2IF4A

Crystal structure of a multi-domain immunophilin from arabidopsis thaliana
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
258
structure length
258
Chain Sequence
NVPPKVDSEAEVLDEKVSKQIIKEGHGSKPSKYSTCFLHYRAWTKNSQHKFEDTWHEQQPIELVLGKEKKELAGLAIGVASMKSGERALVHVGWELAYGKEGNFSFPNVPPMADLLYEVEVIGFDETKEGKARSDMTVEERIGAADRRKMDGNSLFKEEKLEEAMQQYEMAIAYMGDDFMFQLYGKYQDMALAVKNPCHLNIAACLIKLKRYDEAIGHCNIVLTEEEKNPKALFRRGKAKAELGQMDSARDDFRKAQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Multi-domain Immunophilin from Arabidopsis thaliana: A Paradigm for Regulation of Plant ABC Transporters.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein
molecule keywords ATFKBP42
total genus 70
structure length 258
sequence length 258
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2if4A02
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2if4A01
3ASFA 5DITA 3WXXA 5EX0A 4ODKA 2D9FA 2LSUA 3U4TA 1A17A 5BT1A 4NNRA 4IPXA 2VSNA 3GPKA 4UQXA 2MLZA 3RO3A 4G24A 5FZQA 2C2LA 1B6CA 4IN3B 4GA2A 4YVQC 2E2EA 2DG9A 3O5GA 5JJ7A 2FAPA 2VN1A 4LEUA 4AIFA 3GW4A 5HQ8A 4F3VA 4G1TA 1FKTA 4BF8A 3NRKA 2M1IA 4JFMA 4LAXA 4DROA 2PV1A 3OXGA 4DRHA 4IQ2A 3K9IA 4XIFA 2XP8A 4WNFA 2PV3A 4XI0A 5B8IC 2WQHA 2FBNA 2R5SA 1FKHA 5FZRA 4BT8A 3O5MA 3UQBA 2K8IA 4R0XA 2L2SA 5HW7A 4H7YA 2C0MA 2WPVA 3CV0A 3OOBA 3QDNA 4LAYA 5EX3A 1N1AA 3RJVA 3MDYB 5KJNA 1ZK6A 2FF4A 1XNFA 4H7XA 1ZCNA 1JNSA 4U04A 1B89A 5KJLA 2IFUA 3ODKA 2LGOA 1Y8MA 3N71A 4U07A 2LJ4A 5HW6A 3O5JA 4N19A 3WH0A 3LPZA 3ZN3A 2C0LA 5HKGA 3O5KA 1U79A 4HOSA 1BL4A 4DRIA 4GYWA 4G23A 1NMVA 3Q4AB 2XEVA 4KXKB 1YW5A 4GGQA 2DG4A 4APOA 5FTPA 4GCNA 2ZR4A 1YA0A 4FN2A 5HTGA 4TW6A 4UQYA 3Q5MA 2LKNA 1F8AB 2XPBA 1WAO1 4I1AA 3JXVA 4ODLA 5FZSA 5JJ6A 3RIBA 1FKSA 4O6FA 2PQNA 2PZIA 1ZBPA 2KC7A 3GZ2A 4RG6A 5FJYA 3KCEA 3PA7A 3MEKA 4DZ2A 3ZHEA 1YATA 4J4OA 4ODNA 4N3CA 4U0SA 2OOEA 3CVLA 2VQ2A 3KD7A 3LKUA 2ONDA 1A7XA 4DT4A 2RUCA 1BKFA 1JVWA 3MV2B 3QKYA 2KFWA 4ODOA 4MSPA 5D75A 5CCMA 4UI9K 1Y0OA 1QPLA 4J0UA 4WNDA 1D7HA 4N3BA 4GZ5A 3LY7A 3QWWA 3KAGA 4C02B 1Q1CA 5G05J 3CVPA 3OXFA 4ODMA 4CDRA 3MKRA 3Q47B 1HH8A 4MGVA 2PBCA 3ZPJA 4YVOA 3CVNA 2M08A 2PPPA 2MHKA 3IHZA 1KLXA 2XGMA 3O5FA 2VSYA 2XP7A 2YQ8A 3O5DA 3ZGQA 1ROTA 4G2PA 3QWVA 2JZVA 2J9QA 5CHEE 3Q15A 1PC2A 4I9CA 2XP6A 4GIVA 5J6EA 2Q7FA 4W9PA 1J4RA 4UI9J 2KATA 3VTYA 2RUDA 2MLXA 1NZNA 2Y4UA 5AYWD 3UF8A 1ELRA 1FKLA 2UWJG 4Y6CA 4HOTA 3TC5A 3AS5A 3LY9A 5LCWJ 1D7JA 5GPGA 2VGYA 1FKFA 3KZ7A 2ZR5A 2XPIA 1QZ2A 3RFWA 4GYYA 1W3BA 1Q6IA 3CK9A 3CKBA 2DG3A 4I2WA 1NSGA 4I17A 4HOQA 2XP3A 2F2DA 1J6YA 2KCKA 1ELWA 4W9RA 3ESKA 2KCLA 3UI6A 4I9EA 3AS4A 1TJCA 4G50A 3I6CA 4UI9C 2FI7A 3UI4A 3QOUA 3KACA 2VCDA 1FKJA 3O5LA 3S7DA 4ODRA 4ME2A 2AWGA 3SF4A 3RKVA 2Q5AA 5HUAA 5M72A 2JLBA 2DBAA 4U86A 4GPKA 4NQ0A 1Q6HA 2LSVA 5CCLA 2VGXB 3TG4A 5BW8C 3UQIA 2I6HA 2FO7A 2M2AA 4HORA 3O5PA 1IYGA 5DBKA 2L6JA 1NA3A 5I98A 1J4HA 5G04C 3FFLA 4HOUA 3VTXA 2ZR6A 1HXVA 1HXIA 3CVQA 5HW8A 4N39A 5C1DA 2PPNA 4U84A 4DRJA 3PDNA 4G25A 4GZ6A 1L1PA 3PE3A 4TX0A 2ZQUA 3O48A 2PV2A 4LAVA 2F21A 1FAPA 1JNTA 2GW1A 3NTPA 2F4EA 3GYZA 2N87A 2HO1A 2XGOA 4N5CA 2RSEA 2XP4A 5ARGA 3PE4A 3ULQA 3CK8A 3ASDA 2HYZA 2UY1B 3Q49B 3CK7A 3LCAA 4N3AA 4WUYA 4QT2A 4EQFA 1R9HA 3PRDA 3RGCA 4TNSA 4A1SA 2FKEA 2RUQA 4CGWA 5D0OD 1NMWA 2MF9A 1PINA 2KI3A 4YNDA 2HR2A 4TW7A 1D7IA 4W9OA 3KADA 3QWPA 4DRQA 3BEEA 4GA1A 3MV3B 1P5QA 3ASHA 3RO2A 1IHGA 4LAWA 3O5QA 1M5YA 4AY5A 1C9HA 2RQSA 4DRKA 3UI5A 1OUVA 3KS2A 1F40A 2AVPA 3IKGA 3O5RA 4TYOA 4QIBA 1FKBA 3EY6A 4GA0A 1W26A 2XCBA 5BXJA 4ITZA 4ODQA 3UPVA 3KABA 3UUXA 4BTAA 4J8EA 2UZ5A 4O2TA 3VAWA 2XGSA 2MPHA 3ZHEB 3IEGA 4CGVA 1PBKA 3TGOA 4JA7A 1QQEA 2ZQVA 4ODPA 4KYOB 4JFLA 4J4NA 2VYIA 3FP3A 4Y6WA 4U0ZA 4G2VA 3AS8A 4JFJA 3NF1A 4JL0A 2KCVA 5EKQD 3CEQA 2RURA 3ASGA 4DRPA 3U3WA 1FD9A 5LCWC 3GZ1A 1FJDA 3JYSA 2NC9A 3JYMA 3IK8A 4KBQA 4IQCA 2ZQSA 1HZ4A 4DRMA 1Q6UA 2PQRA 3HYMB 1FKRA 4N2QA 3LY8A 3O5IA 3UQAA 2OFNA 4JFKA 3S7FA 2UY1A 4UQZA 3PRBA 4J8DA 4WNEA 4DH0A 5DIVA 1WM5A 2KGJA 5A7DB 4N2SA 4U0UA 1TCOC 2Y4TA 3URZA 4BTBA 5A6CA 2LPVA 3FAPA 3ZFWA 3MA5A 4WNGA 2XP9A 4BT9A 5HWBA 4GZ3A 5DIUA 3KAIA 3CGNA 4I2ZA 4DRNA 3B7XA 4BWRA 2LNIA 4W9QA 3RU0A 4TW8A 5JJTA 4JYSA 3TCZA 2VGXA 5KJMA 3OXLA 2ZQTA 4RG9A 2XPAA 4NRHB 2PL2A 1ZU2A 5HT1A 5DIZA 4FAPA 3TAXA 3O5EA 3TDBA 4GCOA 2ITKA 3LYAA 3EDTB 4U85A 1J4IA 3UQ3A 4G26A 3S7BA 4JFIA 3CKCA 1T11A 3S7JA 4JHRA 1ROUA 2XCCA 5HI7A 1EYMA 3CGMA 3FWVA 5KJKA 3KAEA 2XP5A 2KE0A 1FCHA 3SZ7A 2IF4A 1KT0A 1FKGA 5G04J 3IKDA 1FKDA 3E4BA 3H9RB 1D6OA 1NA0A 3R9AB 4QT3A 5FT9A 4DZ3A 5ARFA 5HWCA 4JA9A 2FEZA 2KR7A 2P58C 2QFCA 2PPOA 3O5OA 4ABNA 1FKKA 3NI6A 5G05C 2MLYA 1EQ3A 3JYJA 1FKIA 1E96B 2Y78A 1QPFA 4AY6A 4B94A 4GYOA 2BUGA 2V5FA 5D0QD 3KAHA 4AM9A 3LUOA 4XI9A 2KO7A 2MNTA 3KAFA 4J8FA 5BNWA 4DIPA 1KT1A 2YHCA 3TG5A
chains in the Genus database with same CATH superfamily
5DITA 4Q96A 1GPFA 3SHFA 5EX0A 4ODKA 4WK9A 2OEWA 4DLQA 3IHVA 1YYHA 1MZCA 5FQ7A 1X5BA 3FTVA 4HS2A 3RO3A 4JB8P 5FZQA 1DCQA 4EZKA 4IN3B 2DG9A 3O5GA 3EIPA 1BD8A 4L1BA 4BFRA 3EU5A 3SGHA 3G6MA 2BEDA 3QARA 3K9IA 4XIFA 4AVXA 2XP8A 3BG1B 4XI0A 3RMEA 4URKA 4LCTA 4H7YA 2C0MA 4LGXA 3DSSA 3T9KA 1TN8A 2ZU6B 3FTZA 3MDYB 1ZK6A 5AJLA 1ZCNA 3RK6A 2YNQA 3CHDA 2LGOA 1FT1A 2LJ4A 1JCHB 3D9JA 3O5JA 3LPZA 4KQZA 2BKGA 2IO3C 3LVQE 5HKGA 4GTRA 1U79A 3O5KA 4OAVB 3AS1A 1E8WA 1BL4A 1UR9A 4GYWA 1HX8A 1JWFA 3PZ3A 3G2UA 3ZEFA 4GGQA 3D3MA 4I43A 3SY2A 3ONLA 2ETNA 1YA0A 1UJJA 3TWWA 4TW6A 1HJWA 3Q5MA 5HBFA 2J07A 3EJNA 3FTSA 2WXQA 1TFVA 1IQRA 1W1PA 5CEAA 3B7TA 2A5EA 4L9PA 4YDYA 3ZU7B 2PZIA 2BTDA 1E8ZA 2KC7A 3KCEA 3MEKA 1Z5SC 1VF8A 2CG2A 2IOLA 1YATA 2RKKA 2H6GA 4J4OA 4U0SA 2OOEA 5LOZA 3CVLA 1OWLA 4Q69A 2AJAA 1BKFA 3P2BA 3QKYA 4MSPA 3ZYQA 4NSBA 3KSLA 3SBSA 1QPLA 2L0TB 3WKZA 3WQWA 1BI8B 3L82A 4EZJA 4NZCA 3KSQA 4YDEA 3AS2A 3EHMA 4KZCA 1EHNA 1U3CA 1ZBWA 1O1TA 3TWQA 1ZU8A 2PPPA 2QY7A 1KLXA 2XGMA 4GTTA 3O5FA 4Z2HA 4ZPWR 2JZVA 3EHNA 2J09A 4GMRA 5BXUA 2XP6A 4TUMA 4A1GA 4UWLA 5J6EA 3V31A 4W9PA 3FH5A 1J4RA 3WL0A 3AJIA 1Z6TA 4ML4A 1SW6A 1NZNA 4JD2G 1HG5A 4Y6CA 4HOTA 2DT2A 3LY9A 5GPGA 1TNZA 2VGYA 1FKFA 5AARA 2GGFA 4ANUA 4FU3A 4Q22A 2XPIA 3ZW3A 5BUZA 4GYYA 3B7UX 1W3BA 4HB5A 4B8AA 3CKBA 4BY6A 2DG3A 3RM4A 3MZLB 3FY4A 3L08A 2BF0X 3B9AA 3ZXSA 4GZDA 3PNLB 4I17A 2DSUA 4CYMD 4HOQA 3UIOC 3UT8A 4GU5A 5CEDB 2KCKA 4W9RA 3JXIA 3FHEA 3NZUA 3UI6A 4G50A 3AS4A 1DCEA 1E9LA 3DRAA 3CVXA 4L72B 3KACA 3E32A 3MGBA 4FADA 3CHEA 2H6IA 4ME2A 1TEZA 3RKVA 4URIA 4Z2KA 2MRIA 2LSVA 2PNNA 3UQIA 1SQMA 3MKQB 3W9GA 5I98A 5G04C 2WLZA 3SFYA 4HOUA 1H0IA 2ZR6A 1HXIA 4CRWA 1H2TC 3PDNA 2IOSA 4PS8A 4BESA 4GZ6A 3PE3A 4HFGA 4LAVA 2F21A 1FAPA 1JNTA 3GYZA 2HO1A 3WD4A 5DO2A 2G8ZA 2AXUA 5CBOA 2UY1B 5HS0A 2E0IA 3Q7FA 4N3AA 4WUYA 3WIJA 3CVWA 3UXGA 2OLHA 5D0OD 2CHWA 5B1AE 3DEPA 3ARRA 4Z2JA 4F1SA 1NMWA 2AOSA 2MF9A 2KI3A 4HI9A 2HR2A 4W9OA 3TWRA 4F1PA 1ZB5A 2DCPA 3FUJA 2WB2A 5EN5D 2OVFA 2XZDG 3ASHA 3RO2A 5LFAA 1M5YA 3DSUA 4R7LA 4AY5A 5KBAA 1N4PA 2XEHA 4L2LA 4B8CB 1F40A 2AVPA 2B0OE 2I9CA 5ANLA 2XCBA 5T4YA 3HDXA 3UPVA 3T5VA 4WWPA 3WD0A 4HRMB 3KABA 4BTAA 3C72A 1H6KA 2WXPA 3ZHEB 3IEGA 3SQVA 3EHQA 4JA7A 2EULA 3WD1A 5AJDA 1H2VC 1OCCE 4KYOB 1N94A 3FP3A 4I6JA 4U0ZA 3CVVA 3HXFA 1LJYA 2A3AA 1TJFA 3NF1A 4JL0A 1L5JA 1X6LA 2X6KA 5EKQD 3CEQA 4DRPA 3U3WA 5LCWC 3PEVB 3CQCB 3D9IA 2NC9A 1N9AA 5ENOD 1H6OA 1LL6A 1OT8A 1RD6A 3B7BA 3PH0C 3FEXA 3OA5A 4DX2A 3O5IA 2OFNA 2KBXA 3ZNGA 4L3NA 3GTYX 4UQZA 4KVMA 5CRUA 4A3VA 2CFZA 3URZA 1FFRA 4EZLA 4LSZE 2MYOA 3DXMG 4BT9A 3UM0A 3R7QA 4I2ZA 4DRNA 3WQVA 4NACA 4W9QA 4DI4A 3RU0A 1GOIA 4WIWA 4I1OB 3V30A 5JJTA 4FC8A 3NOCD 4EHMA 4MNLA 1WDYA 2XPAA 3UM3A 3ZYLA 1TN7A 1HF8A 2ITKA 2QC9A 3LYAA 4GTSA 2IO2C 1HKJA 2LXMA 1J4IA 3UQ3A 2WVIA 1FPPA 3B95A 2PI6A 5JH8A 2V5QC 2DT0A 3DSWA 2XP5A 2DPEA 1UG3A 2IY0C 1JCSA 3E4BA 1D6OA 5HRYA 4HQDA 2KM4A 3UM1A 4E6HA 3C98A 5HWCA 3APFA 2KR7A 2PPOA 3L9TA 3O5OA 1IHBA 3DWLG 4O1OA 4JW1A 5G05C 3JYJA 1OGGA 1FKIA 2Y3AA 3O4ZA 1Z3XA 4DX7D 1Z3YA 3FH7A 3LS8A 2XHEA 3KAHA 2ZGDA 5C2YA 4M3OA 1MX6A 3EHRA 4J8FA 1KT1A 3D9OA 3LJ3A 4WKHA 3WXXA 3IV0A 3V79K 2LSUA 4K03A 2YHEA 4NNRA 3C5RA 2VSNA 3GPKA 1XHGA 1XRVA 4WKAA 2WXIA 1HG2A 2E2EA 5JJ7A 2ZGGA 3EIJA 4L2YA 4F3VA 1FKTA 3NRKA 2M1IA 3E37A 4DROA 1E44A 2XPZA 4IQ2A 3LVRE 2X3MA 2RD0A 2PV3A 4UUCA 1N11A 5B8IC 2R5SA 3UT7A 5FZRA 3DSTA 2O92A 2J49A 3UQBA 2WXMA 3R9MA 2L2SA 5HW7A 4L23A 4U96D 4XZ4A 4ACLA 4AV7A 4BERA 3ZYMA 1NWRA 3OOBA 4LAYA 2J4DA 3ZXPA 5EX3A 3ARYA 3RJVA 4K5BA 4GAAA 1XNFA 1JNSA 5KNGA 3V2OA 2VTBB 4U04A 3EU9A 1TNYA 2IFUA 3ODKA 1Y8MA 1BI7B 5HW6A 3WH0A 3OAWA 2C0LA 3QJZA 3I5PA 4DRIA 1K1AA 3SFZA 4JZYA 3HG0D 2DG4A 3ASOE 4HLEA 1WAWA 4GCNA 4C0MA 1WG0A 3PZ1A 2AW6A 5HTGA 2A5UA 3DPYA 1N4QA 3R7RA 2CG3A 2DT3A 4W5UA 2LUHA 4IULA 5FZSA 5JJ6A 1BPOA 2R59A 2Y0BG 5BV1A 1FKSA 3QK0A 2F8YA 1SYTA 1SZ9A 3L16A 3C3QA 1LG2A 3BQOA 4DWSC 4DZ2A 1LTXA 4MLPA 1D8DA 1ITXA 2FULA 2WM0A 3LKUA 3G2TA 1LG1A 2J8SD 3QNKA 3CVYA 5CCMA 4ATZD 4UI9K 5EIDA 3EIQC 1WB0A 2CHZA 4J0UA 4WNDA 1N54A 3I4RB 5E75A 3LXUX 4JXTA 1Q1CA 3OXFA 4ODMA 3AAAC 3L54A 2WMNA 3ZPJA 4ZPVR 3U66A 5GQBA 3ARPA 2WXGA 2M08A 2MHKA 2XP7A 1E6RA 2YQ8A 3ZGQA 4DX5D 2J9QA 2X38A 3Q15A 3D9NA 4I9CA 3TL5A 1QYMA 2XS1A 1NI1A 3ABLE 3F6QA 2ILRA 2GRPB 1V54E 1ELRA 3CHCA 3TC5A 3AS5A 1D7JA 4Z2GA 2BKKB 5KWDA 3VLDA 4DUIA 1W1TA 2GRNB 2YBUA 1QZ2A 3HVEB 1IXVA 4MNJA 5FQ4A 3TXMA 4GMLA 4G11A 2A3EA 4E85A 4Q7NA 5ENSD 4R5EA 1FVFA 5BV0A 4O60A 3NAWA 3NOGD 1DNPA 3ML8A 3QAQA 3NQPA 5EYLA 2X6IA 1FKJA 1RW2A 3ML9A 3S7DA 5EIBE 3O5LA 3SF4A 3NB2A 3PVLA 5CECB 3BMBA 2DBAA 4NQ0A 1Q6HA 2VGXB 4N5QA 3GZSA 2FO7A 2M2AA 3BU8A 2AXZA 3LEWA 2L6JA 5DBKA 3FFLA 3VTXA 3WG7E 1HXVA 5C1DA 1L1PA 3FU3A 4J8SA 4DX1A 3Q78A 4ZHBA 3NTPA 2GW1A 2F4EA 4ILGA 1GW6A 2N87A 2R2LA 3NZSA 5DEZA 1OCOE 4OVVA 3FULA 5EILA 1S63A 4QZVB 1HFAA 3HXDA 3LCAA 4GTVA 3TWXA 3UIPC 1R9HA 3PRDA 3CSFA 2F8XK 4TNSA 4HBDA 4FHKA 1JWGA 2KXPC 5J08A 3ALGA 1DVPA 1KZOA 2OV8A 3FDHA 4L7TA 4TW7A 5BPPA 3QWPA 4MRUA 3QC1A 2I2OA 1E8YA 3MV3B 4I1MA 4NIKA 3ZIMA 4WWOA 4MAVA 5CMYA 3O5QA 2IUZA 3FEYA 4ANWA 2RQSA 5T8IA 1E7UA 3MCXA 2F0YA 3KS2A 2R17C 3IKGA 4M7CA 4TYOA 4JHKA 4QIBA 4DRXE 2XS8A 3EY6A 4WJXA 1HE8A 1W26A 4IYPA 2A4ZA 3J5PA 1W9VA 4J8EA 2H6FA 2UZ5A 2P9SG 2Y1LE 2MPHA 4KR0B 2MOWA 5DF0A 4CGVA 2OEVA 2PM7A 3TJPA 4BSXA 2DSZA 4ODPA 3OTNA 4J4NA 4ANVA 4Y6WA 3AS8A 1OWNA 2AXVA 4HARA 4KMOA 4XEIG 3ASGA 1LQ0A 1ZBVA 3MKQA 3GZ1A 5FINA 3JYSA 2P2CP 5AENA 3IK8A 3HVEA 3PNTB 1JPLA 4KBQA 4IQCA 1MX2A 3T8MA 2ZQSA 1FKRA 4N2QA 3ARUA 4GTMA 3UQAA 3ENEA 4B0ZA 4JFKA 4C48B 2DYSE 2UY1A 3PRBA 1Q2ZA 1XGWA 4DH0A 1HU3A 4JEUA 4CDMA 5HKPA 4N2SA 4U0UA 1TCOC 3C3RA 3DSXA 3E33A 1N4SA 4P8WA 1EF1C 1W1VA 5ENPD 1LF8A 4YDWA 3NBNB 4BWRA 2DZNA 1E6PA 1NWSA 4TW8A 4GMJA 3TCZA 5LX8A 1KFWA 3OXLA 3UTMA 4LNBA 2IQCA 4NRHB 1ZU2A 3TWVA 5DIZA 4AXHA 3TAXA 2WM9A 3O5EA 3I4GA 4GCOA 1S0PA 2RFMA 2EILE 3FTYA 4U85A 4DWSA 4JFIA 3FWVA 3CGHA 1E15A 4ZS6A 2OVBA 2KE0A 3FUHA 4UWHA 2DSVA 1FKGA 1UOHA 5G04J 3IKDA 1ZB1A 4Q94A 4MKTA 3H9RB 1NA0A 1S70B 5FIOA 1SVXA 5JHAA 1TNOA 2FO1E 4HXIA 4DZ3A 5ARFA 4WKFA 2F23A 4JA9A 2IEJA 2WK2A 3UT4A 4ABNA 4BX9A 3AG3E 3JQ1A 1EQ3A 5JHBA 1NWUA 1H0GA 1LL7A 1S64A 2Y78A 4AY6A 1AP7A 3B7SA 4GYOA 4AM9A 2P9LG 4XI9A 5B3SE 1KZPA 3TG5A 2D9FA 4FA6A 4K5CA 1A17A 2X6FA 4CT4A 4UQXA 1OCRE 2WMOA 4MS6A 4YVQC 2VN1A 4LEUA 4AIFA 3GW4A 5HQ8A 4MTVA 4G1TA 2VJ8A 4DWSB 4GTQA 3B9DA 3UX4A 4PS3A 4JFMA 4TXRA 5AQAA 4LAXA 2PV1A 3VLFA 3JUIA 4WNFA 5D66A 3Q79A 5AN8A 2WQHA 2FBNA 3JCKC 2K8IA 4R0XA 5B1BE 3Q9NC 4PH4B 2WPVA 1DC2A 4A55A 5J90A 3FTWA 1E8XA 5KJNA 2FF4A 4H7XA 5KJLA 1UN8A 4MPKA 4U07A 4N19A 1NH6A 3ZN3A 2X6HA 1INZA 4HOSA 3RRUA 3Q4AB 1OCZE 4PUCA 3UKRG 1LL4A 1H19A 1N0RA 5FTPA 4RVBA 4EECA 3FXYA 2XENA 2R05A 1YMPA 4UQYA 4FJYA 3ISMC 1WAO1 5CRVA 4LRZA 1NP7A 3ONKA 3BUAA 3G2SA 1HKIA 3L17A 1O6IA 3CSTA 4RG6A 5FJYA 4NURA 5FQ8A 2Y69E 4J6IA 4TV3A 3RSEG 1SA5A 3CLJA 4N3CA 4ACKA 2VQ2A 3KD7A 3RRMB 1ZBCA 4DT4A 3PREA 2KFWA 1QNFA 4B93B 3CHQA 1Y0OA 1PAQA 3WD2A 1D7HA 3KAGA 4C02B 3L22A 2P9UG 1EDUA 3CVPA 4CDRA 3D9MA 2B6CA 1JUQA 1HH8A 3FTUA 4S3JA 2EIME 3ZRHA 3ABKE 4YVOA 3IHZA 2VSXE 2VSYA 5KCMA 4G2PA 1ROTA 5CHEE 2A3BA 1PC2A 4UDMA 2P9NG 3JXJA 5AAOA 5A23A 2OCCE 3CH9A 2DT1A 3VTYA 3HXEA 2MLXA 1TR4A 1W9UA 2Y4UA 3TWTA 2NXPA 4TXQA 4GTPA 3D9PA 5LCWJ 3L6AA 3CVUA 2JABA 4RSYA 1FVHA 3KZ7A 2ZR5A 2DVWA 3HRAA 2IU1A 3RFWA 2WXKA 3ABME 3FUDA 2J4BA 3PZDA 3UI2A 4DX6D 3FUKA 4I2WA 4DWSD 1EDQA 4F7AA 1J6YA 3FUFA 4DPRA 4TXPA 2YBTA 3G2WA 5H7PA 2KCLA 2DWZA 1TJCA 2WXHA 3I6CA 4UI9C 1E90A 1WNOA 2L9BA 4ODRA 3ZVVA 4C9BB 2F37A 2AWGA 4C0EA 5M72A 4F53A 4U86A 4UWFA 4K5AB 4GPKA 4U7EB 5CCLA 1W9PA 4S3KA 3TG4A 2RFAA 4HORA 3O5PA 1IYGA 3PRZA 3HHMA 1NA3A 3ARZA 5D2MC 4YDOA 3CVQA 5HW8A 4N39A 4KT6B 4G25A 4AP2A 3ALFA 4TX0A 4JHJA 5FQ6A 3O48A 4HBOA 4AY1A 4GTOA 4P8XA 4ILHB 2XGOA 4WAFA 3FY1A 1GRJA 5ARGA 3ULQA 3ASDA 2HYZA 3Q49B 2WXRA 1EIBA 4P8UA 4ILIA 4QQIA 2FDMA 4EQFA 1H6PA 3W4RA 2RUQA 4CGWA 3MJWA 3SI5A 4OVUA 1PINA 4GB9A 3ZUVB 1NFIE 1D7IA 1UW4B 2M63A 2EQXA 2YINA 3S2AA 4DRQA 4HVBA 4GA1A 4BX8A 1P5QA 3ARVA 1N4RA 3HIZA 1K3ZD 1IHGA 2PM6A 1W1YA 1OWOA 1GUVA 1C9HA 4UWKA 1OXJA 3UI5A 1OUVA 3DBSA 3O5RA 1UN9A 3DXKG 4ZPTR 2GROB 1FKBA 2WXLA 1OY3D 3AU5A 3PUKA 4F6RD 2GRQB 4ITZA 4ODQA 1KPSB 2XRYA 5CERB 2I1JA 3CHPA 3UUXA 1X6NA 1VDYA 3VAWA 4HI8A 1E6NA 5JMND 1PBKA 3TGOA 4XX5A 1QQEA 3AG1E 3JUEA 3HXBA 3UINC 1JCQA 1NWTA 5KNHD 2GRMA 1JCRA 1G3NB 2XPYA 4AOFA 4JFJA 2GRRB 1Y6IA 1MJ0A 4A63B 5ENNA 2EIKE 3JYMA 3RRNB 3SD5A 4DK5A 2V4LA 4IT6A 3FUEA 3IKOB 2PQRA 1RZ4A 3LY8A 3MX3A 1D2KA 1N0QA 2RG8A 2NYJA 4HRNA 4J8DA 4WNEA 2R03A 4APFA 2L0IA 4X8QA 1K9TA 2KGJA 2DYRE 2Y4TA 1O1RA 3AG4E 4BTBA 3B9EA 3FAPA 3MA5A 1FT2A 1A5EA 2LAHA 5HWBA 4GZ3A 2HM8A 3GU0A 1E7VA 3CHSA 5T3RA 3APCA 2LNIA 1H0AA 3B8SA 2VGXA 3AG2E 5KJMA 2QZAA 2WXOA 2DSWA 2PL2A 4GZCA 4ZFHA 3IHYA 3TDBA 5ENRD 3S7BA 4UWGA 3CKCA 2I1KA 4LNGA 4JHRA 4RLYA 2XCCA 3S7JA 1ROUA 3UMVA 5KJKA 1TN6A 2WXFA 3D9KA 3SZ7A 2ZISA 2IF4A 4XAKA 2WQ7A 1FKDA 1H2UA 3ARTA 4QT3A 5FT9A 3PUJA 2P58C 2QFCA 1K1BA 3EUVA 1IQUA 2ESCA 2MLYA 5JA4D 1MYOA 2VSOE 4CCAA 4J8YA 4B94A 4B89A 1OGBA 2BUGA 4D10C 5D0QD 3LUOA 5LP0A 3B7RL 2HE0A 2KO7A 5BNWA 2YHCA 4Z68A 3ASFA 4LUNU 3CHMA 3CR3A 4P8VA 4CT0A 3U4TA 5BT1A 4IPXA 2MLZA 4G24A 3G6LA 2C2LA 1B6CA 4GA2A 4G8LA 2FAPA 3DPDA 3PR9A 4BF8A 3WD3A 2ETCA 3MYVA 1EPUA 2P9IG 3D9LA 4I6GA 2DZOA 3OXGA 4DRHA 2V0PA 1O5MA 4U8YD 1SA4A 1FKHA 4BT8A 3O5MA 1WY6A 2AWIA 4JEHA 5IY5E 4A3TA 3AU4A 4JVSA 4IRUA 3CV0A 3QDNA 3SNXA 1N1AA 4MNMA 4FHJA 4CEMA 3V2XA 3LJNA 1B89A 2V8SE 3AS0A 3N71A 4U8HA 4LNUD 4CZ2D 1UJKA 3HXCA 3UKUG 4K0RA 5EDSA 1NMVA 3L13A 4G23A 5EYPF 3E30A 2XEVA 4KXKB 1YW5A 5FWQA 2R02A 4APOA 3VLEA 4LERA 2ZR4A 4FN2A 3D9HA 3TWSA 2LKNA 1F8AB 2DIWA 3FTXA 2XPBA 1BU9A 1CTNA 2L6BA 4DI3A 4I1AA 3JXVA 4BEPA 3CHFA 4ODLA 3I3NA 3RIBA 3UM2A 1U2VG 2JEKA 2QYUA 4O6FA 1NL4A 4OYSA 2PQNA 1ZBPA 3GZ2A 3PA7A 3ESLA 1UR8A 4EBAG 3ZHEA 2KZTA 4ODNA 3SFXA 2ONDA 1A7XA 2RUCA 1JVWA 3MV2B 4ODOA 5D75A 1JNEA 1X81A 2VTBA 3PZ2A 3CIAA 3U64A 3Q73A 1HKMA 4N3BA 4GZ5A 3LY7A 3QWWA 3IBEA 2QYJA 5G05J 3X2QE 4FULA 3DSVA 3MKRA 3FU6A 3Q47B 3AS3A 4GPMA 4MGVA 2PBCA 3CVNA 3ARSA 3O5DA 3KEZA 3FUNA 3QWVA 4XKBA 2ETAA 1E6ZA 4GIVA 1PY1A 2Q7FA 5G55A 4UI9J 2KATA 2RUDA 3FH8A 2WXJA 4TUUA 5AYWD 2P9KG 1BLXB 5ENQD 1FKLA 3UF8A 3ASNE 2UWJG 4V3IA 5CMWA 3ULYA 1TYQG 4P29A 3T5XA 4HNAD 3SO8A 2WLYA 3ARWA 1Q6IA 3CK9A 4BSZB 4G8KA 1NSGA 4OAUC 2J08A 2LAIA 3ARXA 2XRZA 2XP3A 3Q9UC 4EPZA 3W9FA 2F2DA 3ZYKA 3FUMA 1ELWA 3ESKA 1AWCB 4BETA 4RQIA 4I9EA 1K8KG 3B13A 3UI4A 2FI7A 2NSZA 2IJGX 3TXNA 3QOUA 2VCDA 2Q5AA 4HRLA 4Z2IA 4LG6A 5HUAA 2LXLA 2JLBA 1JNDA 4PTMA 4XE0A 1MHQA 2ZXWE 4FP7A 2LO6A 5BW8C 1EYHA 2I6HA 4FJZA 3RAUA 3J5QB 3Q7AA 5BXOA 4ANXA 1J4HA 2CFUA 4Z2LA 2VGEA 4U8VD 2ZIRA 4U84A 2PPNA 1FFQA 1ZL1A 4DRJA 3CHOA 3E34A 2ZQUA 2PV2A 4DLOA 4FLHA 1LD7A 1TNUA 4N5CA 1HJXA 2RSEA 4IT4A 2XP4A 3JQ0A 3PE4A 3CK8A 4HBEA 3PRAA 2IONA 3CK7A 2O9OA 4QT2A 3RGCA 3DEOA 4A1SA 5GPRA 4FLBA 2FKEA 3P1UA 4YNDA 4MBGA 3KADA 4WWNA 2KZTB 3BEEA 3QB2A 4MNKA 3RM8A 3WL1A 1D8EA 1V55E 3G2VA 4XKCA 1O1SA 2H6HA 4LAWA 1OWQA 2QF8A 4AEZC 4DRKA 2CHXA 3APDA 5E76A 3PZ4A 1ELKA 4KVOA 1MX4A 4GA0A 5BXJA 1SR0A 1LD8A 1HKKA 1YCSB 2XQ0A 2WQ6A 4U63A 3CQGB 5AIJA 4O2TA 2XEEA 5ITZF 1ZBKA 2P9PG 2XGSA 3AROA 3ARQA 4KZ0A 2ZQVA 3BG0B 3IXEA 3U9WA 4JFLA 1IX5A 2VYIA 4AJWA 4G2VA 3PS6A 4QFVA 2KCVA 4PDXA 4EBAA 2RURA 2B31A 1FD9A 3TWUA 1FJDA 1N95A 2EIJE 4O1PA 2G41A 3T8KA 3ZKJA 5ENTD 5CBNA 4DJAA 3CHRA 1HZ4A 4DRMA 1Q6UA 3HYMB 3ULEG 5AQ7A 3S7FA 2A3CA 2ETBA 2X6JA 4PS7A 3C3OA 5DIVA 3KEAA 5AQ9A 1WM5A 5A7DB 1HS6A 4ATGA 3Q75A 5A6CA 2LPVA 3ZFWA 4WNGA 1HJVA 2XP9A 5DIUA 3PEUB 3KAIA 1N52A 3CGNA 3B7XA 4TRQA 2P4VA 4I6EA 1TNBA 4U95D 4JYSA 4J7WA 2ZQTA 1IKND 3LDZA 4RG9A 5HT1A 4FAPA 5AQBA 5ANRA 3FU0A 3EDTB 1MQSA 2PN0A 4G26A 3AQUA 3BXWA 1D9SA 1T11A 3CGMA 1EYMA 5HI7A 3CZ8A 3KAEA 1FCHA 2B5UB 1KT0A 5G2NA 3QOKA 3R9AB 1OWMA 2FEZA 2XZTG 1OWPA 3FUIA 1FKKA 3NI6A 4JC8A 2GRLA 3SBTB 2EINE 1E96B 1U3DA 1QPFA 4JPSA 3FU5A 1SZAA 2V5FA 4CDNA 2V4HC 2WXNA 2MNTA 3KAFA 1QBQA 4DIPA 4HLLA 1HO8A 3RM9A
chains in the Genus database with same CATH topology
5DITA 4Q96A 1GPFA 3SHFA 5EX0A 4ODKA 4WK9A 4DLQA 3IHVA 5FQ7A 1X5BA 3FTVA 4HS2A 3RO3A 5FZQA 4EZKA 4IN3B 2DG9A 3O5GA 4L1BA 4BFRA 3SGHA 3G6MA 3QARA 3K9IA 4XIFA 4AVXA 2XP8A 3BG1B 4XI0A 3RMEA 4URKA 4LCTA 4H7YA 2C0MA 4LGXA 2ZU6B 3FTZA 3MDYB 1ZK6A 5AJLA 1ZCNA 3RK6A 2YNQA 3CHDA 2LGOA 2LJ4A 3D9JA 3O5JA 3LPZA 4KQZA 3LVQE 5HKGA 3O5KA 1U79A 3AS1A 1E8WA 1BL4A 1UR9A 4GYWA 1HX8A 1JWFA 3G2UA 3ZEFA 4GGQA 3D3MA 4I43A 3ONLA 1YA0A 1UJJA 4TW6A 1HJWA 3Q5MA 5HBFA 2J07A 3EJNA 3FTSA 2WXQA 1TFVA 1IQRA 1W1PA 3B7TA 3KCEA 2PZIA 2BTDA 1E8ZA 2KC7A 3MEKA 1VF8A 2CG2A 2IOLA 1YATA 4J4OA 4U0SA 2OOEA 5LOZA 3CVLA 1OWLA 4Q69A 1BKFA 3P2BA 3QKYA 4MSPA 3ZYQA 4NSBA 3SBSA 1QPLA 2L0TB 3WKZA 3WQWA 4NZCA 4EZJA 3AS2A 3EHMA 4KZCA 1EHNA 1U3CA 1ZBWA 1ZU8A 2PPPA 2QY7A 1KLXA 2XGMA 3O5FA 4Z2HA 4ZPWR 2JZVA 3EHNA 2J09A 2XP6A 5J6EA 4A1GA 4UWLA 4W9PA 3FH5A 1J4RA 3WL0A 1Z6TA 4ML4A 1NZNA 1HG5A 4Y6CA 4HOTA 2DT2A 3LY9A 5GPGA 2VGYA 1FKFA 2GGFA 4ANUA 4FU3A 4Q22A 2XPIA 3ZW3A 5BUZA 4GYYA 3B7UX 1W3BA 4B8AA 3CKBA 4BY6A 2DG3A 3RM4A 3MZLB 3FY4A 3L08A 2BF0X 3B9AA 3ZXSA 4GZDA 3PNLB 4I17A 2DSUA 4HOQA 3UT8A 4GU5A 2KCKA 4W9RA 3FHEA 3NZUA 3UI6A 4G50A 3AS4A 1E9LA 3CVXA 4L72B 3KACA 4FADA 3MGBA 3CHEA 4ME2A 1TEZA 3RKVA 4URIA 4Z2KA 2MRIA 2LSVA 3UQIA 1SQMA 3MKQB 5I98A 5G04C 2WLZA 4HOUA 1H0IA 2ZR6A 1HXIA 4CRWA 1H2TC 3PDNA 2IOSA 4PS8A 4GZ6A 3PE3A 4HFGA 4LAVA 2F21A 1FAPA 1JNTA 3GYZA 2HO1A 3WD4A 5DO2A 2G8ZA 2AXUA 2UY1B 2E0IA 4N3AA 4WUYA 3WIJA 3CVWA 4Z2JA 2OLHA 5D0OD 2CHWA 3ARRA 4F1SA 1NMWA 2AOSA 2MF9A 2KI3A 2HR2A 4W9OA 1ZB5A 2DCPA 3FUJA 2WB2A 2OVFA 3ASHA 3RO2A 5LFAA 1M5YA 4R7LA 4AY5A 4L2LA 4B8CB 1F40A 2AVPA 2I9CA 5ANLA 2XCBA 5T4YA 3HDXA 3UPVA 4WWPA 3T5VA 3WD0A 3KABA 4BTAA 1H6KA 2WXPA 3ZHEB 3IEGA 4JA7A 3WD1A 5AJDA 1H2VC 4KYOB 3FP3A 4I6JA 4U0ZA 3CVVA 1LJYA 2A3AA 1TJFA 3NF1A 4JL0A 1L5JA 1X6LA 2X6KA 5EKQD 3CEQA 4DRPA 3U3WA 5LCWC 3PEVB 3CQCB 3D9IA 2NC9A 1LL6A 1RD6A 3PH0C 3FEXA 3OA5A 3O5IA 2OFNA 4L3NA 4UQZA 4KVMA 4A3VA 2CFZA 3URZA 1FFRA 4EZLA 4BT9A 3R7QA 4I2ZA 4DRNA 3WQVA 4NACA 4W9QA 4DI4A 3RU0A 1GOIA 4WIWA 4I1OB 5JJTA 4FC8A 4MNLA 2XPAA 3ZYLA 1HF8A 2ITKA 3LYAA 1HKJA 1J4IA 3UQ3A 2WVIA 2PI6A 5JH8A 2DT0A 2XP5A 2DPEA 1UG3A 3E4BA 1D6OA 2KM4A 4E6HA 3C98A 5HWCA 3APFA 2KR7A 2PPOA 3O5OA 4JW1A 5G05C 3JYJA 1OGGA 1FKIA 2Y3AA 3O4ZA 1Z3XA 1Z3YA 3FH7A 3LS8A 2XHEA 3KAHA 5C2YA 4M3OA 4J8FA 1KT1A 3D9OA 3LJ3A 4WKHA 3WXXA 3IV0A 2LSUA 4K03A 2YHEA 4NNRA 2VSNA 3GPKA 1XHGA 1XRVA 4WKAA 2WXIA 1HG2A 2E2EA 5JJ7A 3EIJA 4L2YA 4F3VA 1FKTA 3NRKA 2M1IA 4DROA 2XPZA 4IQ2A 3LVRE 2X3MA 2RD0A 2PV3A 5B8IC 2R5SA 3UT7A 5FZRA 2O92A 2J49A 3UQBA 2WXMA 2L2SA 5HW7A 4L23A 4XZ4A 4ACLA 4AV7A 3ZYMA 1NWRA 3OOBA 4LAYA 2J4DA 5EX3A 3ARYA 3RJVA 4GAAA 1XNFA 1JNSA 2VTBB 4U04A 2IFUA 3ODKA 1Y8MA 5HW6A 3WH0A 3OAWA 2C0LA 3QJZA 3I5PA 4DRIA 3SFZA 4JZYA 2DG4A 4HLEA 1WAWA 4GCNA 4C0MA 2AW6A 5HTGA 2A5UA 3R7RA 2CG3A 2DT3A 4W5UA 4IULA 5FZSA 5JJ6A 1BPOA 2R59A 5BV1A 1FKSA 3QK0A 1SYTA 1SZ9A 3L16A 1LG2A 4DWSC 4DZ2A 4MLPA 1ITXA 2FULA 2WM0A 3LKUA 3G2TA 1LG1A 3QNKA 3CVYA 5CCMA 4UI9K 3EIQC 1WB0A 2CHZA 4J0UA 4WNDA 1N54A 3I4RB 5E75A 3LXUX 4JXTA 1Q1CA 3OXFA 4ODMA 3L54A 2WMNA 3ZPJA 4ZPVR 3U66A 5GQBA 3ARPA 2WXGA 2M08A 2MHKA 2XP7A 1E6RA 2YQ8A 3ZGQA 2J9QA 2X38A 3Q15A 3D9NA 4I9CA 3TL5A 2ILRA 1ELRA 3CHCA 3TC5A 3AS5A 1D7JA 4Z2GA 3VLDA 1W1TA 2YBUA 1QZ2A 3HVEB 4MNJA 5FQ4A 3TXMA 4GMLA 4G11A 2A3EA 4E85A 4Q7NA 4R5EA 1FVFA 5BV0A 1DNPA 3ML8A 3QAQA 3NQPA 2X6IA 1FKJA 3ML9A 3S7DA 3O5LA 3SF4A 3PVLA 2DBAA 4NQ0A 1Q6HA 2VGXB 3GZSA 2FO7A 2M2AA 2AXZA 3LEWA 2L6JA 5DBKA 3FFLA 3VTXA 1HXVA 5C1DA 1L1PA 3FU3A 4J8SA 3NTPA 2GW1A 2F4EA 4ILGA 1GW6A 2N87A 3NZSA 5DEZA 4OVVA 3FULA 4QZVB 1HFAA 3LCAA 1R9HA 3PRDA 3CSFA 4TNSA 4FHKA 1JWGA 5J08A 3ALGA 1DVPA 2OV8A 3FDHA 4L7TA 4TW7A 5BPPA 3QWPA 4MRUA 3QC1A 2I2OA 1E8YA 3MV3B 4I1MA 3ZIMA 4WWOA 4MAVA 5CMYA 3O5QA 2IUZA 3FEYA 4ANWA 2RQSA 5T8IA 1E7UA 3MCXA 3KS2A 2R17C 3IKGA 4TYOA 4JHKA 4QIBA 3EY6A 4WJXA 1HE8A 1W26A 4IYPA 2A4ZA 1W9VA 4J8EA 2UZ5A 2MPHA 4KR0B 2MOWA 5DF0A 4CGVA 2PM7A 3TJPA 4BSXA 2DSZA 4ODPA 3OTNA 4J4NA 4ANVA 4Y6WA 3AS8A 1OWNA 2AXVA 4HARA 4KMOA 3ASGA 1LQ0A 1ZBVA 3MKQA 3GZ1A 3JYSA 5AENA 3IK8A 3HVEA 3PNTB 1JPLA 4KBQA 4IQCA 3T8MA 2ZQSA 1FKRA 4N2QA 3ARUA 3UQAA 3ENEA 4B0ZA 4JFKA 2UY1A 3PRBA 1XGWA 4DH0A 1HU3A 4JEUA 4CDMA 4N2SA 4U0UA 1TCOC 4P8WA 1EF1C 1W1VA 1LF8A 4BWRA 1E6PA 1NWSA 4TW8A 4GMJA 3TCZA 5LX8A 1KFWA 3OXLA 2IQCA 4NRHB 1ZU2A 5DIZA 4AXHA 3TAXA 2WM9A 3O5EA 3I4GA 4GCOA 1S0PA 3FTYA 4U85A 4DWSA 4JFIA 3FWVA 3CGHA 1E15A 4ZS6A 2OVBA 2KE0A 3FUHA 4UWHA 2DSVA 1FKGA 5G04J 3IKDA 4Q94A 4MKTA 3H9RB 1NA0A 5JHAA 4HXIA 4DZ3A 5ARFA 4WKFA 4JA9A 2WK2A 3UT4A 4ABNA 4BX9A 3JQ1A 1EQ3A 5JHBA 1NWUA 1H0GA 1LL7A 2Y78A 4AY6A 3B7SA 4GYOA 4AM9A 4XI9A 3TG5A 2D9FA 4FA6A 1A17A 2X6FA 4CT4A 4UQXA 2WMOA 4MS6A 4YVQC 2VN1A 4LEUA 4AIFA 3GW4A 5HQ8A 4MTVA 4G1TA 2VJ8A 4DWSB 3B9DA 3UX4A 4PS3A 4JFMA 4LAXA 2PV1A 3VLFA 3JUIA 4WNFA 2WQHA 2FBNA 3JCKC 2K8IA 4R0XA 4PH4B 2WPVA 4A55A 5J90A 3FTWA 1E8XA 5KJNA 2FF4A 4H7XA 5KJLA 1UN8A 4MPKA 4U07A 4N19A 1NH6A 3ZN3A 2X6HA 1INZA 4HOSA 3RRUA 3Q4AB 4PUCA 1LL4A 1H19A 5FTPA 4RVBA 4EECA 3FXYA 4UQYA 4FJYA 1WAO1 4LRZA 1NP7A 3ONKA 3G2SA 1HKIA 3L17A 1O6IA 3CSTA 4RG6A 5FJYA 4NURA 5FQ8A 4J6IA 4TV3A 3CLJA 4N3CA 4ACKA 2VQ2A 3KD7A 3RRMB 1ZBCA 4DT4A 3PREA 2KFWA 1QNFA 3CHQA 1Y0OA 1PAQA 3WD2A 1D7HA 3KAGA 4C02B 3L22A 1EDUA 3CVPA 4CDRA 3D9MA 1JUQA 1HH8A 3FTUA 4S3JA 3ZRHA 4YVOA 3IHZA 2VSXE 2VSYA 5KCMA 4G2PA 1ROTA 5CHEE 2A3BA 1PC2A 5A23A 3CH9A 2DT1A 3VTYA 2MLXA 1W9UA 2Y4UA 2NXPA 3D9PA 5LCWJ 3L6AA 3CVUA 4RSYA 1FVHA 3KZ7A 2ZR5A 2IU1A 3RFWA 2WXKA 3FUDA 2J4BA 3PZDA 3FUKA 4I2WA 4DWSD 1EDQA 4F7AA 1J6YA 3FUFA 4DPRA 2YBTA 3G2WA 2KCLA 1TJCA 2WXHA 3I6CA 4UI9C 1E90A 1WNOA 2L9BA 4ODRA 3ZVVA 4C9BB 2AWGA 4C0EA 5M72A 4F53A 4U86A 4UWFA 4GPKA 5CCLA 1W9PA 4S3KA 3TG4A 4HORA 3O5PA 1IYGA 3PRZA 3HHMA 1NA3A 3ARZA 3CVQA 5HW8A 4N39A 4KT6B 4G25A 4AP2A 3ALFA 4TX0A 4JHJA 5FQ6A 3O48A 4HBOA 4AY1A 4P8XA 4ILHB 2XGOA 4WAFA 3FY1A 5ARGA 3ULQA 3ASDA 2HYZA 3Q49B 2WXRA 1EIBA 4P8UA 4ILIA 2FDMA 4EQFA 3W4RA 2RUQA 4CGWA 3MJWA 3SI5A 4OVUA 1PINA 4GB9A 1D7IA 1UW4B 2M63A 2EQXA 2YINA 3S2AA 4DRQA 4HVBA 4GA1A 4BX8A 1P5QA 3ARVA 3HIZA 1IHGA 2PM6A 1W1YA 1OWOA 1GUVA 1C9HA 4UWKA 3UI5A 1OUVA 3DBSA 3O5RA 1UN9A 4ZPTR 1FKBA 2WXLA 3AU5A 3PUKA 4ITZA 4ODQA 2XRYA 2I1JA 3CHPA 3UUXA 1X6NA 1VDYA 3VAWA 1E6NA 1PBKA 3TGOA 4XX5A 1QQEA 1NWTA 2GRMA 2XPYA 4AOFA 4JFJA 1Y6IA 5ENNA 3JYMA 3RRNB 3SD5A 4DK5A 2V4LA 4IT6A 3FUEA 3IKOB 2PQRA 3LY8A 3MX3A 1D2KA 2RG8A 4J8DA 4WNEA 4APFA 2L0IA 1K9TA 2KGJA 2Y4TA 4BTBA 3B9EA 3FAPA 3MA5A 2LAHA 5HWBA 4GZ3A 2HM8A 1E7VA 3CHSA 5T3RA 3APCA 2LNIA 1H0AA 3B8SA 2VGXA 5KJMA 2WXOA 2DSWA 2PL2A 4GZCA 3IHYA 3TDBA 3S7BA 4UWGA 3CKCA 2I1KA 3S7JA 4JHRA 1ROUA 2XCCA 3UMVA 5KJKA 2WXFA 3D9KA 3SZ7A 2IF4A 4XAKA 2WQ7A 1FKDA 1H2UA 3ARTA 4QT3A 5FT9A 3PUJA 2P58C 2QFCA 1IQUA 2ESCA 2MLYA 2VSOE 4CCAA 4B94A 4B89A 1OGBA 2BUGA 4D10C 5D0QD 3LUOA 5LP0A 3B7RL 2KO7A 5BNWA 2YHCA 4LUNU 3ASFA 3CHMA 3CR3A 4P8VA 4CT0A 3U4TA 5BT1A 4IPXA 2MLZA 4G24A 3G6LA 2C2LA 1B6CA 4GA2A 2FAPA 3DPDA 3PR9A 4BF8A 3WD3A 3MYVA 1EPUA 3D9LA 4I6GA 3OXGA 4DRHA 2V0PA 1FKHA 4BT8A 3O5MA 1WY6A 2AWIA 4JEHA 4A3TA 3AU4A 4JVSA 4IRUA 3CV0A 3QDNA 3SNXA 1N1AA 4MNMA 4FHJA 4CEMA 1B89A 2V8SE 3AS0A 3N71A 4U8HA 1UJKA 4K0RA 5EDSA 1NMVA 3L13A 4G23A 2XEVA 4KXKB 1YW5A 5FWQA 4APOA 3VLEA 4LERA 2ZR4A 4FN2A 2LKNA 1F8AB 2DIWA 3FTXA 2XPBA 1CTNA 4DI3A 4I1AA 3JXVA 3CHFA 4ODLA 3I3NA 3RIBA 2JEKA 4O6FA 4OYSA 2PQNA 1ZBPA 3GZ2A 3PA7A 3ESLA 1UR8A 4EBAG 3ZHEA 2KZTA 4ODNA 2ONDA 1A7XA 2RUCA 1JVWA 3MV2B 4ODOA 5D75A 1JNEA 2VTBA 3CIAA 3U64A 1HKMA 4N3BA 4GZ5A 3LY7A 3QWWA 3IBEA 5G05J 4FULA 3MKRA 3FU6A 3Q47B 3AS3A 4MGVA 2PBCA 3CVNA 3ARSA 3O5DA 3KEZA 3FUNA 3QWVA 4XKBA 1E6ZA 4GIVA 1PY1A 2Q7FA 5G55A 4UI9J 2KATA 2RUDA 3FH8A 2WXJA 4TUUA 5AYWD 3UF8A 1FKLA 2UWJG 4V3IA 5CMWA 4P29A 3T5XA 2WLYA 3ARWA 1Q6IA 3CK9A 1NSGA 2J08A 2LAIA 3ARXA 2XRZA 2XP3A 4EPZA 2F2DA 3ZYKA 3FUMA 1ELWA 3ESKA 4I9EA 3B13A 3UI4A 2FI7A 2NSZA 2IJGX 3TXNA 3QOUA 2VCDA 2Q5AA 4Z2IA 5HUAA 2JLBA 1JNDA 4PTMA 4XE0A 1MHQA 4FP7A 2LO6A 5BW8C 1EYHA 2I6HA 4FJZA 4ANXA 1J4HA 2CFUA 4Z2LA 4U84A 2PPNA 1FFQA 1ZL1A 4DRJA 3CHOA 2ZQUA 2PV2A 4DLOA 4FLHA 4N5CA 1HJXA 2RSEA 4IT4A 2XP4A 3JQ0A 3PE4A 3CK8A 4HBEA 3PRAA 2IONA 3CK7A 2O9OA 4QT2A 3RGCA 4A1SA 5GPRA 4FLBA 2FKEA 3P1UA 4YNDA 3KADA 4WWNA 2KZTB 3BEEA 3QB2A 4MNKA 3RM8A 3WL1A 3G2VA 4XKCA 4LAWA 1OWQA 2QF8A 4AEZC 4DRKA 2CHXA 3APDA 5E76A 1ELKA 4KVOA 4GA0A 5BXJA 1SR0A 1HKKA 2XQ0A 2WQ6A 4U63A 3CQGB 5AIJA 4O2TA 1ZBKA 2XGSA 3AROA 3ARQA 4KZ0A 2ZQVA 3BG0B 4JFLA 3U9WA 1IX5A 2VYIA 4AJWA 4G2VA 3PS6A 4QFVA 2KCVA 4PDXA 4EBAA 2RURA 2B31A 1FD9A 1FJDA 2G41A 4DJAA 3CHRA 1HZ4A 4DRMA 1Q6UA 3HYMB 3S7FA 2A3CA 2X6JA 4PS7A 5DIVA 1WM5A 5A7DB 1HS6A 4ATGA 5A6CA 2LPVA 3ZFWA 4WNGA 1HJVA 2XP9A 5DIUA 3PEUB 3KAIA 1N52A 3CGNA 3B7XA 4TRQA 4I6EA 4JYSA 2ZQTA 3LDZA 4RG9A 5HT1A 4FAPA 5ANRA 3FU0A 3EDTB 1MQSA 4G26A 3AQUA 3BXWA 1T11A 3CGMA 1EYMA 5HI7A 3CZ8A 3KAEA 1FCHA 1KT0A 5G2NA 3QOKA 3R9AB 1OWMA 2FEZA 1OWPA 3FUIA 1FKKA 3NI6A 4JC8A 2GRLA 3SBTB 1E96B 1U3DA 1QPFA 4JPSA 3FU5A 1SZAA 2V5FA 4CDNA 2WXNA 2MNTA 3KAFA 4DIPA 3RM9A 1HO8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ASF A;  5DIT A;  3WXX A;  5EX0 A;  4ODK A;  2D9F A;  2LSU A;  3U4T A;  1A17 A;  5BT1 A;  4NNR A;  4IPX A;  2VSN A;  3GPK A;  4UQX A;  2MLZ A;  3RO3 A;  4G24 A;  5FZQ A;  2C2L A;  1B6C A;  4IN3 B;  4GA2 A;  4YVQ C;  2E2E A;  2DG9 A;  3O5G A;  5JJ7 A;  2FAP A;  2VN1 A;  4LEU A;  4AIF A;  3GW4 A;  5HQ8 A;  4F3V A;  4G1T A;  1FKT A;  4BF8 A;  3NRK A;  2M1I A;  4JFM A;  4LAX A;  4DRO A;  2PV1 A;  3OXG A;  4DRH A;  4IQ2 A;  3K9I A;  4XIF A;  2XP8 A;  4WNF A;  2PV3 A;  4XI0 A;  5B8I C;  2WQH A;  2FBN A;  2R5S A;  1FKH A;  5FZR A;  4BT8 A;  3O5M A;  3UQB A;  2K8I A;  4R0X A;  2L2S A;  5HW7 A;  4H7Y A;  2C0M A;  2WPV A;  3CV0 A;  3OOB A;  3QDN A;  4LAY A;  5EX3 A;  1N1A A;  3RJV A;  3MDY B;  5KJN A;  1ZK6 A;  2FF4 A;  1XNF A;  4H7X A;  1ZCN A;  1JNS A;  4U04 A;  1B89 A;  5KJL A;  2IFU A;  3ODK A;  2LGO A;  1Y8M A;  3N71 A;  4U07 A;  2LJ4 A;  5HW6 A;  3O5J A;  4N19 A;  3WH0 A;  3LPZ A;  3ZN3 A;  2C0L A;  5HKG A;  3O5K A;  1U79 A;  4HOS A;  1BL4 A;  4DRI A;  4GYW A;  4G23 A;  1NMV A;  3Q4A B;  2XEV A;  4KXK B;  1YW5 A;  4GGQ A;  2DG4 A;  4APO A;  5FTP A;  4GCN A;  2ZR4 A;  1YA0 A;  4FN2 A;  5HTG A;  4TW6 A;  4UQY A;  3Q5M A;  2LKN A;  1F8A B;  2XPB A;  1WAO 1;  4I1A A;  3JXV A;  4ODL A;  5FZS A;  5JJ6 A;  3RIB A;  1FKS A;  4O6F A;  2PQN A;  2PZI A;  1ZBP A;  2KC7 A;  3GZ2 A;  4RG6 A;  5FJY A;  3KCE A;  3PA7 A;  3MEK A;  4DZ2 A;  3ZHE A;  1YAT A;  4J4O A;  4ODN A;  4N3C A;  4U0S A;  2OOE A;  3CVL A;  2VQ2 A;  3KD7 A;  3LKU A;  2OND A;  1A7X A;  4DT4 A;  2RUC A;  1BKF A;  1JVW A;  3MV2 B;  3QKY A;  2KFW A;  4ODO A;  4MSP A;  5D75 A;  5CCM A;  4UI9 K;  1Y0O A;  1QPL A;  4J0U A;  4WND A;  1D7H A;  4N3B A;  4GZ5 A;  3LY7 A;  3QWW A;  3KAG A;  4C02 B;  1Q1C A;  5G05 J;  3CVP A;  3OXF A;  4ODM A;  4CDR A;  3MKR A;  3Q47 B;  1HH8 A;  4MGV A;  2PBC A;  3ZPJ A;  4YVO A;  3CVN A;  2M08 A;  2PPP A;  2MHK A;  3IHZ A;  1KLX A;  2XGM A;  3O5F A;  2VSY A;  2XP7 A;  2YQ8 A;  3O5D A;  3ZGQ A;  1ROT A;  4G2P A;  3QWV A;  2JZV A;  2J9Q A;  5CHE E;  3Q15 A;  1PC2 A;  4I9C A;  2XP6 A;  4GIV A;  5J6E A;  2Q7F A;  4W9P A;  1J4R A;  4UI9 J;  2KAT A;  3VTY A;  2RUD A;  2MLX A;  1NZN A;  2Y4U A;  5AYW D;  3UF8 A;  1ELR A;  1FKL A;  2UWJ G;  4Y6C A;  4HOT A;  3TC5 A;  3AS5 A;  3LY9 A;  5LCW J;  1D7J A;  5GPG A;  2VGY A;  1FKF A;  3KZ7 A;  2ZR5 A;  2XPI A;  1QZ2 A;  3RFW A;  4GYY A;  1W3B A;  1Q6I A;  3CK9 A;  3CKB A;  2DG3 A;  4I2W A;  1NSG A;  4I17 A;  4HOQ A;  2XP3 A;  2F2D A;  1J6Y A;  2KCK A;  1ELW A;  4W9R A;  3ESK A;  2KCL A;  3UI6 A;  4I9E A;  3AS4 A;  1TJC A;  4G50 A;  3I6C A;  4UI9 C;  2FI7 A;  3UI4 A;  3QOU A;  3KAC A;  2VCD A;  1FKJ A;  3O5L A;  3S7D A;  4ODR A;  4ME2 A;  2AWG A;  3SF4 A;  3RKV A;  2Q5A A;  5HUA A;  5M72 A;  2JLB A;  2DBA A;  4U86 A;  4GPK A;  4NQ0 A;  1Q6H A;  2LSV A;  5CCL A;  2VGX B;  3TG4 A;  5BW8 C;  3UQI A;  2I6H A;  2FO7 A;  2M2A A;  4HOR A;  3O5P A;  1IYG A;  5DBK A;  2L6J A;  1NA3 A;  5I98 A;  1J4H A;  5G04 C;  3FFL A;  4HOU A;  3VTX A;  2ZR6 A;  1HXV A;  1HXI A;  3CVQ A;  5HW8 A;  4N39 A;  5C1D A;  2PPN A;  4U84 A;  4DRJ A;  3PDN A;  4G25 A;  4GZ6 A;  1L1P A;  3PE3 A;  4TX0 A;  2ZQU A;  3O48 A;  2PV2 A;  4LAV A;  2F21 A;  1FAP A;  1JNT A;  2GW1 A;  3NTP A;  2F4E A;  3GYZ A;  2N87 A;  2HO1 A;  2XGO A;  4N5C A;  2RSE A;  2XP4 A;  5ARG A;  3PE4 A;  3ULQ A;  3CK8 A;  3ASD A;  2HYZ A;  2UY1 B;  3Q49 B;  3CK7 A;  3LCA A;  4N3A A;  4WUY A;  4QT2 A;  4EQF A;  1R9H A;  3PRD A;  3RGC A;  4TNS A;  4A1S A;  2FKE A;  2RUQ A;  4CGW A;  5D0O D;  1NMW A;  2MF9 A;  1PIN A;  2KI3 A;  4YND A;  2HR2 A;  4TW7 A;  1D7I A;  4W9O A;  3KAD A;  3QWP A;  4DRQ A;  3BEE A;  4GA1 A;  3MV3 B;  1P5Q A;  3ASH A;  3RO2 A;  1IHG A;  4LAW A;  3O5Q A;  1M5Y A;  4AY5 A;  1C9H A;  2RQS A;  4DRK A;  3UI5 A;  1OUV A;  3KS2 A;  1F40 A;  2AVP A;  3IKG A;  3O5R A;  4TYO A;  4QIB A;  1FKB A;  3EY6 A;  4GA0 A;  1W26 A;  2XCB A;  5BXJ A;  4ITZ A;  4ODQ A;  3UPV A;  3KAB A;  3UUX A;  4BTA A;  4J8E A;  2UZ5 A;  4O2T A;  3VAW A;  2XGS A;  2MPH A;  3ZHE B;  3IEG A;  4CGV A;  1PBK A;  3TGO A;  4JA7 A;  1QQE A;  2ZQV A;  4ODP A;  4KYO B;  4JFL A;  4J4N A;  2VYI A;  3FP3 A;  4Y6W A;  4U0Z A;  4G2V A;  3AS8 A;  4JFJ A;  3NF1 A;  4JL0 A;  2KCV A;  5EKQ D;  3CEQ A;  2RUR A;  3ASG A;  4DRP A;  3U3W A;  1FD9 A;  5LCW C;  3GZ1 A;  1FJD A;  3JYS A;  2NC9 A;  3JYM A;  3IK8 A;  4KBQ A;  4IQC A;  2ZQS A;  1HZ4 A;  4DRM A;  1Q6U A;  2PQR A;  3HYM B;  1FKR A;  4N2Q A;  3LY8 A;  3O5I A;  3UQA A;  2OFN A;  4JFK A;  3S7F A;  2UY1 A;  4UQZ A;  3PRB A;  4J8D A;  4WNE A;  4DH0 A;  5DIV A;  1WM5 A;  2KGJ A;  5A7D B;  4N2S A;  4U0U A;  1TCO C;  2Y4T A;  3URZ A;  4BTB A;  5A6C A;  2LPV A;  3FAP A;  3ZFW A;  3MA5 A;  4WNG A;  2XP9 A;  4BT9 A;  5HWB A;  4GZ3 A;  5DIU A;  3KAI A;  3CGN A;  4I2Z A;  4DRN A;  3B7X A;  4BWR A;  2LNI A;  4W9Q A;  3RU0 A;  4TW8 A;  5JJT A;  4JYS A;  3TCZ A;  2VGX A;  5KJM A;  3OXL A;  2ZQT A;  4RG9 A;  2XPA A;  4NRH B;  2PL2 A;  1ZU2 A;  5HT1 A;  5DIZ A;  4FAP A;  3TAX A;  3O5E A;  3TDB A;  4GCO A;  2ITK A;  3LYA A;  3EDT B;  4U85 A;  1J4I A;  3UQ3 A;  4G26 A;  3S7B A;  4JFI A;  3CKC A;  1T11 A;  3S7J A;  4JHR A;  1ROU A;  2XCC A;  5HI7 A;  1EYM A;  3CGM A;  3FWV A;  5KJK A;  3KAE A;  2XP5 A;  2KE0 A;  1FCH A;  3SZ7 A;  2IF4 A;  1KT0 A;  1FKG A;  5G04 J;  3IKD A;  1FKD A;  3E4B A;  3H9R B;  1D6O A;  1NA0 A;  3R9A B;  4QT3 A;  5FT9 A;  4DZ3 A;  5ARF A;  5HWC A;  4JA9 A;  2FEZ A;  2KR7 A;  2P58 C;  2QFC A;  2PPO A;  3O5O A;  4ABN A;  1FKK A;  3NI6 A;  5G05 C;  2MLY A;  1EQ3 A;  3JYJ A;  1FKI A;  1E96 B;  2Y78 A;  1QPF A;  4AY6 A;  4B94 A;  4GYO A;  2BUG A;  2V5F A;  5D0Q D;  3KAH A;  4AM9 A;  3LUO A;  4XI9 A;  2KO7 A;  2MNT A;  3KAF A;  4J8F A;  5BNW A;  4DIP A;  1KT1 A;  2YHC A;  3TG5 A; 
#chains in the Genus database with same CATH topology
 5DIT A;  4Q96 A;  1GPF A;  3SHF A;  5EX0 A;  4ODK A;  4WK9 A;  2OEW A;  4DLQ A;  3IHV A;  1YYH A;  1MZC A;  5FQ7 A;  1X5B A;  3FTV A;  4HS2 A;  3RO3 A;  4JB8 P;  5FZQ A;  1DCQ A;  4EZK A;  4IN3 B;  2DG9 A;  3O5G A;  3EIP A;  1BD8 A;  4L1B A;  4BFR A;  3EU5 A;  3SGH A;  3G6M A;  2BED A;  3QAR A;  3K9I A;  4XIF A;  4AVX A;  2XP8 A;  3BG1 B;  4XI0 A;  3RME A;  4URK A;  4LCT A;  4H7Y A;  2C0M A;  4LGX A;  3DSS A;  3T9K A;  1TN8 A;  2ZU6 B;  3FTZ A;  3MDY B;  1ZK6 A;  5AJL A;  1ZCN A;  3RK6 A;  2YNQ A;  3CHD A;  2LGO A;  1FT1 A;  2LJ4 A;  1JCH B;  3D9J A;  3O5J A;  3LPZ A;  4KQZ A;  2BKG A;  2IO3 C;  3LVQ E;  5HKG A;  4GTR A;  1U79 A;  3O5K A;  4OAV B;  3AS1 A;  1E8W A;  1BL4 A;  1UR9 A;  4GYW A;  1HX8 A;  1JWF A;  3PZ3 A;  3G2U A;  3ZEF A;  4GGQ A;  3D3M A;  4I43 A;  3SY2 A;  3ONL A;  2ETN A;  1YA0 A;  1UJJ A;  3TWW A;  4TW6 A;  1HJW A;  3Q5M A;  5HBF A;  2J07 A;  3EJN A;  3FTS A;  2WXQ A;  1TFV A;  1IQR A;  1W1P A;  5CEA A;  3B7T A;  2A5E A;  4L9P A;  4YDY A;  3ZU7 B;  2PZI A;  2BTD A;  1E8Z A;  2KC7 A;  3KCE A;  3MEK A;  1Z5S C;  1VF8 A;  2CG2 A;  2IOL A;  1YAT A;  2RKK A;  2H6G A;  4J4O A;  4U0S A;  2OOE A;  5LOZ A;  3CVL A;  1OWL A;  4Q69 A;  2AJA A;  1BKF A;  3P2B A;  3QKY A;  4MSP A;  3ZYQ A;  4NSB A;  3KSL A;  3SBS A;  1QPL A;  2L0T B;  3WKZ A;  3WQW A;  1BI8 B;  3L82 A;  4EZJ A;  4NZC A;  3KSQ A;  4YDE A;  3AS2 A;  3EHM A;  4KZC A;  1EHN A;  1U3C A;  1ZBW A;  1O1T A;  3TWQ A;  1ZU8 A;  2PPP A;  2QY7 A;  1KLX A;  2XGM A;  4GTT A;  3O5F A;  4Z2H A;  4ZPW R;  2JZV A;  3EHN A;  2J09 A;  4GMR A;  5BXU A;  2XP6 A;  4TUM A;  4A1G A;  4UWL A;  5J6E A;  3V31 A;  4W9P A;  3FH5 A;  1J4R A;  3WL0 A;  3AJI A;  1Z6T A;  4ML4 A;  1SW6 A;  1NZN A;  4JD2 G;  1HG5 A;  4Y6C A;  4HOT A;  2DT2 A;  3LY9 A;  5GPG A;  1TNZ A;  2VGY A;  1FKF A;  5AAR A;  2GGF A;  4ANU A;  4FU3 A;  4Q22 A;  2XPI A;  3ZW3 A;  5BUZ A;  4GYY A;  3B7U X;  1W3B A;  4HB5 A;  4B8A A;  3CKB A;  4BY6 A;  2DG3 A;  3RM4 A;  3MZL B;  3FY4 A;  3L08 A;  2BF0 X;  3B9A A;  3ZXS A;  4GZD A;  3PNL B;  4I17 A;  2DSU A;  4CYM D;  4HOQ A;  3UIO C;  3UT8 A;  4GU5 A;  5CED B;  2KCK A;  4W9R A;  3JXI A;  3FHE A;  3NZU A;  3UI6 A;  4G50 A;  3AS4 A;  1DCE A;  1E9L A;  3DRA A;  3CVX A;  4L72 B;  3KAC A;  3E32 A;  3MGB A;  4FAD A;  3CHE A;  2H6I A;  4ME2 A;  1TEZ A;  3RKV A;  4URI A;  4Z2K A;  2MRI A;  2LSV A;  2PNN A;  3UQI A;  1SQM A;  3MKQ B;  3W9G A;  5I98 A;  5G04 C;  2WLZ A;  3SFY A;  4HOU A;  1H0I A;  2ZR6 A;  1HXI A;  4CRW A;  1H2T C;  3PDN A;  2IOS A;  4PS8 A;  4BES A;  4GZ6 A;  3PE3 A;  4HFG A;  4LAV A;  2F21 A;  1FAP A;  1JNT A;  3GYZ A;  2HO1 A;  3WD4 A;  5DO2 A;  2G8Z A;  2AXU A;  5CBO A;  2UY1 B;  5HS0 A;  2E0I A;  3Q7F A;  4N3A A;  4WUY A;  3WIJ A;  3CVW A;  3UXG A;  2OLH A;  5D0O D;  2CHW A;  5B1A E;  3DEP A;  3ARR A;  4Z2J A;  4F1S A;  1NMW A;  2AOS A;  2MF9 A;  2KI3 A;  4HI9 A;  2HR2 A;  4W9O A;  3TWR A;  4F1P A;  1ZB5 A;  2DCP A;  3FUJ A;  2WB2 A;  5EN5 D;  2OVF A;  2XZD G;  3ASH A;  3RO2 A;  5LFA A;  1M5Y A;  3DSU A;  4R7L A;  4AY5 A;  5KBA A;  1N4P A;  2XEH A;  4L2L A;  4B8C B;  1F40 A;  2AVP A;  2B0O E;  2I9C A;  5ANL A;  2XCB A;  5T4Y A;  3HDX A;  3UPV A;  3T5V A;  4WWP A;  3WD0 A;  4HRM B;  3KAB A;  4BTA A;  3C72 A;  1H6K A;  2WXP A;  3ZHE B;  3IEG A;  3SQV A;  3EHQ A;  4JA7 A;  2EUL A;  3WD1 A;  5AJD A;  1H2V C;  1OCC E;  4KYO B;  1N94 A;  3FP3 A;  4I6J A;  4U0Z A;  3CVV A;  3HXF A;  1LJY A;  2A3A A;  1TJF A;  3NF1 A;  4JL0 A;  1L5J A;  1X6L A;  2X6K A;  5EKQ D;  3CEQ A;  4DRP A;  3U3W A;  5LCW C;  3PEV B;  3CQC B;  3D9I A;  2NC9 A;  1N9A A;  5ENO D;  1H6O A;  1LL6 A;  1OT8 A;  1RD6 A;  3B7B A;  3PH0 C;  3FEX A;  3OA5 A;  4DX2 A;  3O5I A;  2OFN A;  2KBX A;  3ZNG A;  4L3N A;  3GTY X;  4UQZ A;  4KVM A;  5CRU A;  4A3V A;  2CFZ A;  3URZ A;  1FFR A;  4EZL A;  4LSZ E;  2MYO A;  3DXM G;  4BT9 A;  3UM0 A;  3R7Q A;  4I2Z A;  4DRN A;  3WQV A;  4NAC A;  4W9Q A;  4DI4 A;  3RU0 A;  1GOI A;  4WIW A;  4I1O B;  3V30 A;  5JJT A;  4FC8 A;  3NOC D;  4EHM A;  4MNL A;  1WDY A;  2XPA A;  3UM3 A;  3ZYL A;  1TN7 A;  1HF8 A;  2ITK A;  2QC9 A;  3LYA A;  4GTS A;  2IO2 C;  1HKJ A;  2LXM A;  1J4I A;  3UQ3 A;  2WVI A;  1FPP A;  3B95 A;  2PI6 A;  5JH8 A;  2V5Q C;  2DT0 A;  3DSW A;  2XP5 A;  2DPE A;  1UG3 A;  2IY0 C;  1JCS A;  3E4B A;  1D6O A;  5HRY A;  4HQD A;  2KM4 A;  3UM1 A;  4E6H A;  3C98 A;  5HWC A;  3APF A;  2KR7 A;  2PPO A;  3L9T A;  3O5O A;  1IHB A;  3DWL G;  4O1O A;  4JW1 A;  5G05 C;  3JYJ A;  1OGG A;  1FKI A;  2Y3A A;  3O4Z A;  1Z3X A;  4DX7 D;  1Z3Y A;  3FH7 A;  3LS8 A;  2XHE A;  3KAH A;  2ZGD A;  5C2Y A;  4M3O A;  1MX6 A;  3EHR A;  4J8F A;  1KT1 A;  3D9O A;  3LJ3 A;  4WKH A;  3WXX A;  3IV0 A;  3V79 K;  2LSU A;  4K03 A;  2YHE A;  4NNR A;  3C5R A;  2VSN A;  3GPK A;  1XHG A;  1XRV A;  4WKA A;  2WXI A;  1HG2 A;  2E2E A;  5JJ7 A;  2ZGG A;  3EIJ A;  4L2Y A;  4F3V A;  1FKT A;  3NRK A;  2M1I A;  3E37 A;  4DRO A;  1E44 A;  2XPZ A;  4IQ2 A;  3LVR E;  2X3M A;  2RD0 A;  2PV3 A;  4UUC A;  1N11 A;  5B8I C;  2R5S A;  3UT7 A;  5FZR A;  3DST A;  2O92 A;  2J49 A;  3UQB A;  2WXM A;  3R9M A;  2L2S A;  5HW7 A;  4L23 A;  4U96 D;  4XZ4 A;  4ACL A;  4AV7 A;  4BER A;  3ZYM A;  1NWR A;  3OOB A;  4LAY A;  2J4D A;  3ZXP A;  5EX3 A;  3ARY A;  3RJV A;  4K5B A;  4GAA A;  1XNF A;  1JNS A;  5KNG A;  3V2O A;  2VTB B;  4U04 A;  3EU9 A;  1TNY A;  2IFU A;  3ODK A;  1Y8M A;  1BI7 B;  5HW6 A;  3WH0 A;  3OAW A;  2C0L A;  3QJZ A;  3I5P A;  4DRI A;  1K1A A;  3SFZ A;  4JZY A;  3HG0 D;  2DG4 A;  3ASO E;  4HLE A;  1WAW A;  4GCN A;  4C0M A;  1WG0 A;  3PZ1 A;  2AW6 A;  5HTG A;  2A5U A;  3DPY A;  1N4Q A;  3R7R A;  2CG3 A;  2DT3 A;  4W5U A;  2LUH A;  4IUL A;  5FZS A;  5JJ6 A;  1BPO A;  2R59 A;  2Y0B G;  5BV1 A;  1FKS A;  3QK0 A;  2F8Y A;  1SYT A;  1SZ9 A;  3L16 A;  3C3Q A;  1LG2 A;  3BQO A;  4DWS C;  4DZ2 A;  1LTX A;  4MLP A;  1D8D A;  1ITX A;  2FUL A;  2WM0 A;  3LKU A;  3G2T A;  1LG1 A;  2J8S D;  3QNK A;  3CVY A;  5CCM A;  4ATZ D;  4UI9 K;  5EID A;  3EIQ C;  1WB0 A;  2CHZ A;  4J0U A;  4WND A;  1N54 A;  3I4R B;  5E75 A;  3LXU X;  4JXT A;  1Q1C A;  3OXF A;  4ODM A;  3AAA C;  3L54 A;  2WMN A;  3ZPJ A;  4ZPV R;  3U66 A;  5GQB A;  3ARP A;  2WXG A;  2M08 A;  2MHK A;  2XP7 A;  1E6R A;  2YQ8 A;  3ZGQ A;  4DX5 D;  2J9Q A;  2X38 A;  3Q15 A;  3D9N A;  4I9C A;  3TL5 A;  1QYM A;  2XS1 A;  1NI1 A;  3ABL E;  3F6Q A;  2ILR A;  2GRP B;  1V54 E;  1ELR A;  3CHC A;  3TC5 A;  3AS5 A;  1D7J A;  4Z2G A;  2BKK B;  5KWD A;  3VLD A;  4DUI A;  1W1T A;  2GRN B;  2YBU A;  1QZ2 A;  3HVE B;  1IXV A;  4MNJ A;  5FQ4 A;  3TXM A;  4GML A;  4G11 A;  2A3E A;  4E85 A;  4Q7N A;  5ENS D;  4R5E A;  1FVF A;  5BV0 A;  4O60 A;  3NAW A;  3NOG D;  1DNP A;  3ML8 A;  3QAQ A;  3NQP A;  5EYL A;  2X6I A;  1FKJ A;  1RW2 A;  3ML9 A;  3S7D A;  5EIB E;  3O5L A;  3SF4 A;  3NB2 A;  3PVL A;  5CEC B;  3BMB A;  2DBA A;  4NQ0 A;  1Q6H A;  2VGX B;  4N5Q A;  3GZS A;  2FO7 A;  2M2A A;  3BU8 A;  2AXZ A;  3LEW A;  2L6J A;  5DBK A;  3FFL A;  3VTX A;  3WG7 E;  1HXV A;  5C1D A;  1L1P A;  3FU3 A;  4J8S A;  4DX1 A;  3Q78 A;  4ZHB A;  3NTP A;  2GW1 A;  2F4E A;  4ILG A;  1GW6 A;  2N87 A;  2R2L A;  3NZS A;  5DEZ A;  1OCO E;  4OVV A;  3FUL A;  5EIL A;  1S63 A;  4QZV B;  1HFA A;  3HXD A;  3LCA A;  4GTV A;  3TWX A;  3UIP C;  1R9H A;  3PRD A;  3CSF A;  2F8X K;  4TNS A;  4HBD A;  4FHK A;  1JWG A;  2KXP C;  5J08 A;  3ALG A;  1DVP A;  1KZO A;  2OV8 A;  3FDH A;  4L7T A;  4TW7 A;  5BPP A;  3QWP A;  4MRU A;  3QC1 A;  2I2O A;  1E8Y A;  3MV3 B;  4I1M A;  4NIK A;  3ZIM A;  4WWO A;  4MAV A;  5CMY A;  3O5Q A;  2IUZ A;  3FEY A;  4ANW A;  2RQS A;  5T8I A;  1E7U A;  3MCX A;  2F0Y A;  3KS2 A;  2R17 C;  3IKG A;  4M7C A;  4TYO A;  4JHK A;  4QIB A;  4DRX E;  2XS8 A;  3EY6 A;  4WJX A;  1HE8 A;  1W26 A;  4IYP A;  2A4Z A;  3J5P A;  1W9V A;  4J8E A;  2H6F A;  2UZ5 A;  2P9S G;  2Y1L E;  2MPH A;  4KR0 B;  2MOW A;  5DF0 A;  4CGV A;  2OEV A;  2PM7 A;  3TJP A;  4BSX A;  2DSZ A;  4ODP A;  3OTN A;  4J4N A;  4ANV A;  4Y6W A;  3AS8 A;  1OWN A;  2AXV A;  4HAR A;  4KMO A;  4XEI G;  3ASG A;  1LQ0 A;  1ZBV A;  3MKQ A;  3GZ1 A;  5FIN A;  3JYS A;  2P2C P;  5AEN A;  3IK8 A;  3HVE A;  3PNT B;  1JPL A;  4KBQ A;  4IQC A;  1MX2 A;  3T8M A;  2ZQS A;  1FKR A;  4N2Q A;  3ARU A;  4GTM A;  3UQA A;  3ENE A;  4B0Z A;  4JFK A;  4C48 B;  2DYS E;  2UY1 A;  3PRB A;  1Q2Z A;  1XGW A;  4DH0 A;  1HU3 A;  4JEU A;  4CDM A;  5HKP A;  4N2S A;  4U0U A;  1TCO C;  3C3R A;  3DSX A;  3E33 A;  1N4S A;  4P8W A;  1EF1 C;  1W1V A;  5ENP D;  1LF8 A;  4YDW A;  3NBN B;  4BWR A;  2DZN A;  1E6P A;  1NWS A;  4TW8 A;  4GMJ A;  3TCZ A;  5LX8 A;  1KFW A;  3OXL A;  3UTM A;  4LNB A;  2IQC A;  4NRH B;  1ZU2 A;  3TWV A;  5DIZ A;  4AXH A;  3TAX A;  2WM9 A;  3O5E A;  3I4G A;  4GCO A;  1S0P A;  2RFM A;  2EIL E;  3FTY A;  4U85 A;  4DWS A;  4JFI A;  3FWV A;  3CGH A;  1E15 A;  4ZS6 A;  2OVB A;  2KE0 A;  3FUH A;  4UWH A;  2DSV A;  1FKG A;  1UOH A;  5G04 J;  3IKD A;  1ZB1 A;  4Q94 A;  4MKT A;  3H9R B;  1NA0 A;  1S70 B;  5FIO A;  1SVX A;  5JHA A;  1TNO A;  2FO1 E;  4HXI A;  4DZ3 A;  5ARF A;  4WKF A;  2F23 A;  4JA9 A;  2IEJ A;  2WK2 A;  3UT4 A;  4ABN A;  4BX9 A;  3AG3 E;  3JQ1 A;  1EQ3 A;  5JHB A;  1NWU A;  1H0G A;  1LL7 A;  1S64 A;  2Y78 A;  4AY6 A;  1AP7 A;  3B7S A;  4GYO A;  4AM9 A;  2P9L G;  4XI9 A;  5B3S E;  1KZP A;  3TG5 A;  2D9F A;  4FA6 A;  4K5C A;  1A17 A;  2X6F A;  4CT4 A;  4UQX A;  1OCR E;  2WMO A;  4MS6 A;  4YVQ C;  2VN1 A;  4LEU A;  4AIF A;  3GW4 A;  5HQ8 A;  4MTV A;  4G1T A;  2VJ8 A;  4DWS B;  4GTQ A;  3B9D A;  3UX4 A;  4PS3 A;  4JFM A;  4TXR A;  5AQA A;  4LAX A;  2PV1 A;  3VLF A;  3JUI A;  4WNF A;  5D66 A;  3Q79 A;  5AN8 A;  2WQH A;  2FBN A;  3JCK C;  2K8I A;  4R0X A;  5B1B E;  3Q9N C;  4PH4 B;  2WPV A;  1DC2 A;  4A55 A;  5J90 A;  3FTW A;  1E8X A;  5KJN A;  2FF4 A;  4H7X A;  5KJL A;  1UN8 A;  4MPK A;  4U07 A;  4N19 A;  1NH6 A;  3ZN3 A;  2X6H A;  1INZ A;  4HOS A;  3RRU A;  3Q4A B;  1OCZ E;  4PUC A;  3UKR G;  1LL4 A;  1H19 A;  1N0R A;  5FTP A;  4RVB A;  4EEC A;  3FXY A;  2XEN A;  2R05 A;  1YMP A;  4UQY A;  4FJY A;  3ISM C;  1WAO 1;  5CRV A;  4LRZ A;  1NP7 A;  3ONK A;  3BUA A;  3G2S A;  1HKI A;  3L17 A;  1O6I A;  3CST A;  4RG6 A;  5FJY A;  4NUR A;  5FQ8 A;  2Y69 E;  4J6I A;  4TV3 A;  3RSE G;  1SA5 A;  3CLJ A;  4N3C A;  4ACK A;  2VQ2 A;  3KD7 A;  3RRM B;  1ZBC A;  4DT4 A;  3PRE A;  2KFW A;  1QNF A;  4B93 B;  3CHQ A;  1Y0O A;  1PAQ A;  3WD2 A;  1D7H A;  3KAG A;  4C02 B;  3L22 A;  2P9U G;  1EDU A;  3CVP A;  4CDR A;  3D9M A;  2B6C A;  1JUQ A;  1HH8 A;  3FTU A;  4S3J A;  2EIM E;  3ZRH A;  3ABK E;  4YVO A;  3IHZ A;  2VSX E;  2VSY A;  5KCM A;  4G2P A;  1ROT A;  5CHE E;  2A3B A;  1PC2 A;  4UDM A;  2P9N G;  3JXJ A;  5AAO A;  5A23 A;  2OCC E;  3CH9 A;  2DT1 A;  3VTY A;  3HXE A;  2MLX A;  1TR4 A;  1W9U A;  2Y4U A;  3TWT A;  2NXP A;  4TXQ A;  4GTP A;  3D9P A;  5LCW J;  3L6A A;  3CVU A;  2JAB A;  4RSY A;  1FVH A;  3KZ7 A;  2ZR5 A;  2DVW A;  3HRA A;  2IU1 A;  3RFW A;  2WXK A;  3ABM E;  3FUD A;  2J4B A;  3PZD A;  3UI2 A;  4DX6 D;  3FUK A;  4I2W A;  4DWS D;  1EDQ A;  4F7A A;  1J6Y A;  3FUF A;  4DPR A;  4TXP A;  2YBT A;  3G2W A;  5H7P A;  2KCL A;  2DWZ A;  1TJC A;  2WXH A;  3I6C A;  4UI9 C;  1E90 A;  1WNO A;  2L9B A;  4ODR A;  3ZVV A;  4C9B B;  2F37 A;  2AWG A;  4C0E A;  5M72 A;  4F53 A;  4U86 A;  4UWF A;  4K5A B;  4GPK A;  4U7E B;  5CCL A;  1W9P A;  4S3K A;  3TG4 A;  2RFA A;  4HOR A;  3O5P A;  1IYG A;  3PRZ A;  3HHM A;  1NA3 A;  3ARZ A;  5D2M C;  4YDO A;  3CVQ A;  5HW8 A;  4N39 A;  4KT6 B;  4G25 A;  4AP2 A;  3ALF A;  4TX0 A;  4JHJ A;  5FQ6 A;  3O48 A;  4HBO A;  4AY1 A;  4GTO A;  4P8X A;  4ILH B;  2XGO A;  4WAF A;  3FY1 A;  1GRJ A;  5ARG A;  3ULQ A;  3ASD A;  2HYZ A;  3Q49 B;  2WXR A;  1EIB A;  4P8U A;  4ILI A;  4QQI A;  2FDM A;  4EQF A;  1H6P A;  3W4R A;  2RUQ A;  4CGW A;  3MJW A;  3SI5 A;  4OVU A;  1PIN A;  4GB9 A;  3ZUV B;  1NFI E;  1D7I A;  1UW4 B;  2M63 A;  2EQX A;  2YIN A;  3S2A A;  4DRQ A;  4HVB A;  4GA1 A;  4BX8 A;  1P5Q A;  3ARV A;  1N4R A;  3HIZ A;  1K3Z D;  1IHG A;  2PM6 A;  1W1Y A;  1OWO A;  1GUV A;  1C9H A;  4UWK A;  1OXJ A;  3UI5 A;  1OUV A;  3DBS A;  3O5R A;  1UN9 A;  3DXK G;  4ZPT R;  2GRO B;  1FKB A;  2WXL A;  1OY3 D;  3AU5 A;  3PUK A;  4F6R D;  2GRQ B;  4ITZ A;  4ODQ A;  1KPS B;  2XRY A;  5CER B;  2I1J A;  3CHP A;  3UUX A;  1X6N A;  1VDY A;  3VAW A;  4HI8 A;  1E6N A;  5JMN D;  1PBK A;  3TGO A;  4XX5 A;  1QQE A;  3AG1 E;  3JUE A;  3HXB A;  3UIN C;  1JCQ A;  1NWT A;  5KNH D;  2GRM A;  1JCR A;  1G3N B;  2XPY A;  4AOF A;  4JFJ A;  2GRR B;  1Y6I A;  1MJ0 A;  4A63 B;  5ENN A;  2EIK E;  3JYM A;  3RRN B;  3SD5 A;  4DK5 A;  2V4L A;  4IT6 A;  3FUE A;  3IKO B;  2PQR A;  1RZ4 A;  3LY8 A;  3MX3 A;  1D2K A;  1N0Q A;  2RG8 A;  2NYJ A;  4HRN A;  4J8D A;  4WNE A;  2R03 A;  4APF A;  2L0I A;  4X8Q A;  1K9T A;  2KGJ A;  2DYR E;  2Y4T A;  1O1R A;  3AG4 E;  4BTB A;  3B9E A;  3FAP A;  3MA5 A;  1FT2 A;  1A5E A;  2LAH A;  5HWB A;  4GZ3 A;  2HM8 A;  3GU0 A;  1E7V A;  3CHS A;  5T3R A;  3APC A;  2LNI A;  1H0A A;  3B8S A;  2VGX A;  3AG2 E;  5KJM A;  2QZA A;  2WXO A;  2DSW A;  2PL2 A;  4GZC A;  4ZFH A;  3IHY A;  3TDB A;  5ENR D;  3S7B A;  4UWG A;  3CKC A;  2I1K A;  4LNG A;  4JHR A;  4RLY A;  2XCC A;  3S7J A;  1ROU A;  3UMV A;  5KJK A;  1TN6 A;  2WXF A;  3D9K A;  3SZ7 A;  2ZIS A;  2IF4 A;  4XAK A;  2WQ7 A;  1FKD A;  1H2U A;  3ART A;  4QT3 A;  5FT9 A;  3PUJ A;  2P58 C;  2QFC A;  1K1B A;  3EUV A;  1IQU A;  2ESC A;  2MLY A;  5JA4 D;  1MYO A;  2VSO E;  4CCA A;  4J8Y A;  4B94 A;  4B89 A;  1OGB A;  2BUG A;  4D10 C;  5D0Q D;  3LUO A;  5LP0 A;  3B7R L;  2HE0 A;  2KO7 A;  5BNW A;  2YHC A;  4Z68 A;  3ASF A;  4LUN U;  3CHM A;  3CR3 A;  4P8V A;  4CT0 A;  3U4T A;  5BT1 A;  4IPX A;  2MLZ A;  4G24 A;  3G6L A;  2C2L A;  1B6C A;  4GA2 A;  4G8L A;  2FAP A;  3DPD A;  3PR9 A;  4BF8 A;  3WD3 A;  2ETC A;  3MYV A;  1EPU A;  2P9I G;  3D9L A;  4I6G A;  2DZO A;  3OXG A;  4DRH A;  2V0P A;  1O5M A;  4U8Y D;  1SA4 A;  1FKH A;  4BT8 A;  3O5M A;  1WY6 A;  2AWI A;  4JEH A;  5IY5 E;  4A3T A;  3AU4 A;  4JVS A;  4IRU A;  3CV0 A;  3QDN A;  3SNX A;  1N1A A;  4MNM A;  4FHJ A;  4CEM A;  3V2X A;  3LJN A;  1B89 A;  2V8S E;  3AS0 A;  3N71 A;  4U8H A;  4LNU D;  4CZ2 D;  1UJK A;  3HXC A;  3UKU G;  4K0R A;  5EDS A;  1NMV A;  3L13 A;  4G23 A;  5EYP F;  3E30 A;  2XEV A;  4KXK B;  1YW5 A;  5FWQ A;  2R02 A;  4APO A;  3VLE A;  4LER A;  2ZR4 A;  4FN2 A;  3D9H A;  3TWS A;  2LKN A;  1F8A B;  2DIW A;  3FTX A;  2XPB A;  1BU9 A;  1CTN A;  2L6B A;  4DI3 A;  4I1A A;  3JXV A;  4BEP A;  3CHF A;  4ODL A;  3I3N A;  3RIB A;  3UM2 A;  1U2V G;  2JEK A;  2QYU A;  4O6F A;  1NL4 A;  4OYS A;  2PQN A;  1ZBP A;  3GZ2 A;  3PA7 A;  3ESL A;  1UR8 A;  4EBA G;  3ZHE A;  2KZT A;  4ODN A;  3SFX A;  2OND A;  1A7X A;  2RUC A;  1JVW A;  3MV2 B;  4ODO A;  5D75 A;  1JNE A;  1X81 A;  2VTB A;  3PZ2 A;  3CIA A;  3U64 A;  3Q73 A;  1HKM A;  4N3B A;  4GZ5 A;  3LY7 A;  3QWW A;  3IBE A;  2QYJ A;  5G05 J;  3X2Q E;  4FUL A;  3DSV A;  3MKR A;  3FU6 A;  3Q47 B;  3AS3 A;  4GPM A;  4MGV A;  2PBC A;  3CVN A;  3ARS A;  3O5D A;  3KEZ A;  3FUN A;  3QWV A;  4XKB A;  2ETA A;  1E6Z A;  4GIV A;  1PY1 A;  2Q7F A;  5G55 A;  4UI9 J;  2KAT A;  2RUD A;  3FH8 A;  2WXJ A;  4TUU A;  5AYW D;  2P9K G;  1BLX B;  5ENQ D;  1FKL A;  3UF8 A;  3ASN E;  2UWJ G;  4V3I A;  5CMW A;  3ULY A;  1TYQ G;  4P29 A;  3T5X A;  4HNA D;  3SO8 A;  2WLY A;  3ARW A;  1Q6I A;  3CK9 A;  4BSZ B;  4G8K A;  1NSG A;  4OAU C;  2J08 A;  2LAI A;  3ARX A;  2XRZ A;  2XP3 A;  3Q9U C;  4EPZ A;  3W9F A;  2F2D A;  3ZYK A;  3FUM A;  1ELW A;  3ESK A;  1AWC B;  4BET A;  4RQI A;  4I9E A;  1K8K G;  3B13 A;  3UI4 A;  2FI7 A;  2NSZ A;  2IJG X;  3TXN A;  3QOU A;  2VCD A;  2Q5A A;  4HRL A;  4Z2I A;  4LG6 A;  5HUA A;  2LXL A;  2JLB A;  1JND A;  4PTM A;  4XE0 A;  1MHQ A;  2ZXW E;  4FP7 A;  2LO6 A;  5BW8 C;  1EYH A;  2I6H A;  4FJZ A;  3RAU A;  3J5Q B;  3Q7A A;  5BXO A;  4ANX A;  1J4H A;  2CFU A;  4Z2L A;  2VGE A;  4U8V D;  2ZIR A;  4U84 A;  2PPN A;  1FFQ A;  1ZL1 A;  4DRJ A;  3CHO A;  3E34 A;  2ZQU A;  2PV2 A;  4DLO A;  4FLH A;  1LD7 A;  1TNU A;  4N5C A;  1HJX A;  2RSE A;  4IT4 A;  2XP4 A;  3JQ0 A;  3PE4 A;  3CK8 A;  4HBE A;  3PRA A;  2ION A;  3CK7 A;  2O9O A;  4QT2 A;  3RGC A;  3DEO A;  4A1S A;  5GPR A;  4FLB A;  2FKE A;  3P1U A;  4YND A;  4MBG A;  3KAD A;  4WWN A;  2KZT B;  3BEE A;  3QB2 A;  4MNK A;  3RM8 A;  3WL1 A;  1D8E A;  1V55 E;  3G2V A;  4XKC A;  1O1S A;  2H6H A;  4LAW A;  1OWQ A;  2QF8 A;  4AEZ C;  4DRK A;  2CHX A;  3APD A;  5E76 A;  3PZ4 A;  1ELK A;  4KVO A;  1MX4 A;  4GA0 A;  5BXJ A;  1SR0 A;  1LD8 A;  1HKK A;  1YCS B;  2XQ0 A;  2WQ6 A;  4U63 A;  3CQG B;  5AIJ A;  4O2T A;  2XEE A;  5ITZ F;  1ZBK A;  2P9P G;  2XGS A;  3ARO A;  3ARQ A;  4KZ0 A;  2ZQV A;  3BG0 B;  3IXE A;  3U9W A;  4JFL A;  1IX5 A;  2VYI A;  4AJW A;  4G2V A;  3PS6 A;  4QFV A;  2KCV A;  4PDX A;  4EBA A;  2RUR A;  2B31 A;  1FD9 A;  3TWU A;  1FJD A;  1N95 A;  2EIJ E;  4O1P A;  2G41 A;  3T8K A;  3ZKJ A;  5ENT D;  5CBN A;  4DJA A;  3CHR A;  1HZ4 A;  4DRM A;  1Q6U A;  3HYM B;  3ULE G;  5AQ7 A;  3S7F A;  2A3C A;  2ETB A;  2X6J A;  4PS7 A;  3C3O A;  5DIV A;  3KEA A;  5AQ9 A;  1WM5 A;  5A7D B;  1HS6 A;  4ATG A;  3Q75 A;  5A6C A;  2LPV A;  3ZFW A;  4WNG A;  1HJV A;  2XP9 A;  5DIU A;  3PEU B;  3KAI A;  1N52 A;  3CGN A;  3B7X A;  4TRQ A;  2P4V A;  4I6E A;  1TNB A;  4U95 D;  4JYS A;  4J7W A;  2ZQT A;  1IKN D;  3LDZ A;  4RG9 A;  5HT1 A;  4FAP A;  5AQB A;  5ANR A;  3FU0 A;  3EDT B;  1MQS A;  2PN0 A;  4G26 A;  3AQU A;  3BXW A;  1D9S A;  1T11 A;  3CGM A;  1EYM A;  5HI7 A;  3CZ8 A;  3KAE A;  1FCH A;  2B5U B;  1KT0 A;  5G2N A;  3QOK A;  3R9A B;  1OWM A;  2FEZ A;  2XZT G;  1OWP A;  3FUI A;  1FKK A;  3NI6 A;  4JC8 A;  2GRL A;  3SBT B;  2EIN E;  1E96 B;  1U3D A;  1QPF A;  4JPS A;  3FU5 A;  1SZA A;  2V5F A;  4CDN A;  2V4H C;  2WXN A;  2MNT A;  3KAF A;  1QBQ A;  4DIP A;  4HLL A;  1HO8 A;  3RM9 A; 
#chains in the Genus database with same CATH homology
 5DIT A;  4Q96 A;  1GPF A;  3SHF A;  5EX0 A;  4ODK A;  4WK9 A;  4DLQ A;  3IHV A;  5FQ7 A;  1X5B A;  3FTV A;  4HS2 A;  3RO3 A;  5FZQ A;  4EZK A;  4IN3 B;  2DG9 A;  3O5G A;  4L1B A;  4BFR A;  3SGH A;  3G6M A;  3QAR A;  3K9I A;  4XIF A;  4AVX A;  2XP8 A;  3BG1 B;  4XI0 A;  3RME A;  4URK A;  4LCT A;  4H7Y A;  2C0M A;  4LGX A;  2ZU6 B;  3FTZ A;  3MDY B;  1ZK6 A;  5AJL A;  1ZCN A;  3RK6 A;  2YNQ A;  3CHD A;  2LGO A;  2LJ4 A;  3D9J A;  3O5J A;  3LPZ A;  4KQZ A;  3LVQ E;  5HKG A;  3O5K A;  1U79 A;  3AS1 A;  1E8W A;  1BL4 A;  1UR9 A;  4GYW A;  1HX8 A;  1JWF A;  3G2U A;  3ZEF A;  4GGQ A;  3D3M A;  4I43 A;  3ONL A;  1YA0 A;  1UJJ A;  4TW6 A;  1HJW A;  3Q5M A;  5HBF A;  2J07 A;  3EJN A;  3FTS A;  2WXQ A;  1TFV A;  1IQR A;  1W1P A;  3B7T A;  3KCE A;  2PZI A;  2BTD A;  1E8Z A;  2KC7 A;  3MEK A;  1VF8 A;  2CG2 A;  2IOL A;  1YAT A;  4J4O A;  4U0S A;  2OOE A;  5LOZ A;  3CVL A;  1OWL A;  4Q69 A;  1BKF A;  3P2B A;  3QKY A;  4MSP A;  3ZYQ A;  4NSB A;  3SBS A;  1QPL A;  2L0T B;  3WKZ A;  3WQW A;  4NZC A;  4EZJ A;  3AS2 A;  3EHM A;  4KZC A;  1EHN A;  1U3C A;  1ZBW A;  1ZU8 A;  2PPP A;  2QY7 A;  1KLX A;  2XGM A;  3O5F A;  4Z2H A;  4ZPW R;  2JZV A;  3EHN A;  2J09 A;  2XP6 A;  5J6E A;  4A1G A;  4UWL A;  4W9P A;  3FH5 A;  1J4R A;  3WL0 A;  1Z6T A;  4ML4 A;  1NZN A;  1HG5 A;  4Y6C A;  4HOT A;  2DT2 A;  3LY9 A;  5GPG A;  2VGY A;  1FKF A;  2GGF A;  4ANU A;  4FU3 A;  4Q22 A;  2XPI A;  3ZW3 A;  5BUZ A;  4GYY A;  3B7U X;  1W3B A;  4B8A A;  3CKB A;  4BY6 A;  2DG3 A;  3RM4 A;  3MZL B;  3FY4 A;  3L08 A;  2BF0 X;  3B9A A;  3ZXS A;  4GZD A;  3PNL B;  4I17 A;  2DSU A;  4HOQ A;  3UT8 A;  4GU5 A;  2KCK A;  4W9R A;  3FHE A;  3NZU A;  3UI6 A;  4G50 A;  3AS4 A;  1E9L A;  3CVX A;  4L72 B;  3KAC A;  4FAD A;  3MGB A;  3CHE A;  4ME2 A;  1TEZ A;  3RKV A;  4URI A;  4Z2K A;  2MRI A;  2LSV A;  3UQI A;  1SQM A;  3MKQ B;  5I98 A;  5G04 C;  2WLZ A;  4HOU A;  1H0I A;  2ZR6 A;  1HXI A;  4CRW A;  1H2T C;  3PDN A;  2IOS A;  4PS8 A;  4GZ6 A;  3PE3 A;  4HFG A;  4LAV A;  2F21 A;  1FAP A;  1JNT A;  3GYZ A;  2HO1 A;  3WD4 A;  5DO2 A;  2G8Z A;  2AXU A;  2UY1 B;  2E0I A;  4N3A A;  4WUY A;  3WIJ A;  3CVW A;  4Z2J A;  2OLH A;  5D0O D;  2CHW A;  3ARR A;  4F1S A;  1NMW A;  2AOS A;  2MF9 A;  2KI3 A;  2HR2 A;  4W9O A;  1ZB5 A;  2DCP A;  3FUJ A;  2WB2 A;  2OVF A;  3ASH A;  3RO2 A;  5LFA A;  1M5Y A;  4R7L A;  4AY5 A;  4L2L A;  4B8C B;  1F40 A;  2AVP A;  2I9C A;  5ANL A;  2XCB A;  5T4Y A;  3HDX A;  3UPV A;  4WWP A;  3T5V A;  3WD0 A;  3KAB A;  4BTA A;  1H6K A;  2WXP A;  3ZHE B;  3IEG A;  4JA7 A;  3WD1 A;  5AJD A;  1H2V C;  4KYO B;  3FP3 A;  4I6J A;  4U0Z A;  3CVV A;  1LJY A;  2A3A A;  1TJF A;  3NF1 A;  4JL0 A;  1L5J A;  1X6L A;  2X6K A;  5EKQ D;  3CEQ A;  4DRP A;  3U3W A;  5LCW C;  3PEV B;  3CQC B;  3D9I A;  2NC9 A;  1LL6 A;  1RD6 A;  3PH0 C;  3FEX A;  3OA5 A;  3O5I A;  2OFN A;  4L3N A;  4UQZ A;  4KVM A;  4A3V A;  2CFZ A;  3URZ A;  1FFR A;  4EZL A;  4BT9 A;  3R7Q A;  4I2Z A;  4DRN A;  3WQV A;  4NAC A;  4W9Q A;  4DI4 A;  3RU0 A;  1GOI A;  4WIW A;  4I1O B;  5JJT A;  4FC8 A;  4MNL A;  2XPA A;  3ZYL A;  1HF8 A;  2ITK A;  3LYA A;  1HKJ A;  1J4I A;  3UQ3 A;  2WVI A;  2PI6 A;  5JH8 A;  2DT0 A;  2XP5 A;  2DPE A;  1UG3 A;  3E4B A;  1D6O A;  2KM4 A;  4E6H A;  3C98 A;  5HWC A;  3APF A;  2KR7 A;  2PPO A;  3O5O A;  4JW1 A;  5G05 C;  3JYJ A;  1OGG A;  1FKI A;  2Y3A A;  3O4Z A;  1Z3X A;  1Z3Y A;  3FH7 A;  3LS8 A;  2XHE A;  3KAH A;  5C2Y A;  4M3O A;  4J8F A;  1KT1 A;  3D9O A;  3LJ3 A;  4WKH A;  3WXX A;  3IV0 A;  2LSU A;  4K03 A;  2YHE A;  4NNR A;  2VSN A;  3GPK A;  1XHG A;  1XRV A;  4WKA A;  2WXI A;  1HG2 A;  2E2E A;  5JJ7 A;  3EIJ A;  4L2Y A;  4F3V A;  1FKT A;  3NRK A;  2M1I A;  4DRO A;  2XPZ A;  4IQ2 A;  3LVR E;  2X3M A;  2RD0 A;  2PV3 A;  5B8I C;  2R5S A;  3UT7 A;  5FZR A;  2O92 A;  2J49 A;  3UQB A;  2WXM A;  2L2S A;  5HW7 A;  4L23 A;  4XZ4 A;  4ACL A;  4AV7 A;  3ZYM A;  1NWR A;  3OOB A;  4LAY A;  2J4D A;  5EX3 A;  3ARY A;  3RJV A;  4GAA A;  1XNF A;  1JNS A;  2VTB B;  4U04 A;  2IFU A;  3ODK A;  1Y8M A;  5HW6 A;  3WH0 A;  3OAW A;  2C0L A;  3QJZ A;  3I5P A;  4DRI A;  3SFZ A;  4JZY A;  2DG4 A;  4HLE A;  1WAW A;  4GCN A;  4C0M A;  2AW6 A;  5HTG A;  2A5U A;  3R7R A;  2CG3 A;  2DT3 A;  4W5U A;  4IUL A;  5FZS A;  5JJ6 A;  1BPO A;  2R59 A;  5BV1 A;  1FKS A;  3QK0 A;  1SYT A;  1SZ9 A;  3L16 A;  1LG2 A;  4DWS C;  4DZ2 A;  4MLP A;  1ITX A;  2FUL A;  2WM0 A;  3LKU A;  3G2T A;  1LG1 A;  3QNK A;  3CVY A;  5CCM A;  4UI9 K;  3EIQ C;  1WB0 A;  2CHZ A;  4J0U A;  4WND A;  1N54 A;  3I4R B;  5E75 A;  3LXU X;  4JXT A;  1Q1C A;  3OXF A;  4ODM A;  3L54 A;  2WMN A;  3ZPJ A;  4ZPV R;  3U66 A;  5GQB A;  3ARP A;  2WXG A;  2M08 A;  2MHK A;  2XP7 A;  1E6R A;  2YQ8 A;  3ZGQ A;  2J9Q A;  2X38 A;  3Q15 A;  3D9N A;  4I9C A;  3TL5 A;  2ILR A;  1ELR A;  3CHC A;  3TC5 A;  3AS5 A;  1D7J A;  4Z2G A;  3VLD A;  1W1T A;  2YBU A;  1QZ2 A;  3HVE B;  4MNJ A;  5FQ4 A;  3TXM A;  4GML A;  4G11 A;  2A3E A;  4E85 A;  4Q7N A;  4R5E A;  1FVF A;  5BV0 A;  1DNP A;  3ML8 A;  3QAQ A;  3NQP A;  2X6I A;  1FKJ A;  3ML9 A;  3S7D A;  3O5L A;  3SF4 A;  3PVL A;  2DBA A;  4NQ0 A;  1Q6H A;  2VGX B;  3GZS A;  2FO7 A;  2M2A A;  2AXZ A;  3LEW A;  2L6J A;  5DBK A;  3FFL A;  3VTX A;  1HXV A;  5C1D A;  1L1P A;  3FU3 A;  4J8S A;  3NTP A;  2GW1 A;  2F4E A;  4ILG A;  1GW6 A;  2N87 A;  3NZS A;  5DEZ A;  4OVV A;  3FUL A;  4QZV B;  1HFA A;  3LCA A;  1R9H A;  3PRD A;  3CSF A;  4TNS A;  4FHK A;  1JWG A;  5J08 A;  3ALG A;  1DVP A;  2OV8 A;  3FDH A;  4L7T A;  4TW7 A;  5BPP A;  3QWP A;  4MRU A;  3QC1 A;  2I2O A;  1E8Y A;  3MV3 B;  4I1M A;  3ZIM A;  4WWO A;  4MAV A;  5CMY A;  3O5Q A;  2IUZ A;  3FEY A;  4ANW A;  2RQS A;  5T8I A;  1E7U A;  3MCX A;  3KS2 A;  2R17 C;  3IKG A;  4TYO A;  4JHK A;  4QIB A;  3EY6 A;  4WJX A;  1HE8 A;  1W26 A;  4IYP A;  2A4Z A;  1W9V A;  4J8E A;  2UZ5 A;  2MPH A;  4KR0 B;  2MOW A;  5DF0 A;  4CGV A;  2PM7 A;  3TJP A;  4BSX A;  2DSZ A;  4ODP A;  3OTN A;  4J4N A;  4ANV A;  4Y6W A;  3AS8 A;  1OWN A;  2AXV A;  4HAR A;  4KMO A;  3ASG A;  1LQ0 A;  1ZBV A;  3MKQ A;  3GZ1 A;  3JYS A;  5AEN A;  3IK8 A;  3HVE A;  3PNT B;  1JPL A;  4KBQ A;  4IQC A;  3T8M A;  2ZQS A;  1FKR A;  4N2Q A;  3ARU A;  3UQA A;  3ENE A;  4B0Z A;  4JFK A;  2UY1 A;  3PRB A;  1XGW A;  4DH0 A;  1HU3 A;  4JEU A;  4CDM A;  4N2S A;  4U0U A;  1TCO C;  4P8W A;  1EF1 C;  1W1V A;  1LF8 A;  4BWR A;  1E6P A;  1NWS A;  4TW8 A;  4GMJ A;  3TCZ A;  5LX8 A;  1KFW A;  3OXL A;  2IQC A;  4NRH B;  1ZU2 A;  5DIZ A;  4AXH A;  3TAX A;  2WM9 A;  3O5E A;  3I4G A;  4GCO A;  1S0P A;  3FTY A;  4U85 A;  4DWS A;  4JFI A;  3FWV A;  3CGH A;  1E15 A;  4ZS6 A;  2OVB A;  2KE0 A;  3FUH A;  4UWH A;  2DSV A;  1FKG A;  5G04 J;  3IKD A;  4Q94 A;  4MKT A;  3H9R B;  1NA0 A;  5JHA A;  4HXI A;  4DZ3 A;  5ARF A;  4WKF A;  4JA9 A;  2WK2 A;  3UT4 A;  4ABN A;  4BX9 A;  3JQ1 A;  1EQ3 A;  5JHB A;  1NWU A;  1H0G A;  1LL7 A;  2Y78 A;  4AY6 A;  3B7S A;  4GYO A;  4AM9 A;  4XI9 A;  3TG5 A;  2D9F A;  4FA6 A;  1A17 A;  2X6F A;  4CT4 A;  4UQX A;  2WMO A;  4MS6 A;  4YVQ C;  2VN1 A;  4LEU A;  4AIF A;  3GW4 A;  5HQ8 A;  4MTV A;  4G1T A;  2VJ8 A;  4DWS B;  3B9D A;  3UX4 A;  4PS3 A;  4JFM A;  4LAX A;  2PV1 A;  3VLF A;  3JUI A;  4WNF A;  2WQH A;  2FBN A;  3JCK C;  2K8I A;  4R0X A;  4PH4 B;  2WPV A;  4A55 A;  5J90 A;  3FTW A;  1E8X A;  5KJN A;  2FF4 A;  4H7X A;  5KJL A;  1UN8 A;  4MPK A;  4U07 A;  4N19 A;  1NH6 A;  3ZN3 A;  2X6H A;  1INZ A;  4HOS A;  3RRU A;  3Q4A B;  4PUC A;  1LL4 A;  1H19 A;  5FTP A;  4RVB A;  4EEC A;  3FXY A;  4UQY A;  4FJY A;  1WAO 1;  4LRZ A;  1NP7 A;  3ONK A;  3G2S A;  1HKI A;  3L17 A;  1O6I A;  3CST A;  4RG6 A;  5FJY A;  4NUR A;  5FQ8 A;  4J6I A;  4TV3 A;  3CLJ A;  4N3C A;  4ACK A;  2VQ2 A;  3KD7 A;  3RRM B;  1ZBC A;  4DT4 A;  3PRE A;  2KFW A;  1QNF A;  3CHQ A;  1Y0O A;  1PAQ A;  3WD2 A;  1D7H A;  3KAG A;  4C02 B;  3L22 A;  1EDU A;  3CVP A;  4CDR A;  3D9M A;  1JUQ A;  1HH8 A;  3FTU A;  4S3J A;  3ZRH A;  4YVO A;  3IHZ A;  2VSX E;  2VSY A;  5KCM A;  4G2P A;  1ROT A;  5CHE E;  2A3B A;  1PC2 A;  5A23 A;  3CH9 A;  2DT1 A;  3VTY A;  2MLX A;  1W9U A;  2Y4U A;  2NXP A;  3D9P A;  5LCW J;  3L6A A;  3CVU A;  4RSY A;  1FVH A;  3KZ7 A;  2ZR5 A;  2IU1 A;  3RFW A;  2WXK A;  3FUD A;  2J4B A;  3PZD A;  3FUK A;  4I2W A;  4DWS D;  1EDQ A;  4F7A A;  1J6Y A;  3FUF A;  4DPR A;  2YBT A;  3G2W A;  2KCL A;  1TJC A;  2WXH A;  3I6C A;  4UI9 C;  1E90 A;  1WNO A;  2L9B A;  4ODR A;  3ZVV A;  4C9B B;  2AWG A;  4C0E A;  5M72 A;  4F53 A;  4U86 A;  4UWF A;  4GPK A;  5CCL A;  1W9P A;  4S3K A;  3TG4 A;  4HOR A;  3O5P A;  1IYG A;  3PRZ A;  3HHM A;  1NA3 A;  3ARZ A;  3CVQ A;  5HW8 A;  4N39 A;  4KT6 B;  4G25 A;  4AP2 A;  3ALF A;  4TX0 A;  4JHJ A;  5FQ6 A;  3O48 A;  4HBO A;  4AY1 A;  4P8X A;  4ILH B;  2XGO A;  4WAF A;  3FY1 A;  5ARG A;  3ULQ A;  3ASD A;  2HYZ A;  3Q49 B;  2WXR A;  1EIB A;  4P8U A;  4ILI A;  2FDM A;  4EQF A;  3W4R A;  2RUQ A;  4CGW A;  3MJW A;  3SI5 A;  4OVU A;  1PIN A;  4GB9 A;  1D7I A;  1UW4 B;  2M63 A;  2EQX A;  2YIN A;  3S2A A;  4DRQ A;  4HVB A;  4GA1 A;  4BX8 A;  1P5Q A;  3ARV A;  3HIZ A;  1IHG A;  2PM6 A;  1W1Y A;  1OWO A;  1GUV A;  1C9H A;  4UWK A;  3UI5 A;  1OUV A;  3DBS A;  3O5R A;  1UN9 A;  4ZPT R;  1FKB A;  2WXL A;  3AU5 A;  3PUK A;  4ITZ A;  4ODQ A;  2XRY A;  2I1J A;  3CHP A;  3UUX A;  1X6N A;  1VDY A;  3VAW A;  1E6N A;  1PBK A;  3TGO A;  4XX5 A;  1QQE A;  1NWT A;  2GRM A;  2XPY A;  4AOF A;  4JFJ A;  1Y6I A;  5ENN A;  3JYM A;  3RRN B;  3SD5 A;  4DK5 A;  2V4L A;  4IT6 A;  3FUE A;  3IKO B;  2PQR A;  3LY8 A;  3MX3 A;  1D2K A;  2RG8 A;  4J8D A;  4WNE A;  4APF A;  2L0I A;  1K9T A;  2KGJ A;  2Y4T A;  4BTB A;  3B9E A;  3FAP A;  3MA5 A;  2LAH A;  5HWB A;  4GZ3 A;  2HM8 A;  1E7V A;  3CHS A;  5T3R A;  3APC A;  2LNI A;  1H0A A;  3B8S A;  2VGX A;  5KJM A;  2WXO A;  2DSW A;  2PL2 A;  4GZC A;  3IHY A;  3TDB A;  3S7B A;  4UWG A;  3CKC A;  2I1K A;  3S7J A;  4JHR A;  1ROU A;  2XCC A;  3UMV A;  5KJK A;  2WXF A;  3D9K A;  3SZ7 A;  2IF4 A;  4XAK A;  2WQ7 A;  1FKD A;  1H2U A;  3ART A;  4QT3 A;  5FT9 A;  3PUJ A;  2P58 C;  2QFC A;  1IQU A;  2ESC A;  2MLY A;  2VSO E;  4CCA A;  4B94 A;  4B89 A;  1OGB A;  2BUG A;  4D10 C;  5D0Q D;  3LUO A;  5LP0 A;  3B7R L;  2KO7 A;  5BNW A;  2YHC A;  4LUN U;  3ASF A;  3CHM A;  3CR3 A;  4P8V A;  4CT0 A;  3U4T A;  5BT1 A;  4IPX A;  2MLZ A;  4G24 A;  3G6L A;  2C2L A;  1B6C A;  4GA2 A;  2FAP A;  3DPD A;  3PR9 A;  4BF8 A;  3WD3 A;  3MYV A;  1EPU A;  3D9L A;  4I6G A;  3OXG A;  4DRH A;  2V0P A;  1FKH A;  4BT8 A;  3O5M A;  1WY6 A;  2AWI A;  4JEH A;  4A3T A;  3AU4 A;  4JVS A;  4IRU A;  3CV0 A;  3QDN A;  3SNX A;  1N1A A;  4MNM A;  4FHJ A;  4CEM A;  1B89 A;  2V8S E;  3AS0 A;  3N71 A;  4U8H A;  1UJK A;  4K0R A;  5EDS A;  1NMV A;  3L13 A;  4G23 A;  2XEV A;  4KXK B;  1YW5 A;  5FWQ A;  4APO A;  3VLE A;  4LER A;  2ZR4 A;  4FN2 A;  2LKN A;  1F8A B;  2DIW A;  3FTX A;  2XPB A;  1CTN A;  4DI3 A;  4I1A A;  3JXV A;  3CHF A;  4ODL A;  3I3N A;  3RIB A;  2JEK A;  4O6F A;  4OYS A;  2PQN A;  1ZBP A;  3GZ2 A;  3PA7 A;  3ESL A;  1UR8 A;  4EBA G;  3ZHE A;  2KZT A;  4ODN A;  2OND A;  1A7X A;  2RUC A;  1JVW A;  3MV2 B;  4ODO A;  5D75 A;  1JNE A;  2VTB A;  3CIA A;  3U64 A;  1HKM A;  4N3B A;  4GZ5 A;  3LY7 A;  3QWW A;  3IBE A;  5G05 J;  4FUL A;  3MKR A;  3FU6 A;  3Q47 B;  3AS3 A;  4MGV A;  2PBC A;  3CVN A;  3ARS A;  3O5D A;  3KEZ A;  3FUN A;  3QWV A;  4XKB A;  1E6Z A;  4GIV A;  1PY1 A;  2Q7F A;  5G55 A;  4UI9 J;  2KAT A;  2RUD A;  3FH8 A;  2WXJ A;  4TUU A;  5AYW D;  3UF8 A;  1FKL A;  2UWJ G;  4V3I A;  5CMW A;  4P29 A;  3T5X A;  2WLY A;  3ARW A;  1Q6I A;  3CK9 A;  1NSG A;  2J08 A;  2LAI A;  3ARX A;  2XRZ A;  2XP3 A;  4EPZ A;  2F2D A;  3ZYK A;  3FUM A;  1ELW A;  3ESK A;  4I9E A;  3B13 A;  3UI4 A;  2FI7 A;  2NSZ A;  2IJG X;  3TXN A;  3QOU A;  2VCD A;  2Q5A A;  4Z2I A;  5HUA A;  2JLB A;  1JND A;  4PTM A;  4XE0 A;  1MHQ A;  4FP7 A;  2LO6 A;  5BW8 C;  1EYH A;  2I6H A;  4FJZ A;  4ANX A;  1J4H A;  2CFU A;  4Z2L A;  4U84 A;  2PPN A;  1FFQ A;  1ZL1 A;  4DRJ A;  3CHO A;  2ZQU A;  2PV2 A;  4DLO A;  4FLH A;  4N5C A;  1HJX A;  2RSE A;  4IT4 A;  2XP4 A;  3JQ0 A;  3PE4 A;  3CK8 A;  4HBE A;  3PRA A;  2ION A;  3CK7 A;  2O9O A;  4QT2 A;  3RGC A;  4A1S A;  5GPR A;  4FLB A;  2FKE A;  3P1U A;  4YND A;  3KAD A;  4WWN A;  2KZT B;  3BEE A;  3QB2 A;  4MNK A;  3RM8 A;  3WL1 A;  3G2V A;  4XKC A;  4LAW A;  1OWQ A;  2QF8 A;  4AEZ C;  4DRK A;  2CHX A;  3APD A;  5E76 A;  1ELK A;  4KVO A;  4GA0 A;  5BXJ A;  1SR0 A;  1HKK A;  2XQ0 A;  2WQ6 A;  4U63 A;  3CQG B;  5AIJ A;  4O2T A;  1ZBK A;  2XGS A;  3ARO A;  3ARQ A;  4KZ0 A;  2ZQV A;  3BG0 B;  4JFL A;  3U9W A;  1IX5 A;  2VYI A;  4AJW A;  4G2V A;  3PS6 A;  4QFV A;  2KCV A;  4PDX A;  4EBA A;  2RUR A;  2B31 A;  1FD9 A;  1FJD A;  2G41 A;  4DJA A;  3CHR A;  1HZ4 A;  4DRM A;  1Q6U A;  3HYM B;  3S7F A;  2A3C A;  2X6J A;  4PS7 A;  5DIV A;  1WM5 A;  5A7D B;  1HS6 A;  4ATG A;  5A6C A;  2LPV A;  3ZFW A;  4WNG A;  1HJV A;  2XP9 A;  5DIU A;  3PEU B;  3KAI A;  1N52 A;  3CGN A;  3B7X A;  4TRQ A;  4I6E A;  4JYS A;  2ZQT A;  3LDZ A;  4RG9 A;  5HT1 A;  4FAP A;  5ANR A;  3FU0 A;  3EDT B;  1MQS A;  4G26 A;  3AQU A;  3BXW A;  1T11 A;  3CGM A;  1EYM A;  5HI7 A;  3CZ8 A;  3KAE A;  1FCH A;  1KT0 A;  5G2N A;  3QOK A;  3R9A B;  1OWM A;  2FEZ A;  1OWP A;  3FUI A;  1FKK A;  3NI6 A;  4JC8 A;  2GRL A;  3SBT B;  1E96 B;  1U3D A;  1QPF A;  4JPS A;  3FU5 A;  1SZA A;  2V5F A;  4CDN A;  2WXN A;  2MNT A;  3KAF A;  4DIP A;  3RM9 A;  1HO8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...