2IF4A

Crystal structure of a multi-domain immunophilin from arabidopsis thaliana
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
258
structure length
258
Chain Sequence
NVPPKVDSEAEVLDEKVSKQIIKEGHGSKPSKYSTCFLHYRAWTKNSQHKFEDTWHEQQPIELVLGKEKKELAGLAIGVASMKSGERALVHVGWELAYGKEGNFSFPNVPPMADLLYEVEVIGFDETKEGKARSDMTVEERIGAADRRKMDGNSLFKEEKLEEAMQQYEMAIAYMGDDFMFQLYGKYQDMALAVKNPCHLNIAACLIKLKRYDEAIGHCNIVLTEEEKNPKALFRRGKAKAELGQMDSARDDFRKAQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Multi-domain Immunophilin from Arabidopsis thaliana: A Paradigm for Regulation of Plant ABC Transporters.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein
molecule keywords ATFKBP42
total genus 70
structure length 258
sequence length 258
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2if4A02
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2if4A01
3TC5A 2HO1A 1QPFA 2PPNA 2MF9A 5DIVA 4ODQA 1D7JA 3QWVA 2LGOA 3IKGA 1ZCNA 2KI3A 1R9HA 1E96B 3UUXA 4UQXA 2KC7A 5D0OD 4WUYA 2XEVA 3CK7A 1IYGA 3KAEA 3MKRA 3GZ1A 4I2WA 1IHGA 1QPLA 2F2DA 1FD9A 2PZIA 4U86A 5DBKA 2DG9A 1F40A 4W9OA 3SZ7A 1ZU2A 2DG4A 3BEEA 4KYOB 4UI9J 4G23A 5BXJA 3PDNA 4UQZA 2KCVA 1YATA 3PRDA 3ZN3A 3VTYA 3O48A 4ITZA 3Q47B 1ZK6A 3TCZA 5G05C 4HORA 3KD7A 5EX3A 2KFWA 2K8IA 2Y4TA 2ZQSA 5BW8C 5A6CA 1NSGA 2BUGA 3O5MA 4DRQA 1FKJA 3K9IA 4J0UA 2C2LA 4H7YA 5FZRA 3FP3A 1HZ4A 1EYMA 4KBQA 2XPIA 4G25A 1TJCA 5C1DA 3NRKA 3ODKA 2XP9A 3VAWA 3QOUA 4G24A 2MHKA 1HXIA 5ARGA 3KAIA 1F8AB 2L2SA 4JA7A 1NA0A 4O2TA 4TYOA 1BKFA 3OOBA 1NA3A 4G2VA 4U0SA 4DRJA 1FKTA 1Q6UA 4U0UA 3UPVA 3TDBA 3IKDA 4AIFA 3RIBA 1T11A 4LAWA 5D75A 3S7JA 4NRHB 4CDRA 1J4RA 3NTPA 3EDTB 3QWPA 3RU0A 4JHRA 4I2ZA 1A7XA 4DRIA 1D6OA 1YW5A 2C0MA 3LY9A 3N71A 4NNRA 4H7XA 1KT0A 3GZ2A 2XGMA 2FEZA 5JJTA 5HQ8A 2XP5A 4KXKB 1Q1CA 5D0QD 4JA9A 2DG3A 4Y6WA 3I6CA 4B94A 4GYWA 1Q6HA 3NI6A 4ODKA 4GZ5A 3KAFA 1NZNA 4CGWA 4UQYA 1P5QA 1YA0A 2C0LA 1QZ2A 3ULQA 2VSYA 1XNFA 4IN3B 3O5LA 5DIUA 3UF8A 2ZQTA 3FAPA 5KJKA 5FZQA 2XP4A 3UI5A 5HW8A 4AM9A 2VGXA 4DT4A 3CV0A 3CK8A 2YHCA 5HUAA 5CCMA 1N1AA 4W9RA 3Q15A 2FI7A 4QT3A 2E2EA 2R5SA 4I1AA 3R9AB 1Y8MA 2AVPA 3ASGA 4G50A 4WNFA 2RUCA 2WQHA 3FWVA 4DROA 5FZSA 4GA0A 4DIPA 4GA2A 4GCOA 2UZ5A 3KABA 5HW6A 4J4NA 1W3BA 3KS2A 3Q49B 4N39A 3O5KA 2M08A 1FKGA 4GYYA 2VN1A 5KJNA 4G2PA 3S7FA 1FKKA 4IPXA 4ME2A 2ZQVA 4ODRA 2VYIA 4AY5A 2VQ2A 4UI9C 1WM5A 2RUDA 2F21A 2AWGA 2RURA 1J6YA 4YVQC 2GW1A 1HXVA 4TW6A 3ESKA 2M2AA 3CKCA 4DH0A 4N19A 3PA7A 4I9CA 2M1IA 3UQIA 1W26A 2KO7A 2LKNA 1J4HA 3UQBA 2HYZA 4HOTA 3LYAA 2XCCA 1J4IA 4APOA 2LPVA 5CHEE 1FKFA 1PINA 3UI6A 3O5RA 4DRPA 2IFUA 3O5GA 3GPKA 1U79A 3OXGA 5A7DB 4BT8A 4EQFA 2FAPA 4W9PA 4ABNA 3H9RB 2Y78A 4JFMA 1M5YA 4YVOA 2RUQA 4I17A 1JVWA 4BF8A 3QWWA 5BT1A 5HKGA 4N2QA 2PPPA 3JXVA 4ODOA 4NQ0A 4ODPA 2PPOA 3O5OA 3LUOA 3CVPA 1WAO1 2ZR6A 5HWCA 5FTPA 3FFLA 1Y0OA 4MSPA 2LSVA 4RG6A 4GGQA 5J6EA 3QKYA 3RO2A 4G1TA 4WNGA 2WPVA 3UI4A 4HOSA 3RFWA 4JYSA 4U07A 5BNWA 5G04C 3ZHEB 4BWRA 2FKEA 4BT9A 5ARFA 2PV2A 4U84A 2FF4A 5JJ7A 5GPGA 2HR2A 4Y6CA 3AS8A 4DRNA 4I9EA 4DRKA 2L6JA 4F3VA 3ZGQA 1D7HA 2Y4UA 2MLYA 2YQ8A 4JFJA 4JFIA 3KCEA 2PQRA 4GCNA 1JNSA 4ODLA 1FKRA 4DZ3A 1C9HA 3CGNA 1FCHA 4DZ2A 4N2SA 4LAXA 2KCLA 4U85A 3KAGA 4N3AA 4W9QA 2PQNA 4BTBA 3GYZA 4DRHA 2KR7A 2KATA 1FKHA 3SF4A 3UQAA 3RGCA 1FKBA 4R0XA 5JJ6A 5LCWJ 1NMVA 3ASFA 3JYSA 5DIZA 3RO3A 3TG5A 3U4TA 3LKUA 2J9QA 2ITKA 2JLBA 4FAPA 2ONDA 4GIVA 4XI0A 4GZ6A 3CVNA 4HOUA 3O5QA 3LCAA 4DRMA 4MGVA 1ROUA 4TW7A 2PBCA 3KACA 4LAVA 4N3BA 3JYMA 2KE0A 5B8IC 5DITA 3RKVA 2OFNA 5HWBA 5FT9A 3CK9A 2V5FA 5G04J 1FAPA 3U3WA 1D7IA 5EKQD 2XGOA 3WXXA 4GA1A 2MNTA 2OOEA 3PE3A 2FO7A 3PRBA 2PV3A 4TW8A 1ELWA 2MLXA 1KLXA 3MV3B 1PC2A 2VGXB 2PV1A 2XGSA 4JFLA 2FBNA 3CEQA 4J4OA 4O6FA 3RJVA 2P58C 1FKIA 2VGYA 4GYOA 3Q4AB 3GW4A 4J8FA 2LNIA 4HOQA 4RG9A 2Q5AA 1JNTA 2ZR4A 5KJMA 4C02B 2XP7A 3IHZA 3WH0A 1FKLA 2UY1B 4FN2A 1PBKA 4A1SA 2QFCA 3LY7A 5HI7A 3O5EA 5G05J 4LEUA 2XPBA 3MEKA 2N87A 1EQ3A 2KGJA 2MPHA 4U0ZA 5I98A 3E4BA 2DBAA 1HH8A 1ELRA 3OXLA 3KZ7A 3S7BA 3KADA 5HTGA 2RSEA 2VSNA 4AY6A 4BTAA 4UI9K 3CKBA 4YNDA 3TGOA 4IQCA 3MV2B 3OXFA 3B7XA 2XP6A 3O5DA 1A17A 4J8DA 4N5CA 3MDYB 3IEGA 4CGVA 1FKSA 5M72A 2I6HA 2D9FA 1OUVA 3IK8A 5HT1A 3CVQA 5KJLA 1ROTA 2LSUA 3LY8A 1ZBPA 5CCLA 3S7DA 4J8EA 5EX0A 5HW7A 3LPZA 4QT2A 3O5JA 2XP8A 1TCOC 3O5PA 4TNSA 4N3CA 4LAYA 1L1PA 2IF4A 3URZA 2MLZA 4XI9A 2XPAA 1KT1A 4ODNA 2Q7FA 1FKDA 3KAHA 4WNDA 1Q6IA 4G26A 2NC9A 4JL0A 3O5FA 3O5IA 1FJDA 3QDNA 4U04A 3TG4A 3CGMA 3JYJA 2RQSA 2ZQUA 4IQ2A 3EY6A 3Q5MA 3AS5A 3PE4A 3NF1A 2KCKA 3AS4A 4GZ3A 5AYWD 3ZFWA 2UWJG 3VTXA 4TX0A 1B89A 4WNEA 3TAXA 2F4EA 4GPKA 4JFKA 1NMWA 3MA5A 2VCDA 3ZHEA 2LJ4A 4QIBA 1BL4A 1QQEA 2UY1A 3HYMB 4XIFA 4ODMA 2JZVA 2XP3A 2PL2A 5FJYA 3ASHA 3CVLA 3UQ3A 2ZR5A 5LCWC 1B6CA 3ASDA 3ZPJA 2XCBA
chains in the Genus database with same CATH superfamily
2HO1A 1QPFA 2MF9A 2F0YA 4DRXE 4ODQA 4GMLA 3ZUVB 4U96D 2L0TB 3ULYA 2KI3A 3TWSA 4U8HA 1D9SA 4UQXA 4BESA 3I4RB 2KC7A 5C2YA 2ZU6B 3CK7A 1IYGA 4A3VA 4BSXA 1NFIE 4U86A 4J7WA 3D9KA 3GU0A 3P1UA 4W9OA 1ZU2A 4KYOB 3UI2A 3FUDA 3PRDA 3VTYA 4ITZA 1ZK6A 3L54A 5G05C 1NH6A 2KFWA 2VSXE 2BEDA 4UWGA 4EBAA 5A6CA 4RVBA 2HE0A 4DRQA 2MHKA 3Q78A 4ATGA 2WK2A 4O2TA 1NA0A 4JC8A 5CRUA 4TYOA 4U0SA 3EUVA 4N5QA 2WXJA 4DRJA 4LRZA 4U0UA 4AIFA 3CHPA 5D75A 3WL1A 4AOFA 4CDRA 3LEWA 2XPYA 1J4RA 2LUHA 4HNAD 3APFA 4AY1A 3HVEA 2EIJE 1BLXB 1H2VC 3SY2A 3RU0A 3RM4A 4JHRA 4I2ZA 3PZ1A 1S0PA 5JH8A 1JWFA 1N0RA 1OCCE 1LQ0A 3N71A 4TXQA 4EZKA 2HM8A 3UX4A 2FEZA 3B7SA 3DPYA 1Q1CA 1OWPA 3E32A 5FINA 4Y6WA 4GYWA 3O4ZA 3NI6A 4ODKA 4NIKA 5AQ9A 2J49A 4JPSA 5HRYA 3Q7FA 4CGWA 3WKZA 1YA0A 4IN3B 3O5LA 3UM0A 5ENSD 2ZQTA 1D2KA 4EPZA 4AM9A 2YHCA 5HUAA 2RFAA 2E2EA 1RD6A 2A4ZA 1Y8MA 3UMVA 2BKKB 4GA0A 3PUJA 1W3BA 4N39A 3O5KA 2RKKA 5B1BE 5GQBA 3ML9A 4IPXA 3FUIA 1HKMA 1H6KA 1W1TA 2WB2A 4P8XA 1UW4B 1HXVA 1WG0A 3RRUA 3ESKA 3CKCA 4DUIA 2KO7A 2PN0A 1J4HA 2HYZA 4HOTA 1PINA 3O5RA 4Z2IA 1U79A 2MOWA 4HI8A 4L72B 4EQFA 4LSZE 1LL7A 1ZBVA 2Y69E 2RUQA 4I17A 1OCOE 2CHWA 3QWWA 3ZU7B 2ZGGA 3HXCA 3P2BA 5HKGA 2WMOA 1O1TA 1XHGA 4NQ0A 3BQOA 4GAAA 2PPOA 3CVPA 4C0MA 3PZ3A 1AWCB 3E33A 3D9OA 3SGHA 1H0IA 3HXFA 4RG6A 1NI1A 3QKYA 5CRVA 1LG1A 5J08A 1TN6A 4DLOA 1X6LA 4C48B 4DX1A 4A63B 4GZCA 2YINA 1GRJA 4WKFA 4U07A 3JUEA 4L9PA 1FVHA 4FULA 4O1OA 4Z2LA 5GPGA 4Y6CA 3AS8A 4I9EA 2MLYA 2XHEA 2CG2A 4I6JA 2XZDG 1ZL1A 4ODLA 5JMND 1FCHA 2IO3C 4LAXA 4LG6A 4FC8A 2AXVA 3WG7E 1MJ0A 4W9QA 2A3CA 4DRHA 1Y6IA 1JNDA 2KATA 1FKHA 3SF4A 3RGCA 2KBXA 4DWSC 2B6CA 2X6HA 1S64A 3JYSA 3S2AA 5ANRA 3V2OA 5T3RA 2R02A 3TG5A 3U4TA 2PI6A 2J9QA 2ITKA 2JLBA 4FAPA 1HF8A 3CVNA 3DBSA 3LCAA 4DRMA 3SFXA 1HS6A 3ARUA 3KACA 3DSVA 1W9VA 4BEPA 3RKVA 3CK9A 2BTDA 4ZHBA 3WXXA 2ZIRA 3ALFA 3PE3A 2FO7A 4TUUA 4A1GA 1OGBA 5KNHD 3X2QE 4XKBA 1TN8A 2VGXB 1S70B 4KZCA 4OAVB 2PV1A 2XGSA 4L7TA 1WAWA 1BPOA 3CZ8A 2Q5AA 3WD0A 5KJMA 1HO8A 3CVVA 3IHZA 3WH0A 1FKLA 2WXIA 1ZBCA 3SI5A 3O5EA 2DT3A 3ARYA 3MEKA 3PR9A 3ARPA 1EQ3A 3UT7A 1HJVA 4ACLA 4OAUC 3IXEA 3Q7AA 3FH8A 2DBAA 3KZ7A 3S7BA 3KADA 3QNKA 3SD5A 2O92A 4UI9K 3R7QA 1HFAA 2LAHA 4GMRA 3OXFA 1N4RA 3O5DA 3L22A 2IOSA 2P2CP 3IEGA 4AP2A 4CGVA 3W4RA 1MX4A 4I1OB 2QY7A 5HBFA 1ROTA 3LY8A 2IUZA 1SW6A 2P9KG 3LPZA 4QT2A 1TNZA 3SHFA 2XP8A 3O5PA 3CHQA 2MLZA 4XI9A 2DSUA 2I9CA 4ODNA 2L0IA 1UN8A 3Q9NC 4WNDA 5EYPF 2NC9A 4MKTA 3O5FA 3FU0A 4P8VA 3CGMA 3WD1A 5BXOA 3E30A 2ZQUA 3AQUA 4IQ2A 2V8SE 3Q5MA 1LD8A 3PS6A 1OWNA 2QYJA 4ANXA 2F23A 3ZFWA 2VSOE 4TX0A 1BI7B 3U64A 3FUEA 4WNEA 3RRNB 3FUFA 2DYRE 4QIBA 2UY1A 3HYMB 2VJ8A 3EU5A 2DSWA 3PREA 1TYQG 1W1VA 1ZB1A 4BSZB 2PNNA 1B6CA 3LVQE 3OA5A 3MJWA 3MZLB 3QJZA 1D7JA 1N54A 1FVFA 2FO1E 3QWVA 5AQAA 2LGOA 3IKGA 4HFGA 1ZCNA 2XEHA 5FQ4A 5BV1A 3UUXA 4TUMA 3PEUB 1OCRE 2A5UA 4ATZD 4FJYA 3CVWA 2WXOA 3KAEA 4J8SA 1FD9A 4DWSB 3QAQA 1F40A 4F1PA 4Q96A 5BXJA 1K9TA 4UWLA 1WY6A 5CERB 5KCMA 2KCVA 2KZTB 2P4VA 2WXMA 3BG1B 3KEZA 2LXLA 3SBTB 4K0RA 4GTPA 3JCKC 4ZFHA 3I4GA 4WWNA 2EULA 3KD7A 4JZYA 3V79K 3E37A 2J4BA 4FU3A 4GTQA 2BUGA 3O5MA 2KM4A 1HE8A 2CG3A 1N4PA 3FP3A 1HZ4A 1IX5A 3HIZA 3UM3A 4E85A 5C1DA 2XP9A 3VAWA 1HXIA 3ALGA 4EHMA 4JA7A 3OOBA 5A23A 3SFZA 1Q6UA 3UPVA 1S63A 3CSTA 2CFUA 3PH0C 1T11A 5EIBE 4MBGA 5CMYA 1WDYA 2GGFA 2P9PG 3SFYA 4HRMB 2X6KA 3LXUX 3BG0B 3B7UX 3JQ0A 1NWTA 3LY9A 5AJDA 1BI8B 4NNRA 4H7XA 5AENA 2DSVA 2JEKA 1BD8A 1KT0A 2WXQA 3ZRHA 2WXPA 2H6GA 1LG2A 4S3KA 3Q75A 4GTSA 4QZVB 3KEAA 5EN5D 1H2TC 3C3OA 3KAFA 2LAIA 2P9IG 3RRMB 2C0LA 1QZ2A 3NZUA 3B9AA 2VSYA 3CQCB 5B1AE 3TL5A 2A3BA 3ZKJA 4URIA 2F8XK 4JD2G 5AAOA 1IXVA 2X6IA 3ZYKA 1ZU8A 1E90A 4C0EA 5KJKA 2XP4A 1TNBA 1HJXA 3CVXA 3CH9A 3Q9UC 4PUCA 5T8IA 4X8QA 2Y3AA 3PNLB 4QT3A 3FUHA 5KBAA 4WNFA 2RUCA 2WQHA 1V54E 4CDMA 4GA2A 3D9MA 4DK5A 3G6LA 5ENQD 2XS8A 4FA6A 3DSTA 1DNPA 1LL4A 1UN9A 2G41A 4GYYA 2VN1A 4XX5A 3PRAA 2OLHA 4ME2A 4TRQA 2VQ2A 3ASOE 3ONLA 3DSXA 1WM5A 4U63A 3ML8A 2OVFA 4YVQC 2ETCA 1NWSA 1YMPA 1O1RA 2M2AA 2DT1A 4N19A 5GPRA 4I9CA 2M1IA 1W26A 2LKNA 2B31A 3TWTA 1G3NB 3LYAA 1E8XA 3C5RA 4APOA 2LPVA 2X6JA 2IFUA 2J4DA 4HRNA 1UR9A 1M5YA 1ELKA 4TXPA 3FY1A 3FDHA 4Q22A 3D9NA 4BF8A 5BT1A 2DT0A 1K1BA 3DSUA 4N2QA 4K5BA 3DXMG 3MKQB 2PPPA 4ODOA 4UDMA 4ODPA 2WXRA 3O5OA 5KNGA 2ZR6A 4KVOA 4IT6A 5IY5E 4FJZA 2G8ZA 4GGQA 2R05A 3BU8A 4G1TA 4WNGA 2WLYA 4HOSA 1FPPA 4JVSA 4PH4B 3ZEFA 2FKEA 5LX8A 5ARFA 1NP7A 4U84A 2HR2A 1V55E 4F3VA 1SQMA 4JFIA 1N95A 2E0IA 4ML4A 5FQ7A 3CGNA 4UWFA 2WM0A 3CHMA 4BERA 3ZYLA 3HXDA 2PQNA 1WNOA 1EHNA 3UKRG 4GTMA 2KR7A 1MYOA 3F6QA 4U7EB 2R17C 5EILA 3Q73A 5LCWJ 1E8WA 4MTVA 3VLFA 2AJAA 4ZPVR 3RO3A 3LKUA 3APDA 2ONDA 3BUAA 1E6PA 1MHQA 1KZPA 4U8YD 3O5QA 1D8EA 3ZXPA 3D9LA 5EDSA 3AAAC 3WD4A 3EHQA 4TW7A 2PBCA 1WB0A 4N3BA 1KFWA 2KE0A 5B8IC 2P9NG 2OFNA 2XRZA 5G04J 3WQWA 1FAPA 3TWWA 3TWQA 2XGOA 2DVWA 3L13A 2OOEA 3W9FA 4LCTA 1ELWA 1HX8A 2OV8A 5BPPA 2V0PA 5JA4D 4JFLA 3NAWA 1W9UA 2YNQA 3UINC 4G8LA 3GW4A 2LNIA 3RSEG 4C02B 4Z2JA 1HU3A 1NWUA 1PBKA 4WK9A 4A1SA 3LY7A 3G6MA 4GPMA 3B7BA 2XPBA 3C72A 3R7RA 1Z3XA 3IV0A 2KGJA 1LD7A 4HBOA 3E4BA 2L6BA 3FH5A 3CHRA 1L5JA 2P9UG 2VSNA 3EU9A 4BTAA 4YDWA 3TGOA 4O1PA 4IYPA 2DZNA 2RD0A 3B7XA 2CHZA 4RSYA 4B93B 4JEUA 2A5EA 2WLZA 1A17A 4J8DA 2R2LA 4FHKA 4KMOA 4EZJA 3VLDA 2YBUA 5M72A 1OUVA 4B8AA 3L9TA 2IJGX 3CVQA 5KJLA 3ARSA 4JB8P 1DC2A 5CCLA 2IU1A 5EX0A 4L3NA 4DX7D 1HKJA 1MX2A 1TNOA 4F6RD 4AV7A 4LAYA 4NZCA 1L1PA 2IF4A 2NXPA 5FQ8A 4LERA 3URZA 2XPAA 1E7VA 3AG4E 2MRIA 1Q6IA 3QDNA 4U04A 1GPFA 1N52A 4U95D 1HKKA 3MGBA 3HXBA 3JXJA 4B89A 5AYWD 2OVBA 2UWJG 3VTXA 3NQPA 1B89A 3TAXA 1OWMA 4EBAG 3MA5A 1YCSB 2F37A 3ZHEA 2LJ4A 4CDNA 1QQEA 5DEZA 3L82A 4G8KA 4XIFA 2J08A 1OGGA 2H6IA 2ZXWE 4CZ2D 2JZVA 4ANUA 2GRQB 1SA4A 2EINE 4HLEA 3CVLA 4GTOA 3UQ3A 3ZXSA 5LCWC 4HBEA 3ASDA 3ZPJA 3T8MA 3J5QB 3PVLA 4AEZC 1SVXA 2PPNA 1X6NA 2RFMA 1W9PA 5DIVA 2GRNB 2GRLA 3B9DA 4WKAA 1IKND 1N11A 3D3MA 1E96B 5FQ6A 3RM8A 2XEVA 4L1BA 3L17A 4KVMA 4I2WA 2F2DA 3B7RL 3FH7A 2PZIA 2AWIA 1OWLA 2DG9A 3OTNA 4ZPWR 2DG4A 3BEEA 3HHMA 4IRUA 3HDXA 3CSFA 4UQZA 4WWOA 3ZN3A 3O48A 3ULEG 4FP7A 3TCZA 1JCSA 4HORA 1DCQA 4PS3A 2A3EA 2Y4TA 3PEVB 2ESCA 5B3SE 1SZ9A 5ITZF 2XENA 1XRVA 2J07A 5E76A 4BY6A 1FKJA 4JHKA 5LOZA 1EYMA 4KBQA 2XPIA 3FXYA 3QOUA 2VTBA 1E6RA 1YYHA 5T4YA 3KAIA 2WXGA 3RAUA 3FUKA 4DX5D 3V31A 1BKFA 4NSBA 4NACA 3ZVVA 1SR0A 3ARTA 5HS0A 3TDBA 3LS8A 3AJIA 3RIBA 4LAWA 4OVVA 1JWGA 1JUQA 4NRHB 4GTRA 3EHMA 4JXTA 4KZ0A 4OVUA 4ACKA 3EDTB 2FDMA 3AS0A 1A7XA 4DRIA 1YW5A 3B9EA 4GTVA 5ENPD 4I43A 5E75A 2DCPA 2XZTG 3FTXA 5BXUA 3GZ2A 2XGMA 5JJTA 5HQ8A 2XP5A 1NL4A 5AARA 2A3AA 2DG3A 4MAVA 2H6FA 3IKOB 1U3CA 4GZ5A 2DPEA 1P5QA 2ZGDA 2KZTA 3ULQA 3SO8A 1XNFA 5G2NA 2B0OE 2QZAA 1DCEA 3GZSA 2H6HA 2DZOA 2DSZA 4CYMD 5DIUA 1JCRA 3UF8A 2AOSA 5FZQA 3UI5A 3G2TA 2VGXA 1OWOA 4DT4A 2DWZA 5CCMA 3DRAA 4CT4A 5D2MC 4L2YA 2I2OA 3R9AB 2FULA 3V30A 2AVPA 2L9BA 4G50A 4YDYA 1UR8A 4DROA 4DIPA 3TJPA 3AS1A 3KABA 2UZ5A 3DSSA 2XS1A 3IHVA 3KS2A 3Q49B 4LUNU 3WD3A 1MZCA 2DT2A 4NURA 1FKGA 1NWRA 5KJNA 3CHSA 3TWRA 4G2PA 4ODRA 4AY5A 4UI9C 2F21A 4F53A 2ETAA 2EQXA 3FTWA 2R03A 1ZBKA 4MNMA 5LFAA 4DLQA 5J90A 2BKGA 4ILHB 2XCCA 3BXWA 1J4IA 5CHEE 1FKFA 3EIPA 3AS2A 3QOKA 4FHJA 3O5GA 2J8SD 3WQVA 3GPKA 1EF1C 4BT8A 2FAPA 4ANVA 4ABNA 4Z68A 3I5PA 4YVOA 3OAWA 1JVWA 4DI3A 1UJKA 3ARQA 1EYHA 5ENOD 4MRUA 4BX9A 4Z2KA 3CVUA 3LUOA 2GRMA 4GZDA 1OY3D 1Z3YA 5HWCA 1LL6A 5J6EA 4LNUD 3TWVA 1H0GA 3ZYQA 1Z6TA 4HXIA 4P29A 4R7LA 5G55A 5BUZA 3UI4A 3DXKG 4JYSA 5BNWA 2IEJA 5G04C 1TNYA 4HLLA 2PM6A 1SYTA 3UT8A 2Y4UA 4JFJA 2LO6A 2PQRA 1TNUA 4P8UA 1HG2A 1FKRA 4DZ3A 1C9HA 1X81A 2NYJA 1H6PA 4JHJA 1H6OA 2WQ6A 4E6HA 4N2SA 3AROA 4MNLA 1E9LA 4KR0B 3T9KA 4N3AA 3EHNA 4BETA 4QQIA 3ISMC 3PZ2A 3G2WA 3QK0A 4MNKA 2CHXA 4R0XA 5JJ6A 3APCA 3ASFA 1N9AA 5EYLA 3ZW3A 1ITXA 1E6ZA 1U3DA 3ABKE 4PDXA 4GZ6A 2IONA 2WXHA 4F7AA 3CHDA 4MGVA 1ROUA 4DX2A 3MKQA 2ETNA 3PNTB 3JYMA 5DITA 3EIJA 4AVXA 1EIBA 5HWBA 5FT9A 3L08A 4DWSD 4EECA 1UG3A 1D7IA 2V5QC 1VDYA 1JCHB 4KT6B 2PV3A 4TW8A 4V3IA 1K3ZD 1VF8A 4GTTA 2MLXA 3KSQA 3MV3B 3TWUA 1PC2A 1IHBA 2FBNA 3CEQA 4J4OA 1FKIA 4L2LA 4M7CA 2VGYA 4J8FA 4RG9A 4HOQA 1JNTA 2ZR4A 3RMEA 2XP7A 4QFVA 3SBSA 4FLHA 4F1SA 2XPZA 3FEXA 4TXRA 1N94A 1W1PA 1PAQA 4EZLA 3RM9A 3EIQC 4MLPA 4PTMA 1QBQA 4LEUA 3D9PA 3CHFA 1LTXA 2N87A 3W9GA 2MPHA 4IULA 2WMNA 4ZS6A 1TEZA 1ELRA 3OXLA 3TXNA 2ETBA 5HTGA 3L16A 4AY6A 4YNDA 5DO2A 4OYSA 2IQCA 2I1KA 4R5EA 3UXGA 2XP6A 2Y0BG 5AIJA 5CMWA 3B7TA 3MDYB 1GUVA 5AN8A 1E7UA 2I6HA 2D9FA 4Z2HA 3EJNA 2P9SG 3FU5A 3U66A 2LSUA 5D66A 3BMBA 3AU5A 5HW7A 3V2XA 3O5JA 4LGXA 1TCOC 4GMJA 4N3CA 2Q7FA 1FKDA 4G26A 1FT2A 4JL0A 1OWQA 3JYJA 3TG4A 1H2UA 3DSWA 2RQSA 3EY6A 2GRPB 4UUCA 4W5UA 2OEVA 4RLYA 4JFKA 1NMWA 2VCDA 3KSLA 4FADA 1BL4A 4ODMA 2XP3A 5DF0A 3ASHA 4MS6A 4WAFA 2V4LA 2ZR5A 1SZAA 2AW6A 4Q69A 4AXHA 2KXPC 2XCBA 3HVEB 5JHBA 3FTYA 3ZYMA 1A5EA 3TC5A 3HXEA 4UWHA 1Q2ZA 1HG5A 3B8SA 5ENRD 2R59A 3JQ1A 2LXMA 1R9HA 3ONKA 2IOLA 4WWPA 2WXNA 2WM9A 3DWLG 5D0OD 1Z5SC 4WUYA 3MKRA 3GZ1A 1IHGA 1QPLA 4LNBA 3FTSA 4J6IA 4L23A 5DBKA 3T8KA 4K5AB 3SZ7A 3FTZA 3JXIA 4UI9J 4G23A 2XQ0A 3PDNA 3ASNE 1YATA 2DYSE 5CBNA 3Q47B 3E34A 5AJLA 4HI9A 5EX3A 2K8IA 4UWKA 5FIOA 1OXJA 4TV3A 2ZQSA 5BW8C 2X3MA 1NSGA 4ILIA 3K9IA 4J0UA 2C2LA 3LDZA 4H7YA 5FZRA 3NRKA 4XAKA 1H19A 1FT1A 4G25A 1TJCA 3ODKA 5KWDA 4M3OA 1FFQA 4G24A 2X38A 3R9MA 5ARGA 1F8AB 2L2SA 1N4QA 3PRZA 3QARA 1NA3A 3IBEA 2NSZA 4G2VA 1JPLA 3GTYX 1FKTA 2M63A 3G2SA 3IKDA 3UIOC 3S7JA 5CEDB 1TR4A 4CEMA 2MYOA 1QYMA 1U2VG 3C3RA 3NTPA 2QC9A 1K1AA 3QWPA 1OCZE 3MX3A 3PZ4A 1D6OA 2C0MA 4WIWA 5ANLA 4Z2GA 2YBTA 3LVRE 3PZDA 3WIJA 3VLEA 1RW2A 2P9LG 3J5PA 2IY0C 5EIDA 4HB5A 4KXKB 5D0QD 4JA9A 1GOIA 3CQGB 4J8YA 3I6CA 4B94A 4O60A 3ARRA 1INZA 3ENEA 1Q6HA 3AG2E 1NZNA 2BF0X 4C9BB 3FU3A 4UQYA 4JW1A 3MCXA 3UT4A 3T5VA 4JEHA 4G11A 3ARVA 3FAPA 5HW8A 3AG1E 4HRLA 3FTUA 4HBDA 4XKCA 4GU5A 3CV0A 3NOGD 3CK8A 1AP7A 1N1AA 4W9RA 3Q15A 3B95A 4ANWA 2FI7A 2R5SA 4I1AA 2B5UB 3ASGA 3CHOA 4WJXA 4BX8A 1JNEA 2VTBB 3FWVA 5FZSA 4B8CB 2JABA 4GCOA 5HW6A 4J4NA 4DI4A 2M08A 1OT8A 3FULA 3AG3E 3SNXA 1HJWA 3DPDA 2GROB 2OCCE 2O9OA 3S7FA 1FKKA 2ZQVA 2VYIA 1N4SA 2RUDA 2RURA 2AWGA 5LP0A 1J6YA 2GW1A 4TW6A 3CGHA 1KZOA 5ENNA 4DH0A 2XEEA 3CR3A 2PM7A 3PA7A 3UQIA 1ZB5A 3PUKA 4CT0A 4D10C 3UQBA 4YDEA 5CECB 3UI6A 3NB2A 4DRPA 3C98A 3OXGA 5A7DB 4KQZA 4W9PA 3H9RB 4JFMA 2Y78A 1DVPA 3HG0D 4XZ4A 3DEOA 1CTNA 4B0ZA 2QF8A 3JXVA 1WAO1 2GRRB 4HQDA 3D9IA 5FTPA 5ENTD 3FFLA 1Y0OA 3LJ3A 1ZBWA 4MSPA 3DEPA 2LSVA 4HS2A 4U8VD 3ARXA 5AQ7A 4BFRA 2J09A 1H0AA 1O6IA 1EDQA 4DPRA 3RO2A 1O1SA 5CEAA 2WPVA 1E44A 3RFWA 2CFZA 4RQIA 3UM1A 3ABLE 4PS8A 4CRWA 1X5BA 1K8KG 4LNGA 2ZISA 3ZHEB 4BWRA 4BT9A 2PV2A 4XEIG 2FF4A 5JJ7A 3FU6A 1LJYA 4Q7NA 4DRNA 2RG8A 3D9HA 4DRKA 2L6JA 3ZGQA 1D7HA 2YQ8A 1MX6A 2AXUA 1W1YA 4GCNA 3KCEA 1E6NA 1JNSA 5CBOA 3FTVA 4DZ2A 2V4HC 2KCLA 4U85A 1E8YA 3NZSA 3KAGA 4BTBA 3CVYA 3L6AA 3GYZA 3FUJA 4I6GA 3UQAA 4HARA 1FKBA 2OEWA 2QYUA 5AQBA 1NMVA 5DIZA 3TXMA 1TJFA 5HKPA 4GIVA 4XI0A 4HOUA 2EILE 1UOHA 2EIKE 1IQUA 1O5MA 3G2UA 4MPKA 4Q94A 4LAVA 1E8ZA 2I1JA 3ESLA 2V5FA 3B13A 1N0QA 3QB2A 3U3WA 4YDOA 5EKQD 3FEYA 3I3NA 4GA1A 2MNTA 3NBNB 2YHEA 3CLJA 3PRBA 1GW6A 4GB9A 4ZPTR 2IO2C 5BV0A 1KLXA 3WD2A 1EPUA 3MYVA 1UJJA 3UIPC 2X6FA 4O6FA 3CHCA 2P58C 3RJVA 3UKUG 4ILGA 4GYOA 3Q4AB 3JUIA 2WXKA 1RZ4A 3FUMA 4K5CA 4A3TA 4URKA 2UY1B 4FN2A 2WQ7A 1EDUA 2QFCA 1SA5A 1PY1A 3Q79A 3IHYA 3C3QA 5HI7A 5G05J 3FHEA 3ZIMA 5H7PA 1E15A 4U0ZA 4I1MA 5I98A 4HVBA 3ARZA 3CHEA 1HH8A 2WXFA 3UM2A 2Y1LE 3UTMA 1TFVA 2RSEA 4MNJA 1KPSB 3CKBA 4IQCA 2DIWA 2EIME 4AJWA 3U9WA 3MV2B 2ILRA 4CCAA 3QC1A 4PS7A 4DJAA 1LF8A 4N5CA 4A55A 3G2VA 1QNFA 1IQRA 2XRYA 1FKSA 4DWSA 4S3JA 2WVIA 3D9JA 3IK8A 5HT1A 3EHRA 3FY4A 3ARWA 3SQVA 1ZBPA 3ABME 3S7DA 4J8EA 1FFRA 2AXZA 3RK6A 1JCQA 4TNSA 1HKIA 4APFA 4DX6D 1KT1A 4IT4A 3KAHA 3NOCD 4K03A 3O5IA 1FJDA 1XGWA 3AS5A 3PE4A 3NF1A 3TWXA 5FWQA 2VGEA 1D8DA 2KCKA 3AS4A 3CIAA 4P8WA 4GZ3A 4I6EA 3AU4A 1MQSA 2F4EA 3AS3A 4GPKA 5JHAA 3HRAA 1BU9A 3T5XA 3LJNA 2F8YA 3WL0A 4FLBA 2PL2A 5FJYA 4WKHA 1TN7A 4XE0A 3FUNA 3ZNGA 2WXLA
chains in the Genus database with same CATH topology
2HO1A 1QPFA 2MF9A 4ODQA 4GMLA 2L0TB 2KI3A 4U8HA 4UQXA 3I4RB 2KC7A 5C2YA 2ZU6B 3CK7A 1IYGA 4A3VA 4BSXA 4U86A 3D9KA 3P1UA 4W9OA 1ZU2A 4KYOB 3FUDA 3PRDA 3VTYA 4ITZA 1ZK6A 3L54A 5G05C 1NH6A 2KFWA 2VSXE 4UWGA 4EBAA 5A6CA 4RVBA 4DRQA 2MHKA 4ATGA 2WK2A 4O2TA 1NA0A 4JC8A 4TYOA 4U0SA 4DRJA 2WXJA 4LRZA 4U0UA 4AIFA 3CHPA 5D75A 3WL1A 4AOFA 4CDRA 3LEWA 2XPYA 1J4RA 3APFA 4AY1A 3HVEA 1H2VC 3RU0A 3RM4A 4JHRA 4I2ZA 1S0PA 5JH8A 1JWFA 1LQ0A 3N71A 2HM8A 4EZKA 3UX4A 2FEZA 3B7SA 1Q1CA 1OWPA 4Y6WA 4GYWA 3O4ZA 3NI6A 4ODKA 2J49A 4JPSA 4CGWA 3WKZA 1YA0A 4IN3B 3O5LA 2ZQTA 1D2KA 4EPZA 4AM9A 2YHCA 5HUAA 2E2EA 1RD6A 2A4ZA 1Y8MA 3UMVA 4GA0A 3PUJA 1W3BA 4N39A 3O5KA 5GQBA 3ML9A 4IPXA 1HKMA 3FUIA 1H6KA 1W1TA 2WB2A 4P8XA 1UW4B 1HXVA 3RRUA 3ESKA 3CKCA 2KO7A 1J4HA 2HYZA 4HOTA 1PINA 3O5RA 4Z2IA 1U79A 2MOWA 4L72B 4EQFA 1LL7A 1ZBVA 2RUQA 4I17A 2CHWA 3QWWA 3P2BA 5HKGA 2WMOA 1XHGA 4NQ0A 4GAAA 2PPOA 3CVPA 4C0MA 3D9OA 3SGHA 1H0IA 4RG6A 3QKYA 1LG1A 5J08A 4DLOA 1X6LA 4GZCA 2YINA 4WKFA 4U07A 1FVHA 4FULA 4Z2LA 5GPGA 4Y6CA 3AS8A 4I9EA 2MLYA 2XHEA 2CG2A 4I6JA 1ZL1A 4ODLA 1FCHA 4LAXA 4FC8A 2AXVA 4W9QA 2A3CA 4DRHA 1Y6IA 1JNDA 2KATA 1FKHA 3SF4A 3RGCA 4DWSC 2X6HA 3JYSA 3S2AA 5ANRA 5T3RA 3TG5A 3U4TA 2PI6A 2J9QA 2ITKA 2JLBA 4FAPA 1HF8A 3CVNA 3DBSA 3LCAA 4DRMA 1HS6A 3ARUA 3KACA 1W9VA 3RKVA 3CK9A 2BTDA 3WXXA 3ALFA 3PE3A 2FO7A 4TUUA 4A1GA 1OGBA 4XKBA 2VGXB 4KZCA 2PV1A 2XGSA 4L7TA 1WAWA 1BPOA 3CZ8A 2Q5AA 3WD0A 5KJMA 1HO8A 3CVVA 3IHZA 3WH0A 1FKLA 2WXIA 1ZBCA 3SI5A 3O5EA 2DT3A 3ARYA 3MEKA 3PR9A 3ARPA 1EQ3A 3UT7A 1HJVA 4ACLA 3FH8A 2DBAA 3KZ7A 3S7BA 3KADA 3QNKA 3SD5A 2O92A 4UI9K 3R7QA 1HFAA 2LAHA 3OXFA 3O5DA 3L22A 2IOSA 3IEGA 4AP2A 4CGVA 3W4RA 4I1OB 2QY7A 5HBFA 1ROTA 3LY8A 2IUZA 3LPZA 4QT2A 3SHFA 2XP8A 3O5PA 3CHQA 2MLZA 4XI9A 2DSUA 2I9CA 4ODNA 2L0IA 1UN8A 4WNDA 2NC9A 4MKTA 3O5FA 3FU0A 4P8VA 3CGMA 3WD1A 2ZQUA 3AQUA 4IQ2A 2V8SE 3Q5MA 3PS6A 1OWNA 4ANXA 3ZFWA 2VSOE 4TX0A 3U64A 3FUEA 4WNEA 3RRNB 3FUFA 4QIBA 2UY1A 3HYMB 2VJ8A 2DSWA 3PREA 1W1VA 1B6CA 3LVQE 3OA5A 3MJWA 3MZLB 3QJZA 1D7JA 1N54A 1FVFA 3QWVA 2LGOA 3IKGA 4HFGA 1ZCNA 5FQ4A 5BV1A 3UUXA 3PEUB 2A5UA 4FJYA 3CVWA 2WXOA 3KAEA 4J8SA 1FD9A 4DWSB 3QAQA 1F40A 4Q96A 5BXJA 1K9TA 4UWLA 1WY6A 5KCMA 2KCVA 2KZTB 2WXMA 3BG1B 3KEZA 3SBTB 4K0RA 3JCKC 3I4GA 4WWNA 3KD7A 4JZYA 2J4BA 4FU3A 2BUGA 3O5MA 2KM4A 1HE8A 2CG3A 3FP3A 1HZ4A 1IX5A 3HIZA 5C1DA 4E85A 2XP9A 3VAWA 1HXIA 3ALGA 4JA7A 3OOBA 5A23A 3SFZA 1Q6UA 3UPVA 3CSTA 2CFUA 3PH0C 1T11A 5CMYA 2GGFA 2X6KA 3LXUX 3BG0B 3B7UX 3JQ0A 1NWTA 3LY9A 5AJDA 4NNRA 4H7XA 5AENA 2DSVA 2JEKA 1KT0A 2WXQA 3ZRHA 2WXPA 1LG2A 4S3KA 4QZVB 1H2TC 3KAFA 2LAIA 3RRMB 2C0LA 1QZ2A 3NZUA 3B9AA 2VSYA 3CQCB 3TL5A 2A3BA 4URIA 2X6IA 3ZYKA 1ZU8A 1E90A 4C0EA 5KJKA 2XP4A 1HJXA 3CVXA 3CH9A 4PUCA 5T8IA 2Y3AA 3PNLB 4QT3A 3FUHA 4WNFA 2RUCA 2WQHA 4CDMA 4GA2A 3D9MA 4DK5A 3G6LA 4FA6A 1LL4A 1DNPA 1UN9A 2G41A 4GYYA 2VN1A 4XX5A 3PRAA 2OLHA 4ME2A 4TRQA 2VQ2A 3ONLA 4U63A 1WM5A 3ML8A 2OVFA 4YVQC 1NWSA 2M2AA 2DT1A 4N19A 5GPRA 4I9CA 2M1IA 1W26A 2LKNA 2B31A 3LYAA 1E8XA 4APOA 2LPVA 2X6JA 2IFUA 2J4DA 1UR9A 1M5YA 1ELKA 3FY1A 3FDHA 4Q22A 3D9NA 4BF8A 5BT1A 2DT0A 4N2QA 2PPPA 3MKQB 4ODOA 4ODPA 2WXRA 3O5OA 2ZR6A 4KVOA 4IT6A 4FJZA 2G8ZA 4GGQA 4G1TA 4WNGA 2WLYA 4HOSA 4JVSA 4PH4B 3ZEFA 2FKEA 5LX8A 5ARFA 1NP7A 4U84A 2HR2A 4F3VA 1SQMA 4JFIA 2E0IA 4ML4A 5FQ7A 3CGNA 4UWFA 2WM0A 3CHMA 3ZYLA 2PQNA 1WNOA 1EHNA 2KR7A 2R17C 5LCWJ 1E8WA 4MTVA 3VLFA 4ZPVR 3RO3A 3LKUA 3APDA 2ONDA 1E6PA 1MHQA 3O5QA 3D9LA 5EDSA 3WD4A 4TW7A 2PBCA 1WB0A 4N3BA 1KFWA 2KE0A 5B8IC 2OFNA 2XRZA 5G04J 3WQWA 1FAPA 2XGOA 3L13A 2OOEA 4LCTA 1ELWA 1HX8A 2OV8A 5BPPA 2V0PA 4JFLA 1W9UA 2YNQA 3GW4A 2LNIA 4C02B 4Z2JA 1HU3A 1NWUA 1PBKA 4WK9A 4A1SA 3LY7A 3G6MA 2XPBA 3R7RA 1Z3XA 3IV0A 2KGJA 4HBOA 3E4BA 3FH5A 3CHRA 1L5JA 2VSNA 4BTAA 3TGOA 4IYPA 2RD0A 3B7XA 2CHZA 4RSYA 4JEUA 2WLZA 1A17A 4J8DA 4FHKA 4KMOA 4EZJA 3VLDA 2YBUA 5M72A 1OUVA 4B8AA 2IJGX 3CVQA 5KJLA 3ARSA 5CCLA 2IU1A 5EX0A 4L3NA 1HKJA 4AV7A 4LAYA 4NZCA 1L1PA 2IF4A 2NXPA 5FQ8A 4LERA 3URZA 2XPAA 1E7VA 2MRIA 1Q6IA 3QDNA 4U04A 1GPFA 1N52A 1HKKA 3MGBA 4B89A 5AYWD 2OVBA 2UWJG 3VTXA 3NQPA 1B89A 3TAXA 1OWMA 4EBAG 3MA5A 3ZHEA 2LJ4A 5DEZA 4CDNA 1QQEA 4XIFA 2J08A 1OGGA 2JZVA 4ANUA 4HLEA 3CVLA 3UQ3A 3ZXSA 5LCWC 4HBEA 3ASDA 3ZPJA 3T8MA 3PVLA 4AEZC 2PPNA 1X6NA 1W9PA 5DIVA 2GRLA 3B9DA 4WKAA 3D3MA 1E96B 5FQ6A 3RM8A 2XEVA 4L1BA 3L17A 4KVMA 4I2WA 2F2DA 3B7RL 3FH7A 2PZIA 2AWIA 1OWLA 2DG9A 3OTNA 4ZPWR 2DG4A 3BEEA 3HHMA 4IRUA 3HDXA 3CSFA 4UQZA 4WWOA 3ZN3A 3O48A 4FP7A 3TCZA 4HORA 4PS3A 2A3EA 2Y4TA 3PEVB 2ESCA 1SZ9A 1XRVA 2J07A 5E76A 4BY6A 1FKJA 4JHKA 5LOZA 1EYMA 4KBQA 2XPIA 3FXYA 3QOUA 2VTBA 1E6RA 5T4YA 3KAIA 2WXGA 3FUKA 4NSBA 1BKFA 4NACA 3ZVVA 1SR0A 3ARTA 3TDBA 3LS8A 3RIBA 4LAWA 4OVVA 1JWGA 1JUQA 4NRHB 3EHMA 4JXTA 4KZ0A 4OVUA 4ACKA 3EDTB 2FDMA 3AS0A 1A7XA 4DRIA 1YW5A 3B9EA 4I43A 5E75A 2DCPA 3FTXA 3GZ2A 2XGMA 5JJTA 5HQ8A 2XP5A 2A3AA 2DG3A 4MAVA 3IKOB 1U3CA 4GZ5A 2DPEA 1P5QA 3ULQA 2KZTA 1XNFA 5G2NA 2DSZA 3GZSA 5DIUA 3UF8A 2AOSA 5FZQA 3UI5A 3G2TA 2VGXA 1OWOA 4DT4A 5CCMA 4CT4A 4L2YA 2I2OA 3R9AB 2FULA 2AVPA 2L9BA 4G50A 1UR8A 4DROA 4DIPA 3TJPA 3AS1A 3KABA 2UZ5A 3IHVA 3KS2A 3Q49B 4LUNU 3WD3A 2DT2A 4NURA 1FKGA 1NWRA 5KJNA 3CHSA 4G2PA 4ODRA 4AY5A 4UI9C 2F21A 4F53A 2EQXA 3FTWA 1ZBKA 4MNMA 5LFAA 4DLQA 5J90A 4ILHB 2XCCA 3BXWA 1J4IA 5CHEE 1FKFA 3AS2A 3QOKA 4FHJA 3O5GA 3WQVA 3GPKA 1EF1C 4BT8A 2FAPA 4ANVA 4ABNA 3I5PA 4YVOA 3OAWA 1JVWA 4DI3A 1UJKA 3ARQA 1EYHA 4BX9A 4MRUA 4Z2KA 3CVUA 3LUOA 2GRMA 4GZDA 1Z3YA 5HWCA 1LL6A 5J6EA 1H0GA 3ZYQA 1Z6TA 4HXIA 4P29A 4R7LA 5G55A 5BUZA 3UI4A 4JYSA 5BNWA 5G04C 2PM6A 1SYTA 3UT8A 2Y4UA 4JFJA 2LO6A 2PQRA 4P8UA 1HG2A 1FKRA 4DZ3A 1C9HA 4JHJA 2WQ6A 4E6HA 4N2SA 3AROA 4MNLA 1E9LA 4KR0B 4N3AA 3EHNA 3G2WA 3QK0A 4MNKA 2CHXA 4R0XA 5JJ6A 3APCA 3ASFA 3ZW3A 1ITXA 1E6ZA 1U3DA 4PDXA 4GZ6A 2IONA 2WXHA 4F7AA 3CHDA 4MGVA 1ROUA 3MKQA 3PNTB 3JYMA 5DITA 3EIJA 4AVXA 1EIBA 5HWBA 5FT9A 3L08A 4DWSD 4EECA 1UG3A 1D7IA 1VDYA 4KT6B 2PV3A 4TW8A 4V3IA 1VF8A 2MLXA 3MV3B 1PC2A 2FBNA 3CEQA 4J4OA 1FKIA 4L2LA 2VGYA 4J8FA 4RG9A 4HOQA 1JNTA 2ZR4A 3RMEA 2XP7A 4QFVA 3SBSA 4FLHA 4F1SA 2XPZA 3FEXA 1W1PA 1PAQA 4EZLA 3RM9A 3EIQC 4MLPA 4PTMA 4LEUA 3D9PA 3CHFA 2N87A 2MPHA 4IULA 2WMNA 4ZS6A 1TEZA 1ELRA 3OXLA 3TXNA 5HTGA 3L16A 4AY6A 4YNDA 5DO2A 4OYSA 2IQCA 2I1KA 4R5EA 2XP6A 5AIJA 5CMWA 3B7TA 3MDYB 1GUVA 1E7UA 2I6HA 2D9FA 4Z2HA 3EJNA 3FU5A 3U66A 2LSUA 3AU5A 5HW7A 3O5JA 4LGXA 1TCOC 4GMJA 4N3CA 2Q7FA 1FKDA 4G26A 4JL0A 1OWQA 3JYJA 3TG4A 1H2UA 2RQSA 3EY6A 4W5UA 4JFKA 1NMWA 2VCDA 4FADA 1BL4A 4ODMA 2XP3A 5DF0A 3ASHA 4MS6A 4WAFA 2V4LA 2ZR5A 1SZAA 2AW6A 4Q69A 4AXHA 2XCBA 3HVEB 5JHBA 3FTYA 3ZYMA 3TC5A 4UWHA 1HG5A 3B8SA 2R59A 3JQ1A 1R9HA 3ONKA 2IOLA 4WWPA 2WXNA 2WM9A 5D0OD 4WUYA 3MKRA 3GZ1A 1IHGA 1QPLA 3FTSA 4J6IA 4L23A 5DBKA 3SZ7A 3FTZA 4UI9J 4G23A 2XQ0A 3PDNA 1YATA 3Q47B 5AJLA 5EX3A 2K8IA 4UWKA 4TV3A 2ZQSA 5BW8C 2X3MA 1NSGA 4ILIA 3K9IA 4J0UA 2C2LA 3LDZA 4H7YA 4XAKA 5FZRA 3NRKA 1H19A 4G25A 1TJCA 3ODKA 4M3OA 1FFQA 4G24A 2X38A 5ARGA 1F8AB 2L2SA 3PRZA 3QARA 1NA3A 3IBEA 2NSZA 4G2VA 1JPLA 1FKTA 2M63A 3G2SA 3IKDA 3S7JA 4CEMA 3NTPA 3QWPA 3MX3A 1D6OA 2C0MA 4WIWA 5ANLA 4Z2GA 2YBTA 3LVRE 3PZDA 3WIJA 3VLEA 4KXKB 5D0QD 4JA9A 1GOIA 3CQGB 3I6CA 4B94A 3ARRA 1INZA 3ENEA 1Q6HA 1NZNA 2BF0X 4C9BB 3FU3A 4UQYA 4JW1A 3MCXA 3UT4A 3T5VA 4JEHA 4G11A 3ARVA 3FAPA 5HW8A 3FTUA 4XKCA 4GU5A 3CV0A 3CK8A 1N1AA 4W9RA 3Q15A 4ANWA 2FI7A 2R5SA 4I1AA 3ASGA 3CHOA 4WJXA 4BX8A 1JNEA 2VTBB 3FWVA 5FZSA 4B8CB 4GCOA 5HW6A 4J4NA 4DI4A 2M08A 3FULA 3SNXA 1HJWA 3DPDA 2O9OA 3S7FA 1FKKA 2ZQVA 2VYIA 2RUDA 2RURA 2AWGA 5LP0A 1J6YA 2GW1A 4TW6A 3CGHA 5ENNA 4DH0A 3CR3A 2PM7A 3PA7A 3UQIA 1ZB5A 3PUKA 4CT0A 4D10C 3UQBA 3UI6A 4DRPA 3C98A 3OXGA 5A7DB 4KQZA 4W9PA 3H9RB 4JFMA 2Y78A 1DVPA 4XZ4A 1CTNA 4B0ZA 2QF8A 3JXVA 1WAO1 3D9IA 5FTPA 3FFLA 1Y0OA 3LJ3A 1ZBWA 4MSPA 3ARXA 2LSVA 4HS2A 4BFRA 2J09A 1H0AA 1O6IA 1EDQA 4DPRA 3RO2A 2WPVA 3RFWA 2CFZA 4PS8A 4CRWA 1X5BA 3ZHEB 4BWRA 4BT9A 2PV2A 2FF4A 5JJ7A 3FU6A 1LJYA 4Q7NA 4DRNA 2RG8A 4DRKA 2L6JA 3ZGQA 1D7HA 2YQ8A 2AXUA 1W1YA 3KCEA 4GCNA 1E6NA 1JNSA 3FTVA 4DZ2A 2KCLA 4U85A 1E8YA 3NZSA 3KAGA 4BTBA 3CVYA 3L6AA 3GYZA 3FUJA 4I6GA 3UQAA 4HARA 1FKBA 1NMVA 5DIZA 3TXMA 1TJFA 4GIVA 4XI0A 4HOUA 1IQUA 3G2UA 4MPKA 4Q94A 4LAVA 1E8ZA 2I1JA 3ESLA 2V5FA 3B13A 3QB2A 3U3WA 5EKQD 3FEYA 3I3NA 4GA1A 2MNTA 2YHEA 3CLJA 3PRBA 1GW6A 4GB9A 4ZPTR 5BV0A 1KLXA 3WD2A 1EPUA 3MYVA 1UJJA 2X6FA 4O6FA 3CHCA 2P58C 3RJVA 4ILGA 4GYOA 3Q4AB 3JUIA 2WXKA 3FUMA 4A3TA 4URKA 2UY1B 4FN2A 2WQ7A 1EDUA 2QFCA 1PY1A 3IHYA 5HI7A 5G05J 3FHEA 3ZIMA 1E15A 4U0ZA 4I1MA 5I98A 4HVBA 3ARZA 3CHEA 1HH8A 2WXFA 2RSEA 1TFVA 4MNJA 3CKBA 4IQCA 2DIWA 3U9WA 4AJWA 3MV2B 2ILRA 4CCAA 3QC1A 4PS7A 4DJAA 1LF8A 4N5CA 4A55A 3G2VA 1QNFA 1IQRA 2XRYA 1FKSA 4DWSA 4S3JA 2WVIA 3D9JA 3IK8A 5HT1A 3FY4A 3ARWA 1ZBPA 3S7DA 4J8EA 1FFRA 2AXZA 3RK6A 4TNSA 1HKIA 4APFA 4IT4A 1KT1A 3KAHA 4K03A 3O5IA 1FJDA 1XGWA 3AS5A 3PE4A 3NF1A 5FWQA 2KCKA 3CIAA 3AS4A 4P8WA 4GZ3A 4I6EA 3AU4A 1MQSA 2F4EA 3AS3A 4GPKA 5JHAA 3T5XA 3WL0A 4FLBA 2PL2A 5FJYA 4WKHA 4XE0A 3FUNA 2WXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TC5 A;  2HO1 A;  1QPF A;  2PPN A;  2MF9 A;  5DIV A;  4ODQ A;  1D7J A;  3QWV A;  2LGO A;  3IKG A;  1ZCN A;  2KI3 A;  1R9H A;  1E96 B;  3UUX A;  4UQX A;  2KC7 A;  5D0O D;  4WUY A;  2XEV A;  3CK7 A;  1IYG A;  3KAE A;  3MKR A;  3GZ1 A;  4I2W A;  1IHG A;  1QPL A;  2F2D A;  1FD9 A;  2PZI A;  4U86 A;  5DBK A;  2DG9 A;  1F40 A;  4W9O A;  3SZ7 A;  1ZU2 A;  2DG4 A;  3BEE A;  4KYO B;  4UI9 J;  4G23 A;  5BXJ A;  3PDN A;  4UQZ A;  2KCV A;  1YAT A;  3PRD A;  3ZN3 A;  3VTY A;  3O48 A;  4ITZ A;  3Q47 B;  1ZK6 A;  3TCZ A;  5G05 C;  4HOR A;  3KD7 A;  5EX3 A;  2KFW A;  2K8I A;  2Y4T A;  2ZQS A;  5BW8 C;  5A6C A;  1NSG A;  2BUG A;  3O5M A;  4DRQ A;  1FKJ A;  3K9I A;  4J0U A;  2C2L A;  4H7Y A;  5FZR A;  3FP3 A;  1HZ4 A;  1EYM A;  4KBQ A;  2XPI A;  4G25 A;  1TJC A;  5C1D A;  3NRK A;  3ODK A;  2XP9 A;  3VAW A;  3QOU A;  4G24 A;  2MHK A;  1HXI A;  5ARG A;  3KAI A;  1F8A B;  2L2S A;  4JA7 A;  1NA0 A;  4O2T A;  4TYO A;  1BKF A;  3OOB A;  1NA3 A;  4G2V A;  4U0S A;  4DRJ A;  1FKT A;  1Q6U A;  4U0U A;  3UPV A;  3TDB A;  3IKD A;  4AIF A;  3RIB A;  1T11 A;  4LAW A;  5D75 A;  3S7J A;  4NRH B;  4CDR A;  1J4R A;  3NTP A;  3EDT B;  3QWP A;  3RU0 A;  4JHR A;  4I2Z A;  1A7X A;  4DRI A;  1D6O A;  1YW5 A;  2C0M A;  3LY9 A;  3N71 A;  4NNR A;  4H7X A;  1KT0 A;  3GZ2 A;  2XGM A;  2FEZ A;  5JJT A;  5HQ8 A;  2XP5 A;  4KXK B;  1Q1C A;  5D0Q D;  4JA9 A;  2DG3 A;  4Y6W A;  3I6C A;  4B94 A;  4GYW A;  1Q6H A;  3NI6 A;  4ODK A;  4GZ5 A;  3KAF A;  1NZN A;  4CGW A;  4UQY A;  1P5Q A;  1YA0 A;  2C0L A;  1QZ2 A;  3ULQ A;  2VSY A;  1XNF A;  4IN3 B;  3O5L A;  5DIU A;  3UF8 A;  2ZQT A;  3FAP A;  5KJK A;  5FZQ A;  2XP4 A;  3UI5 A;  5HW8 A;  4AM9 A;  2VGX A;  4DT4 A;  3CV0 A;  3CK8 A;  2YHC A;  5HUA A;  5CCM A;  1N1A A;  4W9R A;  3Q15 A;  2FI7 A;  4QT3 A;  2E2E A;  2R5S A;  4I1A A;  3R9A B;  1Y8M A;  2AVP A;  3ASG A;  4G50 A;  4WNF A;  2RUC A;  2WQH A;  3FWV A;  4DRO A;  5FZS A;  4GA0 A;  4DIP A;  4GA2 A;  4GCO A;  2UZ5 A;  3KAB A;  5HW6 A;  4J4N A;  1W3B A;  3KS2 A;  3Q49 B;  4N39 A;  3O5K A;  2M08 A;  1FKG A;  4GYY A;  2VN1 A;  5KJN A;  4G2P A;  3S7F A;  1FKK A;  4IPX A;  4ME2 A;  2ZQV A;  4ODR A;  2VYI A;  4AY5 A;  2VQ2 A;  4UI9 C;  1WM5 A;  2RUD A;  2F21 A;  2AWG A;  2RUR A;  1J6Y A;  4YVQ C;  2GW1 A;  1HXV A;  4TW6 A;  3ESK A;  2M2A A;  3CKC A;  4DH0 A;  4N19 A;  3PA7 A;  4I9C A;  2M1I A;  3UQI A;  1W26 A;  2KO7 A;  2LKN A;  1J4H A;  3UQB A;  2HYZ A;  4HOT A;  3LYA A;  2XCC A;  1J4I A;  4APO A;  2LPV A;  5CHE E;  1FKF A;  1PIN A;  3UI6 A;  3O5R A;  4DRP A;  2IFU A;  3O5G A;  3GPK A;  1U79 A;  3OXG A;  5A7D B;  4BT8 A;  4EQF A;  2FAP A;  4W9P A;  4ABN A;  3H9R B;  2Y78 A;  4JFM A;  1M5Y A;  4YVO A;  2RUQ A;  4I17 A;  1JVW A;  4BF8 A;  3QWW A;  5BT1 A;  5HKG A;  4N2Q A;  2PPP A;  3JXV A;  4ODO A;  4NQ0 A;  4ODP A;  2PPO A;  3O5O A;  3LUO A;  3CVP A;  1WAO 1;  2ZR6 A;  5HWC A;  5FTP A;  3FFL A;  1Y0O A;  4MSP A;  2LSV A;  4RG6 A;  4GGQ A;  5J6E A;  3QKY A;  3RO2 A;  4G1T A;  4WNG A;  2WPV A;  3UI4 A;  4HOS A;  3RFW A;  4JYS A;  4U07 A;  5BNW A;  5G04 C;  3ZHE B;  4BWR A;  2FKE A;  4BT9 A;  5ARF A;  2PV2 A;  4U84 A;  2FF4 A;  5JJ7 A;  5GPG A;  2HR2 A;  4Y6C A;  3AS8 A;  4DRN A;  4I9E A;  4DRK A;  2L6J A;  4F3V A;  3ZGQ A;  1D7H A;  2Y4U A;  2MLY A;  2YQ8 A;  4JFJ A;  4JFI A;  3KCE A;  2PQR A;  4GCN A;  1JNS A;  4ODL A;  1FKR A;  4DZ3 A;  1C9H A;  3CGN A;  1FCH A;  4DZ2 A;  4N2S A;  4LAX A;  2KCL A;  4U85 A;  3KAG A;  4N3A A;  4W9Q A;  2PQN A;  4BTB A;  3GYZ A;  4DRH A;  2KR7 A;  2KAT A;  1FKH A;  3SF4 A;  3UQA A;  3RGC A;  1FKB A;  4R0X A;  5JJ6 A;  5LCW J;  1NMV A;  3ASF A;  3JYS A;  5DIZ A;  3RO3 A;  3TG5 A;  3U4T A;  3LKU A;  2J9Q A;  2ITK A;  2JLB A;  4FAP A;  2OND A;  4GIV A;  4XI0 A;  4GZ6 A;  3CVN A;  4HOU A;  3O5Q A;  3LCA A;  4DRM A;  4MGV A;  1ROU A;  4TW7 A;  2PBC A;  3KAC A;  4LAV A;  4N3B A;  3JYM A;  2KE0 A;  5B8I C;  5DIT A;  3RKV A;  2OFN A;  5HWB A;  5FT9 A;  3CK9 A;  2V5F A;  5G04 J;  1FAP A;  3U3W A;  1D7I A;  5EKQ D;  2XGO A;  3WXX A;  4GA1 A;  2MNT A;  2OOE A;  3PE3 A;  2FO7 A;  3PRB A;  2PV3 A;  4TW8 A;  1ELW A;  2MLX A;  1KLX A;  3MV3 B;  1PC2 A;  2VGX B;  2PV1 A;  2XGS A;  4JFL A;  2FBN A;  3CEQ A;  4J4O A;  4O6F A;  3RJV A;  2P58 C;  1FKI A;  2VGY A;  4GYO A;  3Q4A B;  3GW4 A;  4J8F A;  2LNI A;  4HOQ A;  4RG9 A;  2Q5A A;  1JNT A;  2ZR4 A;  5KJM A;  4C02 B;  2XP7 A;  3IHZ A;  3WH0 A;  1FKL A;  2UY1 B;  4FN2 A;  1PBK A;  4A1S A;  2QFC A;  3LY7 A;  5HI7 A;  3O5E A;  5G05 J;  4LEU A;  2XPB A;  3MEK A;  2N87 A;  1EQ3 A;  2KGJ A;  2MPH A;  4U0Z A;  5I98 A;  3E4B A;  2DBA A;  1HH8 A;  1ELR A;  3OXL A;  3KZ7 A;  3S7B A;  3KAD A;  5HTG A;  2RSE A;  2VSN A;  4AY6 A;  4BTA A;  4UI9 K;  3CKB A;  4YND A;  3TGO A;  4IQC A;  3MV2 B;  3OXF A;  3B7X A;  2XP6 A;  3O5D A;  1A17 A;  4J8D A;  4N5C A;  3MDY B;  3IEG A;  4CGV A;  1FKS A;  5M72 A;  2I6H A;  2D9F A;  1OUV A;  3IK8 A;  5HT1 A;  3CVQ A;  5KJL A;  1ROT A;  2LSU A;  3LY8 A;  1ZBP A;  5CCL A;  3S7D A;  4J8E A;  5EX0 A;  5HW7 A;  3LPZ A;  4QT2 A;  3O5J A;  2XP8 A;  1TCO C;  3O5P A;  4TNS A;  4N3C A;  4LAY A;  1L1P A;  2IF4 A;  3URZ A;  2MLZ A;  4XI9 A;  2XPA A;  1KT1 A;  4ODN A;  2Q7F A;  1FKD A;  3KAH A;  4WND A;  1Q6I A;  4G26 A;  2NC9 A;  4JL0 A;  3O5F A;  3O5I A;  1FJD A;  3QDN A;  4U04 A;  3TG4 A;  3CGM A;  3JYJ A;  2RQS A;  2ZQU A;  4IQ2 A;  3EY6 A;  3Q5M A;  3AS5 A;  3PE4 A;  3NF1 A;  2KCK A;  3AS4 A;  4GZ3 A;  5AYW D;  3ZFW A;  2UWJ G;  3VTX A;  4TX0 A;  1B89 A;  4WNE A;  3TAX A;  2F4E A;  4GPK A;  4JFK A;  1NMW A;  3MA5 A;  2VCD A;  3ZHE A;  2LJ4 A;  4QIB A;  1BL4 A;  1QQE A;  2UY1 A;  3HYM B;  4XIF A;  4ODM A;  2JZV A;  2XP3 A;  2PL2 A;  5FJY A;  3ASH A;  3CVL A;  3UQ3 A;  2ZR5 A;  5LCW C;  1B6C A;  3ASD A;  3ZPJ A;  2XCB A; 
#chains in the Genus database with same CATH topology
 2HO1 A;  1QPF A;  2MF9 A;  2F0Y A;  4DRX E;  4ODQ A;  4GML A;  3ZUV B;  4U96 D;  2L0T B;  3ULY A;  2KI3 A;  3TWS A;  4U8H A;  1D9S A;  4UQX A;  4BES A;  3I4R B;  2KC7 A;  5C2Y A;  2ZU6 B;  3CK7 A;  1IYG A;  4A3V A;  4BSX A;  1NFI E;  4U86 A;  4J7W A;  3D9K A;  3GU0 A;  3P1U A;  4W9O A;  1ZU2 A;  4KYO B;  3UI2 A;  3FUD A;  3PRD A;  3VTY A;  4ITZ A;  1ZK6 A;  3L54 A;  5G05 C;  1NH6 A;  2KFW A;  2VSX E;  2BED A;  4UWG A;  4EBA A;  5A6C A;  4RVB A;  2HE0 A;  4DRQ A;  2MHK A;  3Q78 A;  4ATG A;  2WK2 A;  4O2T A;  1NA0 A;  4JC8 A;  5CRU A;  4TYO A;  4U0S A;  3EUV A;  4N5Q A;  2WXJ A;  4DRJ A;  4LRZ A;  4U0U A;  4AIF A;  3CHP A;  5D75 A;  3WL1 A;  4AOF A;  4CDR A;  3LEW A;  2XPY A;  1J4R A;  2LUH A;  4HNA D;  3APF A;  4AY1 A;  3HVE A;  2EIJ E;  1BLX B;  1H2V C;  3SY2 A;  3RU0 A;  3RM4 A;  4JHR A;  4I2Z A;  3PZ1 A;  1S0P A;  5JH8 A;  1JWF A;  1N0R A;  1OCC E;  1LQ0 A;  3N71 A;  4TXQ A;  4EZK A;  2HM8 A;  3UX4 A;  2FEZ A;  3B7S A;  3DPY A;  1Q1C A;  1OWP A;  3E32 A;  5FIN A;  4Y6W A;  4GYW A;  3O4Z A;  3NI6 A;  4ODK A;  4NIK A;  5AQ9 A;  2J49 A;  4JPS A;  5HRY A;  3Q7F A;  4CGW A;  3WKZ A;  1YA0 A;  4IN3 B;  3O5L A;  3UM0 A;  5ENS D;  2ZQT A;  1D2K A;  4EPZ A;  4AM9 A;  2YHC A;  5HUA A;  2RFA A;  2E2E A;  1RD6 A;  2A4Z A;  1Y8M A;  3UMV A;  2BKK B;  4GA0 A;  3PUJ A;  1W3B A;  4N39 A;  3O5K A;  2RKK A;  5B1B E;  5GQB A;  3ML9 A;  4IPX A;  3FUI A;  1HKM A;  1H6K A;  1W1T A;  2WB2 A;  4P8X A;  1UW4 B;  1HXV A;  1WG0 A;  3RRU A;  3ESK A;  3CKC A;  4DUI A;  2KO7 A;  2PN0 A;  1J4H A;  2HYZ A;  4HOT A;  1PIN A;  3O5R A;  4Z2I A;  1U79 A;  2MOW A;  4HI8 A;  4L72 B;  4EQF A;  4LSZ E;  1LL7 A;  1ZBV A;  2Y69 E;  2RUQ A;  4I17 A;  1OCO E;  2CHW A;  3QWW A;  3ZU7 B;  2ZGG A;  3HXC A;  3P2B A;  5HKG A;  2WMO A;  1O1T A;  1XHG A;  4NQ0 A;  3BQO A;  4GAA A;  2PPO A;  3CVP A;  4C0M A;  3PZ3 A;  1AWC B;  3E33 A;  3D9O A;  3SGH A;  1H0I A;  3HXF A;  4RG6 A;  1NI1 A;  3QKY A;  5CRV A;  1LG1 A;  5J08 A;  1TN6 A;  4DLO A;  1X6L A;  4C48 B;  4DX1 A;  4A63 B;  4GZC A;  2YIN A;  1GRJ A;  4WKF A;  4U07 A;  3JUE A;  4L9P A;  1FVH A;  4FUL A;  4O1O A;  4Z2L A;  5GPG A;  4Y6C A;  3AS8 A;  4I9E A;  2MLY A;  2XHE A;  2CG2 A;  4I6J A;  2XZD G;  1ZL1 A;  4ODL A;  5JMN D;  1FCH A;  2IO3 C;  4LAX A;  4LG6 A;  4FC8 A;  2AXV A;  3WG7 E;  1MJ0 A;  4W9Q A;  2A3C A;  4DRH A;  1Y6I A;  1JND A;  2KAT A;  1FKH A;  3SF4 A;  3RGC A;  2KBX A;  4DWS C;  2B6C A;  2X6H A;  1S64 A;  3JYS A;  3S2A A;  5ANR A;  3V2O A;  5T3R A;  2R02 A;  3TG5 A;  3U4T A;  2PI6 A;  2J9Q A;  2ITK A;  2JLB A;  4FAP A;  1HF8 A;  3CVN A;  3DBS A;  3LCA A;  4DRM A;  3SFX A;  1HS6 A;  3ARU A;  3KAC A;  3DSV A;  1W9V A;  4BEP A;  3RKV A;  3CK9 A;  2BTD A;  4ZHB A;  3WXX A;  2ZIR A;  3ALF A;  3PE3 A;  2FO7 A;  4TUU A;  4A1G A;  1OGB A;  5KNH D;  3X2Q E;  4XKB A;  1TN8 A;  2VGX B;  1S70 B;  4KZC A;  4OAV B;  2PV1 A;  2XGS A;  4L7T A;  1WAW A;  1BPO A;  3CZ8 A;  2Q5A A;  3WD0 A;  5KJM A;  1HO8 A;  3CVV A;  3IHZ A;  3WH0 A;  1FKL A;  2WXI A;  1ZBC A;  3SI5 A;  3O5E A;  2DT3 A;  3ARY A;  3MEK A;  3PR9 A;  3ARP A;  1EQ3 A;  3UT7 A;  1HJV A;  4ACL A;  4OAU C;  3IXE A;  3Q7A A;  3FH8 A;  2DBA A;  3KZ7 A;  3S7B A;  3KAD A;  3QNK A;  3SD5 A;  2O92 A;  4UI9 K;  3R7Q A;  1HFA A;  2LAH A;  4GMR A;  3OXF A;  1N4R A;  3O5D A;  3L22 A;  2IOS A;  2P2C P;  3IEG A;  4AP2 A;  4CGV A;  3W4R A;  1MX4 A;  4I1O B;  2QY7 A;  5HBF A;  1ROT A;  3LY8 A;  2IUZ A;  1SW6 A;  2P9K G;  3LPZ A;  4QT2 A;  1TNZ A;  3SHF A;  2XP8 A;  3O5P A;  3CHQ A;  2MLZ A;  4XI9 A;  2DSU A;  2I9C A;  4ODN A;  2L0I A;  1UN8 A;  3Q9N C;  4WND A;  5EYP F;  2NC9 A;  4MKT A;  3O5F A;  3FU0 A;  4P8V A;  3CGM A;  3WD1 A;  5BXO A;  3E30 A;  2ZQU A;  3AQU A;  4IQ2 A;  2V8S E;  3Q5M A;  1LD8 A;  3PS6 A;  1OWN A;  2QYJ A;  4ANX A;  2F23 A;  3ZFW A;  2VSO E;  4TX0 A;  1BI7 B;  3U64 A;  3FUE A;  4WNE A;  3RRN B;  3FUF A;  2DYR E;  4QIB A;  2UY1 A;  3HYM B;  2VJ8 A;  3EU5 A;  2DSW A;  3PRE A;  1TYQ G;  1W1V A;  1ZB1 A;  4BSZ B;  2PNN A;  1B6C A;  3LVQ E;  3OA5 A;  3MJW A;  3MZL B;  3QJZ A;  1D7J A;  1N54 A;  1FVF A;  2FO1 E;  3QWV A;  5AQA A;  2LGO A;  3IKG A;  4HFG A;  1ZCN A;  2XEH A;  5FQ4 A;  5BV1 A;  3UUX A;  4TUM A;  3PEU B;  1OCR E;  2A5U A;  4ATZ D;  4FJY A;  3CVW A;  2WXO A;  3KAE A;  4J8S A;  1FD9 A;  4DWS B;  3QAQ A;  1F40 A;  4F1P A;  4Q96 A;  5BXJ A;  1K9T A;  4UWL A;  1WY6 A;  5CER B;  5KCM A;  2KCV A;  2KZT B;  2P4V A;  2WXM A;  3BG1 B;  3KEZ A;  2LXL A;  3SBT B;  4K0R A;  4GTP A;  3JCK C;  4ZFH A;  3I4G A;  4WWN A;  2EUL A;  3KD7 A;  4JZY A;  3V79 K;  3E37 A;  2J4B A;  4FU3 A;  4GTQ A;  2BUG A;  3O5M A;  2KM4 A;  1HE8 A;  2CG3 A;  1N4P A;  3FP3 A;  1HZ4 A;  1IX5 A;  3HIZ A;  3UM3 A;  4E85 A;  5C1D A;  2XP9 A;  3VAW A;  1HXI A;  3ALG A;  4EHM A;  4JA7 A;  3OOB A;  5A23 A;  3SFZ A;  1Q6U A;  3UPV A;  1S63 A;  3CST A;  2CFU A;  3PH0 C;  1T11 A;  5EIB E;  4MBG A;  5CMY A;  1WDY A;  2GGF A;  2P9P G;  3SFY A;  4HRM B;  2X6K A;  3LXU X;  3BG0 B;  3B7U X;  3JQ0 A;  1NWT A;  3LY9 A;  5AJD A;  1BI8 B;  4NNR A;  4H7X A;  5AEN A;  2DSV A;  2JEK A;  1BD8 A;  1KT0 A;  2WXQ A;  3ZRH A;  2WXP A;  2H6G A;  1LG2 A;  4S3K A;  3Q75 A;  4GTS A;  4QZV B;  3KEA A;  5EN5 D;  1H2T C;  3C3O A;  3KAF A;  2LAI A;  2P9I G;  3RRM B;  2C0L A;  1QZ2 A;  3NZU A;  3B9A A;  2VSY A;  3CQC B;  5B1A E;  3TL5 A;  2A3B A;  3ZKJ A;  4URI A;  2F8X K;  4JD2 G;  5AAO A;  1IXV A;  2X6I A;  3ZYK A;  1ZU8 A;  1E90 A;  4C0E A;  5KJK A;  2XP4 A;  1TNB A;  1HJX A;  3CVX A;  3CH9 A;  3Q9U C;  4PUC A;  5T8I A;  4X8Q A;  2Y3A A;  3PNL B;  4QT3 A;  3FUH A;  5KBA A;  4WNF A;  2RUC A;  2WQH A;  1V54 E;  4CDM A;  4GA2 A;  3D9M A;  4DK5 A;  3G6L A;  5ENQ D;  2XS8 A;  4FA6 A;  3DST A;  1DNP A;  1LL4 A;  1UN9 A;  2G41 A;  4GYY A;  2VN1 A;  4XX5 A;  3PRA A;  2OLH A;  4ME2 A;  4TRQ A;  2VQ2 A;  3ASO E;  3ONL A;  3DSX A;  1WM5 A;  4U63 A;  3ML8 A;  2OVF A;  4YVQ C;  2ETC A;  1NWS A;  1YMP A;  1O1R A;  2M2A A;  2DT1 A;  4N19 A;  5GPR A;  4I9C A;  2M1I A;  1W26 A;  2LKN A;  2B31 A;  3TWT A;  1G3N B;  3LYA A;  1E8X A;  3C5R A;  4APO A;  2LPV A;  2X6J A;  2IFU A;  2J4D A;  4HRN A;  1UR9 A;  1M5Y A;  1ELK A;  4TXP A;  3FY1 A;  3FDH A;  4Q22 A;  3D9N A;  4BF8 A;  5BT1 A;  2DT0 A;  1K1B A;  3DSU A;  4N2Q A;  4K5B A;  3DXM G;  3MKQ B;  2PPP A;  4ODO A;  4UDM A;  4ODP A;  2WXR A;  3O5O A;  5KNG A;  2ZR6 A;  4KVO A;  4IT6 A;  5IY5 E;  4FJZ A;  2G8Z A;  4GGQ A;  2R05 A;  3BU8 A;  4G1T A;  4WNG A;  2WLY A;  4HOS A;  1FPP A;  4JVS A;  4PH4 B;  3ZEF A;  2FKE A;  5LX8 A;  5ARF A;  1NP7 A;  4U84 A;  2HR2 A;  1V55 E;  4F3V A;  1SQM A;  4JFI A;  1N95 A;  2E0I A;  4ML4 A;  5FQ7 A;  3CGN A;  4UWF A;  2WM0 A;  3CHM A;  4BER A;  3ZYL A;  3HXD A;  2PQN A;  1WNO A;  1EHN A;  3UKR G;  4GTM A;  2KR7 A;  1MYO A;  3F6Q A;  4U7E B;  2R17 C;  5EIL A;  3Q73 A;  5LCW J;  1E8W A;  4MTV A;  3VLF A;  2AJA A;  4ZPV R;  3RO3 A;  3LKU A;  3APD A;  2OND A;  3BUA A;  1E6P A;  1MHQ A;  1KZP A;  4U8Y D;  3O5Q A;  1D8E A;  3ZXP A;  3D9L A;  5EDS A;  3AAA C;  3WD4 A;  3EHQ A;  4TW7 A;  2PBC A;  1WB0 A;  4N3B A;  1KFW A;  2KE0 A;  5B8I C;  2P9N G;  2OFN A;  2XRZ A;  5G04 J;  3WQW A;  1FAP A;  3TWW A;  3TWQ A;  2XGO A;  2DVW A;  3L13 A;  2OOE A;  3W9F A;  4LCT A;  1ELW A;  1HX8 A;  2OV8 A;  5BPP A;  2V0P A;  5JA4 D;  4JFL A;  3NAW A;  1W9U A;  2YNQ A;  3UIN C;  4G8L A;  3GW4 A;  2LNI A;  3RSE G;  4C02 B;  4Z2J A;  1HU3 A;  1NWU A;  1PBK A;  4WK9 A;  4A1S A;  3LY7 A;  3G6M A;  4GPM A;  3B7B A;  2XPB A;  3C72 A;  3R7R A;  1Z3X A;  3IV0 A;  2KGJ A;  1LD7 A;  4HBO A;  3E4B A;  2L6B A;  3FH5 A;  3CHR A;  1L5J A;  2P9U G;  2VSN A;  3EU9 A;  4BTA A;  4YDW A;  3TGO A;  4O1P A;  4IYP A;  2DZN A;  2RD0 A;  3B7X A;  2CHZ A;  4RSY A;  4B93 B;  4JEU A;  2A5E A;  2WLZ A;  1A17 A;  4J8D A;  2R2L A;  4FHK A;  4KMO A;  4EZJ A;  3VLD A;  2YBU A;  5M72 A;  1OUV A;  4B8A A;  3L9T A;  2IJG X;  3CVQ A;  5KJL A;  3ARS A;  4JB8 P;  1DC2 A;  5CCL A;  2IU1 A;  5EX0 A;  4L3N A;  4DX7 D;  1HKJ A;  1MX2 A;  1TNO A;  4F6R D;  4AV7 A;  4LAY A;  4NZC A;  1L1P A;  2IF4 A;  2NXP A;  5FQ8 A;  4LER A;  3URZ A;  2XPA A;  1E7V A;  3AG4 E;  2MRI A;  1Q6I A;  3QDN A;  4U04 A;  1GPF A;  1N52 A;  4U95 D;  1HKK A;  3MGB A;  3HXB A;  3JXJ A;  4B89 A;  5AYW D;  2OVB A;  2UWJ G;  3VTX A;  3NQP A;  1B89 A;  3TAX A;  1OWM A;  4EBA G;  3MA5 A;  1YCS B;  2F37 A;  3ZHE A;  2LJ4 A;  4CDN A;  1QQE A;  5DEZ A;  3L82 A;  4G8K A;  4XIF A;  2J08 A;  1OGG A;  2H6I A;  2ZXW E;  4CZ2 D;  2JZV A;  4ANU A;  2GRQ B;  1SA4 A;  2EIN E;  4HLE A;  3CVL A;  4GTO A;  3UQ3 A;  3ZXS A;  5LCW C;  4HBE A;  3ASD A;  3ZPJ A;  3T8M A;  3J5Q B;  3PVL A;  4AEZ C;  1SVX A;  2PPN A;  1X6N A;  2RFM A;  1W9P A;  5DIV A;  2GRN B;  2GRL A;  3B9D A;  4WKA A;  1IKN D;  1N11 A;  3D3M A;  1E96 B;  5FQ6 A;  3RM8 A;  2XEV A;  4L1B A;  3L17 A;  4KVM A;  4I2W A;  2F2D A;  3B7R L;  3FH7 A;  2PZI A;  2AWI A;  1OWL A;  2DG9 A;  3OTN A;  4ZPW R;  2DG4 A;  3BEE A;  3HHM A;  4IRU A;  3HDX A;  3CSF A;  4UQZ A;  4WWO A;  3ZN3 A;  3O48 A;  3ULE G;  4FP7 A;  3TCZ A;  1JCS A;  4HOR A;  1DCQ A;  4PS3 A;  2A3E A;  2Y4T A;  3PEV B;  2ESC A;  5B3S E;  1SZ9 A;  5ITZ F;  2XEN A;  1XRV A;  2J07 A;  5E76 A;  4BY6 A;  1FKJ A;  4JHK A;  5LOZ A;  1EYM A;  4KBQ A;  2XPI A;  3FXY A;  3QOU A;  2VTB A;  1E6R A;  1YYH A;  5T4Y A;  3KAI A;  2WXG A;  3RAU A;  3FUK A;  4DX5 D;  3V31 A;  1BKF A;  4NSB A;  4NAC A;  3ZVV A;  1SR0 A;  3ART A;  5HS0 A;  3TDB A;  3LS8 A;  3AJI A;  3RIB A;  4LAW A;  4OVV A;  1JWG A;  1JUQ A;  4NRH B;  4GTR A;  3EHM A;  4JXT A;  4KZ0 A;  4OVU A;  4ACK A;  3EDT B;  2FDM A;  3AS0 A;  1A7X A;  4DRI A;  1YW5 A;  3B9E A;  4GTV A;  5ENP D;  4I43 A;  5E75 A;  2DCP A;  2XZT G;  3FTX A;  5BXU A;  3GZ2 A;  2XGM A;  5JJT A;  5HQ8 A;  2XP5 A;  1NL4 A;  5AAR A;  2A3A A;  2DG3 A;  4MAV A;  2H6F A;  3IKO B;  1U3C A;  4GZ5 A;  2DPE A;  1P5Q A;  2ZGD A;  2KZT A;  3ULQ A;  3SO8 A;  1XNF A;  5G2N A;  2B0O E;  2QZA A;  1DCE A;  3GZS A;  2H6H A;  2DZO A;  2DSZ A;  4CYM D;  5DIU A;  1JCR A;  3UF8 A;  2AOS A;  5FZQ A;  3UI5 A;  3G2T A;  2VGX A;  1OWO A;  4DT4 A;  2DWZ A;  5CCM A;  3DRA A;  4CT4 A;  5D2M C;  4L2Y A;  2I2O A;  3R9A B;  2FUL A;  3V30 A;  2AVP A;  2L9B A;  4G50 A;  4YDY A;  1UR8 A;  4DRO A;  4DIP A;  3TJP A;  3AS1 A;  3KAB A;  2UZ5 A;  3DSS A;  2XS1 A;  3IHV A;  3KS2 A;  3Q49 B;  4LUN U;  3WD3 A;  1MZC A;  2DT2 A;  4NUR A;  1FKG A;  1NWR A;  5KJN A;  3CHS A;  3TWR A;  4G2P A;  4ODR A;  4AY5 A;  4UI9 C;  2F21 A;  4F53 A;  2ETA A;  2EQX A;  3FTW A;  2R03 A;  1ZBK A;  4MNM A;  5LFA A;  4DLQ A;  5J90 A;  2BKG A;  4ILH B;  2XCC A;  3BXW A;  1J4I A;  5CHE E;  1FKF A;  3EIP A;  3AS2 A;  3QOK A;  4FHJ A;  3O5G A;  2J8S D;  3WQV A;  3GPK A;  1EF1 C;  4BT8 A;  2FAP A;  4ANV A;  4ABN A;  4Z68 A;  3I5P A;  4YVO A;  3OAW A;  1JVW A;  4DI3 A;  1UJK A;  3ARQ A;  1EYH A;  5ENO D;  4MRU A;  4BX9 A;  4Z2K A;  3CVU A;  3LUO A;  2GRM A;  4GZD A;  1OY3 D;  1Z3Y A;  5HWC A;  1LL6 A;  5J6E A;  4LNU D;  3TWV A;  1H0G A;  3ZYQ A;  1Z6T A;  4HXI A;  4P29 A;  4R7L A;  5G55 A;  5BUZ A;  3UI4 A;  3DXK G;  4JYS A;  5BNW A;  2IEJ A;  5G04 C;  1TNY A;  4HLL A;  2PM6 A;  1SYT A;  3UT8 A;  2Y4U A;  4JFJ A;  2LO6 A;  2PQR A;  1TNU A;  4P8U A;  1HG2 A;  1FKR A;  4DZ3 A;  1C9H A;  1X81 A;  2NYJ A;  1H6P A;  4JHJ A;  1H6O A;  2WQ6 A;  4E6H A;  4N2S A;  3ARO A;  4MNL A;  1E9L A;  4KR0 B;  3T9K A;  4N3A A;  3EHN A;  4BET A;  4QQI A;  3ISM C;  3PZ2 A;  3G2W A;  3QK0 A;  4MNK A;  2CHX A;  4R0X A;  5JJ6 A;  3APC A;  3ASF A;  1N9A A;  5EYL A;  3ZW3 A;  1ITX A;  1E6Z A;  1U3D A;  3ABK E;  4PDX A;  4GZ6 A;  2ION A;  2WXH A;  4F7A A;  3CHD A;  4MGV A;  1ROU A;  4DX2 A;  3MKQ A;  2ETN A;  3PNT B;  3JYM A;  5DIT A;  3EIJ A;  4AVX A;  1EIB A;  5HWB A;  5FT9 A;  3L08 A;  4DWS D;  4EEC A;  1UG3 A;  1D7I A;  2V5Q C;  1VDY A;  1JCH B;  4KT6 B;  2PV3 A;  4TW8 A;  4V3I A;  1K3Z D;  1VF8 A;  4GTT A;  2MLX A;  3KSQ A;  3MV3 B;  3TWU A;  1PC2 A;  1IHB A;  2FBN A;  3CEQ A;  4J4O A;  1FKI A;  4L2L A;  4M7C A;  2VGY A;  4J8F A;  4RG9 A;  4HOQ A;  1JNT A;  2ZR4 A;  3RME A;  2XP7 A;  4QFV A;  3SBS A;  4FLH A;  4F1S A;  2XPZ A;  3FEX A;  4TXR A;  1N94 A;  1W1P A;  1PAQ A;  4EZL A;  3RM9 A;  3EIQ C;  4MLP A;  4PTM A;  1QBQ A;  4LEU A;  3D9P A;  3CHF A;  1LTX A;  2N87 A;  3W9G A;  2MPH A;  4IUL A;  2WMN A;  4ZS6 A;  1TEZ A;  1ELR A;  3OXL A;  3TXN A;  2ETB A;  5HTG A;  3L16 A;  4AY6 A;  4YND A;  5DO2 A;  4OYS A;  2IQC A;  2I1K A;  4R5E A;  3UXG A;  2XP6 A;  2Y0B G;  5AIJ A;  5CMW A;  3B7T A;  3MDY B;  1GUV A;  5AN8 A;  1E7U A;  2I6H A;  2D9F A;  4Z2H A;  3EJN A;  2P9S G;  3FU5 A;  3U66 A;  2LSU A;  5D66 A;  3BMB A;  3AU5 A;  5HW7 A;  3V2X A;  3O5J A;  4LGX A;  1TCO C;  4GMJ A;  4N3C A;  2Q7F A;  1FKD A;  4G26 A;  1FT2 A;  4JL0 A;  1OWQ A;  3JYJ A;  3TG4 A;  1H2U A;  3DSW A;  2RQS A;  3EY6 A;  2GRP B;  4UUC A;  4W5U A;  2OEV A;  4RLY A;  4JFK A;  1NMW A;  2VCD A;  3KSL A;  4FAD A;  1BL4 A;  4ODM A;  2XP3 A;  5DF0 A;  3ASH A;  4MS6 A;  4WAF A;  2V4L A;  2ZR5 A;  1SZA A;  2AW6 A;  4Q69 A;  4AXH A;  2KXP C;  2XCB A;  3HVE B;  5JHB A;  3FTY A;  3ZYM A;  1A5E A;  3TC5 A;  3HXE A;  4UWH A;  1Q2Z A;  1HG5 A;  3B8S A;  5ENR D;  2R59 A;  3JQ1 A;  2LXM A;  1R9H A;  3ONK A;  2IOL A;  4WWP A;  2WXN A;  2WM9 A;  3DWL G;  5D0O D;  1Z5S C;  4WUY A;  3MKR A;  3GZ1 A;  1IHG A;  1QPL A;  4LNB A;  3FTS A;  4J6I A;  4L23 A;  5DBK A;  3T8K A;  4K5A B;  3SZ7 A;  3FTZ A;  3JXI A;  4UI9 J;  4G23 A;  2XQ0 A;  3PDN A;  3ASN E;  1YAT A;  2DYS E;  5CBN A;  3Q47 B;  3E34 A;  5AJL A;  4HI9 A;  5EX3 A;  2K8I A;  4UWK A;  5FIO A;  1OXJ A;  4TV3 A;  2ZQS A;  5BW8 C;  2X3M A;  1NSG A;  4ILI A;  3K9I A;  4J0U A;  2C2L A;  3LDZ A;  4H7Y A;  5FZR A;  3NRK A;  4XAK A;  1H19 A;  1FT1 A;  4G25 A;  1TJC A;  3ODK A;  5KWD A;  4M3O A;  1FFQ A;  4G24 A;  2X38 A;  3R9M A;  5ARG A;  1F8A B;  2L2S A;  1N4Q A;  3PRZ A;  3QAR A;  1NA3 A;  3IBE A;  2NSZ A;  4G2V A;  1JPL A;  3GTY X;  1FKT A;  2M63 A;  3G2S A;  3IKD A;  3UIO C;  3S7J A;  5CED B;  1TR4 A;  4CEM A;  2MYO A;  1QYM A;  1U2V G;  3C3R A;  3NTP A;  2QC9 A;  1K1A A;  3QWP A;  1OCZ E;  3MX3 A;  3PZ4 A;  1D6O A;  2C0M A;  4WIW A;  5ANL A;  4Z2G A;  2YBT A;  3LVR E;  3PZD A;  3WIJ A;  3VLE A;  1RW2 A;  2P9L G;  3J5P A;  2IY0 C;  5EID A;  4HB5 A;  4KXK B;  5D0Q D;  4JA9 A;  1GOI A;  3CQG B;  4J8Y A;  3I6C A;  4B94 A;  4O60 A;  3ARR A;  1INZ A;  3ENE A;  1Q6H A;  3AG2 E;  1NZN A;  2BF0 X;  4C9B B;  3FU3 A;  4UQY A;  4JW1 A;  3MCX A;  3UT4 A;  3T5V A;  4JEH A;  4G11 A;  3ARV A;  3FAP A;  5HW8 A;  3AG1 E;  4HRL A;  3FTU A;  4HBD A;  4XKC A;  4GU5 A;  3CV0 A;  3NOG D;  3CK8 A;  1AP7 A;  1N1A A;  4W9R A;  3Q15 A;  3B95 A;  4ANW A;  2FI7 A;  2R5S A;  4I1A A;  2B5U B;  3ASG A;  3CHO A;  4WJX A;  4BX8 A;  1JNE A;  2VTB B;  3FWV A;  5FZS A;  4B8C B;  2JAB A;  4GCO A;  5HW6 A;  4J4N A;  4DI4 A;  2M08 A;  1OT8 A;  3FUL A;  3AG3 E;  3SNX A;  1HJW A;  3DPD A;  2GRO B;  2OCC E;  2O9O A;  3S7F A;  1FKK A;  2ZQV A;  2VYI A;  1N4S A;  2RUD A;  2RUR A;  2AWG A;  5LP0 A;  1J6Y A;  2GW1 A;  4TW6 A;  3CGH A;  1KZO A;  5ENN A;  4DH0 A;  2XEE A;  3CR3 A;  2PM7 A;  3PA7 A;  3UQI A;  1ZB5 A;  3PUK A;  4CT0 A;  4D10 C;  3UQB A;  4YDE A;  5CEC B;  3UI6 A;  3NB2 A;  4DRP A;  3C98 A;  3OXG A;  5A7D B;  4KQZ A;  4W9P A;  3H9R B;  4JFM A;  2Y78 A;  1DVP A;  3HG0 D;  4XZ4 A;  3DEO A;  1CTN A;  4B0Z A;  2QF8 A;  3JXV A;  1WAO 1;  2GRR B;  4HQD A;  3D9I A;  5FTP A;  5ENT D;  3FFL A;  1Y0O A;  3LJ3 A;  1ZBW A;  4MSP A;  3DEP A;  2LSV A;  4HS2 A;  4U8V D;  3ARX A;  5AQ7 A;  4BFR A;  2J09 A;  1H0A A;  1O6I A;  1EDQ A;  4DPR A;  3RO2 A;  1O1S A;  5CEA A;  2WPV A;  1E44 A;  3RFW A;  2CFZ A;  4RQI A;  3UM1 A;  3ABL E;  4PS8 A;  4CRW A;  1X5B A;  1K8K G;  4LNG A;  2ZIS A;  3ZHE B;  4BWR A;  4BT9 A;  2PV2 A;  4XEI G;  2FF4 A;  5JJ7 A;  3FU6 A;  1LJY A;  4Q7N A;  4DRN A;  2RG8 A;  3D9H A;  4DRK A;  2L6J A;  3ZGQ A;  1D7H A;  2YQ8 A;  1MX6 A;  2AXU A;  1W1Y A;  4GCN A;  3KCE A;  1E6N A;  1JNS A;  5CBO A;  3FTV A;  4DZ2 A;  2V4H C;  2KCL A;  4U85 A;  1E8Y A;  3NZS A;  3KAG A;  4BTB A;  3CVY A;  3L6A A;  3GYZ A;  3FUJ A;  4I6G A;  3UQA A;  4HAR A;  1FKB A;  2OEW A;  2QYU A;  5AQB A;  1NMV A;  5DIZ A;  3TXM A;  1TJF A;  5HKP A;  4GIV A;  4XI0 A;  4HOU A;  2EIL E;  1UOH A;  2EIK E;  1IQU A;  1O5M A;  3G2U A;  4MPK A;  4Q94 A;  4LAV A;  1E8Z A;  2I1J A;  3ESL A;  2V5F A;  3B13 A;  1N0Q A;  3QB2 A;  3U3W A;  4YDO A;  5EKQ D;  3FEY A;  3I3N A;  4GA1 A;  2MNT A;  3NBN B;  2YHE A;  3CLJ A;  3PRB A;  1GW6 A;  4GB9 A;  4ZPT R;  2IO2 C;  5BV0 A;  1KLX A;  3WD2 A;  1EPU A;  3MYV A;  1UJJ A;  3UIP C;  2X6F A;  4O6F A;  3CHC A;  2P58 C;  3RJV A;  3UKU G;  4ILG A;  4GYO A;  3Q4A B;  3JUI A;  2WXK A;  1RZ4 A;  3FUM A;  4K5C A;  4A3T A;  4URK A;  2UY1 B;  4FN2 A;  2WQ7 A;  1EDU A;  2QFC A;  1SA5 A;  1PY1 A;  3Q79 A;  3IHY A;  3C3Q A;  5HI7 A;  5G05 J;  3FHE A;  3ZIM A;  5H7P A;  1E15 A;  4U0Z A;  4I1M A;  5I98 A;  4HVB A;  3ARZ A;  3CHE A;  1HH8 A;  2WXF A;  3UM2 A;  2Y1L E;  3UTM A;  1TFV A;  2RSE A;  4MNJ A;  1KPS B;  3CKB A;  4IQC A;  2DIW A;  2EIM E;  4AJW A;  3U9W A;  3MV2 B;  2ILR A;  4CCA A;  3QC1 A;  4PS7 A;  4DJA A;  1LF8 A;  4N5C A;  4A55 A;  3G2V A;  1QNF A;  1IQR A;  2XRY A;  1FKS A;  4DWS A;  4S3J A;  2WVI A;  3D9J A;  3IK8 A;  5HT1 A;  3EHR A;  3FY4 A;  3ARW A;  3SQV A;  1ZBP A;  3ABM E;  3S7D A;  4J8E A;  1FFR A;  2AXZ A;  3RK6 A;  1JCQ A;  4TNS A;  1HKI A;  4APF A;  4DX6 D;  1KT1 A;  4IT4 A;  3KAH A;  3NOC D;  4K03 A;  3O5I A;  1FJD A;  1XGW A;  3AS5 A;  3PE4 A;  3NF1 A;  3TWX A;  5FWQ A;  2VGE A;  1D8D A;  2KCK A;  3AS4 A;  3CIA A;  4P8W A;  4GZ3 A;  4I6E A;  3AU4 A;  1MQS A;  2F4E A;  3AS3 A;  4GPK A;  5JHA A;  3HRA A;  1BU9 A;  3T5X A;  3LJN A;  2F8Y A;  3WL0 A;  4FLB A;  2PL2 A;  5FJY A;  4WKH A;  1TN7 A;  4XE0 A;  3FUN A;  3ZNG A;  2WXL A; 
#chains in the Genus database with same CATH homology
 2HO1 A;  1QPF A;  2MF9 A;  4ODQ A;  4GML A;  2L0T B;  2KI3 A;  4U8H A;  4UQX A;  3I4R B;  2KC7 A;  5C2Y A;  2ZU6 B;  3CK7 A;  1IYG A;  4A3V A;  4BSX A;  4U86 A;  3D9K A;  3P1U A;  4W9O A;  1ZU2 A;  4KYO B;  3FUD A;  3PRD A;  3VTY A;  4ITZ A;  1ZK6 A;  3L54 A;  5G05 C;  1NH6 A;  2KFW A;  2VSX E;  4UWG A;  4EBA A;  5A6C A;  4RVB A;  4DRQ A;  2MHK A;  4ATG A;  2WK2 A;  4O2T A;  1NA0 A;  4JC8 A;  4TYO A;  4U0S A;  4DRJ A;  2WXJ A;  4LRZ A;  4U0U A;  4AIF A;  3CHP A;  5D75 A;  3WL1 A;  4AOF A;  4CDR A;  3LEW A;  2XPY A;  1J4R A;  3APF A;  4AY1 A;  3HVE A;  1H2V C;  3RU0 A;  3RM4 A;  4JHR A;  4I2Z A;  1S0P A;  5JH8 A;  1JWF A;  1LQ0 A;  3N71 A;  2HM8 A;  4EZK A;  3UX4 A;  2FEZ A;  3B7S A;  1Q1C A;  1OWP A;  4Y6W A;  4GYW A;  3O4Z A;  3NI6 A;  4ODK A;  2J49 A;  4JPS A;  4CGW A;  3WKZ A;  1YA0 A;  4IN3 B;  3O5L A;  2ZQT A;  1D2K A;  4EPZ A;  4AM9 A;  2YHC A;  5HUA A;  2E2E A;  1RD6 A;  2A4Z A;  1Y8M A;  3UMV A;  4GA0 A;  3PUJ A;  1W3B A;  4N39 A;  3O5K A;  5GQB A;  3ML9 A;  4IPX A;  1HKM A;  3FUI A;  1H6K A;  1W1T A;  2WB2 A;  4P8X A;  1UW4 B;  1HXV A;  3RRU A;  3ESK A;  3CKC A;  2KO7 A;  1J4H A;  2HYZ A;  4HOT A;  1PIN A;  3O5R A;  4Z2I A;  1U79 A;  2MOW A;  4L72 B;  4EQF A;  1LL7 A;  1ZBV A;  2RUQ A;  4I17 A;  2CHW A;  3QWW A;  3P2B A;  5HKG A;  2WMO A;  1XHG A;  4NQ0 A;  4GAA A;  2PPO A;  3CVP A;  4C0M A;  3D9O A;  3SGH A;  1H0I A;  4RG6 A;  3QKY A;  1LG1 A;  5J08 A;  4DLO A;  1X6L A;  4GZC A;  2YIN A;  4WKF A;  4U07 A;  1FVH A;  4FUL A;  4Z2L A;  5GPG A;  4Y6C A;  3AS8 A;  4I9E A;  2MLY A;  2XHE A;  2CG2 A;  4I6J A;  1ZL1 A;  4ODL A;  1FCH A;  4LAX A;  4FC8 A;  2AXV A;  4W9Q A;  2A3C A;  4DRH A;  1Y6I A;  1JND A;  2KAT A;  1FKH A;  3SF4 A;  3RGC A;  4DWS C;  2X6H A;  3JYS A;  3S2A A;  5ANR A;  5T3R A;  3TG5 A;  3U4T A;  2PI6 A;  2J9Q A;  2ITK A;  2JLB A;  4FAP A;  1HF8 A;  3CVN A;  3DBS A;  3LCA A;  4DRM A;  1HS6 A;  3ARU A;  3KAC A;  1W9V A;  3RKV A;  3CK9 A;  2BTD A;  3WXX A;  3ALF A;  3PE3 A;  2FO7 A;  4TUU A;  4A1G A;  1OGB A;  4XKB A;  2VGX B;  4KZC A;  2PV1 A;  2XGS A;  4L7T A;  1WAW A;  1BPO A;  3CZ8 A;  2Q5A A;  3WD0 A;  5KJM A;  1HO8 A;  3CVV A;  3IHZ A;  3WH0 A;  1FKL A;  2WXI A;  1ZBC A;  3SI5 A;  3O5E A;  2DT3 A;  3ARY A;  3MEK A;  3PR9 A;  3ARP A;  1EQ3 A;  3UT7 A;  1HJV A;  4ACL A;  3FH8 A;  2DBA A;  3KZ7 A;  3S7B A;  3KAD A;  3QNK A;  3SD5 A;  2O92 A;  4UI9 K;  3R7Q A;  1HFA A;  2LAH A;  3OXF A;  3O5D A;  3L22 A;  2IOS A;  3IEG A;  4AP2 A;  4CGV A;  3W4R A;  4I1O B;  2QY7 A;  5HBF A;  1ROT A;  3LY8 A;  2IUZ A;  3LPZ A;  4QT2 A;  3SHF A;  2XP8 A;  3O5P A;  3CHQ A;  2MLZ A;  4XI9 A;  2DSU A;  2I9C A;  4ODN A;  2L0I A;  1UN8 A;  4WND A;  2NC9 A;  4MKT A;  3O5F A;  3FU0 A;  4P8V A;  3CGM A;  3WD1 A;  2ZQU A;  3AQU A;  4IQ2 A;  2V8S E;  3Q5M A;  3PS6 A;  1OWN A;  4ANX A;  3ZFW A;  2VSO E;  4TX0 A;  3U64 A;  3FUE A;  4WNE A;  3RRN B;  3FUF A;  4QIB A;  2UY1 A;  3HYM B;  2VJ8 A;  2DSW A;  3PRE A;  1W1V A;  1B6C A;  3LVQ E;  3OA5 A;  3MJW A;  3MZL B;  3QJZ A;  1D7J A;  1N54 A;  1FVF A;  3QWV A;  2LGO A;  3IKG A;  4HFG A;  1ZCN A;  5FQ4 A;  5BV1 A;  3UUX A;  3PEU B;  2A5U A;  4FJY A;  3CVW A;  2WXO A;  3KAE A;  4J8S A;  1FD9 A;  4DWS B;  3QAQ A;  1F40 A;  4Q96 A;  5BXJ A;  1K9T A;  4UWL A;  1WY6 A;  5KCM A;  2KCV A;  2KZT B;  2WXM A;  3BG1 B;  3KEZ A;  3SBT B;  4K0R A;  3JCK C;  3I4G A;  4WWN A;  3KD7 A;  4JZY A;  2J4B A;  4FU3 A;  2BUG A;  3O5M A;  2KM4 A;  1HE8 A;  2CG3 A;  3FP3 A;  1HZ4 A;  1IX5 A;  3HIZ A;  5C1D A;  4E85 A;  2XP9 A;  3VAW A;  1HXI A;  3ALG A;  4JA7 A;  3OOB A;  5A23 A;  3SFZ A;  1Q6U A;  3UPV A;  3CST A;  2CFU A;  3PH0 C;  1T11 A;  5CMY A;  2GGF A;  2X6K A;  3LXU X;  3BG0 B;  3B7U X;  3JQ0 A;  1NWT A;  3LY9 A;  5AJD A;  4NNR A;  4H7X A;  5AEN A;  2DSV A;  2JEK A;  1KT0 A;  2WXQ A;  3ZRH A;  2WXP A;  1LG2 A;  4S3K A;  4QZV B;  1H2T C;  3KAF A;  2LAI A;  3RRM B;  2C0L A;  1QZ2 A;  3NZU A;  3B9A A;  2VSY A;  3CQC B;  3TL5 A;  2A3B A;  4URI A;  2X6I A;  3ZYK A;  1ZU8 A;  1E90 A;  4C0E A;  5KJK A;  2XP4 A;  1HJX A;  3CVX A;  3CH9 A;  4PUC A;  5T8I A;  2Y3A A;  3PNL B;  4QT3 A;  3FUH A;  4WNF A;  2RUC A;  2WQH A;  4CDM A;  4GA2 A;  3D9M A;  4DK5 A;  3G6L A;  4FA6 A;  1LL4 A;  1DNP A;  1UN9 A;  2G41 A;  4GYY A;  2VN1 A;  4XX5 A;  3PRA A;  2OLH A;  4ME2 A;  4TRQ A;  2VQ2 A;  3ONL A;  4U63 A;  1WM5 A;  3ML8 A;  2OVF A;  4YVQ C;  1NWS A;  2M2A A;  2DT1 A;  4N19 A;  5GPR A;  4I9C A;  2M1I A;  1W26 A;  2LKN A;  2B31 A;  3LYA A;  1E8X A;  4APO A;  2LPV A;  2X6J A;  2IFU A;  2J4D A;  1UR9 A;  1M5Y A;  1ELK A;  3FY1 A;  3FDH A;  4Q22 A;  3D9N A;  4BF8 A;  5BT1 A;  2DT0 A;  4N2Q A;  2PPP A;  3MKQ B;  4ODO A;  4ODP A;  2WXR A;  3O5O A;  2ZR6 A;  4KVO A;  4IT6 A;  4FJZ A;  2G8Z A;  4GGQ A;  4G1T A;  4WNG A;  2WLY A;  4HOS A;  4JVS A;  4PH4 B;  3ZEF A;  2FKE A;  5LX8 A;  5ARF A;  1NP7 A;  4U84 A;  2HR2 A;  4F3V A;  1SQM A;  4JFI A;  2E0I A;  4ML4 A;  5FQ7 A;  3CGN A;  4UWF A;  2WM0 A;  3CHM A;  3ZYL A;  2PQN A;  1WNO A;  1EHN A;  2KR7 A;  2R17 C;  5LCW J;  1E8W A;  4MTV A;  3VLF A;  4ZPV R;  3RO3 A;  3LKU A;  3APD A;  2OND A;  1E6P A;  1MHQ A;  3O5Q A;  3D9L A;  5EDS A;  3WD4 A;  4TW7 A;  2PBC A;  1WB0 A;  4N3B A;  1KFW A;  2KE0 A;  5B8I C;  2OFN A;  2XRZ A;  5G04 J;  3WQW A;  1FAP A;  2XGO A;  3L13 A;  2OOE A;  4LCT A;  1ELW A;  1HX8 A;  2OV8 A;  5BPP A;  2V0P A;  4JFL A;  1W9U A;  2YNQ A;  3GW4 A;  2LNI A;  4C02 B;  4Z2J A;  1HU3 A;  1NWU A;  1PBK A;  4WK9 A;  4A1S A;  3LY7 A;  3G6M A;  2XPB A;  3R7R A;  1Z3X A;  3IV0 A;  2KGJ A;  4HBO A;  3E4B A;  3FH5 A;  3CHR A;  1L5J A;  2VSN A;  4BTA A;  3TGO A;  4IYP A;  2RD0 A;  3B7X A;  2CHZ A;  4RSY A;  4JEU A;  2WLZ A;  1A17 A;  4J8D A;  4FHK A;  4KMO A;  4EZJ A;  3VLD A;  2YBU A;  5M72 A;  1OUV A;  4B8A A;  2IJG X;  3CVQ A;  5KJL A;  3ARS A;  5CCL A;  2IU1 A;  5EX0 A;  4L3N A;  1HKJ A;  4AV7 A;  4LAY A;  4NZC A;  1L1P A;  2IF4 A;  2NXP A;  5FQ8 A;  4LER A;  3URZ A;  2XPA A;  1E7V A;  2MRI A;  1Q6I A;  3QDN A;  4U04 A;  1GPF A;  1N52 A;  1HKK A;  3MGB A;  4B89 A;  5AYW D;  2OVB A;  2UWJ G;  3VTX A;  3NQP A;  1B89 A;  3TAX A;  1OWM A;  4EBA G;  3MA5 A;  3ZHE A;  2LJ4 A;  5DEZ A;  4CDN A;  1QQE A;  4XIF A;  2J08 A;  1OGG A;  2JZV A;  4ANU A;  4HLE A;  3CVL A;  3UQ3 A;  3ZXS A;  5LCW C;  4HBE A;  3ASD A;  3ZPJ A;  3T8M A;  3PVL A;  4AEZ C;  2PPN A;  1X6N A;  1W9P A;  5DIV A;  2GRL A;  3B9D A;  4WKA A;  3D3M A;  1E96 B;  5FQ6 A;  3RM8 A;  2XEV A;  4L1B A;  3L17 A;  4KVM A;  4I2W A;  2F2D A;  3B7R L;  3FH7 A;  2PZI A;  2AWI A;  1OWL A;  2DG9 A;  3OTN A;  4ZPW R;  2DG4 A;  3BEE A;  3HHM A;  4IRU A;  3HDX A;  3CSF A;  4UQZ A;  4WWO A;  3ZN3 A;  3O48 A;  4FP7 A;  3TCZ A;  4HOR A;  4PS3 A;  2A3E A;  2Y4T A;  3PEV B;  2ESC A;  1SZ9 A;  1XRV A;  2J07 A;  5E76 A;  4BY6 A;  1FKJ A;  4JHK A;  5LOZ A;  1EYM A;  4KBQ A;  2XPI A;  3FXY A;  3QOU A;  2VTB A;  1E6R A;  5T4Y A;  3KAI A;  2WXG A;  3FUK A;  4NSB A;  1BKF A;  4NAC A;  3ZVV A;  1SR0 A;  3ART A;  3TDB A;  3LS8 A;  3RIB A;  4LAW A;  4OVV A;  1JWG A;  1JUQ A;  4NRH B;  3EHM A;  4JXT A;  4KZ0 A;  4OVU A;  4ACK A;  3EDT B;  2FDM A;  3AS0 A;  1A7X A;  4DRI A;  1YW5 A;  3B9E A;  4I43 A;  5E75 A;  2DCP A;  3FTX A;  3GZ2 A;  2XGM A;  5JJT A;  5HQ8 A;  2XP5 A;  2A3A A;  2DG3 A;  4MAV A;  3IKO B;  1U3C A;  4GZ5 A;  2DPE A;  1P5Q A;  3ULQ A;  2KZT A;  1XNF A;  5G2N A;  2DSZ A;  3GZS A;  5DIU A;  3UF8 A;  2AOS A;  5FZQ A;  3UI5 A;  3G2T A;  2VGX A;  1OWO A;  4DT4 A;  5CCM A;  4CT4 A;  4L2Y A;  2I2O A;  3R9A B;  2FUL A;  2AVP A;  2L9B A;  4G50 A;  1UR8 A;  4DRO A;  4DIP A;  3TJP A;  3AS1 A;  3KAB A;  2UZ5 A;  3IHV A;  3KS2 A;  3Q49 B;  4LUN U;  3WD3 A;  2DT2 A;  4NUR A;  1FKG A;  1NWR A;  5KJN A;  3CHS A;  4G2P A;  4ODR A;  4AY5 A;  4UI9 C;  2F21 A;  4F53 A;  2EQX A;  3FTW A;  1ZBK A;  4MNM A;  5LFA A;  4DLQ A;  5J90 A;  4ILH B;  2XCC A;  3BXW A;  1J4I A;  5CHE E;  1FKF A;  3AS2 A;  3QOK A;  4FHJ A;  3O5G A;  3WQV A;  3GPK A;  1EF1 C;  4BT8 A;  2FAP A;  4ANV A;  4ABN A;  3I5P A;  4YVO A;  3OAW A;  1JVW A;  4DI3 A;  1UJK A;  3ARQ A;  1EYH A;  4BX9 A;  4MRU A;  4Z2K A;  3CVU A;  3LUO A;  2GRM A;  4GZD A;  1Z3Y A;  5HWC A;  1LL6 A;  5J6E A;  1H0G A;  3ZYQ A;  1Z6T A;  4HXI A;  4P29 A;  4R7L A;  5G55 A;  5BUZ A;  3UI4 A;  4JYS A;  5BNW A;  5G04 C;  2PM6 A;  1SYT A;  3UT8 A;  2Y4U A;  4JFJ A;  2LO6 A;  2PQR A;  4P8U A;  1HG2 A;  1FKR A;  4DZ3 A;  1C9H A;  4JHJ A;  2WQ6 A;  4E6H A;  4N2S A;  3ARO A;  4MNL A;  1E9L A;  4KR0 B;  4N3A A;  3EHN A;  3G2W A;  3QK0 A;  4MNK A;  2CHX A;  4R0X A;  5JJ6 A;  3APC A;  3ASF A;  3ZW3 A;  1ITX A;  1E6Z A;  1U3D A;  4PDX A;  4GZ6 A;  2ION A;  2WXH A;  4F7A A;  3CHD A;  4MGV A;  1ROU A;  3MKQ A;  3PNT B;  3JYM A;  5DIT A;  3EIJ A;  4AVX A;  1EIB A;  5HWB A;  5FT9 A;  3L08 A;  4DWS D;  4EEC A;  1UG3 A;  1D7I A;  1VDY A;  4KT6 B;  2PV3 A;  4TW8 A;  4V3I A;  1VF8 A;  2MLX A;  3MV3 B;  1PC2 A;  2FBN A;  3CEQ A;  4J4O A;  1FKI A;  4L2L A;  2VGY A;  4J8F A;  4RG9 A;  4HOQ A;  1JNT A;  2ZR4 A;  3RME A;  2XP7 A;  4QFV A;  3SBS A;  4FLH A;  4F1S A;  2XPZ A;  3FEX A;  1W1P A;  1PAQ A;  4EZL A;  3RM9 A;  3EIQ C;  4MLP A;  4PTM A;  4LEU A;  3D9P A;  3CHF A;  2N87 A;  2MPH A;  4IUL A;  2WMN A;  4ZS6 A;  1TEZ A;  1ELR A;  3OXL A;  3TXN A;  5HTG A;  3L16 A;  4AY6 A;  4YND A;  5DO2 A;  4OYS A;  2IQC A;  2I1K A;  4R5E A;  2XP6 A;  5AIJ A;  5CMW A;  3B7T A;  3MDY B;  1GUV A;  1E7U A;  2I6H A;  2D9F A;  4Z2H A;  3EJN A;  3FU5 A;  3U66 A;  2LSU A;  3AU5 A;  5HW7 A;  3O5J A;  4LGX A;  1TCO C;  4GMJ A;  4N3C A;  2Q7F A;  1FKD A;  4G26 A;  4JL0 A;  1OWQ A;  3JYJ A;  3TG4 A;  1H2U A;  2RQS A;  3EY6 A;  4W5U A;  4JFK A;  1NMW A;  2VCD A;  4FAD A;  1BL4 A;  4ODM A;  2XP3 A;  5DF0 A;  3ASH A;  4MS6 A;  4WAF A;  2V4L A;  2ZR5 A;  1SZA A;  2AW6 A;  4Q69 A;  4AXH A;  2XCB A;  3HVE B;  5JHB A;  3FTY A;  3ZYM A;  3TC5 A;  4UWH A;  1HG5 A;  3B8S A;  2R59 A;  3JQ1 A;  1R9H A;  3ONK A;  2IOL A;  4WWP A;  2WXN A;  2WM9 A;  5D0O D;  4WUY A;  3MKR A;  3GZ1 A;  1IHG A;  1QPL A;  3FTS A;  4J6I A;  4L23 A;  5DBK A;  3SZ7 A;  3FTZ A;  4UI9 J;  4G23 A;  2XQ0 A;  3PDN A;  1YAT A;  3Q47 B;  5AJL A;  5EX3 A;  2K8I A;  4UWK A;  4TV3 A;  2ZQS A;  5BW8 C;  2X3M A;  1NSG A;  4ILI A;  3K9I A;  4J0U A;  2C2L A;  3LDZ A;  4H7Y A;  4XAK A;  5FZR A;  3NRK A;  1H19 A;  4G25 A;  1TJC A;  3ODK A;  4M3O A;  1FFQ A;  4G24 A;  2X38 A;  5ARG A;  1F8A B;  2L2S A;  3PRZ A;  3QAR A;  1NA3 A;  3IBE A;  2NSZ A;  4G2V A;  1JPL A;  1FKT A;  2M63 A;  3G2S A;  3IKD A;  3S7J A;  4CEM A;  3NTP A;  3QWP A;  3MX3 A;  1D6O A;  2C0M A;  4WIW A;  5ANL A;  4Z2G A;  2YBT A;  3LVR E;  3PZD A;  3WIJ A;  3VLE A;  4KXK B;  5D0Q D;  4JA9 A;  1GOI A;  3CQG B;  3I6C A;  4B94 A;  3ARR A;  1INZ A;  3ENE A;  1Q6H A;  1NZN A;  2BF0 X;  4C9B B;  3FU3 A;  4UQY A;  4JW1 A;  3MCX A;  3UT4 A;  3T5V A;  4JEH A;  4G11 A;  3ARV A;  3FAP A;  5HW8 A;  3FTU A;  4XKC A;  4GU5 A;  3CV0 A;  3CK8 A;  1N1A A;  4W9R A;  3Q15 A;  4ANW A;  2FI7 A;  2R5S A;  4I1A A;  3ASG A;  3CHO A;  4WJX A;  4BX8 A;  1JNE A;  2VTB B;  3FWV A;  5FZS A;  4B8C B;  4GCO A;  5HW6 A;  4J4N A;  4DI4 A;  2M08 A;  3FUL A;  3SNX A;  1HJW A;  3DPD A;  2O9O A;  3S7F A;  1FKK A;  2ZQV A;  2VYI A;  2RUD A;  2RUR A;  2AWG A;  5LP0 A;  1J6Y A;  2GW1 A;  4TW6 A;  3CGH A;  5ENN A;  4DH0 A;  3CR3 A;  2PM7 A;  3PA7 A;  3UQI A;  1ZB5 A;  3PUK A;  4CT0 A;  4D10 C;  3UQB A;  3UI6 A;  4DRP A;  3C98 A;  3OXG A;  5A7D B;  4KQZ A;  4W9P A;  3H9R B;  4JFM A;  2Y78 A;  1DVP A;  4XZ4 A;  1CTN A;  4B0Z A;  2QF8 A;  3JXV A;  1WAO 1;  3D9I A;  5FTP A;  3FFL A;  1Y0O A;  3LJ3 A;  1ZBW A;  4MSP A;  3ARX A;  2LSV A;  4HS2 A;  4BFR A;  2J09 A;  1H0A A;  1O6I A;  1EDQ A;  4DPR A;  3RO2 A;  2WPV A;  3RFW A;  2CFZ A;  4PS8 A;  4CRW A;  1X5B A;  3ZHE B;  4BWR A;  4BT9 A;  2PV2 A;  2FF4 A;  5JJ7 A;  3FU6 A;  1LJY A;  4Q7N A;  4DRN A;  2RG8 A;  4DRK A;  2L6J A;  3ZGQ A;  1D7H A;  2YQ8 A;  2AXU A;  1W1Y A;  3KCE A;  4GCN A;  1E6N A;  1JNS A;  3FTV A;  4DZ2 A;  2KCL A;  4U85 A;  1E8Y A;  3NZS A;  3KAG A;  4BTB A;  3CVY A;  3L6A A;  3GYZ A;  3FUJ A;  4I6G A;  3UQA A;  4HAR A;  1FKB A;  1NMV A;  5DIZ A;  3TXM A;  1TJF A;  4GIV A;  4XI0 A;  4HOU A;  1IQU A;  3G2U A;  4MPK A;  4Q94 A;  4LAV A;  1E8Z A;  2I1J A;  3ESL A;  2V5F A;  3B13 A;  3QB2 A;  3U3W A;  5EKQ D;  3FEY A;  3I3N A;  4GA1 A;  2MNT A;  2YHE A;  3CLJ A;  3PRB A;  1GW6 A;  4GB9 A;  4ZPT R;  5BV0 A;  1KLX A;  3WD2 A;  1EPU A;  3MYV A;  1UJJ A;  2X6F A;  4O6F A;  3CHC A;  2P58 C;  3RJV A;  4ILG A;  4GYO A;  3Q4A B;  3JUI A;  2WXK A;  3FUM A;  4A3T A;  4URK A;  2UY1 B;  4FN2 A;  2WQ7 A;  1EDU A;  2QFC A;  1PY1 A;  3IHY A;  5HI7 A;  5G05 J;  3FHE A;  3ZIM A;  1E15 A;  4U0Z A;  4I1M A;  5I98 A;  4HVB A;  3ARZ A;  3CHE A;  1HH8 A;  2WXF A;  2RSE A;  1TFV A;  4MNJ A;  3CKB A;  4IQC A;  2DIW A;  3U9W A;  4AJW A;  3MV2 B;  2ILR A;  4CCA A;  3QC1 A;  4PS7 A;  4DJA A;  1LF8 A;  4N5C A;  4A55 A;  3G2V A;  1QNF A;  1IQR A;  2XRY A;  1FKS A;  4DWS A;  4S3J A;  2WVI A;  3D9J A;  3IK8 A;  5HT1 A;  3FY4 A;  3ARW A;  1ZBP A;  3S7D A;  4J8E A;  1FFR A;  2AXZ A;  3RK6 A;  4TNS A;  1HKI A;  4APF A;  4IT4 A;  1KT1 A;  3KAH A;  4K03 A;  3O5I A;  1FJD A;  1XGW A;  3AS5 A;  3PE4 A;  3NF1 A;  5FWQ A;  2KCK A;  3CIA A;  3AS4 A;  4P8W A;  4GZ3 A;  4I6E A;  3AU4 A;  1MQS A;  2F4E A;  3AS3 A;  4GPK A;  5JHA A;  3T5X A;  3WL0 A;  4FLB A;  2PL2 A;  5FJY A;  4WKH A;  4XE0 A;  3FUN A;  2WXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...