  3TWU A;  2WLZ A;  3D9L A;  5JJ6 A;  4A63 B;  2A3A A;  2Y3A A;  1E90 A;  3LUO A;  3CGM A;  2DWZ A;  1NFI E;  1E7V A;  4YVQ C;  3DSS A;  1D8D A;  3CV0 A;  3MZL B;  4XEI G;  1JWG A;  3RU0 A;  5FIO A;  4U0U A;  4U63 A;  3FU0 A;  4TNS A;  5ANL A;  1D7H A;  3RM9 A;  4KVO A;  4FP7 A;  4JFI A;  1OGG A;  4HBD A;  2LJ4 A;  2OVF A;  3JQ0 A;  3JYM A;  3T8M A;  4URI A;  4EHM A;  3VLD A;  3AS5 A;  2NSZ A;  5AN8 A;  3L54 A;  1JCR A;  2MF9 A;  4DRH A;  2ION A;  2IU1 A;  3HXF A;  4G2V A;  5HKP A;  4E6H A;  1Z5S C;  2DPE A;  2DYR E;  1NMV A;  2PBC A;  3TWX A;  4GA1 A;  3HRA A;  1Y8M A;  5B1B E;  3SQV A;  4JEH A;  1MYO A;  4ANU A;  1ZU8 A;  2ZQV A;  1K1B A;  2Q7F A;  3EHM A;  3FUF A;  3MKQ A;  4DLO A;  3ML9 A;  3ASF A;  2MYO A;  4U85 A;  3UUX A;  5KJN A;  1N11 A;  4OAV B;  4DWS D;  3G2T A;  3TAX A;  3FU5 A;  4Q7N A;  4EBA G;  4UI9 J;  3QB2 A;  1H0I A;  2ZQU A;  3FXY A;  3UM0 A;  4GA2 A;  3D9M A;  3UQA A;  4P8W A;  1E8W A;  4BER A;  5G05 J;  5BNW A;  3V2O A;  3JYJ A;  3SI5 A;  3JXI A;  4BWR A;  3JYS A;  5AEN A;  3FUL A;  5KNH D;  3KSL A;  3D9O A;  4DT4 A;  4AP2 A;  3URZ A;  2FO1 E;  2XP7 A;  2JAB A;  1KT0 A;  2VQ2 A;  4GPK A;  1N1A A;  1FKI A;  3KAD A;  4JD2 G;  4DI3 A;  1N0R A;  3HIZ A;  3KAH A;  3AG1 E;  3KAE A;  3RK6 A;  4LAW A;  3G2S A;  4GGQ A;  1D6O A;  1GPF A;  1HJV A;  3G2U A;  1V55 E;  5B8I C;  2V4L A;  4HI8 A;  5BV1 A;  4UWK A;  3KD7 A;  3LYA A;  2RUC A;  2V0P A;  3QOK A;  3TJP A;  3UIO C;  2WXP A;  2P2C P;  3PR9 A;  4DX2 A;  1BKF A;  4GA0 A;  1OCZ E;  5D75 A;  1FVH A;  2KE0 A;  3K9I A;  4DI4 A;  3DWL G;  1UR8 A;  4JC8 A;  2J49 A;  4NZC A;  4J4N A;  4KR0 B;  5E76 A;  4ATG A;  4EBA A;  1N4R A;  2XP3 A;  1TNZ A;  5BXO A;  2QY7 A;  1U2V G;  5DIV A;  4OVV A;  1N9A A;  5GPR A;  4HQD A;  2LAH A;  5EID A;  2DZO A;  4FA6 A;  2DCP A;  5EYL A;  3RRU A;  4TRQ A;  2VSN A;  2WXJ A;  2I1K A;  1TNU A;  3KAF A;  1FCH A;  2F8X K;  4F6R D;  4J7W A;  3UI2 A;  3CVW A;  2WPV A;  5LCW J;  2PZI A;  2CFU A;  1EYM A;  5EIL A;  2LKN A;  1H19 A;  1E6R A;  3UMV A;  2WQ7 A;  4TXQ A;  4BSX A;  2FF4 A;  2JEK A;  5LOZ A;  4BTB A;  1Y0O A;  3ART A;  2LO6 A;  3B7T A;  1NMW A;  2GRN B;  3IHZ A;  1YYH A;  2L6B A;  3QKY A;  2XRZ A;  3E33 A;  4DRK A;  1MX4 A;  4LNG A;  4ZFH A;  4IQ2 A;  4WAF A;  2HR2 A;  3VTX A;  3CHD A;  1IHG A;  4PS7 A;  3GPK A;  3I6C A;  2WXR A;  2V5F A;  3Q4A B;  1YW5 A;  2ETA A;  4BF8 A;  4CDN A;  4U0S A;  4JFK A;  1HXV A;  2FEZ A;  2PL2 A;  1AP7 A;  3CVV A;  4YND A;  4F7A A;  3BG0 B;  3PE3 A;  4ME2 A;  3MGB A;  1IQU A;  1SA4 A;  2A3B A;  3E37 A;  2MLZ A;  3ESK A;  4RSY A;  1NWS A;  1SA5 A;  4WIW A;  2AJA A;  3SGH A;  1A5E A;  1X81 A;  5ENP D;  2L2S A;  2J9Q A;  3EIQ C;  3SO8 A;  3CHR A;  4WKH A;  1OWO A;  3FU3 A;  3WL1 A;  2L0T B;  3B7B A;  4I1O B;  2IEJ A;  2CHX A;  2RFM A;  4GAA A;  4ODP A;  1O1T A;  3NTP A;  1O6I A;  1NWR A;  3GYZ A;  3OA5 A;  4Y6W A;  2XGM A;  3ARU A;  3B9A A;  2DSV A;  5B1A E;  1W1V A;  3UT8 A;  4GIV A;  2L0I A;  3PZD A;  4C02 B;  4RVB A;  3CQC B;  1FJD A;  4CDR A;  3NZS A;  3AS0 A;  4ATZ D;  4GTO A;  1BLX B;  3BMB A;  1TNO A;  5J90 A;  2EIK E;  1F8A B;  2I1J A;  4U95 D;  3IK8 A;  3RRN B;  2ZR5 A;  2EIJ E;  3CKC A;  1ELR A;  1H0A A;  5ENN A;  4I17 A;  2F21 A;  4DPR A;  1B89 A;  1KZO A;  1HXI A;  4C0E A;  4ZPW R;  4UI9 C;  1H2T C;  3C3Q A;  3PNT B;  2MOW A;  3MYV A;  4ANW A;  4V3I A;  1RZ4 A;  3ABM E;  3ZVV A;  3QAQ A;  1DCQ A;  3PZ3 A;  4TV3 A;  4YVO A;  4GTQ A;  4GMJ A;  1LG2 A;  2J4D A;  3CK9 A;  3WXX A;  3Q9N C;  3CR3 A;  3OAW A;  4U0Z A;  3FUD A;  1FPP A;  1JNS A;  2L9B A;  2PNN A;  4JFJ A;  4Q69 A;  1OCR E;  2DSZ A;  2P9P G;  4N19 A;  2FO7 A;  2ZGG A;  1ZBW A;  5CCL A;  3PUJ A;  4ODK A;  4KMO A;  3PRZ A;  3LKU A;  3ZN3 A;  3Q47 B;  1K8K G;  1UJJ A;  4WNE A;  3ZYQ A;  3GW4 A;  1UOH A;  3ZW3 A;  1SR0 A;  1XRV A;  4S3K A;  3LY8 A;  5A7D B;  3B13 A;  2GRP B;  3ZRH A;  2R17 C;  3L17 A;  4QQI A;  2PN0 A;  4I6E A;  3NQP A;  3D9P A;  4GB9 A;  1SQM A;  2MNT A;  3UM3 A;  3RM8 A;  3G6L A;  3ABL E;  3MCX A;  1Q1C A;  3AQU A;  4ODL A;  5AIJ A;  1U79 A;  2PPO A;  3CHQ A;  3UF8 A;  4DRP A;  2VSX E;  4MNL A;  4FLH A;  3SBT B;  3PEV B;  1YAT A;  3DSU A;  1GW6 A;  2B31 A;  3Q78 A;  3DEP A;  3DSW A;  4GTS A;  4HI9 A;  4QFV A;  4UWL A;  3O5E A;  4JVS A;  4IT4 A;  2JZV A;  5AQB A;  4HVB A;  4DZ3 A;  1XGW A;  5G04 C;  3WL0 A;  4JB8 P;  3RO2 A;  3UIN C;  4GPM A;  4U96 D;  1N94 A;  2IQC A;  2VGY A;  4JFM A;  5AQ7 A;  3I4R B;  4W9Q A;  1WB0 A;  3MJW A;  1BPO A;  1N4S A;  4GTM A;  1GRJ A;  1J4R A;  4AJW A;  1ZBP A;  2VTB A;  1KFW A;  1ZB5 A;  2IOS A;  3HG0 D;  3RAU A;  2UZ5 A;  4ZS6 A;  2FKE A;  3G6M A;  2G8Z A;  4J0U A;  3UPV A;  5BXJ A;  4OYS A;  3CEQ A;  5KJM A;  3FTS A;  5M72 A;  1E6N A;  3UM1 A;  2VCD A;  5FT9 A;  2XPZ A;  4WWN A;  3ARR A;  4W9O A;  2R5S A;  5HKG A;  3FY4 A;  4X8Q A;  2VN1 A;  4JZY A;  3LDZ A;  4N5Q A;  2XZT G;  1SW6 A;  4I6J A;  3AS2 A;  4FHK A;  3FUM A;  4GZ3 A;  4UUC A;  5EDS A;  2MRI A;  3FY1 A;  3IKO B;  5CBN A;  4I43 A;  4RG9 A;  2VYI A;  5GQB A;  2ILR A;  2CFZ A;  5A6C A;  3IBE A;  1E8Y A;  3CHS A;  1S0P A;  2P9K G;  2ZR4 A;  5AQ9 A;  4HS2 A;  3R7Q A;  1JNE A;  3AG4 E;  4AOF A;  2UY1 A;  4QIB A;  1PAQ A;  3CHO A;  3VAW A;  4PDX A;  1NWU A;  4XX5 A;  2F37 A;  2AXZ A;  3OTN A;  5EN5 D;  3EJN A;  1LTX A;  1HG5 A;  3FAP A;  4UI9 K;  4B8C B;  3UI4 A;  1ELW A;  4GTR A;  4NAC A;  4E85 A;  3ML8 A;  1UN9 A;  4G2P A;  2R02 A;  4BTA A;  4ZPT R;  2R03 A;  3MX3 A;  4AY5 A;  1E44 A;  3DST A;  3UI5 A;  1FKR A;  5CEC B;  3C3O A;  4ANV A;  1BL4 A;  2MHK A;  2EIM E;  1O1R A;  4R0X A;  3ZYL A;  4DJA A;  3TWR A;  4BX8 A;  1JCS A;  4I9C A;  2ZIS A;  4HRN A;  3QK0 A;  4DX6 D;  5HQ8 A;  1RW2 A;  4NSB A;  3E32 A;  4KZ0 A; 
#chains in the Genus database with same CATH homology
 5FZR A;  3S7F A;  1J4I A;  5J6E A;  2OV8 A;  1XHG A;  2FUL A;  3WD0 A;  5G55 A;  2WXO A;  4FU3 A;  3OOB A;  1HU3 A;  2ZQT A;  4B0Z A;  3WKZ A;  1M5Y A;  3DPD A;  2GW1 A;  1LF8 A;  4HBE A;  3ALF A;  3IHV A;  4P8X A;  3CK7 A;  3BEE A;  4R7L A;  3CHE A;  4ANX A;  2PQR A;  4K0R A;  4ACL A;  4MGV A;  1WY6 A;  3KAC A;  1HKJ A;  3EY6 A;  4XZ4 A;  4LEU A;  4CCA A;  2CG3 A;  4J8D A;  2RSE A;  3ARY A;  2J07 A;  3DBS A;  5JHA A;  5FQ6 A;  3B7R L;  3QC1 A;  1HH8 A;  1XNF A;  2QFC A;  5HWB A;  4MPK A;  1E8Z A;  4WNG A;  4MRU A;  4BFR A;  2VGX B;  3R9A B;  3FH5 A;  1UJK A;  4CGW A;  3FDH A;  3RME A;  3L08 A;  1W26 A;  2X38 A;  4W5U A;  1K9T A;  2DSW A;  5HW8 A;  2M63 A;  2AW6 A;  5FQ7 A;  3SFZ A;  3U66 A;  3SBS A;  4KYO B;  3FH7 A;  1FFR A;  1OGB A;  4PS3 A;  3TDB A;  3BXW A;  2WXK A;  2D9F A;  2FDM A;  4EZL A;  2F4E A;  1FKG A;  4CEM A;  1H2V C;  2DT1 A;  2GRL A;  3ZFW A;  5C1D A;  1L1P A;  3NZU A;  4MKT A;  2VGX A;  5FWQ A;  3IHY A;  3FU6 A;  1EYH A;  4G24 A;  4Z2J A;  3FUH A;  4ABN A;  1QZ2 A;  4IT6 A;  2AXU A;  4GU5 A;  1LL4 A;  4TYO A;  2PV2 A;  4LRZ A;  2XP5 A;  3KCE A;  2X6I A;  5HW6 A;  2LAI A;  3U9W A;  3IKD A;  4L2Y A;  1JWF A;  4KZC A;  2OLH A;  1FKK A;  2XPI A;  3KEZ A;  1FAP A;  4LAV A;  3AS1 A;  5CHE E;  4N2S A;  2XPY A;  4S3J A;  4P8V A;  5AYW D;  2XQ0 A;  2RQS A;  1E8X A;  4AV7 A;  1EIB A;  3MV3 B;  5G04 J;  1H2U A;  1UN8 A;  3UT7 A;  4FHJ A;  3RM4 A;  2KCV A;  1E15 A;  2PM6 A;  1W9V A;  2OVB A;  4HLE A;  3CKB A;  4DRI A;  1JUQ A;  2YHE A;  1HFA A;  2XP6 A;  1Q6I A;  2RG8 A;  3ENE A;  3PRA A;  1FKF A;  3AS3 A;  4PTM A;  4G23 A;  3CVU A;  2PV1 A;  3O4Z A;  5C2Y A;  3ZHE B;  2PI6 A;  3TG5 A;  3FEY A;  4L3N A;  1LG1 A;  2DBA A;  3QDN A;  2WM9 A;  3WH0 A;  4N39 A;  4JHR A;  4FAP A;  3D9J A;  1KLX A;  4I1M A;  4J8E A;  1NA0 A;  4I2Z A;  5G2N A;  4WND A;  2ZU6 B;  4DWS B;  4LER A;  1HF8 A;  4IYP A;  3U3W A;  4DRM A;  4QT3 A;  3ONL A;  2DIW A;  2XEV A;  3I4G A;  4ILG A;  4J6I A;  1D2K A;  4IQC A;  4WNF A;  2KZT B;  2GRM A;  3TG4 A;  5DIU A;  1ZBC A;  4KXK B;  3ZHE A;  1FKD A;  3PUK A;  3TC5 A;  5J08 A;  3WQW A;  3L22 A;  5AJD A;  1FKS A;  4R5E A;  3I3N A;  3CQG B;  2DT3 A;  3FTY A;  3B7X A;  2LGO A;  2WXF A;  4Y6C A;  3R7R A;  3WQV A;  2KM4 A;  3AU4 A;  3VLF A;  3SNX A;  1EDU A;  2XPB A;  4WWO A;  2IF4 A;  2I2O A;  1TJC A;  1JNT A;  1X6L A;  4DWS A;  2KC7 A;  4J8F A;  3O5Q A;  1W9P A;  2M08 A;  2WQ6 A;  1QPF A;  4AM9 A;  2MPH A;  2KI3 A;  3CVY A;  4ODO A;  4G11 A;  4AIF A;  3FUE A;  2YQ8 A;  1OWL A;  3PDN A;  1VF8 A;  4I9E A;  5DIZ A;  4W9R A;  4GCN A;  1HZ4 A;  4A1G A;  4TUU A;  2DG4 A;  1Z6T A;  1TCO C;  2PPN A;  3LY7 A;  2KGJ A;  4U04 A;  5JHB A;  4WWP A;  4XKB A;  4HAR A;  1D7J A;  3LCA A;  2X6H A;  2XP4 A;  4N2Q A;  2MLX A;  4IRU A;  4IUL A;  1R9H A;  2XP9 A;  4MNK A;  2WVI A;  2F2D A;  1JND A;  4DRO A;  4MNM A;  3G2W A;  1HJX A;  1C9H A;  1N52 A;  2XGO A;  4B94 A;  1PBK A;  4GYY A;  4NUR A;  4HOU A;  3KZ7 A;  1ELK A;  5JH8 A;  1FFQ A;  4U84 A;  1TJF A;  4U8H A;  3WD1 A;  3HVE B;  5JJT A;  3ARS A;  4M3O A;  4JL0 A;  4AY6 A;  1EHN A;  2AWI A;  3RFW A;  2KR7 A;  3ODK A;  3CVX A;  3O5J A;  3MKR A;  3CVN A;  2IOL A;  1E96 B;  3O48 A;  3QNK A;  4FN2 A;  4HXI A;  4Q22 A;  1QPL A;  1H6K A;  4A1S A;  4N3C A;  3TXM A;  5DO2 A;  4UWF A;  4TX0 A;  2PM7 A;  3ASD A;  3U4T A;  3W4R A;  1EF1 C;  2CG2 A;  1WAW A;  3O5M A;  1NP7 A;  2WB2 A;  2M2A A;  2WMN A;  2ZQS A;  5CMW A;  4QZV B;  4GML A;  4HOT A;  4Q96 A;  2EQX A;  3CHC A;  1HG2 A;  1ITX A;  1HS6 A;  3ASH A;  4NRH B;  4ODM A;  4Z2H A;  5I98 A;  3PRE A;  1VDY A;  3S7J A;  1FKB A;  4HBO A;  2DT0 A;  1HJW A;  4KBQ A;  3GZ1 A;  4KVM A;  3LY9 A;  3ZYK A;  1T11 A;  2LPV A;  1Z3Y A;  3FUN A;  3B9D A;  3CVQ A;  4EZJ A;  3ALG A;  2OND A;  1P5Q A;  5FQ4 A;  4JYS A;  2Y4T A;  5HWC A;  3FEX A;  3WD2 A;  3B7S A;  1B6C A;  4ODR A;  4HFG A;  4GZ5 A;  4JEU A;  2WXH A;  4G1T A;  1IQR A;  4KQZ A;  4FJY A;  2BF0 X;  3TL5 A;  4FJZ A;  3LS8 A;  4CT4 A;  2UWJ G;  3D3M A;  4UQZ A;  1EPU A;  1QQE A;  5HT1 A;  5FZS A;  3SF4 A;  4JA7 A;  4IN3 B;  5ANR A;  3RO3 A;  1OWN A;  2AWG A;  2OOE A;  4LAX A;  1N54 A;  3LPZ A;  5DEZ A;  2RD0 A;  3FUI A;  5JJ7 A;  2WXQ A;  3O5R A;  2WMO A;  5LX8 A;  1OUV A;  4UWH A;  2J4B A;  5FTP A;  4TW6 A;  4AVX A;  3MV2 B;  3SZ7 A;  4TW8 A;  3S2A A;  2Q5A A;  4PH4 B;  2VSO E;  4Z2K A;  1IX5 A;  1ZK6 A;  4LUN U;  3SHF A;  3U64 A;  4B8A A;  4L2L A;  4BT9 A;  2X6J A;  2XHE A;  3ULQ A;  4UQX A;  3JCK C;  3CIA A;  3PRB A;  1FD9 A;  3O5I A;  4Q94 A;  4UWG A;  4EQF A;  4GZC A;  5HUA A;  1Q6H A;  3FTV A;  3QAR A;  5DBK A;  1A17 A;  3JUI A;  3RIB A;  5A23 A;  4APO A;  3SD5 A;  2PV3 A;  1ZBV A;  3MKQ B;  2AXV A;  4BT8 A;  3AS4 A;  2M1I A;  1U3C A;  1W9U A;  4N3A A;  1TEZ A;  2XGS A;  4H7Y A;  4ILI A;  2FI7 A;  1EDQ A;  1Q6U A;  4WKA A;  2DG3 A;  1WM5 A;  4ODQ A;  3FTW A;  3HHM A;  3P2B A;  3FHE A;  1X6N A;  3GZ2 A;  5HW7 A;  3MA5 A;  3D9N A;  4AXH A;  5CCM A;  4DH0 A;  1PIN A;  3CZ8 A;  1E9L A;  2HO1 A;  4J8S A;  2NC9 A;  2A5U A;  2P58 C;  4GYW A;  1H0G A;  4FUL A;  1IYG A;  4EPZ A;  2VSY A;  2ESC A;  1PY1 A;  3ARV A;  4OVU A;  3Q5M A;  2Y78 A;  5DF0 A;  5BW8 C;  4MLP A;  3AU5 A;  1WAO 1;  5HBF A;  2J08 A;  3PA7 A;  1HKI A;  5T3R A;  3PE4 A;  3MDY B;  1MQS A;  4BY6 A;  3UT4 A;  1ZU2 A;  3O5O A;  3OXG A;  3C98 A;  1HO8 A;  4W9P A;  4DLQ A;  3O5L A;  3MEK A;  4F3V A;  1W1Y A;  1Z3X A;  3QOU A;  1U3D A;  2X3M A;  1HKK A;  3RGC A;  2RUQ A;  4U86 A;  3APF A;  2IJG X;  4JFL A;  2K8I A;  2FBN A;  3O5D A;  1ROU A;  5KJL A;  3FFL A;  1GUV A;  4NNR A;  2YIN A;  2LSV A;  4P29 A;  2BUG A;  2WXI A;  1W3B A;  2YHC A;  5BT1 A;  4G25 A;  2WK2 A;  3CVL A;  3FUJ A;  2KO7 A;  4A3V A;  1X5B A;  2CHZ A;  4I6G A;  1W1P A;  3CVP A;  4U07 A;  1A7X A;  3O5P A;  3QJZ A;  4DIP A;  1SZ9 A;  4DRN A;  2YNQ A;  1JVW A;  3ARZ A;  4APF A;  3JQ1 A;  2DSU A;  3QWP A;  4WK9 A;  3LJ3 A;  2Y4U A;  3BG1 B;  3FP3 A;  5CMY A;  4PS8 A;  4PUC A;  1HKM A;  3L6A A;  3TCZ A;  2MLY A;  4JHJ A;  2NXP A;  5BPP A;  4URK A;  4I2W A;  2XCC A;  2C0M A;  2WXM A;  3TXN A;  4F53 A;  2WXL A;  3O5K A;  1LL6 A;  1ZBK A;  4Z2I A;  1QNF A;  1NSG A;  4EEC A;  4HOR A;  2CHW A;  4C9B B;  1L5J A;  4CT0 A;  4L72 B;  2O9O A;  2IUZ A;  3CHM A;  1ZCN A;  3LEW A;  2WQH A;  1YA0 A;  3KAI A;  3Q49 B;  5E75 A;  4K03 A;  5D0Q D;  1D7I A;  2QF8 A;  2YBU A;  1SYT A;  1UW4 B;  3WIJ A;  4XKC A;  3KS2 A;  4HOQ A;  1DNP A;  2G41 A;  2KFW A;  3EHN A;  1HX8 A;  3OXL A;  3PEU B;  1ZL1 A;  3B7U X;  3OXF A;  1NA3 A;  1ROT A;  1OWM A;  3EDT B;  4NQ0 A;  3L13 A;  1OWP A;  1LQ0 A;  3T5V A;  4O2T A;  4J4O A;  3HYM B;  5FJY A;  4Z2L A;  3LXU X;  4TW7 A;  2ZR6 A;  2WXG A;  4MNJ A;  4G26 A;  2BTD A;  5AJL A;  3ARQ A;  3UQI A;  3KAB A;  4LCT A;  3D9K A;  4MS6 A;  4IPX A;  2O92 A;  4GCO A;  3NF1 A;  3CHF A;  5ARG A;  5EKQ D;  3UX4 A;  4XI0 A;  1E6Z A;  2WXN A;  3FH8 A;  1RD6 A;  3G2V A;  2X6F A;  2KZT A;  3ZEF A;  1FKL A;  1F40 A;  3CGN A;  4WUY A;  3H9R B;  4MAV A;  4ITZ A;  1FKJ A;  2LSU A;  4AY1 A;  4DK5 A;  3ONK A;  3B8S A;  3HDX A;  1NWT A;  2A3C A;  2KAT A;  2HYZ A;  2WLY A;  4GZ6 A;  2PQN A;  3FWV A;  3TGO A;  5G05 C;  3IKG A;  3N71 A;  3PH0 C;  4EZK A;  2RUD A;  2DG9 A;  4RG6 A;  1KT1 A;  4A3T A;  4G50 A;  5T8I A;  4DZ2 A;  4MTV A;  3NI6 A;  3CHP A;  3FTX A;  3GZS A;  4L7T A;  1FKT A;  2YBT A;  3CLJ A;  5EX0 A;  3PRD A;  3FTZ A;  3WD4 A;  4A55 A;  3ZIM A;  2I9C A;  4ACK A;  4AEZ C;  2E2E A;  4O6F A;  5HTG A;  1CTN A;  1UR9 A;  1MHQ A;  3PS6 A;  4D10 C;  5LFA A;  2WM0 A;  3RJV A;  3ASG A;  4JHK A;  1J4H A;  3P1U A;  3O5G A;  5FZQ A;  4N5C A;  3IV0 A;  1OWQ A;  3UQB A;  2KCL A;  3LVQ E;  3JXV A;  4HOS A;  2VTB B;  1E7U A;  2XCB A;  1FVF A;  2XP8 A;  1J6Y A;  2XPA A;  2J09 A;  1JPL A;  1Y6I A;  2VJ8 A;  3D9I A;  3ESL A;  4N3B A;  2I6H A;  3ZGQ A;  4FC8 A;  1GOI A;  3CK8 A;  3IEG A;  2PPP A;  1HE8 A;  5KCM A;  2C2L A;  4Z2G A;  3HVE A;  4MSP A;  4WKF A;  2AVP A;  4F1S A;  4ODN A;  4ILH B;  5LCW C;  3ARP A;  5ARF A;  3L16 A;  2DT2 A;  5HI7 A;  3UI6 A;  2V8S E;  5T4Y A;  1W1T A;  4CRW A;  3RKV A;  1FKH A;  2L6J A;  2R59 A;  3CSF A;  2A4Z A;  4JXT A;  4CDM A;  1NH6 A;  3EIJ A;  2UY1 B;  3ARX A;  4LAY A;  4GZD A;  4GYO A;  5GPG A;  5FQ8 A;  1PC2 A;  1INZ A;  4BX9 A;  3CGH A;  5KJK A;  1SZA A;  4DRJ A;  3PVL A;  4JPS A;  3VTY A;  3FUK A;  4C0M A;  4B89 A;  4JW1 A;  3KAG A;  3CH9 A;  2RUR A;  3APC A;  3E4B A;  3B9E A;  4H7X A;  3FTU A;  5DIT A;  4JA9 A;  1WNO A;  3CST A;  5BV0 A;  2FAP A;  2N87 A;  2ITK A;  2OFN A;  4XAK A;  3VLE A;  4XI9 A;  5D0O D;  2E0I A;  3S7B A;  4XE0 A;  4QT2 A;  2LNI A;  4L23 A;  5LP0 A;  4DWS C;  4FAD A;  3I5P A;  3ARW A;  3ARO A;  3PNL B;  3WD3 A;  4I1A A;  2IFU A;  3LVR E;  2JLB A;  2A3E A;  2HM8 A;  3QWV A;  4WJX A;  2GGF A;  1UG3 A;  1NZN A;  3NRK A;  2KCK A;  5EX3 A;  4CGV A;  4KT6 B;  3S7D A;  4XIF A;  3RRM B;  4L1B A;  1TFV A;  1DVP A;  2AOS A;  2XRY A;  4ML4 A;  3ZYM A;  3O5F A;  4LGX A;  4ZPV R;  3UQ3 A;  4FLB A;  1EQ3 A;  3Q15 A;  2X6K A;  3APD A;  2C0L A;  4P8U A;  4UQY A;  3ZPJ A;  5BUZ A;  3T5X A;  3QWW A;  3ZXS A;  1E6P A;  1LJY A;  1LL7 A;  3AS8 A;  2WLZ A;  3D9L A;  5JJ6 A;  2A3A A;  2Y3A A;  1E90 A;  3LUO A;  3CGM A;  1E7V A;  4YVQ C;  3CV0 A;  3MZL B;  1JWG A;  3RU0 A;  4U0U A;  4U63 A;  3FU0 A;  4TNS A;  5ANL A;  1D7H A;  3RM9 A;  4KVO A;  4FP7 A;  4JFI A;  1OGG A;  2LJ4 A;  2OVF A;  3JQ0 A;  3JYM A;  3T8M A;  4URI A;  3VLD A;  3AS5 A;  2NSZ A;  3L54 A;  2MF9 A;  4DRH A;  2ION A;  2IU1 A;  4G2V A;  4E6H A;  2DPE A;  1NMV A;  2PBC A;  4GA1 A;  1Y8M A;  4JEH A;  4ANU A;  1ZU8 A;  2ZQV A;  2Q7F A;  3EHM A;  3FUF A;  3MKQ A;  4DLO A;  3ML9 A;  3ASF A;  4U85 A;  3UUX A;  5KJN A;  4DWS D;  3G2T A;  3TAX A;  3FU5 A;  4Q7N A;  4EBA G;  4UI9 J;  3QB2 A;  1H0I A;  2ZQU A;  3FXY A;  4GA2 A;  3D9M A;  3UQA A;  4P8W A;  1E8W A;  5G05 J;  5BNW A;  3JYJ A;  3SI5 A;  4BWR A;  3JYS A;  5AEN A;  3FUL A;  3D9O A;  4DT4 A;  4AP2 A;  3URZ A;  2XP7 A;  1KT0 A;  2VQ2 A;  4GPK A;  1N1A A;  1FKI A;  3KAD A;  4DI3 A;  3HIZ A;  3KAH A;  3KAE A;  3RK6 A;  4LAW A;  3G2S A;  4GGQ A;  1D6O A;  1GPF A;  1HJV A;  3G2U A;  5B8I C;  2V4L A;  5BV1 A;  4UWK A;  3KD7 A;  3LYA A;  2RUC A;  2V0P A;  3QOK A;  3TJP A;  2WXP A;  3PR9 A;  1BKF A;  4GA0 A;  5D75 A;  1FVH A;  2KE0 A;  3K9I A;  4DI4 A;  1UR8 A;  4JC8 A;  2J49 A;  4NZC A;  4J4N A;  4KR0 B;  5E76 A;  4ATG A;  4EBA A;  2XP3 A;  2QY7 A;  5DIV A;  4OVV A;  5GPR A;  2LAH A;  4FA6 A;  2DCP A;  3RRU A;  4TRQ A;  2VSN A;  2WXJ A;  2I1K A;  3KAF A;  1FCH A;  3CVW A;  2WPV A;  5LCW J;  2PZI A;  2CFU A;  1EYM A;  2LKN A;  1H19 A;  1E6R A;  3UMV A;  2WQ7 A;  4BSX A;  2FF4 A;  2JEK A;  5LOZ A;  4BTB A;  1Y0O A;  3ART A;  2LO6 A;  3B7T A;  1NMW A;  3IHZ A;  3QKY A;  2XRZ A;  4DRK A;  4IQ2 A;  4WAF A;  2HR2 A;  3VTX A;  3CHD A;  1IHG A;  4PS7 A;  3GPK A;  3I6C A;  2WXR A;  2V5F A;  3Q4A B;  1YW5 A;  4BF8 A;  4CDN A;  4U0S A;  4JFK A;  1HXV A;  2FEZ A;  2PL2 A;  3CVV A;  4YND A;  4F7A A;  3BG0 B;  3PE3 A;  4ME2 A;  3MGB A;  1IQU A;  2A3B A;  2MLZ A;  3ESK A;  4RSY A;  1NWS A;  4WIW A;  3SGH A;  2L2S A;  2J9Q A;  3EIQ C;  3CHR A;  4WKH A;  1OWO A;  3FU3 A;  3WL1 A;  2L0T B;  4I1O B;  2CHX A;  4GAA A;  4ODP A;  3NTP A;  1O6I A;  1NWR A;  3GYZ A;  3OA5 A;  4Y6W A;  2XGM A;  3ARU A;  3B9A A;  2DSV A;  1W1V A;  3UT8 A;  4GIV A;  2L0I A;  3PZD A;  4C02 B;  4RVB A;  3CQC B;  1FJD A;  4CDR A;  3NZS A;  3AS0 A;  5J90 A;  1F8A B;  2I1J A;  3IK8 A;  3RRN B;  2ZR5 A;  3CKC A;  1ELR A;  1H0A A;  5ENN A;  4I17 A;  2F21 A;  4DPR A;  1B89 A;  1HXI A;  4C0E A;  4ZPW R;  4UI9 C;  1H2T C;  3PNT B;  2MOW A;  3MYV A;  4ANW A;  4V3I A;  3ZVV A;  3QAQ A;  4YVO A;  4TV3 A;  4GMJ A;  1LG2 A;  2J4D A;  3CK9 A;  3WXX A;  3CR3 A;  3OAW A;  4U0Z A;  3FUD A;  1JNS A;  2L9B A;  4JFJ A;  4Q69 A;  2DSZ A;  4N19 A;  2FO7 A;  1ZBW A;  5CCL A;  3PUJ A;  4ODK A;  4KMO A;  3PRZ A;  3LKU A;  3ZN3 A;  3Q47 B;  1UJJ A;  4WNE A;  3ZYQ A;  3GW4 A;  3ZW3 A;  1SR0 A;  1XRV A;  4S3K A;  3LY8 A;  5A7D B;  3B13 A;  3ZRH A;  2R17 C;  3L17 A;  4I6E A;  3NQP A;  3D9P A;  4GB9 A;  1SQM A;  2MNT A;  3RM8 A;  3G6L A;  3MCX A;  1Q1C A;  3AQU A;  4ODL A;  5AIJ A;  1U79 A;  2PPO A;  3CHQ A;  3UF8 A;  4DRP A;  2VSX E;  4MNL A;  4FLH A;  3SBT B;  3PEV B;  1YAT A;  1GW6 A;  2B31 A;  4UWL A;  4QFV A;  3O5E A;  4JVS A;  4IT4 A;  2JZV A;  4HVB A;  4DZ3 A;  1XGW A;  5G04 C;  3WL0 A;  3RO2 A;  2IQC A;  2VGY A;  4JFM A;  3I4R B;  4W9Q A;  1WB0 A;  3MJW A;  1BPO A;  1J4R A;  4AJW A;  1ZBP A;  2VTB A;  1KFW A;  1ZB5 A;  2IOS A;  2UZ5 A;  4ZS6 A;  2FKE A;  3G6M A;  2G8Z A;  4J0U A;  3UPV A;  5BXJ A;  4OYS A;  3CEQ A;  5KJM A;  3FTS A;  5M72 A;  1E6N A;  2VCD A;  5FT9 A;  2XPZ A;  4WWN A;  3ARR A;  4W9O A;  2R5S A;  5HKG A;  3FY4 A;  2VN1 A;  4JZY A;  3LDZ A;  4I6J A;  3AS2 A;  4FHK A;  3FUM A;  4GZ3 A;  5EDS A;  2MRI A;  3FY1 A;  3IKO B;  4I43 A;  4RG9 A;  2VYI A;  5GQB A;  2ILR A;  2CFZ A;  5A6C A;  3IBE A;  1E8Y A;  3CHS A;  1S0P A;  2ZR4 A;  4HS2 A;  3R7Q A;  1JNE A;  4AOF A;  2UY1 A;  4QIB A;  1PAQ A;  3CHO A;  3VAW A;  4PDX A;  1NWU A;  4XX5 A;  2AXZ A;  3OTN A;  3EJN A;  1HG5 A;  3FAP A;  4UI9 K;  4B8C B;  3UI4 A;  1ELW A;  4NAC A;  4E85 A;  3ML8 A;  1UN9 A;  4G2P A;  4BTA A;  4ZPT R;  3MX3 A;  4AY5 A;  3UI5 A;  1FKR A;  4ANV A;  1BL4 A;  2MHK A;  4R0X A;  3ZYL A;  4DJA A;  4BX8 A;  4I9C A;  3QK0 A;  5HQ8 A;  4NSB A;  4DRQ A;  4KZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...