2IF4A

Crystal structure of a multi-domain immunophilin from arabidopsis thaliana
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
258
structure length
258
Chain Sequence
NVPPKVDSEAEVLDEKVSKQIIKEGHGSKPSKYSTCFLHYRAWTKNSQHKFEDTWHEQQPIELVLGKEKKELAGLAIGVASMKSGERALVHVGWELAYGKEGNFSFPNVPPMADLLYEVEVIGFDETKEGKARSDMTVEERIGAADRRKMDGNSLFKEEKLEEAMQQYEMAIAYMGDDFMFQLYGKYQDMALAVKNPCHLNIAACLIKLKRYDEAIGHCNIVLTEEEKNPKALFRRGKAKAELGQMDSARDDFRKAQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Multi-domain Immunophilin from Arabidopsis thaliana: A Paradigm for Regulation of Plant ABC Transporters.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein
molecule keywords ATFKBP42
total genus 70
structure length 258
sequence length 258
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2if4A02
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2if4A01
4G23A 4DT4A 2VGYA 1FKFA 4TNSA 3VAWA 4C02B 5D0OD 4XI0A 5LCWC 3ASFA 3MEKA 5A7DB 2XPIA 4HOUA 1XNFA 3O48A 4TW6A 3U4TA 1Y8MA 5JJTA 4BTBA 4CGVA 5BNWA 4AIFA 3RIBA 4DH0A 3S7DA 2NC9A 3PE4A 4WNDA 3TG4A 2XCBA 2RURA 3KAHA 1N1AA 3CGNA 3R9AB 4JYSA 2RUQA 2LNIA 4DRQA 4KXKB 3OXLA 2LSVA 1FKRA 4HORA 3O5OA 3K9IA 5HTGA 3UF8A 2IF4A 3UUXA 2PPOA 2M1IA 2F21A 4CDRA 2ITKA 3SF4A 4TW7A 4NQ0A 3CK9A 3RKVA 2F4EA 2UZ5A 3O5QA 3URZA 3MKRA 5AYWD 4GCNA 5BT1A 3QOUA 4GZ6A 3ZFWA 1FKSA 1FKHA 3O5GA 1FKIA 2PPNA 1QQEA 2L6JA 4N39A 5G04C 3H9RB 1E96B 2VSYA 2PBCA 2XGOA 2I6HA 3LYAA 4GZ5A 4BF8A 4JFIA 2E2EA 3LY9A 3CVPA 3KS2A 2Q5AA 3LY7A 4JFMA 2LJ4A 4N19A 4LAWA 1NA0A 4GCOA 2WQHA 3O5EA 5ARFA 1ELWA 4DRKA 2Q7FA 3TG5A 3PRDA 3Q49B 2MLYA 1EQ3A 3JYSA 5HW7A 3LY8A 3AS5A 4CGWA 2RSEA 5HT1A 1J6YA 3TGOA 4ODLA 3ZHEB 3KZ7A 4LAXA 4JFJA 4TX0A 1OUVA 2OFNA 3JXVA 3O5DA 1D7IA 3LCAA 3RGCA 2XP9A 2XP3A 3ZN3A 1ZCNA 3N71A 1KT1A 3NF1A 4XIFA 5KJLA 4H7YA 3PDNA 1YW5A 3KD7A 2FAPA 4GGQA 1KT0A 4DRMA 1A17A 2FO7A 3BEEA 4W9OA 1FKJA 2C0LA 4DRPA 4JFLA 2FF4A 4GA0A 2DBAA 3ASHA 2VSNA 3UI5A 5FZSA 4U07A 3KABA 5HWBA 4EQFA 4GYWA 4W9QA 4G50A 3PE3A 4N2SA 3EDTB 4BTAA 2DG3A 1FKGA 3O5PA 1FKLA 2MHKA 4GYOA 2RUCA 1Q6HA 4WNFA 3GW4A 2R5SA 4Y6WA 3TC5A 2VGXB 4F3VA 2PV1A 3RO2A 1PINA 3Q47B 2XP8A 2KC7A 2D9FA 4I9EA 4FN2A 5JJ6A 3B7XA 4TYOA 2P58C 5C1DA 3S7BA 2JLBA 1T11A 2PV3A 2L2SA 2PPPA 5KJKA 4ME2A 4JFKA 2PZIA 2VQ2A 3RU0A 3KAIA 3CK8A 2LSUA 3RJVA 1TCOC 3OOBA 1BKFA 5DBKA 3FFLA 2YQ8A 4AY5A 2XCCA 4U0ZA 1B89A 2XP7A 4I17A 3IHZA 5DIZA 1PBKA 1J4IA 3FP3A 3QDNA 5G05C 2XP6A 3IKGA 1HXIA 2OOEA 4JA9A 2DG9A 4B94A 2ZQSA 1FKTA 3PRBA 3VTYA 5A6CA 1A7XA 4KYOB 4WNGA 4AY6A 3CKCA 5I98A 3UPVA 4RG6A 4DIPA 3HYMB 3KAGA 2FKEA 4H7XA 4I9CA 4YVOA 5HUAA 3KAEA 2VYIA 5GPGA 3RO3A 2RUDA 2HYZA 2M08A 3Q4AB 3O5MA 5D75A 2AWGA 5HW6A 4DRIA 3I6CA 2PQRA 1J4HA 2UY1A 1QPFA 2LGOA 2XGMA 1WM5A 5EX3A 4IPXA 1JNTA 2XP5A 3CEQA 2J9QA 1ZBPA 4GA1A 4DZ2A 4AM9A 4UQXA 3QWWA 4BWRA 4DZ3A 4UI9J 2ZQTA 4ODOA 3ASGA 4FAPA 2ZQVA 5KJNA 3S7FA 3CGMA 4JHRA 4LAVA 4Y6CA 2KGJA 4N5CA 5FZRA 4U85A 1L1PA 4ODKA 2GW1A 3MV2B 4APOA 4ITZA 1ZK6A 4WUYA 1D7JA 1W26A 3SZ7A 2ZR4A 5KJMA 3ZPJA 2XPBA 2LPVA 3NRKA 3CVLA 3ESKA 4LAYA 3UI4A 1TJCA 3E4BA 5CCMA 3FWVA 2FBNA 5FZQA 3GYZA 3OXGA 1IHGA 1NMVA 2YHCA 4LEUA 1HH8A 3JYJA 4U0SA 5DIUA 5FTPA 1FAPA 2UWJG 4W9PA 4MSPA 3TCZA 4ABNA 4UI9C 1Y0OA 1PC2A 4O6FA 2PV2A 2KR7A 3GZ2A 1FD9A 2KI3A 3RFWA 2KATA 2RQSA 4QT3A 4UQYA 2HO1A 3PA7A 3KAFA 1FKKA 5FJYA 2WPVA 4YNDA 2C0MA 5ARGA 2XPAA 3MDYB 4R0XA 3FAPA 1FKBA 2KO7A 4A1SA 2BUGA 1BL4A 3UQBA 3MV3B 3UQAA 3UI6A 3JYMA 1D7HA 4J4OA 1C9HA 1WAO1 4G25A 2MPHA 2DG4A 3GZ1A 3WH0A 1JNSA 4IQCA 3O5IA 5BXJA 3CK7A 3O5RA 4QT2A 5FT9A 2LKNA 1KLXA 1YA0A 2KCVA 3TDBA 2VCDA 4MGVA 4ODRA 2KCLA 4GZ3A 4HOQA 4RG9A 3ZHEA 4GYYA 1YATA 3AS4A 1U79A 3KACA 2Y78A 2ZR5A 2KFWA 3U3WA 3ASDA 3LUOA 3O5LA 1Q6UA 5DITA 4I1AA 4UI9K 4I2ZA 3QKYA 3CV0A 5EX0A 4DRHA 2Y4UA 5BW8C 4ODPA 1Q6IA 3IKDA 3O5FA 4U04A 4HOSA 4DROA 5HI7A 2XEVA 5G04J 3VTXA 3WXXA 1EYMA 4N3CA 2MF9A 1ELRA 1IYGA 2V5FA 1QPLA 4J8FA 4U86A 1W3BA 4G2VA 2KE0A 1B6CA 4WNEA 2XGSA 4NRHB 4TW8A 4U0UA 1ZU2A 4UQZA 3LPZA 3TAXA 1NA3A 2M2AA 4G1TA 4QIBA 1HXVA 4BT8A 4DRNA 4GA2A 1HZ4A 5HWCA 2MLZA 4IN3B 4YVQC 2ZR6A 4ODQA 5JJ7A 4G26A 2F2DA 4J8DA 4GPKA 1M5YA 2VN1A 1NSGA 4J0UA 1NMWA 5CHEE 4W9RA 1D6OA 2N87A 1P5QA 4G24A 3NTPA 4KBQA 1QZ2A 1JVWA 4NNRA 2FEZA 4GIVA 1FJDA 5G05J 3O5JA 2XP4A 5LCWJ 3O5KA 4HOTA 3S7JA 4ODNA 5HQ8A 3NI6A 3Q5MA 4I2WA 4N3BA 5DIVA 2ONDA 3EY6A 4ODMA 3CKBA 4XI9A 3ODKA 4JL0A 4N2QA 2MNTA 1ROTA 4J8EA 2FI7A 2K8IA 2JZVA 1ROUA 3QWVA 1R9HA 4G2PA 5M72A 3CVNA 2AVPA 3ZGQA 2VGXA 5CCLA 2HR2A 5J6EA 3IK8A 5B8IC 3LKUA 1FCHA 2PL2A 5HKGA 1F40A 2C2LA 3IEGA 2ZQUA 4O2TA 4JA7A 3ULQA 1J4RA 5HW8A 2PQNA 4N3AA 1FKDA 3OXFA 2UY1B 1Q1CA 1F8AB 3MA5A 4U84A 3KADA 3CVQA 3GPKA 3UQ3A 2Y4TA 5EKQD 4IQ2A 3Q15A 2KCKA 2IFUA 4BT9A 3QWPA 3KCEA 5D0QD 4DRJA 3AS8A 2MLXA 3UQIA 2QFCA 1NZNA 4J4NA
chains in the Genus database with same CATH superfamily
4DT4A 1UR9A 4TNSA 3FU0A 3HRAA 4WWPA 1H6OA 3WKZA 5A7DB 1XNFA 3D9LA 3PVLA 2XS8A 3HDXA 5JJTA 5JH8A 2I2OA 5BNWA 4GTQA 3DSXA 4OAVB 4L3NA 1TNUA 3ZUVB 2HM8A 4JXTA 4LNUD 4TXRA 4J8YA 2XCBA 3CGNA 3R9AB 2XEHA 1Z3XA 2QC9A 2RG8A 4HORA 1GUVA 3UF8A 4DX2A 2M1IA 2F21A 4CDRA 4PS3A 3SF4A 4GU5A 3RKVA 3T5XA 3EJNA 3WD2A 2BEDA 3MKRA 1K3ZD 3U9WA 5BT1A 3B7SA 1FKSA 2KBXA 5J90A 2PNNA 2PPNA 5G04C 1DC2A 3B7UX 4GZ5A 4JFIA 4TXPA 2E2EA 3KS2A 1KFWA 2Q5AA 3LY7A 5HBFA 3FUNA 4JFMA 2LJ4A 1E6RA 4GCOA 2WQHA 3LJNA 4R7LA 4UDMA 3IBEA 3L08A 3P2BA 4JW1A 3ML9A 4CGWA 2RSEA 5HT1A 2DSWA 1JCQA 4KR0B 3QC1A 4YDYA 3FUHA 4LAXA 4FC8A 4TX0A 2VGEA 2OFNA 1FVFA 4GTVA 2LXMA 1HKIA 2IJGX 3FEXA 4XIFA 3PDNA 4L9PA 3WQVA 3G6MA 1KT0A 4EZKA 3RSEG 1A17A 3Q79A 4JVSA 3ABME 1X6NA 4U07A 5T4YA 2OVBA 4EQFA 4G50A 5EIDA 3FY1A 4N2SA 3EDTB 2DG3A 4C48B 4I6EA 1H19A 3JUEA 4L1BA 1FKLA 1D2KA 3L13A 4U8YD 3TC5A 2F37A 1BI8B 3JXIA 1Z3YA 4F3VA 2IU1A 1E7UA 1SA5A 4I9EA 1G3NB 4ANWA 1WB0A 5CBNA 4TYOA 2PV3A 2RKKA 5CERB 3ARRA 3AQUA 3SFYA 5J08A 5H7PA 1OWPA 3RU0A 1E8XA 1OCRE 3L82A 5T8IA 5BV0A 1HU3A 3OOBA 1BKFA 2MRIA 2XRYA 5DBKA 1OWQA 4AY5A 4I17A 3PRZA 3IHZA 1J4IA 1K9TA 3QDNA 1HXIA 2OEWA 2ZQSA 1A7XA 5GQBA 1TR4A 4WNGA 4AY6A 2WMNA 4JPSA 4A3TA 3UPVA 3ARZA 3V2XA 2ZGDA 3HYMB 4MTVA 3KAGA 4I9CA 3PZ2A 1GRJA 5FWQA 4ZHBA 3B7TA 2VYIA 3FH7A 2HYZA 4N5QA 3DSUA 5D75A 2AWGA 4DRIA 2PQRA 2XENA 1JNTA 5ENSD 2YBUA 2J9QA 3ARQA 3BXWA 2BKKB 4UQXA 3LVQE 1SW6A 4BSZB 1Y6IA 4DZ3A 4UI9J 3CR3A 2AXUA 5A23A 4W5UA 2G41A 2IY0C 1IKND 3FH8A 4HRMB 1NL4A 2KGJA 4QFVA 1L1PA 2GW1A 3Q73A 1W26A 3SZ7A 2P9SG 4GB9A 1W1TA 2WXNA 1TJCA 1V55E 3CZ8A 4BFRA 2M63A 1IHGA 2BKGA 4WWNA 5HS0A 4FLHA 1CTNA 5FTPA 3IV0A 3ZYLA 1ZBWA 3HXDA 4MSPA 3E33A 4UI9C 4O6FA 1A5EA 4HBEA 3GZ2A 3ABLE 4NURA 2EIJE 4F53A 4A55A 1N4PA 2KI3A 2ZU6B 1Q2ZA 3WD4A 3ESLA 4LCTA 2R02A 5ENOD 4GAAA 4YNDA 3E32A 1D8EA 1FKBA 4Q94A 2BUGA 3AROA 4UWFA 2XZDG 3MV3B 1D7HA 4DWSC 3RRMB 2KZTB 4J8SA 3QNKA 4GTPA 1TNZA 4IQCA 4QT2A 1EPUA 2LKNA 3ZYKA 1NFIE 4WKAA 1KLXA 4EHMA 1ZU8A 4DX1A 4ODRA 3D9JA 4WKHA 2XRZA 2WQ6A 4GTOA 3FUEA 2Y78A 2IUZA 2GRRB 4XZ4A 4MNLA 2QYUA 3BG1B 5ANLA 2ETBA 4JB8P 5EX0A 4FADA 3TWUA 4DRXE 4O60A 4KT6B 4DROA 3ABKE 4HOSA 3FXYA 3VTXA 4N3CA 4X8QA 2MF9A 2X6HA 1E44A 4I1OB 3OAWA 1HFAA 4K03A 4B0ZA 2KE0A 4NRHB 3CHQA 2WLYA 3B9EA 1BU9A 4DJAA 1JCHB 4A63B 4BT8A 3ENEA 2AWIA 3QAQA 1ZB5A 2J07A 2MLZA 2Y3AA 2EIKE 2F0YA 2Y69E 4DX6D 1MX4A 4KVOA 2VN1A 1E8ZA 1NMWA 5E76A 4JHJA 4GTTA 4HNAD 3NTPA 1QZ2A 1JVWA 2FEZA 1QYMA 3ZNGA 3WQWA 2DT0A 2XP4A 3AS1A 4LNBA 4YDOA 3S7JA 5HQ8A 3NI6A 2WXPA 3Q5MA 3QB2A 4I2WA 5G55A 4N3BA 1YCSB 2ONDA 4R5EA 3UTMA 1IHBA 4G8LA 1SZ9A 3W9FA 2F8XK 5DEZA 1FT2A 3G2WA 4N2QA 3HXEA 1HKKA 4GMLA 5BPPA 2IONA 5BXUA 2K8IA 3FDHA 1W1YA 4HXIA 1EHNA 5AQAA 2WXJA 3ZGQA 2VGXA 3ZIMA 1N52A 2HR2A 5J6EA 3EHMA 2P9KG 1FCHA 2ETCA 5HKGA 3IEGA 4HVBA 4WK9A 3Q7AA 2Y1LE 3CHEA 4U95D 4Z2HA 3JUIA 4FP7A 3MA5A 3GPKA 2Y4TA 3EIQC 4IULA 2P9UG 2MLXA 1FKFA 4UWKA 4C02B 3D9NA 3T8MA 4Q96A 1FFRA 5LCWC 2CFZA 4ILGA 2XPIA 4ZPTR 2X6KA 4TW6A 2NYJA 2VSOE 4AIFA 3ALGA 1IX5A 1OT8A 4GTMA 1E9LA 1TN8A 3KAHA 4JYSA 3WG7E 3ZVVA 1DCQA 2RUQA 4HRLA 2L0IA 3OXLA 1U3CA 2B31A 1OGGA 4AP2A 3SD5A 3UT7A 4ZPVR 4MPKA 1Z6TA 4L72B 4KZ0A 2R03A 4HQDA 5LP0A 4HBOA 4TW7A 4YDWA 2G8ZA 4ATGA 3O5QA 4PS8A 1S64A 3URZA 3FTZA 2QZAA 5AYWD 4GCNA 3QOUA 4O1OA 3ZFWA 2EILE 3O4ZA 1HX8A 4NZCA 4IRUA 1KPSB 1U2VG 3FU6A 4ILIA 2I6HA 3LYAA 3DPDA 4BF8A 2WVIA 3JCKC 5CMYA 3RM9A 5IY5E 4N19A 2OLHA 2GRMA 3UINC 3O5EA 3FY4A 5ARFA 1ELWA 2Q7FA 1N4RA 3PRDA 2J4BA 2P4VA 1XGWA 2IO3C 4RQIA 5HW7A 2H6FA 3AS5A 4ZFHA 4ODLA 3ZHEB 3KZ7A 3CSFA 4U8HA 5CRUA 1JPLA 4JFJA 1OUVA 5AENA 3O5DA 5FIOA 1D7IA 3LCAA 3EU9A 2XP3A 3CHMA 2A3AA 3N71A 1KT1A 1UW4B 3NF1A 1YW5A 1BLXB 1U3DA 3KD7A 3PUKA 4BEPA 4Q7NA 1QBQA 4DRMA 2DSZA 3V31A 3BEEA 3GZSA 4W9OA 2DSVA 1OWNA 2FF4A 4IT6A 4BX8A 3EHRA 2R59A 3G2SA 3KABA 5HWBA 4GYWA 4W9QA 1DCEA 4IYPA 3VLFA 3L9TA 3UIPC 3AU4A 4WNFA 3B95A 4Y6WA 3ARXA 3C3QA 3RO2A 3RRNB 1ELKA 1W9UA 1GOIA 1W1PA 2D9FA 4LRZA 5T3RA 5JJ6A 4OAUC 1H0GA 3L54A 3S7BA 2JLBA 1VF8A 1LL7A 1KZOA 2P9LG 3SHFA 3HIZA 4CRWA 2DYRE 2XQ0A 1HS6A 2LSUA 3LS8A 5CMWA 5ENTD 3RJVA 3FFLA 3ML8A 1NWSA 3ISMC 5DIZA 3FP3A 5G05C 4XKBA 2XP6A 4P8WA 1EDQA 1W9VA 5AJLA 2OOEA 3QOKA 4ZS6A 2DG9A 2CHZA 1FKTA 3VTYA 1NP7A 3TWTA 3CSTA 3OTNA 4H7XA 4Q69A 2MOWA 1H6PA 3RO3A 2RUDA 3D9MA 5JHAA 4C0MA 1TN7A 2I1KA 2LGOA 1QPFA 2ILRA 1LTXA 5EX3A 1ZBCA 4P8XA 2XP5A 3SO8A 1SA4A 1OY3D 3CHDA 4U96D 4WWOA 4F6RD 4KQZA 3CGHA 2B0OE 1X81A 3ASGA 1AP7A 4JHRA 5CRVA 3B7BA 1TNOA 4JEHA 3PZDA 3NAWA 4APOA 2X6JA 4WUYA 1D7JA 4BSXA 2ZR4A 3Q9NC 3FULA 1D9SA 2JABA 1LJYA 2XPBA 5ENNA 2AJAA 1O1RA 2O92A 2FBNA 1EDUA 3GYZA 1NMVA 4M7CA 2I9CA 4ANXA 4JC8A 2DPEA 1N0QA 3ZKJA 3TCZA 3PNTB 3R9MA 3CHSA 2KR7A 1FD9A 1IQUA 4A3VA 3PZ1A 2RQSA 5GPRA 1EYHA 4URIA 2DIWA 3WL1A 2WXFA 4JZYA 4PH4B 1BL4A 3UQBA 3UQAA 4PTMA 3JYMA 3PREA 4IT4A 1FT1A 4J4OA 3W4RA 3UM2A 4J6IA 2MPHA 2FULA 5AJDA 3SY2A 1JNSA 3APCA 4I6JA 1NI1A 3DEOA 2ETNA 3V2OA 2GRQB 2WXHA 4Z2IA 2P9NG 3FUKA 3NQPA 4RVBA 4KZCA 3F6QA 4MGVA 1KZPA 4GZ3A 4RG9A 3D3MA 5JHBA 4FLBA 2CHWA 4TV3A 1YATA 3AS4A 3DSSA 3SGHA 2IO2C 3E34A 5EIBE 4RLYA 2ZR5A 2KFWA 3U3WA 1EF1C 1N4QA 3PS6A 5B1BE 3ARYA 3CHCA 1Q6UA 2DT1A 3MJWA 3CV0A 3R7QA 2VTBA 2R2LA 4ODPA 5BW8C 5AQBA 1Q6IA 4U04A 5HI7A 5G04J 3T9KA 2H6HA 3DSTA 2PM7A 1ELRA 1IYGA 5ENRD 4XAKA 1FVHA 1E90A 2WB2A 1W3BA 4HRNA 3PZ4A 1K1BA 4U0UA 4UQZA 1H2VC 3TAXA 2M2AA 4DLOA 4EZJA 1WY6A 3C98A 2EQXA 4GA2A 4L7TA 1HZ4A 2ZISA 5JJ7A 4I6GA 1HE8A 2A5EA 2EULA 3APFA 1O1TA 5AQ9A 4UWGA 4HB5A 2V4LA 2ZGGA 3KEZA 2QYJA 1P5QA 4KBQA 4NNRA 1UN8A 4C9BB 3O5JA 3IKOB 1PAQA 5EILA 5ENQD 4TRQA 2F8YA 4JEUA 2RFAA 1O5MA 2XZTG 3CIAA 3RMEA 2AOSA 3UM1A 3V30A 3TJPA 4ODMA 4XI9A 3ODKA 4AY1A 2HE0A 5G2NA 4UWLA 2P9PG 1ROTA 3V79K 4J8EA 1AWCB 4PDXA 1SZAA 3DEPA 1R9HA 1MHQA 4G2PA 2WXRA 2AVPA 5C2YA 4FJZA 1XRVA 3IK8A 3CQGB 4G11A 4FU3A 1F40A 2C2LA 2ZQUA 4MBGA 3ULQA 2OV8A 3HHMA 4P8VA 2PQNA 4N3AA 4S3KA 4U84A 4IQ2A 5CECB 2KCKA 2ZXWE 2IFUA 3AG1E 4BT9A 3AS8A 1VDYA 4TXQA 3UQIA 2QFCA 1NZNA 3ARPA 4E85A 3CHFA 5FQ7A 2VGYA 4P29A 3VAWA 3ASFA 2ETAA 3Q7FA 5FQ6A 3W9GA 4HOUA 1LG2A 3D9PA 3O48A 2J49A 2P2CP 3NOCD 1S63A 4BTBA 1XHGA 3AS3A 2L9BA 4DH0A 1N4SA 3S7DA 2NC9A 3PE4A 3TG4A 1DNPA 2RURA 3I4GA 1UG3A 5DF0A 3DXMG 4XKCA 4KVMA 4BESA 2LSVA 4RSYA 1H0IA 2IOLA 2AW6A 3K9IA 4OVVA 3UUXA 2PPOA 2BTDA 3CHRA 3TWWA 2O9OA 2ITKA 3AG2E 3UKRG 4GZCA 2L6BA 4AJWA 3PRAA 3Q9UC 5KWDA 2DSUA 1V54E 4EPZA 1MX6A 4V3IA 3O5GA 2WXMA 1LQ0A 1FKIA 1QQEA 2L6JA 3JQ1A 4N39A 3H9RB 1JCSA 2XGOA 3CVPA 3HVEA 2WM9A 1NA0A 3WD0A 3FTSA 4CDMA 3CH9A 1NWTA 3Q49B 2MLYA 1EQ3A 3JYSA 3QK0A 2WXLA 2A3CA 3SI5A 3AS0A 4ZPWR 3NZUA 3CQCB 3ONKA 3JXVA 2XHEA 1IXVA 4F1PA 3RGCA 2XP9A 3SFXA 4HFGA 5KJLA 4H7YA 2LAHA 5BUZA 2FAPA 2WQ7A 1NWUA 1SYTA 1FKJA 3VLEA 4GA0A 3LEWA 2VSNA 1TYQG 3RRUA 3UI5A 5EN5D 4GMRA 1SQMA 4LUNU 5AIJA 2H6GA 3PE3A 1FKGA 4NACA 4GTRA 1UJJA 4B93B 3WIJA 3FHEA 4GYOA 2RUCA 3RM8A 2R5SA 2VGXB 2PV1A 4DX5D 2CG3A 1PINA 3B8SA 3Q47B 1LF8A 2XP8A 4BERA 4DLQA 3Q75A 4FN2A 3B7XA 3NOGD 3G2TA 2VSXE 3LDZA 5C1DA 1T11A 1MX2A 5FQ4A 2L2SA 1X6LA 3L16A 2V0PA 4ME2A 1E7VA 4JFKA 1OWMA 2VQ2A 3FTXA 4ACLA 4CZ2D 4APFA 1FPPA 1TCOC 3D9OA 4FHJA 3ZU7B 4DUIA 3ONLA 1JWFA 2YQ8A 3LJ3A 2XCCA 4U0ZA 1B89A 4LSZE 1ZL1A 2J08A 2VTBB 1PBKA 4FHKA 3ARTA 1SVXA 3J5QB 5FQ8A 3UI2A 4KMOA 4B94A 1NH6A 1DVPA 3CKCA 3SBSA 2X6FA 5KBAA 5I98A 1OGBA 4U63A 4DIPA 3EIPA 2FKEA 3DXKG 3PR9A 4JHKA 4MNMA 3UM0A 3AG4E 3KAEA 2WMOA 3AU5A 1WNOA 3O5MA 5D2MC 2XPZA 3I6CA 1BPOA 3UIOC 2UY1A 1J4HA 5EDSA 3CEQA 1HJXA 3HXFA 3FUJA 4GA1A 4DZ2A 3EHNA 2ESCA 4BWRA 3BU8A 3CVXA 4CEMA 3FU3A 5D66A 4ODOA 4FAPA 4Z2JA 5KJNA 3S7FA 3CGMA 4DWSB 4XX5A 3I4RB 3TL5A 5JMND 1E6PA 2CG2A 5FZRA 4U85A 4ODKA 2XPYA 4ITZA 1ZK6A 3S2AA 2RFMA 4U7EB 3UXGA 5BV1A 3ESKA 2LPVA 3NRKA 4LAYA 3UI4A 4GZDA 2B5UB 3T5VA 5FZQA 2LUHA 3AAAC 5JA4D 2YHCA 4LEUA 3TXNA 1HH8A 2RD0A 1LG1A 3JYJA 4U0SA 2ZIRA 3WL0A 3PEVB 5DIUA 1W9PA 1FAPA 2UWJG 4ILHB 1Y0OA 4MKTA 1Z5SC 2GRNB 4AOFA 2KATA 3HG0D 2GRPB 2FO1E 1ZB1A 4I43A 1WAWA 4UQYA 3BG0B 1FKKA 5FJYA 3TWXA 1N0RA 2WPVA 2C0MA 3MDYB 2XPAA 1D8DA 2FDMA 2WM0A 3SBTB 4Z68A 5LX8A 1C9HA 1JNEA 4B8CB 2I1JA 3D9IA 2DG4A 3GZ1A 3WH0A 3MKQA 1MJ0A 5BXJA 4C0EA 1FFQA 3CK7A 5FT9A 1H0AA 3T8KA 1UN9A 2KCVA 5EYPF 2KCLA 2IQCA 4MNJA 4BX9A 4GPMA 2OVFA 3ZHEA 1N94A 4DWSA 3ARWA 1U79A 4K0RA 4AEZC 5B3SE 3KACA 2V5QC 2B6CA 3ASDA 3LXUX 5AARA 3MX3A 1O6IA 3ULYA 3QKYA 3UKUG 2GROB 4DRHA 3ZXPA 4F1SA 4URKA 2QF8A 4DI4A 3O5FA 1GPFA 1OWOA 3L22A 4MS6A 3L17A 3ZYQA 3WXXA 2PI6A 1YYHA 1OWLA 2V5FA 1QPLA 5BXOA 4G2VA 3PUJA 2H6IA 3ASNE 1B6CA 1HO8A 3ZYMA 2AXVA 1NA3A 1HXVA 4QIBA 3AJIA 5KNHD 1X5BA 3CHOA 5HWCA 4IN3B 2DZNA 1E8YA 5HKPA 2ZR6A 4ODQA 4G26A 4J8DA 4GPKA 3OA5A 1NSGA 3ZW3A 3PNLB 3B9AA 4WAFA 4W9RA 1D6OA 2N87A 3B13A 3P1UA 4G24A 4EBAA 4GIVA 5LOZA 2GRLA 5EYLA 3UMVA 4ANVA 4ATZD 1ITXA 1L5JA 1MZCA 2LAIA 1IQRA 5DIVA 3CHPA 3HVEB 2J4DA 4UUCA 1N54A 3TWSA 4DWSD 4Z2GA 3KEAA 2FI7A 5AAOA 2JZVA 3C3RA 3C5RA 5M72A 4HI8A 3CVNA 4EECA 5CCLA 2CHXA 5B8IC 2PL2A 2J8SD 4HS2A 5B1AE 4I1MA 4O2TA 1GW6A 4XE0A 4FULA 3KSQA 4Z2KA 3OXFA 1Q1CA 1F8AB 3KADA 3CVQA 1LL4A 3RK6A 2YNQA 3Q15A 3EHQA 3PEUB 1JWGA 5D0QD 1N11A 4J4NA 3GTYX 4G23A 4M3OA 1JNDA 2LXLA 5D0OD 4XI0A 2A4ZA 2A5UA 3MEKA 3DRAA 4ACKA 3U4TA 2XEEA 1Y8MA 4CGVA 1LD7A 1N9AA 2PM6A 3RIBA 1QNFA 1HKMA 3E37A 4WNDA 1N1AA 2DT2A 4HI9A 3MGBA 2LNIA 2R05A 4KXKB 4DRQA 1FKRA 2BF0X 3O5OA 2WXIA 2EIME 2A3BA 3BQOA 5HTGA 2IF4A 3ARVA 4NQ0A 4O1PA 4DK5A 1H6KA 3CK9A 2F4EA 3LVRE 4LNGA 4BY6A 2UZ5A 1N95A 4CYMD 1H2UA 4Z2LA 4HLLA 2WXGA 4NIKA 3I5PA 3AG3E 1E6NA 4GZ6A 3EUVA 1FKHA 2DZOA 1SR0A 1E96B 2VSYA 2PBCA 3JXJA 4PUCA 5DO2A 3LY9A 5KNGA 1K1AA 4AXHA 4LAWA 3QJZA 3SNXA 4DRKA 3TG5A 1TNYA 4P8UA 1PY1A 2V4HC 4E6HA 3LY8A 4K5AB 3MZLB 2NSZA 3ZXSA 1J6YA 3FEYA 3TGOA 2YHEA 3BMBA 4MAVA 5HRYA 2F23A 1YMPA 3ZN3A 1ZCNA 4AV7A 4WKFA 4HBDA 3B7RL 3L6AA 4GGQA 4EBAG 3WD1A 3TWQA 2FO7A 3I3NA 4NSBA 3SFZA 5AN8A 2C0LA 4DRPA 4JFLA 2DBAA 3ASHA 5FZSA 3DWLG 2WXKA 3SQVA 4BTAA 1TJFA 4PS7A 3O5PA 2MHKA 1JUQA 2XS1A 3RAUA 1Q6HA 3GW4A 3TWVA 2X6IA 5LFAA 3CVYA 1RZ4A 1TN6A 3IHVA 3EIJA 3MKQB 1S0PA 2KC7A 4U8VD 1OCZE 3VLDA 5FINA 4MNKA 1BD8A 2P58C 1WDYA 2PPPA 3C3OA 5KJKA 2NXPA 1E15A 4LG6A 2DVWA 2PZIA 3FTYA 3KAIA 3CK8A 5ITZF 4LGXA 2WLZA 2QY7A 4AVXA 3Q78A 2XP7A 3FTUA 3IKGA 1WG0A 2MYOA 4JA9A 2VJ8A 1TNBA 2WK2A 3G6LA 3PRBA 5A6CA 4KYOB 2DWZA 4FJYA 4RG6A 4A1GA 1NWRA 3APDA 1LL6A 4YVOA 5HUAA 2OEVA 3PZ3A 3BUAA 1ZBKA 5GPGA 4FA6A 1LD8A 1MQSA 3TWRA 2M08A 1E8WA 2WXQA 3Q4AB 5HW6A 4S3JA 2XGMA 1WM5A 1OCOE 4CT0A 4IPXA 2EINE 5ENPD 2Y0BG 1S70B 3UX4A 2E0IA 4ANUA 1ZBPA 4AM9A 3QWWA 3E30A 1H2TC 1TFVA 2ZQTA 2AXZA 2ZQVA 4GMJA 4LAVA 3JQ0A 4Y6CA 4N5CA 3D9HA 1K8KG 3MV2B 3FH5A 2GGFA 3DBSA 1EIBA 3CVWA 4UWHA 5KJMA 3ZPJA 5CEAA 3CVLA 2X3MA 3PH0C 5CCMA 3E4BA 4DPRA 3FWVA 3OXGA 3ZEFA 1HG5A 1UJKA 3NB2A 4W9PA 4ABNA 1PC2A 2A3EA 2PV2A 2KXPC 4BETA 3ARUA 3CVUA 3RFWA 4QT3A 2J09A 1ZBVA 2DCPA 3UT8A 1BI7B 1OCCE 2HO1A 2DT3A 3PA7A 3KAFA 5ARGA 4R0XA 1RD6A 3UM3A 3FAPA 2KO7A 3MYVA 4A1SA 3IHYA 3UT4A 4LERA 3UI6A 3DSWA 4Q22A 2CFUA 1WAO1 4OVUA 3B9DA 4G25A 1HJWA 1UR8A 4CT4A 3O5IA 4TUUA 2DYSE 3ARSA 3O5RA 3G2VA 4DI3A 3ALFA 5ANRA 2YBTA 1W1VA 1YA0A 1HG2A 3U64A 4JD2G 4B89A 3TDBA 2VCDA 2YINA 4HOQA 3FTWA 4GYYA 3FU5A 2OCCE 3D9KA 4MRUA 2WXOA 1E6ZA 2IEJA 4XEIG 4OYSA 4DX7D 3LUOA 3O5LA 3X2QE 5DITA 3QARA 4I1AA 4UI9K 4I2ZA 3U66A 1HF8A 2Y4UA 4K5BA 1MYOA 2X38A 2PN0A 3IKDA 3KSLA 3FUMA 2XEVA 2KZTA 3GU0A 1EYMA 4CCAA 3CLJA 3FUIA 1JCRA 4J8FA 4J7WA 4U86A 2P9IG 3DSVA 4WNEA 2XGSA 4WJXA 4L2LA 4TW8A 1ZU2A 2JEKA 1TEZA 4B8AA 2IOSA 3LPZA 3NBNB 4G1TA 4DRNA 3J5PA 3FUFA 4YVQC 3FUDA 3TXMA 4MLPA 3AS2A 4GTSA 3G2UA 3C72A 2F2DA 3MCXA 5KCMA 1M5YA 2V8SE 3RM4A 4J0UA 5CHEE 3CVVA 4D10C 1O1SA 3FTVA 5CBOA 3EU5A 1FJDA 4L23A 5G05J 3ULEG 1INZA 1HKJA 5LCWJ 3IXEA 3O5KA 4HOTA 4TUMA 4ODNA 4QZVB 3HXCA 4ML4A 3ASOE 2L0TB 4QQIA 3EY6A 3CKBA 3DPYA 4HARA 4YDEA 4JL0A 4G8KA 2MNTA 5CEDB 3NZSA 3R7RA 4CDNA 4EZLA 5E75A 1OXJA 5AQ7A 2R17C 1ROUA 3QWVA 4HLEA 3LKUA 1UOHA 1RW2A 3ZRHA 4JA7A 1J4RA 5HW8A 1FKDA 2UY1B 3HXBA 4L2YA 4F7AA 3UQ3A 5EKQD 4WIWA 2KM4A 1HJVA 3QWPA 3KCEA 2LO6A 3WD3A 4DRJA 4K5CA
chains in the Genus database with same CATH topology
4DT4A 1UR9A 4TNSA 3FU0A 4WWPA 3WKZA 5A7DB 1XNFA 3D9LA 3PVLA 3HDXA 5JJTA 5JH8A 2I2OA 5BNWA 4L3NA 2HM8A 4JXTA 2XCBA 3CGNA 3R9AB 1Z3XA 4HORA 2RG8A 1GUVA 3UF8A 2M1IA 2F21A 4CDRA 4PS3A 3SF4A 4GU5A 3RKVA 3T5XA 3EJNA 3WD2A 3MKRA 3U9WA 5BT1A 3B7SA 1FKSA 5J90A 2PPNA 5G04C 3B7UX 4GZ5A 4JFIA 2E2EA 3KS2A 1KFWA 2Q5AA 3LY7A 5HBFA 3FUNA 4JFMA 2LJ4A 1E6RA 4GCOA 2WQHA 4R7LA 3IBEA 3L08A 3P2BA 4JW1A 3ML9A 4CGWA 5HT1A 2RSEA 2DSWA 4KR0B 3QC1A 3FUHA 4LAXA 4FC8A 4TX0A 2OFNA 1FVFA 1HKIA 2IJGX 3FEXA 4XIFA 3PDNA 3WQVA 3G6MA 1KT0A 4EZKA 1A17A 4JVSA 1X6NA 4U07A 5T4YA 2OVBA 4EQFA 4G50A 3FY1A 4N2SA 3EDTB 2DG3A 4I6EA 1H19A 4L1BA 1FKLA 1D2KA 3L13A 3TC5A 1Z3YA 4F3VA 2IU1A 1E7UA 4I9EA 4ANWA 1WB0A 4TYOA 2PV3A 3ARRA 3AQUA 5J08A 1OWPA 3RU0A 1E8XA 5T8IA 5BV0A 1HU3A 3OOBA 1BKFA 2MRIA 2XRYA 5DBKA 1OWQA 4AY5A 4I17A 3PRZA 3IHZA 1J4IA 1K9TA 3QDNA 1HXIA 2ZQSA 1A7XA 5GQBA 4WNGA 4AY6A 2WMNA 4JPSA 4A3TA 3UPVA 3ARZA 3HYMB 4MTVA 3KAGA 4I9CA 5FWQA 3B7TA 2VYIA 3FH7A 2HYZA 5D75A 2AWGA 4DRIA 2PQRA 1JNTA 2YBUA 3ARQA 3BXWA 2J9QA 4UQXA 3LVQE 1Y6IA 4DZ3A 4UI9J 3CR3A 2AXUA 5A23A 4W5UA 2G41A 3FH8A 2KGJA 4QFVA 1L1PA 2GW1A 1W26A 3SZ7A 4GB9A 1W1TA 2WXNA 1TJCA 3CZ8A 4BFRA 2M63A 1IHGA 4WWNA 4FLHA 1CTNA 5FTPA 3IV0A 3ZYLA 1ZBWA 4MSPA 4UI9C 4O6FA 4HBEA 3GZ2A 4NURA 2KI3A 4F53A 4A55A 2ZU6B 3WD4A 3ESLA 4LCTA 4GAAA 4YNDA 1FKBA 4Q94A 2BUGA 3AROA 4UWFA 3MV3B 1D7HA 4DWSC 3RRMB 2KZTB 4J8SA 3QNKA 4IQCA 4QT2A 1EPUA 2LKNA 3ZYKA 4WKAA 1KLXA 1ZU8A 4ODRA 3D9JA 4WKHA 2XRZA 2WQ6A 3FUEA 2Y78A 2IUZA 4XZ4A 4MNLA 3BG1B 5ANLA 5EX0A 4FADA 4KT6B 4DROA 4HOSA 3FXYA 3VTXA 4N3CA 2MF9A 2X6HA 4I1OB 3OAWA 1HFAA 4K03A 4B0ZA 2KE0A 4NRHB 3CHQA 2WLYA 3B9EA 4DJAA 4BT8A 3ENEA 2AWIA 3QAQA 1ZB5A 2J07A 2MLZA 2Y3AA 4KVOA 2VN1A 1E8ZA 1NMWA 5E76A 4JHJA 3NTPA 1QZ2A 1JVWA 2FEZA 3WQWA 2DT0A 2XP4A 3AS1A 3S7JA 5HQ8A 3NI6A 2WXPA 3Q5MA 3QB2A 4I2WA 5G55A 4N3BA 2ONDA 4R5EA 1SZ9A 5DEZA 3G2WA 4N2QA 1HKKA 4GMLA 5BPPA 2IONA 2K8IA 3FDHA 1W1YA 4HXIA 1EHNA 2WXJA 3ZGQA 2VGXA 3ZIMA 1N52A 2HR2A 5J6EA 3EHMA 1FCHA 5HKGA 3IEGA 4HVBA 4WK9A 3CHEA 4Z2HA 3JUIA 4FP7A 3MA5A 3GPKA 2Y4TA 3EIQC 4IULA 2MLXA 1FKFA 4UWKA 4C02B 3D9NA 3T8MA 4Q96A 1FFRA 5LCWC 2CFZA 4ILGA 2XPIA 4ZPTR 2X6KA 4TW6A 2VSOE 4AIFA 3ALGA 1IX5A 1E9LA 3KAHA 4JYSA 3ZVVA 2RUQA 2L0IA 3OXLA 1U3CA 2B31A 1OGGA 4AP2A 3SD5A 3UT7A 4ZPVR 4MPKA 1Z6TA 4L72B 4KZ0A 5LP0A 4HBOA 4TW7A 2G8ZA 4ATGA 3O5QA 4PS8A 3URZA 3FTZA 5AYWD 4GCNA 3QOUA 3ZFWA 3O4ZA 1HX8A 4NZCA 4IRUA 3FU6A 4ILIA 2I6HA 3LYAA 3DPDA 4BF8A 2WVIA 3JCKC 5CMYA 3RM9A 4N19A 2OLHA 2GRMA 3O5EA 3FY4A 5ARFA 1ELWA 3PRDA 2Q7FA 2J4BA 1XGWA 5HW7A 3AS5A 4ODLA 3ZHEB 3KZ7A 3CSFA 4U8HA 1JPLA 4JFJA 1OUVA 5AENA 3O5DA 1D7IA 3LCAA 2XP3A 3CHMA 2A3AA 3N71A 1KT1A 1UW4B 3NF1A 1YW5A 1U3DA 3KD7A 3PUKA 4Q7NA 4DRMA 2DSZA 3BEEA 3GZSA 4W9OA 2DSVA 1OWNA 2FF4A 4IT6A 4BX8A 2R59A 3G2SA 3KABA 5HWBA 4GYWA 4W9QA 4IYPA 3VLFA 3AU4A 4WNFA 4Y6WA 3ARXA 3RO2A 3RRNB 1ELKA 1W9UA 1GOIA 1W1PA 2D9FA 4LRZA 5T3RA 5JJ6A 1H0GA 3L54A 3S7BA 2JLBA 1VF8A 1LL7A 3SHFA 3HIZA 4CRWA 2XQ0A 1HS6A 2LSUA 3LS8A 5CMWA 3RJVA 3FFLA 3ML8A 1NWSA 5DIZA 3FP3A 5G05C 4XKBA 2XP6A 4P8WA 1EDQA 1W9VA 5AJLA 2OOEA 3QOKA 4ZS6A 2DG9A 2CHZA 1FKTA 3VTYA 1NP7A 3CSTA 3OTNA 4H7XA 4Q69A 2MOWA 3RO3A 2RUDA 3D9MA 5JHAA 4C0MA 2I1KA 2LGOA 1QPFA 2ILRA 5EX3A 1ZBCA 4P8XA 2XP5A 3CHDA 4WWOA 4KQZA 3CGHA 3ASGA 4JHRA 4JEHA 3PZDA 4APOA 2X6JA 4WUYA 1D7JA 4BSXA 2ZR4A 3FULA 2XPBA 1LJYA 5ENNA 2O92A 2FBNA 1EDUA 3GYZA 1NMVA 2I9CA 4ANXA 4JC8A 2DPEA 3TCZA 3PNTB 3CHSA 2KR7A 1FD9A 1IQUA 4A3VA 2RQSA 5GPRA 1EYHA 4URIA 2DIWA 3WL1A 2WXFA 4JZYA 4PH4B 1BL4A 3UQBA 3UQAA 4PTMA 3JYMA 3PREA 4IT4A 4J4OA 3W4RA 4J6IA 2MPHA 2FULA 5AJDA 1JNSA 3APCA 4I6JA 2WXHA 4Z2IA 3FUKA 3NQPA 4RVBA 4KZCA 4MGVA 4GZ3A 4RG9A 3D3MA 5JHBA 4FLBA 2CHWA 4TV3A 1YATA 3AS4A 3SGHA 2ZR5A 2KFWA 3U3WA 1EF1C 3PS6A 3CHCA 3ARYA 1Q6UA 2DT1A 3MJWA 3CV0A 3R7QA 2VTBA 4ODPA 5BW8C 1Q6IA 4U04A 5HI7A 5G04J 2PM7A 1ELRA 1IYGA 4XAKA 1FVHA 1E90A 2WB2A 1W3BA 4U0UA 4UQZA 1H2VC 3TAXA 2M2AA 4DLOA 4EZJA 1WY6A 3C98A 2EQXA 4GA2A 4L7TA 1HZ4A 5JJ7A 4I6GA 1HE8A 3APFA 4UWGA 2V4LA 3KEZA 1P5QA 4KBQA 4NNRA 1UN8A 4C9BB 3O5JA 3IKOB 1PAQA 4TRQA 4JEUA 3CIAA 3RMEA 2AOSA 3TJPA 4ODMA 4XI9A 3ODKA 4AY1A 5G2NA 4UWLA 1ROTA 4J8EA 4PDXA 1SZAA 1R9HA 1MHQA 4G2PA 2WXRA 2AVPA 5C2YA 4FJZA 1XRVA 3IK8A 3CQGB 4G11A 4FU3A 1F40A 2C2LA 2ZQUA 3ULQA 2OV8A 3HHMA 4P8VA 2PQNA 4N3AA 4S3KA 4U84A 4IQ2A 2KCKA 2IFUA 4BT9A 3AS8A 1VDYA 3UQIA 2QFCA 1NZNA 3ARPA 4E85A 3CHFA 5FQ7A 2VGYA 4P29A 3VAWA 3ASFA 5FQ6A 1LG2A 4HOUA 3D9PA 3O48A 2J49A 4BTBA 1XHGA 3AS3A 2L9BA 4DH0A 3S7DA 2NC9A 3PE4A 3TG4A 1DNPA 2RURA 3I4GA 1UG3A 5DF0A 4XKCA 4KVMA 2LSVA 4RSYA 1H0IA 2IOLA 2AW6A 3K9IA 4OVVA 3UUXA 2PPOA 2BTDA 3CHRA 2O9OA 2ITKA 4GZCA 4AJWA 3PRAA 2DSUA 4EPZA 4V3IA 3O5GA 2WXMA 1LQ0A 1FKIA 1QQEA 3H9RB 2L6JA 3JQ1A 4N39A 2XGOA 3CVPA 3HVEA 2WM9A 1NA0A 3WD0A 3FTSA 4CDMA 3CH9A 1NWTA 3Q49B 2MLYA 1EQ3A 3JYSA 3QK0A 2WXLA 2A3CA 3SI5A 3AS0A 4ZPWR 3NZUA 3CQCB 3ONKA 3JXVA 2XHEA 3RGCA 2XP9A 4HFGA 5KJLA 4H7YA 2LAHA 5BUZA 2FAPA 2WQ7A 1NWUA 1SYTA 1FKJA 3VLEA 4GA0A 3LEWA 2VSNA 3UI5A 3RRUA 1SQMA 4LUNU 5AIJA 3PE3A 1FKGA 4NACA 1UJJA 3WIJA 3FHEA 4GYOA 2RUCA 3RM8A 2R5SA 2VGXB 2PV1A 2CG3A 1PINA 3B8SA 3Q47B 1LF8A 2XP8A 4DLQA 4FN2A 3B7XA 3G2TA 2VSXE 3LDZA 5C1DA 1T11A 5FQ4A 2L2SA 1X6LA 3L16A 2V0PA 4ME2A 1E7VA 4JFKA 1OWMA 2VQ2A 3FTXA 4ACLA 4APFA 1TCOC 3D9OA 4FHJA 3ONLA 1JWFA 2YQ8A 3LJ3A 2XCCA 4U0ZA 1B89A 1ZL1A 2J08A 2VTBB 1PBKA 4FHKA 3ARTA 5FQ8A 4KMOA 4B94A 1NH6A 1DVPA 3CKCA 3SBSA 2X6FA 5I98A 1OGBA 4U63A 4DIPA 2FKEA 3PR9A 4JHKA 4MNMA 3KAEA 2WMOA 3AU5A 1WNOA 3O5MA 2XPZA 3I6CA 1BPOA 1J4HA 2UY1A 5EDSA 3CEQA 1HJXA 3FUJA 4GA1A 4DZ2A 3EHNA 2ESCA 4BWRA 3CVXA 4CEMA 3FU3A 4ODOA 4FAPA 4Z2JA 5KJNA 3S7FA 3CGMA 4DWSB 4XX5A 3I4RB 3TL5A 1E6PA 2CG2A 5FZRA 4U85A 4ODKA 2XPYA 4ITZA 1ZK6A 3S2AA 2LPVA 3NRKA 5BV1A 3ESKA 4LAYA 3UI4A 4GZDA 3T5VA 5FZQA 2YHCA 4LEUA 3TXNA 1HH8A 2RD0A 1LG1A 3JYJA 4U0SA 3WL0A 3PEVB 5DIUA 1W9PA 1FAPA 2UWJG 4ILHB 1Y0OA 4MKTA 4AOFA 2KATA 4I43A 1WAWA 4UQYA 3BG0B 1FKKA 5FJYA 2WPVA 3MDYB 2C0MA 2XPAA 2FDMA 2WM0A 3SBTB 5LX8A 1C9HA 1JNEA 4B8CB 2I1JA 3D9IA 2DG4A 3GZ1A 3WH0A 3MKQA 5BXJA 4C0EA 1FFQA 3CK7A 5FT9A 1H0AA 1UN9A 2KCVA 2KCLA 2IQCA 4MNJA 4BX9A 2OVFA 3ZHEA 4DWSA 3ARWA 1U79A 4K0RA 4AEZC 3KACA 3ASDA 3LXUX 3MX3A 1O6IA 3QKYA 4DRHA 4F1SA 4URKA 2QF8A 4DI4A 3O5FA 1GPFA 1OWOA 3L22A 4MS6A 3L17A 3ZYQA 3WXXA 2PI6A 1OWLA 2V5FA 1QPLA 4G2VA 3PUJA 1B6CA 1HO8A 3ZYMA 2AXVA 1NA3A 1HXVA 4QIBA 1X5BA 3CHOA 5HWCA 4IN3B 1E8YA 2ZR6A 4ODQA 4G26A 4J8DA 4GPKA 3OA5A 1NSGA 3ZW3A 3PNLB 3B9AA 4WAFA 4W9RA 1D6OA 2N87A 3B13A 3P1UA 4G24A 4EBAA 4GIVA 5LOZA 2GRLA 3UMVA 4ANVA 1ITXA 1L5JA 2LAIA 1IQRA 5DIVA 3CHPA 3HVEB 2J4DA 1N54A 4DWSD 4Z2GA 2FI7A 2JZVA 5M72A 3CVNA 4EECA 5CCLA 2CHXA 5B8IC 2PL2A 4HS2A 4I1MA 4O2TA 1GW6A 4XE0A 4FULA 4Z2KA 3OXFA 1Q1CA 1F8AB 3KADA 3CVQA 1LL4A 3RK6A 2YNQA 3Q15A 3PEUB 1JWGA 5D0QD 4J4NA 4G23A 4M3OA 1JNDA 5D0OD 4XI0A 2A4ZA 2A5UA 3MEKA 4ACKA 3U4TA 1Y8MA 4CGVA 2PM6A 3RIBA 1QNFA 1HKMA 4WNDA 1N1AA 2DT2A 3MGBA 2LNIA 4DRQA 4KXKB 1FKRA 2BF0X 3O5OA 2WXIA 2A3BA 5HTGA 2IF4A 3ARVA 4NQ0A 4DK5A 1H6KA 3CK9A 2F4EA 3LVRE 4BY6A 2UZ5A 1H2UA 4Z2LA 2WXGA 3I5PA 1E6NA 4GZ6A 1FKHA 1SR0A 1E96B 2VSYA 2PBCA 4PUCA 5DO2A 3LY9A 4AXHA 4LAWA 3QJZA 3SNXA 4DRKA 3TG5A 4P8UA 1PY1A 4E6HA 3LY8A 3MZLB 2NSZA 3ZXSA 1J6YA 3FEYA 3TGOA 2YHEA 4MAVA 3ZN3A 1ZCNA 4AV7A 4WKFA 3B7RL 3L6AA 4GGQA 4EBAG 3WD1A 2FO7A 3I3NA 4NSBA 3SFZA 2C0LA 4DRPA 4JFLA 2DBAA 3ASHA 5FZSA 2WXKA 4BTAA 1TJFA 4PS7A 3O5PA 2MHKA 1JUQA 1Q6HA 3GW4A 2X6IA 5LFAA 3CVYA 3IHVA 3EIJA 3MKQB 1S0PA 2KC7A 3VLDA 4MNKA 2P58C 2PPPA 5KJKA 2NXPA 1E15A 2PZIA 3FTYA 3KAIA 3CK8A 4LGXA 2WLZA 2QY7A 4AVXA 2XP7A 3FTUA 3IKGA 4JA9A 2VJ8A 2WK2A 3G6LA 3PRBA 5A6CA 4KYOB 4FJYA 4RG6A 4A1GA 1NWRA 3APDA 1LL6A 4YVOA 5HUAA 1ZBKA 5GPGA 4FA6A 1MQSA 2M08A 1E8WA 2WXQA 3Q4AB 5HW6A 4S3JA 2XGMA 1WM5A 4CT0A 4IPXA 3UX4A 2E0IA 1ZBPA 4ANUA 4AM9A 3QWWA 1H2TC 1TFVA 2ZQTA 2AXZA 2ZQVA 4GMJA 4LAVA 3JQ0A 4Y6CA 4N5CA 3MV2B 3FH5A 2GGFA 3DBSA 1EIBA 3CVWA 4UWHA 5KJMA 3ZPJA 3CVLA 2X3MA 3PH0C 5CCMA 3E4BA 4DPRA 3FWVA 3OXGA 3ZEFA 1HG5A 1UJKA 4W9PA 4ABNA 1PC2A 2A3EA 2PV2A 3ARUA 3CVUA 3RFWA 4QT3A 2J09A 1ZBVA 2DCPA 3UT8A 2HO1A 2DT3A 3PA7A 3KAFA 5ARGA 4R0XA 1RD6A 3FAPA 2KO7A 3MYVA 4A1SA 3IHYA 3UT4A 4LERA 3UI6A 4Q22A 2CFUA 1WAO1 4OVUA 3B9DA 4G25A 1HJWA 1UR8A 4CT4A 3O5IA 4TUUA 3ARSA 3O5RA 3G2VA 4DI3A 3ALFA 5ANRA 2YBTA 1W1VA 1YA0A 1HG2A 3U64A 4B89A 3TDBA 2VCDA 2YINA 4HOQA 3FTWA 4GYYA 3FU5A 3D9KA 4MRUA 2WXOA 1E6ZA 4OYSA 3LUOA 3O5LA 5DITA 3QARA 4I1AA 4UI9K 4I2ZA 3U66A 1HF8A 2Y4UA 2X38A 3IKDA 3FUMA 2XEVA 2KZTA 1EYMA 4CCAA 3CLJA 3FUIA 4J8FA 4U86A 4WNEA 4WJXA 2XGSA 4L2LA 4TW8A 1ZU2A 2JEKA 1TEZA 4B8AA 2IOSA 3LPZA 4G1TA 4DRNA 3FUFA 4YVQC 3FUDA 3TXMA 4MLPA 3AS2A 3G2UA 2F2DA 3MCXA 5KCMA 1M5YA 2V8SE 3RM4A 4J0UA 5CHEE 3CVVA 4D10C 3FTVA 1FJDA 4L23A 5G05J 1INZA 1HKJA 5LCWJ 3O5KA 4HOTA 4ODNA 4QZVB 4ML4A 2L0TB 3EY6A 3CKBA 4HARA 4JL0A 2MNTA 3NZSA 3R7RA 4CDNA 4EZLA 5E75A 2R17C 1ROUA 3QWVA 4HLEA 3LKUA 3ZRHA 4JA7A 1J4RA 5HW8A 1FKDA 2UY1B 4L2YA 4F7AA 3UQ3A 5EKQD 4WIWA 2KM4A 1HJVA 3QWPA 3KCEA 2LO6A 3WD3A 4DRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G23 A;  4DT4 A;  2VGY A;  1FKF A;  4TNS A;  3VAW A;  4C02 B;  5D0O D;  4XI0 A;  5LCW C;  3ASF A;  3MEK A;  5A7D B;  2XPI A;  4HOU A;  1XNF A;  3O48 A;  4TW6 A;  3U4T A;  1Y8M A;  5JJT A;  4BTB A;  4CGV A;  5BNW A;  4AIF A;  3RIB A;  4DH0 A;  3S7D A;  2NC9 A;  3PE4 A;  4WND A;  3TG4 A;  2XCB A;  2RUR A;  3KAH A;  1N1A A;  3CGN A;  3R9A B;  4JYS A;  2RUQ A;  2LNI A;  4DRQ A;  4KXK B;  3OXL A;  2LSV A;  1FKR A;  4HOR A;  3O5O A;  3K9I A;  5HTG A;  3UF8 A;  2IF4 A;  3UUX A;  2PPO A;  2M1I A;  2F21 A;  4CDR A;  2ITK A;  3SF4 A;  4TW7 A;  4NQ0 A;  3CK9 A;  3RKV A;  2F4E A;  2UZ5 A;  3O5Q A;  3URZ A;  3MKR A;  5AYW D;  4GCN A;  5BT1 A;  3QOU A;  4GZ6 A;  3ZFW A;  1FKS A;  1FKH A;  3O5G A;  1FKI A;  2PPN A;  1QQE A;  2L6J A;  4N39 A;  5G04 C;  3H9R B;  1E96 B;  2VSY A;  2PBC A;  2XGO A;  2I6H A;  3LYA A;  4GZ5 A;  4BF8 A;  4JFI A;  2E2E A;  3LY9 A;  3CVP A;  3KS2 A;  2Q5A A;  3LY7 A;  4JFM A;  2LJ4 A;  4N19 A;  4LAW A;  1NA0 A;  4GCO A;  2WQH A;  3O5E A;  5ARF A;  1ELW A;  4DRK A;  2Q7F A;  3TG5 A;  3PRD A;  3Q49 B;  2MLY A;  1EQ3 A;  3JYS A;  5HW7 A;  3LY8 A;  3AS5 A;  4CGW A;  2RSE A;  5HT1 A;  1J6Y A;  3TGO A;  4ODL A;  3ZHE B;  3KZ7 A;  4LAX A;  4JFJ A;  4TX0 A;  1OUV A;  2OFN A;  3JXV A;  3O5D A;  1D7I A;  3LCA A;  3RGC A;  2XP9 A;  2XP3 A;  3ZN3 A;  1ZCN A;  3N71 A;  1KT1 A;  3NF1 A;  4XIF A;  5KJL A;  4H7Y A;  3PDN A;  1YW5 A;  3KD7 A;  2FAP A;  4GGQ A;  1KT0 A;  4DRM A;  1A17 A;  2FO7 A;  3BEE A;  4W9O A;  1FKJ A;  2C0L A;  4DRP A;  4JFL A;  2FF4 A;  4GA0 A;  2DBA A;  3ASH A;  2VSN A;  3UI5 A;  5FZS A;  4U07 A;  3KAB A;  5HWB A;  4EQF A;  4GYW A;  4W9Q A;  4G50 A;  3PE3 A;  4N2S A;  3EDT B;  4BTA A;  2DG3 A;  1FKG A;  3O5P A;  1FKL A;  2MHK A;  4GYO A;  2RUC A;  1Q6H A;  4WNF A;  3GW4 A;  2R5S A;  4Y6W A;  3TC5 A;  2VGX B;  4F3V A;  2PV1 A;  3RO2 A;  1PIN A;  3Q47 B;  2XP8 A;  2KC7 A;  2D9F A;  4I9E A;  4FN2 A;  5JJ6 A;  3B7X A;  4TYO A;  2P58 C;  5C1D A;  3S7B A;  2JLB A;  1T11 A;  2PV3 A;  2L2S A;  2PPP A;  5KJK A;  4ME2 A;  4JFK A;  2PZI A;  2VQ2 A;  3RU0 A;  3KAI A;  3CK8 A;  2LSU A;  3RJV A;  1TCO C;  3OOB A;  1BKF A;  5DBK A;  3FFL A;  2YQ8 A;  4AY5 A;  2XCC A;  4U0Z A;  1B89 A;  2XP7 A;  4I17 A;  3IHZ A;  5DIZ A;  1PBK A;  1J4I A;  3FP3 A;  3QDN A;  5G05 C;  2XP6 A;  3IKG A;  1HXI A;  2OOE A;  4JA9 A;  2DG9 A;  4B94 A;  2ZQS A;  1FKT A;  3PRB A;  3VTY A;  5A6C A;  1A7X A;  4KYO B;  4WNG A;  4AY6 A;  3CKC A;  5I98 A;  3UPV A;  4RG6 A;  4DIP A;  3HYM B;  3KAG A;  2FKE A;  4H7X A;  4I9C A;  4YVO A;  5HUA A;  3KAE A;  2VYI A;  5GPG A;  3RO3 A;  2RUD A;  2HYZ A;  2M08 A;  3Q4A B;  3O5M A;  5D75 A;  2AWG A;  5HW6 A;  4DRI A;  3I6C A;  2PQR A;  1J4H A;  2UY1 A;  1QPF A;  2LGO A;  2XGM A;  1WM5 A;  5EX3 A;  4IPX A;  1JNT A;  2XP5 A;  3CEQ A;  2J9Q A;  1ZBP A;  4GA1 A;  4DZ2 A;  4AM9 A;  4UQX A;  3QWW A;  4BWR A;  4DZ3 A;  4UI9 J;  2ZQT A;  4ODO A;  3ASG A;  4FAP A;  2ZQV A;  5KJN A;  3S7F A;  3CGM A;  4JHR A;  4LAV A;  4Y6C A;  2KGJ A;  4N5C A;  5FZR A;  4U85 A;  1L1P A;  4ODK A;  2GW1 A;  3MV2 B;  4APO A;  4ITZ A;  1ZK6 A;  4WUY A;  1D7J A;  1W26 A;  3SZ7 A;  2ZR4 A;  5KJM A;  3ZPJ A;  2XPB A;  2LPV A;  3NRK A;  3CVL A;  3ESK A;  4LAY A;  3UI4 A;  1TJC A;  3E4B A;  5CCM A;  3FWV A;  2FBN A;  5FZQ A;  3GYZ A;  3OXG A;  1IHG A;  1NMV A;  2YHC A;  4LEU A;  1HH8 A;  3JYJ A;  4U0S A;  5DIU A;  5FTP A;  1FAP A;  2UWJ G;  4W9P A;  4MSP A;  3TCZ A;  4ABN A;  4UI9 C;  1Y0O A;  1PC2 A;  4O6F A;  2PV2 A;  2KR7 A;  3GZ2 A;  1FD9 A;  2KI3 A;  3RFW A;  2KAT A;  2RQS A;  4QT3 A;  4UQY A;  2HO1 A;  3PA7 A;  3KAF A;  1FKK A;  5FJY A;  2WPV A;  4YND A;  2C0M A;  5ARG A;  2XPA A;  3MDY B;  4R0X A;  3FAP A;  1FKB A;  2KO7 A;  4A1S A;  2BUG A;  1BL4 A;  3UQB A;  3MV3 B;  3UQA A;  3UI6 A;  3JYM A;  1D7H A;  4J4O A;  1C9H A;  1WAO 1;  4G25 A;  2MPH A;  2DG4 A;  3GZ1 A;  3WH0 A;  1JNS A;  4IQC A;  3O5I A;  5BXJ A;  3CK7 A;  3O5R A;  4QT2 A;  5FT9 A;  2LKN A;  1KLX A;  1YA0 A;  2KCV A;  3TDB A;  2VCD A;  4MGV A;  4ODR A;  2KCL A;  4GZ3 A;  4HOQ A;  4RG9 A;  3ZHE A;  4GYY A;  1YAT A;  3AS4 A;  1U79 A;  3KAC A;  2Y78 A;  2ZR5 A;  2KFW A;  3U3W A;  3ASD A;  3LUO A;  3O5L A;  1Q6U A;  5DIT A;  4I1A A;  4UI9 K;  4I2Z A;  3QKY A;  3CV0 A;  5EX0 A;  4DRH A;  2Y4U A;  5BW8 C;  4ODP A;  1Q6I A;  3IKD A;  3O5F A;  4U04 A;  4HOS A;  4DRO A;  5HI7 A;  2XEV A;  5G04 J;  3VTX A;  3WXX A;  1EYM A;  4N3C A;  2MF9 A;  1ELR A;  1IYG A;  2V5F A;  1QPL A;  4J8F A;  4U86 A;  1W3B A;  4G2V A;  2KE0 A;  1B6C A;  4WNE A;  2XGS A;  4NRH B;  4TW8 A;  4U0U A;  1ZU2 A;  4UQZ A;  3LPZ A;  3TAX A;  1NA3 A;  2M2A A;  4G1T A;  4QIB A;  1HXV A;  4BT8 A;  4DRN A;  4GA2 A;  1HZ4 A;  5HWC A;  2MLZ A;  4IN3 B;  4YVQ C;  2ZR6 A;  4ODQ A;  5JJ7 A;  4G26 A;  2F2D A;  4J8D A;  4GPK A;  1M5Y A;  2VN1 A;  1NSG A;  4J0U A;  1NMW A;  5CHE E;  4W9R A;  1D6O A;  2N87 A;  1P5Q A;  4G24 A;  3NTP A;  4KBQ A;  1QZ2 A;  1JVW A;  4NNR A;  2FEZ A;  4GIV A;  1FJD A;  5G05 J;  3O5J A;  2XP4 A;  5LCW J;  3O5K A;  4HOT A;  3S7J A;  4ODN A;  5HQ8 A;  3NI6 A;  3Q5M A;  4I2W A;  4N3B A;  5DIV A;  2OND A;  3EY6 A;  4ODM A;  3CKB A;  4XI9 A;  3ODK A;  4JL0 A;  4N2Q A;  2MNT A;  1ROT A;  4J8E A;  2FI7 A;  2K8I A;  2JZV A;  1ROU A;  3QWV A;  1R9H A;  4G2P A;  5M72 A;  3CVN A;  2AVP A;  3ZGQ A;  2VGX A;  5CCL A;  2HR2 A;  5J6E A;  3IK8 A;  5B8I C;  3LKU A;  1FCH A;  2PL2 A;  5HKG A;  1F40 A;  2C2L A;  3IEG A;  2ZQU A;  4O2T A;  4JA7 A;  3ULQ A;  1J4R A;  5HW8 A;  2PQN A;  4N3A A;  1FKD A;  3OXF A;  2UY1 B;  1Q1C A;  1F8A B;  3MA5 A;  4U84 A;  3KAD A;  3CVQ A;  3GPK A;  3UQ3 A;  2Y4T A;  5EKQ D;  4IQ2 A;  3Q15 A;  2KCK A;  2IFU A;  4BT9 A;  3QWP A;  3KCE A;  5D0Q D;  4DRJ A;  3AS8 A;  2MLX A;  3UQI A;  2QFC A;  1NZN A;  4J4N A; 
#chains in the Genus database with same CATH topology
 4DT4 A;  1UR9 A;  4TNS A;  3FU0 A;  3HRA A;  4WWP A;  1H6O A;  3WKZ A;  5A7D B;  1XNF A;  3D9L A;  3PVL A;  2XS8 A;  3HDX A;  5JJT A;  5JH8 A;  2I2O A;  5BNW A;  4GTQ A;  3DSX A;  4OAV B;  4L3N A;  1TNU A;  3ZUV B;  2HM8 A;  4JXT A;  4LNU D;  4TXR A;  4J8Y A;  2XCB A;  3CGN A;  3R9A B;  2XEH A;  1Z3X A;  2QC9 A;  2RG8 A;  4HOR A;  1GUV A;  3UF8 A;  4DX2 A;  2M1I A;  2F21 A;  4CDR A;  4PS3 A;  3SF4 A;  4GU5 A;  3RKV A;  3T5X A;  3EJN A;  3WD2 A;  2BED A;  3MKR A;  1K3Z D;  3U9W A;  5BT1 A;  3B7S A;  1FKS A;  2KBX A;  5J90 A;  2PNN A;  2PPN A;  5G04 C;  1DC2 A;  3B7U X;  4GZ5 A;  4JFI A;  4TXP A;  2E2E A;  3KS2 A;  1KFW A;  2Q5A A;  3LY7 A;  5HBF A;  3FUN A;  4JFM A;  2LJ4 A;  1E6R A;  4GCO A;  2WQH A;  3LJN A;  4R7L A;  4UDM A;  3IBE A;  3L08 A;  3P2B A;  4JW1 A;  3ML9 A;  4CGW A;  2RSE A;  5HT1 A;  2DSW A;  1JCQ A;  4KR0 B;  3QC1 A;  4YDY A;  3FUH A;  4LAX A;  4FC8 A;  4TX0 A;  2VGE A;  2OFN A;  1FVF A;  4GTV A;  2LXM A;  1HKI A;  2IJG X;  3FEX A;  4XIF A;  3PDN A;  4L9P A;  3WQV A;  3G6M A;  1KT0 A;  4EZK A;  3RSE G;  1A17 A;  3Q79 A;  4JVS A;  3ABM E;  1X6N A;  4U07 A;  5T4Y A;  2OVB A;  4EQF A;  4G50 A;  5EID A;  3FY1 A;  4N2S A;  3EDT B;  2DG3 A;  4C48 B;  4I6E A;  1H19 A;  3JUE A;  4L1B A;  1FKL A;  1D2K A;  3L13 A;  4U8Y D;  3TC5 A;  2F37 A;  1BI8 B;  3JXI A;  1Z3Y A;  4F3V A;  2IU1 A;  1E7U A;  1SA5 A;  4I9E A;  1G3N B;  4ANW A;  1WB0 A;  5CBN A;  4TYO A;  2PV3 A;  2RKK A;  5CER B;  3ARR A;  3AQU A;  3SFY A;  5J08 A;  5H7P A;  1OWP A;  3RU0 A;  1E8X A;  1OCR E;  3L82 A;  5T8I A;  5BV0 A;  1HU3 A;  3OOB A;  1BKF A;  2MRI A;  2XRY A;  5DBK A;  1OWQ A;  4AY5 A;  4I17 A;  3PRZ A;  3IHZ A;  1J4I A;  1K9T A;  3QDN A;  1HXI A;  2OEW A;  2ZQS A;  1A7X A;  5GQB A;  1TR4 A;  4WNG A;  4AY6 A;  2WMN A;  4JPS A;  4A3T A;  3UPV A;  3ARZ A;  3V2X A;  2ZGD A;  3HYM B;  4MTV A;  3KAG A;  4I9C A;  3PZ2 A;  1GRJ A;  5FWQ A;  4ZHB A;  3B7T A;  2VYI A;  3FH7 A;  2HYZ A;  4N5Q A;  3DSU A;  5D75 A;  2AWG A;  4DRI A;  2PQR A;  2XEN A;  1JNT A;  5ENS D;  2YBU A;  2J9Q A;  3ARQ A;  3BXW A;  2BKK B;  4UQX A;  3LVQ E;  1SW6 A;  4BSZ B;  1Y6I A;  4DZ3 A;  4UI9 J;  3CR3 A;  2AXU A;  5A23 A;  4W5U A;  2G41 A;  2IY0 C;  1IKN D;  3FH8 A;  4HRM B;  1NL4 A;  2KGJ A;  4QFV A;  1L1P A;  2GW1 A;  3Q73 A;  1W26 A;  3SZ7 A;  2P9S G;  4GB9 A;  1W1T A;  2WXN A;  1TJC A;  1V55 E;  3CZ8 A;  4BFR A;  2M63 A;  1IHG A;  2BKG A;  4WWN A;  5HS0 A;  4FLH A;  1CTN A;  5FTP A;  3IV0 A;  3ZYL A;  1ZBW A;  3HXD A;  4MSP A;  3E33 A;  4UI9 C;  4O6F A;  1A5E A;  4HBE A;  3GZ2 A;  3ABL E;  4NUR A;  2EIJ E;  4F53 A;  4A55 A;  1N4P A;  2KI3 A;  2ZU6 B;  1Q2Z A;  3WD4 A;  3ESL A;  4LCT A;  2R02 A;  5ENO D;  4GAA A;  4YND A;  3E32 A;  1D8E A;  1FKB A;  4Q94 A;  2BUG A;  3ARO A;  4UWF A;  2XZD G;  3MV3 B;  1D7H A;  4DWS C;  3RRM B;  2KZT B;  4J8S A;  3QNK A;  4GTP A;  1TNZ A;  4IQC A;  4QT2 A;  1EPU A;  2LKN A;  3ZYK A;  1NFI E;  4WKA A;  1KLX A;  4EHM A;  1ZU8 A;  4DX1 A;  4ODR A;  3D9J A;  4WKH A;  2XRZ A;  2WQ6 A;  4GTO A;  3FUE A;  2Y78 A;  2IUZ A;  2GRR B;  4XZ4 A;  4MNL A;  2QYU A;  3BG1 B;  5ANL A;  2ETB A;  4JB8 P;  5EX0 A;  4FAD A;  3TWU A;  4DRX E;  4O60 A;  4KT6 B;  4DRO A;  3ABK E;  4HOS A;  3FXY A;  3VTX A;  4N3C A;  4X8Q A;  2MF9 A;  2X6H A;  1E44 A;  4I1O B;  3OAW A;  1HFA A;  4K03 A;  4B0Z A;  2KE0 A;  4NRH B;  3CHQ A;  2WLY A;  3B9E A;  1BU9 A;  4DJA A;  1JCH B;  4A63 B;  4BT8 A;  3ENE A;  2AWI A;  3QAQ A;  1ZB5 A;  2J07 A;  2MLZ A;  2Y3A A;  2EIK E;  2F0Y A;  2Y69 E;  4DX6 D;  1MX4 A;  4KVO A;  2VN1 A;  1E8Z A;  1NMW A;  5E76 A;  4JHJ A;  4GTT A;  4HNA D;  3NTP A;  1QZ2 A;  1JVW A;  2FEZ A;  1QYM A;  3ZNG A;  3WQW A;  2DT0 A;  2XP4 A;  3AS1 A;  4LNB A;  4YDO A;  3S7J A;  5HQ8 A;  3NI6 A;  2WXP A;  3Q5M A;  3QB2 A;  4I2W A;  5G55 A;  4N3B A;  1YCS B;  2OND A;  4R5E A;  3UTM A;  1IHB A;  4G8L A;  1SZ9 A;  3W9F A;  2F8X K;  5DEZ A;  1FT2 A;  3G2W A;  4N2Q A;  3HXE A;  1HKK A;  4GML A;  5BPP A;  2ION A;  5BXU A;  2K8I A;  3FDH A;  1W1Y A;  4HXI A;  1EHN A;  5AQA A;  2WXJ A;  3ZGQ A;  2VGX A;  3ZIM A;  1N52 A;  2HR2 A;  5J6E A;  3EHM A;  2P9K G;  1FCH A;  2ETC A;  5HKG A;  3IEG A;  4HVB A;  4WK9 A;  3Q7A A;  2Y1L E;  3CHE A;  4U95 D;  4Z2H A;  3JUI A;  4FP7 A;  3MA5 A;  3GPK A;  2Y4T A;  3EIQ C;  4IUL A;  2P9U G;  2MLX A;  1FKF A;  4UWK A;  4C02 B;  3D9N A;  3T8M A;  4Q96 A;  1FFR A;  5LCW C;  2CFZ A;  4ILG A;  2XPI A;  4ZPT R;  2X6K A;  4TW6 A;  2NYJ A;  2VSO E;  4AIF A;  3ALG A;  1IX5 A;  1OT8 A;  4GTM A;  1E9L A;  1TN8 A;  3KAH A;  4JYS A;  3WG7 E;  3ZVV A;  1DCQ A;  2RUQ A;  4HRL A;  2L0I A;  3OXL A;  1U3C A;  2B31 A;  1OGG A;  4AP2 A;  3SD5 A;  3UT7 A;  4ZPV R;  4MPK A;  1Z6T A;  4L72 B;  4KZ0 A;  2R03 A;  4HQD A;  5LP0 A;  4HBO A;  4TW7 A;  4YDW A;  2G8Z A;  4ATG A;  3O5Q A;  4PS8 A;  1S64 A;  3URZ A;  3FTZ A;  2QZA A;  5AYW D;  4GCN A;  3QOU A;  4O1O A;  3ZFW A;  2EIL E;  3O4Z A;  1HX8 A;  4NZC A;  4IRU A;  1KPS B;  1U2V G;  3FU6 A;  4ILI A;  2I6H A;  3LYA A;  3DPD A;  4BF8 A;  2WVI A;  3JCK C;  5CMY A;  3RM9 A;  5IY5 E;  4N19 A;  2OLH A;  2GRM A;  3UIN C;  3O5E A;  3FY4 A;  5ARF A;  1ELW A;  2Q7F A;  1N4R A;  3PRD A;  2J4B A;  2P4V A;  1XGW A;  2IO3 C;  4RQI A;  5HW7 A;  2H6F A;  3AS5 A;  4ZFH A;  4ODL A;  3ZHE B;  3KZ7 A;  3CSF A;  4U8H A;  5CRU A;  1JPL A;  4JFJ A;  1OUV A;  5AEN A;  3O5D A;  5FIO A;  1D7I A;  3LCA A;  3EU9 A;  2XP3 A;  3CHM A;  2A3A A;  3N71 A;  1KT1 A;  1UW4 B;  3NF1 A;  1YW5 A;  1BLX B;  1U3D A;  3KD7 A;  3PUK A;  4BEP A;  4Q7N A;  1QBQ A;  4DRM A;  2DSZ A;  3V31 A;  3BEE A;  3GZS A;  4W9O A;  2DSV A;  1OWN A;  2FF4 A;  4IT6 A;  4BX8 A;  3EHR A;  2R59 A;  3G2S A;  3KAB A;  5HWB A;  4GYW A;  4W9Q A;  1DCE A;  4IYP A;  3VLF A;  3L9T A;  3UIP C;  3AU4 A;  4WNF A;  3B95 A;  4Y6W A;  3ARX A;  3C3Q A;  3RO2 A;  3RRN B;  1ELK A;  1W9U A;  1GOI A;  1W1P A;  2D9F A;  4LRZ A;  5T3R A;  5JJ6 A;  4OAU C;  1H0G A;  3L54 A;  3S7B A;  2JLB A;  1VF8 A;  1LL7 A;  1KZO A;  2P9L G;  3SHF A;  3HIZ A;  4CRW A;  2DYR E;  2XQ0 A;  1HS6 A;  2LSU A;  3LS8 A;  5CMW A;  5ENT D;  3RJV A;  3FFL A;  3ML8 A;  1NWS A;  3ISM C;  5DIZ A;  3FP3 A;  5G05 C;  4XKB A;  2XP6 A;  4P8W A;  1EDQ A;  1W9V A;  5AJL A;  2OOE A;  3QOK A;  4ZS6 A;  2DG9 A;  2CHZ A;  1FKT A;  3VTY A;  1NP7 A;  3TWT A;  3CST A;  3OTN A;  4H7X A;  4Q69 A;  2MOW A;  1H6P A;  3RO3 A;  2RUD A;  3D9M A;  5JHA A;  4C0M A;  1TN7 A;  2I1K A;  2LGO A;  1QPF A;  2ILR A;  1LTX A;  5EX3 A;  1ZBC A;  4P8X A;  2XP5 A;  3SO8 A;  1SA4 A;  1OY3 D;  3CHD A;  4U96 D;  4WWO A;  4F6R D;  4KQZ A;  3CGH A;  2B0O E;  1X81 A;  3ASG A;  1AP7 A;  4JHR A;  5CRV A;  3B7B A;  1TNO A;  4JEH A;  3PZD A;  3NAW A;  4APO A;  2X6J A;  4WUY A;  1D7J A;  4BSX A;  2ZR4 A;  3Q9N C;  3FUL A;  1D9S A;  2JAB A;  1LJY A;  2XPB A;  5ENN A;  2AJA A;  1O1R A;  2O92 A;  2FBN A;  1EDU A;  3GYZ A;  1NMV A;  4M7C A;  2I9C A;  4ANX A;  4JC8 A;  2DPE A;  1N0Q A;  3ZKJ A;  3TCZ A;  3PNT B;  3R9M A;  3CHS A;  2KR7 A;  1FD9 A;  1IQU A;  4A3V A;  3PZ1 A;  2RQS A;  5GPR A;  1EYH A;  4URI A;  2DIW A;  3WL1 A;  2WXF A;  4JZY A;  4PH4 B;  1BL4 A;  3UQB A;  3UQA A;  4PTM A;  3JYM A;  3PRE A;  4IT4 A;  1FT1 A;  4J4O A;  3W4R A;  3UM2 A;  4J6I A;  2MPH A;  2FUL A;  5AJD A;  3SY2 A;  1JNS A;  3APC A;  4I6J A;  1NI1 A;  3DEO A;  2ETN A;  3V2O A;  2GRQ B;  2WXH A;  4Z2I A;  2P9N G;  3FUK A;  3NQP A;  4RVB A;  4KZC A;  3F6Q A;  4MGV A;  1KZP A;  4GZ3 A;  4RG9 A;  3D3M A;  5JHB A;  4FLB A;  2CHW A;  4TV3 A;  1YAT A;  3AS4 A;  3DSS A;  3SGH A;  2IO2 C;  3E34 A;  5EIB E;  4RLY A;  2ZR5 A;  2KFW A;  3U3W A;  1EF1 C;  1N4Q A;  3PS6 A;  5B1B E;  3ARY A;  3CHC A;  1Q6U A;  2DT1 A;  3MJW A;  3CV0 A;  3R7Q A;  2VTB A;  2R2L A;  4ODP A;  5BW8 C;  5AQB A;  1Q6I A;  4U04 A;  5HI7 A;  5G04 J;  3T9K A;  2H6H A;  3DST A;  2PM7 A;  1ELR A;  1IYG A;  5ENR D;  4XAK A;  1FVH A;  1E90 A;  2WB2 A;  1W3B A;  4HRN A;  3PZ4 A;  1K1B A;  4U0U A;  4UQZ A;  1H2V C;  3TAX A;  2M2A A;  4DLO A;  4EZJ A;  1WY6 A;  3C98 A;  2EQX A;  4GA2 A;  4L7T A;  1HZ4 A;  2ZIS A;  5JJ7 A;  4I6G A;  1HE8 A;  2A5E A;  2EUL A;  3APF A;  1O1T A;  5AQ9 A;  4UWG A;  4HB5 A;  2V4L A;  2ZGG A;  3KEZ A;  2QYJ A;  1P5Q A;  4KBQ A;  4NNR A;  1UN8 A;  4C9B B;  3O5J A;  3IKO B;  1PAQ A;  5EIL A;  5ENQ D;  4TRQ A;  2F8Y A;  4JEU A;  2RFA A;  1O5M A;  2XZT G;  3CIA A;  3RME A;  2AOS A;  3UM1 A;  3V30 A;  3TJP A;  4ODM A;  4XI9 A;  3ODK A;  4AY1 A;  2HE0 A;  5G2N A;  4UWL A;  2P9P G;  1ROT A;  3V79 K;  4J8E A;  1AWC B;  4PDX A;  1SZA A;  3DEP A;  1R9H A;  1MHQ A;  4G2P A;  2WXR A;  2AVP A;  5C2Y A;  4FJZ A;  1XRV A;  3IK8 A;  3CQG B;  4G11 A;  4FU3 A;  1F40 A;  2C2L A;  2ZQU A;  4MBG A;  3ULQ A;  2OV8 A;  3HHM A;  4P8V A;  2PQN A;  4N3A A;  4S3K A;  4U84 A;  4IQ2 A;  5CEC B;  2KCK A;  2ZXW E;  2IFU A;  3AG1 E;  4BT9 A;  3AS8 A;  1VDY A;  4TXQ A;  3UQI A;  2QFC A;  1NZN A;  3ARP A;  4E85 A;  3CHF A;  5FQ7 A;  2VGY A;  4P29 A;  3VAW A;  3ASF A;  2ETA A;  3Q7F A;  5FQ6 A;  3W9G A;  4HOU A;  1LG2 A;  3D9P A;  3O48 A;  2J49 A;  2P2C P;  3NOC D;  1S63 A;  4BTB A;  1XHG A;  3AS3 A;  2L9B A;  4DH0 A;  1N4S A;  3S7D A;  2NC9 A;  3PE4 A;  3TG4 A;  1DNP A;  2RUR A;  3I4G A;  1UG3 A;  5DF0 A;  3DXM G;  4XKC A;  4KVM A;  4BES A;  2LSV A;  4RSY A;  1H0I A;  2IOL A;  2AW6 A;  3K9I A;  4OVV A;  3UUX A;  2PPO A;  2BTD A;  3CHR A;  3TWW A;  2O9O A;  2ITK A;  3AG2 E;  3UKR G;  4GZC A;  2L6B A;  4AJW A;  3PRA A;  3Q9U C;  5KWD A;  2DSU A;  1V54 E;  4EPZ A;  1MX6 A;  4V3I A;  3O5G A;  2WXM A;  1LQ0 A;  1FKI A;  1QQE A;  2L6J A;  3JQ1 A;  4N39 A;  3H9R B;  1JCS A;  2XGO A;  3CVP A;  3HVE A;  2WM9 A;  1NA0 A;  3WD0 A;  3FTS A;  4CDM A;  3CH9 A;  1NWT A;  3Q49 B;  2MLY A;  1EQ3 A;  3JYS A;  3QK0 A;  2WXL A;  2A3C A;  3SI5 A;  3AS0 A;  4ZPW R;  3NZU A;  3CQC B;  3ONK A;  3JXV A;  2XHE A;  1IXV A;  4F1P A;  3RGC A;  2XP9 A;  3SFX A;  4HFG A;  5KJL A;  4H7Y A;  2LAH A;  5BUZ A;  2FAP A;  2WQ7 A;  1NWU A;  1SYT A;  1FKJ A;  3VLE A;  4GA0 A;  3LEW A;  2VSN A;  1TYQ G;  3RRU A;  3UI5 A;  5EN5 D;  4GMR A;  1SQM A;  4LUN U;  5AIJ A;  2H6G A;  3PE3 A;  1FKG A;  4NAC A;  4GTR A;  1UJJ A;  4B93 B;  3WIJ A;  3FHE A;  4GYO A;  2RUC A;  3RM8 A;  2R5S A;  2VGX B;  2PV1 A;  4DX5 D;  2CG3 A;  1PIN A;  3B8S A;  3Q47 B;  1LF8 A;  2XP8 A;  4BER A;  4DLQ A;  3Q75 A;  4FN2 A;  3B7X A;  3NOG D;  3G2T A;  2VSX E;  3LDZ A;  5C1D A;  1T11 A;  1MX2 A;  5FQ4 A;  2L2S A;  1X6L A;  3L16 A;  2V0P A;  4ME2 A;  1E7V A;  4JFK A;  1OWM A;  2VQ2 A;  3FTX A;  4ACL A;  4CZ2 D;  4APF A;  1FPP A;  1TCO C;  3D9O A;  4FHJ A;  3ZU7 B;  4DUI A;  3ONL A;  1JWF A;  2YQ8 A;  3LJ3 A;  2XCC A;  4U0Z A;  1B89 A;  4LSZ E;  1ZL1 A;  2J08 A;  2VTB B;  1PBK A;  4FHK A;  3ART A;  1SVX A;  3J5Q B;  5FQ8 A;  3UI2 A;  4KMO A;  4B94 A;  1NH6 A;  1DVP A;  3CKC A;  3SBS A;  2X6F A;  5KBA A;  5I98 A;  1OGB A;  4U63 A;  4DIP A;  3EIP A;  2FKE A;  3DXK G;  3PR9 A;  4JHK A;  4MNM A;  3UM0 A;  3AG4 E;  3KAE A;  2WMO A;  3AU5 A;  1WNO A;  3O5M A;  5D2M C;  2XPZ A;  3I6C A;  1BPO A;  3UIO C;  2UY1 A;  1J4H A;  5EDS A;  3CEQ A;  1HJX A;  3HXF A;  3FUJ A;  4GA1 A;  4DZ2 A;  3EHN A;  2ESC A;  4BWR A;  3BU8 A;  3CVX A;  4CEM A;  3FU3 A;  5D66 A;  4ODO A;  4FAP A;  4Z2J A;  5KJN A;  3S7F A;  3CGM A;  4DWS B;  4XX5 A;  3I4R B;  3TL5 A;  5JMN D;  1E6P A;  2CG2 A;  5FZR A;  4U85 A;  4ODK A;  2XPY A;  4ITZ A;  1ZK6 A;  3S2A A;  2RFM A;  4U7E B;  3UXG A;  5BV1 A;  3ESK A;  2LPV A;  3NRK A;  4LAY A;  3UI4 A;  4GZD A;  2B5U B;  3T5V A;  5FZQ A;  2LUH A;  3AAA C;  5JA4 D;  2YHC A;  4LEU A;  3TXN A;  1HH8 A;  2RD0 A;  1LG1 A;  3JYJ A;  4U0S A;  2ZIR A;  3WL0 A;  3PEV B;  5DIU A;  1W9P A;  1FAP A;  2UWJ G;  4ILH B;  1Y0O A;  4MKT A;  1Z5S C;  2GRN B;  4AOF A;  2KAT A;  3HG0 D;  2GRP B;  2FO1 E;  1ZB1 A;  4I43 A;  1WAW A;  4UQY A;  3BG0 B;  1FKK A;  5FJY A;  3TWX A;  1N0R A;  2WPV A;  2C0M A;  3MDY B;  2XPA A;  1D8D A;  2FDM A;  2WM0 A;  3SBT B;  4Z68 A;  5LX8 A;  1C9H A;  1JNE A;  4B8C B;  2I1J A;  3D9I A;  2DG4 A;  3GZ1 A;  3WH0 A;  3MKQ A;  1MJ0 A;  5BXJ A;  4C0E A;  1FFQ A;  3CK7 A;  5FT9 A;  1H0A A;  3T8K A;  1UN9 A;  2KCV A;  5EYP F;  2KCL A;  2IQC A;  4MNJ A;  4BX9 A;  4GPM A;  2OVF A;  3ZHE A;  1N94 A;  4DWS A;  3ARW A;  1U79 A;  4K0R A;  4AEZ C;  5B3S E;  3KAC A;  2V5Q C;  2B6C A;  3ASD A;  3LXU X;  5AAR A;  3MX3 A;  1O6I A;  3ULY A;  3QKY A;  3UKU G;  2GRO B;  4DRH A;  3ZXP A;  4F1S A;  4URK A;  2QF8 A;  4DI4 A;  3O5F A;  1GPF A;  1OWO A;  3L22 A;  4MS6 A;  3L17 A;  3ZYQ A;  3WXX A;  2PI6 A;  1YYH A;  1OWL A;  2V5F A;  1QPL A;  5BXO A;  4G2V A;  3PUJ A;  2H6I A;  3ASN E;  1B6C A;  1HO8 A;  3ZYM A;  2AXV A;  1NA3 A;  1HXV A;  4QIB A;  3AJI A;  5KNH D;  1X5B A;  3CHO A;  5HWC A;  4IN3 B;  2DZN A;  1E8Y A;  5HKP A;  2ZR6 A;  4ODQ A;  4G26 A;  4J8D A;  4GPK A;  3OA5 A;  1NSG A;  3ZW3 A;  3PNL B;  3B9A A;  4WAF A;  4W9R A;  1D6O A;  2N87 A;  3B13 A;  3P1U A;  4G24 A;  4EBA A;  4GIV A;  5LOZ A;  2GRL A;  5EYL A;  3UMV A;  4ANV A;  4ATZ D;  1ITX A;  1L5J A;  1MZC A;  2LAI A;  1IQR A;  5DIV A;  3CHP A;  3HVE B;  2J4D A;  4UUC A;  1N54 A;  3TWS A;  4DWS D;  4Z2G A;  3KEA A;  2FI7 A;  5AAO A;  2JZV A;  3C3R A;  3C5R A;  5M72 A;  4HI8 A;  3CVN A;  4EEC A;  5CCL A;  2CHX A;  5B8I C;  2PL2 A;  2J8S D;  4HS2 A;  5B1A E;  4I1M A;  4O2T A;  1GW6 A;  4XE0 A;  4FUL A;  3KSQ A;  4Z2K A;  3OXF A;  1Q1C A;  1F8A B;  3KAD A;  3CVQ A;  1LL4 A;  3RK6 A;  2YNQ A;  3Q15 A;  3EHQ A;  3PEU B;  1JWG A;  5D0Q D;  1N11 A;  4J4N A;  3GTY X;  4G23 A;  4M3O A;  1JND A;  2LXL A;  5D0O D;  4XI0 A;  2A4Z A;  2A5U A;  3MEK A;  3DRA A;  4ACK A;  3U4T A;  2XEE A;  1Y8M A;  4CGV A;  1LD7 A;  1N9A A;  2PM6 A;  3RIB A;  1QNF A;  1HKM A;  3E37 A;  4WND A;  1N1A A;  2DT2 A;  4HI9 A;  3MGB A;  2LNI A;  2R05 A;  4KXK B;  4DRQ A;  1FKR A;  2BF0 X;  3O5O A;  2WXI A;  2EIM E;  2A3B A;  3BQO A;  5HTG A;  2IF4 A;  3ARV A;  4NQ0 A;  4O1P A;  4DK5 A;  1H6K A;  3CK9 A;  2F4E A;  3LVR E;  4LNG A;  4BY6 A;  2UZ5 A;  1N95 A;  4CYM D;  1H2U A;  4Z2L A;  4HLL A;  2WXG A;  4NIK A;  3I5P A;  3AG3 E;  1E6N A;  4GZ6 A;  3EUV A;  1FKH A;  2DZO A;  1SR0 A;  1E96 B;  2VSY A;  2PBC A;  3JXJ A;  4PUC A;  5DO2 A;  3LY9 A;  5KNG A;  1K1A A;  4AXH A;  4LAW A;  3QJZ A;  3SNX A;  4DRK A;  3TG5 A;  1TNY A;  4P8U A;  1PY1 A;  2V4H C;  4E6H A;  3LY8 A;  4K5A B;  3MZL B;  2NSZ A;  3ZXS A;  1J6Y A;  3FEY A;  3TGO A;  2YHE A;  3BMB A;  4MAV A;  5HRY A;  2F23 A;  1YMP A;  3ZN3 A;  1ZCN A;  4AV7 A;  4WKF A;  4HBD A;  3B7R L;  3L6A A;  4GGQ A;  4EBA G;  3WD1 A;  3TWQ A;  2FO7 A;  3I3N A;  4NSB A;  3SFZ A;  5AN8 A;  2C0L A;  4DRP A;  4JFL A;  2DBA A;  3ASH A;  5FZS A;  3DWL G;  2WXK A;  3SQV A;  4BTA A;  1TJF A;  4PS7 A;  3O5P A;  2MHK A;  1JUQ A;  2XS1 A;  3RAU A;  1Q6H A;  3GW4 A;  3TWV A;  2X6I A;  5LFA A;  3CVY A;  1RZ4 A;  1TN6 A;  3IHV A;  3EIJ A;  3MKQ B;  1S0P A;  2KC7 A;  4U8V D;  1OCZ E;  3VLD A;  5FIN A;  4MNK A;  1BD8 A;  2P58 C;  1WDY A;  2PPP A;  3C3O A;  5KJK A;  2NXP A;  1E15 A;  4LG6 A;  2DVW A;  2PZI A;  3FTY A;  3KAI A;  3CK8 A;  5ITZ F;  4LGX A;  2WLZ A;  2QY7 A;  4AVX A;  3Q78 A;  2XP7 A;  3FTU A;  3IKG A;  1WG0 A;  2MYO A;  4JA9 A;  2VJ8 A;  1TNB A;  2WK2 A;  3G6L A;  3PRB A;  5A6C A;  4KYO B;  2DWZ A;  4FJY A;  4RG6 A;  4A1G A;  1NWR A;  3APD A;  1LL6 A;  4YVO A;  5HUA A;  2OEV A;  3PZ3 A;  3BUA A;  1ZBK A;  5GPG A;  4FA6 A;  1LD8 A;  1MQS A;  3TWR A;  2M08 A;  1E8W A;  2WXQ A;  3Q4A B;  5HW6 A;  4S3J A;  2XGM A;  1WM5 A;  1OCO E;  4CT0 A;  4IPX A;  2EIN E;  5ENP D;  2Y0B G;  1S70 B;  3UX4 A;  2E0I A;  4ANU A;  1ZBP A;  4AM9 A;  3QWW A;  3E30 A;  1H2T C;  1TFV A;  2ZQT A;  2AXZ A;  2ZQV A;  4GMJ A;  4LAV A;  3JQ0 A;  4Y6C A;  4N5C A;  3D9H A;  1K8K G;  3MV2 B;  3FH5 A;  2GGF A;  3DBS A;  1EIB A;  3CVW A;  4UWH A;  5KJM A;  3ZPJ A;  5CEA A;  3CVL A;  2X3M A;  3PH0 C;  5CCM A;  3E4B A;  4DPR A;  3FWV A;  3OXG A;  3ZEF A;  1HG5 A;  1UJK A;  3NB2 A;  4W9P A;  4ABN A;  1PC2 A;  2A3E A;  2PV2 A;  2KXP C;  4BET A;  3ARU A;  3CVU A;  3RFW A;  4QT3 A;  2J09 A;  1ZBV A;  2DCP A;  3UT8 A;  1BI7 B;  1OCC E;  2HO1 A;  2DT3 A;  3PA7 A;  3KAF A;  5ARG A;  4R0X A;  1RD6 A;  3UM3 A;  3FAP A;  2KO7 A;  3MYV A;  4A1S A;  3IHY A;  3UT4 A;  4LER A;  3UI6 A;  3DSW A;  4Q22 A;  2CFU A;  1WAO 1;  4OVU A;  3B9D A;  4G25 A;  1HJW A;  1UR8 A;  4CT4 A;  3O5I A;  4TUU A;  2DYS E;  3ARS A;  3O5R A;  3G2V A;  4DI3 A;  3ALF A;  5ANR A;  2YBT A;  1W1V A;  1YA0 A;  1HG2 A;  3U64 A;  4JD2 G;  4B89 A;  3TDB A;  2VCD A;  2YIN A;  4HOQ A;  3FTW A;  4GYY A;  3FU5 A;  2OCC E;  3D9K A;  4MRU A;  2WXO A;  1E6Z A;  2IEJ A;  4XEI G;  4OYS A;  4DX7 D;  3LUO A;  3O5L A;  3X2Q E;  5DIT A;  3QAR A;  4I1A A;  4UI9 K;  4I2Z A;  3U66 A;  1HF8 A;  2Y4U A;  4K5B A;  1MYO A;  2X38 A;  2PN0 A;  3IKD A;  3KSL A;  3FUM A;  2XEV A;  2KZT A;  3GU0 A;  1EYM A;  4CCA A;  3CLJ A;  3FUI A;  1JCR A;  4J8F A;  4J7W A;  4U86 A;  2P9I G;  3DSV A;  4WNE A;  2XGS A;  4WJX A;  4L2L A;  4TW8 A;  1ZU2 A;  2JEK A;  1TEZ A;  4B8A A;  2IOS A;  3LPZ A;  3NBN B;  4G1T A;  4DRN A;  3J5P A;  3FUF A;  4YVQ C;  3FUD A;  3TXM A;  4MLP A;  3AS2 A;  4GTS A;  3G2U A;  3C72 A;  2F2D A;  3MCX A;  5KCM A;  1M5Y A;  2V8S E;  3RM4 A;  4J0U A;  5CHE E;  3CVV A;  4D10 C;  1O1S A;  3FTV A;  5CBO A;  3EU5 A;  1FJD A;  4L23 A;  5G05 J;  3ULE G;  1INZ A;  1HKJ A;  5LCW J;  3IXE A;  3O5K A;  4HOT A;  4TUM A;  4ODN A;  4QZV B;  3HXC A;  4ML4 A;  3ASO E;  2L0T B;  4QQI A;  3EY6 A;  3CKB A;  3DPY A;  4HAR A;  4YDE A;  4JL0 A;  4G8K A;  2MNT A;  5CED B;  3NZS A;  3R7R A;  4CDN A;  4EZL A;  5E75 A;  1OXJ A;  5AQ7 A;  2R17 C;  1ROU A;  3QWV A;  4HLE A;  3LKU A;  1UOH A;  1RW2 A;  3ZRH A;  4JA7 A;  1J4R A;  5HW8 A;  1FKD A;  2UY1 B;  3HXB A;  4L2Y A;  4F7A A;  3UQ3 A;  5EKQ D;  4WIW A;  2KM4 A;  1HJV A;  3QWP A;  3KCE A;  2LO6 A;  3WD3 A;  4DRJ A;  4K5C A; 
#chains in the Genus database with same CATH homology
 4DT4 A;  1UR9 A;  4TNS A;  3FU0 A;  4WWP A;  3WKZ A;  5A7D B;  1XNF A;  3D9L A;  3PVL A;  3HDX A;  5JJT A;  5JH8 A;  2I2O A;  5BNW A;  4L3N A;  2HM8 A;  4JXT A;  2XCB A;  3CGN A;  3R9A B;  1Z3X A;  4HOR A;  2RG8 A;  1GUV A;  3UF8 A;  2M1I A;  2F21 A;  4CDR A;  4PS3 A;  3SF4 A;  4GU5 A;  3RKV A;  3T5X A;  3EJN A;  3WD2 A;  3MKR A;  3U9W A;  5BT1 A;  3B7S A;  1FKS A;  5J90 A;  2PPN A;  5G04 C;  3B7U X;  4GZ5 A;  4JFI A;  2E2E A;  3KS2 A;  1KFW A;  2Q5A A;  3LY7 A;  5HBF A;  3FUN A;  4JFM A;  2LJ4 A;  1E6R A;  4GCO A;  2WQH A;  4R7L A;  3IBE A;  3L08 A;  3P2B A;  4JW1 A;  3ML9 A;  4CGW A;  5HT1 A;  2RSE A;  2DSW A;  4KR0 B;  3QC1 A;  3FUH A;  4LAX A;  4FC8 A;  4TX0 A;  2OFN A;  1FVF A;  1HKI A;  2IJG X;  3FEX A;  4XIF A;  3PDN A;  3WQV A;  3G6M A;  1KT0 A;  4EZK A;  1A17 A;  4JVS A;  1X6N A;  4U07 A;  5T4Y A;  2OVB A;  4EQF A;  4G50 A;  3FY1 A;  4N2S A;  3EDT B;  2DG3 A;  4I6E A;  1H19 A;  4L1B A;  1FKL A;  1D2K A;  3L13 A;  3TC5 A;  1Z3Y A;  4F3V A;  2IU1 A;  1E7U A;  4I9E A;  4ANW A;  1WB0 A;  4TYO A;  2PV3 A;  3ARR A;  3AQU A;  5J08 A;  1OWP A;  3RU0 A;  1E8X A;  5T8I A;  5BV0 A;  1HU3 A;  3OOB A;  1BKF A;  2MRI A;  2XRY A;  5DBK A;  1OWQ A;  4AY5 A;  4I17 A;  3PRZ A;  3IHZ A;  1J4I A;  1K9T A;  3QDN A;  1HXI A;  2ZQS A;  1A7X A;  5GQB A;  4WNG A;  4AY6 A;  2WMN A;  4JPS A;  4A3T A;  3UPV A;  3ARZ A;  3HYM B;  4MTV A;  3KAG A;  4I9C A;  5FWQ A;  3B7T A;  2VYI A;  3FH7 A;  2HYZ A;  5D75 A;  2AWG A;  4DRI A;  2PQR A;  1JNT A;  2YBU A;  3ARQ A;  3BXW A;  2J9Q A;  4UQX A;  3LVQ E;  1Y6I A;  4DZ3 A;  4UI9 J;  3CR3 A;  2AXU A;  5A23 A;  4W5U A;  2G41 A;  3FH8 A;  2KGJ A;  4QFV A;  1L1P A;  2GW1 A;  1W26 A;  3SZ7 A;  4GB9 A;  1W1T A;  2WXN A;  1TJC A;  3CZ8 A;  4BFR A;  2M63 A;  1IHG A;  4WWN A;  4FLH A;  1CTN A;  5FTP A;  3IV0 A;  3ZYL A;  1ZBW A;  4MSP A;  4UI9 C;  4O6F A;  4HBE A;  3GZ2 A;  4NUR A;  2KI3 A;  4F53 A;  4A55 A;  2ZU6 B;  3WD4 A;  3ESL A;  4LCT A;  4GAA A;  4YND A;  1FKB A;  4Q94 A;  2BUG A;  3ARO A;  4UWF A;  3MV3 B;  1D7H A;  4DWS C;  3RRM B;  2KZT B;  4J8S A;  3QNK A;  4IQC A;  4QT2 A;  1EPU A;  2LKN A;  3ZYK A;  4WKA A;  1KLX A;  1ZU8 A;  4ODR A;  3D9J A;  4WKH A;  2XRZ A;  2WQ6 A;  3FUE A;  2Y78 A;  2IUZ A;  4XZ4 A;  4MNL A;  3BG1 B;  5ANL A;  5EX0 A;  4FAD A;  4KT6 B;  4DRO A;  4HOS A;  3FXY A;  3VTX A;  4N3C A;  2MF9 A;  2X6H A;  4I1O B;  3OAW A;  1HFA A;  4K03 A;  4B0Z A;  2KE0 A;  4NRH B;  3CHQ A;  2WLY A;  3B9E A;  4DJA A;  4BT8 A;  3ENE A;  2AWI A;  3QAQ A;  1ZB5 A;  2J07 A;  2MLZ A;  2Y3A A;  4KVO A;  2VN1 A;  1E8Z A;  1NMW A;  5E76 A;  4JHJ A;  3NTP A;  1QZ2 A;  1JVW A;  2FEZ A;  3WQW A;  2DT0 A;  2XP4 A;  3AS1 A;  3S7J A;  5HQ8 A;  3NI6 A;  2WXP A;  3Q5M A;  3QB2 A;  4I2W A;  5G55 A;  4N3B A;  2OND A;  4R5E A;  1SZ9 A;  5DEZ A;  3G2W A;  4N2Q A;  1HKK A;  4GML A;  5BPP A;  2ION A;  2K8I A;  3FDH A;  1W1Y A;  4HXI A;  1EHN A;  2WXJ A;  3ZGQ A;  2VGX A;  3ZIM A;  1N52 A;  2HR2 A;  5J6E A;  3EHM A;  1FCH A;  5HKG A;  3IEG A;  4HVB A;  4WK9 A;  3CHE A;  4Z2H A;  3JUI A;  4FP7 A;  3MA5 A;  3GPK A;  2Y4T A;  3EIQ C;  4IUL A;  2MLX A;  1FKF A;  4UWK A;  4C02 B;  3D9N A;  3T8M A;  4Q96 A;  1FFR A;  5LCW C;  2CFZ A;  4ILG A;  2XPI A;  4ZPT R;  2X6K A;  4TW6 A;  2VSO E;  4AIF A;  3ALG A;  1IX5 A;  1E9L A;  3KAH A;  4JYS A;  3ZVV A;  2RUQ A;  2L0I A;  3OXL A;  1U3C A;  2B31 A;  1OGG A;  4AP2 A;  3SD5 A;  3UT7 A;  4ZPV R;  4MPK A;  1Z6T A;  4L72 B;  4KZ0 A;  5LP0 A;  4HBO A;  4TW7 A;  2G8Z A;  4ATG A;  3O5Q A;  4PS8 A;  3URZ A;  3FTZ A;  5AYW D;  4GCN A;  3QOU A;  3ZFW A;  3O4Z A;  1HX8 A;  4NZC A;  4IRU A;  3FU6 A;  4ILI A;  2I6H A;  3LYA A;  3DPD A;  4BF8 A;  2WVI A;  3JCK C;  5CMY A;  3RM9 A;  4N19 A;  2OLH A;  2GRM A;  3O5E A;  3FY4 A;  5ARF A;  1ELW A;  3PRD A;  2Q7F A;  2J4B A;  1XGW A;  5HW7 A;  3AS5 A;  4ODL A;  3ZHE B;  3KZ7 A;  3CSF A;  4U8H A;  1JPL A;  4JFJ A;  1OUV A;  5AEN A;  3O5D A;  1D7I A;  3LCA A;  2XP3 A;  3CHM A;  2A3A A;  3N71 A;  1KT1 A;  1UW4 B;  3NF1 A;  1YW5 A;  1U3D A;  3KD7 A;  3PUK A;  4Q7N A;  4DRM A;  2DSZ A;  3BEE A;  3GZS A;  4W9O A;  2DSV A;  1OWN A;  2FF4 A;  4IT6 A;  4BX8 A;  2R59 A;  3G2S A;  3KAB A;  5HWB A;  4GYW A;  4W9Q A;  4IYP A;  3VLF A;  3AU4 A;  4WNF A;  4Y6W A;  3ARX A;  3RO2 A;  3RRN B;  1ELK A;  1W9U A;  1GOI A;  1W1P A;  2D9F A;  4LRZ A;  5T3R A;  5JJ6 A;  1H0G A;  3L54 A;  3S7B A;  2JLB A;  1VF8 A;  1LL7 A;  3SHF A;  3HIZ A;  4CRW A;  2XQ0 A;  1HS6 A;  2LSU A;  3LS8 A;  5CMW A;  3RJV A;  3FFL A;  3ML8 A;  1NWS A;  5DIZ A;  3FP3 A;  5G05 C;  4XKB A;  2XP6 A;  4P8W A;  1EDQ A;  1W9V A;  5AJL A;  2OOE A;  3QOK A;  4ZS6 A;  2DG9 A;  2CHZ A;  1FKT A;  3VTY A;  1NP7 A;  3CST A;  3OTN A;  4H7X A;  4Q69 A;  2MOW A;  3RO3 A;  2RUD A;  3D9M A;  5JHA A;  4C0M A;  2I1K A;  2LGO A;  1QPF A;  2ILR A;  5EX3 A;  1ZBC A;  4P8X A;  2XP5 A;  3CHD A;  4WWO A;  4KQZ A;  3CGH A;  3ASG A;  4JHR A;  4JEH A;  3PZD A;  4APO A;  2X6J A;  4WUY A;  1D7J A;  4BSX A;  2ZR4 A;  3FUL A;  2XPB A;  1LJY A;  5ENN A;  2O92 A;  2FBN A;  1EDU A;  3GYZ A;  1NMV A;  2I9C A;  4ANX A;  4JC8 A;  2DPE A;  3TCZ A;  3PNT B;  3CHS A;  2KR7 A;  1FD9 A;  1IQU A;  4A3V A;  2RQS A;  5GPR A;  1EYH A;  4URI A;  2DIW A;  3WL1 A;  2WXF A;  4JZY A;  4PH4 B;  1BL4 A;  3UQB A;  3UQA A;  4PTM A;  3JYM A;  3PRE A;  4IT4 A;  4J4O A;  3W4R A;  4J6I A;  2MPH A;  2FUL A;  5AJD A;  1JNS A;  3APC A;  4I6J A;  2WXH A;  4Z2I A;  3FUK A;  3NQP A;  4RVB A;  4KZC A;  4MGV A;  4GZ3 A;  4RG9 A;  3D3M A;  5JHB A;  4FLB A;  2CHW A;  4TV3 A;  1YAT A;  3AS4 A;  3SGH A;  2ZR5 A;  2KFW A;  3U3W A;  1EF1 C;  3PS6 A;  3CHC A;  3ARY A;  1Q6U A;  2DT1 A;  3MJW A;  3CV0 A;  3R7Q A;  2VTB A;  4ODP A;  5BW8 C;  1Q6I A;  4U04 A;  5HI7 A;  5G04 J;  2PM7 A;  1ELR A;  1IYG A;  4XAK A;  1FVH A;  1E90 A;  2WB2 A;  1W3B A;  4U0U A;  4UQZ A;  1H2V C;  3TAX A;  2M2A A;  4DLO A;  4EZJ A;  1WY6 A;  3C98 A;  2EQX A;  4GA2 A;  4L7T A;  1HZ4 A;  5JJ7 A;  4I6G A;  1HE8 A;  3APF A;  4UWG A;  2V4L A;  3KEZ A;  1P5Q A;  4KBQ A;  4NNR A;  1UN8 A;  4C9B B;  3O5J A;  3IKO B;  1PAQ A;  4TRQ A;  4JEU A;  3CIA A;  3RME A;  2AOS A;  3TJP A;  4ODM A;  4XI9 A;  3ODK A;  4AY1 A;  5G2N A;  4UWL A;  1ROT A;  4J8E A;  4PDX A;  1SZA A;  1R9H A;  1MHQ A;  4G2P A;  2WXR A;  2AVP A;  5C2Y A;  4FJZ A;  1XRV A;  3IK8 A;  3CQG B;  4G11 A;  4FU3 A;  1F40 A;  2C2L A;  2ZQU A;  3ULQ A;  2OV8 A;  3HHM A;  4P8V A;  2PQN A;  4N3A A;  4S3K A;  4U84 A;  4IQ2 A;  2KCK A;  2IFU A;  4BT9 A;  3AS8 A;  1VDY A;  3UQI A;  2QFC A;  1NZN A;  3ARP A;  4E85 A;  3CHF A;  5FQ7 A;  2VGY A;  4P29 A;  3VAW A;  3ASF A;  5FQ6 A;  1LG2 A;  4HOU A;  3D9P A;  3O48 A;  2J49 A;  4BTB A;  1XHG A;  3AS3 A;  2L9B A;  4DH0 A;  3S7D A;  2NC9 A;  3PE4 A;  3TG4 A;  1DNP A;  2RUR A;  3I4G A;  1UG3 A;  5DF0 A;  4XKC A;  4KVM A;  2LSV A;  4RSY A;  1H0I A;  2IOL A;  2AW6 A;  3K9I A;  4OVV A;  3UUX A;  2PPO A;  2BTD A;  3CHR A;  2O9O A;  2ITK A;  4GZC A;  4AJW A;  3PRA A;  2DSU A;  4EPZ A;  4V3I A;  3O5G A;  2WXM A;  1LQ0 A;  1FKI A;  1QQE A;  3H9R B;  2L6J A;  3JQ1 A;  4N39 A;  2XGO A;  3CVP A;  3HVE A;  2WM9 A;  1NA0 A;  3WD0 A;  3FTS A;  4CDM A;  3CH9 A;  1NWT A;  3Q49 B;  2MLY A;  1EQ3 A;  3JYS A;  3QK0 A;  2WXL A;  2A3C A;  3SI5 A;  3AS0 A;  4ZPW R;  3NZU A;  3CQC B;  3ONK A;  3JXV A;  2XHE A;  3RGC A;  2XP9 A;  4HFG A;  5KJL A;  4H7Y A;  2LAH A;  5BUZ A;  2FAP A;  2WQ7 A;  1NWU A;  1SYT A;  1FKJ A;  3VLE A;  4GA0 A;  3LEW A;  2VSN A;  3UI5 A;  3RRU A;  1SQM A;  4LUN U;  5AIJ A;  3PE3 A;  1FKG A;  4NAC A;  1UJJ A;  3WIJ A;  3FHE A;  4GYO A;  2RUC A;  3RM8 A;  2R5S A;  2VGX B;  2PV1 A;  2CG3 A;  1PIN A;  3B8S A;  3Q47 B;  1LF8 A;  2XP8 A;  4DLQ A;  4FN2 A;  3B7X A;  3G2T A;  2VSX E;  3LDZ A;  5C1D A;  1T11 A;  5FQ4 A;  2L2S A;  1X6L A;  3L16 A;  2V0P A;  4ME2 A;  1E7V A;  4JFK A;  1OWM A;  2VQ2 A;  3FTX A;  4ACL A;  4APF A;  1TCO C;  3D9O A;  4FHJ A;  3ONL A;  1JWF A;  2YQ8 A;  3LJ3 A;  2XCC A;  4U0Z A;  1B89 A;  1ZL1 A;  2J08 A;  2VTB B;  1PBK A;  4FHK A;  3ART A;  5FQ8 A;  4KMO A;  4B94 A;  1NH6 A;  1DVP A;  3CKC A;  3SBS A;  2X6F A;  5I98 A;  1OGB A;  4U63 A;  4DIP A;  2FKE A;  3PR9 A;  4JHK A;  4MNM A;  3KAE A;  2WMO A;  3AU5 A;  1WNO A;  3O5M A;  2XPZ A;  3I6C A;  1BPO A;  1J4H A;  2UY1 A;  5EDS A;  3CEQ A;  1HJX A;  3FUJ A;  4GA1 A;  4DZ2 A;  3EHN A;  2ESC A;  4BWR A;  3CVX A;  4CEM A;  3FU3 A;  4ODO A;  4FAP A;  4Z2J A;  5KJN A;  3S7F A;  3CGM A;  4DWS B;  4XX5 A;  3I4R B;  3TL5 A;  1E6P A;  2CG2 A;  5FZR A;  4U85 A;  4ODK A;  2XPY A;  4ITZ A;  1ZK6 A;  3S2A A;  2LPV A;  3NRK A;  5BV1 A;  3ESK A;  4LAY A;  3UI4 A;  4GZD A;  3T5V A;  5FZQ A;  2YHC A;  4LEU A;  3TXN A;  1HH8 A;  2RD0 A;  1LG1 A;  3JYJ A;  4U0S A;  3WL0 A;  3PEV B;  5DIU A;  1W9P A;  1FAP A;  2UWJ G;  4ILH B;  1Y0O A;  4MKT A;  4AOF A;  2KAT A;  4I43 A;  1WAW A;  4UQY A;  3BG0 B;  1FKK A;  5FJY A;  2WPV A;  3MDY B;  2C0M A;  2XPA A;  2FDM A;  2WM0 A;  3SBT B;  5LX8 A;  1C9H A;  1JNE A;  4B8C B;  2I1J A;  3D9I A;  2DG4 A;  3GZ1 A;  3WH0 A;  3MKQ A;  5BXJ A;  4C0E A;  1FFQ A;  3CK7 A;  5FT9 A;  1H0A A;  1UN9 A;  2KCV A;  2KCL A;  2IQC A;  4MNJ A;  4BX9 A;  2OVF A;  3ZHE A;  4DWS A;  3ARW A;  1U79 A;  4K0R A;  4AEZ C;  3KAC A;  3ASD A;  3LXU X;  3MX3 A;  1O6I A;  3QKY A;  4DRH A;  4F1S A;  4URK A;  2QF8 A;  4DI4 A;  3O5F A;  1GPF A;  1OWO A;  3L22 A;  4MS6 A;  3L17 A;  3ZYQ A;  3WXX A;  2PI6 A;  1OWL A;  2V5F A;  1QPL A;  4G2V A;  3PUJ A;  1B6C A;  1HO8 A;  3ZYM A;  2AXV A;  1NA3 A;  1HXV A;  4QIB A;  1X5B A;  3CHO A;  5HWC A;  4IN3 B;  1E8Y A;  2ZR6 A;  4ODQ A;  4G26 A;  4J8D A;  4GPK A;  3OA5 A;  1NSG A;  3ZW3 A;  3PNL B;  3B9A A;  4WAF A;  4W9R A;  1D6O A;  2N87 A;  3B13 A;  3P1U A;  4G24 A;  4EBA A;  4GIV A;  5LOZ A;  2GRL A;  3UMV A;  4ANV A;  1ITX A;  1L5J A;  2LAI A;  1IQR A;  5DIV A;  3CHP A;  3HVE B;  2J4D A;  1N54 A;  4DWS D;  4Z2G A;  2FI7 A;  2JZV A;  5M72 A;  3CVN A;  4EEC A;  5CCL A;  2CHX A;  5B8I C;  2PL2 A;  4HS2 A;  4I1M A;  4O2T A;  1GW6 A;  4XE0 A;  4FUL A;  4Z2K A;  3OXF A;  1Q1C A;  1F8A B;  3KAD A;  3CVQ A;  1LL4 A;  3RK6 A;  2YNQ A;  3Q15 A;  3PEU B;  1JWG A;  5D0Q D;  4J4N A;  4G23 A;  4M3O A;  1JND A;  5D0O D;  4XI0 A;  2A4Z A;  2A5U A;  3MEK A;  4ACK A;  3U4T A;  1Y8M A;  4CGV A;  2PM6 A;  3RIB A;  1QNF A;  1HKM A;  4WND A;  1N1A A;  2DT2 A;  3MGB A;  2LNI A;  4DRQ A;  4KXK B;  1FKR A;  2BF0 X;  3O5O A;  2WXI A;  2A3B A;  5HTG A;  2IF4 A;  3ARV A;  4NQ0 A;  4DK5 A;  1H6K A;  3CK9 A;  2F4E A;  3LVR E;  4BY6 A;  2UZ5 A;  1H2U A;  4Z2L A;  2WXG A;  3I5P A;  1E6N A;  4GZ6 A;  1FKH A;  1SR0 A;  1E96 B;  2VSY A;  2PBC A;  4PUC A;  5DO2 A;  3LY9 A;  4AXH A;  4LAW A;  3QJZ A;  3SNX A;  4DRK A;  3TG5 A;  4P8U A;  1PY1 A;  4E6H A;  3LY8 A;  3MZL B;  2NSZ A;  3ZXS A;  1J6Y A;  3FEY A;  3TGO A;  2YHE A;  4MAV A;  3ZN3 A;  1ZCN A;  4AV7 A;  4WKF A;  3B7R L;  3L6A A;  4GGQ A;  4EBA G;  3WD1 A;  2FO7 A;  3I3N A;  4NSB A;  3SFZ A;  2C0L A;  4DRP A;  4JFL A;  2DBA A;  3ASH A;  5FZS A;  2WXK A;  4BTA A;  1TJF A;  4PS7 A;  3O5P A;  2MHK A;  1JUQ A;  1Q6H A;  3GW4 A;  2X6I A;  5LFA A;  3CVY A;  3IHV A;  3EIJ A;  3MKQ B;  1S0P A;  2KC7 A;  3VLD A;  4MNK A;  2P58 C;  2PPP A;  5KJK A;  2NXP A;  1E15 A;  2PZI A;  3FTY A;  3KAI A;  3CK8 A;  4LGX A;  2WLZ A;  2QY7 A;  4AVX A;  2XP7 A;  3FTU A;  3IKG A;  4JA9 A;  2VJ8 A;  2WK2 A;  3G6L A;  3PRB A;  5A6C A;  4KYO B;  4FJY A;  4RG6 A;  4A1G A;  1NWR A;  3APD A;  1LL6 A;  4YVO A;  5HUA A;  1ZBK A;  5GPG A;  4FA6 A;  1MQS A;  2M08 A;  1E8W A;  2WXQ A;  3Q4A B;  5HW6 A;  4S3J A;  2XGM A;  1WM5 A;  4CT0 A;  4IPX A;  3UX4 A;  2E0I A;  1ZBP A;  4ANU A;  4AM9 A;  3QWW A;  1H2T C;  1TFV A;  2ZQT A;  2AXZ A;  2ZQV A;  4GMJ A;  4LAV A;  3JQ0 A;  4Y6C A;  4N5C A;  3MV2 B;  3FH5 A;  2GGF A;  3DBS A;  1EIB A;  3CVW A;  4UWH A;  5KJM A;  3ZPJ A;  3CVL A;  2X3M A;  3PH0 C;  5CCM A;  3E4B A;  4DPR A;  3FWV A;  3OXG A;  3ZEF A;  1HG5 A;  1UJK A;  4W9P A;  4ABN A;  1PC2 A;  2A3E A;  2PV2 A;  3ARU A;  3CVU A;  3RFW A;  4QT3 A;  2J09 A;  1ZBV A;  2DCP A;  3UT8 A;  2HO1 A;  2DT3 A;  3PA7 A;  3KAF A;  5ARG A;  4R0X A;  1RD6 A;  3FAP A;  2KO7 A;  3MYV A;  4A1S A;  3IHY A;  3UT4 A;  4LER A;  3UI6 A;  4Q22 A;  2CFU A;  1WAO 1;  4OVU A;  3B9D A;  4G25 A;  1HJW A;  1UR8 A;  4CT4 A;  3O5I A;  4TUU A;  3ARS A;  3O5R A;  3G2V A;  4DI3 A;  3ALF A;  5ANR A;  2YBT A;  1W1V A;  1YA0 A;  1HG2 A;  3U64 A;  4B89 A;  3TDB A;  2VCD A;  2YIN A;  4HOQ A;  3FTW A;  4GYY A;  3FU5 A;  3D9K A;  4MRU A;  2WXO A;  1E6Z A;  4OYS A;  3LUO A;  3O5L A;  5DIT A;  3QAR A;  4I1A A;  4UI9 K;  4I2Z A;  3U66 A;  1HF8 A;  2Y4U A;  2X38 A;  3IKD A;  3FUM A;  2XEV A;  2KZT A;  1EYM A;  4CCA A;  3CLJ A;  3FUI A;  4J8F A;  4U86 A;  4WNE A;  4WJX A;  2XGS A;  4L2L A;  4TW8 A;  1ZU2 A;  2JEK A;  1TEZ A;  4B8A A;  2IOS A;  3LPZ A;  4G1T A;  4DRN A;  3FUF A;  4YVQ C;  3FUD A;  3TXM A;  4MLP A;  3AS2 A;  3G2U A;  2F2D A;  3MCX A;  5KCM A;  1M5Y A;  2V8S E;  3RM4 A;  4J0U A;  5CHE E;  3CVV A;  4D10 C;  3FTV A;  1FJD A;  4L23 A;  5G05 J;  1INZ A;  1HKJ A;  5LCW J;  3O5K A;  4HOT A;  4ODN A;  4QZV B;  4ML4 A;  2L0T B;  3EY6 A;  3CKB A;  4HAR A;  4JL0 A;  2MNT A;  3NZS A;  3R7R A;  4CDN A;  4EZL A;  5E75 A;  2R17 C;  1ROU A;  3QWV A;  4HLE A;  3LKU A;  3ZRH A;  4JA7 A;  1J4R A;  5HW8 A;  1FKD A;  2UY1 B;  4L2Y A;  4F7A A;  3UQ3 A;  5EKQ D;  4WIW A;  2KM4 A;  1HJV A;  3QWP A;  3KCE A;  2LO6 A;  3WD3 A;  4DRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...