2IF4A

Crystal structure of a multi-domain immunophilin from arabidopsis thaliana
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
258
structure length
258
Chain Sequence
NVPPKVDSEAEVLDEKVSKQIIKEGHGSKPSKYSTCFLHYRAWTKNSQHKFEDTWHEQQPIELVLGKEKKELAGLAIGVASMKSGERALVHVGWELAYGKEGNFSFPNVPPMADLLYEVEVIGFDETKEGKARSDMTVEERIGAADRRKMDGNSLFKEEKLEEAMQQYEMAIAYMGDDFMFQLYGKYQDMALAVKNPCHLNIAACLIKLKRYDEAIGHCNIVLTEEEKNPKALFRRGKAKAELGQMDSARDDFRKAQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATFKBP42
publication title Crystal Structure of a Multi-domain Immunophilin from Arabidopsis thaliana: A Paradigm for Regulation of Plant ABC Transporters.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein
total genus 70
structure length 258
sequence length 258
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2if4A02
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2if4A01
4GCNA 4G2PA 1J4HA 4CDRA 3H9RB 3URZA 2XCBA 2BUGA 5A7DB 3LYAA 5D75A 1HXIA 3O5GA 2MNTA 3PE3A 4W9OA 2KCVA 2DG9A 3MV2B 2MLYA 1NA0A 3QWVA 1KT0A 2PBCA 2RSEA 4RG9A 3UI5A 3O5MA 3KABA 2VQ2A 1IYGA 4N3AA 4N2QA 3S7BA 2LSVA 3KACA 4HOSA 2R5SA 1FKIA 3O5IA 3IKDA 5LCWC 4ODPA 3LKUA 1ZU2A 5C1DA 4LAXA 2XP5A 2XPAA 4GGQA 3TAXA 1F40A 4UQZA 1J4RA 3EDTB 2PV2A 4HOUA 4DIPA 1KT1A 1Q6HA 2VGXB 4GA0A 3WH0A 4N39A 3ZHEA 4ODLA 4U0SA 4HORA 2NC9A 3GYZA 4N2SA 3UPVA 3CKCA 4RG6A 4JFJA 4JHRA 3VTYA 2LPVA 2N87A 2L6JA 2LSUA 5KJLA 4O2TA 2UZ5A 4U86A 2KGJA 4O6FA 5FJYA 4G23A 5DBKA 1U79A 2DBAA 4G25A 1HXVA 2FF4A 3MKRA 4I9EA 3GPKA 3NTPA 3NI6A 4UI9C 4ODKA 3S7FA 5HW7A 3LY8A 3ASFA 1W26A 2FAPA 3O5KA 3RJVA 1D7HA 3JXVA 5CCLA 4FAPA 2ZR6A 3O5DA 4FN2A 2AVPA 3GW4A 3VTXA 5LCWJ 3Q15A 3S7JA 3CVLA 2VYIA 3FAPA 2VGYA 2XP6A 3UUXA 3HYMB 2XP8A 2OOEA 4WNEA 3O5LA 4H7YA 5HW6A 4LAWA 4YVOA 4B94A 3RU0A 1YW5A 1R9HA 5KJNA 4ABNA 3ZN3A 2QFCA 5G04C 2UWJG 2PV3A 2VSNA 3PRDA 4BT8A 1T11A 4J4OA 5CHEE 5J6EA 3NRKA 3RKVA 1J4IA 4G50A 4JL0A 5EX0A 3LCAA 4HOQA 2JZVA 2ZR4A 2PPPA 1D7IA 2MLZA 1IHGA 5M72A 1FKSA 2C0MA 3KD7A 4EQFA 4I1AA 3ASDA 3NF1A 5EKQD 4LAYA 3ZFWA 4R0XA 2LKNA 3KCEA 2FKEA 4UI9J 3MV3B 4BWRA 5B8IC 1FD9A 5BXJA 2WPVA 2XGSA 2MF9A 1KLXA 4GA2A 4CGWA 1Q1CA 5DIVA 5G05C 1FKDA 2L2SA 4N19A 2XPBA 2UY1B 1FKJA 3VAWA 2LNIA 5FTPA 5FT9A 4NRHB 4GZ5A 3TG5A 1NA3A 4U84A 4APOA 2VGXA 3CKBA 2PL2A 3CK7A 1FCHA 2PQNA 4GCOA 4I17A 4AM9A 1B6CA 5G04J 2Y4TA 4HOTA 4TW8A 3WXXA 1NMVA 4DZ2A 2KC7A 1B89A 3QKYA 3Q4AB 2WQHA 3UQBA 4DRIA 4WNGA 4GIVA 4DRQA 3CK9A 4KYOB 3B7XA 2KI3A 3FFLA 1Q6UA 3TCZA 2OFNA 4A1SA 3QWWA 1ROTA 2FEZA 1FKHA 3PRBA 2F21A 4J8FA 4G1TA 1HH8A 3LUOA 5JJ6A 4DRJA 5FZRA 1PC2A 1E96B 4IN3B 3S7DA 2Y78A 4DROA 2C0LA 5G05J 2XEVA 4U0ZA 4IQCA 3AS4A 4Y6WA 4XI9A 4DT4A 2GW1A 4J8DA 3KAIA 3IKGA 4ITZA 4UI9K 2AWGA 3AS8A 4N5CA 3KADA 3ZGQA 4G2VA 1QPLA 2KATA 3Q47B 4KXKB 3Q5MA 2XGMA 2KFWA 5DIZA 4G24A 1FKKA 1C9HA 3MA5A 3CV0A 5CCMA 4DRMA 5BNWA 2ZQSA 1FKRA 4TYOA 3IEGA 3JYJA 5FZSA 3U3WA 1JVWA 3JYMA 4J0UA 1FJDA 4GYYA 2XP9A 3I6CA 5HKGA 2M08A 5KJMA 5FZQA 3O5PA 1Y8MA 1ZBPA 1ZCNA 4JFIA 3OXGA 4ODNA 4DRHA 3O5FA 4BF8A 4WNDA 1NSGA 1Y0OA 3UI6A 1YA0A 4NNRA 3UQAA 3LY7A 1WAO1 2M1IA 4QIBA 1P5QA 1A7XA 5KJKA 4TNSA 3CEQA 2YHCA 4GZ3A 2UY1A 3U4TA 2PZIA 3CVPA 2KCKA 3BEEA 3R9AB 1BL4A 1QZ2A 1XNFA 4IPXA 2PQRA 3O5QA 2FBNA 4G26A 2XP7A 4JFLA 2I6HA 4AIFA 4GYOA 3QOUA 2MHKA 3O5EA 2RUQA 3LY9A 3K9IA 2LJ4A 4MSPA 3PDNA 1JNTA 4YVQC 1Q6IA 4GA1A 2KO7A 2ZQTA 4TW6A 1JNSA 2E2EA 2FO7A 2VSYA 3KAEA 2ZQVA 5ARFA 4U85A 4NQ0A 5AYWD 2IF4A 5HWCA 1OUVA 2KE0A 2V5FA 3IK8A 2LGOA 3RIBA 4DZ3A 3UF8A 4LAVA 4MGVA 1FKGA 3E4BA 2VN1A 5HW8A 2PV1A 4AY6A 4JFKA 1A17A 5ARGA 2Y4UA 4H7XA 4U04A 2KCLA 1PINA 1TCOC 2Q5AA 4GZ6A 1J6YA 3TGOA 4I2ZA 3CGMA 3SF4A 2K8IA 4IQ2A 1NMWA 4TW7A 2P58C 4W9QA 3ESKA 4JA7A 2FI7A 3RO3A 5GPGA 3GZ1A 2XP3A 2XCCA 4WNFA 4ODMA 3Q49B 3FWVA 5HTGA 3KAHA 2RQSA 3MDYB 3LPZA 2VCDA 4DRKA 3PE4A 4DH0A 1NZNA 3OXLA 4Y6CA 4UQYA 3O5RA 4XIFA 4BT9A 5HQ8A 2ITKA 2RUCA 4JYSA 4QT2A 3N71A 1FAPA 3RO2A 3SZ7A 5HWBA 5HI7A 4YNDA 2F4EA 1D7JA 1D6OA 3QWPA 2JLBA 2IFUA 2KR7A 3CVNA 2ZQUA 3FP3A 3TC5A 1HZ4A 4UQXA 5JJ7A 3O48A 2DG3A 1QQEA 2Q7FA 3CVQA 4W9RA 3TG4A 4KBQA 1ELWA 5BW8C 1ROUA 3PA7A 1FKBA 3KAGA 2HYZA 4N3BA 1FKLA 3ZPJA 1ELRA 4GYWA 4J4NA 3O5JA 1F8AB 3IHZA 1EYMA 5DITA 3MEKA 2XGOA 4ME2A 3O5OA 2MPHA 2RUDA 4C02B 4ODQA 5BT1A 4U0UA 3KS2A 1WM5A 2HO1A 3ZHEB 4BTBA 5JJTA 3TDBA 4J8EA 4JFMA 4LEUA 2M2AA 2ONDA 1W3BA 4XI0A 4ODRA 2PPNA 2C2LA 3OOBA 2RURA 4F3VA 2MLXA 4JA9A 5I98A 4GPKA 1TJCA 4I2WA 3AS5A 1N1AA 3EY6A 3ULQA 4DRPA 2XP4A 3OXFA 1BKFA 3KZ7A 4AY5A 1PBKA 3RFWA 1M5YA 5DIUA 1EQ3A 3GZ2A 1ZK6A 1YATA 4I9CA 3UQ3A 4BTAA 5EX3A 2HR2A 3QDNA 3RGCA 4WUYA 3ASHA 2J9QA 2F2DA 2YQ8A 3ASGA 2D9FA 3CGNA 5HUAA 3CK8A 3KAFA 4TX0A 2ZR5A 1FKTA 2DG4A 3UI4A 1FKFA 4U07A 2PPOA 4ODOA 1QPFA 3ODKA 4QT3A 3UQIA 5A6CA 1L1PA 5D0QD 3JYSA 4N3CA 5D0OD 4W9PA 5HT1A 4CGVA 2XPIA 4DRNA
chains in the Genus database with same CATH superfamily
4G2PA 1J4HA 4GZDA 4CDRA 4YDEA 3BMBA 2EIJE 5A7DB 3LYAA 4IYPA 2MNTA 2KCVA 3PNLB 4JEHA 1DC2A 1KT0A 2PBCA 4ACKA 2RSEA 3UI5A 3O5MA 3ESLA 1JWGA 4DJAA 4WK9A 3JQ0A 2F0YA 2L0TB 1ZB1A 1WY6A 3FTWA 3O5IA 5C1DA 1UR9A 3UT7A 3BXWA 4UQZA 2J09A 2PV2A 1KT1A 3APFA 1X6NA 4GMJA 4ZHBA 4I6EA 3D9OA 4DRXE 4AY1A 4BSXA 4QZVB 1E90A 2MYOA 3WH0A 3ZHEA 3B7UX 4ODLA 4U0SA 2NC9A 2QC9A 3GYZA 4N2SA 3B95A 2P9LG 4RG6A 2OEVA 3W9GA 4JHRA 2LPVA 2P2CP 2N87A 4FP7A 1L5JA 3AU4A 2BTDA 2AXUA 2RFMA 4P8WA 2KGJA 5FJYA 3QARA 4UUCA 5CRUA 1E7UA 1U79A 3IXEA 3DSXA 4I9EA 3NI6A 1IKND 3LY8A 4U7EB 1W26A 4S3KA 3O5KA 3FY4A 4FC8A 4RLYA 3JXVA 3TWQA 1K1AA 4CRWA 4FN2A 3MKQA 2VTBA 4Z2KA 3JUIA 4LCTA 3V2OA 2RFAA 4MAVA 3WD2A 2VGYA 3R7RA 3UUXA 2OOEA 5G2NA 2FULA 1N0QA 2VSNA 2WXQA 1N4PA 1OCOE 1T11A 1O6IA 5CHEE 2X6FA 1RZ4A 3RKVA 1J4IA 3BG0B 4JL0A 5EX0A 3ARTA 4HOQA 4EZJA 2PPPA 1IX5A 5JHAA 1GRJA 1FKSA 2C0MA 2XPYA 2JABA 3KCEA 1V54E 3PH0C 3MV3B 4HARA 1NWSA 5T4YA 2MF9A 4ANXA 1Q1CA 2H6IA 4XEIG 2L2SA 4N19A 3O4ZA 3CSTA 3SY2A 3B7TA 1Z5SC 2LNIA 4MTVA 5BPPA 3TG5A 4DI3A 4APOA 1WG0A 5B3SE 1EHNA 3L13A 4LG6A 2DT3A 4ML4A 3PEUB 1B6CA 4AP2A 5EILA 4CYMD 4HOTA 3NOCD 3C5RA 3EU9A 3FH8A 1B89A 5C2YA 2GRMA 1HKJA 2WQHA 4L2YA 4WNGA 2X6IA 2L6BA 1VF8A 3TCZA 2OFNA 4A1SA 4LERA 3G2TA 1K8KG 3QWWA 2IO3C 2AW6A 3LUOA 3VLFA 1MX2A 1E7VA 3S7DA 2C0LA 2WLZA 3AG2E 4IQCA 1OXJA 4DX2A 4Y6WA 4J8SA 1N4RA 1NWTA 4FLHA 4URIA 2NSZA 3APDA 1HJXA 4UI9K 5FQ4A 4N5CA 3V2XA 3RM4A 3FEYA 5ITZF 3FTSA 3VLEA 4S3JA 3Q47B 4Z2IA 4GAAA 3ARXA 4MKTA 5DIZA 3CV0A 1N4SA 3NBNB 2CG2A 1MJ0A 4OVVA 1FFQA 3UM2A 5CEAA 4TYOA 1HG5A 5FZSA 3FULA 2V4LA 1FJDA 2VGEA 4Q7NA 1K9TA 3SFYA 3OXGA 2NYJA 5J08A 4P8UA 3FUNA 4HB5A 4M3OA 4QIBA 1P5QA 5JMND 1A7XA 4FADA 3AS3A 3IHVA 1YMPA 3U4TA 1U3DA 2PZIA 3BEEA 3CVPA 3EIJA 3R9AB 2OVFA 1QZ2A 2XPZA 4OVUA 1XNFA 1OT8A 2XS8A 2R02A 1FT2A 3J5QB 3IBEA 3LY9A 2P9SG 3CVWA 4CT4A 1Q6IA 4TW6A 4D10C 3AG4E 2PI6A 4AJWA 3ABKE 2VSYA 3WIJA 2ZQVA 4U85A 1JCQA 2G8ZA 2H6HA 5HWCA 3BUAA 2KE0A 2V5FA 3TXNA 4OYSA 3IK8A 5DF0A 1HF8A 1U3CA 2H6FA 3RK6A 5HW8A 5BUZA 2PV1A 4AY6A 4HRNA 3PUJA 1A17A 4HLEA 2WXOA 3ARUA 4ACLA 4GZCA 2X6KA 2LAHA 3SO8A 4GZ6A 2J08A 1E6ZA 3TGOA 3CGMA 4TUUA 3SF4A 1JCRA 4HI8A 2K8IA 5LX8A 1NMWA 4W9QA 4ZPVR 4JA7A 2XP3A 1H6KA 2J07A 1E44A 4G11A 4U96D 3HHMA 5HTGA 3G2SA 4PDXA 1KZPA 4DX6D 4DRKA 4DH0A 4KZCA 4F53A 5HRYA 5FQ6A 1HKIA 4BT9A 2ITKA 4QT2A 1FAPA 3HXEA 3SZ7A 3FUIA 4C0EA 4YNDA 4ANWA 4MRUA 3NQPA 2IFUA 3SNXA 3ZXSA 4UQXA 4J6IA 3OAWA 1QQEA 3TG4A 2B31A 4KBQA 1ELWA 5E76A 4XKBA 3PA7A 2DSVA 3KAGA 3IHYA 2GRPB 2YINA 2PN0A 4DX7D 4J4NA 3DXKG 3IHZA 3BG1B 1LF8A 1RW2A 3DSUA 2P9KG 2RUDA 1LTXA 1S64A 1SA5A 2WXLA 1WDYA 1FFRA 4LEUA 4ILIA 4PTMA 4XI0A 4ODRA 4FHJA 1SVXA 3SHFA 2RURA 4TUMA 5EDSA 5KWDA 4I2WA 1N1AA 3HVEA 2WMOA 4DRPA 3TWVA 2XP4A 1N4QA 3OXFA 3KZ7A 4AY5A 1U2VG 1M5YA 5HS0A 3X2QE 3SFXA 3GZ2A 5EX3A 3CR3A 3ARYA 2HR2A 1TN7A 4BESA 5CERB 3R9MA 4X8QA 3SBSA 4RQIA 2F2DA 2D9FA 1BI8B 3EUVA 2CHZA 1E6PA 3B8SA 4U07A 4ODOA 1GOIA 4OAVB 4RSYA 1L1PA 2R59A 5D0QD 1SYTA 5B1BE 3IV0A 5HT1A 2XPIA 2WVIA 3E33A 2Y0BG 1O5MA 3U64A 2QY7A 3CHPA 4WWPA 5ENPD 2BUGA 5D75A 3O5GA 4Z68A 3ZYKA 4W9OA 3E30A 4Q94A 2EULA 2MLYA 1NA0A 3QWVA 1SW6A 3B13A 4XX5A 3LEWA 4RG9A 2IEJA 2BEDA 4N3AA 2WK2A 4GMLA 2LSVA 1H0IA 4EZKA 4L3NA 3LVQE 3E32A 1FKIA 2KM4A 3UT4A 3CHFA 2DZNA 3Q73A 4KZ0A 5LCWC 2IQCA 4ODPA 4LAXA 2XP5A 1WAWA 1JNEA 3TAXA 3QB2A 5ENTD 2KZTB 4DIPA 3CIAA 4E85A 2ETBA 2KBXA 4EBAA 3APCA 1WNOA 3UPVA 4JFJA 4RVBA 3ULEG 3PZ3A 3Q7AA 2WQ7A 1SR0A 4JPSA 1H0AA 5EYLA 4U86A 1MQSA 4G23A 1H6OA 2H6GA 1HXVA 2FF4A 3MKRA 4GTMA 4P29A 5LFAA 3GPKA 3S7FA 4WWOA 2P9NG 3ASFA 5HW7A 4JEUA 3AS1A 3RJVA 4IT6A 3L17A 2WMNA 2AVPA 3GW4A 5LCWJ 5D2MC 3ONKA 3S7JA 4KT6B 3FAPA 4Z2JA 3CHRA 1ZBWA 3MYVA 2WXGA 2XP8A 3O5LA 1JUQA 4AV7A 5JHBA 2ZISA 1YW5A 2O9OA 5KJNA 4ABNA 1TJFA 3FU0A 2QFCA 2WQ6A 5G04C 2GRRB 3CGHA 5LOZA 2PV3A 3WQVA 4BT8A 2DPEA 3G6MA 2QF8A 1BU9A 4MNLA 2JZVA 3PRZA 4L9PA 2ZR4A 2MLZA 1IHGA 1O1SA 5M72A 3FUJA 1Z3YA 3HXCA 3KD7A 4I1AA 3NF1A 5EKQD 3ZFWA 4FJYA 3HG0D 2LKNA 3ARQA 3R7QA 5HBFA 1SQMA 2ETCA 1UN8A 1FD9A 2WPVA 3BU8A 2XGSA 1ZBCA 4FA6A 4GA2A 4CGWA 3RRNB 5ENOD 2L0IA 2XPBA 2UY1B 5AN8A 2KZTA 2DCPA 4NRHB 3JQ1A 3CQCB 4GZ5A 2XRZA 5AAOA 2PL2A 3CK7A 5BXOA 2PQNA 4E6HA 4TRQA 5G04J 4ATGA 1DCEA 4TW8A 1OWOA 3UKRG 2AXVA 4GIVA 4DRQA 4GTTA 3CK9A 3B7XA 3FFLA 5DEZA 4XAKA 1ROTA 3LJ3A 2GRLA 3CHQA 4GTOA 4O60A 1LQ0A 1OWNA 4J8FA 4G1TA 4IT4A 3P2BA 2F8XK 2E0IA 5FZRA 1PC2A 3ML9A 4IN3B 2WXPA 2XEVA 3I3NA 4XI9A 2XENA 3L54A 3D3MA 3KAIA 3IKGA 2LXMA 3AS8A 3KADA 3ZGQA 1H6PA 4G2VA 3U66A 2V8SE 1HKMA 3PZ1A 2ZU6B 5EYPF 2KFWA 1LL7A 4G24A 1C9HA 4GTQA 1PY1A 3FXYA 1W9UA 3SI5A 2GGFA 3JYJA 3JYMA 4J0UA 5KJMA 2V0PA 3O5PA 1MX6A 4XKCA 1ZBPA 3D9KA 1ZCNA 4JFIA 5KNHD 4JZYA 4BF8A 1Y0OA 2ZGDA 3DXMG 4NNRA 1QYMA 3ONLA 1WAO1 3Q79A 3WG7E 4NZCA 5KJKA 4TNSA 1JPLA 3T8MA 4GZ3A 2UY1A 2KCKA 2EQXA 2BKGA 2PQRA 3O5QA 5ANLA 4WAFA 3UINC 4DWSD 1SA4A 1W1VA 3QOUA 2MHKA 1TFVA 4ZS6A 3FEXA 2RUQA 3KSQA 1VDYA 3T8KA 4YVQC 4BFRA 4GA1A 3FY1A 2WLYA 5ARFA 4UWGA 1YCSB 3UMVA 5AYWD 3CHSA 3KEZA 2IF4A 2I1JA 3VLDA 2LGOA 3RIBA 4LAVA 1EIBA 3UT8A 3E4BA 2GRNB 3U9WA 3ASOE 2WXKA 3P1UA 4H7XA 2YBUA 4U04A 5ENRD 4ATZD 1TCOC 4G8LA 3AQUA 1J6YA 4I2ZA 1PAQA 3DSTA 3TWXA 4TW7A 2P58C 3RO3A 4LNGA 3GZ1A 4UDMA 2XCCA 4YDYA 1IXVA 3ARVA 3CHOA 3D9IA 3KAHA 3NB2A 3MDYB 3LPZA 3ZW3A 4MNMA 2VCDA 2XQ0A 1NZNA 3OXLA 4UQYA 5HQ8A 1GPFA 2R05A 1MHQA 2F4EA 4FULA 1D7JA 2ZIRA 3QWPA 4AEZC 5AJDA 4L23A 2KR7A 3CVNA 2A3EA 1A5EA 3TC5A 1HZ4A 3SQVA 2DG3A 3CVQA 3L6AA 2WXMA 3TWWA 2ESCA 3S2AA 1ROUA 1W1YA 1FKBA 2Y1LE 1RD6A 4JC8A 4HNAD 1FKLA 4GYWA 1JCHB 3O5JA 3MEKA 4ME2A 3O5OA 2R17C 2AWIA 2MPHA 3FH5A 1UOHA 4C02B 4ODQA 1WM5A 1NL4A 3WD0A 2ONDA 3QAQA 2F23A 5AENA 2MLXA 3WL1A 1TNZA 3HDXA 1TJCA 4KVMA 3B7BA 3EY6A 3UX4A 3RFWA 4B0ZA 3ARZA 1EQ3A 1ZK6A 5A23A 4TXPA 4I9CA 2J4DA 3FTZA 4I6GA 4PS8A 4JD2G 4WUYA 2J9QA 4LGXA 3PRAA 3B7RL 4UWLA 5HUAA 3LS8A 2I2OA 4U63A 2PPOA 3ODKA 4QT3A 1W9VA 3UQIA 3PR9A 1Z3XA 3ML8A 1IHBA 3JYSA 4N3CA 3AS2A 1S0PA 5D0OD 1Y6IA 2HE0A 4C9BB 4GCNA 2CHXA 2BKKB 4NURA 3FU5A 3GTYX 5G55A 3PE3A 4CZ2D 1NH6A 2DVWA 3MV2B 3ALFA 2IUZA 4MNKA 1IYGA 4ANUA 2A3CA 4N2QA 3S7BA 4L2LA 3DSWA 4MBGA 4HOSA 2R5SA 3FUHA 1X5BA 3J5PA 3UTMA 1UJJA 3LKUA 1ZU2A 1QNFA 4U95D 4FJZA 5JA4D 3WQWA 2XPAA 1F40A 1J4RA 4HOUA 1E8XA 2IO2C 1H0GA 2VGXB 4GA0A 3RSEG 4N39A 4IRUA 3D9LA 5H7PA 3Q9UC 4HS2A 3C72A 3NOGD 3T9KA 1Z6TA 4GU5A 3ZXPA 2L6JA 2LSUA 5KJLA 2AJAA 4O6FA 2CHWA 5E75A 1TNUA 1O1RA 4DLOA 2X6HA 1TN8A 3L08A 1UN9A 2DBAA 4G25A 3C98A 3EHNA 1OCZE 4ODKA 2FAPA 3GU0A 2DT1A 3G2VA 3RRMB 1D7HA 4F6RD 3FTVA 5CCLA 3W4RA 4FAPA 2ZR6A 3TWUA 3EHMA 5AQ9A 4ILGA 4DWSC 2PM6A 4I6JA 5KBAA 2X38A 3T5XA 2Y69E 2VYIA 4U8VD 1H2VC 2XP6A 3WD1A 3EJNA 3HYMB 5FINA 4WNEA 4K5BA 4H7YA 5HW6A 2PM7A 1R9HA 3EIQC 2PNNA 4V3IA 2F8YA 1UG3A 4A3VA 4J4OA 1G3NB 5KNGA 2WXJA 3NRKA 4LSZE 1HKKA 1O1TA 1JNDA 1INZA 1XRVA 1D7IA 4ANVA 5D66A 4EQFA 3ASDA 4R0XA 4LAYA 3ALGA 4F1PA 4KMOA 2DT2A 5B8IC 4MNJA 1KFWA 4F1SA 4HLLA 3CZ8A 3CH9A 4BY6A 5FTPA 5FT9A 1NA3A 2VGXA 3E37A 3CKBA 1FCHA 3PUKA 4GCOA 2EILE 4I17A 5AQ7A 3C3OA 3D9JA 2EIME 1H2TC 3WXXA 1NMVA 4DZ2A 2KC7A 3Q7FA 3RMEA 5ENQD 3Q4AB 4CDNA 1EDUA 4KYOB 3PZDA 3CHMA 2KI3A 2WXIA 1Q6UA 5EN5D 2YHEA 2FEZA 1E15A 1FKHA 1NP7A 3PRBA 3B7SA 4DRJA 1D8DA 1GW6A 3D9NA 4ZPWR 1E96B 3TWTA 3EIPA 2Y78A 4BSZB 1D8EA 2F37A 1ZL1A 4U0ZA 4MS6A 1BI7B 3AS4A 4DT4A 2GW1A 2GROB 3LXUX 4YDOA 3L16A 4J7WA 2DSZA 4ITZA 5ENSD 2AWGA 2R2LA 3HXFA 2NXPA 5KCMA 4BETA 1NFIE 2Y3AA 3LJNA 1QPLA 2KATA 5CMWA 4KXKB 3ZNGA 3Q5MA 3CHEA 2XGMA 1IQUA 3AU5A 3LDZA 1FKKA 2IOSA 4K03A 3I4RB 2V4HC 3MA5A 4K5CA 2ZQSA 3QJZA 4GTVA 3U3WA 1JVWA 3RM8A 1AWCB 1UW4B 4GYYA 3I6CA 3ZIMA 2FDMA 5HKGA 1HS6A 2AOSA 1Y8MA 1D2KA 3O5FA 4CCAA 3WKZA 3UI6A 4C0MA 1YA0A 2MOWA 3HRAA 3PZ4A 2M1IA 1W1PA 3JXIA 4Z2LA 3CEQA 2YHCA 4WKFA 4I43A 4G26A 1TR4A 4ZFHA 2XP7A 3AS0A 2WM0A 4AIFA 4FLBA 3O5EA 4EECA 1HJWA 4J8YA 2YBTA 3K9IA 4GPMA 5J90A 3PDNA 2KO7A 1EDQA 3MKQB 3FUEA 3KAEA 3LVRE 4GTPA 4KVOA 3JUEA 4IULA 4CT0A 2CFZA 4P8VA 3ARWA 3FDHA 4LUNU 1FKGA 1HU3A 5CMYA 4JFKA 3WD3A 3G2WA 4HXIA 2QYUA 2KCLA 2Q5AA 3FHEA 1HJVA 2J8SD 3B9AA 1N52A 3CHCA 2WXRA 1N94A 4IQ2A 3DBSA 5GPGA 4CGVA 4WNFA 3V31A 4ODMA 3Q49B 4XE0A 4GTSA 1LD7A 4DWSB 2B0OE 4R5EA 4U8YD 5IY5E 2RQSA 3RRUA 1K3ZD 4Y6CA 3O5RA 4XIFA 4OAUC 4B8AA 3ZU7B 5CRVA 4JYSA 3MJWA 4L72B 2X3MA 3KSLA 3WD4A 2QZAA 3FTUA 5HI7A 3HIZA 5FQ8A 4QFVA 3FUDA 3TL5A 2JLBA 2IY0C 4C48B 3FH7A 3JCKC 2WXFA 3FP3A 1XHGA 3ZEFA 1N95A 2Q7FA 4W9RA 3DEOA 5BW8C 3DSVA 4JVSA 4N5QA 3CVYA 3BQOA 1MYOA 3ZRHA 5AIJA 4Q96A 4APFA 3ZPJA 2P9PG 2J4BA 3ABLE 2XS1A 2CFUA 4U0UA 4LNBA 3KS2A 5JJTA 3HXDA 4PS7A 4J8EA 4JFMA 1OWPA 3W9FA 3DWLG 4A3TA 3DRAA 3AAAC 4Q69A 2PPNA 5I98A 3F6QA 4JHJA 4DI4A 4TXRA 4TV3A 3AS5A 5AJLA 1MX4A 2IU1A 5FIOA 4A63B 4L1BA 4QQIA 5AQAA 4DX5D 2XRYA 1OWLA 3UXGA 2O92A 4HBEA 4G8KA 1LG1A 3ASHA 5BV1A 5LP0A 3PREA 3CGNA 4P8XA 2ZR5A 1HG2A 3UI4A 5GQBA 2LUHA 3DEPA 3ZVVA 1QPFA 2DWZA 3SFZA 1KPSB 3CVXA 2EINE 1YYHA 3AROA 4NACA 2KXPC 2WB2A 3ZYMA 3D9HA 3ZYLA 4M7CA 4DWSA 4DRNA 1SZ9A 2DZOA 4KR0B 3H9RB 3URZA 3SGHA 3SD5A 2XCBA 2DSUA 3MZLB 3AJIA 3ARPA 1HXIA 3OA5A 1ZBKA 3B9EA 2DG9A 3CSFA 4WKAA 4HRLA 4JW1A 3ENEA 4CDMA 1TYQG 3ISMC 3KABA 4B8CB 2VQ2A 1TNOA 3NZUA 2HM8A 2P4VA 3KACA 4MPKA 1E6RA 1EF1C 4WIWA 2VSOE 1E6NA 2RD0A 2GRQB 3IKDA 3GZSA 4GGQA 3EDTB 3D9PA 2R03A 3TWRA 1Q6HA 4EHMA 3CVUA 3AG1E 4HORA 1OWQA 3CKCA 5FQ7A 3I5PA 1MZCA 3VTYA 3PZ2A 2DT0A 5BXUA 1DVPA 4O2TA 2ILRA 2UZ5A 4GTRA 1TEZA 1ZU8A 4AOFA 3DPDA 1D9SA 5DBKA 2XEEA 3PNTB 1K1BA 3NTPA 4UI9C 1E8YA 2AXZA 1TN6A 4ILHB 3O5DA 5T3RA 3ZKJA 3VTXA 3Q15A 4I1OB 3CVLA 1HFAA 4DK5A 1XGWA 3Q9NC 4FU3A 3CHDA 4LAWA 4YVOA 1N11A 3RU0A 3DSSA 4LNUD 4B94A 4BERA 1OY3D 3MCXA 3ZN3A 3FUFA 1JCSA 2UWJG 1IQRA 3PRDA 3G6LA 1AP7A 5J6EA 1JWFA 4G50A 1W1TA 3LCAA 2M63A 2OV8A 3PEVB 5GPRA 2IOLA 2OEWA 4NSBA 4I1MA 2I9CA 4U8HA 2FKEA 3FUKA 4UI9J 4KQZA 4BWRA 2V5QC 3CVVA 5BXJA 2DYRE 3MGBA 1KLXA 4MLPA 5DIVA 5G05C 3HVEB 1FKDA 1FKJA 3NAWA 2A4ZA 4W5UA 3VAWA 5EIBE 2VJ8A 1TNBA 4U84A 4HFGA 1OWMA 1LD8A 4AM9A 3I4GA 2Y4TA 2DYSE 1S63A 2A3BA 4GMRA 2RG8A 3L22A 3QKYA 3UQBA 3UM3A 3TWSA 2P9IG 4DRIA 4BX9A 2A5EA 4BEPA 4PH4B 4NIKA 1WB0A 1H2UA 1DCQA 2ETNA 2MRIA 4UWFA 1HX8A 4PUCA 5CBOA 2F21A 4JB8P 4JXTA 1HH8A 5JJ6A 2WXHA 1NWRA 4HBOA 1FVFA 3Q78A 5ANRA 1FT1A 3MX3A 1OGGA 5AARA 4DROA 1OGBA 5G05J 3TJPA 3UKUG 3ULYA 4EBAG 3T5VA 1S70B 4UWKA 3QOKA 4J8DA 2G41A 3UM0A 3ARRA 4O1OA 2A3AA 2I1KA 4TXQA 4HI9A 3L82A 1LJYA 1HO8A 3C3RA 5CEDB 2FO1E 2BF0X 4BX8A 1Q2ZA 3SBTB 2WM9A 4F7AA 4A1GA 3EU5A 3HXBA 5CCMA 4DRMA 1UJKA 3TXMA 5BNWA 1EPUA 1FKRA 3IEGA 2IJGX 2ZGGA 2XP9A 2M08A 5FZQA 1W9PA 4UWHA 3QC1A 1E8WA 4ODNA 4DRHA 2XHEA 4B93B 2OCCE 4WNDA 5B1AE 3FU6A 1NSGA 4EPZA 3UQAA 1V55E 3EHRA 5FWQA 3LY7A 4XZ4A 2P9UG 2CG3A 4DUIA 4EZLA 1BL4A 1LL4A 4L7TA 2EIKE 4A55A 1NI1A 1BPOA 2VSXE 4HRMB 4IPXA 2FBNA 4HBDA 3AG3E 4JFLA 1N0RA 2OVBA 1X81A 2I6HA 3NZSA 4GYOA 3UI2A 1LL6A 2LJ4A 5ENNA 1N9AA 2YNQA 4MSPA 1JNTA 2RKKA 2ZQTA 3E34A 2ZXWE 1JNSA 3FTXA 2E2EA 2FO7A 4URKA 1EYHA 3ZYQA 4NQ0A 3D9MA 1DNPA 5CBNA 3UIOC 1OUVA 3QK0A 4DLQA 3RM9A 4DX1A 1H19A 4Q22A 1N54A 4AVXA 4DZ3A 3UF8A 4MGVA 3OTNA 1UR8A 2DSWA 2VN1A 1NWUA 5ARGA 5CECB 1E9LA 2Y4UA 1PINA 4AXHA 4WKHA 2A5UA 2X6JA 3PVLA 5JH8A 5EIDA 4GB9A 3CLJA 1HE8A 3ESKA 5BV0A 2FI7A 3ZUVB 1OCCE 1OCRE 4Z2GA 4K0RA 3ASNE 3FWVA 4FHKA 3FTYA 2IONA 2QYJA 2ETAA 4Z2HA 3ABME 3PE4A 3C3QA 3V79K 1FPPA 2RUCA 1X6LA 2XZTG 3N71A 1SZAA 3RO2A 5HWBA 3FUMA 1D6OA 3QNKA 3Q75A 1LG2A 4K5AB 2ZQUA 3IKOB 3L9TA 5JJ7A 3O48A 3DPYA 2XZDG 3G2UA 2LO6A 1E8ZA 4HQDA 5HKPA 2HYZA 4N3BA 1ZB5A 1GUVA 4R7LA 1CTNA 1ELRA 4YDWA 5AQBA 5T8IA 1F8AB 2B5UB 1EYMA 5DITA 2XGOA 3JXJA 1ZBVA 3UIPC 1QBQA 5BT1A 3TDBA 2HO1A 3ZHEB 4BTBA 3RAUA 2JEKA 3EHQA 2M2AA 2LAIA 1W3BA 1BD8A 2C2LA 3OOBA 4F3VA 4JA9A 2OLHA 3ARSA 5DO2A 1ITXA 4GPKA 3ULQA 2DIWA 2XEHA 1BKFA 3FU3A 4B89A 4WJXA 1PBKA 5DIUA 1YATA 3UQ3A 4BTAA 3B9DA 1ELKA 4WWNA 1BLXB 3WL0A 3KEAA 3QDNA 3RGCA 4O1PA 4PS3A 2YQ8A 2WXNA 3ASGA 1TNYA 3CK8A 3PS6A 3KAFA 2VTBB 2LXLA 4TX0A 1FKTA 2DG4A 1KZOA 3CQGB 1FKFA 3V30A 4DPRA 2J49A 4JHKA 5A6CA 4HVBA 4ZPTR 4LRZA 4CEMA 3UM1A 2B6CA 4W9PA 1FVHA 2L9BA
chains in the Genus database with same CATH topology
4G2PA 1J4HA 4GZDA 4CDRA 5A7DB 3LYAA 4IYPA 2MNTA 2KCVA 3PNLB 4JEHA 1KT0A 2PBCA 4ACKA 2RSEA 3UI5A 3O5MA 3ESLA 1JWGA 4DJAA 4WK9A 3JQ0A 2L0TB 1WY6A 3FTWA 3O5IA 5C1DA 1UR9A 3UT7A 3BXWA 4UQZA 2J09A 2PV2A 1KT1A 3APFA 1X6NA 4GMJA 4I6EA 3D9OA 4AY1A 4BSXA 4QZVB 1E90A 3WH0A 3ZHEA 3B7UX 4ODLA 4U0SA 2NC9A 3GYZA 4N2SA 4RG6A 4JHRA 2LPVA 2N87A 4FP7A 1L5JA 3AU4A 2BTDA 2AXUA 4P8WA 2KGJA 5FJYA 3QARA 1E7UA 1U79A 4I9EA 3NI6A 3LY8A 1W26A 4S3KA 3O5KA 3FY4A 4FC8A 3JXVA 4CRWA 4FN2A 3MKQA 2VTBA 4Z2KA 3JUIA 4LCTA 4MAVA 3WD2A 2VGYA 3R7RA 3UUXA 2OOEA 5G2NA 2FULA 2VSNA 2WXQA 1T11A 1O6IA 5CHEE 2X6FA 3RKVA 1J4IA 3BG0B 4JL0A 5EX0A 3ARTA 4HOQA 4EZJA 2PPPA 1IX5A 5JHAA 1FKSA 2C0MA 2XPYA 3KCEA 3PH0C 3MV3B 4HARA 1NWSA 5T4YA 2MF9A 4ANXA 1Q1CA 2L2SA 4N19A 3O4ZA 3CSTA 3B7TA 2LNIA 4MTVA 5BPPA 3TG5A 4DI3A 4APOA 1EHNA 3L13A 2DT3A 4ML4A 3PEUB 1B6CA 4AP2A 4HOTA 3FH8A 1B89A 5C2YA 2GRMA 1HKJA 2WQHA 4L2YA 4WNGA 2X6IA 1VF8A 3TCZA 2OFNA 4A1SA 4LERA 3G2TA 3QWWA 2AW6A 3LUOA 3VLFA 1E7VA 3S7DA 2C0LA 2WLZA 4IQCA 4Y6WA 4J8SA 1NWTA 4FLHA 4URIA 2NSZA 3APDA 1HJXA 4UI9K 5FQ4A 4N5CA 3RM4A 3FEYA 3FTSA 3VLEA 4S3JA 3Q47B 4Z2IA 4GAAA 3ARXA 4MKTA 5DIZA 3CV0A 2CG2A 4OVVA 1FFQA 4TYOA 1HG5A 5FZSA 3FULA 2V4LA 1FJDA 4Q7NA 1K9TA 3OXGA 5J08A 4P8UA 3FUNA 4M3OA 4QIBA 1P5QA 1A7XA 4FADA 3AS3A 3IHVA 3U4TA 1U3DA 2PZIA 3BEEA 3CVPA 3EIJA 3R9AB 2OVFA 1QZ2A 2XPZA 4OVUA 1XNFA 3IBEA 3LY9A 3CVWA 4CT4A 1Q6IA 4TW6A 4D10C 2PI6A 4AJWA 2VSYA 3WIJA 2ZQVA 4U85A 2G8ZA 5HWCA 2KE0A 2V5FA 3TXNA 4OYSA 3IK8A 5DF0A 1HF8A 1U3CA 3RK6A 5HW8A 5BUZA 2PV1A 4AY6A 3PUJA 1A17A 4HLEA 2WXOA 3ARUA 4ACLA 4GZCA 2X6KA 2LAHA 4GZ6A 2J08A 1E6ZA 3TGOA 3CGMA 4TUUA 3SF4A 2K8IA 5LX8A 1NMWA 4W9QA 4ZPVR 4JA7A 2XP3A 1H6KA 2J07A 4G11A 3HHMA 5HTGA 3G2SA 4PDXA 4DRKA 4DH0A 4KZCA 4F53A 5FQ6A 1HKIA 4BT9A 2ITKA 4QT2A 1FAPA 3SZ7A 3FUIA 4C0EA 4YNDA 4ANWA 4MRUA 3NQPA 2IFUA 3SNXA 3ZXSA 4UQXA 4J6IA 3OAWA 1QQEA 3TG4A 2B31A 4KBQA 1ELWA 5E76A 4XKBA 3PA7A 2DSVA 3KAGA 3IHYA 2YINA 4J4NA 3IHZA 3BG1B 1LF8A 2RUDA 2WXLA 1FFRA 4LEUA 4ILIA 4PTMA 4XI0A 4ODRA 4FHJA 3SHFA 2RURA 5EDSA 4I2WA 1N1AA 3HVEA 2WMOA 4DRPA 2XP4A 3OXFA 3KZ7A 4AY5A 1M5YA 3GZ2A 5EX3A 3CR3A 3ARYA 2HR2A 3SBSA 2F2DA 2D9FA 2CHZA 1E6PA 3B8SA 4U07A 4ODOA 1GOIA 4RSYA 1L1PA 2R59A 5D0QD 1SYTA 3IV0A 5HT1A 2XPIA 2WVIA 3U64A 2QY7A 3CHPA 4WWPA 2BUGA 5D75A 3O5GA 3ZYKA 4W9OA 4Q94A 2MLYA 1NA0A 3QWVA 3B13A 4XX5A 3LEWA 4RG9A 4N3AA 2WK2A 4GMLA 2LSVA 1H0IA 4EZKA 4L3NA 3LVQE 1FKIA 2KM4A 3UT4A 3CHFA 4KZ0A 5LCWC 2IQCA 4ODPA 4LAXA 2XP5A 1WAWA 1JNEA 3TAXA 3QB2A 2KZTB 4DIPA 3CIAA 4E85A 4EBAA 3APCA 1WNOA 3UPVA 4JFJA 4RVBA 2WQ7A 1SR0A 4JPSA 1H0AA 4U86A 1MQSA 4G23A 1HXVA 2FF4A 3MKRA 4P29A 5LFAA 3GPKA 3S7FA 4WWOA 5HW7A 3ASFA 4JEUA 3AS1A 3RJVA 4IT6A 3L17A 2WMNA 2AVPA 3GW4A 5LCWJ 3S7JA 3ONKA 4KT6B 3FAPA 4Z2JA 3CHRA 1ZBWA 3MYVA 2WXGA 2XP8A 3O5LA 1JUQA 4AV7A 5JHBA 1YW5A 2O9OA 5KJNA 4ABNA 1TJFA 3FU0A 2QFCA 2WQ6A 5G04C 3CGHA 3WQVA 5LOZA 2PV3A 4BT8A 2DPEA 3G6MA 2QF8A 4MNLA 2JZVA 3PRZA 2ZR4A 2MLZA 1IHGA 5M72A 3FUJA 1Z3YA 3KD7A 4I1AA 3NF1A 5EKQD 3ZFWA 4FJYA 2LKNA 3ARQA 3R7QA 5HBFA 1SQMA 1UN8A 1FD9A 2WPVA 2XGSA 1ZBCA 4FA6A 4GA2A 4CGWA 3RRNB 2L0IA 2XPBA 2UY1B 2KZTA 2DCPA 4NRHB 3JQ1A 3CQCB 4GZ5A 2XRZA 2PL2A 3CK7A 2PQNA 4E6HA 4TRQA 5G04J 4ATGA 4TW8A 1OWOA 2AXVA 4GIVA 4DRQA 3CK9A 3B7XA 3FFLA 5DEZA 4XAKA 1ROTA 3LJ3A 2GRLA 3CHQA 1LQ0A 1OWNA 4J8FA 4G1TA 4IT4A 3P2BA 2E0IA 5FZRA 1PC2A 3ML9A 4IN3B 2WXPA 2XEVA 3I3NA 4XI9A 3L54A 3D3MA 3KAIA 3IKGA 3AS8A 3KADA 3ZGQA 4G2VA 3U66A 2V8SE 1HKMA 2ZU6B 2KFWA 1LL7A 4G24A 1C9HA 1PY1A 3FXYA 1W9UA 3SI5A 2GGFA 3JYJA 3JYMA 4J0UA 5KJMA 2V0PA 3O5PA 4XKCA 1ZBPA 3D9KA 1ZCNA 4JFIA 4JZYA 4BF8A 1Y0OA 4NNRA 3ONLA 1WAO1 4NZCA 5KJKA 4TNSA 1JPLA 3T8MA 4GZ3A 2UY1A 2KCKA 2EQXA 2PQRA 3O5QA 5ANLA 4WAFA 4DWSD 1W1VA 3QOUA 2MHKA 1TFVA 4ZS6A 3FEXA 2RUQA 1VDYA 4YVQC 3FY1A 4BFRA 4GA1A 2WLYA 5ARFA 4UWGA 3UMVA 5AYWD 3CHSA 3KEZA 2IF4A 2I1JA 3VLDA 2LGOA 3RIBA 4LAVA 1EIBA 3UT8A 3E4BA 3U9WA 2WXKA 3P1UA 4H7XA 2YBUA 4U04A 1TCOC 3AQUA 1J6YA 4I2ZA 1PAQA 4TW7A 2P58C 3RO3A 3GZ1A 2XCCA 3ARVA 3CHOA 3D9IA 3KAHA 3MDYB 3LPZA 3ZW3A 4MNMA 2VCDA 2XQ0A 1NZNA 3OXLA 4UQYA 5HQ8A 1GPFA 1MHQA 2F4EA 4FULA 1D7JA 3QWPA 4AEZC 5AJDA 4L23A 2KR7A 3CVNA 2A3EA 3TC5A 1HZ4A 2DG3A 3CVQA 3L6AA 2WXMA 2ESCA 3S2AA 1ROUA 1W1YA 1FKBA 1RD6A 4JC8A 1FKLA 4GYWA 3O5JA 3MEKA 4ME2A 3O5OA 2R17C 2AWIA 2MPHA 3FH5A 4C02B 4ODQA 1WM5A 3WD0A 2ONDA 3QAQA 5AENA 2MLXA 3WL1A 3HDXA 1TJCA 4KVMA 3EY6A 3UX4A 3RFWA 4B0ZA 3ARZA 1EQ3A 1ZK6A 5A23A 4I9CA 2J4DA 3FTZA 4I6GA 4PS8A 4WUYA 2J9QA 4LGXA 3PRAA 3B7RL 4UWLA 5HUAA 3LS8A 2I2OA 4U63A 2PPOA 3ODKA 4QT3A 1W9VA 3UQIA 3PR9A 1Z3XA 3ML8A 3JYSA 4N3CA 3AS2A 1S0PA 5D0OD 1Y6IA 4C9BB 4GCNA 2CHXA 4NURA 3FU5A 5G55A 3PE3A 1NH6A 3MV2B 3ALFA 2IUZA 4MNKA 1IYGA 4ANUA 2A3CA 4N2QA 3S7BA 4L2LA 4HOSA 2R5SA 3FUHA 1X5BA 1UJJA 3LKUA 1ZU2A 1QNFA 4FJZA 3WQWA 2XPAA 1F40A 1J4RA 4HOUA 1E8XA 1H0GA 2VGXB 4GA0A 4N39A 4IRUA 3D9LA 4HS2A 1Z6TA 4GU5A 2L6JA 2LSUA 5KJLA 4O6FA 2CHWA 5E75A 4DLOA 2X6HA 3L08A 1UN9A 2DBAA 4G25A 3C98A 3EHNA 4ODKA 2FAPA 2DT1A 3G2VA 3RRMB 1D7HA 3FTVA 5CCLA 3W4RA 4FAPA 2ZR6A 3EHMA 4ILGA 4DWSC 2PM6A 4I6JA 2X38A 3T5XA 2VYIA 1H2VC 2XP6A 3WD1A 3EJNA 3HYMB 4WNEA 4H7YA 5HW6A 2PM7A 1R9HA 3EIQC 4V3IA 1UG3A 4A3VA 4J4OA 2WXJA 3NRKA 1HKKA 1JNDA 1INZA 1XRVA 1D7IA 4ANVA 4EQFA 3ASDA 4R0XA 4LAYA 3ALGA 4KMOA 2DT2A 5B8IC 4MNJA 1KFWA 4F1SA 3CZ8A 3CH9A 4BY6A 5FTPA 5FT9A 1NA3A 2VGXA 3CKBA 1FCHA 3PUKA 4GCOA 4I17A 3D9JA 1H2TC 3WXXA 1NMVA 4DZ2A 2KC7A 3RMEA 3Q4AB 4CDNA 1EDUA 4KYOB 3PZDA 3CHMA 2KI3A 2WXIA 1Q6UA 2YHEA 2FEZA 1E15A 1FKHA 1NP7A 3PRBA 3B7SA 4DRJA 1GW6A 3D9NA 4ZPWR 1E96B 2Y78A 1ZL1A 4U0ZA 4MS6A 3AS4A 4DT4A 2GW1A 3LXUX 3L16A 2DSZA 4ITZA 2AWGA 2NXPA 5KCMA 2Y3AA 1QPLA 2KATA 5CMWA 4KXKB 3CHEA 3Q5MA 2XGMA 1IQUA 3AU5A 3LDZA 1FKKA 2IOSA 4K03A 3I4RB 3MA5A 2ZQSA 3QJZA 3U3WA 1JVWA 3RM8A 1UW4B 4GYYA 3I6CA 3ZIMA 2FDMA 5HKGA 1HS6A 2AOSA 1Y8MA 1D2KA 3O5FA 4CCAA 3WKZA 3UI6A 4C0MA 1YA0A 2MOWA 2M1IA 1W1PA 4Z2LA 3CEQA 2YHCA 4WKFA 4I43A 4G26A 2XP7A 3AS0A 2WM0A 4AIFA 4FLBA 3O5EA 4EECA 1HJWA 2YBTA 3K9IA 5J90A 3PDNA 2KO7A 1EDQA 3MKQB 3FUEA 3KAEA 3LVRE 4KVOA 4IULA 4CT0A 2CFZA 4P8VA 3ARWA 3FDHA 4LUNU 1FKGA 1HU3A 5CMYA 4JFKA 3WD3A 3G2WA 4HXIA 2KCLA 2Q5AA 3FHEA 1HJVA 3B9AA 1N52A 3CHCA 2WXRA 4IQ2A 3DBSA 5GPGA 4WNFA 4ODMA 3Q49B 4XE0A 4DWSB 4R5EA 2RQSA 3RRUA 4Y6CA 3O5RA 4XIFA 4B8AA 4JYSA 3MJWA 4L72B 2X3MA 3WD4A 3FTUA 5HI7A 3HIZA 5FQ8A 4QFVA 3FUDA 3TL5A 2JLBA 3FH7A 3JCKC 2WXFA 3FP3A 1XHGA 3ZEFA 2Q7FA 4W9RA 5BW8C 4JVSA 3CVYA 3ZRHA 5AIJA 4Q96A 4APFA 3ZPJA 2J4BA 2CFUA 4U0UA 3KS2A 5JJTA 4PS7A 4J8EA 4JFMA 1OWPA 4A3TA 4Q69A 2PPNA 5I98A 4JHJA 4DI4A 4TV3A 3AS5A 5AJLA 2IU1A 4L1BA 2XRYA 1OWLA 2O92A 4HBEA 1LG1A 3ASHA 5BV1A 5LP0A 3PREA 3CGNA 4P8XA 2ZR5A 1HG2A 3UI4A 5GQBA 3ZVVA 1QPFA 3SFZA 3CVXA 3AROA 4NACA 2WB2A 3ZYMA 3ZYLA 4DWSA 4DRNA 1SZ9A 4KR0B 3H9RB 3URZA 3SGHA 3SD5A 2XCBA 2DSUA 3MZLB 3ARPA 1HXIA 3OA5A 1ZBKA 3B9EA 2DG9A 3CSFA 4WKAA 4JW1A 3ENEA 4CDMA 3KABA 4B8CB 2VQ2A 3NZUA 2HM8A 3KACA 4MPKA 1E6RA 1EF1C 4WIWA 2VSOE 1E6NA 2RD0A 3IKDA 3GZSA 4GGQA 3EDTB 3D9PA 1Q6HA 3CVUA 4HORA 1OWQA 3CKCA 5FQ7A 3I5PA 3VTYA 2DT0A 1DVPA 4O2TA 2ILRA 2UZ5A 1TEZA 1ZU8A 4AOFA 3DPDA 5DBKA 3PNTB 3NTPA 4UI9C 1E8YA 2AXZA 4ILHB 3O5DA 5T3RA 3VTXA 3Q15A 4I1OB 3CVLA 1HFAA 4DK5A 1XGWA 4FU3A 3CHDA 4LAWA 4YVOA 4B94A 3RU0A 3MCXA 3ZN3A 3FUFA 2UWJG 1IQRA 3PRDA 3G6LA 5J6EA 1JWFA 4G50A 1W1TA 3LCAA 2M63A 2OV8A 3PEVB 5GPRA 2IOLA 4NSBA 4I1MA 2I9CA 4U8HA 2FKEA 3FUKA 4UI9J 4KQZA 4BWRA 3CVVA 5BXJA 3MGBA 1KLXA 4MLPA 5DIVA 5G05C 3HVEB 1FKDA 1FKJA 4W5UA 2A4ZA 3VAWA 2VJ8A 4U84A 4HFGA 1OWMA 4AM9A 3I4GA 2Y4TA 2A3BA 2RG8A 3L22A 3QKYA 3UQBA 4DRIA 4BX9A 4PH4B 1WB0A 1H2UA 2MRIA 4UWFA 1HX8A 4PUCA 2F21A 4JXTA 1HH8A 5JJ6A 2WXHA 1NWRA 4HBOA 1FVFA 5ANRA 3MX3A 1OGGA 4DROA 1OGBA 5G05J 3TJPA 4EBAG 3T5VA 4UWKA 3QOKA 4J8DA 2G41A 3ARRA 2A3AA 2I1KA 1LJYA 1HO8A 2BF0X 4BX8A 3SBTB 2WM9A 4F7AA 4A1GA 5CCMA 4DRMA 1UJKA 3TXMA 5BNWA 1EPUA 1FKRA 3IEGA 2IJGX 2XP9A 2M08A 5FZQA 1W9PA 4UWHA 3QC1A 1E8WA 4ODNA 4DRHA 2XHEA 4WNDA 1NSGA 3FU6A 4EPZA 3UQAA 5FWQA 3LY7A 4XZ4A 2CG3A 4EZLA 1BL4A 1LL4A 4L7TA 4A55A 1BPOA 2VSXE 4IPXA 2FBNA 4JFLA 2OVBA 2I6HA 3NZSA 4GYOA 1LL6A 2LJ4A 5ENNA 4MSPA 2YNQA 1JNTA 2ZQTA 1JNSA 3FTXA 2E2EA 2FO7A 4URKA 1EYHA 3ZYQA 4NQ0A 3D9MA 1DNPA 1OUVA 3QK0A 4DLQA 3RM9A 1H19A 4Q22A 1N54A 4AVXA 4DZ3A 3UF8A 4MGVA 3OTNA 1UR8A 2DSWA 2VN1A 1NWUA 5ARGA 1E9LA 2Y4UA 1PINA 4AXHA 4WKHA 2A5UA 2X6JA 3PVLA 5JH8A 4GB9A 3CLJA 1HE8A 3ESKA 5BV0A 2FI7A 4Z2GA 1FVHA 4K0RA 3FWVA 4FHKA 3FTYA 2IONA 4Z2HA 3PE4A 2RUCA 1X6LA 3N71A 1SZAA 3RO2A 5HWBA 3FUMA 1D6OA 3QNKA 1LG2A 2ZQUA 3IKOB 5JJ7A 3O48A 3G2UA 2LO6A 1E8ZA 2HYZA 1ZB5A 4N3BA 1GUVA 4R7LA 1CTNA 1ELRA 5T8IA 1F8AB 5DITA 1EYMA 2XGOA 1ZBVA 5BT1A 3TDBA 2HO1A 3ZHEB 4BTBA 2JEKA 2M2AA 2LAIA 1W3BA 2C2LA 3OOBA 4F3VA 4JA9A 2OLHA 3ARSA 5DO2A 1ITXA 4GPKA 3ULQA 2DIWA 1BKFA 3FU3A 4B89A 4WJXA 1PBKA 5DIUA 1YATA 3UQ3A 4BTAA 3B9DA 1ELKA 4WWNA 3WL0A 3QDNA 3RGCA 4PS3A 2YQ8A 2WXNA 3ASGA 3CK8A 3PS6A 3KAFA 2VTBB 4TX0A 1FKTA 2DG4A 3CQGB 1FKFA 4DPRA 2J49A 4JHKA 5A6CA 4HVBA 4ZPTR 4LRZA 4CEMA 4W9PA 4CGVA 2L9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GCN A;  4G2P A;  1J4H A;  4CDR A;  3H9R B;  3URZ A;  2XCB A;  2BUG A;  5A7D B;  3LYA A;  5D75 A;  1HXI A;  3O5G A;  2MNT A;  3PE3 A;  4W9O A;  2KCV A;  2DG9 A;  3MV2 B;  2MLY A;  1NA0 A;  3QWV A;  1KT0 A;  2PBC A;  2RSE A;  4RG9 A;  3UI5 A;  3O5M A;  3KAB A;  2VQ2 A;  1IYG A;  4N3A A;  4N2Q A;  3S7B A;  2LSV A;  3KAC A;  4HOS A;  2R5S A;  1FKI A;  3O5I A;  3IKD A;  5LCW C;  4ODP A;  3LKU A;  1ZU2 A;  5C1D A;  4LAX A;  2XP5 A;  2XPA A;  4GGQ A;  3TAX A;  1F40 A;  4UQZ A;  1J4R A;  3EDT B;  2PV2 A;  4HOU A;  4DIP A;  1KT1 A;  1Q6H A;  2VGX B;  4GA0 A;  3WH0 A;  4N39 A;  3ZHE A;  4ODL A;  4U0S A;  4HOR A;  2NC9 A;  3GYZ A;  4N2S A;  3UPV A;  3CKC A;  4RG6 A;  4JFJ A;  4JHR A;  3VTY A;  2LPV A;  2N87 A;  2L6J A;  2LSU A;  5KJL A;  4O2T A;  2UZ5 A;  4U86 A;  2KGJ A;  4O6F A;  5FJY A;  4G23 A;  5DBK A;  1U79 A;  2DBA A;  4G25 A;  1HXV A;  2FF4 A;  3MKR A;  4I9E A;  3GPK A;  3NTP A;  3NI6 A;  4UI9 C;  4ODK A;  3S7F A;  5HW7 A;  3LY8 A;  3ASF A;  1W26 A;  2FAP A;  3O5K A;  3RJV A;  1D7H A;  3JXV A;  5CCL A;  4FAP A;  2ZR6 A;  3O5D A;  4FN2 A;  2AVP A;  3GW4 A;  3VTX A;  5LCW J;  3Q15 A;  3S7J A;  3CVL A;  2VYI A;  3FAP A;  2VGY A;  2XP6 A;  3UUX A;  3HYM B;  2XP8 A;  2OOE A;  4WNE A;  3O5L A;  4H7Y A;  5HW6 A;  4LAW A;  4YVO A;  4B94 A;  3RU0 A;  1YW5 A;  1R9H A;  5KJN A;  4ABN A;  3ZN3 A;  2QFC A;  5G04 C;  2UWJ G;  2PV3 A;  2VSN A;  3PRD A;  4BT8 A;  1T11 A;  4J4O A;  5CHE E;  5J6E A;  3NRK A;  3RKV A;  1J4I A;  4G50 A;  4JL0 A;  5EX0 A;  3LCA A;  4HOQ A;  2JZV A;  2ZR4 A;  2PPP A;  1D7I A;  2MLZ A;  1IHG A;  5M72 A;  1FKS A;  2C0M A;  3KD7 A;  4EQF A;  4I1A A;  3ASD A;  3NF1 A;  5EKQ D;  4LAY A;  3ZFW A;  4R0X A;  2LKN A;  3KCE A;  2FKE A;  4UI9 J;  3MV3 B;  4BWR A;  5B8I C;  1FD9 A;  5BXJ A;  2WPV A;  2XGS A;  2MF9 A;  1KLX A;  4GA2 A;  4CGW A;  1Q1C A;  5DIV A;  5G05 C;  1FKD A;  2L2S A;  4N19 A;  2XPB A;  2UY1 B;  1FKJ A;  3VAW A;  2LNI A;  5FTP A;  5FT9 A;  4NRH B;  4GZ5 A;  3TG5 A;  1NA3 A;  4U84 A;  4APO A;  2VGX A;  3CKB A;  2PL2 A;  3CK7 A;  1FCH A;  2PQN A;  4GCO A;  4I17 A;  4AM9 A;  1B6C A;  5G04 J;  2Y4T A;  4HOT A;  4TW8 A;  3WXX A;  1NMV A;  4DZ2 A;  2KC7 A;  1B89 A;  3QKY A;  3Q4A B;  2WQH A;  3UQB A;  4DRI A;  4WNG A;  4GIV A;  4DRQ A;  3CK9 A;  4KYO B;  3B7X A;  2KI3 A;  3FFL A;  1Q6U A;  3TCZ A;  2OFN A;  4A1S A;  3QWW A;  1ROT A;  2FEZ A;  1FKH A;  3PRB A;  2F21 A;  4J8F A;  4G1T A;  1HH8 A;  3LUO A;  5JJ6 A;  4DRJ A;  5FZR A;  1PC2 A;  1E96 B;  4IN3 B;  3S7D A;  2Y78 A;  4DRO A;  2C0L A;  5G05 J;  2XEV A;  4U0Z A;  4IQC A;  3AS4 A;  4Y6W A;  4XI9 A;  4DT4 A;  2GW1 A;  4J8D A;  3KAI A;  3IKG A;  4ITZ A;  4UI9 K;  2AWG A;  3AS8 A;  4N5C A;  3KAD A;  3ZGQ A;  4G2V A;  1QPL A;  2KAT A;  3Q47 B;  4KXK B;  3Q5M A;  2XGM A;  2KFW A;  5DIZ A;  4G24 A;  1FKK A;  1C9H A;  3MA5 A;  3CV0 A;  5CCM A;  4DRM A;  5BNW A;  2ZQS A;  1FKR A;  4TYO A;  3IEG A;  3JYJ A;  5FZS A;  3U3W A;  1JVW A;  3JYM A;  4J0U A;  1FJD A;  4GYY A;  2XP9 A;  3I6C A;  5HKG A;  2M08 A;  5KJM A;  5FZQ A;  3O5P A;  1Y8M A;  1ZBP A;  1ZCN A;  4JFI A;  3OXG A;  4ODN A;  4DRH A;  3O5F A;  4BF8 A;  4WND A;  1NSG A;  1Y0O A;  3UI6 A;  1YA0 A;  4NNR A;  3UQA A;  3LY7 A;  1WAO 1;  2M1I A;  4QIB A;  1P5Q A;  1A7X A;  5KJK A;  4TNS A;  3CEQ A;  2YHC A;  4GZ3 A;  2UY1 A;  3U4T A;  2PZI A;  3CVP A;  2KCK A;  3BEE A;  3R9A B;  1BL4 A;  1QZ2 A;  1XNF A;  4IPX A;  2PQR A;  3O5Q A;  2FBN A;  4G26 A;  2XP7 A;  4JFL A;  2I6H A;  4AIF A;  4GYO A;  3QOU A;  2MHK A;  3O5E A;  2RUQ A;  3LY9 A;  3K9I A;  2LJ4 A;  4MSP A;  3PDN A;  1JNT A;  4YVQ C;  1Q6I A;  4GA1 A;  2KO7 A;  2ZQT A;  4TW6 A;  1JNS A;  2E2E A;  2FO7 A;  2VSY A;  3KAE A;  2ZQV A;  5ARF A;  4U85 A;  4NQ0 A;  5AYW D;  2IF4 A;  5HWC A;  1OUV A;  2KE0 A;  2V5F A;  3IK8 A;  2LGO A;  3RIB A;  4DZ3 A;  3UF8 A;  4LAV A;  4MGV A;  1FKG A;  3E4B A;  2VN1 A;  5HW8 A;  2PV1 A;  4AY6 A;  4JFK A;  1A17 A;  5ARG A;  2Y4U A;  4H7X A;  4U04 A;  2KCL A;  1PIN A;  1TCO C;  2Q5A A;  4GZ6 A;  1J6Y A;  3TGO A;  4I2Z A;  3CGM A;  3SF4 A;  2K8I A;  4IQ2 A;  1NMW A;  4TW7 A;  2P58 C;  4W9Q A;  3ESK A;  4JA7 A;  2FI7 A;  3RO3 A;  5GPG A;  3GZ1 A;  2XP3 A;  2XCC A;  4WNF A;  4ODM A;  3Q49 B;  3FWV A;  5HTG A;  3KAH A;  2RQS A;  3MDY B;  3LPZ A;  2VCD A;  4DRK A;  3PE4 A;  4DH0 A;  1NZN A;  3OXL A;  4Y6C A;  4UQY A;  3O5R A;  4XIF A;  4BT9 A;  5HQ8 A;  2ITK A;  2RUC A;  4JYS A;  4QT2 A;  3N71 A;  1FAP A;  3RO2 A;  3SZ7 A;  5HWB A;  5HI7 A;  4YND A;  2F4E A;  1D7J A;  1D6O A;  3QWP A;  2JLB A;  2IFU A;  2KR7 A;  3CVN A;  2ZQU A;  3FP3 A;  3TC5 A;  1HZ4 A;  4UQX A;  5JJ7 A;  3O48 A;  2DG3 A;  1QQE A;  2Q7F A;  3CVQ A;  4W9R A;  3TG4 A;  4KBQ A;  1ELW A;  5BW8 C;  1ROU A;  3PA7 A;  1FKB A;  3KAG A;  2HYZ A;  4N3B A;  1FKL A;  3ZPJ A;  1ELR A;  4GYW A;  4J4N A;  3O5J A;  1F8A B;  3IHZ A;  1EYM A;  5DIT A;  3MEK A;  2XGO A;  4ME2 A;  3O5O A;  2MPH A;  2RUD A;  4C02 B;  4ODQ A;  5BT1 A;  4U0U A;  3KS2 A;  1WM5 A;  2HO1 A;  3ZHE B;  4BTB A;  5JJT A;  3TDB A;  4J8E A;  4JFM A;  4LEU A;  2M2A A;  2OND A;  1W3B A;  4XI0 A;  4ODR A;  2PPN A;  2C2L A;  3OOB A;  2RUR A;  4F3V A;  2MLX A;  4JA9 A;  5I98 A;  4GPK A;  1TJC A;  4I2W A;  3AS5 A;  1N1A A;  3EY6 A;  3ULQ A;  4DRP A;  2XP4 A;  3OXF A;  1BKF A;  3KZ7 A;  4AY5 A;  1PBK A;  3RFW A;  1M5Y A;  5DIU A;  1EQ3 A;  3GZ2 A;  1ZK6 A;  1YAT A;  4I9C A;  3UQ3 A;  4BTA A;  5EX3 A;  2HR2 A;  3QDN A;  3RGC A;  4WUY A;  3ASH A;  2J9Q A;  2F2D A;  2YQ8 A;  3ASG A;  2D9F A;  3CGN A;  5HUA A;  3CK8 A;  3KAF A;  4TX0 A;  2ZR5 A;  1FKT A;  2DG4 A;  3UI4 A;  1FKF A;  4U07 A;  2PPO A;  4ODO A;  1QPF A;  3ODK A;  4QT3 A;  3UQI A;  5A6C A;  1L1P A;  5D0Q D;  3JYS A;  4N3C A;  5D0O D;  4W9P A;  5HT1 A;  4CGV A;  2XPI A;  4DRN A; 
#chains in the Genus database with same CATH topology
 4G2P A;  1J4H A;  4GZD A;  4CDR A;  4YDE A;  3BMB A;  2EIJ E;  5A7D B;  3LYA A;  4IYP A;  2MNT A;  2KCV A;  3PNL B;  4JEH A;  1DC2 A;  1KT0 A;  2PBC A;  4ACK A;  2RSE A;  3UI5 A;  3O5M A;  3ESL A;  1JWG A;  4DJA A;  4WK9 A;  3JQ0 A;  2F0Y A;  2L0T B;  1ZB1 A;  1WY6 A;  3FTW A;  3O5I A;  5C1D A;  1UR9 A;  3UT7 A;  3BXW A;  4UQZ A;  2J09 A;  2PV2 A;  1KT1 A;  3APF A;  1X6N A;  4GMJ A;  4ZHB A;  4I6E A;  3D9O A;  4DRX E;  4AY1 A;  4BSX A;  4QZV B;  1E90 A;  2MYO A;  3WH0 A;  3ZHE A;  3B7U X;  4ODL A;  4U0S A;  2NC9 A;  2QC9 A;  3GYZ A;  4N2S A;  3B95 A;  2P9L G;  4RG6 A;  2OEV A;  3W9G A;  4JHR A;  2LPV A;  2P2C P;  2N87 A;  4FP7 A;  1L5J A;  3AU4 A;  2BTD A;  2AXU A;  2RFM A;  4P8W A;  2KGJ A;  5FJY A;  3QAR A;  4UUC A;  5CRU A;  1E7U A;  1U79 A;  3IXE A;  3DSX A;  4I9E A;  3NI6 A;  1IKN D;  3LY8 A;  4U7E B;  1W26 A;  4S3K A;  3O5K A;  3FY4 A;  4FC8 A;  4RLY A;  3JXV A;  3TWQ A;  1K1A A;  4CRW A;  4FN2 A;  3MKQ A;  2VTB A;  4Z2K A;  3JUI A;  4LCT A;  3V2O A;  2RFA A;  4MAV A;  3WD2 A;  2VGY A;  3R7R A;  3UUX A;  2OOE A;  5G2N A;  2FUL A;  1N0Q A;  2VSN A;  2WXQ A;  1N4P A;  1OCO E;  1T11 A;  1O6I A;  5CHE E;  2X6F A;  1RZ4 A;  3RKV A;  1J4I A;  3BG0 B;  4JL0 A;  5EX0 A;  3ART A;  4HOQ A;  4EZJ A;  2PPP A;  1IX5 A;  5JHA A;  1GRJ A;  1FKS A;  2C0M A;  2XPY A;  2JAB A;  3KCE A;  1V54 E;  3PH0 C;  3MV3 B;  4HAR A;  1NWS A;  5T4Y A;  2MF9 A;  4ANX A;  1Q1C A;  2H6I A;  4XEI G;  2L2S A;  4N19 A;  3O4Z A;  3CST A;  3SY2 A;  3B7T A;  1Z5S C;  2LNI A;  4MTV A;  5BPP A;  3TG5 A;  4DI3 A;  4APO A;  1WG0 A;  5B3S E;  1EHN A;  3L13 A;  4LG6 A;  2DT3 A;  4ML4 A;  3PEU B;  1B6C A;  4AP2 A;  5EIL A;  4CYM D;  4HOT A;  3NOC D;  3C5R A;  3EU9 A;  3FH8 A;  1B89 A;  5C2Y A;  2GRM A;  1HKJ A;  2WQH A;  4L2Y A;  4WNG A;  2X6I A;  2L6B A;  1VF8 A;  3TCZ A;  2OFN A;  4A1S A;  4LER A;  3G2T A;  1K8K G;  3QWW A;  2IO3 C;  2AW6 A;  3LUO A;  3VLF A;  1MX2 A;  1E7V A;  3S7D A;  2C0L A;  2WLZ A;  3AG2 E;  4IQC A;  1OXJ A;  4DX2 A;  4Y6W A;  4J8S A;  1N4R A;  1NWT A;  4FLH A;  4URI A;  2NSZ A;  3APD A;  1HJX A;  4UI9 K;  5FQ4 A;  4N5C A;  3V2X A;  3RM4 A;  3FEY A;  5ITZ F;  3FTS A;  3VLE A;  4S3J A;  3Q47 B;  4Z2I A;  4GAA A;  3ARX A;  4MKT A;  5DIZ A;  3CV0 A;  1N4S A;  3NBN B;  2CG2 A;  1MJ0 A;  4OVV A;  1FFQ A;  3UM2 A;  5CEA A;  4TYO A;  1HG5 A;  5FZS A;  3FUL A;  2V4L A;  1FJD A;  2VGE A;  4Q7N A;  1K9T A;  3SFY A;  3OXG A;  2NYJ A;  5J08 A;  4P8U A;  3FUN A;  4HB5 A;  4M3O A;  4QIB A;  1P5Q A;  5JMN D;  1A7X A;  4FAD A;  3AS3 A;  3IHV A;  1YMP A;  3U4T A;  1U3D A;  2PZI A;  3BEE A;  3CVP A;  3EIJ A;  3R9A B;  2OVF A;  1QZ2 A;  2XPZ A;  4OVU A;  1XNF A;  1OT8 A;  2XS8 A;  2R02 A;  1FT2 A;  3J5Q B;  3IBE A;  3LY9 A;  2P9S G;  3CVW A;  4CT4 A;  1Q6I A;  4TW6 A;  4D10 C;  3AG4 E;  2PI6 A;  4AJW A;  3ABK E;  2VSY A;  3WIJ A;  2ZQV A;  4U85 A;  1JCQ A;  2G8Z A;  2H6H A;  5HWC A;  3BUA A;  2KE0 A;  2V5F A;  3TXN A;  4OYS A;  3IK8 A;  5DF0 A;  1HF8 A;  1U3C A;  2H6F A;  3RK6 A;  5HW8 A;  5BUZ A;  2PV1 A;  4AY6 A;  4HRN A;  3PUJ A;  1A17 A;  4HLE A;  2WXO A;  3ARU A;  4ACL A;  4GZC A;  2X6K A;  2LAH A;  3SO8 A;  4GZ6 A;  2J08 A;  1E6Z A;  3TGO A;  3CGM A;  4TUU A;  3SF4 A;  1JCR A;  4HI8 A;  2K8I A;  5LX8 A;  1NMW A;  4W9Q A;  4ZPV R;  4JA7 A;  2XP3 A;  1H6K A;  2J07 A;  1E44 A;  4G11 A;  4U96 D;  3HHM A;  5HTG A;  3G2S A;  4PDX A;  1KZP A;  4DX6 D;  4DRK A;  4DH0 A;  4KZC A;  4F53 A;  5HRY A;  5FQ6 A;  1HKI A;  4BT9 A;  2ITK A;  4QT2 A;  1FAP A;  3HXE A;  3SZ7 A;  3FUI A;  4C0E A;  4YND A;  4ANW A;  4MRU A;  3NQP A;  2IFU A;  3SNX A;  3ZXS A;  4UQX A;  4J6I A;  3OAW A;  1QQE A;  3TG4 A;  2B31 A;  4KBQ A;  1ELW A;  5E76 A;  4XKB A;  3PA7 A;  2DSV A;  3KAG A;  3IHY A;  2GRP B;  2YIN A;  2PN0 A;  4DX7 D;  4J4N A;  3DXK G;  3IHZ A;  3BG1 B;  1LF8 A;  1RW2 A;  3DSU A;  2P9K G;  2RUD A;  1LTX A;  1S64 A;  1SA5 A;  2WXL A;  1WDY A;  1FFR A;  4LEU A;  4ILI A;  4PTM A;  4XI0 A;  4ODR A;  4FHJ A;  1SVX A;  3SHF A;  2RUR A;  4TUM A;  5EDS A;  5KWD A;  4I2W A;  1N1A A;  3HVE A;  2WMO A;  4DRP A;  3TWV A;  2XP4 A;  1N4Q A;  3OXF A;  3KZ7 A;  4AY5 A;  1U2V G;  1M5Y A;  5HS0 A;  3X2Q E;  3SFX A;  3GZ2 A;  5EX3 A;  3CR3 A;  3ARY A;  2HR2 A;  1TN7 A;  4BES A;  5CER B;  3R9M A;  4X8Q A;  3SBS A;  4RQI A;  2F2D A;  2D9F A;  1BI8 B;  3EUV A;  2CHZ A;  1E6P A;  3B8S A;  4U07 A;  4ODO A;  1GOI A;  4OAV B;  4RSY A;  1L1P A;  2R59 A;  5D0Q D;  1SYT A;  5B1B E;  3IV0 A;  5HT1 A;  2XPI A;  2WVI A;  3E33 A;  2Y0B G;  1O5M A;  3U64 A;  2QY7 A;  3CHP A;  4WWP A;  5ENP D;  2BUG A;  5D75 A;  3O5G A;  4Z68 A;  3ZYK A;  4W9O A;  3E30 A;  4Q94 A;  2EUL A;  2MLY A;  1NA0 A;  3QWV A;  1SW6 A;  3B13 A;  4XX5 A;  3LEW A;  4RG9 A;  2IEJ A;  2BED A;  4N3A A;  2WK2 A;  4GML A;  2LSV A;  1H0I A;  4EZK A;  4L3N A;  3LVQ E;  3E32 A;  1FKI A;  2KM4 A;  3UT4 A;  3CHF A;  2DZN A;  3Q73 A;  4KZ0 A;  5LCW C;  2IQC A;  4ODP A;  4LAX A;  2XP5 A;  1WAW A;  1JNE A;  3TAX A;  3QB2 A;  5ENT D;  2KZT B;  4DIP A;  3CIA A;  4E85 A;  2ETB A;  2KBX A;  4EBA A;  3APC A;  1WNO A;  3UPV A;  4JFJ A;  4RVB A;  3ULE G;  3PZ3 A;  3Q7A A;  2WQ7 A;  1SR0 A;  4JPS A;  1H0A A;  5EYL A;  4U86 A;  1MQS A;  4G23 A;  1H6O A;  2H6G A;  1HXV A;  2FF4 A;  3MKR A;  4GTM A;  4P29 A;  5LFA A;  3GPK A;  3S7F A;  4WWO A;  2P9N G;  3ASF A;  5HW7 A;  4JEU A;  3AS1 A;  3RJV A;  4IT6 A;  3L17 A;  2WMN A;  2AVP A;  3GW4 A;  5LCW J;  5D2M C;  3ONK A;  3S7J A;  4KT6 B;  3FAP A;  4Z2J A;  3CHR A;  1ZBW A;  3MYV A;  2WXG A;  2XP8 A;  3O5L A;  1JUQ A;  4AV7 A;  5JHB A;  2ZIS A;  1YW5 A;  2O9O A;  5KJN A;  4ABN A;  1TJF A;  3FU0 A;  2QFC A;  2WQ6 A;  5G04 C;  2GRR B;  3CGH A;  5LOZ A;  2PV3 A;  3WQV A;  4BT8 A;  2DPE A;  3G6M A;  2QF8 A;  1BU9 A;  4MNL A;  2JZV A;  3PRZ A;  4L9P A;  2ZR4 A;  2MLZ A;  1IHG A;  1O1S A;  5M72 A;  3FUJ A;  1Z3Y A;  3HXC A;  3KD7 A;  4I1A A;  3NF1 A;  5EKQ D;  3ZFW A;  4FJY A;  3HG0 D;  2LKN A;  3ARQ A;  3R7Q A;  5HBF A;  1SQM A;  2ETC A;  1UN8 A;  1FD9 A;  2WPV A;  3BU8 A;  2XGS A;  1ZBC A;  4FA6 A;  4GA2 A;  4CGW A;  3RRN B;  5ENO D;  2L0I A;  2XPB A;  2UY1 B;  5AN8 A;  2KZT A;  2DCP A;  4NRH B;  3JQ1 A;  3CQC B;  4GZ5 A;  2XRZ A;  5AAO A;  2PL2 A;  3CK7 A;  5BXO A;  2PQN A;  4E6H A;  4TRQ A;  5G04 J;  4ATG A;  1DCE A;  4TW8 A;  1OWO A;  3UKR G;  2AXV A;  4GIV A;  4DRQ A;  4GTT A;  3CK9 A;  3B7X A;  3FFL A;  5DEZ A;  4XAK A;  1ROT A;  3LJ3 A;  2GRL A;  3CHQ A;  4GTO A;  4O60 A;  1LQ0 A;  1OWN A;  4J8F A;  4G1T A;  4IT4 A;  3P2B A;  2F8X K;  2E0I A;  5FZR A;  1PC2 A;  3ML9 A;  4IN3 B;  2WXP A;  2XEV A;  3I3N A;  4XI9 A;  2XEN A;  3L54 A;  3D3M A;  3KAI A;  3IKG A;  2LXM A;  3AS8 A;  3KAD A;  3ZGQ A;  1H6P A;  4G2V A;  3U66 A;  2V8S E;  1HKM A;  3PZ1 A;  2ZU6 B;  5EYP F;  2KFW A;  1LL7 A;  4G24 A;  1C9H A;  4GTQ A;  1PY1 A;  3FXY A;  1W9U A;  3SI5 A;  2GGF A;  3JYJ A;  3JYM A;  4J0U A;  5KJM A;  2V0P A;  3O5P A;  1MX6 A;  4XKC A;  1ZBP A;  3D9K A;  1ZCN A;  4JFI A;  5KNH D;  4JZY A;  4BF8 A;  1Y0O A;  2ZGD A;  3DXM G;  4NNR A;  1QYM A;  3ONL A;  1WAO 1;  3Q79 A;  3WG7 E;  4NZC A;  5KJK A;  4TNS A;  1JPL A;  3T8M A;  4GZ3 A;  2UY1 A;  2KCK A;  2EQX A;  2BKG A;  2PQR A;  3O5Q A;  5ANL A;  4WAF A;  3UIN C;  4DWS D;  1SA4 A;  1W1V A;  3QOU A;  2MHK A;  1TFV A;  4ZS6 A;  3FEX A;  2RUQ A;  3KSQ A;  1VDY A;  3T8K A;  4YVQ C;  4BFR A;  4GA1 A;  3FY1 A;  2WLY A;  5ARF A;  4UWG A;  1YCS B;  3UMV A;  5AYW D;  3CHS A;  3KEZ A;  2IF4 A;  2I1J A;  3VLD A;  2LGO A;  3RIB A;  4LAV A;  1EIB A;  3UT8 A;  3E4B A;  2GRN B;  3U9W A;  3ASO E;  2WXK A;  3P1U A;  4H7X A;  2YBU A;  4U04 A;  5ENR D;  4ATZ D;  1TCO C;  4G8L A;  3AQU A;  1J6Y A;  4I2Z A;  1PAQ A;  3DST A;  3TWX A;  4TW7 A;  2P58 C;  3RO3 A;  4LNG A;  3GZ1 A;  4UDM A;  2XCC A;  4YDY A;  1IXV A;  3ARV A;  3CHO A;  3D9I A;  3KAH A;  3NB2 A;  3MDY B;  3LPZ A;  3ZW3 A;  4MNM A;  2VCD A;  2XQ0 A;  1NZN A;  3OXL A;  4UQY A;  5HQ8 A;  1GPF A;  2R05 A;  1MHQ A;  2F4E A;  4FUL A;  1D7J A;  2ZIR A;  3QWP A;  4AEZ C;  5AJD A;  4L23 A;  2KR7 A;  3CVN A;  2A3E A;  1A5E A;  3TC5 A;  1HZ4 A;  3SQV A;  2DG3 A;  3CVQ A;  3L6A A;  2WXM A;  3TWW A;  2ESC A;  3S2A A;  1ROU A;  1W1Y A;  1FKB A;  2Y1L E;  1RD6 A;  4JC8 A;  4HNA D;  1FKL A;  4GYW A;  1JCH B;  3O5J A;  3MEK A;  4ME2 A;  3O5O A;  2R17 C;  2AWI A;  2MPH A;  3FH5 A;  1UOH A;  4C02 B;  4ODQ A;  1WM5 A;  1NL4 A;  3WD0 A;  2OND A;  3QAQ A;  2F23 A;  5AEN A;  2MLX A;  3WL1 A;  1TNZ A;  3HDX A;  1TJC A;  4KVM A;  3B7B A;  3EY6 A;  3UX4 A;  3RFW A;  4B0Z A;  3ARZ A;  1EQ3 A;  1ZK6 A;  5A23 A;  4TXP A;  4I9C A;  2J4D A;  3FTZ A;  4I6G A;  4PS8 A;  4JD2 G;  4WUY A;  2J9Q A;  4LGX A;  3PRA A;  3B7R L;  4UWL A;  5HUA A;  3LS8 A;  2I2O A;  4U63 A;  2PPO A;  3ODK A;  4QT3 A;  1W9V A;  3UQI A;  3PR9 A;  1Z3X A;  3ML8 A;  1IHB A;  3JYS A;  4N3C A;  3AS2 A;  1S0P A;  5D0O D;  1Y6I A;  2HE0 A;  4C9B B;  4GCN A;  2CHX A;  2BKK B;  4NUR A;  3FU5 A;  3GTY X;  5G55 A;  3PE3 A;  4CZ2 D;  1NH6 A;  2DVW A;  3MV2 B;  3ALF A;  2IUZ A;  4MNK A;  1IYG A;  4ANU A;  2A3C A;  4N2Q A;  3S7B A;  4L2L A;  3DSW A;  4MBG A;  4HOS A;  2R5S A;  3FUH A;  1X5B A;  3J5P A;  3UTM A;  1UJJ A;  3LKU A;  1ZU2 A;  1QNF A;  4U95 D;  4FJZ A;  5JA4 D;  3WQW A;  2XPA A;  1F40 A;  1J4R A;  4HOU A;  1E8X A;  2IO2 C;  1H0G A;  2VGX B;  4GA0 A;  3RSE G;  4N39 A;  4IRU A;  3D9L A;  5H7P A;  3Q9U C;  4HS2 A;  3C72 A;  3NOG D;  3T9K A;  1Z6T A;  4GU5 A;  3ZXP A;  2L6J A;  2LSU A;  5KJL A;  2AJA A;  4O6F A;  2CHW A;  5E75 A;  1TNU A;  1O1R A;  4DLO A;  2X6H A;  1TN8 A;  3L08 A;  1UN9 A;  2DBA A;  4G25 A;  3C98 A;  3EHN A;  1OCZ E;  4ODK A;  2FAP A;  3GU0 A;  2DT1 A;  3G2V A;  3RRM B;  1D7H A;  4F6R D;  3FTV A;  5CCL A;  3W4R A;  4FAP A;  2ZR6 A;  3TWU A;  3EHM A;  5AQ9 A;  4ILG A;  4DWS C;  2PM6 A;  4I6J A;  5KBA A;  2X38 A;  3T5X A;  2Y69 E;  2VYI A;  4U8V D;  1H2V C;  2XP6 A;  3WD1 A;  3EJN A;  3HYM B;  5FIN A;  4WNE A;  4K5B A;  4H7Y A;  5HW6 A;  2PM7 A;  1R9H A;  3EIQ C;  2PNN A;  4V3I A;  2F8Y A;  1UG3 A;  4A3V A;  4J4O A;  1G3N B;  5KNG A;  2WXJ A;  3NRK A;  4LSZ E;  1HKK A;  1O1T A;  1JND A;  1INZ A;  1XRV A;  1D7I A;  4ANV A;  5D66 A;  4EQF A;  3ASD A;  4R0X A;  4LAY A;  3ALG A;  4F1P A;  4KMO A;  2DT2 A;  5B8I C;  4MNJ A;  1KFW A;  4F1S A;  4HLL A;  3CZ8 A;  3CH9 A;  4BY6 A;  5FTP A;  5FT9 A;  1NA3 A;  2VGX A;  3E37 A;  3CKB A;  1FCH A;  3PUK A;  4GCO A;  2EIL E;  4I17 A;  5AQ7 A;  3C3O A;  3D9J A;  2EIM E;  1H2T C;  3WXX A;  1NMV A;  4DZ2 A;  2KC7 A;  3Q7F A;  3RME A;  5ENQ D;  3Q4A B;  4CDN A;  1EDU A;  4KYO B;  3PZD A;  3CHM A;  2KI3 A;  2WXI A;  1Q6U A;  5EN5 D;  2YHE A;  2FEZ A;  1E15 A;  1FKH A;  1NP7 A;  3PRB A;  3B7S A;  4DRJ A;  1D8D A;  1GW6 A;  3D9N A;  4ZPW R;  1E96 B;  3TWT A;  3EIP A;  2Y78 A;  4BSZ B;  1D8E A;  2F37 A;  1ZL1 A;  4U0Z A;  4MS6 A;  1BI7 B;  3AS4 A;  4DT4 A;  2GW1 A;  2GRO B;  3LXU X;  4YDO A;  3L16 A;  4J7W A;  2DSZ A;  4ITZ A;  5ENS D;  2AWG A;  2R2L A;  3HXF A;  2NXP A;  5KCM A;  4BET A;  1NFI E;  2Y3A A;  3LJN A;  1QPL A;  2KAT A;  5CMW A;  4KXK B;  3ZNG A;  3Q5M A;  3CHE A;  2XGM A;  1IQU A;  3AU5 A;  3LDZ A;  1FKK A;  2IOS A;  4K03 A;  3I4R B;  2V4H C;  3MA5 A;  4K5C A;  2ZQS A;  3QJZ A;  4GTV A;  3U3W A;  1JVW A;  3RM8 A;  1AWC B;  1UW4 B;  4GYY A;  3I6C A;  3ZIM A;  2FDM A;  5HKG A;  1HS6 A;  2AOS A;  1Y8M A;  1D2K A;  3O5F A;  4CCA A;  3WKZ A;  3UI6 A;  4C0M A;  1YA0 A;  2MOW A;  3HRA A;  3PZ4 A;  2M1I A;  1W1P A;  3JXI A;  4Z2L A;  3CEQ A;  2YHC A;  4WKF A;  4I43 A;  4G26 A;  1TR4 A;  4ZFH A;  2XP7 A;  3AS0 A;  2WM0 A;  4AIF A;  4FLB A;  3O5E A;  4EEC A;  1HJW A;  4J8Y A;  2YBT A;  3K9I A;  4GPM A;  5J90 A;  3PDN A;  2KO7 A;  1EDQ A;  3MKQ B;  3FUE A;  3KAE A;  3LVR E;  4GTP A;  4KVO A;  3JUE A;  4IUL A;  4CT0 A;  2CFZ A;  4P8V A;  3ARW A;  3FDH A;  4LUN U;  1FKG A;  1HU3 A;  5CMY A;  4JFK A;  3WD3 A;  3G2W A;  4HXI A;  2QYU A;  2KCL A;  2Q5A A;  3FHE A;  1HJV A;  2J8S D;  3B9A A;  1N52 A;  3CHC A;  2WXR A;  1N94 A;  4IQ2 A;  3DBS A;  5GPG A;  4CGV A;  4WNF A;  3V31 A;  4ODM A;  3Q49 B;  4XE0 A;  4GTS A;  1LD7 A;  4DWS B;  2B0O E;  4R5E A;  4U8Y D;  5IY5 E;  2RQS A;  3RRU A;  1K3Z D;  4Y6C A;  3O5R A;  4XIF A;  4OAU C;  4B8A A;  3ZU7 B;  5CRV A;  4JYS A;  3MJW A;  4L72 B;  2X3M A;  3KSL A;  3WD4 A;  2QZA A;  3FTU A;  5HI7 A;  3HIZ A;  5FQ8 A;  4QFV A;  3FUD A;  3TL5 A;  2JLB A;  2IY0 C;  4C48 B;  3FH7 A;  3JCK C;  2WXF A;  3FP3 A;  1XHG A;  3ZEF A;  1N95 A;  2Q7F A;  4W9R A;  3DEO A;  5BW8 C;  3DSV A;  4JVS A;  4N5Q A;  3CVY A;  3BQO A;  1MYO A;  3ZRH A;  5AIJ A;  4Q96 A;  4APF A;  3ZPJ A;  2P9P G;  2J4B A;  3ABL E;  2XS1 A;  2CFU A;  4U0U A;  4LNB A;  3KS2 A;  5JJT A;  3HXD A;  4PS7 A;  4J8E A;  4JFM A;  1OWP A;  3W9F A;  3DWL G;  4A3T A;  3DRA A;  3AAA C;  4Q69 A;  2PPN A;  5I98 A;  3F6Q A;  4JHJ A;  4DI4 A;  4TXR A;  4TV3 A;  3AS5 A;  5AJL A;  1MX4 A;  2IU1 A;  5FIO A;  4A63 B;  4L1B A;  4QQI A;  5AQA A;  4DX5 D;  2XRY A;  1OWL A;  3UXG A;  2O92 A;  4HBE A;  4G8K A;  1LG1 A;  3ASH A;  5BV1 A;  5LP0 A;  3PRE A;  3CGN A;  4P8X A;  2ZR5 A;  1HG2 A;  3UI4 A;  5GQB A;  2LUH A;  3DEP A;  3ZVV A;  1QPF A;  2DWZ A;  3SFZ A;  1KPS B;  3CVX A;  2EIN E;  1YYH A;  3ARO A;  4NAC A;  2KXP C;  2WB2 A;  3ZYM A;  3D9H A;  3ZYL A;  4M7C A;  4DWS A;  4DRN A;  1SZ9 A;  2DZO A;  4KR0 B;  3H9R B;  3URZ A;  3SGH A;  3SD5 A;  2XCB A;  2DSU A;  3MZL B;  3AJI A;  3ARP A;  1HXI A;  3OA5 A;  1ZBK A;  3B9E A;  2DG9 A;  3CSF A;  4WKA A;  4HRL A;  4JW1 A;  3ENE A;  4CDM A;  1TYQ G;  3ISM C;  3KAB A;  4B8C B;  2VQ2 A;  1TNO A;  3NZU A;  2HM8 A;  2P4V A;  3KAC A;  4MPK A;  1E6R A;  1EF1 C;  4WIW A;  2VSO E;  1E6N A;  2RD0 A;  2GRQ B;  3IKD A;  3GZS A;  4GGQ A;  3EDT B;  3D9P A;  2R03 A;  3TWR A;  1Q6H A;  4EHM A;  3CVU A;  3AG1 E;  4HOR A;  1OWQ A;  3CKC A;  5FQ7 A;  3I5P A;  1MZC A;  3VTY A;  3PZ2 A;  2DT0 A;  5BXU A;  1DVP A;  4O2T A;  2ILR A;  2UZ5 A;  4GTR A;  1TEZ A;  1ZU8 A;  4AOF A;  3DPD A;  1D9S A;  5DBK A;  2XEE A;  3PNT B;  1K1B A;  3NTP A;  4UI9 C;  1E8Y A;  2AXZ A;  1TN6 A;  4ILH B;  3O5D A;  5T3R A;  3ZKJ A;  3VTX A;  3Q15 A;  4I1O B;  3CVL A;  1HFA A;  4DK5 A;  1XGW A;  3Q9N C;  4FU3 A;  3CHD A;  4LAW A;  4YVO A;  1N11 A;  3RU0 A;  3DSS A;  4LNU D;  4B94 A;  4BER A;  1OY3 D;  3MCX A;  3ZN3 A;  3FUF A;  1JCS A;  2UWJ G;  1IQR A;  3PRD A;  3G6L A;  1AP7 A;  5J6E A;  1JWF A;  4G50 A;  1W1T A;  3LCA A;  2M63 A;  2OV8 A;  3PEV B;  5GPR A;  2IOL A;  2OEW A;  4NSB A;  4I1M A;  2I9C A;  4U8H A;  2FKE A;  3FUK A;  4UI9 J;  4KQZ A;  4BWR A;  2V5Q C;  3CVV A;  5BXJ A;  2DYR E;  3MGB A;  1KLX A;  4MLP A;  5DIV A;  5G05 C;  3HVE B;  1FKD A;  1FKJ A;  3NAW A;  2A4Z A;  4W5U A;  3VAW A;  5EIB E;  2VJ8 A;  1TNB A;  4U84 A;  4HFG A;  1OWM A;  1LD8 A;  4AM9 A;  3I4G A;  2Y4T A;  2DYS E;  1S63 A;  2A3B A;  4GMR A;  2RG8 A;  3L22 A;  3QKY A;  3UQB A;  3UM3 A;  3TWS A;  2P9I G;  4DRI A;  4BX9 A;  2A5E A;  4BEP A;  4PH4 B;  4NIK A;  1WB0 A;  1H2U A;  1DCQ A;  2ETN A;  2MRI A;  4UWF A;  1HX8 A;  4PUC A;  5CBO A;  2F21 A;  4JB8 P;  4JXT A;  1HH8 A;  5JJ6 A;  2WXH A;  1NWR A;  4HBO A;  1FVF A;  3Q78 A;  5ANR A;  1FT1 A;  3MX3 A;  1OGG A;  5AAR A;  4DRO A;  1OGB A;  5G05 J;  3TJP A;  3UKU G;  3ULY A;  4EBA G;  3T5V A;  1S70 B;  4UWK A;  3QOK A;  4J8D A;  2G41 A;  3UM0 A;  3ARR A;  4O1O A;  2A3A A;  2I1K A;  4TXQ A;  4HI9 A;  3L82 A;  1LJY A;  1HO8 A;  3C3R A;  5CED B;  2FO1 E;  2BF0 X;  4BX8 A;  1Q2Z A;  3SBT B;  2WM9 A;  4F7A A;  4A1G A;  3EU5 A;  3HXB A;  5CCM A;  4DRM A;  1UJK A;  3TXM A;  5BNW A;  1EPU A;  1FKR A;  3IEG A;  2IJG X;  2ZGG A;  2XP9 A;  2M08 A;  5FZQ A;  1W9P A;  4UWH A;  3QC1 A;  1E8W A;  4ODN A;  4DRH A;  2XHE A;  4B93 B;  2OCC E;  4WND A;  5B1A E;  3FU6 A;  1NSG A;  4EPZ A;  3UQA A;  1V55 E;  3EHR A;  5FWQ A;  3LY7 A;  4XZ4 A;  2P9U G;  2CG3 A;  4DUI A;  4EZL A;  1BL4 A;  1LL4 A;  4L7T A;  2EIK E;  4A55 A;  1NI1 A;  1BPO A;  2VSX E;  4HRM B;  4IPX A;  2FBN A;  4HBD A;  3AG3 E;  4JFL A;  1N0R A;  2OVB A;  1X81 A;  2I6H A;  3NZS A;  4GYO A;  3UI2 A;  1LL6 A;  2LJ4 A;  5ENN A;  1N9A A;  2YNQ A;  4MSP A;  1JNT A;  2RKK A;  2ZQT A;  3E34 A;  2ZXW E;  1JNS A;  3FTX A;  2E2E A;  2FO7 A;  4URK A;  1EYH A;  3ZYQ A;  4NQ0 A;  3D9M A;  1DNP A;  5CBN A;  3UIO C;  1OUV A;  3QK0 A;  4DLQ A;  3RM9 A;  4DX1 A;  1H19 A;  4Q22 A;  1N54 A;  4AVX A;  4DZ3 A;  3UF8 A;  4MGV A;  3OTN A;  1UR8 A;  2DSW A;  2VN1 A;  1NWU A;  5ARG A;  5CEC B;  1E9L A;  2Y4U A;  1PIN A;  4AXH A;  4WKH A;  2A5U A;  2X6J A;  3PVL A;  5JH8 A;  5EID A;  4GB9 A;  3CLJ A;  1HE8 A;  3ESK A;  5BV0 A;  2FI7 A;  3ZUV B;  1OCC E;  1OCR E;  4Z2G A;  4K0R A;  3ASN E;  3FWV A;  4FHK A;  3FTY A;  2ION A;  2QYJ A;  2ETA A;  4Z2H A;  3ABM E;  3PE4 A;  3C3Q A;  3V79 K;  1FPP A;  2RUC A;  1X6L A;  2XZT G;  3N71 A;  1SZA A;  3RO2 A;  5HWB A;  3FUM A;  1D6O A;  3QNK A;  3Q75 A;  1LG2 A;  4K5A B;  2ZQU A;  3IKO B;  3L9T A;  5JJ7 A;  3O48 A;  3DPY A;  2XZD G;  3G2U A;  2LO6 A;  1E8Z A;  4HQD A;  5HKP A;  2HYZ A;  4N3B A;  1ZB5 A;  1GUV A;  4R7L A;  1CTN A;  1ELR A;  4YDW A;  5AQB A;  5T8I A;  1F8A B;  2B5U B;  1EYM A;  5DIT A;  2XGO A;  3JXJ A;  1ZBV A;  3UIP C;  1QBQ A;  5BT1 A;  3TDB A;  2HO1 A;  3ZHE B;  4BTB A;  3RAU A;  2JEK A;  3EHQ A;  2M2A A;  2LAI A;  1W3B A;  1BD8 A;  2C2L A;  3OOB A;  4F3V A;  4JA9 A;  2OLH A;  3ARS A;  5DO2 A;  1ITX A;  4GPK A;  3ULQ A;  2DIW A;  2XEH A;  1BKF A;  3FU3 A;  4B89 A;  4WJX A;  1PBK A;  5DIU A;  1YAT A;  3UQ3 A;  4BTA A;  3B9D A;  1ELK A;  4WWN A;  1BLX B;  3WL0 A;  3KEA A;  3QDN A;  3RGC A;  4O1P A;  4PS3 A;  2YQ8 A;  2WXN A;  3ASG A;  1TNY A;  3CK8 A;  3PS6 A;  3KAF A;  2VTB B;  2LXL A;  4TX0 A;  1FKT A;  2DG4 A;  1KZO A;  3CQG B;  1FKF A;  3V30 A;  4DPR A;  2J49 A;  4JHK A;  5A6C A;  4HVB A;  4ZPT R;  4LRZ A;  4CEM A;  3UM1 A;  2B6C A;  4W9P A;  1FVH A;  2L9B A; 
#chains in the Genus database with same CATH homology
 4G2P A;  1J4H A;  4GZD A;  4CDR A;  5A7D B;  3LYA A;  4IYP A;  2MNT A;  2KCV A;  3PNL B;  4JEH A;  1KT0 A;  2PBC A;  4ACK A;  2RSE A;  3UI5 A;  3O5M A;  3ESL A;  1JWG A;  4DJA A;  4WK9 A;  3JQ0 A;  2L0T B;  1WY6 A;  3FTW A;  3O5I A;  5C1D A;  1UR9 A;  3UT7 A;  3BXW A;  4UQZ A;  2J09 A;  2PV2 A;  1KT1 A;  3APF A;  1X6N A;  4GMJ A;  4I6E A;  3D9O A;  4AY1 A;  4BSX A;  4QZV B;  1E90 A;  3WH0 A;  3ZHE A;  3B7U X;  4ODL A;  4U0S A;  2NC9 A;  3GYZ A;  4N2S A;  4RG6 A;  4JHR A;  2LPV A;  2N87 A;  4FP7 A;  1L5J A;  3AU4 A;  2BTD A;  2AXU A;  4P8W A;  2KGJ A;  5FJY A;  3QAR A;  1E7U A;  1U79 A;  4I9E A;  3NI6 A;  3LY8 A;  1W26 A;  4S3K A;  3O5K A;  3FY4 A;  4FC8 A;  3JXV A;  4CRW A;  4FN2 A;  3MKQ A;  2VTB A;  4Z2K A;  3JUI A;  4LCT A;  4MAV A;  3WD2 A;  2VGY A;  3R7R A;  3UUX A;  2OOE A;  5G2N A;  2FUL A;  2VSN A;  2WXQ A;  1T11 A;  1O6I A;  5CHE E;  2X6F A;  3RKV A;  1J4I A;  3BG0 B;  4JL0 A;  5EX0 A;  3ART A;  4HOQ A;  4EZJ A;  2PPP A;  1IX5 A;  5JHA A;  1FKS A;  2C0M A;  2XPY A;  3KCE A;  3PH0 C;  3MV3 B;  4HAR A;  1NWS A;  5T4Y A;  2MF9 A;  4ANX A;  1Q1C A;  2L2S A;  4N19 A;  3O4Z A;  3CST A;  3B7T A;  2LNI A;  4MTV A;  5BPP A;  3TG5 A;  4DI3 A;  4APO A;  1EHN A;  3L13 A;  2DT3 A;  4ML4 A;  3PEU B;  1B6C A;  4AP2 A;  4HOT A;  3FH8 A;  1B89 A;  5C2Y A;  2GRM A;  1HKJ A;  2WQH A;  4L2Y A;  4WNG A;  2X6I A;  1VF8 A;  3TCZ A;  2OFN A;  4A1S A;  4LER A;  3G2T A;  3QWW A;  2AW6 A;  3LUO A;  3VLF A;  1E7V A;  3S7D A;  2C0L A;  2WLZ A;  4IQC A;  4Y6W A;  4J8S A;  1NWT A;  4FLH A;  4URI A;  2NSZ A;  3APD A;  1HJX A;  4UI9 K;  5FQ4 A;  4N5C A;  3RM4 A;  3FEY A;  3FTS A;  3VLE A;  4S3J A;  3Q47 B;  4Z2I A;  4GAA A;  3ARX A;  4MKT A;  5DIZ A;  3CV0 A;  2CG2 A;  4OVV A;  1FFQ A;  4TYO A;  1HG5 A;  5FZS A;  3FUL A;  2V4L A;  1FJD A;  4Q7N A;  1K9T A;  3OXG A;  5J08 A;  4P8U A;  3FUN A;  4M3O A;  4QIB A;  1P5Q A;  1A7X A;  4FAD A;  3AS3 A;  3IHV A;  3U4T A;  1U3D A;  2PZI A;  3BEE A;  3CVP A;  3EIJ A;  3R9A B;  2OVF A;  1QZ2 A;  2XPZ A;  4OVU A;  1XNF A;  3IBE A;  3LY9 A;  3CVW A;  4CT4 A;  1Q6I A;  4TW6 A;  4D10 C;  2PI6 A;  4AJW A;  2VSY A;  3WIJ A;  2ZQV A;  4U85 A;  2G8Z A;  5HWC A;  2KE0 A;  2V5F A;  3TXN A;  4OYS A;  3IK8 A;  5DF0 A;  1HF8 A;  1U3C A;  3RK6 A;  5HW8 A;  5BUZ A;  2PV1 A;  4AY6 A;  3PUJ A;  1A17 A;  4HLE A;  2WXO A;  3ARU A;  4ACL A;  4GZC A;  2X6K A;  2LAH A;  4GZ6 A;  2J08 A;  1E6Z A;  3TGO A;  3CGM A;  4TUU A;  3SF4 A;  2K8I A;  5LX8 A;  1NMW A;  4W9Q A;  4ZPV R;  4JA7 A;  2XP3 A;  1H6K A;  2J07 A;  4G11 A;  3HHM A;  5HTG A;  3G2S A;  4PDX A;  4DRK A;  4DH0 A;  4KZC A;  4F53 A;  5FQ6 A;  1HKI A;  4BT9 A;  2ITK A;  4QT2 A;  1FAP A;  3SZ7 A;  3FUI A;  4C0E A;  4YND A;  4ANW A;  4MRU A;  3NQP A;  2IFU A;  3SNX A;  3ZXS A;  4UQX A;  4J6I A;  3OAW A;  1QQE A;  3TG4 A;  2B31 A;  4KBQ A;  1ELW A;  5E76 A;  4XKB A;  3PA7 A;  2DSV A;  3KAG A;  3IHY A;  2YIN A;  4J4N A;  3IHZ A;  3BG1 B;  1LF8 A;  2RUD A;  2WXL A;  1FFR A;  4LEU A;  4ILI A;  4PTM A;  4XI0 A;  4ODR A;  4FHJ A;  3SHF A;  2RUR A;  5EDS A;  4I2W A;  1N1A A;  3HVE A;  2WMO A;  4DRP A;  2XP4 A;  3OXF A;  3KZ7 A;  4AY5 A;  1M5Y A;  3GZ2 A;  5EX3 A;  3CR3 A;  3ARY A;  2HR2 A;  3SBS A;  2F2D A;  2D9F A;  2CHZ A;  1E6P A;  3B8S A;  4U07 A;  4ODO A;  1GOI A;  4RSY A;  1L1P A;  2R59 A;  5D0Q D;  1SYT A;  3IV0 A;  5HT1 A;  2XPI A;  2WVI A;  3U64 A;  2QY7 A;  3CHP A;  4WWP A;  2BUG A;  5D75 A;  3O5G A;  3ZYK A;  4W9O A;  4Q94 A;  2MLY A;  1NA0 A;  3QWV A;  3B13 A;  4XX5 A;  3LEW A;  4RG9 A;  4N3A A;  2WK2 A;  4GML A;  2LSV A;  1H0I A;  4EZK A;  4L3N A;  3LVQ E;  1FKI A;  2KM4 A;  3UT4 A;  3CHF A;  4KZ0 A;  5LCW C;  2IQC A;  4ODP A;  4LAX A;  2XP5 A;  1WAW A;  1JNE A;  3TAX A;  3QB2 A;  2KZT B;  4DIP A;  3CIA A;  4E85 A;  4EBA A;  3APC A;  1WNO A;  3UPV A;  4JFJ A;  4RVB A;  2WQ7 A;  1SR0 A;  4JPS A;  1H0A A;  4U86 A;  1MQS A;  4G23 A;  1HXV A;  2FF4 A;  3MKR A;  4P29 A;  5LFA A;  3GPK A;  3S7F A;  4WWO A;  5HW7 A;  3ASF A;  4JEU A;  3AS1 A;  3RJV A;  4IT6 A;  3L17 A;  2WMN A;  2AVP A;  3GW4 A;  5LCW J;  3S7J A;  3ONK A;  4KT6 B;  3FAP A;  4Z2J A;  3CHR A;  1ZBW A;  3MYV A;  2WXG A;  2XP8 A;  3O5L A;  1JUQ A;  4AV7 A;  5JHB A;  1YW5 A;  2O9O A;  5KJN A;  4ABN A;  1TJF A;  3FU0 A;  2QFC A;  2WQ6 A;  5G04 C;  3CGH A;  3WQV A;  5LOZ A;  2PV3 A;  4BT8 A;  2DPE A;  3G6M A;  2QF8 A;  4MNL A;  2JZV A;  3PRZ A;  2ZR4 A;  2MLZ A;  1IHG A;  5M72 A;  3FUJ A;  1Z3Y A;  3KD7 A;  4I1A A;  3NF1 A;  5EKQ D;  3ZFW A;  4FJY A;  2LKN A;  3ARQ A;  3R7Q A;  5HBF A;  1SQM A;  1UN8 A;  1FD9 A;  2WPV A;  2XGS A;  1ZBC A;  4FA6 A;  4GA2 A;  4CGW A;  3RRN B;  2L0I A;  2XPB A;  2UY1 B;  2KZT A;  2DCP A;  4NRH B;  3JQ1 A;  3CQC B;  4GZ5 A;  2XRZ A;  2PL2 A;  3CK7 A;  2PQN A;  4E6H A;  4TRQ A;  5G04 J;  4ATG A;  4TW8 A;  1OWO A;  2AXV A;  4GIV A;  4DRQ A;  3CK9 A;  3B7X A;  3FFL A;  5DEZ A;  4XAK A;  1ROT A;  3LJ3 A;  2GRL A;  3CHQ A;  1LQ0 A;  1OWN A;  4J8F A;  4G1T A;  4IT4 A;  3P2B A;  2E0I A;  5FZR A;  1PC2 A;  3ML9 A;  4IN3 B;  2WXP A;  2XEV A;  3I3N A;  4XI9 A;  3L54 A;  3D3M A;  3KAI A;  3IKG A;  3AS8 A;  3KAD A;  3ZGQ A;  4G2V A;  3U66 A;  2V8S E;  1HKM A;  2ZU6 B;  2KFW A;  1LL7 A;  4G24 A;  1C9H A;  1PY1 A;  3FXY A;  1W9U A;  3SI5 A;  2GGF A;  3JYJ A;  3JYM A;  4J0U A;  5KJM A;  2V0P A;  3O5P A;  4XKC A;  1ZBP A;  3D9K A;  1ZCN A;  4JFI A;  4JZY A;  4BF8 A;  1Y0O A;  4NNR A;  3ONL A;  1WAO 1;  4NZC A;  5KJK A;  4TNS A;  1JPL A;  3T8M A;  4GZ3 A;  2UY1 A;  2KCK A;  2EQX A;  2PQR A;  3O5Q A;  5ANL A;  4WAF A;  4DWS D;  1W1V A;  3QOU A;  2MHK A;  1TFV A;  4ZS6 A;  3FEX A;  2RUQ A;  1VDY A;  4YVQ C;  3FY1 A;  4BFR A;  4GA1 A;  2WLY A;  5ARF A;  4UWG A;  3UMV A;  5AYW D;  3CHS A;  3KEZ A;  2IF4 A;  2I1J A;  3VLD A;  2LGO A;  3RIB A;  4LAV A;  1EIB A;  3UT8 A;  3E4B A;  3U9W A;  2WXK A;  3P1U A;  4H7X A;  2YBU A;  4U04 A;  1TCO C;  3AQU A;  1J6Y A;  4I2Z A;  1PAQ A;  4TW7 A;  2P58 C;  3RO3 A;  3GZ1 A;  2XCC A;  3ARV A;  3CHO A;  3D9I A;  3KAH A;  3MDY B;  3LPZ A;  3ZW3 A;  4MNM A;  2VCD A;  2XQ0 A;  1NZN A;  3OXL A;  4UQY A;  5HQ8 A;  1GPF A;  1MHQ A;  2F4E A;  4FUL A;  1D7J A;  3QWP A;  4AEZ C;  5AJD A;  4L23 A;  2KR7 A;  3CVN A;  2A3E A;  3TC5 A;  1HZ4 A;  2DG3 A;  3CVQ A;  3L6A A;  2WXM A;  2ESC A;  3S2A A;  1ROU A;  1W1Y A;  1FKB A;  1RD6 A;  4JC8 A;  1FKL A;  4GYW A;  3O5J A;  3MEK A;  4ME2 A;  3O5O A;  2R17 C;  2AWI A;  2MPH A;  3FH5 A;  4C02 B;  4ODQ A;  1WM5 A;  3WD0 A;  2OND A;  3QAQ A;  5AEN A;  2MLX A;  3WL1 A;  3HDX A;  1TJC A;  4KVM A;  3EY6 A;  3UX4 A;  3RFW A;  4B0Z A;  3ARZ A;  1EQ3 A;  1ZK6 A;  5A23 A;  4I9C A;  2J4D A;  3FTZ A;  4I6G A;  4PS8 A;  4WUY A;  2J9Q A;  4LGX A;  3PRA A;  3B7R L;  4UWL A;  5HUA A;  3LS8 A;  2I2O A;  4U63 A;  2PPO A;  3ODK A;  4QT3 A;  1W9V A;  3UQI A;  3PR9 A;  1Z3X A;  3ML8 A;  3JYS A;  4N3C A;  3AS2 A;  1S0P A;  5D0O D;  1Y6I A;  4C9B B;  4GCN A;  2CHX A;  4NUR A;  3FU5 A;  5G55 A;  3PE3 A;  1NH6 A;  3MV2 B;  3ALF A;  2IUZ A;  4MNK A;  1IYG A;  4ANU A;  2A3C A;  4N2Q A;  3S7B A;  4L2L A;  4HOS A;  2R5S A;  3FUH A;  1X5B A;  1UJJ A;  3LKU A;  1ZU2 A;  1QNF A;  4FJZ A;  3WQW A;  2XPA A;  1F40 A;  1J4R A;  4HOU A;  1E8X A;  1H0G A;  2VGX B;  4GA0 A;  4N39 A;  4IRU A;  3D9L A;  4HS2 A;  1Z6T A;  4GU5 A;  2L6J A;  2LSU A;  5KJL A;  4O6F A;  2CHW A;  5E75 A;  4DLO A;  2X6H A;  3L08 A;  1UN9 A;  2DBA A;  4G25 A;  3C98 A;  3EHN A;  4ODK A;  2FAP A;  2DT1 A;  3G2V A;  3RRM B;  1D7H A;  3FTV A;  5CCL A;  3W4R A;  4FAP A;  2ZR6 A;  3EHM A;  4ILG A;  4DWS C;  2PM6 A;  4I6J A;  2X38 A;  3T5X A;  2VYI A;  1H2V C;  2XP6 A;  3WD1 A;  3EJN A;  3HYM B;  4WNE A;  4H7Y A;  5HW6 A;  2PM7 A;  1R9H A;  3EIQ C;  4V3I A;  1UG3 A;  4A3V A;  4J4O A;  2WXJ A;  3NRK A;  1HKK A;  1JND A;  1INZ A;  1XRV A;  1D7I A;  4ANV A;  4EQF A;  3ASD A;  4R0X A;  4LAY A;  3ALG A;  4KMO A;  2DT2 A;  5B8I C;  4MNJ A;  1KFW A;  4F1S A;  3CZ8 A;  3CH9 A;  4BY6 A;  5FTP A;  5FT9 A;  1NA3 A;  2VGX A;  3CKB A;  1FCH A;  3PUK A;  4GCO A;  4I17 A;  3D9J A;  1H2T C;  3WXX A;  1NMV A;  4DZ2 A;  2KC7 A;  3RME A;  3Q4A B;  4CDN A;  1EDU A;  4KYO B;  3PZD A;  3CHM A;  2KI3 A;  2WXI A;  1Q6U A;  2YHE A;  2FEZ A;  1E15 A;  1FKH A;  1NP7 A;  3PRB A;  3B7S A;  4DRJ A;  1GW6 A;  3D9N A;  4ZPW R;  1E96 B;  2Y78 A;  1ZL1 A;  4U0Z A;  4MS6 A;  3AS4 A;  4DT4 A;  2GW1 A;  3LXU X;  3L16 A;  2DSZ A;  4ITZ A;  2AWG A;  2NXP A;  5KCM A;  2Y3A A;  1QPL A;  2KAT A;  5CMW A;  4KXK B;  3CHE A;  3Q5M A;  2XGM A;  1IQU A;  3AU5 A;  3LDZ A;  1FKK A;  2IOS A;  4K03 A;  3I4R B;  3MA5 A;  2ZQS A;  3QJZ A;  3U3W A;  1JVW A;  3RM8 A;  1UW4 B;  4GYY A;  3I6C A;  3ZIM A;  2FDM A;  5HKG A;  1HS6 A;  2AOS A;  1Y8M A;  1D2K A;  3O5F A;  4CCA A;  3WKZ A;  3UI6 A;  4C0M A;  1YA0 A;  2MOW A;  2M1I A;  1W1P A;  4Z2L A;  3CEQ A;  2YHC A;  4WKF A;  4I43 A;  4G26 A;  2XP7 A;  3AS0 A;  2WM0 A;  4AIF A;  4FLB A;  3O5E A;  4EEC A;  1HJW A;  2YBT A;  3K9I A;  5J90 A;  3PDN A;  2KO7 A;  1EDQ A;  3MKQ B;  3FUE A;  3KAE A;  3LVR E;  4KVO A;  4IUL A;  4CT0 A;  2CFZ A;  4P8V A;  3ARW A;  3FDH A;  4LUN U;  1FKG A;  1HU3 A;  5CMY A;  4JFK A;  3WD3 A;  3G2W A;  4HXI A;  2KCL A;  2Q5A A;  3FHE A;  1HJV A;  3B9A A;  1N52 A;  3CHC A;  2WXR A;  4IQ2 A;  3DBS A;  5GPG A;  4WNF A;  4ODM A;  3Q49 B;  4XE0 A;  4DWS B;  4R5E A;  2RQS A;  3RRU A;  4Y6C A;  3O5R A;  4XIF A;  4B8A A;  4JYS A;  3MJW A;  4L72 B;  2X3M A;  3WD4 A;  3FTU A;  5HI7 A;  3HIZ A;  5FQ8 A;  4QFV A;  3FUD A;  3TL5 A;  2JLB A;  3FH7 A;  3JCK C;  2WXF A;  3FP3 A;  1XHG A;  3ZEF A;  2Q7F A;  4W9R A;  5BW8 C;  4JVS A;  3CVY A;  3ZRH A;  5AIJ A;  4Q96 A;  4APF A;  3ZPJ A;  2J4B A;  2CFU A;  4U0U A;  3KS2 A;  5JJT A;  4PS7 A;  4J8E A;  4JFM A;  1OWP A;  4A3T A;  4Q69 A;  2PPN A;  5I98 A;  4JHJ A;  4DI4 A;  4TV3 A;  3AS5 A;  5AJL A;  2IU1 A;  4L1B A;  2XRY A;  1OWL A;  2O92 A;  4HBE A;  1LG1 A;  3ASH A;  5BV1 A;  5LP0 A;  3PRE A;  3CGN A;  4P8X A;  2ZR5 A;  1HG2 A;  3UI4 A;  5GQB A;  3ZVV A;  1QPF A;  3SFZ A;  3CVX A;  3ARO A;  4NAC A;  2WB2 A;  3ZYM A;  3ZYL A;  4DWS A;  4DRN A;  1SZ9 A;  4KR0 B;  3H9R B;  3URZ A;  3SGH A;  3SD5 A;  2XCB A;  2DSU A;  3MZL B;  3ARP A;  1HXI A;  3OA5 A;  1ZBK A;  3B9E A;  2DG9 A;  3CSF A;  4WKA A;  4JW1 A;  3ENE A;  4CDM A;  3KAB A;  4B8C B;  2VQ2 A;  3NZU A;  2HM8 A;  3KAC A;  4MPK A;  1E6R A;  1EF1 C;  4WIW A;  2VSO E;  1E6N A;  2RD0 A;  3IKD A;  3GZS A;  4GGQ A;  3EDT B;  3D9P A;  1Q6H A;  3CVU A;  4HOR A;  1OWQ A;  3CKC A;  5FQ7 A;  3I5P A;  3VTY A;  2DT0 A;  1DVP A;  4O2T A;  2ILR A;  2UZ5 A;  1TEZ A;  1ZU8 A;  4AOF A;  3DPD A;  5DBK A;  3PNT B;  3NTP A;  4UI9 C;  1E8Y A;  2AXZ A;  4ILH B;  3O5D A;  5T3R A;  3VTX A;  3Q15 A;  4I1O B;  3CVL A;  1HFA A;  4DK5 A;  1XGW A;  4FU3 A;  3CHD A;  4LAW A;  4YVO A;  4B94 A;  3RU0 A;  3MCX A;  3ZN3 A;  3FUF A;  2UWJ G;  1IQR A;  3PRD A;  3G6L A;  5J6E A;  1JWF A;  4G50 A;  1W1T A;  3LCA A;  2M63 A;  2OV8 A;  3PEV B;  5GPR A;  2IOL A;  4NSB A;  4I1M A;  2I9C A;  4U8H A;  2FKE A;  3FUK A;  4UI9 J;  4KQZ A;  4BWR A;  3CVV A;  5BXJ A;  3MGB A;  1KLX A;  4MLP A;  5DIV A;  5G05 C;  3HVE B;  1FKD A;  1FKJ A;  4W5U A;  2A4Z A;  3VAW A;  2VJ8 A;  4U84 A;  4HFG A;  1OWM A;  4AM9 A;  3I4G A;  2Y4T A;  2A3B A;  2RG8 A;  3L22 A;  3QKY A;  3UQB A;  4DRI A;  4BX9 A;  4PH4 B;  1WB0 A;  1H2U A;  2MRI A;  4UWF A;  1HX8 A;  4PUC A;  2F21 A;  4JXT A;  1HH8 A;  5JJ6 A;  2WXH A;  1NWR A;  4HBO A;  1FVF A;  5ANR A;  3MX3 A;  1OGG A;  4DRO A;  1OGB A;  5G05 J;  3TJP A;  4EBA G;  3T5V A;  4UWK A;  3QOK A;  4J8D A;  2G41 A;  3ARR A;  2A3A A;  2I1K A;  1LJY A;  1HO8 A;  2BF0 X;  4BX8 A;  3SBT B;  2WM9 A;  4F7A A;  4A1G A;  5CCM A;  4DRM A;  1UJK A;  3TXM A;  5BNW A;  1EPU A;  1FKR A;  3IEG A;  2IJG X;  2XP9 A;  2M08 A;  5FZQ A;  1W9P A;  4UWH A;  3QC1 A;  1E8W A;  4ODN A;  4DRH A;  2XHE A;  4WND A;  1NSG A;  3FU6 A;  4EPZ A;  3UQA A;  5FWQ A;  3LY7 A;  4XZ4 A;  2CG3 A;  4EZL A;  1BL4 A;  1LL4 A;  4L7T A;  4A55 A;  1BPO A;  2VSX E;  4IPX A;  2FBN A;  4JFL A;  2OVB A;  2I6H A;  3NZS A;  4GYO A;  1LL6 A;  2LJ4 A;  5ENN A;  4MSP A;  2YNQ A;  1JNT A;  2ZQT A;  1JNS A;  3FTX A;  2E2E A;  2FO7 A;  4URK A;  1EYH A;  3ZYQ A;  4NQ0 A;  3D9M A;  1DNP A;  1OUV A;  3QK0 A;  4DLQ A;  3RM9 A;  1H19 A;  4Q22 A;  1N54 A;  4AVX A;  4DZ3 A;  3UF8 A;  4MGV A;  3OTN A;  1UR8 A;  2DSW A;  2VN1 A;  1NWU A;  5ARG A;  1E9L A;  2Y4U A;  1PIN A;  4AXH A;  4WKH A;  2A5U A;  2X6J A;  3PVL A;  5JH8 A;  4GB9 A;  3CLJ A;  1HE8 A;  3ESK A;  5BV0 A;  2FI7 A;  4Z2G A;  1FVH A;  4K0R A;  3FWV A;  4FHK A;  3FTY A;  2ION A;  4Z2H A;  3PE4 A;  2RUC A;  1X6L A;  3N71 A;  1SZA A;  3RO2 A;  5HWB A;  3FUM A;  1D6O A;  3QNK A;  1LG2 A;  2ZQU A;  3IKO B;  5JJ7 A;  3O48 A;  3G2U A;  2LO6 A;  1E8Z A;  2HYZ A;  1ZB5 A;  4N3B A;  1GUV A;  4R7L A;  1CTN A;  1ELR A;  5T8I A;  1F8A B;  5DIT A;  1EYM A;  2XGO A;  1ZBV A;  5BT1 A;  3TDB A;  2HO1 A;  3ZHE B;  4BTB A;  2JEK A;  2M2A A;  2LAI A;  1W3B A;  2C2L A;  3OOB A;  4F3V A;  4JA9 A;  2OLH A;  3ARS A;  5DO2 A;  1ITX A;  4GPK A;  3ULQ A;  2DIW A;  1BKF A;  3FU3 A;  4B89 A;  4WJX A;  1PBK A;  5DIU A;  1YAT A;  3UQ3 A;  4BTA A;  3B9D A;  1ELK A;  4WWN A;  3WL0 A;  3QDN A;  3RGC A;  4PS3 A;  2YQ8 A;  2WXN A;  3ASG A;  3CK8 A;  3PS6 A;  3KAF A;  2VTB B;  4TX0 A;  1FKT A;  2DG4 A;  3CQG B;  1FKF A;  4DPR A;  2J49 A;  4JHK A;  5A6C A;  4HVB A;  4ZPT R;  4LRZ A;  4CEM A;  4W9P A;  4CGV A;  2L9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...