2IF4A

Crystal structure of a multi-domain immunophilin from arabidopsis thaliana
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
258
structure length
258
Chain Sequence
b'NVPPKVDSEAEVLDEKVSKQIIKEGHGSKPSKYSTCFLHYRAWTKNSQHKFEDTWHEQQPIELVLGKEKKELAGLAIGVASMKSGERALVHVGWELAYGKEGNFSFPNVPPMADLLYEVEVIGFDETKEGKARSDMTVEERIGAADRRKMDGNSLFKEEKLEEAMQQYEMAIAYMGDDFMFQLYGKYQDMALAVKNPCHLNIAACLIKLKRYDEAIGHCNIVLTEEEKNPKALFRRGKAKAELGQMDSARDDFRKAQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATFKBP42
publication title Crystal Structure of a Multi-domain Immunophilin from Arabidopsis thaliana: A Paradigm for Regulation of Plant ABC Transporters.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein
total genus 70
structure length 258
sequence length 258
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2if4A02
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2if4A01
1ROUA 3MDYB 3CVQA 3RGCA 3KAEA 3UPVA 3PA7A 4G23A 4U0ZA 3OOBA 5DIVA 3URZA 1FKGA 3FWVA 1EYMA 3O5OA 2JLBA 2ZR6A 5HWBA 4N5CA 1FKSA 4N3AA 2ZQSA 4XI9A 4N39A 1TJCA 4JFMA 4BF8A 5HW7A 2KCKA 4ODKA 3JYJA 4CGWA 4NRHB 2Y4UA 2PZIA 3O5PA 3LY9A 2HYZA 3ASGA 3OXFA 4XI0A 3O5IA 4Y6WA 4W9PA 4I9EA 5GPGA 2XPAA 4BWRA 5CHEE 3RIBA 2XP5A 3KAHA 4JHRA 2PV2A 4G2VA 5KJKA 4YNDA 5FT9A 5BW8C 1HXIA 2KO7A 4I2ZA 2KE0A 4DH0A 3NTPA 1NMWA 4O6FA 5DIZA 4ODPA 3TG5A 2ITKA 4U85A 3Q15A 4BT9A 3LPZA 4N2SA 4HOQA 3NF1A 2KCLA 5G04J 1FCHA 3AS4A 3UI6A 4NQ0A 5DBKA 3IEGA 2RUQA 4GZ5A 2IFUA 3CGNA 3GPKA 2OOEA 4R0XA 1Q6HA 4UI9K 3QOUA 3JYMA 4DZ3A 4GYYA 3GZ1A 4MGVA 4TW8A 2D9FA 4ODLA 1Q6IA 5ARGA 2LSUA 5JJ6A 4J4OA 2KCVA 4RG9A 1HZ4A 3PE3A 2IF4A 4Y6CA 3RO3A 4J8EA 4W9OA 3PRDA 3KS2A 1N1AA 3KACA 5EX3A 4HOTA 1ZK6A 2ZQVA 1HXVA 1ZBPA 4GYOA 4RG6A 2FEZA 3UI4A 2ONDA 1D7JA 5J6EA 4GCOA 3FAPA 5G04C 4DRMA 1NA0A 2AWGA 1A17A 4F3VA 3KADA 3CK9A 4UQZA 2Y78A 4C02B 2JZVA 3QWWA 5FJYA 1D6OA 1FKKA 1TCOC 3WXXA 1JNSA 2PL2A 4J4NA 1T11A 1OUVA 4HORA 2MLZA 3O5KA 5LCWC 5KJNA 3JXVA 2L6JA 2DG4A 1JVWA 4LAYA 4WNDA 1FKDA 2KC7A 2L2SA 4CGVA 2RUCA 3UF8A 1F8AB 4JL0A 3MEKA 3CGMA 3LY8A 4BTBA 2MF9A 2XGSA 5C1DA 2ZR4A 1J4IA 4JFLA 4N3BA 2VGYA 3CEQA 2Y4TA 4LAXA 5BXJA 4FN2A 3LKUA 4H7YA 2FAPA 3UQIA 4G50A 4TW7A 4LAWA 4IPXA 4JFIA 2XGMA 3E4BA 2PPNA 2RURA 2ZR5A 4DRJA 5CCMA 1FKHA 4TW6A 1QPLA 2KI3A 2LJ4A 2XGOA 5HUAA 5DITA 1B89A 2MNTA 3MV3B 2KR7A 4WNFA 3ZHEB 3VTXA 5KJLA 2KGJA 3FP3A 3KD7A 4UQYA 5CCLA 4GPKA 2QFCA 2MHKA 1YW5A 1ROTA 4G25A 3EY6A 2J9QA 4ITZA 2FF4A 5M72A 1BL4A 1FKFA 4XIFA 4JFJA 2DBAA 4BT8A 2PQRA 1XNFA 3LYAA 1YA0A 3KZ7A 4DIPA 3CKBA 3UI5A 1F40A 2RQSA 3QWPA 2HO1A 1JNTA 4GA2A 4J8DA 4U07A 4AY6A 4DRKA 3TC5A 5ARFA 4ABNA 5A6CA 3KAFA 4W9QA 2PPPA 4WUYA 3TG4A 3N71A 2XCBA 1R9HA 4I2WA 4IQ2A 2VYIA 3R9AB 2C2LA 3O5RA 4DZ2A 4TNSA 1PINA 1PC2A 4G2PA 3S7JA 4AY5A 2HR2A 3ASHA 5A7DB 1FJDA 3UQ3A 1FKTA 3JYSA 2MPHA 2M1IA 1W3BA 4QIBA 4I17A 3S7BA 1J6YA 2LSVA 2VGXA 3SF4A 1FAPA 1QPFA 3IKGA 5HQ8A 4U04A 2XP3A 2E2EA 5JJTA 3TAXA 2VSYA 2F2DA 4DT4A 3KCEA 2C0LA 2XPBA 3ASDA 4J0UA 3O5GA 3O5FA 5DIUA 1QZ2A 5D0QD 2DG3A 4GA1A 2FKEA 3NRKA 1J4HA 2YHCA 3O5MA 3OXLA 4WNEA 4HOSA 3ASFA 3S7FA 4CDRA 3PE4A 4TX0A 3BEEA 5FZRA 2UZ5A 1P5QA 5D75A 4O2TA 3PRBA 5HT1A 4IQCA 3U3WA 4G26A 4DRQA 1ELRA 1U79A 4N19A 3OXGA 3K9IA 2YQ8A 5HI7A 4G1TA 1PBKA 2MLYA 3MA5A 2KATA 3QKYA 2Q7FA 4BTAA 5FTPA 4H7XA 4N3CA 3RFWA 4KYOB 3GZ2A 4NNRA 1Y8MA 2BUGA 1ZCNA 5FZQA 2OFNA 1IYGA 2XP6A 3TDBA 1M5YA 1BKFA 4GZ6A 4U84A 4I1AA 4I9CA 3TGOA 3GYZA 1FKJA 2XP9A 4J8FA 2XPIA 2FBNA 4DRHA 1NZNA 4U86A 4G24A 3GW4A 2DG9A 4ODMA 1ZU2A 2C0MA 5EX0A 3VAWA 3CK7A 3QWVA 4YVOA 5AYWD 3ODKA 2R5SA 1WM5A 3H9RB 2LNIA 3MV2B 4GGQA 2XP4A 4GYWA 4ME2A 3Q5MA 2M2AA 5EKQD 4A1SA 4KBQA 3S7DA 3RO2A 4JFKA 4QT2A 3WH0A 1YATA 1NSGA 3RKVA 4AIFA 4JYSA 4ODRA 4DROA 3O5QA 4WNGA 3TCZA 2PPOA 3MKRA 2GW1A 3Q47B 5HW8A 3AS8A 2XP8A 4DRPA 2ZQUA 1NA3A 4W9RA 1A7XA 3AS5A 3O5LA 3LY7A 4GZ3A 1FKRA 2UY1A 3CVLA 4DRIA 4MSPA 1EQ3A 4ODNA 5KJMA 2PV3A 2PQNA 2AVPA 3Q49B 3CK8A 1QQEA 4UI9J 1KT0A 3UQAA 4QT3A 5HWCA 2PV1A 2RSEA 2WQHA 2ZQTA 2FI7A 2FO7A 2F21A 2XP7A 3KAIA 2VSNA 4AM9A 5FZSA 3EDTB 5B8IC 3U4TA 4IN3B 3UQBA 1ELWA 1WAO1 5G05J 1FD9A 3KAGA 2K8IA 3ULQA 1C9HA 3Q4AB 4HOUA 1NMVA 3IK8A 2UWJG 4TYOA 1Y0OA 2KFWA 3FFLA 1D7IA 3ZFWA 2MLXA 3PDNA 5LCWJ 1KLXA 5BNWA 2V5FA 3IKDA 2M08A 3ZGQA 4DRNA 3LUOA 4KXKB 4GA0A 2N87A 4B94A 3B7XA 2WPVA 4UI9C 1D7HA 1Q6UA 3LCAA 3RJVA 5JJ7A 1HH8A 4EQFA 1E96B 5HKGA 2XCCA 2UY1B 3ESKA 4U0SA 5HW6A 5HTGA 3I6CA 2LGOA 2NC9A 3CKCA 5D0OD 3IHZA 2LKNA 2F4EA 4LAVA 5G05C 3O5JA 3SZ7A 1J4RA 1W26A 3ZHEA 2LPVA 4JA9A 2RUDA 2P58C 3NI6A 3O5EA 3RU0A 2PBCA 4YVQC 4JA7A 4GIVA 3ZPJA 5BT1A 4U0UA 5I98A 2VGXB 1Q1CA 3QDNA 4UQXA 3ZN3A 4FAPA 4LEUA 3KABA 1L1PA 3VTYA 4APOA 2VQ2A 1KT1A 4GCNA 2I6HA 4N2QA 2Q5AA 3CVNA 2VN1A 2VCDA 3HYMB 1FKLA 3CVPA 3O48A 1FKIA 4ODQA 2XEVA 1FKBA 1IHGA 4ODOA 3CV0A 1B6CA 3O5DA 3UUXA
chains in the Genus database with same CATH superfamily
1JCRA 3CVQA 3RGCA 2EULA 1H0GA 3PA7A 4U8VD 3HVEB 4JVSA 4U0ZA 3G6LA 5DIVA 2JLBA 4N3AA 2ZQSA 4XI9A 3Q9NC 1TJCA 4BF8A 4ODKA 3JYJA 3P1UA 3OXFA 4K0RA 4JB8P 3FUMA 5CHEE 4F1PA 4DK5A 3CH9A 3NZUA 3KAHA 1MX6A 3IKOB 4EZLA 4D10C 2ZIRA 4HI8A 4PS8A 3OTNA 3Q9UC 5BW8C 3ZIMA 3KEAA 2KO7A 1JUQA 5E75A 1YYHA 3EHNA 4EZKA 5DIZA 3TG5A 5KCMA 5LP0A 2KCLA 4NQ0A 3GPKA 4R0XA 3QOUA 4DZ3A 4GYYA 1ZB5A 4TW8A 2D9FA 4PS7A 3LVQE 3JXIA 4URKA 4I6GA 4RG9A 3AS0A 4Y6CA 1ZBVA 5B1BE 3CQCB 5C2YA 4J8EA 2B0OE 4YDOA 1VF8A 2P9LG 4PDXA 3MCXA 3KACA 5EX3A 3ML9A 2FEZA 4P8UA 3DSUA 5AARA 4NZCA 1N0QA 1N9AA 2WXLA 3FAPA 4DRMA 1N52A 2P9NG 1MZCA 4BERA 1A17A 1LTXA 4IRUA 4E6HA 3CHOA 2P9SG 3R9MA 1JNSA 4J4NA 3KSLA 2MLZA 3O5KA 1D2KA 1GW6A 3FTSA 3D9PA 4ILGA 3JXVA 2GRNB 1E6NA 1JVWA 2KC7A 3BUAA 1NL4A 2L2SA 4CGVA 2X38A 2RUCA 3B9DA 4JL0A 3CGMA 4JW1A 2VTBB 2XGSA 2DCPA 3UX4A 2VGYA 3W9GA 3RRUA 4IT6A 3Q79A 4LAXA 4Z2JA 3ZRHA 4FN2A 2J8SD 4B93B 3WQVA 3E34A 2R59A 3LKUA 4IULA 2Y1LE 3JQ1A 3SBSA 3X2QE 1S64A 2A3AA 2F23A 2WXPA 4LAWA 4JFIA 4L7TA 1KZOA 2PPNA 2RURA 5EILA 4DRJA 3SNXA 5BXOA 5HUAA 5DITA 2L6BA 4UWHA 3MV3B 2DVWA 4WNFA 3VTXA 3CHQA 3FDHA 3FP3A 1HG5A 3FHEA 4GTPA 4GPKA 4BFRA 1YW5A 2AOSA 4FP7A 1D9SA 5ENOD 2OEVA 4G25A 3AJIA 3HRAA 5AQ7A 3SFZA 3LJNA 2DBAA 5CBNA 4ML4A 4AOFA 4GZCA 3CKBA 5AQ9A 2XS1A 4U63A 4A3TA 1F40A 4R7LA 3F6QA 3QWPA 4OVVA 4KZ0A 1FFQA 1VDYA 4AY6A 4ABNA 3FTVA 1H19A 3N71A 2XCBA 1INZA 4I2WA 2ETCA 2VYIA 1HKJA 3WL1A 1PINA 4LCTA 3CIAA 3S7JA 3ASHA 4HLLA 5A7DB 1FJDA 2IQCA 4DLQA 3ARZA 3UM1A 1WNOA 2M1IA 2P4VA 4QIBA 1KZPA 2LAIA 2Y0BG 1N4PA 4MNMA 1FAPA 1QPFA 3IKGA 1W1TA 4YDEA 2F2DA 3J5PA 3ASDA 5CMWA 1ZL1A 3JUIA 4Z2LA 1X81A 3O5FA 5D0QD 3ML8A 3NRKA 3O5MA 2YHCA 1OGGA 3ASFA 4CDRA 4FHJA 1CTNA 5FZRA 1QYMA 4O2TA 2P9UG 1ITXA 5HT1A 4R5EA 1O6IA 1TYQG 4Z2KA 1SZ9A 4G1TA 1PBKA 2MLYA 3MA5A 3MGBA 3QKYA 4F7AA 3TL5A 3WL0A 4QFVA 3RMEA 4LNUD 5FQ6A 4ATZD 4UDMA 4BX8A 5FZQA 2XP6A 4N5QA 1BKFA 4WKHA 4U84A 4ANXA 1HE8A 5DO2A 3T8MA 3GYZA 3Q7AA 4URIA 3ARQA 2M63A 3R7RA 4TXRA 3D9KA 5LOZA 2CFZA 1A5EA 5IY5E 3ESLA 1EF1C 4K5BA 4ODMA 5EX0A 2XHEA 3QWVA 4YVOA 4HARA 1AWCB 4FHKA 2FDMA 3H9RB 3GZSA 2DSVA 3MV2B 2XPZA 1X6LA 1S63A 1SA4A 3Q5MA 4A1SA 4XZ4A 4O60A 3UM2A 2KM4A 2MOWA 4TUMA 1K1AA 3S7DA 1HU3A 4QT2A 5HKPA 2ZGDA 1SYTA 4AIFA 4JYSA 4DROA 1OWLA 4Q94A 3O5QA 4LUNU 5FQ4A 2PPOA 1ELKA 4TRQA 3Q47B 5BV1A 1W1YA 5HW8A 4B8CB 2ZQUA 1UN8A 4GTRA 3LY7A 4DUIA 4BESA 3PVLA 2ETBA 4JHKA 4J8SA 3WG7E 3E37A 4MSPA 2JEKA 2J08A 5KJMA 1XGWA 4C0MA 3Q49B 2PV3A 3BXWA 3NB2A 1QQEA 3HXBA 4PUCA 3FTYA 2PV1A 2WXIA 2RSEA 4L9PA 3FEYA 3Q78A 3ONKA 4HS2A 1U3DA 5B8IC 3UQBA 3BG1B 1UR8A 2K8IA 3FY1A 4GTVA 1EDQA 4UWFA 3TWSA 2F8XK 2UWJG 4TYOA 3RM4A 2KFWA 3Q75A 3DXMG 1KLXA 2IY0C 2V5FA 1MYOA 4PS3A 1HF8A 4DRNA 4GA0A 1SA5A 3MKQA 3B7XA 3FULA 3AG3E 4UI9C 1D7HA 3RJVA 5JJ7A 2VSXE 4G8LA 4EQFA 1E96B 3ZU7B 2XCCA 1TR4A 2UY1B 1UR9A 2LGOA 2WLZA 4CRWA 3ZYLA 1NP7A 4LAVA 1J4RA 3ZHEA 1UJKA 1SVXA 3HXDA 3Q7FA 4HRMB 2VJ8A 3CHCA 2PBCA 2ETNA 3S2AA 4HRLA 1JNDA 4GIVA 3ZPJA 2WLYA 2QZAA 3APDA 1JNEA 3D9MA 4HRNA 1JWGA 3AG2E 5AIJA 3DSWA 2WB2A 1SZAA 4F6RD 1NWTA 1FKIA 3D9HA 1OWMA 4WK9A 2LAHA 3QNKA 2WXOA 1NZNA 1MX4A 4L72B 1ROUA 3CSFA 3KAEA 1FT1A 3UPVA 1EYMA 4N5CA 1U3CA 1FKSA 1E15A 1V55E 1PAQA 4N39A 3V30A 4B89A 4IT4A 2HYZA 4XI0A 4XX5A 4ZPTR 3O5IA 4I9EA 3V31A 1LD8A 4BWRA 1UJJA 3TJPA 3CHPA 3UT4A 4DWSD 4ZPVR 4DWSA 1LG2A 4YNDA 2P9KG 5GPRA 4HNAD 3LXUX 1NMWA 4O6FA 4BSXA 1OY3D 4MNJA 4WAFA 5AJDA 2LUHA 2ITKA 3L22A 3Q15A 4XKCA 1E6PA 4N2SA 1RZ4A 2XZTG 3DBSA 5DBKA 1N0RA 2J07A 3CGNA 2WMNA 1Q6HA 2DZNA 4UI9K 4PTMA 3GZ1A 2OEWA 4I1MA 4ZPWR 4ACLA 4ODLA 1Q6IA 3FTUA 2MYOA 4J4OA 3EJNA 1S0PA 2GRQB 1WB0A 1HZ4A 3PE3A 1OT8A 4BSZB 4KVMA 2RKKA 2IF4A 3CHDA 2WM0A 3RO3A 2R17C 4W9OA 2XPYA 3UTMA 4HXIA 4GTTA 4BY6A 4APFA 2FO1E 3ABLE 3B7RL 5G04C 3FU0A 2EIJE 3LVRE 3OAWA 2R03A 1E8YA 4F53A 3CK9A 4DX1A 1H6OA 2H6IA 5FJYA 2ESCA 3ISMC 4MS6A 3ZNGA 3ULYA 4HORA 3G2VA 4OYSA 1XRVA 4EBAG 2L6JA 2Y69E 4AY1A 5A23A 4WNDA 1D8DA 3T9KA 1UG3A 3ZXPA 2A5UA 1JCQA 2X6HA 5EYLA 2EIME 2MF9A 2J09A 4N3BA 4M3OA 4Q22A 1K3ZD 3CEQA 3G2SA 4HI9A 4LG6A 3GTYX 2Y4TA 3MX3A 4Z2HA 1E7VA 2FAPA 4G50A 4TW7A 1OWPA 4IPXA 4GTSA 3SQVA 3TWWA 5CECB 5CCMA 1FKHA 3WD4A 1QPLA 4G11A 3FUJA 2KI3A 1B89A 2WXJA 4NURA 3CVVA 2KGJA 2MHKA 1FVHA 2KZTA 2I1KA 4DPRA 2CHXA 3HXEA 1BL4A 3D9NA 1IHBA 2OVBA 4XIFA 2P2CP 1E7UA 1LL4A 5EIDA 3CZ8A 3PH0C 3UI5A 1HKMA 1N94A 2PNNA 3L08A 3QC1A 5ARFA 4MLPA 4W9QA 2WQ6A 4GAAA 1HS6A 2A3BA 4GZDA 1W9UA 2F37A 1R9HA 4GTQA 5ENQD 1EDUA 2L0IA 2DZOA 3O5RA 5AQAA 3BMBA 4AY5A 2DT3A 4GU5A 4LSZE 3D9OA 1W1PA 1GOIA 4U7EB 5ENRD 2IUZA 1LJYA 4Q96A 2GROB 2H6HA 3S7BA 4FA6A 4DX2A 5H7PA 3SF4A 3JXJA 3RK6A 1QNFA 3QB2A 4ZS6A 4Q69A 3SGHA 5EIBE 3ALFA 5DIUA 2GRLA 1LG1A 3B9EA 1J4HA 3D9IA 3PZ1A 4HOSA 3QOKA 1TNZA 3O4ZA 1HKKA 3ARPA 3EUVA 3E32A 4Z2GA 2UZ5A 1P5QA 4EPZA 4UWGA 3HVEA 4IQCA 4DRQA 1ELRA 4NIKA 3OXGA 5HI7A 2YQ8A 1K1BA 4AV7A 2KATA 4CT0A 4BTAA 1UN9A 4GMRA 4H7XA 4N3CA 4NNRA 3C72A 3GZ2A 1Y8MA 2OFNA 5HS0A 1IYGA 3TDBA 4GZ6A 1BI7B 1KFWA 4WKAA 1SR0A 3V79K 4ANVA 2V8SE 1ZB1A 4DRHA 3WD1A 1E90A 4G24A 4M7CA 2PI6A 3VAWA 3C3RA 5AYWD 3G6MA 4MNLA 3B7TA 2DIWA 3OA5A 4ME2A 5G55A 2YBUA 3U64A 3PZDA 4KBQA 2KBXA 5KNGA 4JFKA 3TWXA 1NSGA 3ZYQA 1QBQA 1N4SA 5J90A 3ONLA 1W9VA 4L2YA 2XP8A 4GTMA 1RW2A 1Z3XA 4L2LA 3O5LA 3DPDA 4GZ3A 3CVXA 1FKRA 3C5RA 1TN7A 3CVLA 5ENPD 4J7WA 2BEDA 1OCCE 1K9TA 1YCSB 1Y6IA 3ASNE 2L0TB 4UI9J 2O9OA 3ASOE 4Z2IA 1HX8A 3VLDA 1G3NB 2WQHA 2L9BA 5ANLA 2VSNA 5G2NA 3U4TA 4IN3B 3ULEG 3L54A 3KAGA 1TNYA 3NZSA 3ULQA 3Q4AB 1MX2A 4FADA 2VTBA 2YBTA 1IX5A 3ZFWA 3PDNA 2FULA 5LCWJ 3ARUA 4HVBA 5DEZA 4WWNA 1MQSA 3IKDA 5AQBA 3SI5A 4B94A 3SFYA 3NOGD 2WPVA 3T8KA 3LCAA 4JEUA 2CHZA 3SFXA 4U0SA 3I6CA 1D8EA 2BTDA 2A3EA 1L5JA 3SZ7A 1W26A 5EYPF 2V5QC 1JWFA 2EINE 2RUDA 3NI6A 2EQXA 3RU0A 3TWTA 2P9IG 2DSWA 2F8YA 4DX5D 2VGXB 3QDNA 4UQXA 2V4HC 3B7SA 2J4BA 3ZN3A 3RRMB 4EZJA 4FAPA 4LEUA 3KABA 4MPKA 3VTYA 2CFUA 5T8IA 4L3NA 1OWOA 4RLYA 3RM8A 5JH8A 3HYMB 4TXPA 3ZYKA 4DX7D 1FKLA 2XEVA 1TNUA 2G41A 4ODOA 1WG0A 3PS6A 1HO8A 3WIJA 3FUHA 3UUXA 4LNBA 5D66A 5HBFA 3DRAA 1NH6A 4G23A 3OOBA 1FKGA 1X6NA 3O5OA 1FPPA 2WXKA 4K03A 3CQGB 4DJAA 5HW7A 4YDWA 3E33A 3O5PA 2Y4UA 3R7QA 3LDZA 3AS3A 3ASGA 4W9PA 1H0AA 2WQ7A 3RIBA 2VGEA 2PV2A 4AXHA 3C3QA 4ANWA 3BG0B 5KJKA 4KMOA 5FQ8A 5FT9A 1HXIA 4I2ZA 3TWUA 2KE0A 2XRZA 4DH0A 3NTPA 2YNQA 1XHGA 1DCEA 4EBAA 4ODPA 3FTXA 2AXZA 5B1AE 4U85A 3AU4A 4BT9A 2A4ZA 3LPZA 5ENTD 4HOQA 3DXKG 5G04J 3WD3A 1BU9A 3CVWA 2XQ0A 3IEGA 2IFUA 2OOEA 1WY6A 1TN8A 3NAWA 3JYMA 4MGVA 3PR9A 5ARGA 2LSUA 4JXTA 3V2XA 3VLFA 2KCVA 1N4QA 2F0YA 3AG1E 3SHFA 4WIWA 3B95A 1N1AA 1ZBPA 3UI2A 3SBTB 4RG6A 3UI4A 2ONDA 3FUEA 3EHRA 4GCOA 3I5PA 4DLOA 4YDYA 1NA0A 2H6FA 2AWGA 2I1JA 2AXVA 4F3VA 2GGFA 4W5UA 4RSYA 2JZVA 1OGBA 2XRYA 1BD8A 1D6OA 1TCOC 3EU5A 3WXXA 2B6CA 3Q73A 1JCSA 4CT4A 1T11A 1SQMA 3FUIA 4AVXA 4KZCA 4TUUA 5LCWC 5DF0A 2DG4A 3PNLB 4LAYA 3SY2A 3FTWA 3RRNB 1JCHB 5CBOA 4WJXA 1E6ZA 3LY8A 4BTBA 5AAOA 3JUEA 5C1DA 3JQ0A 3ZW3A 3ARSA 4TXQA 1J4IA 4JFLA 2ZGGA 2CHWA 2WXFA 3I4RB 3UIPC 3FY4A 5E76A 5LX8A 3FTZA 2B5UB 3CGHA 3C3OA 2LJ4A 4TV3A 1TNBA 2ZISA 2MNTA 1IKND 5ITZF 5KJLA 4LGXA 2LXLA 1E8XA 3FU5A 3KD7A 4UQYA 4B8AA 2HM8A 5CCLA 2QFCA 3HG0D 3GU0A 2OV8A 2DT1A 3HHMA 3QJZA 1EIBA 3KZ7A 4MKTA 4WWOA 4JHJA 2RQSA 2HO1A 3TWQA 2ILRA 4GA2A 4J8DA 4U07A 4FJYA 5JA4D 3ABKE 4BEPA 1NWSA 5A6CA 3KAFA 2PPPA 4WUYA 1HKIA 1AP7A 1WAWA 4IQ2A 3R9AB 4DZ2A 1U2VG 3IXEA 2IO3C 4TNSA 4O1OA 2HR2A 4GMLA 4HFGA 3AROA 4J6IA 1FKTA 1IQRA 3JYSA 2MPHA 2MRIA 3DSSA 3ARYA 1W3BA 1SW6A 5FWQA 4GB9A 1ZBCA 3ZXSA 3ALGA 2RG8A 4MTVA 4U04A 3IBEA 3NQPA 2XP3A 3G2TA 5CEDB 2VSYA 2XZDG 4JD2G 3KCEA 4J0UA 1TFVA 3O5GA 2FKEA 1HG2A 4GA1A 3DEOA 3LEWA 3OXLA 2PM7A 4WNEA 1OWQA 3S7FA 4ZHBA 1IXVA 2XEHA 4TX0A 3BEEA 2DSZA 4I43A 5D75A 2BKKB 2R05A 3CHEA 4AEZC 3PRBA 3FU6A 4NSBA 3U3WA 2YHEA 1U79A 4N19A 2OLHA 4ILHB 3ZUVB 3K9IA 2Q7FA 3FUDA 4BX9A 5FTPA 4AJWA 3RFWA 3ARXA 2BUGA 4MNKA 3FH7A 1HJXA 1H6PA 1Z6TA 3I3NA 4GTOA 4F1SA 2H6GA 5BPPA 2XP9A 4J8FA 5FQ7A 3GW4A 3UIOC 2C0MA 2R2LA 3HXFA 4OVUA 2WMOA 3G2UA 2R5SA 3CSTA 2OVFA 1WM5A 1H6KA 3ZKJA 4CZ2D 3RM9A 4HQDA 2CG2A 4GYWA 3PNTB 5EKQD 3P2BA 3D3MA 2AW6A 3UT7A 3VLEA 3G2WA 1N11A 3RO2A 5CEAA 3EHMA 2CG3A 3WH0A 1YATA 3RKVA 2YINA 4ODRA 1E8ZA 4E85A 4WNGA 3TCZA 2GW1A 1RD6A 4DRPA 3ARTA 3AS5A 3UT8A 1FFRA 4P29A 3C98A 4U8YD 1EQ3A 4ODNA 2PQNA 1NI1A 4FULA 3CK8A 3UMVA 1GPFA 1DC2A 4MAVA 4QT3A 1E8WA 2OCCE 3J5QB 5HWCA 3RAUA 1HJVA 2V0PA 2WXQA 2F21A 2XP7A 2IOSA 2GRPB 1ELWA 1ZU8A 4A63B 5FIOA 1C9HA 1NMVA 5T4YA 3CR3A 3FFLA 1D7IA 3WD2A 2P9PG 2NXPA 4ILIA 3ZGQA 2M08A 3UKRG 4KXKB 2JABA 2X3MA 1Q6UA 4I6JA 1K8KG 5AN8A 5ENNA 1MHQA 4QQIA 5HTGA 2ZU6B 2EILE 1OWNA 3W4RA 1TN6A 4FLHA 1E6RA 1LL7A 3FUFA 3FUKA 3IHZA 4CEMA 2LKNA 1LF8A 5G05C 1E44A 3UINC 1HJWA 2O92A 2LPVA 5ENSD 1TNOA 2P58C 4LERA 3HXCA 1BI8B 2DYRE 4GMJA 1EPUA 2VSOE 5KBAA 4U0UA 4XE0A 5I98A 1Q1CA 3SO8A 1LL6A 4L23A 1LQ0A 1L1PA 1MJ0A 4APOA 1N4RA 4X8QA 2VN1A 3HIZA 2AXUA 1OXJA 1DVPA 3O48A 1GRJA 4QZVB 3UKUG 4ODQA 3MJWA 2WXHA 4Z68A 3CV0A 3QARA 4RQIA 4A1GA 4I1OB 3MDYB 3KSQA 3QK0A 3URZA 3FWVA 3CVUA 2ZR6A 5HWBA 3PZ4A 2DYSE 4JFMA 2KCKA 4CGWA 4NRHB 2PZIA 1H2UA 1UOHA 3NBNB 4K5AB 3LY9A 5B3SE 5CMYA 4DI3A 4Y6WA 2QY7A 5GPGA 2XPAA 3E30A 4U95D 5ANRA 2XP5A 4JHRA 5T3RA 4I6EA 3CHFA 4G2VA 1NFIE 4CCAA 3ABME 4JPSA 4PH4B 1PY1A 3DSXA 3LS8A 5LFAA 3ARRA 3FUNA 4LNGA 3IV0A 1ZBWA 4FC8A 3TXNA 2KXPC 3ZYMA 3NF1A 1FCHA 3AS4A 3UI6A 1O1SA 2RUQA 4GZ5A 2HE0A 4L1BA 2AJAA 3V2OA 2LO6A 5J08A 3WD0A 3D9LA 4A3VA 5JJ6A 2QYJA 1UW4B 2I9CA 1BPOA 4NACA 3WKZA 3ZEFA 1H2VC 3DPYA 3PRDA 3KS2A 4HOTA 1ZK6A 3ARVA 2ZQVA 4U96D 1HXVA 4GYOA 4K5CA 4OAVB 1D7JA 2DPEA 5J6EA 4LRZA 4KR0B 3T5XA 3EU9A 4P8VA 3KADA 1NWUA 4U8HA 3APFA 4UQZA 2Y78A 4C02B 2GRMA 3QWWA 1FKKA 2PL2A 3QAQA 1OUVA 2NYJA 3W9FA 1OCZE 4JZYA 2A3CA 2IU1A 5KJNA 2IONA 1S70B 3WQWA 2DT0A 1FKDA 3PZ2A 4Q7NA 3UF8A 1TJFA 1F8AB 3PRAA 3MEKA 1W1VA 2Y3AA 3SD5A 2ZR4A 4DI4A 2AWIA 5BUZA 1N54A 2BF0X 5BXJA 5CERB 4KQZA 3DWLG 4H7YA 3MKQB 3LJ3A 1FVFA 3UQIA 2V4LA 2X6JA 2WVIA 2XGMA 3E4BA 3ENEA 2ZR5A 2IJGX 3EHQA 3IHYA 4TW6A 2XGOA 2DT2A 4UUCA 2WM9A 5BV0A 2KR7A 4DRXE 3ZHEB 3EIQC 3ARWA 1ROTA 1LD7A 4G8KA 4DX6D 2QYUA 4MBGA 3EY6A 3U9WA 2J9QA 1Q2ZA 2FF4A 5M72A 4ITZA 1FKFA 4WWPA 4JFJA 4BT8A 2PQRA 1Z5SC 1XNFA 3LYAA 1YA0A 4DIPA 4XEIG 3B7UX 4P8WA 2EIKE 4MRUA 3RSEG 2ETAA 5KNHD 4UWLA 1JNTA 1EYHA 4DRKA 2PN0A 3TC5A 4XKBA 3L82A 4FU3A 3DEPA 3TG4A 3TWVA 4IYPA 2XEEA 2C2LA 1PC2A 3B7BA 4G2PA 1O1TA 2XS8A 2X6FA 3I4GA 4KVOA 3UQ3A 3PEVB 3PEUB 4GPMA 2A5EA 2IO2C 1FT2A 3TWRA 2GRRB 4I17A 3AU5A 1J6YA 4HBDA 2R02A 1KPSB 2LSVA 2VGXA 5HQ8A 4DWSB 2E2EA 5JJTA 3UM0A 3TAXA 4DT4A 3UXGA 1V54E 2C0LA 1JPLA 2XPBA 4S3JA 2X6KA 1QZ2A 2DG3A 3FH8A 1DNPA 3PUKA 4JEHA 4OAUC 2PM6A 3B8SA 4C48B 3PE4A 3U66A 3APCA 1GUVA 3CLJA 3BQOA 4G26A 2J49A 3CVYA 3CHSA 3NOCD 4RVBA 2BKGA 5JHBA 3L16A 2WXMA 3CHRA 4KYOB 2WXNA 2IEJA 1ZCNA 3B9AA 1DCQA 1M5YA 3BU8A 4AP2A 4I1AA 5EN5D 5JMND 4I9CA 3TGOA 5HRYA 1FKJA 3ZVVA 2XPIA 2FBNA 4U86A 2DG9A 1ZU2A 3AS2A 3AS1A 3MZLB 3T5VA 3CK7A 4FLBA 4C0EA 1N95A 4EHMA 2IOLA 3ODKA 1E9LA 3L13A 3L17A 2LNIA 2B31A 2X6IA 3L6AA 2XP4A 4GGQA 4HB5A 2DSUA 2M2AA 2I2OA 5FINA 2XENA 1NWRA 2RFMA 4FJZA 3B13A 4JC8A 3MKRA 4B0ZA 5CRUA 5CRVA 2QF8A 3TXMA 3AS8A 1NA3A 4W9RA 4HBOA 4XAKA 1A7XA 2NSZA 4P8XA 1Z3YA 2UY1A 1O5MA 4A55A 3MYVA 3FXYA 2RFAA 2WXGA 3JCKC 4DRIA 4EECA 4DWSC 2AVPA 5EDSA 1H0IA 1X5BA 3D9JA 1KT0A 1WDYA 3AG4E 3UQAA 3FEXA 2WXRA 2ZQTA 3HDXA 3AQUA 3PREA 2FI7A 2KZTB 3IHVA 2FO7A 3KAIA 4AM9A 5FZSA 3EDTB 4BETA 1HFAA 1OCRE 1WAO1 5G05J 1FD9A 1O1RA 4O1PA 4HOUA 5AENA 3IK8A 1OCOE 5BXUA 1Y0OA 3DSTA 2MLXA 5BNWA 3EIPA 5AJLA 2RD0A 3PRZA 5D2MC 2J4DA 3LUOA 1H2TC 2N87A 5KWDA 4UWKA 3FH5A 1HH8A 3DSVA 4ATGA 5HKGA 3ESKA 5HW6A 2G8ZA 4ACKA 2NC9A 4WKFA 3CKCA 5D0OD 5GQBA 4HBEA 2F4EA 1TEZA 5JHAA 3O5JA 4HLEA 3EIJA 4S3KA 4JA9A 1BLXB 4CDNA 3O5EA 3KEZA 4YVQC 4JA7A 3PUJA 5BT1A 2LXMA 3CHMA 3UM3A 3FU3A 4CYMD 1W9PA 3L9TA 4CDMA 1EHNA 2VQ2A 1KT1A 3PZ3A 4GCNA 2I6HA 4ZFHA 4N2QA 2Q5AA 3CVNA 4ANUA 4C9BB 2QC9A 3AAAC 1ZBKA 2VCDA 2ZXWE 4J8YA 2E0IA 3CVPA 4KT6B 1YMPA 4V3IA 1FKBA 1IHGA 2WK2A 2DWZA 1B6CA 1IQUA 3O5DA
chains in the Genus database with same CATH topology
3CVQA 3RGCA 1H0GA 3PA7A 3HVEB 4JVSA 4U0ZA 3G6LA 5DIVA 2JLBA 4N3AA 2ZQSA 4XI9A 1TJCA 4BF8A 4ODKA 3JYJA 3P1UA 3OXFA 4K0RA 3FUMA 5CHEE 3CH9A 4DK5A 3NZUA 3KAHA 3IKOB 4EZLA 4D10C 4PS8A 3OTNA 5BW8C 3ZIMA 2KO7A 1JUQA 5E75A 3EHNA 4EZKA 5DIZA 3TG5A 5KCMA 5LP0A 2KCLA 4NQ0A 3GPKA 4R0XA 3QOUA 4DZ3A 4GYYA 1ZB5A 4TW8A 2D9FA 4PS7A 3LVQE 4URKA 4I6GA 4RG9A 3AS0A 4Y6CA 1ZBVA 3CQCB 5C2YA 4J8EA 1VF8A 4PDXA 3MCXA 3KACA 5EX3A 3ML9A 2FEZA 4P8UA 4NZCA 2WXLA 3FAPA 4DRMA 1N52A 1A17A 4IRUA 4E6HA 3CHOA 1JNSA 4J4NA 2MLZA 3O5KA 1D2KA 1GW6A 3FTSA 3D9PA 4ILGA 3JXVA 1E6NA 1JVWA 2KC7A 2L2SA 4CGVA 2X38A 2RUCA 3B9DA 4JL0A 3CGMA 4JW1A 2VTBB 2XGSA 2DCPA 3UX4A 2VGYA 3RRUA 4IT6A 4LAXA 4Z2JA 3ZRHA 4FN2A 3WQVA 2R59A 3LKUA 4IULA 3JQ1A 3SBSA 2A3AA 2WXPA 4LAWA 4JFIA 4L7TA 2PPNA 2RURA 4DRJA 3SNXA 5HUAA 5DITA 4UWHA 3MV3B 4WNFA 3VTXA 3CHQA 3FDHA 3FP3A 1HG5A 3FHEA 4GPKA 4BFRA 1YW5A 2AOSA 4FP7A 4G25A 3SFZA 2DBAA 4ML4A 4AOFA 4GZCA 3CKBA 4U63A 4A3TA 1F40A 4R7LA 4OVVA 3QWPA 1FFQA 4KZ0A 1VDYA 4AY6A 4ABNA 3FTVA 1H19A 3N71A 2XCBA 1INZA 4I2WA 2VYIA 1HKJA 3WL1A 1PINA 4LCTA 3CIAA 3S7JA 3ASHA 5A7DB 1FJDA 2IQCA 4DLQA 3ARZA 1WNOA 2M1IA 4QIBA 2LAIA 4MNMA 1FAPA 1QPFA 3IKGA 1W1TA 2F2DA 3ASDA 5CMWA 1ZL1A 3JUIA 4Z2LA 3O5FA 5D0QD 3ML8A 3NRKA 3O5MA 2YHCA 1OGGA 3ASFA 4CDRA 4FHJA 1CTNA 5FZRA 4O2TA 1ITXA 5HT1A 4R5EA 1O6IA 4Z2KA 1SZ9A 4G1TA 1PBKA 2MLYA 3MA5A 3MGBA 3QKYA 4F7AA 3TL5A 3WL0A 4QFVA 3RMEA 5FQ6A 4BX8A 5FZQA 2XP6A 1BKFA 4WKHA 4U84A 4ANXA 1HE8A 5DO2A 3T8MA 3GYZA 4URIA 3ARQA 2M63A 3R7RA 3D9KA 5LOZA 2CFZA 3ESLA 1EF1C 4ODMA 5EX0A 2XHEA 3QWVA 4YVOA 4HARA 4FHKA 2FDMA 3H9RB 3GZSA 2DSVA 3MV2B 2XPZA 1X6LA 3Q5MA 4A1SA 4XZ4A 2KM4A 2MOWA 3S7DA 1HU3A 4QT2A 1SYTA 4AIFA 4JYSA 4DROA 1OWLA 4Q94A 3O5QA 4LUNU 5FQ4A 2PPOA 1ELKA 4TRQA 3Q47B 5BV1A 1W1YA 5HW8A 4B8CB 2ZQUA 1UN8A 3LY7A 3PVLA 4JHKA 4J8SA 4MSPA 2JEKA 2J08A 5KJMA 1XGWA 4C0MA 3Q49B 2PV3A 3BXWA 1QQEA 4PUCA 3FTYA 2PV1A 2WXIA 2RSEA 3FEYA 3ONKA 4HS2A 1U3DA 5B8IC 3UQBA 3BG1B 1UR8A 2K8IA 3FY1A 1EDQA 4UWFA 2UWJG 4TYOA 3RM4A 2KFWA 1KLXA 2V5FA 4PS3A 1HF8A 4DRNA 4GA0A 3MKQA 3B7XA 3FULA 4UI9C 1D7HA 3RJVA 5JJ7A 2VSXE 4EQFA 1E96B 2XCCA 2UY1B 1UR9A 2LGOA 2WLZA 4CRWA 3ZYLA 1NP7A 4LAVA 1J4RA 3ZHEA 1UJKA 2VJ8A 3CHCA 2PBCA 3S2AA 1JNDA 4GIVA 3ZPJA 2WLYA 3APDA 1JNEA 3D9MA 1JWGA 5AIJA 2WB2A 1SZAA 1NWTA 1FKIA 1OWMA 4WK9A 2LAHA 3QNKA 2WXOA 1NZNA 4L72B 1ROUA 3CSFA 3KAEA 3UPVA 1EYMA 4N5CA 1U3CA 1FKSA 1E15A 1PAQA 4N39A 4B89A 4IT4A 2HYZA 4XI0A 4XX5A 4ZPTR 3O5IA 4I9EA 4BWRA 1UJJA 3TJPA 3CHPA 3UT4A 4DWSD 4ZPVR 4DWSA 1LG2A 4YNDA 5GPRA 3LXUX 1NMWA 4O6FA 4BSXA 4MNJA 4WAFA 5AJDA 2ITKA 3L22A 3Q15A 4XKCA 1E6PA 4N2SA 3DBSA 5DBKA 2J07A 3CGNA 2WMNA 1Q6HA 4UI9K 4PTMA 3GZ1A 4I1MA 4ZPWR 4ACLA 4ODLA 1Q6IA 3FTUA 4J4OA 3EJNA 1S0PA 1WB0A 1HZ4A 3PE3A 4KVMA 2IF4A 3CHDA 2WM0A 3RO3A 2R17C 4W9OA 2XPYA 4HXIA 4BY6A 4APFA 3B7RL 5G04C 3FU0A 3LVRE 3OAWA 1E8YA 4F53A 3CK9A 5FJYA 2ESCA 4MS6A 4HORA 3G2VA 4OYSA 1XRVA 4EBAG 2L6JA 4AY1A 5A23A 4WNDA 1UG3A 2A5UA 2X6HA 2MF9A 2J09A 4N3BA 4M3OA 4Q22A 3G2SA 3CEQA 2Y4TA 3MX3A 4Z2HA 1E7VA 2FAPA 4G50A 4TW7A 1OWPA 4IPXA 5CCMA 1FKHA 3WD4A 1QPLA 4G11A 3FUJA 2KI3A 1B89A 2WXJA 4NURA 3CVVA 2KGJA 2MHKA 1FVHA 2KZTA 2I1KA 4DPRA 2CHXA 1BL4A 3D9NA 2OVBA 4XIFA 1E7UA 1LL4A 3CZ8A 3PH0C 3UI5A 1HKMA 3L08A 3QC1A 5ARFA 4MLPA 4W9QA 2WQ6A 4GAAA 1HS6A 2A3BA 4GZDA 1W9UA 1R9HA 1EDUA 2L0IA 3O5RA 4AY5A 2DT3A 4GU5A 3D9OA 1W1PA 1GOIA 2IUZA 1LJYA 4Q96A 3S7BA 4FA6A 3SF4A 3RK6A 1QNFA 3QB2A 4ZS6A 4Q69A 3SGHA 3ALFA 5DIUA 2GRLA 1LG1A 3B9EA 1J4HA 3D9IA 4HOSA 3QOKA 3O4ZA 1HKKA 3ARPA 4Z2GA 2UZ5A 1P5QA 4EPZA 4UWGA 3HVEA 4IQCA 4DRQA 1ELRA 3OXGA 5HI7A 2YQ8A 4AV7A 2KATA 4CT0A 4BTAA 1UN9A 4H7XA 4N3CA 4NNRA 3GZ2A 1Y8MA 2OFNA 1IYGA 3TDBA 4GZ6A 1KFWA 4WKAA 1SR0A 4ANVA 2V8SE 4DRHA 3WD1A 1E90A 4G24A 2PI6A 3VAWA 5AYWD 3G6MA 4MNLA 3B7TA 2DIWA 3OA5A 4ME2A 5G55A 2YBUA 3U64A 3PZDA 4KBQA 4JFKA 1NSGA 3ZYQA 5J90A 3ONLA 1W9VA 4L2YA 2XP8A 1Z3XA 4L2LA 3O5LA 3DPDA 4GZ3A 3CVXA 1FKRA 3CVLA 1K9TA 1Y6IA 2L0TB 4UI9J 2O9OA 4Z2IA 1HX8A 3VLDA 2WQHA 2L9BA 5ANLA 2VSNA 5G2NA 3U4TA 4IN3B 3L54A 3KAGA 3NZSA 3ULQA 3Q4AB 4FADA 2VTBA 2YBTA 1IX5A 3ZFWA 3PDNA 2FULA 5LCWJ 3ARUA 4HVBA 5DEZA 4WWNA 1MQSA 3IKDA 3SI5A 4B94A 2WPVA 3LCAA 4JEUA 2CHZA 4U0SA 3I6CA 2BTDA 2A3EA 1L5JA 3SZ7A 1W26A 1JWFA 2RUDA 3NI6A 2EQXA 3RU0A 2DSWA 2VGXB 3QDNA 4UQXA 3ZN3A 3B7SA 2J4BA 3RRMB 4EZJA 4FAPA 4LEUA 3KABA 4MPKA 3VTYA 2CFUA 5T8IA 4L3NA 1OWOA 3RM8A 5JH8A 3HYMB 3ZYKA 1FKLA 2XEVA 2G41A 4ODOA 3PS6A 1HO8A 3WIJA 3FUHA 3UUXA 5HBFA 1NH6A 4G23A 3OOBA 1FKGA 1X6NA 3O5OA 2WXKA 4K03A 3CQGB 4DJAA 5HW7A 3O5PA 2Y4UA 3R7QA 3LDZA 3AS3A 3ASGA 4W9PA 1H0AA 2WQ7A 3RIBA 2PV2A 4AXHA 4ANWA 3BG0B 5KJKA 4KMOA 5FQ8A 5FT9A 1HXIA 4I2ZA 2KE0A 2XRZA 4DH0A 3NTPA 2YNQA 1XHGA 4EBAA 4ODPA 3FTXA 2AXZA 4U85A 3AU4A 4BT9A 2A4ZA 3LPZA 4HOQA 5G04J 3WD3A 3CVWA 2XQ0A 3IEGA 2IFUA 2OOEA 1WY6A 3JYMA 4MGVA 3PR9A 5ARGA 2LSUA 4JXTA 3VLFA 2KCVA 3SHFA 4WIWA 1N1AA 1ZBPA 3SBTB 4RG6A 3UI4A 2ONDA 3FUEA 4GCOA 3I5PA 4DLOA 1NA0A 2AWGA 2I1JA 2AXVA 4F3VA 2GGFA 4W5UA 4RSYA 2JZVA 1OGBA 2XRYA 1D6OA 1TCOC 3WXXA 4CT4A 1T11A 1SQMA 3FUIA 4AVXA 4KZCA 4TUUA 5LCWC 5DF0A 2DG4A 3PNLB 4LAYA 3FTWA 3RRNB 4WJXA 1E6ZA 3LY8A 4BTBA 5C1DA 3JQ0A 3ZW3A 3ARSA 1J4IA 4JFLA 2CHWA 2WXFA 3I4RB 3FY4A 5E76A 5LX8A 3FTZA 3CGHA 2LJ4A 4TV3A 2MNTA 5KJLA 4LGXA 1E8XA 3FU5A 3KD7A 4UQYA 4B8AA 2HM8A 5CCLA 2QFCA 2OV8A 2DT1A 3HHMA 3QJZA 1EIBA 3KZ7A 4MKTA 4WWOA 4JHJA 2RQSA 2HO1A 2ILRA 4GA2A 4J8DA 4U07A 4FJYA 1NWSA 5A6CA 3KAFA 2PPPA 4WUYA 1HKIA 1WAWA 4IQ2A 3R9AB 4DZ2A 4TNSA 2HR2A 4GMLA 4HFGA 3AROA 4J6IA 1FKTA 1IQRA 3JYSA 2MPHA 2MRIA 3ARYA 1W3BA 5FWQA 4GB9A 1ZBCA 3ZXSA 3ALGA 2RG8A 4MTVA 4U04A 3IBEA 3NQPA 2XP3A 3G2TA 2VSYA 3KCEA 4J0UA 1TFVA 3O5GA 2FKEA 1HG2A 4GA1A 3LEWA 3OXLA 2PM7A 4WNEA 1OWQA 3S7FA 4TX0A 3BEEA 2DSZA 4I43A 5D75A 3CHEA 4AEZC 3PRBA 3FU6A 4NSBA 3U3WA 2YHEA 1U79A 4N19A 2OLHA 4ILHB 3K9IA 2Q7FA 3FUDA 4BX9A 5FTPA 4AJWA 3RFWA 3ARXA 2BUGA 4MNKA 3FH7A 1HJXA 1Z6TA 3I3NA 4F1SA 5BPPA 2XP9A 4J8FA 5FQ7A 3GW4A 2C0MA 4OVUA 2WMOA 3G2UA 2R5SA 3CSTA 2OVFA 1WM5A 1H6KA 3RM9A 2CG2A 4GYWA 3PNTB 5EKQD 3P2BA 3D3MA 2AW6A 3UT7A 3VLEA 3G2WA 3RO2A 3EHMA 2CG3A 3WH0A 1YATA 3RKVA 2YINA 4ODRA 1E8ZA 4E85A 4WNGA 3TCZA 2GW1A 1RD6A 4DRPA 3ARTA 3AS5A 3UT8A 1FFRA 4P29A 3C98A 1EQ3A 4ODNA 2PQNA 4FULA 3CK8A 3UMVA 1GPFA 4MAVA 4QT3A 1E8WA 5HWCA 1HJVA 2V0PA 2WXQA 2F21A 2XP7A 2IOSA 1ELWA 1ZU8A 1C9HA 1NMVA 5T4YA 3CR3A 3FFLA 1D7IA 3WD2A 2NXPA 4ILIA 3ZGQA 2M08A 4KXKB 2X3MA 1Q6UA 4I6JA 5ENNA 1MHQA 5HTGA 2ZU6B 1OWNA 3W4RA 4FLHA 1E6RA 1LL7A 3FUFA 3FUKA 3IHZA 4CEMA 2LKNA 1LF8A 5G05C 1HJWA 2O92A 2LPVA 2P58C 4LERA 4GMJA 1EPUA 2VSOE 4U0UA 4XE0A 5I98A 1Q1CA 1LL6A 4L23A 1LQ0A 1L1PA 4APOA 2VN1A 3HIZA 2AXUA 1DVPA 3O48A 4QZVB 4ODQA 3MJWA 2WXHA 3CV0A 3QARA 4A1GA 4I1OB 3MDYB 3QK0A 3URZA 3FWVA 3CVUA 2ZR6A 5HWBA 4JFMA 2KCKA 4CGWA 4NRHB 2PZIA 1H2UA 3LY9A 5CMYA 4DI3A 4Y6WA 2QY7A 5GPGA 2XPAA 5ANRA 2XP5A 4JHRA 5T3RA 4I6EA 3CHFA 4G2VA 4CCAA 4JPSA 4PH4B 1PY1A 3ARRA 3LS8A 5LFAA 3FUNA 3IV0A 1ZBWA 4FC8A 3TXNA 3ZYMA 3NF1A 1FCHA 3AS4A 3UI6A 2RUQA 4GZ5A 4L1BA 2LO6A 5J08A 3WD0A 3D9LA 4A3VA 5JJ6A 1UW4B 2I9CA 1BPOA 4NACA 3WKZA 3ZEFA 1H2VC 3PRDA 3KS2A 4HOTA 1ZK6A 3ARVA 2ZQVA 1HXVA 4GYOA 1D7JA 2DPEA 5J6EA 4LRZA 4KR0B 3T5XA 4P8VA 3KADA 1NWUA 4U8HA 3APFA 4UQZA 2Y78A 4C02B 2GRMA 3QWWA 1FKKA 2PL2A 3QAQA 1OUVA 4JZYA 2A3CA 2IU1A 5KJNA 2IONA 3WQWA 2DT0A 1FKDA 4Q7NA 3UF8A 1TJFA 1F8AB 3PRAA 3MEKA 1W1VA 2Y3AA 3SD5A 2ZR4A 4DI4A 2AWIA 5BUZA 1N54A 2BF0X 5BXJA 4KQZA 4H7YA 3MKQB 3LJ3A 1FVFA 3UQIA 2V4LA 2X6JA 2WVIA 2XGMA 3E4BA 3ENEA 2ZR5A 2IJGX 3IHYA 4TW6A 2XGOA 2DT2A 2WM9A 5BV0A 2KR7A 3ZHEB 3EIQC 3ARWA 1ROTA 3EY6A 3U9WA 2J9QA 4ITZA 2FF4A 5M72A 1FKFA 4WWPA 4JFJA 4BT8A 2PQRA 1XNFA 3LYAA 1YA0A 4DIPA 3B7UX 4P8WA 4MRUA 4UWLA 1JNTA 1EYHA 4DRKA 3TC5A 4XKBA 4FU3A 3TG4A 4IYPA 2C2LA 1PC2A 4G2PA 3I4GA 2X6FA 4KVOA 3UQ3A 3PEVB 3PEUB 4I17A 3AU5A 1J6YA 2LSVA 2VGXA 5HQ8A 4DWSB 2E2EA 5JJTA 3TAXA 4DT4A 2C0LA 1JPLA 2XPBA 4S3JA 2X6KA 1QZ2A 2DG3A 3FH8A 1DNPA 3PUKA 4JEHA 2PM6A 3B8SA 3PE4A 3U66A 3APCA 1GUVA 3CLJA 4G26A 2J49A 3CVYA 3CHSA 4RVBA 5JHBA 3L16A 2WXMA 3CHRA 4KYOB 2WXNA 1ZCNA 3B9AA 1M5YA 4AP2A 4I1AA 4I9CA 3TGOA 1FKJA 3ZVVA 2XPIA 2FBNA 4U86A 2DG9A 1ZU2A 3AS2A 3AS1A 3MZLB 3T5VA 3CK7A 4FLBA 4C0EA 3ODKA 2IOLA 1E9LA 3L13A 3L17A 2LNIA 2B31A 2X6IA 3L6AA 2XP4A 4GGQA 2DSUA 2M2AA 2I2OA 1NWRA 4FJZA 3B13A 4JC8A 3MKRA 4B0ZA 2QF8A 3TXMA 3AS8A 1NA3A 4W9RA 4HBOA 4XAKA 1A7XA 2NSZA 4P8XA 1Z3YA 2UY1A 4A55A 3MYVA 3FXYA 4DRIA 2WXGA 3JCKC 4DWSC 4EECA 2AVPA 5EDSA 1H0IA 1X5BA 3D9JA 1KT0A 3UQAA 3FEXA 2WXRA 2ZQTA 3HDXA 3AQUA 3PREA 2FI7A 2KZTB 3IHVA 2FO7A 3KAIA 4AM9A 5FZSA 3EDTB 1HFAA 1WAO1 5G05J 1FD9A 3IK8A 4HOUA 5AENA 1Y0OA 2MLXA 5BNWA 5AJLA 2RD0A 3PRZA 2J4DA 3LUOA 1H2TC 2N87A 4UWKA 3FH5A 1HH8A 4ATGA 5HKGA 3ESKA 5HW6A 2G8ZA 4ACKA 2NC9A 4WKFA 3CKCA 5D0OD 5GQBA 4HBEA 2F4EA 1TEZA 5JHAA 3O5JA 4HLEA 3EIJA 4S3KA 4JA9A 3O5EA 4CDNA 3KEZA 4YVQC 4JA7A 3PUJA 5BT1A 3CHMA 3FU3A 1W9PA 4CDMA 1EHNA 2VQ2A 1KT1A 4GCNA 2I6HA 4N2QA 2Q5AA 3CVNA 4ANUA 4C9BB 1ZBKA 2VCDA 2E0IA 3CVPA 4KT6B 4V3IA 1FKBA 1IHGA 2WK2A 1B6CA 1IQUA 3O5DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ROU A;  3MDY B;  3CVQ A;  3RGC A;  3KAE A;  3UPV A;  3PA7 A;  4G23 A;  4U0Z A;  3OOB A;  5DIV A;  3URZ A;  1FKG A;  3FWV A;  1EYM A;  3O5O A;  2JLB A;  2ZR6 A;  5HWB A;  4N5C A;  1FKS A;  4N3A A;  2ZQS A;  4XI9 A;  4N39 A;  1TJC A;  4JFM A;  4BF8 A;  5HW7 A;  2KCK A;  4ODK A;  3JYJ A;  4CGW A;  4NRH B;  2Y4U A;  2PZI A;  3O5P A;  3LY9 A;  2HYZ A;  3ASG A;  3OXF A;  4XI0 A;  3O5I A;  4Y6W A;  4W9P A;  4I9E A;  5GPG A;  2XPA A;  4BWR A;  5CHE E;  3RIB A;  2XP5 A;  3KAH A;  4JHR A;  2PV2 A;  4G2V A;  5KJK A;  4YND A;  5FT9 A;  5BW8 C;  1HXI A;  2KO7 A;  4I2Z A;  2KE0 A;  4DH0 A;  3NTP A;  1NMW A;  4O6F A;  5DIZ A;  4ODP A;  3TG5 A;  2ITK A;  4U85 A;  3Q15 A;  4BT9 A;  3LPZ A;  4N2S A;  4HOQ A;  3NF1 A;  2KCL A;  5G04 J;  1FCH A;  3AS4 A;  3UI6 A;  4NQ0 A;  5DBK A;  3IEG A;  2RUQ A;  4GZ5 A;  2IFU A;  3CGN A;  3GPK A;  2OOE A;  4R0X A;  1Q6H A;  4UI9 K;  3QOU A;  3JYM A;  4DZ3 A;  4GYY A;  3GZ1 A;  4MGV A;  4TW8 A;  2D9F A;  4ODL A;  1Q6I A;  5ARG A;  2LSU A;  5JJ6 A;  4J4O A;  2KCV A;  4RG9 A;  1HZ4 A;  3PE3 A;  2IF4 A;  4Y6C A;  3RO3 A;  4J8E A;  4W9O A;  3PRD A;  3KS2 A;  1N1A A;  3KAC A;  5EX3 A;  4HOT A;  1ZK6 A;  2ZQV A;  1HXV A;  1ZBP A;  4GYO A;  4RG6 A;  2FEZ A;  3UI4 A;  2OND A;  1D7J A;  5J6E A;  4GCO A;  3FAP A;  5G04 C;  4DRM A;  1NA0 A;  2AWG A;  1A17 A;  4F3V A;  3KAD A;  3CK9 A;  4UQZ A;  2Y78 A;  4C02 B;  2JZV A;  3QWW A;  5FJY A;  1D6O A;  1FKK A;  1TCO C;  3WXX A;  1JNS A;  2PL2 A;  4J4N A;  1T11 A;  1OUV A;  4HOR A;  2MLZ A;  3O5K A;  5LCW C;  5KJN A;  3JXV A;  2L6J A;  2DG4 A;  1JVW A;  4LAY A;  4WND A;  1FKD A;  2KC7 A;  2L2S A;  4CGV A;  2RUC A;  3UF8 A;  1F8A B;  4JL0 A;  3MEK A;  3CGM A;  3LY8 A;  4BTB A;  2MF9 A;  2XGS A;  5C1D A;  2ZR4 A;  1J4I A;  4JFL A;  4N3B A;  2VGY A;  3CEQ A;  2Y4T A;  4LAX A;  5BXJ A;  4FN2 A;  3LKU A;  4H7Y A;  2FAP A;  3UQI A;  4G50 A;  4TW7 A;  4LAW A;  4IPX A;  4JFI A;  2XGM A;  3E4B A;  2PPN A;  2RUR A;  2ZR5 A;  4DRJ A;  5CCM A;  1FKH A;  4TW6 A;  1QPL A;  2KI3 A;  2LJ4 A;  2XGO A;  5HUA A;  5DIT A;  1B89 A;  2MNT A;  3MV3 B;  2KR7 A;  4WNF A;  3ZHE B;  3VTX A;  5KJL A;  2KGJ A;  3FP3 A;  3KD7 A;  4UQY A;  5CCL A;  4GPK A;  2QFC A;  2MHK A;  1YW5 A;  1ROT A;  4G25 A;  3EY6 A;  2J9Q A;  4ITZ A;  2FF4 A;  5M72 A;  1BL4 A;  1FKF A;  4XIF A;  4JFJ A;  2DBA A;  4BT8 A;  2PQR A;  1XNF A;  3LYA A;  1YA0 A;  3KZ7 A;  4DIP A;  3CKB A;  3UI5 A;  1F40 A;  2RQS A;  3QWP A;  2HO1 A;  1JNT A;  4GA2 A;  4J8D A;  4U07 A;  4AY6 A;  4DRK A;  3TC5 A;  5ARF A;  4ABN A;  5A6C A;  3KAF A;  4W9Q A;  2PPP A;  4WUY A;  3TG4 A;  3N71 A;  2XCB A;  1R9H A;  4I2W A;  4IQ2 A;  2VYI A;  3R9A B;  2C2L A;  3O5R A;  4DZ2 A;  4TNS A;  1PIN A;  1PC2 A;  4G2P A;  3S7J A;  4AY5 A;  2HR2 A;  3ASH A;  5A7D B;  1FJD A;  3UQ3 A;  1FKT A;  3JYS A;  2MPH A;  2M1I A;  1W3B A;  4QIB A;  4I17 A;  3S7B A;  1J6Y A;  2LSV A;  2VGX A;  3SF4 A;  1FAP A;  1QPF A;  3IKG A;  5HQ8 A;  4U04 A;  2XP3 A;  2E2E A;  5JJT A;  3TAX A;  2VSY A;  2F2D A;  4DT4 A;  3KCE A;  2C0L A;  2XPB A;  3ASD A;  4J0U A;  3O5G A;  3O5F A;  5DIU A;  1QZ2 A;  5D0Q D;  2DG3 A;  4GA1 A;  2FKE A;  3NRK A;  1J4H A;  2YHC A;  3O5M A;  3OXL A;  4WNE A;  4HOS A;  3ASF A;  3S7F A;  4CDR A;  3PE4 A;  4TX0 A;  3BEE A;  5FZR A;  2UZ5 A;  1P5Q A;  5D75 A;  4O2T A;  3PRB A;  5HT1 A;  4IQC A;  3U3W A;  4G26 A;  4DRQ A;  1ELR A;  1U79 A;  4N19 A;  3OXG A;  3K9I A;  2YQ8 A;  5HI7 A;  4G1T A;  1PBK A;  2MLY A;  3MA5 A;  2KAT A;  3QKY A;  2Q7F A;  4BTA A;  5FTP A;  4H7X A;  4N3C A;  3RFW A;  4KYO B;  3GZ2 A;  4NNR A;  1Y8M A;  2BUG A;  1ZCN A;  5FZQ A;  2OFN A;  1IYG A;  2XP6 A;  3TDB A;  1M5Y A;  1BKF A;  4GZ6 A;  4U84 A;  4I1A A;  4I9C A;  3TGO A;  3GYZ A;  1FKJ A;  2XP9 A;  4J8F A;  2XPI A;  2FBN A;  4DRH A;  1NZN A;  4U86 A;  4G24 A;  3GW4 A;  2DG9 A;  4ODM A;  1ZU2 A;  2C0M A;  5EX0 A;  3VAW A;  3CK7 A;  3QWV A;  4YVO A;  5AYW D;  3ODK A;  2R5S A;  1WM5 A;  3H9R B;  2LNI A;  3MV2 B;  4GGQ A;  2XP4 A;  4GYW A;  4ME2 A;  3Q5M A;  2M2A A;  5EKQ D;  4A1S A;  4KBQ A;  3S7D A;  3RO2 A;  4JFK A;  4QT2 A;  3WH0 A;  1YAT A;  1NSG A;  3RKV A;  4AIF A;  4JYS A;  4ODR A;  4DRO A;  3O5Q A;  4WNG A;  3TCZ A;  2PPO A;  3MKR A;  2GW1 A;  3Q47 B;  5HW8 A;  3AS8 A;  2XP8 A;  4DRP A;  2ZQU A;  1NA3 A;  4W9R A;  1A7X A;  3AS5 A;  3O5L A;  3LY7 A;  4GZ3 A;  1FKR A;  2UY1 A;  3CVL A;  4DRI A;  4MSP A;  1EQ3 A;  4ODN A;  5KJM A;  2PV3 A;  2PQN A;  2AVP A;  3Q49 B;  3CK8 A;  1QQE A;  4UI9 J;  1KT0 A;  3UQA A;  4QT3 A;  5HWC A;  2PV1 A;  2RSE A;  2WQH A;  2ZQT A;  2FI7 A;  2FO7 A;  2F21 A;  2XP7 A;  3KAI A;  2VSN A;  4AM9 A;  5FZS A;  3EDT B;  5B8I C;  3U4T A;  4IN3 B;  3UQB A;  1ELW A;  1WAO 1;  5G05 J;  1FD9 A;  3KAG A;  2K8I A;  3ULQ A;  1C9H A;  3Q4A B;  4HOU A;  1NMV A;  3IK8 A;  2UWJ G;  4TYO A;  1Y0O A;  2KFW A;  3FFL A;  1D7I A;  3ZFW A;  2MLX A;  3PDN A;  5LCW J;  1KLX A;  5BNW A;  2V5F A;  3IKD A;  2M08 A;  3ZGQ A;  4DRN A;  3LUO A;  4KXK B;  4GA0 A;  2N87 A;  4B94 A;  3B7X A;  2WPV A;  4UI9 C;  1D7H A;  1Q6U A;  3LCA A;  3RJV A;  5JJ7 A;  1HH8 A;  4EQF A;  1E96 B;  5HKG A;  2XCC A;  2UY1 B;  3ESK A;  4U0S A;  5HW6 A;  5HTG A;  3I6C A;  2LGO A;  2NC9 A;  3CKC A;  5D0O D;  3IHZ A;  2LKN A;  2F4E A;  4LAV A;  5G05 C;  3O5J A;  3SZ7 A;  1J4R A;  1W26 A;  3ZHE A;  2LPV A;  4JA9 A;  2RUD A;  2P58 C;  3NI6 A;  3O5E A;  3RU0 A;  2PBC A;  4YVQ C;  4JA7 A;  4GIV A;  3ZPJ A;  5BT1 A;  4U0U A;  5I98 A;  2VGX B;  1Q1C A;  3QDN A;  4UQX A;  3ZN3 A;  4FAP A;  4LEU A;  3KAB A;  1L1P A;  3VTY A;  4APO A;  2VQ2 A;  1KT1 A;  4GCN A;  2I6H A;  4N2Q A;  2Q5A A;  3CVN A;  2VN1 A;  2VCD A;  3HYM B;  1FKL A;  3CVP A;  3O48 A;  1FKI A;  4ODQ A;  2XEV A;  1FKB A;  1IHG A;  4ODO A;  3CV0 A;  1B6C A;  3O5D A;  3UUX A; 
#chains in the Genus database with same CATH topology
 1JCR A;  3CVQ A;  3RGC A;  2EUL A;  1H0G A;  3PA7 A;  4U8V D;  3HVE B;  4JVS A;  4U0Z A;  3G6L A;  5DIV A;  2JLB A;  4N3A A;  2ZQS A;  4XI9 A;  3Q9N C;  1TJC A;  4BF8 A;  4ODK A;  3JYJ A;  3P1U A;  3OXF A;  4K0R A;  4JB8 P;  3FUM A;  5CHE E;  4F1P A;  4DK5 A;  3CH9 A;  3NZU A;  3KAH A;  1MX6 A;  3IKO B;  4EZL A;  4D10 C;  2ZIR A;  4HI8 A;  4PS8 A;  3OTN A;  3Q9U C;  5BW8 C;  3ZIM A;  3KEA A;  2KO7 A;  1JUQ A;  5E75 A;  1YYH A;  3EHN A;  4EZK A;  5DIZ A;  3TG5 A;  5KCM A;  5LP0 A;  2KCL A;  4NQ0 A;  3GPK A;  4R0X A;  3QOU A;  4DZ3 A;  4GYY A;  1ZB5 A;  4TW8 A;  2D9F A;  4PS7 A;  3LVQ E;  3JXI A;  4URK A;  4I6G A;  4RG9 A;  3AS0 A;  4Y6C A;  1ZBV A;  5B1B E;  3CQC B;  5C2Y A;  4J8E A;  2B0O E;  4YDO A;  1VF8 A;  2P9L G;  4PDX A;  3MCX A;  3KAC A;  5EX3 A;  3ML9 A;  2FEZ A;  4P8U A;  3DSU A;  5AAR A;  4NZC A;  1N0Q A;  1N9A A;  2WXL A;  3FAP A;  4DRM A;  1N52 A;  2P9N G;  1MZC A;  4BER A;  1A17 A;  1LTX A;  4IRU A;  4E6H A;  3CHO A;  2P9S G;  3R9M A;  1JNS A;  4J4N A;  3KSL A;  2MLZ A;  3O5K A;  1D2K A;  1GW6 A;  3FTS A;  3D9P A;  4ILG A;  3JXV A;  2GRN B;  1E6N A;  1JVW A;  2KC7 A;  3BUA A;  1NL4 A;  2L2S A;  4CGV A;  2X38 A;  2RUC A;  3B9D A;  4JL0 A;  3CGM A;  4JW1 A;  2VTB B;  2XGS A;  2DCP A;  3UX4 A;  2VGY A;  3W9G A;  3RRU A;  4IT6 A;  3Q79 A;  4LAX A;  4Z2J A;  3ZRH A;  4FN2 A;  2J8S D;  4B93 B;  3WQV A;  3E34 A;  2R59 A;  3LKU A;  4IUL A;  2Y1L E;  3JQ1 A;  3SBS A;  3X2Q E;  1S64 A;  2A3A A;  2F23 A;  2WXP A;  4LAW A;  4JFI A;  4L7T A;  1KZO A;  2PPN A;  2RUR A;  5EIL A;  4DRJ A;  3SNX A;  5BXO A;  5HUA A;  5DIT A;  2L6B A;  4UWH A;  3MV3 B;  2DVW A;  4WNF A;  3VTX A;  3CHQ A;  3FDH A;  3FP3 A;  1HG5 A;  3FHE A;  4GTP A;  4GPK A;  4BFR A;  1YW5 A;  2AOS A;  4FP7 A;  1D9S A;  5ENO D;  2OEV A;  4G25 A;  3AJI A;  3HRA A;  5AQ7 A;  3SFZ A;  3LJN A;  2DBA A;  5CBN A;  4ML4 A;  4AOF A;  4GZC A;  3CKB A;  5AQ9 A;  2XS1 A;  4U63 A;  4A3T A;  1F40 A;  4R7L A;  3F6Q A;  3QWP A;  4OVV A;  4KZ0 A;  1FFQ A;  1VDY A;  4AY6 A;  4ABN A;  3FTV A;  1H19 A;  3N71 A;  2XCB A;  1INZ A;  4I2W A;  2ETC A;  2VYI A;  1HKJ A;  3WL1 A;  1PIN A;  4LCT A;  3CIA A;  3S7J A;  3ASH A;  4HLL A;  5A7D B;  1FJD A;  2IQC A;  4DLQ A;  3ARZ A;  3UM1 A;  1WNO A;  2M1I A;  2P4V A;  4QIB A;  1KZP A;  2LAI A;  2Y0B G;  1N4P A;  4MNM A;  1FAP A;  1QPF A;  3IKG A;  1W1T A;  4YDE A;  2F2D A;  3J5P A;  3ASD A;  5CMW A;  1ZL1 A;  3JUI A;  4Z2L A;  1X81 A;  3O5F A;  5D0Q D;  3ML8 A;  3NRK A;  3O5M A;  2YHC A;  1OGG A;  3ASF A;  4CDR A;  4FHJ A;  1CTN A;  5FZR A;  1QYM A;  4O2T A;  2P9U G;  1ITX A;  5HT1 A;  4R5E A;  1O6I A;  1TYQ G;  4Z2K A;  1SZ9 A;  4G1T A;  1PBK A;  2MLY A;  3MA5 A;  3MGB A;  3QKY A;  4F7A A;  3TL5 A;  3WL0 A;  4QFV A;  3RME A;  4LNU D;  5FQ6 A;  4ATZ D;  4UDM A;  4BX8 A;  5FZQ A;  2XP6 A;  4N5Q A;  1BKF A;  4WKH A;  4U84 A;  4ANX A;  1HE8 A;  5DO2 A;  3T8M A;  3GYZ A;  3Q7A A;  4URI A;  3ARQ A;  2M63 A;  3R7R A;  4TXR A;  3D9K A;  5LOZ A;  2CFZ A;  1A5E A;  5IY5 E;  3ESL A;  1EF1 C;  4K5B A;  4ODM A;  5EX0 A;  2XHE A;  3QWV A;  4YVO A;  4HAR A;  1AWC B;  4FHK A;  2FDM A;  3H9R B;  3GZS A;  2DSV A;  3MV2 B;  2XPZ A;  1X6L A;  1S63 A;  1SA4 A;  3Q5M A;  4A1S A;  4XZ4 A;  4O60 A;  3UM2 A;  2KM4 A;  2MOW A;  4TUM A;  1K1A A;  3S7D A;  1HU3 A;  4QT2 A;  5HKP A;  2ZGD A;  1SYT A;  4AIF A;  4JYS A;  4DRO A;  1OWL A;  4Q94 A;  3O5Q A;  4LUN U;  5FQ4 A;  2PPO A;  1ELK A;  4TRQ A;  3Q47 B;  5BV1 A;  1W1Y A;  5HW8 A;  4B8C B;  2ZQU A;  1UN8 A;  4GTR A;  3LY7 A;  4DUI A;  4BES A;  3PVL A;  2ETB A;  4JHK A;  4J8S A;  3WG7 E;  3E37 A;  4MSP A;  2JEK A;  2J08 A;  5KJM A;  1XGW A;  4C0M A;  3Q49 B;  2PV3 A;  3BXW A;  3NB2 A;  1QQE A;  3HXB A;  4PUC A;  3FTY A;  2PV1 A;  2WXI A;  2RSE A;  4L9P A;  3FEY A;  3Q78 A;  3ONK A;  4HS2 A;  1U3D A;  5B8I C;  3UQB A;  3BG1 B;  1UR8 A;  2K8I A;  3FY1 A;  4GTV A;  1EDQ A;  4UWF A;  3TWS A;  2F8X K;  2UWJ G;  4TYO A;  3RM4 A;  2KFW A;  3Q75 A;  3DXM G;  1KLX A;  2IY0 C;  2V5F A;  1MYO A;  4PS3 A;  1HF8 A;  4DRN A;  4GA0 A;  1SA5 A;  3MKQ A;  3B7X A;  3FUL A;  3AG3 E;  4UI9 C;  1D7H A;  3RJV A;  5JJ7 A;  2VSX E;  4G8L A;  4EQF A;  1E96 B;  3ZU7 B;  2XCC A;  1TR4 A;  2UY1 B;  1UR9 A;  2LGO A;  2WLZ A;  4CRW A;  3ZYL A;  1NP7 A;  4LAV A;  1J4R A;  3ZHE A;  1UJK A;  1SVX A;  3HXD A;  3Q7F A;  4HRM B;  2VJ8 A;  3CHC A;  2PBC A;  2ETN A;  3S2A A;  4HRL A;  1JND A;  4GIV A;  3ZPJ A;  2WLY A;  2QZA A;  3APD A;  1JNE A;  3D9M A;  4HRN A;  1JWG A;  3AG2 E;  5AIJ A;  3DSW A;  2WB2 A;  1SZA A;  4F6R D;  1NWT A;  1FKI A;  3D9H A;  1OWM A;  4WK9 A;  2LAH A;  3QNK A;  2WXO A;  1NZN A;  1MX4 A;  4L72 B;  1ROU A;  3CSF A;  3KAE A;  1FT1 A;  3UPV A;  1EYM A;  4N5C A;  1U3C A;  1FKS A;  1E15 A;  1V55 E;  1PAQ A;  4N39 A;  3V30 A;  4B89 A;  4IT4 A;  2HYZ A;  4XI0 A;  4XX5 A;  4ZPT R;  3O5I A;  4I9E A;  3V31 A;  1LD8 A;  4BWR A;  1UJJ A;  3TJP A;  3CHP A;  3UT4 A;  4DWS D;  4ZPV R;  4DWS A;  1LG2 A;  4YND A;  2P9K G;  5GPR A;  4HNA D;  3LXU X;  1NMW A;  4O6F A;  4BSX A;  1OY3 D;  4MNJ A;  4WAF A;  5AJD A;  2LUH A;  2ITK A;  3L22 A;  3Q15 A;  4XKC A;  1E6P A;  4N2S A;  1RZ4 A;  2XZT G;  3DBS A;  5DBK A;  1N0R A;  2J07 A;  3CGN A;  2WMN A;  1Q6H A;  2DZN A;  4UI9 K;  4PTM A;  3GZ1 A;  2OEW A;  4I1M A;  4ZPW R;  4ACL A;  4ODL A;  1Q6I A;  3FTU A;  2MYO A;  4J4O A;  3EJN A;  1S0P A;  2GRQ B;  1WB0 A;  1HZ4 A;  3PE3 A;  1OT8 A;  4BSZ B;  4KVM A;  2RKK A;  2IF4 A;  3CHD A;  2WM0 A;  3RO3 A;  2R17 C;  4W9O A;  2XPY A;  3UTM A;  4HXI A;  4GTT A;  4BY6 A;  4APF A;  2FO1 E;  3ABL E;  3B7R L;  5G04 C;  3FU0 A;  2EIJ E;  3LVR E;  3OAW A;  2R03 A;  1E8Y A;  4F53 A;  3CK9 A;  4DX1 A;  1H6O A;  2H6I A;  5FJY A;  2ESC A;  3ISM C;  4MS6 A;  3ZNG A;  3ULY A;  4HOR A;  3G2V A;  4OYS A;  1XRV A;  4EBA G;  2L6J A;  2Y69 E;  4AY1 A;  5A23 A;  4WND A;  1D8D A;  3T9K A;  1UG3 A;  3ZXP A;  2A5U A;  1JCQ A;  2X6H A;  5EYL A;  2EIM E;  2MF9 A;  2J09 A;  4N3B A;  4M3O A;  4Q22 A;  1K3Z D;  3CEQ A;  3G2S A;  4HI9 A;  4LG6 A;  3GTY X;  2Y4T A;  3MX3 A;  4Z2H A;  1E7V A;  2FAP A;  4G50 A;  4TW7 A;  1OWP A;  4IPX A;  4GTS A;  3SQV A;  3TWW A;  5CEC B;  5CCM A;  1FKH A;  3WD4 A;  1QPL A;  4G11 A;  3FUJ A;  2KI3 A;  1B89 A;  2WXJ A;  4NUR A;  3CVV A;  2KGJ A;  2MHK A;  1FVH A;  2KZT A;  2I1K A;  4DPR A;  2CHX A;  3HXE A;  1BL4 A;  3D9N A;  1IHB A;  2OVB A;  4XIF A;  2P2C P;  1E7U A;  1LL4 A;  5EID A;  3CZ8 A;  3PH0 C;  3UI5 A;  1HKM A;  1N94 A;  2PNN A;  3L08 A;  3QC1 A;  5ARF A;  4MLP A;  4W9Q A;  2WQ6 A;  4GAA A;  1HS6 A;  2A3B A;  4GZD A;  1W9U A;  2F37 A;  1R9H A;  4GTQ A;  5ENQ D;  1EDU A;  2L0I A;  2DZO A;  3O5R A;  5AQA A;  3BMB A;  4AY5 A;  2DT3 A;  4GU5 A;  4LSZ E;  3D9O A;  1W1P A;  1GOI A;  4U7E B;  5ENR D;  2IUZ A;  1LJY A;  4Q96 A;  2GRO B;  2H6H A;  3S7B A;  4FA6 A;  4DX2 A;  5H7P A;  3SF4 A;  3JXJ A;  3RK6 A;  1QNF A;  3QB2 A;  4ZS6 A;  4Q69 A;  3SGH A;  5EIB E;  3ALF A;  5DIU A;  2GRL A;  1LG1 A;  3B9E A;  1J4H A;  3D9I A;  3PZ1 A;  4HOS A;  3QOK A;  1TNZ A;  3O4Z A;  1HKK A;  3ARP A;  3EUV A;  3E32 A;  4Z2G A;  2UZ5 A;  1P5Q A;  4EPZ A;  4UWG A;  3HVE A;  4IQC A;  4DRQ A;  1ELR A;  4NIK A;  3OXG A;  5HI7 A;  2YQ8 A;  1K1B A;  4AV7 A;  2KAT A;  4CT0 A;  4BTA A;  1UN9 A;  4GMR A;  4H7X A;  4N3C A;  4NNR A;  3C72 A;  3GZ2 A;  1Y8M A;  2OFN A;  5HS0 A;  1IYG A;  3TDB A;  4GZ6 A;  1BI7 B;  1KFW A;  4WKA A;  1SR0 A;  3V79 K;  4ANV A;  2V8S E;  1ZB1 A;  4DRH A;  3WD1 A;  1E90 A;  4G24 A;  4M7C A;  2PI6 A;  3VAW A;  3C3R A;  5AYW D;  3G6M A;  4MNL A;  3B7T A;  2DIW A;  3OA5 A;  4ME2 A;  5G55 A;  2YBU A;  3U64 A;  3PZD A;  4KBQ A;  2KBX A;  5KNG A;  4JFK A;  3TWX A;  1NSG A;  3ZYQ A;  1QBQ A;  1N4S A;  5J90 A;  3ONL A;  1W9V A;  4L2Y A;  2XP8 A;  4GTM A;  1RW2 A;  1Z3X A;  4L2L A;  3O5L A;  3DPD A;  4GZ3 A;  3CVX A;  1FKR A;  3C5R A;  1TN7 A;  3CVL A;  5ENP D;  4J7W A;  2BED A;  1OCC E;  1K9T A;  1YCS B;  1Y6I A;  3ASN E;  2L0T B;  4UI9 J;  2O9O A;  3ASO E;  4Z2I A;  1HX8 A;  3VLD A;  1G3N B;  2WQH A;  2L9B A;  5ANL A;  2VSN A;  5G2N A;  3U4T A;  4IN3 B;  3ULE G;  3L54 A;  3KAG A;  1TNY A;  3NZS A;  3ULQ A;  3Q4A B;  1MX2 A;  4FAD A;  2VTB A;  2YBT A;  1IX5 A;  3ZFW A;  3PDN A;  2FUL A;  5LCW J;  3ARU A;  4HVB A;  5DEZ A;  4WWN A;  1MQS A;  3IKD A;  5AQB A;  3SI5 A;  4B94 A;  3SFY A;  3NOG D;  2WPV A;  3T8K A;  3LCA A;  4JEU A;  2CHZ A;  3SFX A;  4U0S A;  3I6C A;  1D8E A;  2BTD A;  2A3E A;  1L5J A;  3SZ7 A;  1W26 A;  5EYP F;  2V5Q C;  1JWF A;  2EIN E;  2RUD A;  3NI6 A;  2EQX A;  3RU0 A;  3TWT A;  2P9I G;  2DSW A;  2F8Y A;  4DX5 D;  2VGX B;  3QDN A;  4UQX A;  2V4H C;  3B7S A;  2J4B A;  3ZN3 A;  3RRM B;  4EZJ A;  4FAP A;  4LEU A;  3KAB A;  4MPK A;  3VTY A;  2CFU A;  5T8I A;  4L3N A;  1OWO A;  4RLY A;  3RM8 A;  5JH8 A;  3HYM B;  4TXP A;  3ZYK A;  4DX7 D;  1FKL A;  2XEV A;  1TNU A;  2G41 A;  4ODO A;  1WG0 A;  3PS6 A;  1HO8 A;  3WIJ A;  3FUH A;  3UUX A;  4LNB A;  5D66 A;  5HBF A;  3DRA A;  1NH6 A;  4G23 A;  3OOB A;  1FKG A;  1X6N A;  3O5O A;  1FPP A;  2WXK A;  4K03 A;  3CQG B;  4DJA A;  5HW7 A;  4YDW A;  3E33 A;  3O5P A;  2Y4U A;  3R7Q A;  3LDZ A;  3AS3 A;  3ASG A;  4W9P A;  1H0A A;  2WQ7 A;  3RIB A;  2VGE A;  2PV2 A;  4AXH A;  3C3Q A;  4ANW A;  3BG0 B;  5KJK A;  4KMO A;  5FQ8 A;  5FT9 A;  1HXI A;  4I2Z A;  3TWU A;  2KE0 A;  2XRZ A;  4DH0 A;  3NTP A;  2YNQ A;  1XHG A;  1DCE A;  4EBA A;  4ODP A;  3FTX A;  2AXZ A;  5B1A E;  4U85 A;  3AU4 A;  4BT9 A;  2A4Z A;  3LPZ A;  5ENT D;  4HOQ A;  3DXK G;  5G04 J;  3WD3 A;  1BU9 A;  3CVW A;  2XQ0 A;  3IEG A;  2IFU A;  2OOE A;  1WY6 A;  1TN8 A;  3NAW A;  3JYM A;  4MGV A;  3PR9 A;  5ARG A;  2LSU A;  4JXT A;  3V2X A;  3VLF A;  2KCV A;  1N4Q A;  2F0Y A;  3AG1 E;  3SHF A;  4WIW A;  3B95 A;  1N1A A;  1ZBP A;  3UI2 A;  3SBT B;  4RG6 A;  3UI4 A;  2OND A;  3FUE A;  3EHR A;  4GCO A;  3I5P A;  4DLO A;  4YDY A;  1NA0 A;  2H6F A;  2AWG A;  2I1J A;  2AXV A;  4F3V A;  2GGF A;  4W5U A;  4RSY A;  2JZV A;  1OGB A;  2XRY A;  1BD8 A;  1D6O A;  1TCO C;  3EU5 A;  3WXX A;  2B6C A;  3Q73 A;  1JCS A;  4CT4 A;  1T11 A;  1SQM A;  3FUI A;  4AVX A;  4KZC A;  4TUU A;  5LCW C;  5DF0 A;  2DG4 A;  3PNL B;  4LAY A;  3SY2 A;  3FTW A;  3RRN B;  1JCH B;  5CBO A;  4WJX A;  1E6Z A;  3LY8 A;  4BTB A;  5AAO A;  3JUE A;  5C1D A;  3JQ0 A;  3ZW3 A;  3ARS A;  4TXQ A;  1J4I A;  4JFL A;  2ZGG A;  2CHW A;  2WXF A;  3I4R B;  3UIP C;  3FY4 A;  5E76 A;  5LX8 A;  3FTZ A;  2B5U B;  3CGH A;  3C3O A;  2LJ4 A;  4TV3 A;  1TNB A;  2ZIS A;  2MNT A;  1IKN D;  5ITZ F;  5KJL A;  4LGX A;  2LXL A;  1E8X A;  3FU5 A;  3KD7 A;  4UQY A;  4B8A A;  2HM8 A;  5CCL A;  2QFC A;  3HG0 D;  3GU0 A;  2OV8 A;  2DT1 A;  3HHM A;  3QJZ A;  1EIB A;  3KZ7 A;  4MKT A;  4WWO A;  4JHJ A;  2RQS A;  2HO1 A;  3TWQ A;  2ILR A;  4GA2 A;  4J8D A;  4U07 A;  4FJY A;  5JA4 D;  3ABK E;  4BEP A;  1NWS A;  5A6C A;  3KAF A;  2PPP A;  4WUY A;  1HKI A;  1AP7 A;  1WAW A;  4IQ2 A;  3R9A B;  4DZ2 A;  1U2V G;  3IXE A;  2IO3 C;  4TNS A;  4O1O A;  2HR2 A;  4GML A;  4HFG A;  3ARO A;  4J6I A;  1FKT A;  1IQR A;  3JYS A;  2MPH A;  2MRI A;  3DSS A;  3ARY A;  1W3B A;  1SW6 A;  5FWQ A;  4GB9 A;  1ZBC A;  3ZXS A;  3ALG A;  2RG8 A;  4MTV A;  4U04 A;  3IBE A;  3NQP A;  2XP3 A;  3G2T A;  5CED B;  2VSY A;  2XZD G;  4JD2 G;  3KCE A;  4J0U A;  1TFV A;  3O5G A;  2FKE A;  1HG2 A;  4GA1 A;  3DEO A;  3LEW A;  3OXL A;  2PM7 A;  4WNE A;  1OWQ A;  3S7F A;  4ZHB A;  1IXV A;  2XEH A;  4TX0 A;  3BEE A;  2DSZ A;  4I43 A;  5D75 A;  2BKK B;  2R05 A;  3CHE A;  4AEZ C;  3PRB A;  3FU6 A;  4NSB A;  3U3W A;  2YHE A;  1U79 A;  4N19 A;  2OLH A;  4ILH B;  3ZUV B;  3K9I A;  2Q7F A;  3FUD A;  4BX9 A;  5FTP A;  4AJW A;  3RFW A;  3ARX A;  2BUG A;  4MNK A;  3FH7 A;  1HJX A;  1H6P A;  1Z6T A;  3I3N A;  4GTO A;  4F1S A;  2H6G A;  5BPP A;  2XP9 A;  4J8F A;  5FQ7 A;  3GW4 A;  3UIO C;  2C0M A;  2R2L A;  3HXF A;  4OVU A;  2WMO A;  3G2U A;  2R5S A;  3CST A;  2OVF A;  1WM5 A;  1H6K A;  3ZKJ A;  4CZ2 D;  3RM9 A;  4HQD A;  2CG2 A;  4GYW A;  3PNT B;  5EKQ D;  3P2B A;  3D3M A;  2AW6 A;  3UT7 A;  3VLE A;  3G2W A;  1N11 A;  3RO2 A;  5CEA A;  3EHM A;  2CG3 A;  3WH0 A;  1YAT A;  3RKV A;  2YIN A;  4ODR A;  1E8Z A;  4E85 A;  4WNG A;  3TCZ A;  2GW1 A;  1RD6 A;  4DRP A;  3ART A;  3AS5 A;  3UT8 A;  1FFR A;  4P29 A;  3C98 A;  4U8Y D;  1EQ3 A;  4ODN A;  2PQN A;  1NI1 A;  4FUL A;  3CK8 A;  3UMV A;  1GPF A;  1DC2 A;  4MAV A;  4QT3 A;  1E8W A;  2OCC E;  3J5Q B;  5HWC A;  3RAU A;  1HJV A;  2V0P A;  2WXQ A;  2F21 A;  2XP7 A;  2IOS A;  2GRP B;  1ELW A;  1ZU8 A;  4A63 B;  5FIO A;  1C9H A;  1NMV A;  5T4Y A;  3CR3 A;  3FFL A;  1D7I A;  3WD2 A;  2P9P G;  2NXP A;  4ILI A;  3ZGQ A;  2M08 A;  3UKR G;  4KXK B;  2JAB A;  2X3M A;  1Q6U A;  4I6J A;  1K8K G;  5AN8 A;  5ENN A;  1MHQ A;  4QQI A;  5HTG A;  2ZU6 B;  2EIL E;  1OWN A;  3W4R A;  1TN6 A;  4FLH A;  1E6R A;  1LL7 A;  3FUF A;  3FUK A;  3IHZ A;  4CEM A;  2LKN A;  1LF8 A;  5G05 C;  1E44 A;  3UIN C;  1HJW A;  2O92 A;  2LPV A;  5ENS D;  1TNO A;  2P58 C;  4LER A;  3HXC A;  1BI8 B;  2DYR E;  4GMJ A;  1EPU A;  2VSO E;  5KBA A;  4U0U A;  4XE0 A;  5I98 A;  1Q1C A;  3SO8 A;  1LL6 A;  4L23 A;  1LQ0 A;  1L1P A;  1MJ0 A;  4APO A;  1N4R A;  4X8Q A;  2VN1 A;  3HIZ A;  2AXU A;  1OXJ A;  1DVP A;  3O48 A;  1GRJ A;  4QZV B;  3UKU G;  4ODQ A;  3MJW A;  2WXH A;  4Z68 A;  3CV0 A;  3QAR A;  4RQI A;  4A1G A;  4I1O B;  3MDY B;  3KSQ A;  3QK0 A;  3URZ A;  3FWV A;  3CVU A;  2ZR6 A;  5HWB A;  3PZ4 A;  2DYS E;  4JFM A;  2KCK A;  4CGW A;  4NRH B;  2PZI A;  1H2U A;  1UOH A;  3NBN B;  4K5A B;  3LY9 A;  5B3S E;  5CMY A;  4DI3 A;  4Y6W A;  2QY7 A;  5GPG A;  2XPA A;  3E30 A;  4U95 D;  5ANR A;  2XP5 A;  4JHR A;  5T3R A;  4I6E A;  3CHF A;  4G2V A;  1NFI E;  4CCA A;  3ABM E;  4JPS A;  4PH4 B;  1PY1 A;  3DSX A;  3LS8 A;  5LFA A;  3ARR A;  3FUN A;  4LNG A;  3IV0 A;  1ZBW A;  4FC8 A;  3TXN A;  2KXP C;  3ZYM A;  3NF1 A;  1FCH A;  3AS4 A;  3UI6 A;  1O1S A;  2RUQ A;  4GZ5 A;  2HE0 A;  4L1B A;  2AJA A;  3V2O A;  2LO6 A;  5J08 A;  3WD0 A;  3D9L A;  4A3V A;  5JJ6 A;  2QYJ A;  1UW4 B;  2I9C A;  1BPO A;  4NAC A;  3WKZ A;  3ZEF A;  1H2V C;  3DPY A;  3PRD A;  3KS2 A;  4HOT A;  1ZK6 A;  3ARV A;  2ZQV A;  4U96 D;  1HXV A;  4GYO A;  4K5C A;  4OAV B;  1D7J A;  2DPE A;  5J6E A;  4LRZ A;  4KR0 B;  3T5X A;  3EU9 A;  4P8V A;  3KAD A;  1NWU A;  4U8H A;  3APF A;  4UQZ A;  2Y78 A;  4C02 B;  2GRM A;  3QWW A;  1FKK A;  2PL2 A;  3QAQ A;  1OUV A;  2NYJ A;  3W9F A;  1OCZ E;  4JZY A;  2A3C A;  2IU1 A;  5KJN A;  2ION A;  1S70 B;  3WQW A;  2DT0 A;  1FKD A;  3PZ2 A;  4Q7N A;  3UF8 A;  1TJF A;  1F8A B;  3PRA A;  3MEK A;  1W1V A;  2Y3A A;  3SD5 A;  2ZR4 A;  4DI4 A;  2AWI A;  5BUZ A;  1N54 A;  2BF0 X;  5BXJ A;  5CER B;  4KQZ A;  3DWL G;  4H7Y A;  3MKQ B;  3LJ3 A;  1FVF A;  3UQI A;  2V4L A;  2X6J A;  2WVI A;  2XGM A;  3E4B A;  3ENE A;  2ZR5 A;  2IJG X;  3EHQ A;  3IHY A;  4TW6 A;  2XGO A;  2DT2 A;  4UUC A;  2WM9 A;  5BV0 A;  2KR7 A;  4DRX E;  3ZHE B;  3EIQ C;  3ARW A;  1ROT A;  1LD7 A;  4G8K A;  4DX6 D;  2QYU A;  4MBG A;  3EY6 A;  3U9W A;  2J9Q A;  1Q2Z A;  2FF4 A;  5M72 A;  4ITZ A;  1FKF A;  4WWP A;  4JFJ A;  4BT8 A;  2PQR A;  1Z5S C;  1XNF A;  3LYA A;  1YA0 A;  4DIP A;  4XEI G;  3B7U X;  4P8W A;  2EIK E;  4MRU A;  3RSE G;  2ETA A;  5KNH D;  4UWL A;  1JNT A;  1EYH A;  4DRK A;  2PN0 A;  3TC5 A;  4XKB A;  3L82 A;  4FU3 A;  3DEP A;  3TG4 A;  3TWV A;  4IYP A;  2XEE A;  2C2L A;  1PC2 A;  3B7B A;  4G2P A;  1O1T A;  2XS8 A;  2X6F A;  3I4G A;  4KVO A;  3UQ3 A;  3PEV B;  3PEU B;  4GPM A;  2A5E A;  2IO2 C;  1FT2 A;  3TWR A;  2GRR B;  4I17 A;  3AU5 A;  1J6Y A;  4HBD A;  2R02 A;  1KPS B;  2LSV A;  2VGX A;  5HQ8 A;  4DWS B;  2E2E A;  5JJT A;  3UM0 A;  3TAX A;  4DT4 A;  3UXG A;  1V54 E;  2C0L A;  1JPL A;  2XPB A;  4S3J A;  2X6K A;  1QZ2 A;  2DG3 A;  3FH8 A;  1DNP A;  3PUK A;  4JEH A;  4OAU C;  2PM6 A;  3B8S A;  4C48 B;  3PE4 A;  3U66 A;  3APC A;  1GUV A;  3CLJ A;  3BQO A;  4G26 A;  2J49 A;  3CVY A;  3CHS A;  3NOC D;  4RVB A;  2BKG A;  5JHB A;  3L16 A;  2WXM A;  3CHR A;  4KYO B;  2WXN A;  2IEJ A;  1ZCN A;  3B9A A;  1DCQ A;  1M5Y A;  3BU8 A;  4AP2 A;  4I1A A;  5EN5 D;  5JMN D;  4I9C A;  3TGO A;  5HRY A;  1FKJ A;  3ZVV A;  2XPI A;  2FBN A;  4U86 A;  2DG9 A;  1ZU2 A;  3AS2 A;  3AS1 A;  3MZL B;  3T5V A;  3CK7 A;  4FLB A;  4C0E A;  1N95 A;  4EHM A;  2IOL A;  3ODK A;  1E9L A;  3L13 A;  3L17 A;  2LNI A;  2B31 A;  2X6I A;  3L6A A;  2XP4 A;  4GGQ A;  4HB5 A;  2DSU A;  2M2A A;  2I2O A;  5FIN A;  2XEN A;  1NWR A;  2RFM A;  4FJZ A;  3B13 A;  4JC8 A;  3MKR A;  4B0Z A;  5CRU A;  5CRV A;  2QF8 A;  3TXM A;  3AS8 A;  1NA3 A;  4W9R A;  4HBO A;  4XAK A;  1A7X A;  2NSZ A;  4P8X A;  1Z3Y A;  2UY1 A;  1O5M A;  4A55 A;  3MYV A;  3FXY A;  2RFA A;  2WXG A;  3JCK C;  4DRI A;  4EEC A;  4DWS C;  2AVP A;  5EDS A;  1H0I A;  1X5B A;  3D9J A;  1KT0 A;  1WDY A;  3AG4 E;  3UQA A;  3FEX A;  2WXR A;  2ZQT A;  3HDX A;  3AQU A;  3PRE A;  2FI7 A;  2KZT B;  3IHV A;  2FO7 A;  3KAI A;  4AM9 A;  5FZS A;  3EDT B;  4BET A;  1HFA A;  1OCR E;  1WAO 1;  5G05 J;  1FD9 A;  1O1R A;  4O1P A;  4HOU A;  5AEN A;  3IK8 A;  1OCO E;  5BXU A;  1Y0O A;  3DST A;  2MLX A;  5BNW A;  3EIP A;  5AJL A;  2RD0 A;  3PRZ A;  5D2M C;  2J4D A;  3LUO A;  1H2T C;  2N87 A;  5KWD A;  4UWK A;  3FH5 A;  1HH8 A;  3DSV A;  4ATG A;  5HKG A;  3ESK A;  5HW6 A;  2G8Z A;  4ACK A;  2NC9 A;  4WKF A;  3CKC A;  5D0O D;  5GQB A;  4HBE A;  2F4E A;  1TEZ A;  5JHA A;  3O5J A;  4HLE A;  3EIJ A;  4S3K A;  4JA9 A;  1BLX B;  4CDN A;  3O5E A;  3KEZ A;  4YVQ C;  4JA7 A;  3PUJ A;  5BT1 A;  2LXM A;  3CHM A;  3UM3 A;  3FU3 A;  4CYM D;  1W9P A;  3L9T A;  4CDM A;  1EHN A;  2VQ2 A;  1KT1 A;  3PZ3 A;  4GCN A;  2I6H A;  4ZFH A;  4N2Q A;  2Q5A A;  3CVN A;  4ANU A;  4C9B B;  2QC9 A;  3AAA C;  1ZBK A;  2VCD A;  2ZXW E;  4J8Y A;  2E0I A;  3CVP A;  4KT6 B;  1YMP A;  4V3I A;  1FKB A;  1IHG A;  2WK2 A;  2DWZ A;  1B6C A;  1IQU A;  3O5D A; 
#chains in the Genus database with same CATH homology
 3CVQ A;  3RGC A;  1H0G A;  3PA7 A;  3HVE B;  4JVS A;  4U0Z A;  3G6L A;  5DIV A;  2JLB A;  4N3A A;  2ZQS A;  4XI9 A;  1TJC A;  4BF8 A;  4ODK A;  3JYJ A;  3P1U A;  3OXF A;  4K0R A;  3FUM A;  5CHE E;  3CH9 A;  4DK5 A;  3NZU A;  3KAH A;  3IKO B;  4EZL A;  4D10 C;  4PS8 A;  3OTN A;  5BW8 C;  3ZIM A;  2KO7 A;  1JUQ A;  5E75 A;  3EHN A;  4EZK A;  5DIZ A;  3TG5 A;  5KCM A;  5LP0 A;  2KCL A;  4NQ0 A;  3GPK A;  4R0X A;  3QOU A;  4DZ3 A;  4GYY A;  1ZB5 A;  4TW8 A;  2D9F A;  4PS7 A;  3LVQ E;  4URK A;  4I6G A;  4RG9 A;  3AS0 A;  4Y6C A;  1ZBV A;  3CQC B;  5C2Y A;  4J8E A;  1VF8 A;  4PDX A;  3MCX A;  3KAC A;  5EX3 A;  3ML9 A;  2FEZ A;  4P8U A;  4NZC A;  2WXL A;  3FAP A;  4DRM A;  1N52 A;  1A17 A;  4IRU A;  4E6H A;  3CHO A;  1JNS A;  4J4N A;  2MLZ A;  3O5K A;  1D2K A;  1GW6 A;  3FTS A;  3D9P A;  4ILG A;  3JXV A;  1E6N A;  1JVW A;  2KC7 A;  2L2S A;  4CGV A;  2X38 A;  2RUC A;  3B9D A;  4JL0 A;  3CGM A;  4JW1 A;  2VTB B;  2XGS A;  2DCP A;  3UX4 A;  2VGY A;  3RRU A;  4IT6 A;  4LAX A;  4Z2J A;  3ZRH A;  4FN2 A;  3WQV A;  2R59 A;  3LKU A;  4IUL A;  3JQ1 A;  3SBS A;  2A3A A;  2WXP A;  4LAW A;  4JFI A;  4L7T A;  2PPN A;  2RUR A;  4DRJ A;  3SNX A;  5HUA A;  5DIT A;  4UWH A;  3MV3 B;  4WNF A;  3VTX A;  3CHQ A;  3FDH A;  3FP3 A;  1HG5 A;  3FHE A;  4GPK A;  4BFR A;  1YW5 A;  2AOS A;  4FP7 A;  4G25 A;  3SFZ A;  2DBA A;  4ML4 A;  4AOF A;  4GZC A;  3CKB A;  4U63 A;  4A3T A;  1F40 A;  4R7L A;  4OVV A;  3QWP A;  1FFQ A;  4KZ0 A;  1VDY A;  4AY6 A;  4ABN A;  3FTV A;  1H19 A;  3N71 A;  2XCB A;  1INZ A;  4I2W A;  2VYI A;  1HKJ A;  3WL1 A;  1PIN A;  4LCT A;  3CIA A;  3S7J A;  3ASH A;  5A7D B;  1FJD A;  2IQC A;  4DLQ A;  3ARZ A;  1WNO A;  2M1I A;  4QIB A;  2LAI A;  4MNM A;  1FAP A;  1QPF A;  3IKG A;  1W1T A;  2F2D A;  3ASD A;  5CMW A;  1ZL1 A;  3JUI A;  4Z2L A;  3O5F A;  5D0Q D;  3ML8 A;  3NRK A;  3O5M A;  2YHC A;  1OGG A;  3ASF A;  4CDR A;  4FHJ A;  1CTN A;  5FZR A;  4O2T A;  1ITX A;  5HT1 A;  4R5E A;  1O6I A;  4Z2K A;  1SZ9 A;  4G1T A;  1PBK A;  2MLY A;  3MA5 A;  3MGB A;  3QKY A;  4F7A A;  3TL5 A;  3WL0 A;  4QFV A;  3RME A;  5FQ6 A;  4BX8 A;  5FZQ A;  2XP6 A;  1BKF A;  4WKH A;  4U84 A;  4ANX A;  1HE8 A;  5DO2 A;  3T8M A;  3GYZ A;  4URI A;  3ARQ A;  2M63 A;  3R7R A;  3D9K A;  5LOZ A;  2CFZ A;  3ESL A;  1EF1 C;  4ODM A;  5EX0 A;  2XHE A;  3QWV A;  4YVO A;  4HAR A;  4FHK A;  2FDM A;  3H9R B;  3GZS A;  2DSV A;  3MV2 B;  2XPZ A;  1X6L A;  3Q5M A;  4A1S A;  4XZ4 A;  2KM4 A;  2MOW A;  3S7D A;  1HU3 A;  4QT2 A;  1SYT A;  4AIF A;  4JYS A;  4DRO A;  1OWL A;  4Q94 A;  3O5Q A;  4LUN U;  5FQ4 A;  2PPO A;  1ELK A;  4TRQ A;  3Q47 B;  5BV1 A;  1W1Y A;  5HW8 A;  4B8C B;  2ZQU A;  1UN8 A;  3LY7 A;  3PVL A;  4JHK A;  4J8S A;  4MSP A;  2JEK A;  2J08 A;  5KJM A;  1XGW A;  4C0M A;  3Q49 B;  2PV3 A;  3BXW A;  1QQE A;  4PUC A;  3FTY A;  2PV1 A;  2WXI A;  2RSE A;  3FEY A;  3ONK A;  4HS2 A;  1U3D A;  5B8I C;  3UQB A;  3BG1 B;  1UR8 A;  2K8I A;  3FY1 A;  1EDQ A;  4UWF A;  2UWJ G;  4TYO A;  3RM4 A;  2KFW A;  1KLX A;  2V5F A;  4PS3 A;  1HF8 A;  4DRN A;  4GA0 A;  3MKQ A;  3B7X A;  3FUL A;  4UI9 C;  1D7H A;  3RJV A;  5JJ7 A;  2VSX E;  4EQF A;  1E96 B;  2XCC A;  2UY1 B;  1UR9 A;  2LGO A;  2WLZ A;  4CRW A;  3ZYL A;  1NP7 A;  4LAV A;  1J4R A;  3ZHE A;  1UJK A;  2VJ8 A;  3CHC A;  2PBC A;  3S2A A;  1JND A;  4GIV A;  3ZPJ A;  2WLY A;  3APD A;  1JNE A;  3D9M A;  1JWG A;  5AIJ A;  2WB2 A;  1SZA A;  1NWT A;  1FKI A;  1OWM A;  4WK9 A;  2LAH A;  3QNK A;  2WXO A;  1NZN A;  4L72 B;  1ROU A;  3CSF A;  3KAE A;  3UPV A;  1EYM A;  4N5C A;  1U3C A;  1FKS A;  1E15 A;  1PAQ A;  4N39 A;  4B89 A;  4IT4 A;  2HYZ A;  4XI0 A;  4XX5 A;  4ZPT R;  3O5I A;  4I9E A;  4BWR A;  1UJJ A;  3TJP A;  3CHP A;  3UT4 A;  4DWS D;  4ZPV R;  4DWS A;  1LG2 A;  4YND A;  5GPR A;  3LXU X;  1NMW A;  4O6F A;  4BSX A;  4MNJ A;  4WAF A;  5AJD A;  2ITK A;  3L22 A;  3Q15 A;  4XKC A;  1E6P A;  4N2S A;  3DBS A;  5DBK A;  2J07 A;  3CGN A;  2WMN A;  1Q6H A;  4UI9 K;  4PTM A;  3GZ1 A;  4I1M A;  4ZPW R;  4ACL A;  4ODL A;  1Q6I A;  3FTU A;  4J4O A;  3EJN A;  1S0P A;  1WB0 A;  1HZ4 A;  3PE3 A;  4KVM A;  2IF4 A;  3CHD A;  2WM0 A;  3RO3 A;  2R17 C;  4W9O A;  2XPY A;  4HXI A;  4BY6 A;  4APF A;  3B7R L;  5G04 C;  3FU0 A;  3LVR E;  3OAW A;  1E8Y A;  4F53 A;  3CK9 A;  5FJY A;  2ESC A;  4MS6 A;  4HOR A;  3G2V A;  4OYS A;  1XRV A;  4EBA G;  2L6J A;  4AY1 A;  5A23 A;  4WND A;  1UG3 A;  2A5U A;  2X6H A;  2MF9 A;  2J09 A;  4N3B A;  4M3O A;  4Q22 A;  3G2S A;  3CEQ A;  2Y4T A;  3MX3 A;  4Z2H A;  1E7V A;  2FAP A;  4G50 A;  4TW7 A;  1OWP A;  4IPX A;  5CCM A;  1FKH A;  3WD4 A;  1QPL A;  4G11 A;  3FUJ A;  2KI3 A;  1B89 A;  2WXJ A;  4NUR A;  3CVV A;  2KGJ A;  2MHK A;  1FVH A;  2KZT A;  2I1K A;  4DPR A;  2CHX A;  1BL4 A;  3D9N A;  2OVB A;  4XIF A;  1E7U A;  1LL4 A;  3CZ8 A;  3PH0 C;  3UI5 A;  1HKM A;  3L08 A;  3QC1 A;  5ARF A;  4MLP A;  4W9Q A;  2WQ6 A;  4GAA A;  1HS6 A;  2A3B A;  4GZD A;  1W9U A;  1R9H A;  1EDU A;  2L0I A;  3O5R A;  4AY5 A;  2DT3 A;  4GU5 A;  3D9O A;  1W1P A;  1GOI A;  2IUZ A;  1LJY A;  4Q96 A;  3S7B A;  4FA6 A;  3SF4 A;  3RK6 A;  1QNF A;  3QB2 A;  4ZS6 A;  4Q69 A;  3SGH A;  3ALF A;  5DIU A;  2GRL A;  1LG1 A;  3B9E A;  1J4H A;  3D9I A;  4HOS A;  3QOK A;  3O4Z A;  1HKK A;  3ARP A;  4Z2G A;  2UZ5 A;  1P5Q A;  4EPZ A;  4UWG A;  3HVE A;  4IQC A;  4DRQ A;  1ELR A;  3OXG A;  5HI7 A;  2YQ8 A;  4AV7 A;  2KAT A;  4CT0 A;  4BTA A;  1UN9 A;  4H7X A;  4N3C A;  4NNR A;  3GZ2 A;  1Y8M A;  2OFN A;  1IYG A;  3TDB A;  4GZ6 A;  1KFW A;  4WKA A;  1SR0 A;  4ANV A;  2V8S E;  4DRH A;  3WD1 A;  1E90 A;  4G24 A;  2PI6 A;  3VAW A;  5AYW D;  3G6M A;  4MNL A;  3B7T A;  2DIW A;  3OA5 A;  4ME2 A;  5G55 A;  2YBU A;  3U64 A;  3PZD A;  4KBQ A;  4JFK A;  1NSG A;  3ZYQ A;  5J90 A;  3ONL A;  1W9V A;  4L2Y A;  2XP8 A;  1Z3X A;  4L2L A;  3O5L A;  3DPD A;  4GZ3 A;  3CVX A;  1FKR A;  3CVL A;  1K9T A;  1Y6I A;  2L0T B;  4UI9 J;  2O9O A;  4Z2I A;  1HX8 A;  3VLD A;  2WQH A;  2L9B A;  5ANL A;  2VSN A;  5G2N A;  3U4T A;  4IN3 B;  3L54 A;  3KAG A;  3NZS A;  3ULQ A;  3Q4A B;  4FAD A;  2VTB A;  2YBT A;  1IX5 A;  3ZFW A;  3PDN A;  2FUL A;  5LCW J;  3ARU A;  4HVB A;  5DEZ A;  4WWN A;  1MQS A;  3IKD A;  3SI5 A;  4B94 A;  2WPV A;  3LCA A;  4JEU A;  2CHZ A;  4U0S A;  3I6C A;  2BTD A;  2A3E A;  1L5J A;  3SZ7 A;  1W26 A;  1JWF A;  2RUD A;  3NI6 A;  2EQX A;  3RU0 A;  2DSW A;  2VGX B;  3QDN A;  4UQX A;  3ZN3 A;  3B7S A;  2J4B A;  3RRM B;  4EZJ A;  4FAP A;  4LEU A;  3KAB A;  4MPK A;  3VTY A;  2CFU A;  5T8I A;  4L3N A;  1OWO A;  3RM8 A;  5JH8 A;  3HYM B;  3ZYK A;  1FKL A;  2XEV A;  2G41 A;  4ODO A;  3PS6 A;  1HO8 A;  3WIJ A;  3FUH A;  3UUX A;  5HBF A;  1NH6 A;  4G23 A;  3OOB A;  1FKG A;  1X6N A;  3O5O A;  2WXK A;  4K03 A;  3CQG B;  4DJA A;  5HW7 A;  3O5P A;  2Y4U A;  3R7Q A;  3LDZ A;  3AS3 A;  3ASG A;  4W9P A;  1H0A A;  2WQ7 A;  3RIB A;  2PV2 A;  4AXH A;  4ANW A;  3BG0 B;  5KJK A;  4KMO A;  5FQ8 A;  5FT9 A;  1HXI A;  4I2Z A;  2KE0 A;  2XRZ A;  4DH0 A;  3NTP A;  2YNQ A;  1XHG A;  4EBA A;  4ODP A;  3FTX A;  2AXZ A;  4U85 A;  3AU4 A;  4BT9 A;  2A4Z A;  3LPZ A;  4HOQ A;  5G04 J;  3WD3 A;  3CVW A;  2XQ0 A;  3IEG A;  2IFU A;  2OOE A;  1WY6 A;  3JYM A;  4MGV A;  3PR9 A;  5ARG A;  2LSU A;  4JXT A;  3VLF A;  2KCV A;  3SHF A;  4WIW A;  1N1A A;  1ZBP A;  3SBT B;  4RG6 A;  3UI4 A;  2OND A;  3FUE A;  4GCO A;  3I5P A;  4DLO A;  1NA0 A;  2AWG A;  2I1J A;  2AXV A;  4F3V A;  2GGF A;  4W5U A;  4RSY A;  2JZV A;  1OGB A;  2XRY A;  1D6O A;  1TCO C;  3WXX A;  4CT4 A;  1T11 A;  1SQM A;  3FUI A;  4AVX A;  4KZC A;  4TUU A;  5LCW C;  5DF0 A;  2DG4 A;  3PNL B;  4LAY A;  3FTW A;  3RRN B;  4WJX A;  1E6Z A;  3LY8 A;  4BTB A;  5C1D A;  3JQ0 A;  3ZW3 A;  3ARS A;  1J4I A;  4JFL A;  2CHW A;  2WXF A;  3I4R B;  3FY4 A;  5E76 A;  5LX8 A;  3FTZ A;  3CGH A;  2LJ4 A;  4TV3 A;  2MNT A;  5KJL A;  4LGX A;  1E8X A;  3FU5 A;  3KD7 A;  4UQY A;  4B8A A;  2HM8 A;  5CCL A;  2QFC A;  2OV8 A;  2DT1 A;  3HHM A;  3QJZ A;  1EIB A;  3KZ7 A;  4MKT A;  4WWO A;  4JHJ A;  2RQS A;  2HO1 A;  2ILR A;  4GA2 A;  4J8D A;  4U07 A;  4FJY A;  1NWS A;  5A6C A;  3KAF A;  2PPP A;  4WUY A;  1HKI A;  1WAW A;  4IQ2 A;  3R9A B;  4DZ2 A;  4TNS A;  2HR2 A;  4GML A;  4HFG A;  3ARO A;  4J6I A;  1FKT A;  1IQR A;  3JYS A;  2MPH A;  2MRI A;  3ARY A;  1W3B A;  5FWQ A;  4GB9 A;  1ZBC A;  3ZXS A;  3ALG A;  2RG8 A;  4MTV A;  4U04 A;  3IBE A;  3NQP A;  2XP3 A;  3G2T A;  2VSY A;  3KCE A;  4J0U A;  1TFV A;  3O5G A;  2FKE A;  1HG2 A;  4GA1 A;  3LEW A;  3OXL A;  2PM7 A;  4WNE A;  1OWQ A;  3S7F A;  4TX0 A;  3BEE A;  2DSZ A;  4I43 A;  5D75 A;  3CHE A;  4AEZ C;  3PRB A;  3FU6 A;  4NSB A;  3U3W A;  2YHE A;  1U79 A;  4N19 A;  2OLH A;  4ILH B;  3K9I A;  2Q7F A;  3FUD A;  4BX9 A;  5FTP A;  4AJW A;  3RFW A;  3ARX A;  2BUG A;  4MNK A;  3FH7 A;  1HJX A;  1Z6T A;  3I3N A;  4F1S A;  5BPP A;  2XP9 A;  4J8F A;  5FQ7 A;  3GW4 A;  2C0M A;  4OVU A;  2WMO A;  3G2U A;  2R5S A;  3CST A;  2OVF A;  1WM5 A;  1H6K A;  3RM9 A;  2CG2 A;  4GYW A;  3PNT B;  5EKQ D;  3P2B A;  3D3M A;  2AW6 A;  3UT7 A;  3VLE A;  3G2W A;  3RO2 A;  3EHM A;  2CG3 A;  3WH0 A;  1YAT A;  3RKV A;  2YIN A;  4ODR A;  1E8Z A;  4E85 A;  4WNG A;  3TCZ A;  2GW1 A;  1RD6 A;  4DRP A;  3ART A;  3AS5 A;  3UT8 A;  1FFR A;  4P29 A;  3C98 A;  1EQ3 A;  4ODN A;  2PQN A;  4FUL A;  3CK8 A;  3UMV A;  1GPF A;  4MAV A;  4QT3 A;  1E8W A;  5HWC A;  1HJV A;  2V0P A;  2WXQ A;  2F21 A;  2XP7 A;  2IOS A;  1ELW A;  1ZU8 A;  1C9H A;  1NMV A;  5T4Y A;  3CR3 A;  3FFL A;  1D7I A;  3WD2 A;  2NXP A;  4ILI A;  3ZGQ A;  2M08 A;  4KXK B;  2X3M A;  1Q6U A;  4I6J A;  5ENN A;  1MHQ A;  5HTG A;  2ZU6 B;  1OWN A;  3W4R A;  4FLH A;  1E6R A;  1LL7 A;  3FUF A;  3FUK A;  3IHZ A;  4CEM A;  2LKN A;  1LF8 A;  5G05 C;  1HJW A;  2O92 A;  2LPV A;  2P58 C;  4LER A;  4GMJ A;  1EPU A;  2VSO E;  4U0U A;  4XE0 A;  5I98 A;  1Q1C A;  1LL6 A;  4L23 A;  1LQ0 A;  1L1P A;  4APO A;  2VN1 A;  3HIZ A;  2AXU A;  1DVP A;  3O48 A;  4QZV B;  4ODQ A;  3MJW A;  2WXH A;  3CV0 A;  3QAR A;  4A1G A;  4I1O B;  3MDY B;  3QK0 A;  3URZ A;  3FWV A;  3CVU A;  2ZR6 A;  5HWB A;  4JFM A;  2KCK A;  4CGW A;  4NRH B;  2PZI A;  1H2U A;  3LY9 A;  5CMY A;  4DI3 A;  4Y6W A;  2QY7 A;  5GPG A;  2XPA A;  5ANR A;  2XP5 A;  4JHR A;  5T3R A;  4I6E A;  3CHF A;  4G2V A;  4CCA A;  4JPS A;  4PH4 B;  1PY1 A;  3ARR A;  3LS8 A;  5LFA A;  3FUN A;  3IV0 A;  1ZBW A;  4FC8 A;  3TXN A;  3ZYM A;  3NF1 A;  1FCH A;  3AS4 A;  3UI6 A;  2RUQ A;  4GZ5 A;  4L1B A;  2LO6 A;  5J08 A;  3WD0 A;  3D9L A;  4A3V A;  5JJ6 A;  1UW4 B;  2I9C A;  1BPO A;  4NAC A;  3WKZ A;  3ZEF A;  1H2V C;  3PRD A;  3KS2 A;  4HOT A;  1ZK6 A;  3ARV A;  2ZQV A;  1HXV A;  4GYO A;  1D7J A;  2DPE A;  5J6E A;  4LRZ A;  4KR0 B;  3T5X A;  4P8V A;  3KAD A;  1NWU A;  4U8H A;  3APF A;  4UQZ A;  2Y78 A;  4C02 B;  2GRM A;  3QWW A;  1FKK A;  2PL2 A;  3QAQ A;  1OUV A;  4JZY A;  2A3C A;  2IU1 A;  5KJN A;  2ION A;  3WQW A;  2DT0 A;  1FKD A;  4Q7N A;  3UF8 A;  1TJF A;  1F8A B;  3PRA A;  3MEK A;  1W1V A;  2Y3A A;  3SD5 A;  2ZR4 A;  4DI4 A;  2AWI A;  5BUZ A;  1N54 A;  2BF0 X;  5BXJ A;  4KQZ A;  4H7Y A;  3MKQ B;  3LJ3 A;  1FVF A;  3UQI A;  2V4L A;  2X6J A;  2WVI A;  2XGM A;  3E4B A;  3ENE A;  2ZR5 A;  2IJG X;  3IHY A;  4TW6 A;  2XGO A;  2DT2 A;  2WM9 A;  5BV0 A;  2KR7 A;  3ZHE B;  3EIQ C;  3ARW A;  1ROT A;  3EY6 A;  3U9W A;  2J9Q A;  4ITZ A;  2FF4 A;  5M72 A;  1FKF A;  4WWP A;  4JFJ A;  4BT8 A;  2PQR A;  1XNF A;  3LYA A;  1YA0 A;  4DIP A;  3B7U X;  4P8W A;  4MRU A;  4UWL A;  1JNT A;  1EYH A;  4DRK A;  3TC5 A;  4XKB A;  4FU3 A;  3TG4 A;  4IYP A;  2C2L A;  1PC2 A;  4G2P A;  3I4G A;  2X6F A;  4KVO A;  3UQ3 A;  3PEV B;  3PEU B;  4I17 A;  3AU5 A;  1J6Y A;  2LSV A;  2VGX A;  5HQ8 A;  4DWS B;  2E2E A;  5JJT A;  3TAX A;  4DT4 A;  2C0L A;  1JPL A;  2XPB A;  4S3J A;  2X6K A;  1QZ2 A;  2DG3 A;  3FH8 A;  1DNP A;  3PUK A;  4JEH A;  2PM6 A;  3B8S A;  3PE4 A;  3U66 A;  3APC A;  1GUV A;  3CLJ A;  4G26 A;  2J49 A;  3CVY A;  3CHS A;  4RVB A;  5JHB A;  3L16 A;  2WXM A;  3CHR A;  4KYO B;  2WXN A;  1ZCN A;  3B9A A;  1M5Y A;  4AP2 A;  4I1A A;  4I9C A;  3TGO A;  1FKJ A;  3ZVV A;  2XPI A;  2FBN A;  4U86 A;  2DG9 A;  1ZU2 A;  3AS2 A;  3AS1 A;  3MZL B;  3T5V A;  3CK7 A;  4FLB A;  4C0E A;  3ODK A;  2IOL A;  1E9L A;  3L13 A;  3L17 A;  2LNI A;  2B31 A;  2X6I A;  3L6A A;  2XP4 A;  4GGQ A;  2DSU A;  2M2A A;  2I2O A;  1NWR A;  4FJZ A;  3B13 A;  4JC8 A;  3MKR A;  4B0Z A;  2QF8 A;  3TXM A;  3AS8 A;  1NA3 A;  4W9R A;  4HBO A;  4XAK A;  1A7X A;  2NSZ A;  4P8X A;  1Z3Y A;  2UY1 A;  4A55 A;  3MYV A;  3FXY A;  4DRI A;  2WXG A;  3JCK C;  4DWS C;  4EEC A;  2AVP A;  5EDS A;  1H0I A;  1X5B A;  3D9J A;  1KT0 A;  3UQA A;  3FEX A;  2WXR A;  2ZQT A;  3HDX A;  3AQU A;  3PRE A;  2FI7 A;  2KZT B;  3IHV A;  2FO7 A;  3KAI A;  4AM9 A;  5FZS A;  3EDT B;  1HFA A;  1WAO 1;  5G05 J;  1FD9 A;  3IK8 A;  4HOU A;  5AEN A;  1Y0O A;  2MLX A;  5BNW A;  5AJL A;  2RD0 A;  3PRZ A;  2J4D A;  3LUO A;  1H2T C;  2N87 A;  4UWK A;  3FH5 A;  1HH8 A;  4ATG A;  5HKG A;  3ESK A;  5HW6 A;  2G8Z A;  4ACK A;  2NC9 A;  4WKF A;  3CKC A;  5D0O D;  5GQB A;  4HBE A;  2F4E A;  1TEZ A;  5JHA A;  3O5J A;  4HLE A;  3EIJ A;  4S3K A;  4JA9 A;  3O5E A;  4CDN A;  3KEZ A;  4YVQ C;  4JA7 A;  3PUJ A;  5BT1 A;  3CHM A;  3FU3 A;  1W9P A;  4CDM A;  1EHN A;  2VQ2 A;  1KT1 A;  4GCN A;  2I6H A;  4N2Q A;  2Q5A A;  3CVN A;  4ANU A;  4C9B B;  1ZBK A;  2VCD A;  2E0I A;  3CVP A;  4KT6 B;  4V3I A;  1FKB A;  1IHG A;  2WK2 A;  1B6C A;  1IQU A;  3O5D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...