2IF4A

Crystal structure of a multi-domain immunophilin from arabidopsis thaliana
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
258
structure length
258
Chain Sequence
NVPPKVDSEAEVLDEKVSKQIIKEGHGSKPSKYSTCFLHYRAWTKNSQHKFEDTWHEQQPIELVLGKEKKELAGLAIGVASMKSGERALVHVGWELAYGKEGNFSFPNVPPMADLLYEVEVIGFDETKEGKARSDMTVEERIGAADRRKMDGNSLFKEEKLEEAMQQYEMAIAYMGDDFMFQLYGKYQDMALAVKNPCHLNIAACLIKLKRYDEAIGHCNIVLTEEEKNPKALFRRGKAKAELGQMDSARDDFRKAQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords ATFKBP42
publication title Crystal Structure of a Multi-domain Immunophilin from Arabidopsis thaliana: A Paradigm for Regulation of Plant ABC Transporters.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 70
structure length 258
sequence length 258
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2if4A02
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2if4A01
4UI9J 1NMVA 4KXKB 1J6YA 2WQHA 1JNTA 2MNTA 3KAGA 3UQBA 5M72A 3KAFA 2VYIA 4BTAA 1HH8A 4UQXA 4LAXA 3NI6A 4FAPA 2YHCA 5JJ6A 1FKKA 3KACA 1FKBA 4U04A 3Q49B 4JFIA 1JNSA 1J4IA 2HR2A 4DRNA 4ODMA 4N3AA 3PE4A 3S7JA 3TAXA 3QOUA 3PRDA 1E96B 3S7FA 1A17A 4LAVA 2HO1A 2PBCA 1IHGA 4DZ2A 1QPLA 2KE0A 3KADA 4I2ZA 4J8FA 4ODNA 5BT1A 2XP7A 3QKYA 5JJTA 5HW7A 5G04C 4GYYA 3ZPJA 1J4HA 1TCOC 2PPPA 4LAWA 1PBKA 4JFLA 2KCLA 2RUCA 2Q7FA 5FZRA 3UUXA 1FKFA 3FWVA 3O5EA 4IQ2A 2VSYA 5FT9A 3OOBA 2ZQSA 3ASFA 4ABNA 2KR7A 4O6FA 3WH0A 2XCBA 1ELWA 5GPGA 2FKEA 1D7IA 3KAIA 5HI7A 3O5IA 1FKDA 2XP3A 3TG4A 1NA3A 2XGSA 5G04J 1YA0A 3PDNA 1F8AB 4XI0A 5FTPA 5CCLA 3Q15A 3TGOA 1KLXA 4GZ6A 2C0LA 3QWVA 2XP6A 3CGMA 4N2SA 5KJLA 5HT1A 2F4EA 3MV2B 1Y8MA 3CVNA 4TNSA 2LJ4A 1Q6HA 4ODLA 3FFLA 2LSVA 3VAWA 2KO7A 4BT9A 4XIFA 1HZ4A 2WPVA 2ZR5A 3I6CA 4GIVA 1OUVA 4LEUA 1XNFA 3CKCA 1R9HA 3MEKA 4YVOA 4DRMA 3SZ7A 2Y78A 5DIVA 3GZ2A 3RIBA 4IN3B 3ZFWA 4N3BA 2AWGA 3CVQA 2FF4A 1QPFA 3O5PA 5B8IC 3ODKA 3RFWA 1ROUA 5AYWD 2LNIA 4N5CA 2OOEA 5DBKA 4EQFA 4CGVA 2JZVA 1QQEA 1FKRA 4DIPA 1Q6UA 4N3CA 4W9RA 3CEQA 4BTBA 4JFKA 5CCMA 2MLZA 3RKVA 4N39A 4CGWA 4CDRA 4U0UA 4ITZA 4W9OA 3JXVA 5BXJA 3AS4A 3AS5A 3Q47B 5KJKA 1FKGA 3RO2A 4GGQA 4YNDA 2XGOA 3UI4A 5HTGA 1FKHA 2Y4TA 2LKNA 4GA1A 4DH0A 4N2QA 2PPNA 3LPZA 3URZA 4G24A 3ULQA 3IEGA 3OXFA 5DITA 5HWBA 4ODOA 4QIBA 1BKFA 3TDBA 3HYMB 4BF8A 3KABA 2XGMA 4ODRA 1YATA 5BNWA 3N71A 4G2PA 3JYJA 1P5QA 2D9FA 2DG9A 2MLYA 4I2WA 2YQ8A 1FCHA 3PRBA 2NC9A 1B89A 1WAO1 2M2AA 4HOUA 3O5JA 2FI7A 3O5GA 2UY1B 3VTYA 4FN2A 3E4BA 2IF4A 2C2LA 3GW4A 1J4RA 1PC2A 4NRHB 4I9EA 1W26A 5D75A 1ZBPA 4BT8A 4HORA 4ODQA 3TC5A 5BW8C 4TW8A 4DROA 3EY6A 2XP5A 3KAEA 1NZNA 4J0UA 2DBAA 4DT4A 3LKUA 3GPKA 4ME2A 2RSEA 2RUDA 3B7XA 3ZN3A 2M1IA 1ZCNA 2F2DA 1D7HA 4GCNA 2F21A 3IK8A 2L2SA 3KCEA 3O5RA 1KT0A 2UWJG 2N87A 2RURA 4C02B 4W9QA 4GZ3A 2PPOA 3UI6A 5EX0A 2VSNA 1A7XA 3FAPA 3GYZA 5ARGA 5C1DA 4J8DA 3Q4AB 2DG3A 2FBNA 1FD9A 4APOA 3LY7A 4O2TA 2VGYA 4JA7A 2C0MA 4B94A 4JL0A 2ZQTA 1N1AA 3ZHEB 3O5FA 2M08A 1TJCA 2K8IA 4DZ3A 4U07A 1KT1A 5HUAA 4AY5A 3ESKA 3S7BA 2Q5AA 3LUOA 4DRKA 2KC7A 3U3WA 3MA5A 4AY6A 5HW8A 3KS2A 2LPVA 3ASGA 4JFMA 4G26A 4KBQA 4BWRA 1ZK6A 5G05C 4HOTA 4GPKA 2IFUA 2XPIA 5EX3A 5J6EA 3O5KA 3JYMA 4MSPA 2FEZA 1ELRA 3RGCA 4I17A 3TG5A 3MKRA 4H7XA 4F3VA 1IYGA 3QWWA 2GW1A 4A1SA 5A7DB 3UF8A 3H9RB 1FKJA 1M5YA 2VGXA 4ODPA 2UY1A 5G05J 4JYSA 4WNFA 2KCKA 1ROTA 3UQ3A 3UQAA 4TW6A 2LSUA 4UI9C 3ASDA 3KZ7A 2XP8A 2PZIA 5LCWC 4JFJA 1NA0A 3LY8A 4I1AA 5CHEE 4UQYA 5EKQD 2UZ5A 4GYWA 4G1TA 5ARFA 4MGVA 3RU0A 3ZGQA 4W9PA 2PQRA 3OXLA 5HWCA 2KI3A 4U85A 3CK9A 2MF9A 2VQ2A 3QDNA 5FZSA 2PV3A 4R0XA 4QT3A 3IKDA 1QZ2A 3LCAA 4TX0A 3AS8A 1EQ3A 5LCWJ 3O5OA 3RJVA 4YVQC 3O5MA 1EYMA 4GCOA 2VGXB 4WNEA 3RO3A 1T11A 3WXXA 4KYOB 4ODKA 2XP4A 2KATA 1NMWA 2MHKA 5HKGA 3O48A 4J8EA 3PA7A 2P58C 4GA2A 4NQ0A 1Y0OA 3CVPA 3ZHEA 1FAPA 4LAYA 3NF1A 3CV0A 4G2VA 3LYAA 3UPVA 4DRHA 4J4NA 2PL2A 3K9IA 2PQNA 2KGJA 1HXIA 2XCCA 1B6CA 4DRJA 1W3BA 3IHZA 4G25A 2FO7A 4GA0A 2ITKA 3QWPA 4U0ZA 4XI9A 3Q5MA 3TCZA 1Q1CA 2E2EA 3MDYB 5FZQA 4N19A 4HOQA 2I6HA 5HW6A 3KAHA 2JLBA 2MPHA 3FP3A 3LY9A 4AIFA 3UI5A 2ZQVA 4IPXA 1WM5A 4IQCA 3CK8A 1FKSA 2KFWA 2XP9A 2PV2A 4NNRA 3OXGA 4U84A 3MV3B 3U4TA 3CGNA 4RG6A 1FKTA 3R9AB 4RG9A 3CK7A 5D0QD 5HQ8A 5KJNA 2RQSA 4GYOA 1NSGA 1C9HA 1Q6IA 2ZR4A 1FKLA 2ZQUA 2AVPA 4WUYA 4G23A 4DRQA 3SF4A 5JJ7A 3CVLA 3O5LA 1YW5A 4QT2A 2FAPA 4UQZA 4WNGA 2PV1A 2HYZA 4JA9A 4AM9A 2RUQA 2DG4A 2V5FA 4I9CA 2BUGA 2ONDA 3EDTB 4UI9K 3BEEA 4Y6CA 1D7JA 1BL4A 5KJMA 1D6OA 2XPAA 5A6CA 1FKIA 3JYSA 2XEVA 1FJDA 1L1PA 3GZ1A 2R5SA 3ASHA 1HXVA 2KCVA 5DIZA 2MLXA 4J4OA 5I98A 1F40A 1ZU2A 3IKGA 4DRPA 2L6JA 3O5QA 2LGOA 1U79A 2QFCA 4Y6WA 2ZR6A 4TW7A 4U86A 3UQIA 4H7YA 2J9QA 4U0SA 5D0OD 2VN1A 1JVWA 3KD7A 5DIUA 3S7DA 4JHRA 4TYOA 4HOSA 2OFNA 3NTPA 3PE3A 2XPBA 4G50A 3CKBA 4GZ5A 3VTXA 1PINA 3O5DA 5FJYA 4WNDA 2Y4UA 2VCDA 3NRKA 4DRIA
chains in the Genus database with same CATH superfamily
5ENPD 4XE0A 3V2OA 4IYPA 4C9BB 3NB2A 4UQXA 3L6AA 4FAPA 4L23A 1FKBA 3GU0A 4D10C 4JFIA 3I5PA 5J08A 2DZOA 4C0EA 3TWTA 4ZPWR 4N3AA 4FHKA 2ETNA 1E96B 5AQBA 2HO1A 3L82A 4DZ2A 2EIME 3KADA 1UOHA 3ARSA 5CRUA 3AAAC 4GYYA 3RSEG 3DWLG 1UW4B 4LAWA 3B7RL 4YDEA 2DSVA 2Q7FA 4P29A 1FKFA 4IQ2A 2VSYA 4IT6A 3WH0A 2PM6A 1S63A 4EPZA 3O5IA 1WNOA 1JCHB 5G04J 5JA4D 3APDA 4P8XA 3WG7E 4JHJA 4XI0A 4OVUA 5FTPA 2ETAA 3Q15A 4ZPTR 2M63A 5JH8A 2X6HA 3IV0A 2XP6A 4PUCA 3MX3A 5CRVA 4N2SA 3ZXPA 1INZA 1D9SA 1IKND 1Y8MA 1SR0A 2LJ4A 4ODLA 5T8IA 4HRNA 3I6CA 3FUHA 1IQUA 1K8KG 3CKCA 3PUKA 1R9HA 2VJ8A 1OWLA 3QJZA 4IN3B 1UR8A 4JXTA 4N3BA 3PR9A 4LRZA 4MRUA 3C98A 1QPFA 3O5PA 3SBSA 3ODKA 5G55A 3ZKJA 3RFWA 4U96D 1ROUA 4MPKA 1UJJA 3PRZA 5LX8A 3RM4A 5B3SE 4N5CA 4EQFA 4CGVA 1QQEA 4GMJA 1MQSA 1Q6UA 3WIJA 4N3CA 2WMNA 1OCZE 4ZPVR 4ILIA 3RKVA 4CGWA 4CDRA 3B13A 1HJXA 5BXUA 2A3EA 3HG0D 3JXVA 2E0IA 5GPRA 3Q79A 4ZS6A 2H6GA 3RO2A 1V55E 3VLFA 5KWDA 5HTGA 2LKNA 4GA1A 2YNQA 4B8AA 1RZ4A 3LPZA 2IU1A 2PPNA 4Q7NA 2WK2A 5KCMA 5ITZF 3G2TA 2X38A 4KQZA 1N4SA 4NSBA 3PEUB 2V5QC 2XEEA 4HRMB 5HWBA 4GMLA 4CT0A 3TDBA 2WXKA 3HYMB 4CT4A 2FDMA 2DT3A 4ODRA 3WD4A 3B95A 5EDSA 2DG9A 3FTZA 1LL7A 4PDXA 3FTWA 3IKOB 3IHVA 1W1PA 2UY1B 4DI3A 4A3VA 3SHFA 3CLJA 1E6ZA 1W26A 3FUFA 3SI5A 1N0RA 2Y69E 1VF8A 3RRNB 4FC8A 4O1OA 2A3AA 4U63A 1NZNA 4BSXA 2XQ0A 3EU9A 3GPKA 3B7TA 5AAOA 2RSEA 3B7XA 3MJWA 4GTSA 4EBAG 3KCEA 2WM9A 2R17C 4GZ3A 3TWUA 1O6IA 3FUJA 3RMEA 2EIKE 4EZJA 1NH6A 4DWSC 3R9MA 1YMPA 4O2TA 1O1RA 1JUQA 3G2SA 3QC1A 2PM7A 2RFAA 4JA7A 2PI6A 4WJXA 4JL0A 5CEAA 1Z3XA 1MZCA 3O5FA 2M08A 2K8IA 4FLHA 5EIDA 4FA6A 1ZB5A 4IRUA 3SNXA 2KC7A 5EYPF 4KVOA 1D2KA 3ZRHA 2LPVA 3ASGA 1LQ0A 4J8YA 4JFMA 4G26A 4KBQA 4UWLA 4BWRA 5G05C 1H2TC 2J09A 3AG3E 2IFUA 1FT2A 5J6EA 2A3BA 2KZTA 2FEZA 4M3OA 1SZAA 3RGCA 4DWSB 4U8VD 2WXLA 1IYGA 3QWWA 2CHWA 2GW1A 3ARUA 5A7DB 3UF8A 3H9RB 2DT1A 1W1TA 1N4PA 1NWTA 1ROTA 4LUNU 2VTBA 4LGXA 2R05A 3ASDA 2X6JA 1NA0A 2L6BA 4I1AA 4HQDA 2EINE 5EKQD 1EHNA 4G1TA 2PNNA 1E15A 4MGVA 4Z2IA 2GGFA 4W9PA 1EIBA 5HWCA 4U85A 1GUVA 2VQ2A 3UKRG 3IKDA 2XZTG 3CSFA 3DBSA 3LCAA 4F1PA 4I6JA 4Z2GA 5AN8A 5AQ7A 3RRMB 3NZUA 3L54A 2R03A 1T11A 3UTMA 4F1SA 4DJAA 4K5AB 4LCTA 3SQVA 3ARPA 1YYHA 3PA7A 2P58C 4GA2A 4DK5A 1FAPA 5ENRD 3B9AA 2RKKA 4A1GA 4G2VA 1EPUA 1ZBKA 3WQVA 1SW6A 5D66A 2PQNA 1B6CA 2FO7A 4GA0A 2ITKA 2DWZA 4U0ZA 4XI9A 3ONLA 3W9GA 4AEZC 5FZQA 1E8WA 3AS2A 2G8ZA 4HOQA 1UN9A 4MNJA 3ZVVA 1ZBVA 4JEHA 1H6KA 3FU3A 1HKJA 2QC9A 3CK8A 2FULA 1EYHA 1FKSA 4XX5A 2XP9A 3HXDA 2PV2A 5E76A 1N0QA 3MV3B 2WXJA 3U4TA 2CG2A 3V31A 3ZXSA 3KSQA 5AIJA 4RG6A 3R9AB 4RG9A 3G2UA 5D0QD 5KJNA 4GYOA 1Q6IA 2ZR4A 2ZQUA 3SF4A 3ALFA 3CVLA 4GTRA 2MOWA 3FUMA 4UQZA 3I4RB 2BF0X 2HYZA 4JA9A 4HFGA 2RUQA 2DG4A 2V5FA 2ONDA 3BEEA 1BL4A 1HJVA 3UMVA 3SY2A 2P9LG 5A6CA 4AP2A 4HLEA 4BERA 3TWRA 2WB2A 2R5SA 3ASHA 3SFXA 5CBOA 4WIWA 3DSUA 1HXVA 5DIZA 4HB5A 3FTYA 5FQ7A 5I98A 3X2QE 2L6JA 3O5QA 5EILA 4U86A 4TUMA 2J9QA 3PNTB 5D0OD 2VN1A 1O1TA 3KD7A 2XS8A 2A3CA 4JHRA 1HS6A 4HOSA 3EHQA 1OGGA 1DNPA 4I1MA 3O5DA 5FJYA 4BX8A 3PH0C 4CYMD 5CMYA 4BEPA 2WQHA 1X5BA 4BX9A 5M72A 3KAFA 2VYIA 4HS2A 3NI6A 5JJ6A 3V30A 3NBNB 1FKKA 3KACA 4DX5D 1W9VA 1IHBA 4U04A 1H19A 3TWWA 4XZ4A 5ENQD 1JNSA 5D2MC 2HR2A 1VDYA 1OCRE 4ODMA 3MYVA 4CRWA 3S7JA 3APCA 3C5RA 3S7FA 1YCSB 3KEZA 1A17A 2QZAA 4JPSA 5B1BE 1QPLA 3W4RA 4MNMA 3CHQA 5BT1A 3HVEA 2XP7A 5HW7A 3ZPJA 1L5JA 2PPPA 2IOLA 2KCLA 2RUCA 3UI2A 3C72A 4CZ2D 4FJYA 3UXGA 5GPGA 2IONA 4L2YA 2FKEA 1D7IA 1RD6A 2WXPA 2RD0A 3TG4A 4XKCA 2L0TB 4DPRA 5T3RA 2XGSA 1BU9A 1F8AB 4ILGA 3TXMA 3CHSA 1JCQA 3FUIA 2P9SG 3TGOA 1LG2A 1E7VA 2C0LA 3CGMA 4I43A 5HT1A 2GRQB 1ZBWA 3MGBA 5FWQA 3B7UX 3CVNA 1Q6HA 4JB8P 1TN8A 2LSVA 3ARYA 3J5QB 2KO7A 4MTVA 4BT9A 1HZ4A 1ITXA 4DX7D 4GIVA 2XRYA 4JEUA 4LEUA 2LXLA 1NWUA 1XNFA 4HVBA 4RLYA 3MEKA 2DYRE 1IQRA 2QY7A 4YVOA 3D9MA 3GZ2A 4J8SA 3FEYA 3ZFWA 4V3IA 1D8DA 2AXVA 2RFMA 3CVQA 2J08A 4Q22A 3D3MA 2F23A 2J4DA 1OY3D 5FQ4A 3WL1A 1OCCE 2LXMA 1FT1A 1N95A 2OOEA 2WXHA 4A63B 2VGEA 4BTBA 4JFKA 2MLZA 3Q9UC 2DSUA 4FP7A 2LAIA 3ULYA 2P9PG 3CGHA 2Y0BG 4W9OA 2V8SE 3CQCB 3JCKC 1OXJA 1FKGA 1EDUA 2P9NG 4GGQA 2XGOA 3ALGA 4FULA 2WXGA 3FTUA 1W9UA 2B6CA 3URZA 4ZFHA 4DRXE 4KZCA 3CR3A 3IEGA 5DITA 4BF8A 1K3ZD 2XGMA 4WKAA 3PZDA 3WKZA 3PRBA 4IULA 3U64A 4O1PA 4DLQA 3HXFA 3O5GA 2WQ7A 4TXPA 4FN2A 2YBTA 3VLEA 1FFRA 3E4BA 2BTDA 4ANWA 1J4RA 4GPMA 3DSWA 4KR0B 3EJNA 2MYOA 4I9EA 4MS6A 1ZBPA 4HORA 1HJWA 4ODQA 5BW8C 4DROA 1NFIE 2WM0A 3L17A 3S2AA 3CVVA 5FINA 3KAEA 3CH9A 3D9NA 2BKGA 2OLHA 5LP0A 4E6HA 2F2DA 1TNYA 2L2SA 1KT0A 2UWJG 3ARZA 2XPYA 1A7XA 3GYZA 4J8DA 3Q4AB 2DG3A 2FBNA 1TYQG 3JQ1A 4LNUD 2A4ZA 4KT6B 4OAUC 1N1AA 3UKUG 5FQ6A 3RK6A 2P9KG 3B7SA 1LJYA 5KBAA 3B9DA 3RM8A 4HBDA 3ESKA 2Q5AA 3B8SA 3CHOA 4DRKA 3U3WA 1WG0A 1OWPA 3MA5A 1N52A 3WD1A 4DWSD 4B8CB 4GPKA 2QF8A 1K1BA 4LNBA 2XPIA 3JQ0A 3JYMA 1OWOA 3AG4E 2B5UB 4I17A 4H7XA 3ARQA 2DCPA 1O5MA 3L13A 3AQUA 3JXJA 3L16A 4ODPA 2ZGDA 5G05J 1XHGA 2KCKA 4PS3A 1NL4A 3CHDA 2ETCA 4URKA 4TW6A 3CHMA 4L1BA 5LCWC 1SQMA 3FUNA 3WD0A 2X6FA 1Z3YA 5EIBE 4U8YD 2UZ5A 3B9EA 3CVUA 5ARFA 3PZ2A 2ETBA 3RU0A 5ANRA 3OXLA 4C0MA 3NZSA 2MF9A 3FTSA 4QT3A 3FTVA 4TX0A 5AQAA 2EIJE 1FFQA 3DRAA 4M7CA 1EYMA 4Q69A 1X81A 1LL4A 3QARA 4ODKA 2MHKA 3O48A 3T8KA 2WLYA 4JW1A 4NQ0A 1Y0OA 4XEIG 4EZLA 3ASNE 3CVPA 3Q7FA 4I6GA 3NF1A 3CV0A 3ZHEA 1UR9A 3AROA 2PL2A 4B0ZA 3AG2E 4GTMA 4QFVA 2P2CP 3PNLB 4G25A 5G2NA 2VSXE 2R02A 3TCZA 1H6PA 2E2EA 1ZBCA 4N19A 5EYLA 3CVWA 4ILHB 4MAVA 5GQBA 3G6MA 5C2YA 4FLBA 3PS6A 3UI5A 4L3NA 1WM5A 3CHFA 3RAUA 4ATGA 1N9AA 2KFWA 3CHRA 2GRRB 3B7BA 3AG1E 4K5CA 4ANVA 4X8QA 1C9HA 4Z2JA 3E30A 1FKLA 2AVPA 5AJLA 2ZISA 4C48B 1S64A 4S3KA 1KPSB 4F53A 1YW5A 5FQ8A 1IXVA 2R2LA 2GROB 3EDTB 1OWQA 3C3OA 3ML8A 2Y1LE 2XPAA 4WKFA 4HBEA 1TN7A 3MZLB 1L1PA 5ANLA 4DX2A 1BI8B 2MLXA 1E7UA 1AWCB 4J4OA 3EHRA 1X6NA 4KZ0A 1GW6A 3TJPA 1ZU2A 3D9KA 1O1SA 5HKPA 1FVHA 1U79A 4Q94A 2ZR6A 3UQIA 1HX8A 1LL6A 5AENA 4WK9A 3ZUVB 3HXBA 4U0SA 4UWFA 1JVWA 2NYJA 1ZB1A 4F7AA 4Z2KA 2OEVA 2EILE 4G50A 3R7RA 3CKBA 2J4BA 3QK0A 1PINA 4OYSA 4NIKA 4ANUA 4WNDA 4FADA 3V79K 2VCDA 4UI9J 1NMVA 4L9PA 5BUZA 2V4HC 1JNTA 2MNTA 3JXIA 3KAGA 1KFWA 3UQBA 4BTAA 3ABLE 1E6NA 4CEMA 3UM2A 4Z68A 1E44A 1JWGA 2H6FA 1MYOA 4WWNA 2F0YA 2OVBA 3PE4A 3QOUA 1HE8A 1ZL1A 2PBCA 1TNUA 4OAVB 3V2XA 5AARA 4ODNA 1SVXA 1Q2ZA 3WQWA 2P9IG 3HXCA 1ZU8A 3DSTA 1TCOC 3UX4A 3SBTB 4GAAA 3UUXA 3O5EA 3OOBA 2ZQSA 3ASFA 4ABNA 4O6FA 2F8XK 2XCBA 3MKQB 3KAIA 2OV8A 2LO6A 4BETA 3ZYQA 1YA0A 1LG1A 4GZ6A 3QWVA 1N94A 2F4EA 3MV2B 4UDMA 3PEVB 3FFLA 3UIOC 2WLZA 1PY1A 3BXWA 3FXYA 4HBOA 4AJWA 1MHQA 3QOKA 1BLXB 2J49A 1MJ0A 3SZ7A 3RIBA 2AWGA 2OCCE 1H2VC 4HARA 3D9JA 3DPYA 2FF4A 2V0PA 4BSZB 5B8IC 1D8EA 3DXKG 3P1UA 2GRPB 3FUDA 3FUKA 3SD5A 1W9PA 3BQOA 4W9RA 3CEQA 5CCMA 5CERB 3NOGD 3ABME 2H6HA 4N39A 2DVWA 4U0UA 2I2OA 4ITZA 5T4YA 5BXJA 2ZIRA 3AS4A 3AS5A 4HNAD 3Q47B 4ACKA 2B0OE 5KJKA 1FVFA 1H0AA 4YNDA 1UJKA 3UI4A 1FKHA 2P9UG 4AXHA 4MNLA 4DH0A 4Q96A 4ZHBA 3BUAA 1NI1A 2EULA 4LSZE 4G24A 5HS0A 2QYUA 3P2BA 2IUZA 4ODOA 4J7WA 3ZNGA 4QIBA 1BKFA 4WAFA 3IBEA 2KZTB 3BG0B 1MX2A 4TXRA 3N71A 4G2PA 3JYJA 2D9FA 3W9FA 3LEWA 4I2WA 1FCHA 5KNGA 4CCAA 1B89A 2M2AA 3AS1A 2FI7A 4DI4A 5LOZA 5DO2A 3NOCD 4ML4A 2C2LA 3TWQA 1PC2A 3CHEA 4NRHB 5D75A 2GRLA 4P8UA 4BT8A 5BXOA 3D9OA 2CHXA 3TC5A 4TW8A 1JPLA 1U2VG 2DIWA 3EY6A 2YBUA 4FU3A 4K03A 2IJGX 3F6QA 3L9TA 3OA5A 2DBAA 1CTNA 3LKUA 4ME2A 4TXQA 1XGWA 1U3CA 2XENA 4ACLA 3ZN3A 4A3TA 4TRQA 5H7PA 3T5VA 2F21A 5A23A 1SZ9A 5ENNA 2ESCA 4BFRA 3U9WA 2BEDA 2N87A 1E6PA 5ENOD 2PPOA 3UIPC 5EX0A 2IO3C 4G8LA 5C1DA 2KBXA 5KNHD 3PZ1A 3GZSA 4APOA 3SGHA 4AVXA 2VGYA 2C0MA 4JZYA 4B94A 1MX6A 2XS1A 2HM8A 1TJCA 3DPDA 1KT1A 5HUAA 4AY5A 3WL0A 1Y6IA 4OVVA 3S7BA 3L22A 3LUOA 4ATZD 3ZU7B 1PAQA 2RG8A 4AY6A 2WXOA 5HW8A 4UWHA 1ZK6A 1TEZA 2IEJA 3TG5A 3MKRA 3ZYMA 2HE0A 4NURA 5CMWA 1TJFA 4A1SA 1FKJA 1HKMA 2XHEA 5AJDA 3FU5A 1HO8A 2UY1A 4WNFA 3UT4A 3UQAA 3LJNA 3E32A 3KZ7A 3UM3A 4JFJA 3LY8A 2AJAA 3AU5A 2GRNB 2DYSE 2X6IA 3IHYA 3ARVA 3PVLA 3ZGQA 2PQRA 4LERA 1DCQA 3NQPA 3QDNA 3G6LA 3ESLA 2PV3A 5CEDB 3U66A 4R0XA 5JMND 3FH8A 3AJIA 3UM1A 1TR4A 3AS8A 4R7LA 1OCOE 4JD2G 3ULEG 5LCWJ 3PRAA 1KZOA 3E33A 3L08A 3O5MA 4ANXA 4GCOA 2VGXB 4WNEA 3RO3A 2DSZA 4KYOB 2XP4A 5HKGA 1NMWA 4EZKA 4J8EA 3HHMA 3ISMC 1KZPA 3UPVA 4DRHA 2QYJA 3C3RA 1HKKA 2XCCA 4UWGA 3FU6A 4GTQA 2X3MA 3Q5MA 1Q1CA 3MDYB 4L72B 1TNZA 5HW6A 4AOFA 3EIJA 4QQIA 1E9LA 2I9CA 2DT0A 4K5BA 2ZQVA 4IPXA 4IQCA 1LF8A 4DWSA 4RVBA 3FY1A 5DEZA 3CGNA 1FKTA 1HF8A 5CBNA 2BKKB 4AY1A 2O9OA 5HQ8A 4J6IA 1NSGA 2L9BA 4Z2LA 2B31A 1S70B 1LTXA 2ILRA 4G23A 1DCEA 4WUYA 2DPEA 3HVEB 3DXMG 3D9PA 3D9HA 3CVXA 2FAPA 4AM9A 4F6RD 3ZW3A 1DC2A 2BUGA 4HI9A 1HG5A 5BPPA 4Y6CA 5KJMA 1FKIA 2J07A 3G2WA 2XEVA 4JHKA 5IY5E 3UM0A 3RRUA 1S0PA 3Q78A 2KCVA 3QNKA 3BU8A 3QAQA 1G3NB 1WDYA 4DRPA 4UWKA 4Y6WA 1W1YA 4H7YA 3Q7AA 4HLLA 2R59A 5DIUA 4E85A 5E75A 4PH4B 3VLDA 3LVRE 3NTPA 2XPBA 4B89A 3VTXA 1UG3A 1K1AA 4KMOA 2EQXA 2KXPC 4DRIA 4FHJA 4KXKB 1J6YA 2WQ6A 4S3JA 3MKQA 1HH8A 3DEOA 4LAXA 4K0RA 2YHCA 2DSWA 3SO8A 2DZNA 2XZDG 1H2UA 3PUJA 3Q49B 1H0IA 4HXIA 1J4IA 4DRNA 4U8HA 4DX6D 4IT4A 3LDZA 1OWNA 4GTTA 3TAXA 4MKTA 3DSVA 3PRDA 4LAVA 1IHGA 3CVYA 2KE0A 1JNDA 1HFAA 4I2ZA 4J8FA 1IX5A 3QKYA 5JJTA 2ZGGA 5G04C 1J4HA 1BI7B 4GTVA 4PS8A 5HBFA 3Q75A 4BESA 2H6IA 1PBKA 4G11A 4GU5A 4JFLA 5FZRA 3FWVA 1OGBA 3DSXA 5FT9A 3EHNA 2KR7A 5DF0A 3DEPA 1ELWA 1Z5SC 4WWPA 5HI7A 1EDQA 1FKDA 2XP3A 1NA3A 4TV3A 3PDNA 3NAWA 1JCRA 5CCLA 1KLXA 4JVSA 3FDHA 3TWVA 2IO2C 3EHMA 5KJLA 4JC8A 2F37A 4FJZA 4TNSA 1WY6A 3HXEA 3VAWA 3FTXA 2YINA 4XIFA 2AXUA 2WPVA 1E8XA 2ZR5A 1OUVA 2JABA 3Q73A 1LD8A 4TUUA 3AS3A 3OAWA 3C3QA 1MX4A 4DX1A 4EECA 4YDWA 2WXRA 4DRMA 2Y78A 5DIVA 3FEXA 1ELKA 4MNKA 4GZCA 1U3DA 4W5UA 5EN5D 3CSTA 4GTOA 2LNIA 5AYWD 3ONKA 4GMRA 5DBKA 2AW6A 4B93B 2JZVA 2VSOE 3ZEFA 1FKRA 4DIPA 3ASOE 3WD3A 4DLOA 1H0GA 2IQCA 2X6KA 2ZXWE 1UN8A 2CG3A 3HDXA 2OVFA 2AOSA 4BY6A 3AU4A 3MCXA 2F8YA 5B1AE 1N4QA 2Y4TA 4N2QA 3JUEA 4YDOA 3LVQE 1WB0A 3QB2A 3ULQA 1RW2A 3OXFA 3SFZA 2I1KA 2WXQA 3FULA 3KABA 1NP7A 1YATA 5BNWA 1P5QA 3IXEA 2MLYA 2YQ8A 5HRYA 2NC9A 1WAO1 1V54E 2CHZA 4HOUA 1GOIA 3O5JA 3VTYA 1E6RA 2IF4A 3GW4A 4PTMA 1WAWA 2DT2A 2XP5A 2WVIA 2XPZA 4XKBA 3UT8A 3ZYKA 4J0UA 1HG2A 3LXUX 4DT4A 4Z2HA 1K9TA 2RUDA 3J5PA 1SA4A 2V4LA 2M1IA 2MRIA 1ZCNA 1BD8A 1D7HA 3PZ4A 4GCNA 3IK8A 3O5RA 4I6EA 3TWXA 2PN0A 2RURA 4C02B 4W9QA 1TNBA 1QYMA 3WD2A 3UI6A 1Z6TA 4WWOA 3AS0A 3RM9A 2VSNA 1X6LA 3FAPA 1JCSA 5ARGA 5AQ9A 4U95D 2WXIA 1FD9A 3LY7A 4EHMA 1N4RA 2ZQTA 4NACA 4QZVB 3ZHEB 4GZDA 4DZ3A 2A5EA 2L0IA 1W1VA 1TNOA 4U07A 2I1JA 3BG1B 3ENEA 4LG6A 4GTPA 3ZIMA 4CDMA 3KS2A 1E90A 1OWMA 4R5EA 5BV0A 4HOTA 4P8VA 5EX3A 3O5KA 2AWIA 3TWSA 2XRZA 1JWFA 4HI8A 1JNEA 4MSPA 4WKHA 1ELRA 2IY0C 4N5QA 4F3VA 1OT8A 4NZCA 1M5YA 1QNFA 2VGXA 3CHCA 4LNGA 1LD7A 1H6OA 2ZU6B 4CDNA 4JYSA 2A5UA 3UQ3A 4U7EB 2IOSA 2GRMA 3KSLA 2LSUA 4UI9C 4YDYA 2XP8A 2PZIA 5FIOA 1EF1C 4MLPA 3EUVA 5CHEE 4UQYA 2WXMA 3LS8A 3PREA 3HRAA 4GYWA 1TFVA 4HRLA 4XAKA 2FO1E 3CZ8A 2KI3A 3CK9A 5FZSA 4P8WA 1HKIA 2OEWA 3UINC 5CECB 2G41A 3ARTA 1QZ2A 3T8MA 1EQ3A 2XEHA 4APFA 3O5OA 3RJVA 3EU5A 4PS7A 4I1OB 3T9KA 4YVQC 3TXNA 1XRVA 3WXXA 4UUCA 2KATA 1TN6A 3FUEA 2VTBB 2KM4A 5JHBA 4LAYA 3CQGB 3LYAA 4J4NA 1NWRA 4RSYA 2P4VA 1N54A 3K9IA 3E34A 3ARWA 2KGJA 1HXIA 4DRJA 1W3BA 3IHZA 3JUIA 3O4ZA 4AV7A 2WXNA 3QWPA 2JEKA 4GB9A 2WMOA 3ML9A 3EIPA 2I6HA 3KAHA 2JLBA 2MPHA 3DSSA 3FHEA 3FP3A 3LY9A 3ABKE 4AIFA 2WXFA 2O92A 1E8ZA 4L2LA 4NNRA 3OXGA 3BMBA 3FH5A 4U84A 3I3NA 3SFYA 1SYTA 4RQIA 2CFZA 3LJ3A 3CK7A 3APFA 5BV1A 2RQSA 5JHAA 3D9IA 4DRQA 3CIAA 5JJ7A 3Q9NC 1SA5A 1N11A 3ARXA 3O5LA 3ARRA 4QT2A 4WNGA 2PV1A 2LAHA 3E37A 3FH7A 3G2VA 1GRJA 4I9CA 1A5EA 4UI9K 5ENSD 3D9LA 3T5XA 1D7JA 4G8KA 1AP7A 3GTYX 1D6OA 2J8SD 3JYSA 4KVMA 1FJDA 5LFAA 3GZ1A 1NWSA 3CHPA 4O60A 4A55A 1BPOA 3I4GA 2CFUA 1GPFA 1QBQA 4DUIA 1F40A 3FY4A 2Y3AA 2AXZA 3UT7A 3IKGA 4EBAA 2NXPA 2LGOA 1FPPA 1E8YA 2QFCA 4TW7A 3R7QA 5J90A 3KEAA 5ENTD 2NSZA 4URIA 4L7TA 3PZ3A 3OTNA 3S7DA 4TYOA 3ZYLA 3FU0A 3HIZA 4MBGA 2OFNA 3PE3A 3TL5A 4GZ5A 1DVPA 3EIQC 1HU3A 2Y4UA 2LUHA 3NRKA 2YHEA
chains in the Genus database with same CATH topology
4XE0A 4IYPA 4C9BB 4UQXA 3L6AA 4FAPA 4L23A 1FKBA 4D10C 4JFIA 3I5PA 5J08A 4C0EA 4ZPWR 4N3AA 4FHKA 1E96B 2HO1A 4DZ2A 3KADA 3ARSA 4GYYA 1UW4B 4LAWA 3B7RL 2DSVA 2Q7FA 4P29A 1FKFA 4IQ2A 2VSYA 4IT6A 3WH0A 2PM6A 4EPZA 3O5IA 1WNOA 5G04J 3APDA 4P8XA 4JHJA 4XI0A 4OVUA 5FTPA 3Q15A 4ZPTR 2M63A 5JH8A 2X6HA 3IV0A 2XP6A 4PUCA 3MX3A 4N2SA 1INZA 1Y8MA 1SR0A 2LJ4A 4ODLA 5T8IA 3I6CA 3FUHA 1IQUA 3CKCA 1R9HA 3PUKA 2VJ8A 1OWLA 3QJZA 4IN3B 1UR8A 4JXTA 4N3BA 3PR9A 4LRZA 4MRUA 3C98A 1QPFA 3O5PA 3SBSA 3ODKA 5G55A 3RFWA 1ROUA 4MPKA 1UJJA 3PRZA 5LX8A 3RM4A 4N5CA 4EQFA 4CGVA 1QQEA 4GMJA 1MQSA 1Q6UA 3WIJA 4N3CA 2WMNA 4ZPVR 4ILIA 3RKVA 4CGWA 4CDRA 3B13A 1HJXA 2A3EA 3JXVA 2E0IA 5GPRA 4ZS6A 3RO2A 3VLFA 5HTGA 2LKNA 4GA1A 2YNQA 4B8AA 2PPNA 3LPZA 2IU1A 4Q7NA 2WK2A 5KCMA 3G2TA 2X38A 4KQZA 4NSBA 3PEUB 5HWBA 4GMLA 4CT0A 3TDBA 2WXKA 3HYMB 4CT4A 2FDMA 2DT3A 4ODRA 3WD4A 5EDSA 2DG9A 3FTZA 1LL7A 4PDXA 3FTWA 3IKOB 3IHVA 1W1PA 2UY1B 4DI3A 4A3VA 3SHFA 3CLJA 1E6ZA 1W26A 3FUFA 3SI5A 1VF8A 3RRNB 4FC8A 2A3AA 4U63A 1NZNA 4BSXA 2XQ0A 3GPKA 3B7TA 2RSEA 3B7XA 3MJWA 4EBAG 3KCEA 2WM9A 2R17C 4GZ3A 1O6IA 3FUJA 3RMEA 4EZJA 1NH6A 4DWSC 4O2TA 1JUQA 3G2SA 3QC1A 2PM7A 4JA7A 2PI6A 4WJXA 4JL0A 1Z3XA 3O5FA 2M08A 2K8IA 4FLHA 4FA6A 1ZB5A 4IRUA 3SNXA 2KC7A 4KVOA 1D2KA 2LPVA 3ZRHA 3ASGA 1LQ0A 4JFMA 4G26A 4KBQA 4UWLA 4BWRA 5G05C 1H2TC 2J09A 2IFUA 5J6EA 2A3BA 2KZTA 2FEZA 4M3OA 1SZAA 3RGCA 4DWSB 2WXLA 1IYGA 3QWWA 2CHWA 2GW1A 3ARUA 5A7DB 3UF8A 3H9RB 2DT1A 1W1TA 1NWTA 1ROTA 4LUNU 2VTBA 4LGXA 3ASDA 2X6JA 1NA0A 4I1AA 5EKQD 1EHNA 4G1TA 1E15A 4MGVA 4Z2IA 2GGFA 4W9PA 1EIBA 5HWCA 4U85A 1GUVA 2VQ2A 3IKDA 3CSFA 3DBSA 3LCAA 4I6JA 4Z2GA 3RRMB 3NZUA 3L54A 1T11A 4F1SA 4DJAA 4LCTA 3ARPA 3PA7A 2P58C 4GA2A 4DK5A 1FAPA 3B9AA 4A1GA 4G2VA 1EPUA 1ZBKA 3WQVA 2PQNA 1B6CA 2FO7A 4GA0A 2ITKA 4U0ZA 4XI9A 3ONLA 4AEZC 5FZQA 1E8WA 3AS2A 2G8ZA 4HOQA 1UN9A 4MNJA 3ZVVA 1ZBVA 4JEHA 1H6KA 3FU3A 1HKJA 3CK8A 2FULA 1EYHA 1FKSA 4XX5A 2XP9A 2PV2A 5E76A 3MV3B 2WXJA 3U4TA 2CG2A 3ZXSA 5AIJA 4RG6A 3R9AB 4RG9A 3G2UA 5D0QD 5KJNA 4GYOA 1Q6IA 2ZR4A 2ZQUA 3SF4A 3ALFA 3CVLA 2MOWA 3FUMA 4UQZA 3I4RB 2BF0X 2HYZA 4JA9A 4HFGA 2RUQA 2DG4A 2V5FA 2ONDA 3BEEA 1BL4A 1HJVA 3UMVA 5A6CA 4AP2A 4HLEA 2WB2A 2R5SA 3ASHA 4WIWA 1HXVA 5DIZA 3FTYA 5FQ7A 5I98A 2L6JA 3O5QA 4U86A 2J9QA 3PNTB 5D0OD 2VN1A 3KD7A 2A3CA 4JHRA 1HS6A 4HOSA 1OGGA 1DNPA 4I1MA 3O5DA 5FJYA 4BX8A 3PH0C 5CMYA 2WQHA 1X5BA 4BX9A 5M72A 3KAFA 2VYIA 4HS2A 3NI6A 5JJ6A 1FKKA 3KACA 1W9VA 4U04A 1H19A 4XZ4A 1JNSA 2HR2A 1VDYA 4ODMA 3MYVA 4CRWA 3S7JA 3APCA 3S7FA 3KEZA 1A17A 4JPSA 1QPLA 3W4RA 4MNMA 3CHQA 5BT1A 3HVEA 2XP7A 5HW7A 3ZPJA 1L5JA 2PPPA 2IOLA 2KCLA 2RUCA 4FJYA 5GPGA 2IONA 4L2YA 2FKEA 1D7IA 1RD6A 2WXPA 2RD0A 3TG4A 4XKCA 2L0TB 4DPRA 5T3RA 2XGSA 1F8AB 4ILGA 3TXMA 3CHSA 3FUIA 3TGOA 1LG2A 1E7VA 2C0LA 3CGMA 4I43A 5HT1A 1ZBWA 3MGBA 5FWQA 3B7UX 3CVNA 1Q6HA 3ARYA 2LSVA 2KO7A 4MTVA 4BT9A 1HZ4A 1ITXA 4GIVA 2XRYA 4JEUA 4LEUA 1NWUA 1XNFA 4HVBA 3MEKA 1IQRA 2QY7A 4YVOA 3D9MA 3GZ2A 4J8SA 3FEYA 3ZFWA 4V3IA 2AXVA 3CVQA 2J08A 4Q22A 3D3MA 2J4DA 5FQ4A 3WL1A 2OOEA 2WXHA 4BTBA 4JFKA 2MLZA 2DSUA 4FP7A 2LAIA 3CGHA 4W9OA 2V8SE 3CQCB 3JCKC 1FKGA 1EDUA 4GGQA 2XGOA 3ALGA 4FULA 2WXGA 3FTUA 1W9UA 3URZA 4KZCA 3CR3A 3IEGA 5DITA 4BF8A 2XGMA 4WKAA 3PZDA 3WKZA 3PRBA 4IULA 3U64A 4DLQA 3O5GA 2WQ7A 4FN2A 2YBTA 3VLEA 1FFRA 3E4BA 2BTDA 4ANWA 1J4RA 4KR0B 3EJNA 4I9EA 4MS6A 1ZBPA 4HORA 1HJWA 4ODQA 5BW8C 4DROA 2WM0A 3L17A 3S2AA 3CVVA 3KAEA 3CH9A 3D9NA 2OLHA 5LP0A 4E6HA 2F2DA 2L2SA 1KT0A 2UWJG 3ARZA 2XPYA 1A7XA 3GYZA 4J8DA 3Q4AB 2DG3A 2FBNA 3JQ1A 2A4ZA 4KT6B 1N1AA 5FQ6A 3RK6A 3B7SA 1LJYA 3B9DA 3RM8A 3ESKA 2Q5AA 3B8SA 3CHOA 4DRKA 3U3WA 1OWPA 3MA5A 1N52A 3WD1A 4DWSD 4B8CB 4GPKA 2QF8A 2XPIA 3JQ0A 3JYMA 1OWOA 4I17A 4H7XA 3ARQA 2DCPA 3L13A 3AQUA 3L16A 4ODPA 5G05J 1XHGA 2KCKA 4PS3A 3CHDA 4URKA 4TW6A 3CHMA 4L1BA 5LCWC 1SQMA 3FUNA 3WD0A 2X6FA 1Z3YA 2UZ5A 3B9EA 3CVUA 5ARFA 3RU0A 5ANRA 3OXLA 4C0MA 3NZSA 2MF9A 3FTSA 4QT3A 3FTVA 4TX0A 1FFQA 1EYMA 4Q69A 1LL4A 3QARA 4ODKA 2MHKA 3O48A 2WLYA 4JW1A 4NQ0A 1Y0OA 4EZLA 3CVPA 3ZHEA 4I6GA 3NF1A 3CV0A 1UR9A 3AROA 2PL2A 4B0ZA 4QFVA 3PNLB 4G25A 5G2NA 2VSXE 3TCZA 2E2EA 1ZBCA 4N19A 3CVWA 4ILHB 4MAVA 5GQBA 3G6MA 5C2YA 4FLBA 3PS6A 3UI5A 4L3NA 1WM5A 3CHFA 2KFWA 4ATGA 3CHRA 4ANVA 1C9HA 4Z2JA 1FKLA 2AVPA 5AJLA 4S3KA 4F53A 1YW5A 5FQ8A 3EDTB 1OWQA 3ML8A 2XPAA 4WKFA 4HBEA 3MZLB 1L1PA 5ANLA 2MLXA 1E7UA 4J4OA 1X6NA 4KZ0A 1GW6A 3TJPA 1ZU2A 3D9KA 1FVHA 1U79A 4Q94A 2ZR6A 3UQIA 1HX8A 1LL6A 5AENA 4WK9A 4U0SA 4UWFA 1JVWA 4F7AA 4Z2KA 4G50A 3R7RA 3CKBA 2J4BA 3QK0A 1PINA 4OYSA 4ANUA 4WNDA 4FADA 2VCDA 4UI9J 1NMVA 5BUZA 1JNTA 2MNTA 3KAGA 1KFWA 3UQBA 4BTAA 1E6NA 4CEMA 1JWGA 4WWNA 2OVBA 3PE4A 3QOUA 1HE8A 1ZL1A 2PBCA 4ODNA 3WQWA 1ZU8A 1TCOC 3UX4A 3SBTB 4GAAA 3UUXA 3O5EA 3OOBA 2ZQSA 3ASFA 4ABNA 4O6FA 2XCBA 3MKQB 3KAIA 2OV8A 2LO6A 3ZYQA 1YA0A 1LG1A 4GZ6A 3QWVA 2F4EA 3MV2B 3PEVB 3FFLA 2WLZA 1PY1A 3BXWA 3FXYA 4HBOA 4AJWA 1MHQA 3QOKA 2J49A 3SZ7A 3RIBA 2AWGA 1H2VC 4HARA 3D9JA 2FF4A 2V0PA 5B8IC 3P1UA 3FUDA 3FUKA 3SD5A 1W9PA 4W9RA 3CEQA 5CCMA 4N39A 4U0UA 2I2OA 4ITZA 5T4YA 5BXJA 3AS4A 3AS5A 3Q47B 4ACKA 5KJKA 1FVFA 1H0AA 4YNDA 1UJKA 3UI4A 1FKHA 4AXHA 4MNLA 4DH0A 4Q96A 4G24A 3P2BA 2IUZA 4ODOA 4QIBA 1BKFA 4WAFA 3IBEA 2KZTB 3BG0B 3N71A 4G2PA 3JYJA 2D9FA 3LEWA 4I2WA 1FCHA 4CCAA 1B89A 2M2AA 3AS1A 2FI7A 4DI4A 5LOZA 5DO2A 4ML4A 2C2LA 1PC2A 3CHEA 4NRHB 5D75A 2GRLA 4P8UA 4BT8A 3D9OA 2CHXA 3TC5A 4TW8A 1JPLA 2DIWA 3EY6A 2YBUA 4FU3A 4K03A 2IJGX 3OA5A 2DBAA 1CTNA 3LKUA 4ME2A 1XGWA 1U3CA 4ACLA 3ZN3A 4A3TA 4TRQA 3T5VA 2F21A 5A23A 1SZ9A 5ENNA 2ESCA 4BFRA 3U9WA 2N87A 1E6PA 2PPOA 5EX0A 5C1DA 3GZSA 4APOA 3SGHA 4AVXA 2VGYA 2C0MA 4JZYA 4B94A 2HM8A 1TJCA 3DPDA 1KT1A 5HUAA 4AY5A 3WL0A 1Y6IA 4OVVA 3S7BA 3L22A 3LUOA 1PAQA 2RG8A 4AY6A 2WXOA 5HW8A 4UWHA 1ZK6A 1TEZA 3TG5A 3MKRA 3ZYMA 4NURA 5CMWA 1TJFA 4A1SA 1FKJA 1HKMA 2XHEA 5AJDA 3FU5A 1HO8A 2UY1A 4WNFA 3UT4A 3UQAA 3KZ7A 4JFJA 3LY8A 3AU5A 2X6IA 3IHYA 3ARVA 3PVLA 3ZGQA 2PQRA 4LERA 3NQPA 3QDNA 3G6LA 3ESLA 2PV3A 3U66A 4R0XA 3FH8A 3AS8A 4R7LA 5LCWJ 3PRAA 3L08A 3O5MA 4ANXA 4GCOA 2VGXB 4WNEA 3RO3A 2DSZA 4KYOB 2XP4A 5HKGA 1NMWA 4EZKA 4J8EA 3HHMA 3UPVA 4DRHA 1HKKA 2XCCA 4UWGA 3FU6A 2X3MA 3Q5MA 1Q1CA 3MDYB 4L72B 5HW6A 4AOFA 3EIJA 1E9LA 2I9CA 2DT0A 2ZQVA 4IPXA 4IQCA 1LF8A 4DWSA 4RVBA 3FY1A 5DEZA 3CGNA 1FKTA 1HF8A 4AY1A 2O9OA 5HQ8A 4J6IA 1NSGA 2L9BA 4Z2LA 2B31A 4WUYA 2ILRA 4G23A 2DPEA 3HVEB 3D9PA 3CVXA 2FAPA 4AM9A 3ZW3A 2BUGA 1HG5A 5BPPA 4Y6CA 5KJMA 1FKIA 2J07A 3G2WA 2XEVA 4JHKA 3RRUA 1S0PA 2KCVA 3QNKA 3QAQA 4DRPA 4UWKA 4Y6WA 1W1YA 4H7YA 2R59A 5DIUA 4E85A 5E75A 4PH4B 3VLDA 3LVRE 3NTPA 2XPBA 4B89A 3VTXA 1UG3A 4KMOA 2EQXA 4DRIA 4FHJA 4KXKB 1J6YA 2WQ6A 4S3JA 3MKQA 1HH8A 4LAXA 4K0RA 2YHCA 2DSWA 1H2UA 3PUJA 3Q49B 1H0IA 4HXIA 1J4IA 4DRNA 4U8HA 4IT4A 3LDZA 1OWNA 3TAXA 4MKTA 3PRDA 4LAVA 1IHGA 3CVYA 2KE0A 1JNDA 1HFAA 4I2ZA 4J8FA 1IX5A 3QKYA 5JJTA 5G04C 1J4HA 4PS8A 5HBFA 1PBKA 4G11A 4GU5A 4JFLA 5FZRA 3FWVA 1OGBA 5FT9A 3EHNA 2KR7A 5DF0A 1ELWA 4WWPA 5HI7A 1EDQA 1FKDA 2XP3A 1NA3A 4TV3A 3PDNA 5CCLA 1KLXA 4JVSA 3FDHA 3EHMA 5KJLA 4JC8A 4FJZA 4TNSA 1WY6A 3VAWA 3FTXA 2YINA 4XIFA 2AXUA 2WPVA 1E8XA 2ZR5A 1OUVA 4TUUA 3AS3A 3OAWA 4EECA 2WXRA 4DRMA 2Y78A 5DIVA 3FEXA 1ELKA 4MNKA 4GZCA 1U3DA 4W5UA 3CSTA 5AYWD 2LNIA 3ONKA 5DBKA 2AW6A 2JZVA 2VSOE 3ZEFA 1FKRA 4DIPA 3WD3A 4DLOA 1H0GA 2IQCA 2X6KA 1UN8A 2CG3A 3HDXA 2OVFA 2AOSA 4BY6A 3AU4A 3MCXA 2Y4TA 4N2QA 3LVQE 1WB0A 3QB2A 3ULQA 3OXFA 3SFZA 2I1KA 2WXQA 3FULA 3KABA 1NP7A 1YATA 5BNWA 1P5QA 2MLYA 2YQ8A 2NC9A 1WAO1 2CHZA 4HOUA 1GOIA 3O5JA 3VTYA 1E6RA 2IF4A 3GW4A 4PTMA 1WAWA 2DT2A 2XP5A 2XPZA 2WVIA 4XKBA 3UT8A 3ZYKA 4J0UA 1HG2A 3LXUX 4DT4A 4Z2HA 1K9TA 2RUDA 2V4LA 2M1IA 2MRIA 1ZCNA 1D7HA 4GCNA 3IK8A 3O5RA 4I6EA 2RURA 4C02B 4W9QA 3WD2A 3UI6A 1Z6TA 4WWOA 3AS0A 3RM9A 2VSNA 1X6LA 3FAPA 5ARGA 2WXIA 1FD9A 3LY7A 2ZQTA 4NACA 4QZVB 3ZHEB 4GZDA 4DZ3A 2L0IA 1W1VA 4U07A 2I1JA 3BG1B 3ENEA 3ZIMA 4CDMA 3KS2A 1E90A 1OWMA 4R5EA 5BV0A 4HOTA 4P8VA 5EX3A 3O5KA 2AWIA 2XRZA 1JWFA 1JNEA 4MSPA 4WKHA 1ELRA 4F3VA 4NZCA 1M5YA 1QNFA 2VGXA 3CHCA 2ZU6B 4JYSA 4CDNA 2A5UA 3UQ3A 2IOSA 2GRMA 2LSUA 4UI9C 2XP8A 2PZIA 1EF1C 4MLPA 5CHEE 4UQYA 2WXMA 3LS8A 3PREA 4GYWA 1TFVA 4XAKA 3CZ8A 2KI3A 3CK9A 5FZSA 4P8WA 1HKIA 2G41A 3ARTA 1QZ2A 3T8MA 1EQ3A 4APFA 3O5OA 3RJVA 4PS7A 4I1OB 4YVQC 3TXNA 1XRVA 3WXXA 2KATA 3FUEA 2VTBB 2KM4A 5JHBA 4LAYA 3CQGB 3LYAA 4J4NA 1NWRA 4RSYA 1N54A 3K9IA 3ARWA 2KGJA 1HXIA 4DRJA 1W3BA 3IHZA 3JUIA 3O4ZA 4AV7A 2WXNA 3QWPA 2JEKA 4GB9A 2WMOA 3ML9A 2I6HA 3KAHA 2JLBA 2MPHA 3FHEA 3FP3A 3LY9A 4AIFA 2WXFA 2O92A 1E8ZA 4L2LA 4NNRA 3OXGA 3FH5A 4U84A 3I3NA 1SYTA 2CFZA 3LJ3A 3CK7A 3APFA 5BV1A 2RQSA 5JHAA 3D9IA 4DRQA 3CIAA 5JJ7A 3ARXA 3O5LA 3ARRA 4QT2A 4WNGA 2PV1A 2LAHA 3FH7A 3G2VA 4I9CA 4UI9K 3D9LA 3T5XA 1D7JA 1D6OA 3JYSA 4KVMA 1FJDA 5LFAA 3GZ1A 1NWSA 3CHPA 4A55A 1BPOA 3I4GA 2CFUA 1GPFA 1F40A 3FY4A 2Y3AA 2AXZA 3UT7A 3IKGA 4EBAA 2NXPA 2LGOA 1E8YA 2QFCA 4TW7A 3R7QA 5J90A 2NSZA 4URIA 4L7TA 3OTNA 3S7DA 4TYOA 3ZYLA 3FU0A 3HIZA 2OFNA 3PE3A 3TL5A 4GZ5A 1DVPA 3EIQC 1HU3A 2Y4UA 3NRKA 2YHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UI9 J;  1NMV A;  4KXK B;  1J6Y A;  2WQH A;  1JNT A;  2MNT A;  3KAG A;  3UQB A;  5M72 A;  3KAF A;  2VYI A;  4BTA A;  1HH8 A;  4UQX A;  4LAX A;  3NI6 A;  4FAP A;  2YHC A;  5JJ6 A;  1FKK A;  3KAC A;  1FKB A;  4U04 A;  3Q49 B;  4JFI A;  1JNS A;  1J4I A;  2HR2 A;  4DRN A;  4ODM A;  4N3A A;  3PE4 A;  3S7J A;  3TAX A;  3QOU A;  3PRD A;  1E96 B;  3S7F A;  1A17 A;  4LAV A;  2HO1 A;  2PBC A;  1IHG A;  4DZ2 A;  1QPL A;  2KE0 A;  3KAD A;  4I2Z A;  4J8F A;  4ODN A;  5BT1 A;  2XP7 A;  3QKY A;  5JJT A;  5HW7 A;  5G04 C;  4GYY A;  3ZPJ A;  1J4H A;  1TCO C;  2PPP A;  4LAW A;  1PBK A;  4JFL A;  2KCL A;  2RUC A;  2Q7F A;  5FZR A;  3UUX A;  1FKF A;  3FWV A;  3O5E A;  4IQ2 A;  2VSY A;  5FT9 A;  3OOB A;  2ZQS A;  3ASF A;  4ABN A;  2KR7 A;  4O6F A;  3WH0 A;  2XCB A;  1ELW A;  5GPG A;  2FKE A;  1D7I A;  3KAI A;  5HI7 A;  3O5I A;  1FKD A;  2XP3 A;  3TG4 A;  1NA3 A;  2XGS A;  5G04 J;  1YA0 A;  3PDN A;  1F8A B;  4XI0 A;  5FTP A;  5CCL A;  3Q15 A;  3TGO A;  1KLX A;  4GZ6 A;  2C0L A;  3QWV A;  2XP6 A;  3CGM A;  4N2S A;  5KJL A;  5HT1 A;  2F4E A;  3MV2 B;  1Y8M A;  3CVN A;  4TNS A;  2LJ4 A;  1Q6H A;  4ODL A;  3FFL A;  2LSV A;  3VAW A;  2KO7 A;  4BT9 A;  4XIF A;  1HZ4 A;  2WPV A;  2ZR5 A;  3I6C A;  4GIV A;  1OUV A;  4LEU A;  1XNF A;  3CKC A;  1R9H A;  3MEK A;  4YVO A;  4DRM A;  3SZ7 A;  2Y78 A;  5DIV A;  3GZ2 A;  3RIB A;  4IN3 B;  3ZFW A;  4N3B A;  2AWG A;  3CVQ A;  2FF4 A;  1QPF A;  3O5P A;  5B8I C;  3ODK A;  3RFW A;  1ROU A;  5AYW D;  2LNI A;  4N5C A;  2OOE A;  5DBK A;  4EQF A;  4CGV A;  2JZV A;  1QQE A;  1FKR A;  4DIP A;  1Q6U A;  4N3C A;  4W9R A;  3CEQ A;  4BTB A;  4JFK A;  5CCM A;  2MLZ A;  3RKV A;  4N39 A;  4CGW A;  4CDR A;  4U0U A;  4ITZ A;  4W9O A;  3JXV A;  5BXJ A;  3AS4 A;  3AS5 A;  3Q47 B;  5KJK A;  1FKG A;  3RO2 A;  4GGQ A;  4YND A;  2XGO A;  3UI4 A;  5HTG A;  1FKH A;  2Y4T A;  2LKN A;  4GA1 A;  4DH0 A;  4N2Q A;  2PPN A;  3LPZ A;  3URZ A;  4G24 A;  3ULQ A;  3IEG A;  3OXF A;  5DIT A;  5HWB A;  4ODO A;  4QIB A;  1BKF A;  3TDB A;  3HYM B;  4BF8 A;  3KAB A;  2XGM A;  4ODR A;  1YAT A;  5BNW A;  3N71 A;  4G2P A;  3JYJ A;  1P5Q A;  2D9F A;  2DG9 A;  2MLY A;  4I2W A;  2YQ8 A;  1FCH A;  3PRB A;  2NC9 A;  1B89 A;  1WAO 1;  2M2A A;  4HOU A;  3O5J A;  2FI7 A;  3O5G A;  2UY1 B;  3VTY A;  4FN2 A;  3E4B A;  2IF4 A;  2C2L A;  3GW4 A;  1J4R A;  1PC2 A;  4NRH B;  4I9E A;  1W26 A;  5D75 A;  1ZBP A;  4BT8 A;  4HOR A;  4ODQ A;  3TC5 A;  5BW8 C;  4TW8 A;  4DRO A;  3EY6 A;  2XP5 A;  3KAE A;  1NZN A;  4J0U A;  2DBA A;  4DT4 A;  3LKU A;  3GPK A;  4ME2 A;  2RSE A;  2RUD A;  3B7X A;  3ZN3 A;  2M1I A;  1ZCN A;  2F2D A;  1D7H A;  4GCN A;  2F21 A;  3IK8 A;  2L2S A;  3KCE A;  3O5R A;  1KT0 A;  2UWJ G;  2N87 A;  2RUR A;  4C02 B;  4W9Q A;  4GZ3 A;  2PPO A;  3UI6 A;  5EX0 A;  2VSN A;  1A7X A;  3FAP A;  3GYZ A;  5ARG A;  5C1D A;  4J8D A;  3Q4A B;  2DG3 A;  2FBN A;  1FD9 A;  4APO A;  3LY7 A;  4O2T A;  2VGY A;  4JA7 A;  2C0M A;  4B94 A;  4JL0 A;  2ZQT A;  1N1A A;  3ZHE B;  3O5F A;  2M08 A;  1TJC A;  2K8I A;  4DZ3 A;  4U07 A;  1KT1 A;  5HUA A;  4AY5 A;  3ESK A;  3S7B A;  2Q5A A;  3LUO A;  4DRK A;  2KC7 A;  3U3W A;  3MA5 A;  4AY6 A;  5HW8 A;  3KS2 A;  2LPV A;  3ASG A;  4JFM A;  4G26 A;  4KBQ A;  4BWR A;  1ZK6 A;  5G05 C;  4HOT A;  4GPK A;  2IFU A;  2XPI A;  5EX3 A;  5J6E A;  3O5K A;  3JYM A;  4MSP A;  2FEZ A;  1ELR A;  3RGC A;  4I17 A;  3TG5 A;  3MKR A;  4H7X A;  4F3V A;  1IYG A;  3QWW A;  2GW1 A;  4A1S A;  5A7D B;  3UF8 A;  3H9R B;  1FKJ A;  1M5Y A;  2VGX A;  4ODP A;  2UY1 A;  5G05 J;  4JYS A;  4WNF A;  2KCK A;  1ROT A;  3UQ3 A;  3UQA A;  4TW6 A;  2LSU A;  4UI9 C;  3ASD A;  3KZ7 A;  2XP8 A;  2PZI A;  5LCW C;  4JFJ A;  1NA0 A;  3LY8 A;  4I1A A;  5CHE E;  4UQY A;  5EKQ D;  2UZ5 A;  4GYW A;  4G1T A;  5ARF A;  4MGV A;  3RU0 A;  3ZGQ A;  4W9P A;  2PQR A;  3OXL A;  5HWC A;  2KI3 A;  4U85 A;  3CK9 A;  2MF9 A;  2VQ2 A;  3QDN A;  5FZS A;  2PV3 A;  4R0X A;  4QT3 A;  3IKD A;  1QZ2 A;  3LCA A;  4TX0 A;  3AS8 A;  1EQ3 A;  5LCW J;  3O5O A;  3RJV A;  4YVQ C;  3O5M A;  1EYM A;  4GCO A;  2VGX B;  4WNE A;  3RO3 A;  1T11 A;  3WXX A;  4KYO B;  4ODK A;  2XP4 A;  2KAT A;  1NMW A;  2MHK A;  5HKG A;  3O48 A;  4J8E A;  3PA7 A;  2P58 C;  4GA2 A;  4NQ0 A;  1Y0O A;  3CVP A;  3ZHE A;  1FAP A;  4LAY A;  3NF1 A;  3CV0 A;  4G2V A;  3LYA A;  3UPV A;  4DRH A;  4J4N A;  2PL2 A;  3K9I A;  2PQN A;  2KGJ A;  1HXI A;  2XCC A;  1B6C A;  4DRJ A;  1W3B A;  3IHZ A;  4G25 A;  2FO7 A;  4GA0 A;  2ITK A;  3QWP A;  4U0Z A;  4XI9 A;  3Q5M A;  3TCZ A;  1Q1C A;  2E2E A;  3MDY B;  5FZQ A;  4N19 A;  4HOQ A;  2I6H A;  5HW6 A;  3KAH A;  2JLB A;  2MPH A;  3FP3 A;  3LY9 A;  4AIF A;  3UI5 A;  2ZQV A;  4IPX A;  1WM5 A;  4IQC A;  3CK8 A;  1FKS A;  2KFW A;  2XP9 A;  2PV2 A;  4NNR A;  3OXG A;  4U84 A;  3MV3 B;  3U4T A;  3CGN A;  4RG6 A;  1FKT A;  3R9A B;  4RG9 A;  3CK7 A;  5D0Q D;  5HQ8 A;  5KJN A;  2RQS A;  4GYO A;  1NSG A;  1C9H A;  1Q6I A;  2ZR4 A;  1FKL A;  2ZQU A;  2AVP A;  4WUY A;  4G23 A;  4DRQ A;  3SF4 A;  5JJ7 A;  3CVL A;  3O5L A;  1YW5 A;  4QT2 A;  2FAP A;  4UQZ A;  4WNG A;  2PV1 A;  2HYZ A;  4JA9 A;  4AM9 A;  2RUQ A;  2DG4 A;  2V5F A;  4I9C A;  2BUG A;  2OND A;  3EDT B;  4UI9 K;  3BEE A;  4Y6C A;  1D7J A;  1BL4 A;  5KJM A;  1D6O A;  2XPA A;  5A6C A;  1FKI A;  3JYS A;  2XEV A;  1FJD A;  1L1P A;  3GZ1 A;  2R5S A;  3ASH A;  1HXV A;  2KCV A;  5DIZ A;  2MLX A;  4J4O A;  5I98 A;  1F40 A;  1ZU2 A;  3IKG A;  4DRP A;  2L6J A;  3O5Q A;  2LGO A;  1U79 A;  2QFC A;  4Y6W A;  2ZR6 A;  4TW7 A;  4U86 A;  3UQI A;  4H7Y A;  2J9Q A;  4U0S A;  5D0O D;  2VN1 A;  1JVW A;  3KD7 A;  5DIU A;  3S7D A;  4JHR A;  4TYO A;  4HOS A;  2OFN A;  3NTP A;  3PE3 A;  2XPB A;  4G50 A;  3CKB A;  4GZ5 A;  3VTX A;  1PIN A;  3O5D A;  5FJY A;  4WND A;  2Y4U A;  2VCD A;  3NRK A;  4DRI A; 
#chains in the Genus database with same CATH topology
 5ENP D;  4XE0 A;  3V2O A;  4IYP A;  4C9B B;  3NB2 A;  4UQX A;  3L6A A;  4FAP A;  4L23 A;  1FKB A;  3GU0 A;  4D10 C;  4JFI A;  3I5P A;  5J08 A;  2DZO A;  4C0E A;  3TWT A;  4ZPW R;  4N3A A;  4FHK A;  2ETN A;  1E96 B;  5AQB A;  2HO1 A;  3L82 A;  4DZ2 A;  2EIM E;  3KAD A;  1UOH A;  3ARS A;  5CRU A;  3AAA C;  4GYY A;  3RSE G;  3DWL G;  1UW4 B;  4LAW A;  3B7R L;  4YDE A;  2DSV A;  2Q7F A;  4P29 A;  1FKF A;  4IQ2 A;  2VSY A;  4IT6 A;  3WH0 A;  2PM6 A;  1S63 A;  4EPZ A;  3O5I A;  1WNO A;  1JCH B;  5G04 J;  5JA4 D;  3APD A;  4P8X A;  3WG7 E;  4JHJ A;  4XI0 A;  4OVU A;  5FTP A;  2ETA A;  3Q15 A;  4ZPT R;  2M63 A;  5JH8 A;  2X6H A;  3IV0 A;  2XP6 A;  4PUC A;  3MX3 A;  5CRV A;  4N2S A;  3ZXP A;  1INZ A;  1D9S A;  1IKN D;  1Y8M A;  1SR0 A;  2LJ4 A;  4ODL A;  5T8I A;  4HRN A;  3I6C A;  3FUH A;  1IQU A;  1K8K G;  3CKC A;  3PUK A;  1R9H A;  2VJ8 A;  1OWL A;  3QJZ A;  4IN3 B;  1UR8 A;  4JXT A;  4N3B A;  3PR9 A;  4LRZ A;  4MRU A;  3C98 A;  1QPF A;  3O5P A;  3SBS A;  3ODK A;  5G55 A;  3ZKJ A;  3RFW A;  4U96 D;  1ROU A;  4MPK A;  1UJJ A;  3PRZ A;  5LX8 A;  3RM4 A;  5B3S E;  4N5C A;  4EQF A;  4CGV A;  1QQE A;  4GMJ A;  1MQS A;  1Q6U A;  3WIJ A;  4N3C A;  2WMN A;  1OCZ E;  4ZPV R;  4ILI A;  3RKV A;  4CGW A;  4CDR A;  3B13 A;  1HJX A;  5BXU A;  2A3E A;  3HG0 D;  3JXV A;  2E0I A;  5GPR A;  3Q79 A;  4ZS6 A;  2H6G A;  3RO2 A;  1V55 E;  3VLF A;  5KWD A;  5HTG A;  2LKN A;  4GA1 A;  2YNQ A;  4B8A A;  1RZ4 A;  3LPZ A;  2IU1 A;  2PPN A;  4Q7N A;  2WK2 A;  5KCM A;  5ITZ F;  3G2T A;  2X38 A;  4KQZ A;  1N4S A;  4NSB A;  3PEU B;  2V5Q C;  2XEE A;  4HRM B;  5HWB A;  4GML A;  4CT0 A;  3TDB A;  2WXK A;  3HYM B;  4CT4 A;  2FDM A;  2DT3 A;  4ODR A;  3WD4 A;  3B95 A;  5EDS A;  2DG9 A;  3FTZ A;  1LL7 A;  4PDX A;  3FTW A;  3IKO B;  3IHV A;  1W1P A;  2UY1 B;  4DI3 A;  4A3V A;  3SHF A;  3CLJ A;  1E6Z A;  1W26 A;  3FUF A;  3SI5 A;  1N0R A;  2Y69 E;  1VF8 A;  3RRN B;  4FC8 A;  4O1O A;  2A3A A;  4U63 A;  1NZN A;  4BSX A;  2XQ0 A;  3EU9 A;  3GPK A;  3B7T A;  5AAO A;  2RSE A;  3B7X A;  3MJW A;  4GTS A;  4EBA G;  3KCE A;  2WM9 A;  2R17 C;  4GZ3 A;  3TWU A;  1O6I A;  3FUJ A;  3RME A;  2EIK E;  4EZJ A;  1NH6 A;  4DWS C;  3R9M A;  1YMP A;  4O2T A;  1O1R A;  1JUQ A;  3G2S A;  3QC1 A;  2PM7 A;  2RFA A;  4JA7 A;  2PI6 A;  4WJX A;  4JL0 A;  5CEA A;  1Z3X A;  1MZC A;  3O5F A;  2M08 A;  2K8I A;  4FLH A;  5EID A;  4FA6 A;  1ZB5 A;  4IRU A;  3SNX A;  2KC7 A;  5EYP F;  4KVO A;  1D2K A;  3ZRH A;  2LPV A;  3ASG A;  1LQ0 A;  4J8Y A;  4JFM A;  4G26 A;  4KBQ A;  4UWL A;  4BWR A;  5G05 C;  1H2T C;  2J09 A;  3AG3 E;  2IFU A;  1FT2 A;  5J6E A;  2A3B A;  2KZT A;  2FEZ A;  4M3O A;  1SZA A;  3RGC A;  4DWS B;  4U8V D;  2WXL A;  1IYG A;  3QWW A;  2CHW A;  2GW1 A;  3ARU A;  5A7D B;  3UF8 A;  3H9R B;  2DT1 A;  1W1T A;  1N4P A;  1NWT A;  1ROT A;  4LUN U;  2VTB A;  4LGX A;  2R05 A;  3ASD A;  2X6J A;  1NA0 A;  2L6B A;  4I1A A;  4HQD A;  2EIN E;  5EKQ D;  1EHN A;  4G1T A;  2PNN A;  1E15 A;  4MGV A;  4Z2I A;  2GGF A;  4W9P A;  1EIB A;  5HWC A;  4U85 A;  1GUV A;  2VQ2 A;  3UKR G;  3IKD A;  2XZT G;  3CSF A;  3DBS A;  3LCA A;  4F1P A;  4I6J A;  4Z2G A;  5AN8 A;  5AQ7 A;  3RRM B;  3NZU A;  3L54 A;  2R03 A;  1T11 A;  3UTM A;  4F1S A;  4DJA A;  4K5A B;  4LCT A;  3SQV A;  3ARP A;  1YYH A;  3PA7 A;  2P58 C;  4GA2 A;  4DK5 A;  1FAP A;  5ENR D;  3B9A A;  2RKK A;  4A1G A;  4G2V A;  1EPU A;  1ZBK A;  3WQV A;  1SW6 A;  5D66 A;  2PQN A;  1B6C A;  2FO7 A;  4GA0 A;  2ITK A;  2DWZ A;  4U0Z A;  4XI9 A;  3ONL A;  3W9G A;  4AEZ C;  5FZQ A;  1E8W A;  3AS2 A;  2G8Z A;  4HOQ A;  1UN9 A;  4MNJ A;  3ZVV A;  1ZBV A;  4JEH A;  1H6K A;  3FU3 A;  1HKJ A;  2QC9 A;  3CK8 A;  2FUL A;  1EYH A;  1FKS A;  4XX5 A;  2XP9 A;  3HXD A;  2PV2 A;  5E76 A;  1N0Q A;  3MV3 B;  2WXJ A;  3U4T A;  2CG2 A;  3V31 A;  3ZXS A;  3KSQ A;  5AIJ A;  4RG6 A;  3R9A B;  4RG9 A;  3G2U A;  5D0Q D;  5KJN A;  4GYO A;  1Q6I A;  2ZR4 A;  2ZQU A;  3SF4 A;  3ALF A;  3CVL A;  4GTR A;  2MOW A;  3FUM A;  4UQZ A;  3I4R B;  2BF0 X;  2HYZ A;  4JA9 A;  4HFG A;  2RUQ A;  2DG4 A;  2V5F A;  2OND A;  3BEE A;  1BL4 A;  1HJV A;  3UMV A;  3SY2 A;  2P9L G;  5A6C A;  4AP2 A;  4HLE A;  4BER A;  3TWR A;  2WB2 A;  2R5S A;  3ASH A;  3SFX A;  5CBO A;  4WIW A;  3DSU A;  1HXV A;  5DIZ A;  4HB5 A;  3FTY A;  5FQ7 A;  5I98 A;  3X2Q E;  2L6J A;  3O5Q A;  5EIL A;  4U86 A;  4TUM A;  2J9Q A;  3PNT B;  5D0O D;  2VN1 A;  1O1T A;  3KD7 A;  2XS8 A;  2A3C A;  4JHR A;  1HS6 A;  4HOS A;  3EHQ A;  1OGG A;  1DNP A;  4I1M A;  3O5D A;  5FJY A;  4BX8 A;  3PH0 C;  4CYM D;  5CMY A;  4BEP A;  2WQH A;  1X5B A;  4BX9 A;  5M72 A;  3KAF A;  2VYI A;  4HS2 A;  3NI6 A;  5JJ6 A;  3V30 A;  3NBN B;  1FKK A;  3KAC A;  4DX5 D;  1W9V A;  1IHB A;  4U04 A;  1H19 A;  3TWW A;  4XZ4 A;  5ENQ D;  1JNS A;  5D2M C;  2HR2 A;  1VDY A;  1OCR E;  4ODM A;  3MYV A;  4CRW A;  3S7J A;  3APC A;  3C5R A;  3S7F A;  1YCS B;  3KEZ A;  1A17 A;  2QZA A;  4JPS A;  5B1B E;  1QPL A;  3W4R A;  4MNM A;  3CHQ A;  5BT1 A;  3HVE A;  2XP7 A;  5HW7 A;  3ZPJ A;  1L5J A;  2PPP A;  2IOL A;  2KCL A;  2RUC A;  3UI2 A;  3C72 A;  4CZ2 D;  4FJY A;  3UXG A;  5GPG A;  2ION A;  4L2Y A;  2FKE A;  1D7I A;  1RD6 A;  2WXP A;  2RD0 A;  3TG4 A;  4XKC A;  2L0T B;  4DPR A;  5T3R A;  2XGS A;  1BU9 A;  1F8A B;  4ILG A;  3TXM A;  3CHS A;  1JCQ A;  3FUI A;  2P9S G;  3TGO A;  1LG2 A;  1E7V A;  2C0L A;  3CGM A;  4I43 A;  5HT1 A;  2GRQ B;  1ZBW A;  3MGB A;  5FWQ A;  3B7U X;  3CVN A;  1Q6H A;  4JB8 P;  1TN8 A;  2LSV A;  3ARY A;  3J5Q B;  2KO7 A;  4MTV A;  4BT9 A;  1HZ4 A;  1ITX A;  4DX7 D;  4GIV A;  2XRY A;  4JEU A;  4LEU A;  2LXL A;  1NWU A;  1XNF A;  4HVB A;  4RLY A;  3MEK A;  2DYR E;  1IQR A;  2QY7 A;  4YVO A;  3D9M A;  3GZ2 A;  4J8S A;  3FEY A;  3ZFW A;  4V3I A;  1D8D A;  2AXV A;  2RFM A;  3CVQ A;  2J08 A;  4Q22 A;  3D3M A;  2F23 A;  2J4D A;  1OY3 D;  5FQ4 A;  3WL1 A;  1OCC E;  2LXM A;  1FT1 A;  1N95 A;  2OOE A;  2WXH A;  4A63 B;  2VGE A;  4BTB A;  4JFK A;  2MLZ A;  3Q9U C;  2DSU A;  4FP7 A;  2LAI A;  3ULY A;  2P9P G;  3CGH A;  2Y0B G;  4W9O A;  2V8S E;  3CQC B;  3JCK C;  1OXJ A;  1FKG A;  1EDU A;  2P9N G;  4GGQ A;  2XGO A;  3ALG A;  4FUL A;  2WXG A;  3FTU A;  1W9U A;  2B6C A;  3URZ A;  4ZFH A;  4DRX E;  4KZC A;  3CR3 A;  3IEG A;  5DIT A;  4BF8 A;  1K3Z D;  2XGM A;  4WKA A;  3PZD A;  3WKZ A;  3PRB A;  4IUL A;  3U64 A;  4O1P A;  4DLQ A;  3HXF A;  3O5G A;  2WQ7 A;  4TXP A;  4FN2 A;  2YBT A;  3VLE A;  1FFR A;  3E4B A;  2BTD A;  4ANW A;  1J4R A;  4GPM A;  3DSW A;  4KR0 B;  3EJN A;  2MYO A;  4I9E A;  4MS6 A;  1ZBP A;  4HOR A;  1HJW A;  4ODQ A;  5BW8 C;  4DRO A;  1NFI E;  2WM0 A;  3L17 A;  3S2A A;  3CVV A;  5FIN A;  3KAE A;  3CH9 A;  3D9N A;  2BKG A;  2OLH A;  5LP0 A;  4E6H A;  2F2D A;  1TNY A;  2L2S A;  1KT0 A;  2UWJ G;  3ARZ A;  2XPY A;  1A7X A;  3GYZ A;  4J8D A;  3Q4A B;  2DG3 A;  2FBN A;  1TYQ G;  3JQ1 A;  4LNU D;  2A4Z A;  4KT6 B;  4OAU C;  1N1A A;  3UKU G;  5FQ6 A;  3RK6 A;  2P9K G;  3B7S A;  1LJY A;  5KBA A;  3B9D A;  3RM8 A;  4HBD A;  3ESK A;  2Q5A A;  3B8S A;  3CHO A;  4DRK A;  3U3W A;  1WG0 A;  1OWP A;  3MA5 A;  1N52 A;  3WD1 A;  4DWS D;  4B8C B;  4GPK A;  2QF8 A;  1K1B A;  4LNB A;  2XPI A;  3JQ0 A;  3JYM A;  1OWO A;  3AG4 E;  2B5U B;  4I17 A;  4H7X A;  3ARQ A;  2DCP A;  1O5M A;  3L13 A;  3AQU A;  3JXJ A;  3L16 A;  4ODP A;  2ZGD A;  5G05 J;  1XHG A;  2KCK A;  4PS3 A;  1NL4 A;  3CHD A;  2ETC A;  4URK A;  4TW6 A;  3CHM A;  4L1B A;  5LCW C;  1SQM A;  3FUN A;  3WD0 A;  2X6F A;  1Z3Y A;  5EIB E;  4U8Y D;  2UZ5 A;  3B9E A;  3CVU A;  5ARF A;  3PZ2 A;  2ETB A;  3RU0 A;  5ANR A;  3OXL A;  4C0M A;  3NZS A;  2MF9 A;  3FTS A;  4QT3 A;  3FTV A;  4TX0 A;  5AQA A;  2EIJ E;  1FFQ A;  3DRA A;  4M7C A;  1EYM A;  4Q69 A;  1X81 A;  1LL4 A;  3QAR A;  4ODK A;  2MHK A;  3O48 A;  3T8K A;  2WLY A;  4JW1 A;  4NQ0 A;  1Y0O A;  4XEI G;  4EZL A;  3ASN E;  3CVP A;  3Q7F A;  4I6G A;  3NF1 A;  3CV0 A;  3ZHE A;  1UR9 A;  3ARO A;  2PL2 A;  4B0Z A;  3AG2 E;  4GTM A;  4QFV A;  2P2C P;  3PNL B;  4G25 A;  5G2N A;  2VSX E;  2R02 A;  3TCZ A;  1H6P A;  2E2E A;  1ZBC A;  4N19 A;  5EYL A;  3CVW A;  4ILH B;  4MAV A;  5GQB A;  3G6M A;  5C2Y A;  4FLB A;  3PS6 A;  3UI5 A;  4L3N A;  1WM5 A;  3CHF A;  3RAU A;  4ATG A;  1N9A A;  2KFW A;  3CHR A;  2GRR B;  3B7B A;  3AG1 E;  4K5C A;  4ANV A;  4X8Q A;  1C9H A;  4Z2J A;  3E30 A;  1FKL A;  2AVP A;  5AJL A;  2ZIS A;  4C48 B;  1S64 A;  4S3K A;  1KPS B;  4F53 A;  1YW5 A;  5FQ8 A;  1IXV A;  2R2L A;  2GRO B;  3EDT B;  1OWQ A;  3C3O A;  3ML8 A;  2Y1L E;  2XPA A;  4WKF A;  4HBE A;  1TN7 A;  3MZL B;  1L1P A;  5ANL A;  4DX2 A;  1BI8 B;  2MLX A;  1E7U A;  1AWC B;  4J4O A;  3EHR A;  1X6N A;  4KZ0 A;  1GW6 A;  3TJP A;  1ZU2 A;  3D9K A;  1O1S A;  5HKP A;  1FVH A;  1U79 A;  4Q94 A;  2ZR6 A;  3UQI A;  1HX8 A;  1LL6 A;  5AEN A;  4WK9 A;  3ZUV B;  3HXB A;  4U0S A;  4UWF A;  1JVW A;  2NYJ A;  1ZB1 A;  4F7A A;  4Z2K A;  2OEV A;  2EIL E;  4G50 A;  3R7R A;  3CKB A;  2J4B A;  3QK0 A;  1PIN A;  4OYS A;  4NIK A;  4ANU A;  4WND A;  4FAD A;  3V79 K;  2VCD A;  4UI9 J;  1NMV A;  4L9P A;  5BUZ A;  2V4H C;  1JNT A;  2MNT A;  3JXI A;  3KAG A;  1KFW A;  3UQB A;  4BTA A;  3ABL E;  1E6N A;  4CEM A;  3UM2 A;  4Z68 A;  1E44 A;  1JWG A;  2H6F A;  1MYO A;  4WWN A;  2F0Y A;  2OVB A;  3PE4 A;  3QOU A;  1HE8 A;  1ZL1 A;  2PBC A;  1TNU A;  4OAV B;  3V2X A;  5AAR A;  4ODN A;  1SVX A;  1Q2Z A;  3WQW A;  2P9I G;  3HXC A;  1ZU8 A;  3DST A;  1TCO C;  3UX4 A;  3SBT B;  4GAA A;  3UUX A;  3O5E A;  3OOB A;  2ZQS A;  3ASF A;  4ABN A;  4O6F A;  2F8X K;  2XCB A;  3MKQ B;  3KAI A;  2OV8 A;  2LO6 A;  4BET A;  3ZYQ A;  1YA0 A;  1LG1 A;  4GZ6 A;  3QWV A;  1N94 A;  2F4E A;  3MV2 B;  4UDM A;  3PEV B;  3FFL A;  3UIO C;  2WLZ A;  1PY1 A;  3BXW A;  3FXY A;  4HBO A;  4AJW A;  1MHQ A;  3QOK A;  1BLX B;  2J49 A;  1MJ0 A;  3SZ7 A;  3RIB A;  2AWG A;  2OCC E;  1H2V C;  4HAR A;  3D9J A;  3DPY A;  2FF4 A;  2V0P A;  4BSZ B;  5B8I C;  1D8E A;  3DXK G;  3P1U A;  2GRP B;  3FUD A;  3FUK A;  3SD5 A;  1W9P A;  3BQO A;  4W9R A;  3CEQ A;  5CCM A;  5CER B;  3NOG D;  3ABM E;  2H6H A;  4N39 A;  2DVW A;  4U0U A;  2I2O A;  4ITZ A;  5T4Y A;  5BXJ A;  2ZIR A;  3AS4 A;  3AS5 A;  4HNA D;  3Q47 B;  4ACK A;  2B0O E;  5KJK A;  1FVF A;  1H0A A;  4YND A;  1UJK A;  3UI4 A;  1FKH A;  2P9U G;  4AXH A;  4MNL A;  4DH0 A;  4Q96 A;  4ZHB A;  3BUA A;  1NI1 A;  2EUL A;  4LSZ E;  4G24 A;  5HS0 A;  2QYU A;  3P2B A;  2IUZ A;  4ODO A;  4J7W A;  3ZNG A;  4QIB A;  1BKF A;  4WAF A;  3IBE A;  2KZT B;  3BG0 B;  1MX2 A;  4TXR A;  3N71 A;  4G2P A;  3JYJ A;  2D9F A;  3W9F A;  3LEW A;  4I2W A;  1FCH A;  5KNG A;  4CCA A;  1B89 A;  2M2A A;  3AS1 A;  2FI7 A;  4DI4 A;  5LOZ A;  5DO2 A;  3NOC D;  4ML4 A;  2C2L A;  3TWQ A;  1PC2 A;  3CHE A;  4NRH B;  5D75 A;  2GRL A;  4P8U A;  4BT8 A;  5BXO A;  3D9O A;  2CHX A;  3TC5 A;  4TW8 A;  1JPL A;  1U2V G;  2DIW A;  3EY6 A;  2YBU A;  4FU3 A;  4K03 A;  2IJG X;  3F6Q A;  3L9T A;  3OA5 A;  2DBA A;  1CTN A;  3LKU A;  4ME2 A;  4TXQ A;  1XGW A;  1U3C A;  2XEN A;  4ACL A;  3ZN3 A;  4A3T A;  4TRQ A;  5H7P A;  3T5V A;  2F21 A;  5A23 A;  1SZ9 A;  5ENN A;  2ESC A;  4BFR A;  3U9W A;  2BED A;  2N87 A;  1E6P A;  5ENO D;  2PPO A;  3UIP C;  5EX0 A;  2IO3 C;  4G8L A;  5C1D A;  2KBX A;  5KNH D;  3PZ1 A;  3GZS A;  4APO A;  3SGH A;  4AVX A;  2VGY A;  2C0M A;  4JZY A;  4B94 A;  1MX6 A;  2XS1 A;  2HM8 A;  1TJC A;  3DPD A;  1KT1 A;  5HUA A;  4AY5 A;  3WL0 A;  1Y6I A;  4OVV A;  3S7B A;  3L22 A;  3LUO A;  4ATZ D;  3ZU7 B;  1PAQ A;  2RG8 A;  4AY6 A;  2WXO A;  5HW8 A;  4UWH A;  1ZK6 A;  1TEZ A;  2IEJ A;  3TG5 A;  3MKR A;  3ZYM A;  2HE0 A;  4NUR A;  5CMW A;  1TJF A;  4A1S A;  1FKJ A;  1HKM A;  2XHE A;  5AJD A;  3FU5 A;  1HO8 A;  2UY1 A;  4WNF A;  3UT4 A;  3UQA A;  3LJN A;  3E32 A;  3KZ7 A;  3UM3 A;  4JFJ A;  3LY8 A;  2AJA A;  3AU5 A;  2GRN B;  2DYS E;  2X6I A;  3IHY A;  3ARV A;  3PVL A;  3ZGQ A;  2PQR A;  4LER A;  1DCQ A;  3NQP A;  3QDN A;  3G6L A;  3ESL A;  2PV3 A;  5CED B;  3U66 A;  4R0X A;  5JMN D;  3FH8 A;  3AJI A;  3UM1 A;  1TR4 A;  3AS8 A;  4R7L A;  1OCO E;  4JD2 G;  3ULE G;  5LCW J;  3PRA A;  1KZO A;  3E33 A;  3L08 A;  3O5M A;  4ANX A;  4GCO A;  2VGX B;  4WNE A;  3RO3 A;  2DSZ A;  4KYO B;  2XP4 A;  5HKG A;  1NMW A;  4EZK A;  4J8E A;  3HHM A;  3ISM C;  1KZP A;  3UPV A;  4DRH A;  2QYJ A;  3C3R A;  1HKK A;  2XCC A;  4UWG A;  3FU6 A;  4GTQ A;  2X3M A;  3Q5M A;  1Q1C A;  3MDY B;  4L72 B;  1TNZ A;  5HW6 A;  4AOF A;  3EIJ A;  4QQI A;  1E9L A;  2I9C A;  2DT0 A;  4K5B A;  2ZQV A;  4IPX A;  4IQC A;  1LF8 A;  4DWS A;  4RVB A;  3FY1 A;  5DEZ A;  3CGN A;  1FKT A;  1HF8 A;  5CBN A;  2BKK B;  4AY1 A;  2O9O A;  5HQ8 A;  4J6I A;  1NSG A;  2L9B A;  4Z2L A;  2B31 A;  1S70 B;  1LTX A;  2ILR A;  4G23 A;  1DCE A;  4WUY A;  2DPE A;  3HVE B;  3DXM G;  3D9P A;  3D9H A;  3CVX A;  2FAP A;  4AM9 A;  4F6R D;  3ZW3 A;  1DC2 A;  2BUG A;  4HI9 A;  1HG5 A;  5BPP A;  4Y6C A;  5KJM A;  1FKI A;  2J07 A;  3G2W A;  2XEV A;  4JHK A;  5IY5 E;  3UM0 A;  3RRU A;  1S0P A;  3Q78 A;  2KCV A;  3QNK A;  3BU8 A;  3QAQ A;  1G3N B;  1WDY A;  4DRP A;  4UWK A;  4Y6W A;  1W1Y A;  4H7Y A;  3Q7A A;  4HLL A;  2R59 A;  5DIU A;  4E85 A;  5E75 A;  4PH4 B;  3VLD A;  3LVR E;  3NTP A;  2XPB A;  4B89 A;  3VTX A;  1UG3 A;  1K1A A;  4KMO A;  2EQX A;  2KXP C;  4DRI A;  4FHJ A;  4KXK B;  1J6Y A;  2WQ6 A;  4S3J A;  3MKQ A;  1HH8 A;  3DEO A;  4LAX A;  4K0R A;  2YHC A;  2DSW A;  3SO8 A;  2DZN A;  2XZD G;  1H2U A;  3PUJ A;  3Q49 B;  1H0I A;  4HXI A;  1J4I A;  4DRN A;  4U8H A;  4DX6 D;  4IT4 A;  3LDZ A;  1OWN A;  4GTT A;  3TAX A;  4MKT A;  3DSV A;  3PRD A;  4LAV A;  1IHG A;  3CVY A;  2KE0 A;  1JND A;  1HFA A;  4I2Z A;  4J8F A;  1IX5 A;  3QKY A;  5JJT A;  2ZGG A;  5G04 C;  1J4H A;  1BI7 B;  4GTV A;  4PS8 A;  5HBF A;  3Q75 A;  4BES A;  2H6I A;  1PBK A;  4G11 A;  4GU5 A;  4JFL A;  5FZR A;  3FWV A;  1OGB A;  3DSX A;  5FT9 A;  3EHN A;  2KR7 A;  5DF0 A;  3DEP A;  1ELW A;  1Z5S C;  4WWP A;  5HI7 A;  1EDQ A;  1FKD A;  2XP3 A;  1NA3 A;  4TV3 A;  3PDN A;  3NAW A;  1JCR A;  5CCL A;  1KLX A;  4JVS A;  3FDH A;  3TWV A;  2IO2 C;  3EHM A;  5KJL A;  4JC8 A;  2F37 A;  4FJZ A;  4TNS A;  1WY6 A;  3HXE A;  3VAW A;  3FTX A;  2YIN A;  4XIF A;  2AXU A;  2WPV A;  1E8X A;  2ZR5 A;  1OUV A;  2JAB A;  3Q73 A;  1LD8 A;  4TUU A;  3AS3 A;  3OAW A;  3C3Q A;  1MX4 A;  4DX1 A;  4EEC A;  4YDW A;  2WXR A;  4DRM A;  2Y78 A;  5DIV A;  3FEX A;  1ELK A;  4MNK A;  4GZC A;  1U3D A;  4W5U A;  5EN5 D;  3CST A;  4GTO A;  2LNI A;  5AYW D;  3ONK A;  4GMR A;  5DBK A;  2AW6 A;  4B93 B;  2JZV A;  2VSO E;  3ZEF A;  1FKR A;  4DIP A;  3ASO E;  3WD3 A;  4DLO A;  1H0G A;  2IQC A;  2X6K A;  2ZXW E;  1UN8 A;  2CG3 A;  3HDX A;  2OVF A;  2AOS A;  4BY6 A;  3AU4 A;  3MCX A;  2F8Y A;  5B1A E;  1N4Q A;  2Y4T A;  4N2Q A;  3JUE A;  4YDO A;  3LVQ E;  1WB0 A;  3QB2 A;  3ULQ A;  1RW2 A;  3OXF A;  3SFZ A;  2I1K A;  2WXQ A;  3FUL A;  3KAB A;  1NP7 A;  1YAT A;  5BNW A;  1P5Q A;  3IXE A;  2MLY A;  2YQ8 A;  5HRY A;  2NC9 A;  1WAO 1;  1V54 E;  2CHZ A;  4HOU A;  1GOI A;  3O5J A;  3VTY A;  1E6R A;  2IF4 A;  3GW4 A;  4PTM A;  1WAW A;  2DT2 A;  2XP5 A;  2WVI A;  2XPZ A;  4XKB A;  3UT8 A;  3ZYK A;  4J0U A;  1HG2 A;  3LXU X;  4DT4 A;  4Z2H A;  1K9T A;  2RUD A;  3J5P A;  1SA4 A;  2V4L A;  2M1I A;  2MRI A;  1ZCN A;  1BD8 A;  1D7H A;  3PZ4 A;  4GCN A;  3IK8 A;  3O5R A;  4I6E A;  3TWX A;  2PN0 A;  2RUR A;  4C02 B;  4W9Q A;  1TNB A;  1QYM A;  3WD2 A;  3UI6 A;  1Z6T A;  4WWO A;  3AS0 A;  3RM9 A;  2VSN A;  1X6L A;  3FAP A;  1JCS A;  5ARG A;  5AQ9 A;  4U95 D;  2WXI A;  1FD9 A;  3LY7 A;  4EHM A;  1N4R A;  2ZQT A;  4NAC A;  4QZV B;  3ZHE B;  4GZD A;  4DZ3 A;  2A5E A;  2L0I A;  1W1V A;  1TNO A;  4U07 A;  2I1J A;  3BG1 B;  3ENE A;  4LG6 A;  4GTP A;  3ZIM A;  4CDM A;  3KS2 A;  1E90 A;  1OWM A;  4R5E A;  5BV0 A;  4HOT A;  4P8V A;  5EX3 A;  3O5K A;  2AWI A;  3TWS A;  2XRZ A;  1JWF A;  4HI8 A;  1JNE A;  4MSP A;  4WKH A;  1ELR A;  2IY0 C;  4N5Q A;  4F3V A;  1OT8 A;  4NZC A;  1M5Y A;  1QNF A;  2VGX A;  3CHC A;  4LNG A;  1LD7 A;  1H6O A;  2ZU6 B;  4CDN A;  4JYS A;  2A5U A;  3UQ3 A;  4U7E B;  2IOS A;  2GRM A;  3KSL A;  2LSU A;  4UI9 C;  4YDY A;  2XP8 A;  2PZI A;  5FIO A;  1EF1 C;  4MLP A;  3EUV A;  5CHE E;  4UQY A;  2WXM A;  3LS8 A;  3PRE A;  3HRA A;  4GYW A;  1TFV A;  4HRL A;  4XAK A;  2FO1 E;  3CZ8 A;  2KI3 A;  3CK9 A;  5FZS A;  4P8W A;  1HKI A;  2OEW A;  3UIN C;  5CEC B;  2G41 A;  3ART A;  1QZ2 A;  3T8M A;  1EQ3 A;  2XEH A;  4APF A;  3O5O A;  3RJV A;  3EU5 A;  4PS7 A;  4I1O B;  3T9K A;  4YVQ C;  3TXN A;  1XRV A;  3WXX A;  4UUC A;  2KAT A;  1TN6 A;  3FUE A;  2VTB B;  2KM4 A;  5JHB A;  4LAY A;  3CQG B;  3LYA A;  4J4N A;  1NWR A;  4RSY A;  2P4V A;  1N54 A;  3K9I A;  3E34 A;  3ARW A;  2KGJ A;  1HXI A;  4DRJ A;  1W3B A;  3IHZ A;  3JUI A;  3O4Z A;  4AV7 A;  2WXN A;  3QWP A;  2JEK A;  4GB9 A;  2WMO A;  3ML9 A;  3EIP A;  2I6H A;  3KAH A;  2JLB A;  2MPH A;  3DSS A;  3FHE A;  3FP3 A;  3LY9 A;  3ABK E;  4AIF A;  2WXF A;  2O92 A;  1E8Z A;  4L2L A;  4NNR A;  3OXG A;  3BMB A;  3FH5 A;  4U84 A;  3I3N A;  3SFY A;  1SYT A;  4RQI A;  2CFZ A;  3LJ3 A;  3CK7 A;  3APF A;  5BV1 A;  2RQS A;  5JHA A;  3D9I A;  4DRQ A;  3CIA A;  5JJ7 A;  3Q9N C;  1SA5 A;  1N11 A;  3ARX A;  3O5L A;  3ARR A;  4QT2 A;  4WNG A;  2PV1 A;  2LAH A;  3E37 A;  3FH7 A;  3G2V A;  1GRJ A;  4I9C A;  1A5E A;  4UI9 K;  5ENS D;  3D9L A;  3T5X A;  1D7J A;  4G8K A;  1AP7 A;  3GTY X;  1D6O A;  2J8S D;  3JYS A;  4KVM A;  1FJD A;  5LFA A;  3GZ1 A;  1NWS A;  3CHP A;  4O60 A;  4A55 A;  1BPO A;  3I4G A;  2CFU A;  1GPF A;  1QBQ A;  4DUI A;  1F40 A;  3FY4 A;  2Y3A A;  2AXZ A;  3UT7 A;  3IKG A;  4EBA A;  2NXP A;  2LGO A;  1FPP A;  1E8Y A;  2QFC A;  4TW7 A;  3R7Q A;  5J90 A;  3KEA A;  5ENT D;  2NSZ A;  4URI A;  4L7T A;  3PZ3 A;  3OTN A;  3S7D A;  4TYO A;  3ZYL A;  3FU0 A;  3HIZ A;  4MBG A;  2OFN A;  3PE3 A;  3TL5 A;  4GZ5 A;  1DVP A;  3EIQ C;  1HU3 A;  2Y4U A;  2LUH A;  3NRK A;  2YHE A; 
#chains in the Genus database with same CATH homology
 4XE0 A;  4IYP A;  4C9B B;  4UQX A;  3L6A A;  4FAP A;  4L23 A;  1FKB A;  4D10 C;  4JFI A;  3I5P A;  5J08 A;  4C0E A;  4ZPW R;  4N3A A;  4FHK A;  1E96 B;  2HO1 A;  4DZ2 A;  3KAD A;  3ARS A;  4GYY A;  1UW4 B;  4LAW A;  3B7R L;  2DSV A;  2Q7F A;  4P29 A;  1FKF A;  4IQ2 A;  2VSY A;  4IT6 A;  3WH0 A;  2PM6 A;  4EPZ A;  3O5I A;  1WNO A;  5G04 J;  3APD A;  4P8X A;  4JHJ A;  4XI0 A;  4OVU A;  5FTP A;  3Q15 A;  4ZPT R;  2M63 A;  5JH8 A;  2X6H A;  3IV0 A;  2XP6 A;  4PUC A;  3MX3 A;  4N2S A;  1INZ A;  1Y8M A;  1SR0 A;  2LJ4 A;  4ODL A;  5T8I A;  3I6C A;  3FUH A;  1IQU A;  3CKC A;  1R9H A;  3PUK A;  2VJ8 A;  1OWL A;  3QJZ A;  4IN3 B;  1UR8 A;  4JXT A;  4N3B A;  3PR9 A;  4LRZ A;  4MRU A;  3C98 A;  1QPF A;  3O5P A;  3SBS A;  3ODK A;  5G55 A;  3RFW A;  1ROU A;  4MPK A;  1UJJ A;  3PRZ A;  5LX8 A;  3RM4 A;  4N5C A;  4EQF A;  4CGV A;  1QQE A;  4GMJ A;  1MQS A;  1Q6U A;  3WIJ A;  4N3C A;  2WMN A;  4ZPV R;  4ILI A;  3RKV A;  4CGW A;  4CDR A;  3B13 A;  1HJX A;  2A3E A;  3JXV A;  2E0I A;  5GPR A;  4ZS6 A;  3RO2 A;  3VLF A;  5HTG A;  2LKN A;  4GA1 A;  2YNQ A;  4B8A A;  2PPN A;  3LPZ A;  2IU1 A;  4Q7N A;  2WK2 A;  5KCM A;  3G2T A;  2X38 A;  4KQZ A;  4NSB A;  3PEU B;  5HWB A;  4GML A;  4CT0 A;  3TDB A;  2WXK A;  3HYM B;  4CT4 A;  2FDM A;  2DT3 A;  4ODR A;  3WD4 A;  5EDS A;  2DG9 A;  3FTZ A;  1LL7 A;  4PDX A;  3FTW A;  3IKO B;  3IHV A;  1W1P A;  2UY1 B;  4DI3 A;  4A3V A;  3SHF A;  3CLJ A;  1E6Z A;  1W26 A;  3FUF A;  3SI5 A;  1VF8 A;  3RRN B;  4FC8 A;  2A3A A;  4U63 A;  1NZN A;  4BSX A;  2XQ0 A;  3GPK A;  3B7T A;  2RSE A;  3B7X A;  3MJW A;  4EBA G;  3KCE A;  2WM9 A;  2R17 C;  4GZ3 A;  1O6I A;  3FUJ A;  3RME A;  4EZJ A;  1NH6 A;  4DWS C;  4O2T A;  1JUQ A;  3G2S A;  3QC1 A;  2PM7 A;  4JA7 A;  2PI6 A;  4WJX A;  4JL0 A;  1Z3X A;  3O5F A;  2M08 A;  2K8I A;  4FLH A;  4FA6 A;  1ZB5 A;  4IRU A;  3SNX A;  2KC7 A;  4KVO A;  1D2K A;  2LPV A;  3ZRH A;  3ASG A;  1LQ0 A;  4JFM A;  4G26 A;  4KBQ A;  4UWL A;  4BWR A;  5G05 C;  1H2T C;  2J09 A;  2IFU A;  5J6E A;  2A3B A;  2KZT A;  2FEZ A;  4M3O A;  1SZA A;  3RGC A;  4DWS B;  2WXL A;  1IYG A;  3QWW A;  2CHW A;  2GW1 A;  3ARU A;  5A7D B;  3UF8 A;  3H9R B;  2DT1 A;  1W1T A;  1NWT A;  1ROT A;  4LUN U;  2VTB A;  4LGX A;  3ASD A;  2X6J A;  1NA0 A;  4I1A A;  5EKQ D;  1EHN A;  4G1T A;  1E15 A;  4MGV A;  4Z2I A;  2GGF A;  4W9P A;  1EIB A;  5HWC A;  4U85 A;  1GUV A;  2VQ2 A;  3IKD A;  3CSF A;  3DBS A;  3LCA A;  4I6J A;  4Z2G A;  3RRM B;  3NZU A;  3L54 A;  1T11 A;  4F1S A;  4DJA A;  4LCT A;  3ARP A;  3PA7 A;  2P58 C;  4GA2 A;  4DK5 A;  1FAP A;  3B9A A;  4A1G A;  4G2V A;  1EPU A;  1ZBK A;  3WQV A;  2PQN A;  1B6C A;  2FO7 A;  4GA0 A;  2ITK A;  4U0Z A;  4XI9 A;  3ONL A;  4AEZ C;  5FZQ A;  1E8W A;  3AS2 A;  2G8Z A;  4HOQ A;  1UN9 A;  4MNJ A;  3ZVV A;  1ZBV A;  4JEH A;  1H6K A;  3FU3 A;  1HKJ A;  3CK8 A;  2FUL A;  1EYH A;  1FKS A;  4XX5 A;  2XP9 A;  2PV2 A;  5E76 A;  3MV3 B;  2WXJ A;  3U4T A;  2CG2 A;  3ZXS A;  5AIJ A;  4RG6 A;  3R9A B;  4RG9 A;  3G2U A;  5D0Q D;  5KJN A;  4GYO A;  1Q6I A;  2ZR4 A;  2ZQU A;  3SF4 A;  3ALF A;  3CVL A;  2MOW A;  3FUM A;  4UQZ A;  3I4R B;  2BF0 X;  2HYZ A;  4JA9 A;  4HFG A;  2RUQ A;  2DG4 A;  2V5F A;  2OND A;  3BEE A;  1BL4 A;  1HJV A;  3UMV A;  5A6C A;  4AP2 A;  4HLE A;  2WB2 A;  2R5S A;  3ASH A;  4WIW A;  1HXV A;  5DIZ A;  3FTY A;  5FQ7 A;  5I98 A;  2L6J A;  3O5Q A;  4U86 A;  2J9Q A;  3PNT B;  5D0O D;  2VN1 A;  3KD7 A;  2A3C A;  4JHR A;  1HS6 A;  4HOS A;  1OGG A;  1DNP A;  4I1M A;  3O5D A;  5FJY A;  4BX8 A;  3PH0 C;  5CMY A;  2WQH A;  1X5B A;  4BX9 A;  5M72 A;  3KAF A;  2VYI A;  4HS2 A;  3NI6 A;  5JJ6 A;  1FKK A;  3KAC A;  1W9V A;  4U04 A;  1H19 A;  4XZ4 A;  1JNS A;  2HR2 A;  1VDY A;  4ODM A;  3MYV A;  4CRW A;  3S7J A;  3APC A;  3S7F A;  3KEZ A;  1A17 A;  4JPS A;  1QPL A;  3W4R A;  4MNM A;  3CHQ A;  5BT1 A;  3HVE A;  2XP7 A;  5HW7 A;  3ZPJ A;  1L5J A;  2PPP A;  2IOL A;  2KCL A;  2RUC A;  4FJY A;  5GPG A;  2ION A;  4L2Y A;  2FKE A;  1D7I A;  1RD6 A;  2WXP A;  2RD0 A;  3TG4 A;  4XKC A;  2L0T B;  4DPR A;  5T3R A;  2XGS A;  1F8A B;  4ILG A;  3TXM A;  3CHS A;  3FUI A;  3TGO A;  1LG2 A;  1E7V A;  2C0L A;  3CGM A;  4I43 A;  5HT1 A;  1ZBW A;  3MGB A;  5FWQ A;  3B7U X;  3CVN A;  1Q6H A;  3ARY A;  2LSV A;  2KO7 A;  4MTV A;  4BT9 A;  1HZ4 A;  1ITX A;  4GIV A;  2XRY A;  4JEU A;  4LEU A;  1NWU A;  1XNF A;  4HVB A;  3MEK A;  1IQR A;  2QY7 A;  4YVO A;  3D9M A;  3GZ2 A;  4J8S A;  3FEY A;  3ZFW A;  4V3I A;  2AXV A;  3CVQ A;  2J08 A;  4Q22 A;  3D3M A;  2J4D A;  5FQ4 A;  3WL1 A;  2OOE A;  2WXH A;  4BTB A;  4JFK A;  2MLZ A;  2DSU A;  4FP7 A;  2LAI A;  3CGH A;  4W9O A;  2V8S E;  3CQC B;  3JCK C;  1FKG A;  1EDU A;  4GGQ A;  2XGO A;  3ALG A;  4FUL A;  2WXG A;  3FTU A;  1W9U A;  3URZ A;  4KZC A;  3CR3 A;  3IEG A;  5DIT A;  4BF8 A;  2XGM A;  4WKA A;  3PZD A;  3WKZ A;  3PRB A;  4IUL A;  3U64 A;  4DLQ A;  3O5G A;  2WQ7 A;  4FN2 A;  2YBT A;  3VLE A;  1FFR A;  3E4B A;  2BTD A;  4ANW A;  1J4R A;  4KR0 B;  3EJN A;  4I9E A;  4MS6 A;  1ZBP A;  4HOR A;  1HJW A;  4ODQ A;  5BW8 C;  4DRO A;  2WM0 A;  3L17 A;  3S2A A;  3CVV A;  3KAE A;  3CH9 A;  3D9N A;  2OLH A;  5LP0 A;  4E6H A;  2F2D A;  2L2S A;  1KT0 A;  2UWJ G;  3ARZ A;  2XPY A;  1A7X A;  3GYZ A;  4J8D A;  3Q4A B;  2DG3 A;  2FBN A;  3JQ1 A;  2A4Z A;  4KT6 B;  1N1A A;  5FQ6 A;  3RK6 A;  3B7S A;  1LJY A;  3B9D A;  3RM8 A;  3ESK A;  2Q5A A;  3B8S A;  3CHO A;  4DRK A;  3U3W A;  1OWP A;  3MA5 A;  1N52 A;  3WD1 A;  4DWS D;  4B8C B;  4GPK A;  2QF8 A;  2XPI A;  3JQ0 A;  3JYM A;  1OWO A;  4I17 A;  4H7X A;  3ARQ A;  2DCP A;  3L13 A;  3AQU A;  3L16 A;  4ODP A;  5G05 J;  1XHG A;  2KCK A;  4PS3 A;  3CHD A;  4URK A;  4TW6 A;  3CHM A;  4L1B A;  5LCW C;  1SQM A;  3FUN A;  3WD0 A;  2X6F A;  1Z3Y A;  2UZ5 A;  3B9E A;  3CVU A;  5ARF A;  3RU0 A;  5ANR A;  3OXL A;  4C0M A;  3NZS A;  2MF9 A;  3FTS A;  4QT3 A;  3FTV A;  4TX0 A;  1FFQ A;  1EYM A;  4Q69 A;  1LL4 A;  3QAR A;  4ODK A;  2MHK A;  3O48 A;  2WLY A;  4JW1 A;  4NQ0 A;  1Y0O A;  4EZL A;  3CVP A;  3ZHE A;  4I6G A;  3NF1 A;  3CV0 A;  1UR9 A;  3ARO A;  2PL2 A;  4B0Z A;  4QFV A;  3PNL B;  4G25 A;  5G2N A;  2VSX E;  3TCZ A;  2E2E A;  1ZBC A;  4N19 A;  3CVW A;  4ILH B;  4MAV A;  5GQB A;  3G6M A;  5C2Y A;  4FLB A;  3PS6 A;  3UI5 A;  4L3N A;  1WM5 A;  3CHF A;  2KFW A;  4ATG A;  3CHR A;  4ANV A;  1C9H A;  4Z2J A;  1FKL A;  2AVP A;  5AJL A;  4S3K A;  4F53 A;  1YW5 A;  5FQ8 A;  3EDT B;  1OWQ A;  3ML8 A;  2XPA A;  4WKF A;  4HBE A;  3MZL B;  1L1P A;  5ANL A;  2MLX A;  1E7U A;  4J4O A;  1X6N A;  4KZ0 A;  1GW6 A;  3TJP A;  1ZU2 A;  3D9K A;  1FVH A;  1U79 A;  4Q94 A;  2ZR6 A;  3UQI A;  1HX8 A;  1LL6 A;  5AEN A;  4WK9 A;  4U0S A;  4UWF A;  1JVW A;  4F7A A;  4Z2K A;  4G50 A;  3R7R A;  3CKB A;  2J4B A;  3QK0 A;  1PIN A;  4OYS A;  4ANU A;  4WND A;  4FAD A;  2VCD A;  4UI9 J;  1NMV A;  5BUZ A;  1JNT A;  2MNT A;  3KAG A;  1KFW A;  3UQB A;  4BTA A;  1E6N A;  4CEM A;  1JWG A;  4WWN A;  2OVB A;  3PE4 A;  3QOU A;  1HE8 A;  1ZL1 A;  2PBC A;  4ODN A;  3WQW A;  1ZU8 A;  1TCO C;  3UX4 A;  3SBT B;  4GAA A;  3UUX A;  3O5E A;  3OOB A;  2ZQS A;  3ASF A;  4ABN A;  4O6F A;  2XCB A;  3MKQ B;  3KAI A;  2OV8 A;  2LO6 A;  3ZYQ A;  1YA0 A;  1LG1 A;  4GZ6 A;  3QWV A;  2F4E A;  3MV2 B;  3PEV B;  3FFL A;  2WLZ A;  1PY1 A;  3BXW A;  3FXY A;  4HBO A;  4AJW A;  1MHQ A;  3QOK A;  2J49 A;  3SZ7 A;  3RIB A;  2AWG A;  1H2V C;  4HAR A;  3D9J A;  2FF4 A;  2V0P A;  5B8I C;  3P1U A;  3FUD A;  3FUK A;  3SD5 A;  1W9P A;  4W9R A;  3CEQ A;  5CCM A;  4N39 A;  4U0U A;  2I2O A;  4ITZ A;  5T4Y A;  5BXJ A;  3AS4 A;  3AS5 A;  3Q47 B;  4ACK A;  5KJK A;  1FVF A;  1H0A A;  4YND A;  1UJK A;  3UI4 A;  1FKH A;  4AXH A;  4MNL A;  4DH0 A;  4Q96 A;  4G24 A;  3P2B A;  2IUZ A;  4ODO A;  4QIB A;  1BKF A;  4WAF A;  3IBE A;  2KZT B;  3BG0 B;  3N71 A;  4G2P A;  3JYJ A;  2D9F A;  3LEW A;  4I2W A;  1FCH A;  4CCA A;  1B89 A;  2M2A A;  3AS1 A;  2FI7 A;  4DI4 A;  5LOZ A;  5DO2 A;  4ML4 A;  2C2L A;  1PC2 A;  3CHE A;  4NRH B;  5D75 A;  2GRL A;  4P8U A;  4BT8 A;  3D9O A;  2CHX A;  3TC5 A;  4TW8 A;  1JPL A;  2DIW A;  3EY6 A;  2YBU A;  4FU3 A;  4K03 A;  2IJG X;  3OA5 A;  2DBA A;  1CTN A;  3LKU A;  4ME2 A;  1XGW A;  1U3C A;  4ACL A;  3ZN3 A;  4A3T A;  4TRQ A;  3T5V A;  2F21 A;  5A23 A;  1SZ9 A;  5ENN A;  2ESC A;  4BFR A;  3U9W A;  2N87 A;  1E6P A;  2PPO A;  5EX0 A;  5C1D A;  3GZS A;  4APO A;  3SGH A;  4AVX A;  2VGY A;  2C0M A;  4JZY A;  4B94 A;  2HM8 A;  1TJC A;  3DPD A;  1KT1 A;  5HUA A;  4AY5 A;  3WL0 A;  1Y6I A;  4OVV A;  3S7B A;  3L22 A;  3LUO A;  1PAQ A;  2RG8 A;  4AY6 A;  2WXO A;  5HW8 A;  4UWH A;  1ZK6 A;  1TEZ A;  3TG5 A;  3MKR A;  3ZYM A;  4NUR A;  5CMW A;  1TJF A;  4A1S A;  1FKJ A;  1HKM A;  2XHE A;  5AJD A;  3FU5 A;  1HO8 A;  2UY1 A;  4WNF A;  3UT4 A;  3UQA A;  3KZ7 A;  4JFJ A;  3LY8 A;  3AU5 A;  2X6I A;  3IHY A;  3ARV A;  3PVL A;  3ZGQ A;  2PQR A;  4LER A;  3NQP A;  3QDN A;  3G6L A;  3ESL A;  2PV3 A;  3U66 A;  4R0X A;  3FH8 A;  3AS8 A;  4R7L A;  5LCW J;  3PRA A;  3L08 A;  3O5M A;  4ANX A;  4GCO A;  2VGX B;  4WNE A;  3RO3 A;  2DSZ A;  4KYO B;  2XP4 A;  5HKG A;  1NMW A;  4EZK A;  4J8E A;  3HHM A;  3UPV A;  4DRH A;  1HKK A;  2XCC A;  4UWG A;  3FU6 A;  2X3M A;  3Q5M A;  1Q1C A;  3MDY B;  4L72 B;  5HW6 A;  4AOF A;  3EIJ A;  1E9L A;  2I9C A;  2DT0 A;  2ZQV A;  4IPX A;  4IQC A;  1LF8 A;  4DWS A;  4RVB A;  3FY1 A;  5DEZ A;  3CGN A;  1FKT A;  1HF8 A;  4AY1 A;  2O9O A;  5HQ8 A;  4J6I A;  1NSG A;  2L9B A;  4Z2L A;  2B31 A;  4WUY A;  2ILR A;  4G23 A;  2DPE A;  3HVE B;  3D9P A;  3CVX A;  2FAP A;  4AM9 A;  3ZW3 A;  2BUG A;  1HG5 A;  5BPP A;  4Y6C A;  5KJM A;  1FKI A;  2J07 A;  3G2W A;  2XEV A;  4JHK A;  3RRU A;  1S0P A;  2KCV A;  3QNK A;  3QAQ A;  4DRP A;  4UWK A;  4Y6W A;  1W1Y A;  4H7Y A;  2R59 A;  5DIU A;  4E85 A;  5E75 A;  4PH4 B;  3VLD A;  3LVR E;  3NTP A;  2XPB A;  4B89 A;  3VTX A;  1UG3 A;  4KMO A;  2EQX A;  4DRI A;  4FHJ A;  4KXK B;  1J6Y A;  2WQ6 A;  4S3J A;  3MKQ A;  1HH8 A;  4LAX A;  4K0R A;  2YHC A;  2DSW A;  1H2U A;  3PUJ A;  3Q49 B;  1H0I A;  4HXI A;  1J4I A;  4DRN A;  4U8H A;  4IT4 A;  3LDZ A;  1OWN A;  3TAX A;  4MKT A;  3PRD A;  4LAV A;  1IHG A;  3CVY A;  2KE0 A;  1JND A;  1HFA A;  4I2Z A;  4J8F A;  1IX5 A;  3QKY A;  5JJT A;  5G04 C;  1J4H A;  4PS8 A;  5HBF A;  1PBK A;  4G11 A;  4GU5 A;  4JFL A;  5FZR A;  3FWV A;  1OGB A;  5FT9 A;  3EHN A;  2KR7 A;  5DF0 A;  1ELW A;  4WWP A;  5HI7 A;  1EDQ A;  1FKD A;  2XP3 A;  1NA3 A;  4TV3 A;  3PDN A;  5CCL A;  1KLX A;  4JVS A;  3FDH A;  3EHM A;  5KJL A;  4JC8 A;  4FJZ A;  4TNS A;  1WY6 A;  3VAW A;  3FTX A;  2YIN A;  4XIF A;  2AXU A;  2WPV A;  1E8X A;  2ZR5 A;  1OUV A;  4TUU A;  3AS3 A;  3OAW A;  4EEC A;  2WXR A;  4DRM A;  2Y78 A;  5DIV A;  3FEX A;  1ELK A;  4MNK A;  4GZC A;  1U3D A;  4W5U A;  3CST A;  5AYW D;  2LNI A;  3ONK A;  5DBK A;  2AW6 A;  2JZV A;  2VSO E;  3ZEF A;  1FKR A;  4DIP A;  3WD3 A;  4DLO A;  1H0G A;  2IQC A;  2X6K A;  1UN8 A;  2CG3 A;  3HDX A;  2OVF A;  2AOS A;  4BY6 A;  3AU4 A;  3MCX A;  2Y4T A;  4N2Q A;  3LVQ E;  1WB0 A;  3QB2 A;  3ULQ A;  3OXF A;  3SFZ A;  2I1K A;  2WXQ A;  3FUL A;  3KAB A;  1NP7 A;  1YAT A;  5BNW A;  1P5Q A;  2MLY A;  2YQ8 A;  2NC9 A;  1WAO 1;  2CHZ A;  4HOU A;  1GOI A;  3O5J A;  3VTY A;  1E6R A;  2IF4 A;  3GW4 A;  4PTM A;  1WAW A;  2DT2 A;  2XP5 A;  2XPZ A;  2WVI A;  4XKB A;  3UT8 A;  3ZYK A;  4J0U A;  1HG2 A;  3LXU X;  4DT4 A;  4Z2H A;  1K9T A;  2RUD A;  2V4L A;  2M1I A;  2MRI A;  1ZCN A;  1D7H A;  4GCN A;  3IK8 A;  3O5R A;  4I6E A;  2RUR A;  4C02 B;  4W9Q A;  3WD2 A;  3UI6 A;  1Z6T A;  4WWO A;  3AS0 A;  3RM9 A;  2VSN A;  1X6L A;  3FAP A;  5ARG A;  2WXI A;  1FD9 A;  3LY7 A;  2ZQT A;  4NAC A;  4QZV B;  3ZHE B;  4GZD A;  4DZ3 A;  2L0I A;  1W1V A;  4U07 A;  2I1J A;  3BG1 B;  3ENE A;  3ZIM A;  4CDM A;  3KS2 A;  1E90 A;  1OWM A;  4R5E A;  5BV0 A;  4HOT A;  4P8V A;  5EX3 A;  3O5K A;  2AWI A;  2XRZ A;  1JWF A;  1JNE A;  4MSP A;  4WKH A;  1ELR A;  4F3V A;  4NZC A;  1M5Y A;  1QNF A;  2VGX A;  3CHC A;  2ZU6 B;  4JYS A;  4CDN A;  2A5U A;  3UQ3 A;  2IOS A;  2GRM A;  2LSU A;  4UI9 C;  2XP8 A;  2PZI A;  1EF1 C;  4MLP A;  5CHE E;  4UQY A;  2WXM A;  3LS8 A;  3PRE A;  4GYW A;  1TFV A;  4XAK A;  3CZ8 A;  2KI3 A;  3CK9 A;  5FZS A;  4P8W A;  1HKI A;  2G41 A;  3ART A;  1QZ2 A;  3T8M A;  1EQ3 A;  4APF A;  3O5O A;  3RJV A;  4PS7 A;  4I1O B;  4YVQ C;  3TXN A;  1XRV A;  3WXX A;  2KAT A;  3FUE A;  2VTB B;  2KM4 A;  5JHB A;  4LAY A;  3CQG B;  3LYA A;  4J4N A;  1NWR A;  4RSY A;  1N54 A;  3K9I A;  3ARW A;  2KGJ A;  1HXI A;  4DRJ A;  1W3B A;  3IHZ A;  3JUI A;  3O4Z A;  4AV7 A;  2WXN A;  3QWP A;  2JEK A;  4GB9 A;  2WMO A;  3ML9 A;  2I6H A;  3KAH A;  2JLB A;  2MPH A;  3FHE A;  3FP3 A;  3LY9 A;  4AIF A;  2WXF A;  2O92 A;  1E8Z A;  4L2L A;  4NNR A;  3OXG A;  3FH5 A;  4U84 A;  3I3N A;  1SYT A;  2CFZ A;  3LJ3 A;  3CK7 A;  3APF A;  5BV1 A;  2RQS A;  5JHA A;  3D9I A;  4DRQ A;  3CIA A;  5JJ7 A;  3ARX A;  3O5L A;  3ARR A;  4QT2 A;  4WNG A;  2PV1 A;  2LAH A;  3FH7 A;  3G2V A;  4I9C A;  4UI9 K;  3D9L A;  3T5X A;  1D7J A;  1D6O A;  3JYS A;  4KVM A;  1FJD A;  5LFA A;  3GZ1 A;  1NWS A;  3CHP A;  4A55 A;  1BPO A;  3I4G A;  2CFU A;  1GPF A;  1F40 A;  3FY4 A;  2Y3A A;  2AXZ A;  3UT7 A;  3IKG A;  4EBA A;  2NXP A;  2LGO A;  1E8Y A;  2QFC A;  4TW7 A;  3R7Q A;  5J90 A;  2NSZ A;  4URI A;  4L7T A;  3OTN A;  3S7D A;  4TYO A;  3ZYL A;  3FU0 A;  3HIZ A;  2OFN A;  3PE3 A;  3TL5 A;  4GZ5 A;  1DVP A;  3EIQ C;  1HU3 A;  2Y4U A;  3NRK A;  2YHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...