1OWQA

Crystal structure of a 40 kda signalling protein (spc-40) secreted during involution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNFGSERFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVPAGKIAIDRGYDIAQISRHLDFISLLTYDFHGGWRGTVGHHSPLFRGNSDGSSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGQFTKEKGTLAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords signal processing protein
publication title Crystal structure of a 40 kDa signalling protein (SPC-40) secreted during involution
rcsb
total genus 119
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2003-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1owqA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1owqA01
2DIEA 1J0JA 4YHGA 4JKLA 1PX4A 3RIKA 4WSKA 2QV4A 1V02E 2UY3A 1G0CA 4U33A 1UD5A 6TAAA 3IAPA 1G5AA 1JYNA 3AMCA 1V0KA 3GH7A 4DUVA 3A3HA 4OOUA 1TFVA 1CXHA 2BXZA 2AOSA 3NSMA 5E9AA 3THCA 4LXFA 2DH3A 1R7OA 3KWXA 5GPRA 1GNXA 1GVIA 3FHQA 2YLAA 1OM0A 3MMUA 1EDTA 3OB8A 1KR0A 3AS1A 2XUCA 1NOFA 5M17A 2C0HA 2VUYA 1UKTA 5CXPA 1G94A 3ZT7A 3ZMRA 1O6IA 3PZNA 4PMQA 1GONA 5FL1A 2EO7A 1E6NA 1NWRA 3MKKA 5ABGA 5KEZA 1LG1A 1QI2A 4AZ5A 1H2JA 5FIPA 3SCQA 4PEEA 2OWWA 3FY1A 3L4YA 4JZ5A 1FFQA 1UQZA 2YBUA 1B1YA 2HVMA 3CIVA 4HOZA 1G1YA 2XM1A 1ITCA 1EOMA 1XGZA 3TTSA 1WDPA 2WZHA 2DH2A 1JFHA 3N9KA 3PZQA 2VURA 4QP0A 1E9LA 1FP8A 3VD9A 1UZ4A 4H8VA 3W4RA 1LG2A 1AQMA 4JKKA 1R86A 4H2CA 3VOCA 5KZ6A 1V0NA 2X05A 1UHVA 1WZAA 2J78A 3K1DA 3QOMA 1E1FA 5EB8A 1EQPA 1W1PA 3FNDA 3WQWA 2EPMX 1NP0A 1UG6A 4XZWA 2PB1A 2VZOA 5CQ1A 2J7DA 5DEZA 2G3IA 1DHKA 2J75A 3ARQA 1B3VA 1EO7A 4U31A 5A6SA 3IJ9A 4LGXA 5A95A 3PTMA 5LA1A 3CMGA 1CENA 5AY7A 2J77A 2ZXDA 4MB3A 3WSUA 1J12A 1UD3A 1E0WA 5A69A 4OUEA 3EYPA 3K4AA 5A8PA 2V38A 3D3AA 3VIFA 3VIGA 2PI6A 3WBAA 4JFUA 1KXTA 2YL5A 2YOCA 2CHOA 3SEPA 3CMJA 2VX5A 3HN3A 4UFMA 4QFUA 1P6WA 4FF5A 3VGDA 1EDQA 2D0FA 2WKGA 3EDKA 5TD4A 3ARZA 3GXFA 2X09A 1NOWA 3O2LA 4W8AA 4R27A 4TVUA 1W91A 1LWJA 1M04A 4GQRA 3MUIA 1EHAA 1UKSA 3WL1A 5BXPA 1Q6EA 3SURA 1OIMA 4Q22A 2BNJA 3MSDA 1Q6CA 3E1F1 3U5UA 2X2YA 3CLWA 2XVNA 5IXEA 2D20A 1UH2A 3MO4A 4BQ3A 1OT1A 4TTUA 3B8SA 4J27A 3VIMA 1QNPA 3AQUA 2VVNA 4JAWA 1UH3A 3GNOA 3W53A 1JZ8A 1BYDA 1HT6A 3PTQA 1ISXA 5FOOA 5A6JA 3M07A 4V2XA 4GINA 3MMDA 2YA0A 1LL4A 3RJYA 4AD3A 3VGHA 3W6LA 1K9DA 2QHAA 1L0PA 4H8HA 2VCCA 5D4YA 4AD4A 1W32A 3AICA 2BY1A 2WLZA 4GQQA 1KCKA 5D9MA 1HJQA 1W9DM 1L8NA 3WH6A 2WSKA 4M82A 2QMJA 1W2PA 4AZBA 4FK9A 1UWTA 2Y5EA 3BAWA 2CITA 2WHKA 4NSBA 1FFRA 2JF7A 2ZUNA 2W5FA 3VDBA 3GDBA 4MJ2A 4AD1A 5I79A 2VQUA 1E0XA 2E9BA 2ZX7A 1UA3A 3SCPA 1E6XM 5A94A 3GH4A 4AEEA 1MXGA 3BH4A 1OINA 5DFAA 3TA9A 3VKKA 4AMCA 3WUFA 1E6SM 3MUY1 4JFTA 3BCDA 1XSKA 3AZTA 4B9YA 7TAAA 3AIUA 1BVZA 1MYRA 1V3MA 1JZ4A 2BXYA 2DDXA 3AHVA 1KGUA 4D72A 5ABEA 3WD3A 1XHGA 2V5DA 4CN4A 1E70M 2O92A 3M6DA 4TUFA 2WSPA 2GK1A 1G9HA 4GXPA 4UOZA 2QPUA 3CZJA 2WM0A 2VQTA 1E73M 2WHLA 1NWUA 4CD4A 4HU0A 1HKJA 2CBJA 1UWIA 1V6WA 3IJ8A 3OGSA 2E9MA 5C70A 1WZKA 2WW5A 3PTKA 2GJPA 2EEXA 1V3IA 4CKQA 4W8LA 8A3HA 3K46A 2WCSA 1M7XA 2V3FA 2WMIA 5C8BB 1TZ7A 4U3CA 1US3A 5GNXA 4MDOA 1ZJBA 2PBGA 3CHDA 1XC6A 4CU6A 4JFWA 1VRXA 1E0VA 1GOKA 1UD8A 3ZSTA 4J3TA 1UWRA 1H41A 4W8BA 3WQ8A 2GSJA 2YBTA 4ZXLA 2GDUA 2DGAA 3W25A 2BVYA 3WNPA 1Q6FA 3RM8A 4IISA 1JF5A 1JZ7A 2NSXA 4DWSB 1GJWA 5CSYA 4EKJA 2E8ZA 2Y24A 3OLGA 2G4FA 4AZGA 2XIBA 4D6GA 3GYCA 1U30A 1MFVA 4KWUA 1KWKA 4UQAA 1UD4A 3NCOA 6A3HA 1GOMA 1JD7A 2QPSA 3DHUA 1CGUA 3UETA 1QI3A 5FKYA 3W28A 3WD4A 1VFOA 3ZR6A 4W89A 3UCQA 4H8UA 2WB5A 1A47A 3ZM8A 3CGTA 3T08A 4AIEA 4C7FA 4A4AA 4HMCA 1FHDA 2YDQA 2W63A 4UTFA 1CGWA 4MTVA 4OZOA 5GNYA 2ZUUA 3ZSSA 2WXDM 1QOXA 1ESWA 1W3HA 4N42A 2EPOA 2CYGA 4PTXA 3VIJA 3QHNA 2J62A 1OD8A 1HKIA 1VEOA 4AD2A 2J8FA 5DT7A 4F9DA 1J0ZA 1J18A 2Q8XA 2O9TA 3AS3A 2VZSA 2C8NA 2J47A 3ARSA 4BA0A 3NIYA 2ZE0A 3WD2A 1SYTA 4JCLA 4UQCA 3KL5A 2XWEA 4CVUA 4PUEA 3RCNA 4YHEA 3CUHA 3JUGA 4W5ZA 4XV0A 4AC1X 5A8MA 1XD0A 1X1NA 2XGBA 1VFFA 3WBEA 4PTMA 5BROA 3CUFA 5AC4A 3L2LA 5D9NA 1JF6A 1E3XA 4GO9A 1F4AA 1W9VA 1XD1A 1WAWA 2CEQA 1XYZA 1WPCA 5JBFA 1GQIA 2ZX5A 3N18A 4KMQA 4GZJA 2EXOA 1XSJA 2NT1A 4PMRA 4S3KA 4HZ8A 4HMDA 4HA1A 3AIWA 2IXUA 1E72M 4PSRA 2BY2A 8CGTA 2YLLA 1NWTA 1E43A 1J10A 1H1NA 1HVXA 1GUVA 2WBKA 3F5LA 4QDMA 1QHZA 3VU2A 1B3WA 1OCQA 3WH5A 5CPSA 3N04A 4PMYA 1OGSA 3VO0A 1E5NA 1QI5A 1AMYA 1EOKA 2WAGA 1FA2A 2BV9A 3BSGA 4WKHA 3ZQ9A 1TMQA 4CVWA 4TTGA 3OGVA 4RL3A 1BGGA 1JDCA 2VR5A 3BMVA 3L4UA 3SCTA 4MPKA 4LPCA 1B90A 1C93A 5HBFA 4PMUA 1SMDA 1VBRA 2JE8A 1MW3A 2F2HA 1MW1A 2XHYA 2EBNA 1BHGA 1E3ZA 1H49A 4M29A 1JI2A 3RM4A 1EIBA 1VJZA 1V6XA 1M01A 3OIHA 3EBVA 4HPHA 1JNEA 5FCZA 1BVNP 3LMYA 1AQ0A 3VGFA 3WF4A 3T2QA 1JI1A 2WVUA 1H11A 2DT2A 2CCRA 1GHRA 2F8QA 3AFBA 5GNZA 4BS0A 3SCUA 4EK7A 5A6LA 3WF0A 5JBEA 4JFVA 4NI3A 1GZJA 5A6BA 2FH6A 1MQRA 1BYCA 2G41A 2JFEX 4ZXOA 2J7HA 2OLHA 1CYGA 4OKDA 1EH9A 1BTCA 3T0BA 1FOBA 1FH9A 2GUYA 3AMGA 2VR4A 1J0YA 1JXKA 1V02A 2E3ZA 2WWCA 5EBAA 4Z2IA 4ZENA 4CN6A 3HJEA 4MB4A 1OGBA 3TTQA 5E70A 4PRWA 1MWOA 1ITXA 1PPIA 3WNNA 4BQ2A 1PBGA 1EHNA 4D6JA 4FLRA 1EGZA 1KXQA 2QF8A 1QHPA 4AZ6A 4OBSA 2WANA 4XX6A 2VX6A 3DYPA 2VRJA 1RD6A 1C92A 1TE1A 4NRRA 1Q6GA 1H09A 2J7GA 4WF7A 3PZTA 2G3JA 2XVLA 2IXVA 2WVVA 3VX0A 4M8UA 1FH8A 4BQ5A 3TP4A 3W0KA 1LL6A 3WUEA 1CGTA 3GZAA 7CGTA 1B2YA 1CLVA 1V3JA 5BXTA 4JL1A 2F61A 1ISVA 2YJQA 2DIJA 4TX8A 2J25A 4MNKA 1GQJA 5HXMA 4HA4A 1VJSA 2J4GA 1NWSA 1B30A 2VVSA 4U3AA 1C8XA 2XFFA 2D22A 3TTYA 1MQQA 1WZLA 4J28A 3WDIA 2ZUVA 4V28A 3ZOAA 1K9TA 2BY0A 3WEMA 1IT0A 2XWDA 1QI0A 1CPUA 2ZOXA 1UR9A 2PWHA 5EFDA 1HP5A 1S46A 3AISA 1VAHA 3VILA 4S3JA 4CD7A 1H4PA 2ZUTA 3ZJ6A 2CIPA 3VIHA 1JAKA 2DSVA 1OD0A 1DWIM 1J0HA 1BFNA 1UR4A 5A8QA 4GO8A 4KH2A 2GJXB 4V27A 2WHJA 2WMGA 1UWUA 1F4HA 1R87A 4UZUA 2OWXA 4J3WA 2YDRA 2WCGA 3CO4A 2ZX9A 2WVSA 3K8KA 3AYRA 1KR1A 5I0DA 5JUVA 5FL0A 2HISA 5JIPA 3BC9A 3WQ6A 4MNLA 4U2YA 2CBVA 4XZBA 2FHBA 1YQ2A 2RGLA 2YA1A 1OIFA 1DWJM 1JFXA 2BVDA 3WDJA 1V3KA 1CTNA 4GZEA 4AZCA 2D0HA 3A4AA 1CBGA 3VGGA 4UQEA 2VZUA 4RE2A 1CXKA 4E4PA 2EJ1A 1IZJA 4H04A 1GCYA 2G3NA 3K4DA 4D1IA 1V03A 3AI0A 5E6YA 5CLWA 2WCAA 3LPGA 1V6VA 4GPNA 1VB9A 3WL0A 1XCXA 2CBUA 1UWSA 1NOUA 1HN1A 1WO2A 5E0FA 1ZB5A 3CUIA 1A3HA 1E6PA 1JZ2A 1V6YA 1Y7VA 1MVYA 1LLOA 3W6MA 5IFTA 5CPTA 5I78A 1X6NA 4ZFMA 2PWDA 4HMEA 1K9EA 1OGGA 1C8QA 2XTKA 3QOKA 1H0IA 3VM5A 2VX4A 3THDA 3WMSA 1WDRA 3PBGA 5A6AA 1BQCA 2PWEA 2J74A 2DEPA 4AY1A 1US2A 2VCAA 4KRTA 2CERA 5I3DA 2PWFA 1V3LA 1KB3A 2YDSA 4Z2HA 3AZSA 4Z2JA 3M46A 1PJ9A 4U5KA 3T0DA 4E8DA 2W66A 2VI0A 3GXDA 4C7DA 4KRUA 3VGBA 1XRVA 4RE4A 4OOZA 4IUGA 3GH5A 1GQKA 2VX7A 2E9LA 2WPGA 3WDQA 5CZKA 2GK1B 3BMWA 1ODUA 1UH4A 3VIIA 4DWSD 3WQ5A 2D3NA 1QNSA 4ATDA 5AYIA 3RM9A 4ACZA 3SCRA 4GIAA 1BAGA 4FLOA 3ARUA 4B3LA 1LJYA 4W93A 3PN8A 5BXRA 4AD0A 3AIBA 5A2CA 1B9ZA 4PMNA 1E6RA 4JHZA 4HP5A 3WUBA 4P8VA 3WD1A 4PN2A 3DYOA 2WMIB 4JKMA 4TVCA 4M24A 3NJ3A 1DP0A 4FLSA 3KE0A 1TA3B 3PZVA 3FAWA 1KBBA 2B31A 4LX4A 2JEPA 3GNRA 3VD7A 1HVQA 2GDVA 4OJYA 1KBKA 2WMHA 5D9PA 4JFSA 1R7AA 3PZ9A 1QW8A 4UFIA 3WNKA 4UCFA 3OLEA 2WKLA 4DUXA 1V0MA 2DSZA 2DSKA 1Z32X 4ZEPA 3TONA 3GXIA 3S6TA 2OYKA 1J11A 3G6MA 4QLKA 4CCDA 4U5IA 1JYXA 1E71M 5HOSA 2EPKX 1UWQA 1HL9A 2Y4SA 1W1TA 4ML4A 4W7VA 1JYWA 2XSBA 3VUPA 1NP2A 2D24A 3WEOA 3BAXA 3NSNA 3WF3A 1NM9A 5BRPA 1HKMA 5CSUA 1C7TA 4CUCA 3T2PA 4Z2KA 2Y8VA 2XPKA 3TOPA 2A3AA 4ATLA 3W37A 4M80A 3AZRA 1LQ0A 4RE3A 2D2OA 3ZIZA 3OZPA 1W2VA 2AMGA 1JL8A 2WNWA 2DSUA 1VFUA 3WY1A 3ARYA 1VF8A 4UNIA 4D6EA 2J7EA 2W92A 4F66A 9CGTA 1JD9A 4FLQA 4E2OA 1HJXA 1JNDA 3F5KA 4IPLA 1HJSA 4MNMA 1DTUA 3BCFA 1X6LA 3IK2A 3NDYA 3UESA 4D6DA 3MSGA 3W26A 1EQCA 1UZ1A 2ZUMA 4TXEA 3VVGA 3BLKA 4Z2GA 1XH0A 4DWSC 1ZBVA 1KXHA 1D7FA 2G3MA 4PMXA 2CKRA 2E4TA 5M03A 5BXSA 1ZU8A 4QCEA 1CIUA 2G8ZA 1WNOA 1GHSA 3WQ4A 2WBGA 1K6AA 1GVYA 4P8XA 1E1EA 1CXIA 2X0YA 1DEDA 1V3HA 3W27A 2J8GA 1UKPA 2ZWYA 5BWFA 2CHNA 2BFGA 5LA2A 2IUZA 1ISWA 2ZUSA 2CBIA 1W3LA 1I75A 1HJVA 1HNYA 1H0GA 1HF6A 4DM1A 3U7BA 2CESA 4UOJA 1EO5A 4D71A 1VBUA 4HZ6A 1KGWA 1VIWA 4B9ZA 3UG4A 5ABHA 4AXNA 3RILA 4M56A 4CCCA 1E56A 1C91A 3WUGA 5A8NA 2VOTA 1BPLB 2JF6A 3FXYA 1UKQA 3WD0A 3NYDA 1M03A 3AIEA 3S2CA 3AXXA 5ABFA 1BG4A 3K8MA 5HPOA 5A2AA 2UY4A 1JDDA 1QHOA 3MUZ1 5DMYA 5E0CA 1TG7A 3KL3A 1G01A 4J3SA 3L4XA 3WENA 3HU7A 2EPLX 1VEMA 1U33A 3MMWA 4W86A 1E6QM 2CETA 2XVKA 2VL4A 4MAZA 4AZHA 4QLLA 2PBOA 4GKLA 3WFZA 1WCGA 2XVPA 4PTVA 1W1VA 3ARXA 4EE9A 2JEQA 1JAEA 2W62A 4QCFA 4P7QA 2VJXA 3EDJA 3SCVA 2WMFA 2PWGA 3VIOA 4B3KA 3EDEA 3BAKA 4GI6A 2WMJA 1MQPA 5FD0A 3AHTA 5ECUA 3N13A 3VDAA 1J0IA 2DT1A 3AMKA 3U7VA 4PTWA 4X0VA 3G6LA 1SFSA 1QNRA 1FH7A 3N1AA 4D6FA 6CGTA 3FN9A 4AISA 1TR1A 4IPNB 2WWDA 4AIOA 1CWYA 2CXGA 1UYQA 2OYMA 2Z1SA 3VMPA 3NUKA 1K9FA 2XFYA 2OSYA 2WVVB 3U5YA 3VD4A 4WK9A 1JG9A 2BHYA 5I6SA 2VRQA 3FW6A 1UR8A 3DYMA 1GJUA 3T2OA 3IANA 3AIQA 4LYPA 2DPEA 1W9UA 1BLIA 1W9BM 4ATWA 5EFFA 5LYRA 2WK2A 1C3FA 3O9NA 2XJ7A 3CTTA 3MU7A 3BAIA 3WN6A 4MADA 3I3BA 1WDSA 2XYLA 2ZICA 4TX6A 3SCNA 4JL2A 2FHCA 3WDPP 1CXFA 3UERA 4H7VA 3OBAA 4P7NA 3ARVA 3HMCA 4PMOA 2ZUWA 3WFLA 2VTFA 3CH9A 2GJRA 1IV8A 4L4OA 1NQ6A 2DQXA 1HKKA 4PMZA 3CHFA 1XSIA 3AIVA 2UWFA 1TUXA 1JXJA 3QHOA 5JIWA 4HZ7A 1XH1A 3W81A 1UOKA 3WMCA 1M53A 1D2KA 3VMNA 2YL8A 3N11A 1JDAA 1ZBCA 4MAVA 2V5CA 3TTOA 4ZE5A 1UR1A 3AXHA 3IAQA 1XH2A 2OSXA 4WJXA 3PZUA 2OSWA 1GOWA 2CPUA 2EPNA 1V08A 3A47A 5I77A 1FP9A 5BRQA 1GOOA 3CZLA 4HA3A 2CKSA 2Z1KA 1BYAA 1GPFA 3AOFA 2VCBA 2BHZA 4PMVA 4J3UA 5EMYA 4UQ9A 2W61A 1BGAA 4IM4A 4AZIA 4CU8A 1ZL1A 5BCAA 3AMDA 4AZCB 1CGYA 5IDIA 3BGAA 4HPGA 3VM7A 4HU8A 3AS2A 2TAAA 4AWEA 1HJUA 4CGTA 3AJ7A 2FDMA 3W38A 5I5RA 1OBAA 4J7RA 4BF7A 4LYQA 3AXIA 3POHA 3SCWA 1DWHM 1MW0A 4J3VA 3WDHA 1E4IA 5CPQA 4UR9A 1XYFA 3SUSA 1VEPA 1U2YA 2YL6A 4DUWA 3A4XA 3RJXA 3AHYA 3WH8A 1C8YA 4F79A 1ODZA 5C71A 1GW1A 4UFJA 4PBGA 3IJ7A 3CZEA 3QGVA 1WZMA 1UA7A 4GI8A 3CZKA 3WH7A 3BAJA 4W7WA 2ZIDA 3CUGA 3KEHA 5F7UA 3AHXA 1GOIA 1E4LA 1ZS2A 4Z2LA 4BQ4A 5A6MA 1H3GA 1ZBKA 1Q6DA 3EMZA 5E09A 1ZJAA 2ZXBA 2E40A 3GXMA 3SIMA 3GBEA 1VFMA 5DO8A 1RH9A 1JIBA 4MB1A 3VIKA 3MV01 3ZJKA 4GZIA 4D6IA 1J0KA 2AAAA 1TVNA 1B3ZA 1HXJA 4AYSA 2OYLA 4J3XA 3ALGA 1CDGA 2FGZA 1MFUA 3OGRA 1C90A 5D9OA 2W67A 1D3CA 3EMCA 3VIPA 4NRSA 3MV11 2WHMA 3SUUA 4W5UA 1E40A 3SUTA 3MANA 1J01A 1BF2A 4N0RA 4UOQA 1E5JA 2VT0A 5JH8A 4KGJA 1TCMA 4ACZB 1JZ5A 3WF1A 1WP6A 3RMEA 3K8LA 2DSWA 1FHLA 3W24A 2JIEA 4Y7EA 5HPCA 2E8YA 3AROA 4CD8A 2VO5A 4QLJA 4HTYA 1XCWA 3DHPA 1PZ3A 3M7SA 4YN5A 4HOXA 4EAMA 5LA0A 1CGVA 3CHEA 1OT2A 3I3EA 1WDQA 1O7AA 3VPLA 5HNNA 3LPFA 2FH8A 2J79A 3RO8A 4AW7A 4W87A 2D23A 4B15A 3NSXA 2W4XA 2GJXA 3RDKA 3FAXA 3L4WA 4PUDA 3J7HA 2ESCA 4P8UA 2V3EA 5GQBA 4FMVA 1AVAA 3F5JA 4WLCA 1PZ2A 4UQBA 2XIIA 4GI9A 1B31A 4CCEA 1CGXA 2CNCA 2XGIA 1KGXA 2VNCA 2A3CA 2WZEA 1NARA 1QBBA 1QBAA 1LWHA 1W9XA 2FGLA 3WF2A 1WKYA 2YKKA 1RP9A 1PX3A 5D8ZA 3KL0A 1PEZA 4LYRA 1GQLA 5AC5A 1RPKA 1WB0A 3VX1A 3VDHA 3WNOA 2BY3A 5E6ZA 3ECQA 3WMBA 3WNLA 3VMOA 4KGLA 2Y8KA 4W85A 1C7SA 1VENA 4C7GA 3AMLA 2A3HA 2MANA 2XM2A 4P7RA 1PIGA 4F9JA 1R85A 3PZMA 2BVTA 2D3LA 4MB5A 3SCSA 4JIEA 2WLYA 2UY5A 1W1YA 5A3HA 1I1XA 4AEFA 4JCMA 2DT3A 3WQVA 3N17A 4URIA 2JIWA 2ZXQA 1W3JA 1H5VA 4W7UA 4LQ1A 3OG2A 2UY2A 2QLYA 3SUWA 4YPJA 3DECA 1B3YA 3UG3A 3UG5A 3F4VA 2BHUA 5I23A 4P8WA 2WYSA 4UFHA 1IZKA 4MJ4A 4A3YA 3BXWA 4W84A 1CEOA 3D5HA 3NDZA 1ECEA 3APGA 1BSIA 1DWAM 4ZE4A 4F8XA 1RP8A 4X0NA 5A8OA 5IHSA 1CECA 1V6UA 4E8CA 2GFTA 2YIHA 3L4ZA 3PZIA 4JHOA 3SCOA 1OSEA 3QR3A 3W29A 3WDRA 1BG9A 3VD3A 2WVTA 4WIWA 4D6HA 3WEZA 3O6AA 2VRKA 4AD5A 3ARPA 4QAWA 2QMKA 4HOWA 2E0PA 5A6BD 1W9PA 1NH6A 1I1WA 3B9AA 2J7BA 3VGEA 2A3BA 2X0HA 3UR7A 1DWFM 5D8WA 5ABFB 4D1JA 2NT0A 1LF1A 3CUJA 5A1AA 1CXEA 3WNMA 1CZ1A 2XFRA 3VNYA 2WC3A 5DT5A 4AZ7A 3T09A 1OWQA 1Q4NX 1TA3A 4XUYA 1MXDA 3ZT5A 3VDCA 1SR0A 1MW2A 4L4PA 3L2MA 1UD2A 3VD5A 1QW9A 5M3WA 5DF0A 4PSPA 1KWGA 3ARRA 4BZYA 3EDFA 1KCLA 1BYBA 2FHFA 5IHRA 1PAMA 1E55A 3KZSA 1EA9C 3WIJA 4PMDA 1UD6A 3OLDA 3PZOA 3U57A 3VINA 2RGMA 3ZR5A 4WKFA 2JALA 5AYBA 4CD6A 2OWCA 2J7CA 1JZ6A 5I2UA 5BYWA 1PIFA 1HIZA 1HJWA 4BCEA 3OLIA 1ISYA 1EXPA 3CBWA 1KQZA 3OZOA 3UR8A 3AHZA 3LPPA 4PYSA 1UR0A 3AIRA 3OA5A 1R8LA 4K68A 1UUQA 2NW0A 3VNZA 3L4VA 7A3HA 4D6CA 4TVDA 2X8RA 5A2BA 2ZX8A 3DC0A 3A4WA 4X9YA 2DT0A 1GOQA 2BS9A 2VC9A 4DM2A 1E6ZA 2V3DA 3N12A 4B16A 1LL7A 4P7LA 2D0GA 1EDGA 4CD5A 1SMAA 1DWGM 3QHMA 4XB3A 3WH9A 3ZJ8A 4OIFA 1QPKA 5CJ5A 1J9YA 4UFLA 3VTRA 3WKZA 4OBRA 2XSAA 3FHAA 3LPOA 1UQYA 4W88A 4P7OA 1CXLA 3SUVA 3I3DA 4H41A 4ACYA 1B3XA 4AIUA 3ARWA 4WKAA 1V0LA 1WE5A 2ZWZA 3T0AA 4M81A 2O9PA 1JYVA 4UZSA 4MDPA 2ZX6A 2VZVA 5CGTA 1OB0A 4DWSA 4PCSA 2WZIA 2YL9A 2GVYA 4CN1A 4UFKA 5HDRA 1YHTA 2WC7A 3CPUA 2EQDA 5JBDA 1W3KA 4TOQA 3B9DA 5I24A 3AYSA 5M5DA 3CHCA 3PZGA 1ZBWA 2XVGA 1QNOA 1UR2A 2X1IA 5CLTA 3W82A 2ZXAA 1ISZA 3MS8A 2V3GA 1HL8A 4UQDA 3AS0A 3ZJ7A 3GTNA 1N82A 2PC8A 3ALFA 4Q7NA 2WC4A 4EANA 2VMFA 3B9EA 1CNVA 1QNQA 1XV8A 3EDDA 3GM8A 3ARTA 1HP4A 5CG0A 4NZCA 4R5EA 1E4NA 1PX8A 3WELA 2A3EA 2C7FA 1KFWA 2WMKA 2W91A 1B0IA 1JGIA 1KXVA 4PCTA 3CZ8A 2PF0A 3PHAA 3CZGA 1TVPA 4MNJA 3BLPX 1JZ3A 2O9OA 3II1A 1QI4A 1E4MM 2O9RA 4CU7A 3MUAA 3ZO9A 2VZTA 3GNPA 5CGMA 3RPMA 3POCA 4NF7A 4WSJA 1HX0A 1E15A 1KQYA 3ZT6A 2Y2WA 2XG9A 3EMQA 3GBDA 4U2ZA 2J7FA 3L4TA 3A6OA 3BSHA 4A3HA 2D1ZA 1GORA 4M1RA 1QVBA 3N15A 1AQHA 3BAYA 1CLXA 1UKOA 5IFPA 5A6KA 3UEQA 2YA2A
chains in the Genus database with same CATH superfamily
2DIEA 5FEXA 2WQDA 4L3NA 1PX4A 1VHCA 3RIKA 3MKVA 5GJMA 4WSKA 4IXHA 1V02E 2WJZA 1UD5A 3HPAA 4IG2B 3LHVA 4Q33A 3A3HA 1EX5A 1TFVA 5LNSA 4FNQA 2XP7A 3MDUA 2NX9A 3BZGA 5G1TA 1NMWA 1LLWA 3OZMA 3KWXA 5GPRA 1GNXA 2VWSA 2HSAA 2YCEA 5BOOA 1EDTA 3OB8A 1M7PA 4H9UA 3AS1A 2DP3A 2Y7EA 4G2DA 1O5RA 1UKTA 1Y5WA 1XIDA 3ZMRA 2F23A 3QPZA 3PZNA 1EB3A 3EXSA 3LMZA 3IVUA 5ABGA 5KEZA 1Q13A 1LG1A 1F3EA 1MDRA 1QI2A 3CAVA 1KBJA 4WX2A 2YZRA 3GG8A 4JZ5A 2HVMA 3CIVA 4Q8PA 4HOZA 3KFTA 1ITCA 3WBWA 3NQBA 4HKPA 3TWAA 3Q65A 4DIPA 1XPGA 4QRNA 1B4EA 4M19A 1PZ0A 3TXZA 1HQTA 1LG2A 5E93A 4JKKA 1R86A 2V5JA 3W7RA 4J40A 3QOMA 1G6CA 3URNA 5EB8A 3SFWA 3E0LA 4RKAA 1W1PA 2EPMX 4K2SA 4HIBA 4UTUA 3R94A 3ID7A 5CQ1A 1M5YA 2SFPA 2J7DA 5DEZA 3UF9A 3ARQA 2EHHA 1GJPA 5AVHA 5HQEA 1XXXA 2G95A 2W0UA 2J24A 3MT1A 4JTUA 1BD0A 4LT9A 2DUXA 3N4AA 2YGYA 5AY7A 4TMBA 1V4YA 1FWRA 4MB3A 2DZTA 2E67A 4L72B 5A69A 3EYPA 3FYYA 5KINA 4H2HA 3K4AA 2K8IA 4YYCA 2CZDA 3WBAA 4ZOAA 2YL5A 2YOCA 2CHOA 3CMJA 4DRPA 3HN3A 4UFMA 2NV9A 4QFUA 4MY8A 4FF5A 1FWHC 5D09A 1SU5A 1EDQA 1OK6A 2WKGA 3HURA 3ARZA 3W1MA 2ZDSA 3N4FA 2X09A 4NJJA 3TN3A 5C5YA 3DFQA 1S5WA 1EX1A 4L4MA 3VKBA 2F2DA 3U2EA 4ENLA 2E1WA 4MWAC 3WL1A 5BXPA 2GOUA 4H7CA 3REQB 6ALDA 4JS3A 1Q6CA 3OZYA 2JQXA 3WLKX 3DEQA 1IEQA 4MYXA 3B8SA 2ZRWA 3D46A 3CASA 2AQWA 3AQUA 4Q6JA 1AD1A 1UBPC 4OT7A 3OOBA 1UH3A 1LUCB 2PDPA 4L65A 1BYDA 2C91A 1GG1A 1XIFA 5A6JA 4V2XA 5U7SA 4GINA 2PV3A 4XVDA 1LL4A 4AD3A 3W6LA 4HYRA 2PZ0A 1RUSA 4B5WA 4EXBA 8XIAA 1L0PA 3N73A 5D4YA 4AVNA 3SRKA 4MZ1A 3V35A 3G22A 4EP8C 4EX4A 1SR9A 4GQQA 3KACA 1FCBA 4BWLC 4YJ5A 1PB0A 5DIVA 3WH6A 4OTKA 1XIBA 3BGGA 4AZBA 1N1AA 2Y5EA 2R91A 2P0IA 2Z1BA 2R24A 2PV2A 2DZXA 2W5FA 2NUXA 2XIJA 4MJ2A 1E0XA 1UA3A 4WGXA 3SCPA 5A94A 2C16A 4AEEA 1MXGA 4RCXA 2HXTA 3FOKA 5HTGA 2Y62A 3I6CA 4Q8NA 1G69A 3BCDA 1GTEA 1JCLA 3LSBA 3UT0A 1BVZA 1JZ4A 3OHMB 3KBSA 4XD6A 4QM1A 5ABEA 1Q8JA 4CN4A 2O92A 3P60A 2GK1A 1G9HA 4OUIA 3MI2A 2WM0A 1E73M 3ITCA 1YXYA 5I06A 3KBVA 2Y88A 3C5QA 1OFPA 1EJRC 3PTKA 3KCEA 4C6NA 1V3IA 5CSSA 4QIBA 2PDQA 4W8LA 3TYDA 1XG4A 2QF7A 2WCSA 1D7JA 2WMIA 5C8BB 2ISWA 3A12A 4CU6A 1E0VA 4Y90A 2RUQA 1LORA 1UWRA 5F1VA 1H41A 3V16A 6XIMA 3L68A 2PP1A 3O8AA 5H91A 3VC5A 1F3XA 1S1PA 2DGAA 3TK7A 4S38A 4LUSB 2QCMA 4JTQA 1TZZA 3ORWA 1TWSA 4IISA 5F4SA 2PFHA 4U84A 1JF5A 1HW6A 4DWSB 5CSYA 5GJNA 5B7YA 2FFIA 4AZGA 4A21A 1AZ1A 1TIMA 1FXPA 1I2OA 3IIPA 5CJNA 3H4GA 2GGHA 2C15A 3PPFA 2VFGA 3JYMA 3QC3A 1UD4A 1SVDA 4ERIA 2OEKA 1JD7A 3O16A 5AVNA 1D3HA 1QI3A 4ZPVR 2ZZ7A 3ZZ1A 2Y85A 2X42A 2PTWA 3T08A 4AIEA 4QEHA 1WDDA 1FHDA 4LH8A 1XINA 1VH7A 3XISA 4UTFA 2ZUUA 3ZSSA 3RAOA 2FKEA 2WXDM 5JH2A 3MB9A 1ZSXA 1GYNA 4GG9A 5CKSA 3W1AA 1HKIA 2HE5A 4AD2A 2KAUC 3I7RA 3SAZA 3P62A 3AU2A 3DFTA 2J47A 1VCGA 3DC8A 3ARSA 1DIOA 1EC8A 3BW4A 3W7DA 1DJHA 1EYWA 3NPXA 4JCLA 4G56A 2XWEA 4CVUA 4YHEA 3CUHA 4W5ZA 4AC1X 1EJVC 5A8MA 2NX1A 3SN0A 1XD0A 2XGBA 4MUZA 4PTMA 4C6DA 5AC4A 1JF6A 3VUSA 5BNKA 4F0HA 3DFOA 3WJWA 1W9VA 1WAWA 1Z6KA 2FLIA 2CEQA 2ZZ3A 5JBFA 2ZX5A 5KZDA 1HKVA 4KMQA 2Z7GA 2ZVRA 3PULA 4GXWA 3ABSA 4Q8TA 4HSHA 4S3KA 1YW1A 1N8FA 3TQPA 2IXUA 2BY2A 4CNTA 1R3YA 1NWTA 2QUTA 1HVXA 5TF0A 5AC6A 3F5LA 1QHZA 4LUTA 3ABXA 1M3UA 5CPSA 3N04A 4PMYA 2J9YA 3VO0A 3WLTA 5T9CE 1AMYA 3M0ZA 2WAGA 1FA2A 1NJJA 3IRSA 3VCRA 3RPTA 1TMQA 4TTGA 3VE9A 2C18A 4JTAA 4RL3A 3IRDA 3C61A 4QS5A 3BMVA 3UD6A 2ISDA 5T9BG 4IICA 3L4UA 3SCTA 3PPCA 3MZNA 1FWIC 1C93A 1V77A 3CWOX 2P76A 1TPVA 1SM9A 1MW1A 2EBNA 1JI2A 3RM4A 1M01A 3KTSA 3NAVA 4Z17A 3LMYA 1H7PA 2CCRA 2F8QA 3PBWA 4WR3A 3QY6A 1G7VA 2ON3A 5HUPA 3SCUA 3WLQA 3HFYA 4UTLA 1KLZA 4NI3A 2GJLA 3L66A 5A6BA 2FH6A 4ZXOA 2FB3A 1BTCA 2GUYA 1FH9A 3S9ZA 2MNRA 3AMGA 2VR4A 1V02A 2E3ZA 3CS2A 3PVFA 3HJEA 2OZ8A 3CT7A 4GYPC 4PRWA 1ITXA 1PPIA 1DJYA 4Z1BA 4HPXA 1W26A 3PY2A 3C2RA 3BJSA 1KXQA 1FY6A 3VABA 1PWLA 3QQ1A 2JKEA 2VYOA 2G3JA 1S2UA 3A9BA 4JFMA 4WGHA 3IPWA 2HEJA 5CC3A 4M8UA 2ATMA 4K8EA 2F6UA 3TP4A 5LIYX 3CQJA 1P1MA 2FVLA 2YCIX 4FIQA 2ONEA 4ZBCA 4EXQA 4LU0A 3UCDA 1CLVA 1ZCCA 1QDSA 3JS3A 5BXTA 4B5VA 3RFAA 4ZTXA 2F61A 3FAPA 3B7XA 2YJQA 4JOMA 4DLMA 3K4WA 3AYTA 4TX8A 4MNKA 1N55A 4HA4A 4JIPA 1VJSA 1NWSA 2VVSA 3RYSA 1C8XA 2D22A 1MQQA 1KNWA 1WZLA 2J8TA 1H7OA 4HHLA 4IQJA 4V28A 3ZOAA 1YYAA 3URBA 3KDOA 1QI0A 2ZOXA 3CT2A 5EFDA 2ZR4A 4QJ4B 1H4PA 3G24A 2DSVA 1J0HA 4JQ2A 1D3GA 5A8QA 1FDYA 5C2CA 3PNZA 4UWMA 4JFIA 4Y8FA 1JDEA 5TQLA 2WMGA 4J2PA 1H7RA 4UZUA 2OWXA 4HZMA 1M7OA 3CO4A 2ZX9A 2QUNA 4AU0A 3AYRA 5I0DA 1OZQA 4GGHA 5FL0A 1E1CA 3RCMA 5JIPA 1M7JA 4IMGA 2H3BA 5D2VA 3SQLA 2CBVA 2RGLA 1W31A 4A6GA 2OZTA 1PO9A 4C6JA 4GY1A 1A53A 4AZCA 1NFPA 3TW7A 2FQIA 2DJXA 3M0XA 4LUJA 4JFJA 4D2JA 4HBOA 3H4XA 3PR9A 2FFCA 4XAZA 2ZQTA 3NZGA 2PCEA 3OOQA 1IZJA 4M6PA 3RU8X 4WJ8A 1ONRA 1WUEA 3S1VA 3LCIA 3QMTA 3QYSA 4GPNA 2FVMA 2CBUA 3NXLA 4DRSA 3CUIA 4EWND 1DTNA 1A3HA 1QATA 1E6PA 4UIOA 4F4RA 4RR4A 4JIQA 5XIAA 1IR1A 1Y7VA 1VFTA 1MVYA 4RNJA 4I9TA 3W6MA 3UXLA 4OV4A 1X6NA 4MFDA 5KSWA 2PWVA 1LBFA 1K9EA 3OVQA 2XTKA 3U48A 3QOKA 4IX0A 3THDA 2BMBA 3DFHA 4NJGA 1SFTA 4PZVA 4NIRA 5TNVA 2TPSA 3R6IA 4FB7A 3B8TA 1XLAA 1KM4A 3VOJA 3VKJA 2P88A 3BJTA 1KB3A 1SZNA 4Z2JA 4JIIX 2RQSA 4E8DA 1XL9A 1A4LA 1XRVA 3Q45A 1F3WA 2OGYA 3BW2A 1GQKA 3KAOA 4B90A 1P0KA 3UG8A 3WDQA 3VZYA 1EUAA 5CZKA 1QO2A 1YATA 1GVRA 2H90A 1EKOA 1UH4A 4GIEA 5DANA 3VIIA 3WQ5A 4KWVA 1LBMA 1IF2A 2TODA 4IP5A 2X7VA 2PDJA 3SCRA 4GIAA 3ARUA 1P5QA 4GOAA 4B3LA 1LJYA 1NEYA 1VPXA 3PN8A 4E5TA 3AIBA 2KGJA 4LAMA 1W3IA 2QCEA 2OQLA 5E9XA 4QHRA 4IPPA 2HMCA 3DYOA 1M9HA 3PZVA 4DQWA 1AW5A 1YADA 4Q8OA 3TFCA 4LAYA 4GQ0A 2H8ZA 2JEPA 3NVTA 3GNRA 3VD7A 1HVQA 2GDVA 5D9PA 1QW8A 3PJUA 3LU2A 1YBQB 3GNDA 3MYPA 1Z32X 3S6TA 4JX5A 2PRHA 4HNCA 1DOSA 4QDPA 1JYXA 4YU1A 1E71M 5HOSA 2EPKX 1UWQA 1HL9A 4ML4A 2YX0A 4W7VA 4ZO7A 4QQ3A 3WF3A 2GZXA 1PE1A 4FX7A 4HYVA 2R8WA 3TZNA 2XPKA 1LUCA 4ATLA 3W37A 1THFD 4Q4KA 4I8DA 4M80A 2D2OA 4DBUA 4I6VA 1EUNA 3TN6A 3GFXA 1AD4A 1F7BA 2I14A 2PWUA 1VPYA 3LX9A 1EYEA 4C65A 1Q66A 3C2FA 4JYFA 4PULA 4G8TA 2J7EA 5BW6A 1WYIA 3PTDA 4F66A 2FGBA 3SO7A 3JR2A 4FLQA 4GC3A 3STPA 4E2OA 4FXFA 3NRKA 3S1XA 3F5KA 2P53A 4IPLA 4MNMA 1DTUA 3STCA 4YCOA 1X6LA 3UBPC 3JZEA 1O4UA 3UESA 4FNSA 1XI3A 1YDOA 1OFAA 3W26A 1EQCA 1UZ1A 3VVGA 3BLKA 1I45A 3NQFA 1I0DA 4RW5A 1XH0A 3QMRA 4DWSC 3P67A 1ZRQA 3HA1A 3SRHA 4ADUA 3HGSA 3KOXA 3ZS4A 2F21A 4KR0B 4QCEA 3EPOA 1CIUA 3LCHA 2Z1XA 2EG8A 2ACRA 4Q32A 1GVYA 1E1EA 1CXIA 1JJKA 1V3HA 3F4CA 2Q5AA 3CL6A 4XISA 1AW1A 2IUZA 1KM5A 4Q4MA 1PCKA 3MVTA 1HF6A 5H1WA 3MCMA 1VBUA 4HZ6A 4CQ8A 1GKQA 1V93A 1KGWA 1VIWA 4B9ZA 3SIZA 3U2ZA 1EIXA 3RILA 3WCZA 4CCCA 1O5QA 1XLMA 1TV5A 5CCZA 5C54A 3R10A 2WOQA 2V30A 1GYMA 1FX6A 1H61A 3AALA 3W7GA 2XISA 1JDDA 4ECLA 3MUZ1 3LGGA 2INFA 3BICA 1C9WA 2QAPA 4J3SA 3L4XA 3HU7A 4Q8MA 2E5DA 4IMFA 2Y70A 2PDMA 3URQA 2QVNA 3HG2A 4AWTA 3S5ZA 1TTQA 1E9YB 2WNQA 4AZHA 3ITGA 1L8PA 1MO0A 4IIFA 5K3VA 2XVPA 4QE1A 2MLYA 3DG7A 4ZB0A 3KCJA 2JEQA 3NO5A 4LUSA 1Q4WA 2W62A 4C6LA 5G4EA 2VJXA 3EDJA 3IS4A 5I3JA 3VKCA 3P7YA 4O14A 3VIOA 3EDEA 4UTWA 4QJ3B 1A3XA 3BAKA 2ZQVA 3GVVA 2LKNA 3UCCA 1J0IA 2DT1A 3KW3A 4MJZA 2P4VA 3JZUA 3G6LA 4JR5A 3GTFA 2VXNA 1FH7A 1P6CA 3KADA 4D6FA 1P7TB 4BR1A 3LHTA 3H7VA 2CXGA 2XIQA 4UXDA 4R9OA 4HNOA 1A5UA 5HULA 3B9OA 2OYMA 2DZSA 1OY0A 4BI5A 3DOPA 2Z1WA 3L0NA 3NUKA 2P50A 4ZFCA 1ZJIA 3ITYA 1T5AA 2WPBA 3DYMA 2YPIA 4AEOA 3FLUA 1WKFA 4F0MA 4GY7A 1M5WA 1JQVA 5EFFA 4IMDA 2XZ7A 4MADA 1QPFA 3PNUA 4DRKA 4C1NA 4XO7A 2FHCA 3I7SA 1XLCA 4I3GA 4P7NA 4A29A 3UQBA 7REQB 4PMOA 3WFLA 4FAPA 3NA8A 5FJRA 2PA6A 2DQXA 4PMZA 1OJXA 1TUXA 1JXJA 5DELA 4DO5A 3W81A 1UOKA 3WMCA 5I3GA 1D2KA 4D8ZA 4KPLA 1C29A 4DAIA 2CWNA 1ZBCA 4DI8A 2V5CA 4O1FA 3TTOA 2QJMA 3AXHA 1TWDA 3W84A 4O12A 2OSWA 1L1PA 2CPUA 2ODOA 5HKGA 4HD5A 3QPYA 3KBJA 4YWIA 1V08A 2KI3A 1V5XA 3UPWA 1KTBA 3AU6A 1GOOA 1XWYA 4HA3A 3WLOA 2HWGA 4ICNA 2BHZA 4J3UA 4Z42C 4IM4A 4AHPA 1RQHA 1XDMA 1WDWA 1ZL1A 3B0UX 5HJYA 4IMEA 1CGYA 1DXIA 1RJQA 2OVLA 4WEVX 1RBLA 3VM7A 4AF0A 3N6QA 3GUWA 4HU8A 1N2VA 4EF9A 1R2SA 1TPFA 4RE0A 5C9WA 2FDMA 1IYXA 1OBAA 3LM3A 4J7RA 4IXXA 2YW3A 2OX1A 1FKGA 1YNQA 3F4NA 3AXIA 4YIWA 1E4IA 5CPQA 3OA3A 3TR9A 3U4AA 3DUGA 3G3MA 1Z48A 1GGOA 4L7ZA 3BG9A 3A4XA 1C8YA 3B8DA 4XD4A 1LDCA 1KBLA 3P5ZA 4LBRA 3FYPA 2ISSA 3QGVA 2OU4A 5LZLA 4DRJA 2HVOA 1EL3A 2WSQA 4GH1A 3ERPA 1DORA 2ZC1A 4F40A 1IXQA 1X98A 3GHTA 5F7UA 1BQGA 2VFIA 1R47A 2WV8A 1BSLA 1P0EA 1S2WA 4DPQA 3NQ2A 5E09A 3KLLA 4LV9A 1VFMA 1PZ1A 3PWGA 3VIKA 5ECVA 3MV01 1NIUA 3ZJKA 2AAAA 4R3UA 5D2WA 2OYLA 4J3XA 1GVEA 4CQBA 5LNRA 2QPXA 1CDGA 2FGZA 1MFUA 2W67A 5CZTA 3PJXA 4NRSA 2WHMA 5CC7A 1IIHA 3QSRA 2FDSA 3MANA 4RNIA 2VT0A 2FTPA 4ACZB 3WF1A 1L6YA 1A50A 4BF9A 1LT8A 4CD8A 1W37A 2VO5A 2QZRA 4QLJA 4HTYA 1Z89A 1PZ3A 4EAMA 5HJLA 1CGVA 3KTXA 3TC5A 2ZRUA 1OT2A 3A24A 1O7AA 1DJQA 3PG9A 4V33A 4XG1A 3VNIA 3B8VA 6XIAA 4AW7A 5CBJA 1PKLA 1W5OA 4B15A 3L5LA 4O15A 2W4XA 1R9ZA 3OODA 4PUDA 1FWFC 3HPFA 3J7HA 4P8UA 3U0HA 1QZ2A 5IBXA 1AVAA 1JPKA 4NUWA 1K4GA 3EB4A 4R7OA 2D73A 2V63A 2XGIA 1F74A 4O50A 1QBBA 1X1OA 4IPIA 3HQOA 1QBAA 4KS0A 1WKYA 2RDTA 4JHMA 1I0BA 1I4NA 3TMLA 3RG6A 5EA9A 2PTDA 2H9AB 4BK9A 5AC5A 4IH3A 4ICMA 3VDHA 3AUJA 3C0SA 3RX2A 5C9UA 3VMOA 4W85A 1X8FA 2A2IA 2GVGA 3AMLA 2MANA 2XM2A 4P7RA 1PIGA 3VZXA 3CV1A 4F9JA 3N25A 5AZ1A 3PZMA 4Y9AA 2FJUB 4YWSA 4JIEA 3LGEA 3EWXA 1Y0EA 2UY5A 4HGXA 5FEWA 1I1XA 2Q8LA 2DT3A 2PPNA 1MZRA 2A21A 1I9CB 2D9FA 3WQVA 4URIA 1HXVA 2JIWA 4O1EA 2C6QA 3EEGA 1O5XA 1XYBA 3OG2A 3NNTA 2VEPA 2F84A 3R0UA 3SUWA 4YPJA 3HM7A 5LIKX 4MWAA 1KRCC 3F4VA 3UNDA 5DBUA 4P8WA 2WYSA 3I10A 4MSPA 1KFCA 1X7FA 1GVSA 2B4GA 4GJIA 1BSIA 1WQ5A 3UVAA 3CL7A 1L6SA 1RP8A 3G2GA 3UW6A 3MZ2A 3C86A 1R46A 1V6UA 2GFTA 4CNPA 3L4ZA 2X16A 3JXVA 3H4WA 2EJAA 3W29A 3WEZA 5C9XA 4ICCX 4AD5A 2IPWA 5KZEA 5A6BD 3QFWA 2CXEA 1W9PA 1I1WA 2A3BA 3C2VA 3UR7A 4B5TA 4BWLA 1ZCOA 4GUHA 4JTCA 2NT0A 5A1AA 3WNMA 4DXKA 4AZ7A 1TELA 2C71A 4K1GA 1OWQA 1Q6HA 3RLVA 3WMLA 3ZT5A 2PPOA 2V9DA 2PLKA 3GTXA 2E7FA 4N6FA 5M3WA 5DF0A 4DJFC 4I7WA 3CNYA 1R30A 4FHAA 4IIHA 1KWGA 2JKPA 3EDFA 5IHRA 4FEZA 4ZA0A 3MQTA 2A1YA 1EA9C 3KZSA 1P1XA 3WIJA 1UD6A 3OLDA 2CZVA 2FPTA 3VINA 1QNVA 2V82A 5AYBA 4DJEA 1JZ6A 3S47A 3IGSA 2OR2A 1BKFA 2Z6IA 3OLIA 2OJPA 3B8WA 4L56A 1UR0A 3OA5A 4K68A 1UUQA 4DO6A 5FF7A 7A3HA 2ZADA 4ZB5A 5A2BA 3UQNA 3A4WA 2GVJA 1TWZA 3M0KA 4DM2A 2IKJA 3KRZA 1E6ZA 1LT7A 3DBPA 2V3DA 4B16A 1LL7A 4L1GA 3TV8A 1EDGA 4ZTYA 1SMAA 4NXSA 3H2FA 3QGAC 1QPKA 4KQZA 1OQFA 3GTIA 3TDBA 4OBRA 2J9XA 1UQYA 4P7OA 3Q67A 3BPWA 3SUVA 4KEMA 3LLDA 4PBEA 3WYZA 1XKYA 1B3XA 3B3DA 4FS9A 1WE5A 2O9PA 3LD5A 3K5XA 1TWWA 4MDPA 3WLJA 5AFDA 1UROA 4CQ9A 3LV5A 3OVRA 1TTPA 2D2GA 2YYUA 2H6RA 5AZ0A 3E96A 1W3KA 1CB2A 1F6YA 4S3EA 3ZVHB 2NLYA 3PBVA 2OT0A 1QNOA 2X1IA 5C0QA 3DI0A 1FWNA 3WLSA 1TWIA 3UVIA 1OX4A 4I8YA 2V3GA 1MI3A 1HL8A 4EVZA 3AS0A 1ME9A 1N82A 2PC8A 3R79A 3B9EA 4C6QA 3G1YA 1AUSL 3FGCA 1E4NA 1XYCA 3NQVA 4HARA 3A23A 1BVWA 1B54A 2PU1A 1BTMA 2I9EA 2OKOA 3UF8A 3PHAA 3CZGA 1TVPA 4PFHA 2W79A 1ZZMA 5FJPA 2WJEA 5G4HC 2AAMA 2A7PA 4PCFA 1QI4A 4GFSA 4XIMA 3RPMA 3UXDA 1O60A 4NF7A 4E3TA 2QJJA 1OF6A 5DLCA 5PTDA 1W17A 3PFMA 5BMXA 3EA3A 4JDBA 1F2JA 2MUCA 4HNVA 4DJDC 1GORA 1XKJA 1FHUA 3WLPA 3BAYA 1UKOA 3MY9A 5A6KA 4C1KA 3W22A 2GSEA 4MIMA 3MMTA 1KRAC 4AX6A 2YA2A 1TJ1A 2QULA 1UB3A 4H19A 2XGZA 5FESA 2G97A 4MOZA 2UY3A 1G0CA 2HK0A 3LBMA 3KABA 6TAAA 1K3UA 1G5AA 3ZXWA 3GH7A 4DUVA 1J6OA 2BG5A 1S3TC 2ZTJA 3GG7A 1CXHA 1BXBA 1FJDA 2N87A 3B06A 4R85A 1C9DA 2AOSA 2QNEA 4GYJA 3O15A 1FCVA 4EOUA 1R7OA 2QCLA 1IEWA 2IKIA 3NI6A 3SECA 3QQ0A 1A5NC 1GVIA 2YLAA 1OM0A 2DUZA 3A13A 3UPMA 3FVMA 2GGGA 1KR0A 3DDMA 4C02B 3GR8A 4E6MA 4EF8A 4DYEA 2C0HA 1AL7A 4MG4A 2VGGA 3WO8A 5FJIA 4ZOEA 4PC8A 2EO7A 1NWRA 1TV4A 4JN6A 1I2PA 1QW7A 1XYMA 4I5RA 1AA1B 3SCQA 4PEEA 3CTLA 2OWWA 3FY1A 2GQAA 5LGXA 2QUUA 2RH9A 3QH2A 4B92A 3L4YA 5F2GA 2JBMA 1FFQA 4ORIA 1JUBA 4QG6A 1WDPA 2WZHA 1JFHA 3N9KA 2VURA 3C8NA 3D47A 3H22A 4PTDA 2XN1A 4H8VA 3W4RA 4WCJA 4NKCA 2R9RA 3VOCA 1OZMA 1V0NA 2J78A 1OX5A 2WSRA 4XKYA 1EQPA 1TUFA 3VI2A 2PD5A 1H63A 1L2QA 3WX7A 2VZOA 5FAJA 3OW1A 2GQ9A 1DHKA 4QSHA 3T4CA 1XRFA 5MKGB 2QW5A 2CZFA 5A95A 2HZGA 3NZQA 3EX3A 3W1LA 1VQTA 2J77A 1KW1A 1XDLA 4GCAA 4J1OA 2ABAA 1E0WA 3DESA 4ODKA 2A0NA 5HNUA 1F8IA 5MHBA 3RR4A 4S2CA 3GNNA 4Y9OA 1EA0A 4JFUA 1Y8BA 3HPZA 2VX5A 3SRDA 3OTRA 1GYLA 4RPQA 1OFBA 4N4PA 3HG5A 3IIOA 5FF2A 5TD4A 3GXFA 1NDYA 4TVUA 1EGMA 4ZQRA 4J3ZA 2XP8A 1M04A 4M51A 5D33A 1U79A 3UJ2A 4R34A 3U4FA 1Q6EA 3SURA 3BCJA 2PPGA 3MSDA 2V81A 4XO6A 2X2YA 5EYWA 2D20A 4DAFA 4LNCA 1AH0A 1QASA 1XIJA 2XH2A 1IQ8A 3MW7A 1C8VA 4H9XA 4ADTA 4JY8A 2POZA 3GC2A 4NAFA 3EOLA 3O5LA 2HNEA 3NQDA 4LOCA 2CHRA 1K7EA 5FOOA 3M07A 3T0TA 1XLBA 3RGTA 3MMDA 2YA0A 1A5SA 4O57A 3IJ6A 1KRMA 4E2BA 2ZBTA 1K9DA 2QHAA 2VENA 4C5ZA 4JDYA 1HG3A 1R3WA 1KT0A 4AD4A 4E0CA 4X9SA 4F2UA 1UUOA 3IJLA 1IWBA 1W9DM 1BKHA 4M82A 5HWCA 1VPQA 2PDIA 4GIRA 4I5UA 2V68A 3TYEA 2NWRA 2Q8ZA 2XN2A 3LOTA 5CBIA 3MPGA 4DXXA 1MUCA 4KESA 3E3HA 4PB4A 2ZUNA 4ZQNA 3QKZA 5D03A 2PGRA 4AD1A 5HW6A 2VQUA 1XG3A 5DCEA 1P4CA 4A2SA 3BH4A 4Z1DA 2FZNA 2ZC8A 4Y8EA 4U4MA 3VKKA 1Q6IA 2QDGA 3WUFA 3UWYA 3S5NA 3ANVA 1ZAHA 3VNDA 1POJA 3AZTA 4DVOA 4RNFA 1R3RA 7TAAA 1VHNA 1V3MA 3AIUA 1IIGA 4D72A 3WD3A 3IGUA 1QT1A 4DBSA 3CXOA 4WY0F 4GXPA 1DXFA 2QS8A 1RQEA 2VQTA 4NHVA 4HU0A 1V6WA 1TRIA 4O0KA 1RSCA 4PUMA 3N2OA 2ACQA 3KDNA 3P80A 1KM0A 2Z27A 1QOQA 1FVPA 2V3FA 1YIXA 2DORA 3TXVA 4MDOA 3WQFA 1ZJBA 3EWZA 1JCMP 4JTKA 1VRXA 2M1IA 1N8WA 3ZSTA 4J3TA 3NPWA 4BEQA 1A0CA 1Q6RA 4W8BA 2ETNA 3SQMA 4QT3A 3HBLA 4RDZA 3E12A 2YBTA 3PUEA 5CC6A 2GDUA 3QY8A 1KTNA 3UJRA 1Q6FA 3RM8A 2QCHA 3NQMA 4LNYA 4H83A 4EKJA 2G4FA 4RDWA 2A5HA 2XIBA 3G77A 4LF1A 3PBMA 3W7OA 4ML9A 4LJ3A 1UP2A 1MFVA 2AL2B 1KWKA 2PS2A 3NCOA 1EZ2A 1GOMA 1FWCC 3W7LA 3DHUA 3S6DA 5FKYA 1CB7B 1HO1A 4H8UA 3L23A 3HPSA 3LHZA 3ZM8A 4FR1A 4GY0A 2VDIA 3O0FA 3GVWA 3H2MA 1CGWA 3W7JA 2L5HA 3N6JA 5LNUA 4OZOA 1K03A 3NXFA 4H1ZA 1QOXA 3G18A 2EPOA 2CYGA 2GYIA 3VIJA 3APYA 3GDLA 2OLAA 1KFBA 2J8FA 3GD6A 4F9DA 1J0ZA 3DENA 1J5SA 3UWWA 3E0FA 2O9TA 3AS3A 3KRBA 3LTYA 3KOYA 2XP3A 3WD2A 1W56A 4IL2A 1A4MA 4PUEA 4NYUA 2ALRA 3H24A 3JUGA 4H9MA 3M43A 4XV0A 3W7PA 4AWSA 3QLDA 3WBEA 3WLMA 5SWUA 5BROA 1R3TA 3BG3A 4JQ3A 3RFWA 3KX6A 1VYPX 3H23A 1XYZA 1OFDA 3GB6A 3TH6A 4GZJA 2NT1A 1ECQA 1YMYA 4PMRA 3O0KA 1GVOA 3BTNA 4HMDA 4PSRA 3WLHA 8CGTA 3NZPA 1E43A 1J10A 1H1NA 4H3DA 1JGMA 1GUVA 4FI4A 4QDMA 4HCDA 3UZXA 1CI1A 3WH5A 4LTSA 1E5NA 1V51A 1RCXB 2FZ8A 1AK5A 4WKHA 3P61A 3H2CA 3ZQ9A 3OGVA 3R12A 4J4NA 1BGGA 1UMYA 2BP1A 2VR5A 3BURA 4KWSA 1RJRA 3Q37A 4LY4A 5I7GA 4U10A 1SW0A 3GQYA 4IT6A 4MPKA 4QIUA 3ICJA 1B90A 4C6PA 5HBFA 1YRRA 2R1LA 4BI7A 1VBRA 2HBXA 4LAOA 4LAKA 1E3ZA 4M29A 1A5LC 2FZ9A 2XH4A 1V6XA 4A3QA 3EBVA 1BVNP 2C1HA 3VGFA 5HJXA 1NDWA 1PIIA 1JI1A 4GBDA 3QYQA 2Y8UA 5GNZA 5A6LA 3WF0A 1SZFA 3BLDA 3BLFA 4IQEA 2XSXA 1GZJA 3QSTA 1MQRA 3CM4A 1F05A 1CYGA 3GU0A 3ZVHA 2I16A 3FDKA 4PUKA 4CN6A 3PJWA 3TTQA 2VWTA 3V75A 3RO6A 4WZHA 3LCGA 2CU0A 3THAA 4FAMA 4D6JA 3FJ6A 4FLRA 2Q71A 2ZA2A 2QF8A 2WANA 3HPXA 1XYLA 4UMCA 3W7MA 1P0DA 3TMQA 3NL5A 2XVLA 4X3ZA 2IXVA 1H50A 2PC4A 2ITKA 4X60A 1SW7A 4BQ5A 1LL6A 4F0RA 3UI5A 5D02A 3N2TA 4NASA 1CGTA 2R6OA 3SM0A 1FAPA 1ICSA 2VGBA 5HINA 2OQHA 2Q02A 2DIJA 1GQJA 4MWAD 5HXMA 3IK8A 4I9MA 4JEQA 3O1NA 2J4GA 5J04A 1LQ2A 2VR2A 2CLMA 1TJ0A 2PGEA 1ZAIA 3CV2A 1WBHA 2IS7A 4XAPA 1UASA 5CPMA 5RUBA 3V5OA 3SI9A 1YKWA 4TW6A 1L6WA 3WEMA 1IT0A 2Y7GA 1A49A 1UIOA 2G5WA 5HR7A 2PDNA 1I2QA 3OHIA 3HG4A 3NOEA 4ZO9A 1O1ZA 2Y7FA 1VAHA 3DI1A 1OADA 4S3JA 3PAJA 2OB3A 2ZUTA 5B80A 4XWUA 7ENLA 4ROQA 4C6IA 5G2HA 1OD0A 4L80A 1UR4A 3FKKA 4JQAA 4GO8A 6PTDA 3OIXA 2NVDA 2GJXB 1UUMA 1MNZA 1XGEA 1K8ZA 4M6QA 4G1NA 4J3WA 2GLKA 2PE4A 4UTIA 3H7UA 4RZ5A 3SADA 2YDAA 3T44A 2HISA 1V79A 3BC9A 1AJ0A 3KXQA 5JQ9A 1L6GA 2GJNA 2X1RA 3CB3A 1AZ2A 1PDZA 1DWJM 1P5BA 2I56A 3WDJA 3TU9A 2XIOA 3QTGA 3W86A 1V3KA 2G96A 3O05A 4JX6A 2PD9A 3CIWA 1Y0OA 1FWAC 2W27A 5DO2A 3WJXA 3FVDA 3TROA 3QBUA 2VZUA 2WQPA 4RLIA 1GTHA 4E4PA 4LY8A 4TV5A 2YZ5A 4F2TA 4GYFA 5AHLA 1SUXA 3HFTA 4DJED 2JGYA 4H04A 3E2VA 1GCYA 4QG8A 4D1IA 2UZ9A 1OG0A 4ADSA 2VFFA 1V6VA 2DY3A 3N3MA 5D2YA 2F6XA 1XCXA 2XINA 1UWSA 3GHSA 4NVTA 1NOUA 1Q7QA 3E5PA 7TIMA 1HN1A 1WO2A 1ZHAA 1PYFA 1ZB5A 2ACUA 3UR5A 1V6YA 1WX0A 1OFEA 5IFTA 5CPTA 5I78A 2PWDA 4HMEA 3KOZA 1OGGA 1C8QA 3IJIA 3L2IA 5A6AA 1BQCA 2J74A 2DEPA 3S5OA 5DBTA 2KE0A 2VCAA 4KRTA 5I3DA 2KFWA 3UXIA 4XZHA 2ANUA 1DPMA 4MZYA 3AZSA 4FSAA 1XR2A 3T0DA 1T0OA 1DE6A 4KRUA 5C2XA 4OOZA 3CV6A 1ZGDA 4O13A 2WPGA 1U83A 3CQKA 4HK6A 2GK1B 4JD4A 4AYGA 4GLEA 3TC3A 1QNSA 2XIMA 4INFA 3SR7A 4IFKA 2FMNA 3EY6A 3RM9A 2IQTA 4FLOA 4C6EA 1AH4A 4W93A 1UW9A 2NV2A 1C9HA 4AD0A 3I6RA 1TJRA 3ATYA 1L2UA 3WUBA 5IRPA 2B81A 1XF0A 4PN2A 2WMIB 4TVCA 2E6FA 2HQAA 1EP2A 4FF7A 3WK0A 1TPDA 2PDCA 4XIAA 4FLSA 5HMDA 1TA3B 2ABBA 1TPUA 2QIWA 4GQGA 1KBBA 3BG5A 4LX4A 4OJYA 1KBKA 4B5XA 3T8LA 4UFIA 3WNKA 5K9DA 3OLEA 2WKLA 4DUXA 2VC6A 1P43A 3UQIA 4G1KA 2VHLA 4NAEA 3GXIA 3V1HA 3M47A 2OYKA 3OQ8A 1J11A 4O1BA 4CCDA 4U5IA 2QCDB 1FKRA 4DH0A 2Y4SA 1W1TA 4B2DA 1JYWA 3VUPA 2GOKA 1NP2A 2F2KA 1NM9A 5BRPA 4IIBA 1AFSA 4W9QA 3TWBA 1Q8AA 5CSUA 4CUCA 4Z2KA 2FPYA 3EGJA 1T8QA 3T42A 3AZRA 1LQ0A 3ZIZA 3OZPA 3LYEA 5FJUA 2WNWA 2DQWA 4LCQA 3EOSA 4ZQPA 4FN2A 2DSUA 2C1GA 3PBYA 3B03A 4DHGA 1VFUA 3VAWA 3EX6A 3WY1A 3ARYA 3OU8A 3QC0A 2G4JA 3XINA 3M5XA 3FSTA 5HANA 2OEMA 1JD9A 4JTDA 4S3FA 1RBAA 1HJXA 1JNDA 3FV9A 2BSLA 3R8RA 3W7NA 4DZAA 4YVPA 1J4HA 1FWSA 4LSBA 4ZGYA 3MSGA 4HJFA 1FDJA 5LGZA 4TXEA 2I1OA 4I7VA 2I57A 2PTYA 1ZBVA 4Q4SA 1SJBA 3S0CA 2E4TA 5BXSA 1ZU8A 4B5UA 1OFQA 3T81A 2G8ZA 4GFIA 3WQ4A 5CAHA 4LWWA 1P0BA 3GFYA 9XIAA 4FOJA 3TR2A 3W27A 5LA2A 4AVOA 1ISWA 2Y7DA 4GC4A 5BWAA 1H7WA 1I75A 1HNYA 1H0GA 4JYSA 2CESA 3KRSA 4LUTB 4AXNA 1UZDA 5J8LA 2OGJA 4DELA 1C91A 1F8MA 3PS7A 4YLWA 1BPLB 2E5CA 4YMZA 3NYDA 2NQLA 3S2CA 3AXXA 1XUUA 3YPIA 3OJGA 5E0CA 1TG7A 3KL3A 1G01A 3WENA 2R14A 1U33A 4JTTA 2XVKA 2F4EA 4ROPA 3F2DA 4WVXA 4BY3A 3LLXA 4QLLA 1L9WA 1W1B1 1IZCA 3MYOA 4GKLA 5CGQA 1WCGA 4L1XA 4PTVA 4AAJA 2CLLA 4Q8WA 5FEPA 4EE9A 1DJXA 2CFFA 1JAEA 4QCFA 2BASA 3SCVA 2WMFA 2X7WA 3INPA 3NOYA 3UFYA 4B3KA 5LHFA 4IIDA 3N3TA 4GI6A 2WMJA 1MQPA 5ECUA 3MKCA 1R9YA 3K1GA 1JNTA 1JUKA 3GKFA 4NU7A 3AMKA 3E49A 4X0VA 5D75A 3VA8A 4C5YA 1IEXA 2OMAA 3N1AA 1RY8A 2GVEA 1O95A 4BF5A 4AISA 4E38A 1WOBA 2G50A 4ODMA 4IPNB 2WWDA 2Z0IA 2MLZA 3KBMA 1M1BA 4OBTA 4GGBA 4O10A 2Z1SA 1XJBA 4JN8A 3KBNA 5LNVA 1XYAA 4YNGA 3V5CA 4XBJA 3VMPA 1K9FA 3CJPA 1QJWA 3GG0A 3WK1A 2W6RA 1XBXA 3U5YA 4LVDA 3CUZA 4YL2A 4WK9A 1JG9A 2BHYA 2XP9A 1FWJC 1TZ9A 2VRQA 4GABA 3FW6A 1UR8A 5TIMA 1GJUA 3T2OA 4DNHA 3AIQA 7PTDA 3ZYZA 5B7ZA 2ZYFA 1W5QA 1W9BM 3KVMA 5AHNA 2PZNA 2J13A 3RX4A 3S42A 1YW5A 1EBGA 3O9NA 3CTTA 3KM8A 3MU7A 3BAIA 4NT0A 4BHYA 2XYLA 4TX6A 2QJNA 2Z26A 1DIEA 2HV5A 1TPWA 3UERA 1NAL1 3ARVA 3HMCA 3LDVA 4O18A 4TV6A 2O7SA 2VTFA 3ZWSA 3E6EA 3ANYA 3LTSA 2YXGA 3TLLA 3KRUA 3N19B 2H8XA 1HKKA 2PURA 3TTEA 1IX5A 3AIVA 1TCDA 4B3ZA 4IT1A 4DO4A 4HZ7A 2Z4GA 4ZB2A 3W2NA 1YE6A 1EZWA 3HTWA 3MHGA 3TW9A 4EIVA 1KV8A 4MAVA 1NU5A 1S2VA 4ZE5A 1UR1A 2A7RA 2BGSA 2OSXA 2R1NA 3TJLA 1GOWA 4DZ5A 1AG1O 4XKMA 2AWGA 3W2UA 3EX1A 1XQLA 3RITA 3A47A 3FSUA 1FP9A 2DW7A 3LV6A 5BRQA 1E1CB 2PPPA 2C14A 4PGLA 3MC5A 3FEQA 4PMVA 5J5DA 2CLOA 3CUXA 2W61A 1FKBA 3EX2A 4KCWA 3VNKA 4AZCB 3GIQA 5IDIA 1D7HA 5BU9A 4JBRA 3O5JA 4I7UA 2YCLA 3GDTA 3I4EA 1X6UA 3AS2A 4LRTA 3NQ8A 4JNYA 4AWEA 1FKXA 5CPOA 4K39A 4EPKA 3RR1A 3GXTA 4XZLX 4BF7A 3MHUA 4LYQA 4B5NA 3SCWA 1MW0A 2TYSA 4ZS6A 2RDUA 2Q6ZA 2PF8A 1JCHB 4DBWA 2YB1A 1HTIA 2EAWA 1XBZA 3R4IA 3RJXA 3FEMA 4ZO6A 5C71A 4UFJA 3UWEA 1H1ZA 3IUHA 1J79A 4GI8A 3DGBA 1UA7A 4HNUA 3CZKA 3MA8A 2Z1VA 1RVKA 3AHXA 4X63A 5DMNA 4IJBA 1ZS2A 1PL9A 4BQ4A 5LNWA 5K2ZA 1W3TA 1ZBKA 3NDOA 1T40A 4TW8A 1ZJAA 4ZSTA 2ZXBA 3GXMA 3H2NA 1TTIA 4W4QA 5DO8A 4XAFA 1RH9A 1JIBA 4GQBA 1XLDA 4XAKA 4O11A 4GZIA 1KKOA 1TVNA 2CWXA 1MEWA 2PBCA 2QIIA 3ALGA 2ZQUA 3IIVA 4FNUA 4Q8UA 3OGRA 1C90A 4AY7A 3NQCA 2E28A 4N4QA 4RNHA 3O06A 2XH0A 1D3CA 1J93A 3H2AA 3SFKA 1M41A 2NQZA 4W5UA 4MKNA 2V67A 4Y96A 1Q6QA 4UOQA 1E5JA 5JH8A 4KGJA 1TCMA 3R25A 4UCGA 1JZ5A 1JPMA 1WP6A 3RMEA 3K8LA 1FHLA 3CH0A 4IOTA 3W24A 3SSZA 2JIEA 3H53A 3GLCA 2B7OA 5DITA 1XCWA 4IPJA 3I3EA 1WDQA 3VPLA 4S2BA 3UWZA 4CNNA 1DQWA 2FH8A 3KTCA 4JFKA 3M0IA 4W87A 2D23A 2VOMA 4GZ7A 3LI1A 3TX9A 3NSXA 2GJXA 5EMJA 4JPGA 3JU2A 2V3EA 3E74A 3QZAA 4KFOA 5AHFA 1VBGA 1XLJA 4FMVA 3F5JA 3WQOA 2Q01A 1XISA 5A6TC 5ABTA 3GNXA 2PRMA 4M7SA 1KGXA 2A3CA 5LIXX 1W5MA 4MJMA 3A64A 4OHQA 2J6VA 3QKEA 3RRAA 4JTFA 2BVWA 2REQA 1DL3A 3SJNA 1JQXA 3M0LA 1GQLA 2I17A 1RPKA 1WB0A 1G7UA 3SGZA 5E6ZA 3ECQA 3WMBA 3WNLA 3D0CA 1UOZA 2Y8KA 3G1VA 1TX0A 1C7SA 1G4TA 2CLFA 1EJXC 1DIDA 2A3HA 2Z6JA 3WJYA 1XFCA 2IPGA 1VZWA 1G4PA 5A3HA 4AEFA 5HWMA 1LM1A 5HA7A 1PCWA 3E9AA 3MWAA 1QXLA 4IQLA 2ZXQA 2GSHA 2NXIA 3ZLFA 4W7UA 1POKA 4GH3A 1XBYA 2YW4A 3SY5A 5FJOA 3QPEA 2PCQA 5I23A 1P48A 4IGHA 4FA3A 2PDUA 4MJ4A 3VFCA 1GG0A 3BLEA 4B91A 5AB3A 5C55A 1VGAA 4PUWA 5C6MA 3RMJA 3D5HA 3BLOA 3NDZA 4LVAA 1IEIA 2PN0A 1ICPA 4RV8A 5D32A 2GQ8A 4X0NA 2PDFA 1S5NA 4E8CA 2BGNE 3E5BA 5TBOA 3R8HA 4JHOA 2BOEX 3T78A 3SCOA 4XUGA 3W85A 3QR3A 3GZ3A 3UZYA 1BG9A 2WVTA 4WIWA 3B4UA 3BOFA 4D6HA 1EPXA 3O6AA 5LHEA 2VRKA 3TKFA 3ARPA 1RPXA 4HOWA 3M0MA 2PTXA 1SSDA 4J9JA 3OPSA 3PBUA 3EXTA 4GUFA 3S2JA 2X0HA 4Q4RA 1YEYA 4G9PA 4DRQA 5BOEA 3WJSA 4UDMA 4L1WA 3M9YA 3EIPA 3BLLA 4GWEA 1OCNA 4LYKA 1SPQA 1TA3A 4XK2A 2OZ0A 1MXDA 3VDCA 1MW2A 4M7TA 2VEFA 3L2MA 5EMKA 1UD2A 2YBVA 5G4WA 1A5KC 1PTAA 4RV3A 1BYBA 3D3FA 1F6KA 2FHFA 1EYMA 4KETA 4I5XA 1RV8A 3LCXA 2CLIA 3TNBA 2ZZ5A 4PB5A 3ZR5A 4CD6A 4DYJA 4WUIA 2QCDA 1J8VA 5BYWA 1A5AA 1GZ1A 4QITA 4OU1A 1HJWA 1JULA 4UTTA 4XZIA 1EXPA 3OZOA 4HB7A 3AHZA 3AIRA 5LSMA 4RZ6A 2NW0A 3ABZA 3I7QA 1E51A 3RGCA 2RJGA 1V8EA 4TVDA 1TREA 3NL3A 2RURA 2DT0A 2BS9A 2VC9A 4L6DA 3T9PA 2UZ5A 4XZMX 3TQKA 1JVWA 1B57A 2Y5JA 4P7LA 2D0GA 2JGQA 4DLFA 1F8AB 3U8GA 3TSDA 4L9YA 3M16A 1F61A 3BOXA 3WH9A 1WUFA 3ZJ8A 4Q6XA 2ZCGA 4OIFA 4J35A 4FNRA 1HUVA 3VTRA 3WKZA 2XSAA 1S39A 3S1WA 4US6A 4EWJA 4R88A 3I3DA 5T26A 5C9RA 4K7YA 4AIUA 4LB3A 1XLHA 4WKAA 3CYJA 1V0LA 2ZWZA 3NQ6A 4M81A 1GRJA 4K1WA 1XLFA 1DHPA 2VZVA 1YLVA 2KZHA 5CGTA 4O8AA 1OB0A 4PCSA 4C1NB 2WZIA 4PCNA 1QK2A 1YHTA 2FZBA 1OYBA 4PUJA 3AYSA 5M5DA 3WG6A 3CHCA 3PZGA 3LQGA 2RJHA 1ZBWA 2XVGA 4UTJA 1UR2A 3I65A 3Q58A 1NSJA 2DG4A 4PBFA 2ZXAA 1FKIA 1ISZA 1FRBA 1RJPA 4C6MA 4CNSA 3ZLGA 4UQDA 3GTNA 3ALFA 2WKJA 1IEVA 5I07A 4PA8A 1QNQA 1XV8A 3EDDA 3GM8A 3IJQA 2NLIA 3ARTA 4TIMA 3WELA 2BX7A 2A3EA 2C7FA 3BDKA 1KFWA 4V1XA 3DZ1A 1B0IA 4GUJA 3RN6A 2QDHA 2V6AA 3PPGA 1AW2A 3T07A 4PCTA 5J6EA 4NZ1A 2FMOA 5CH9A 1WXZA 3LENA 3BLPX 3PAOA 3QV9A 3II1A 3EOOA 1GZGA 3TW6A 5C2GA 4C6BA 4AQLA 4CU7A 3MUAA 3ZO9A 1R9XA 2ICSA 2G0WA 2ZRZA 1HX0A 4RK8A 4AF0B 1KQYA 3M6YA 3GY1A 2Y2WA 2XG9A 3COTA 1KLYA 4GACA 2P1FA 2J7FA 3LY0A 2GVLA 4GKTA 1ZAJA 3D6NA 1QPLA 1TB3A 4EPDC 3QV6A 4IGNA 3RNDA 3NL2A 1QVBA 2VC5A 1EJ7L 3FJ4A 3N15A 4HSOA 4HSNA 1UC4A 4J2MA 1LLOA 1J0JA 4YHGA 5F4WA 3WK2A 4F0LA 4NNBA 1KTCA 2QV4A 2Y61A 4FNPA 3IAPA 1RA0A 1JYNA 4JEJA 4J4KA 3G0SA 3LNMA 2C13A 2BXZA 4H4IA 5TAOA 3NSMA 2CLEA 1CX9A 5E9AA 4LXFA 1MRQA 2DH3A 3BOLA 3M44A 3VKAA 3LK6A 3WQPA 4PB3A 3LGDA 4JICA 4H9VA 4I90A 1FCQA 1NOFA 4JTEA 3M0VA 4F0KA 1G94A 1J2WA 1O6IA 2HBVA 2FKPA 4PMQA 3RPDA 5FL1A 1E6NA 3F2CA 4B2DD 3E02A 1J96A 4RUBA 3A4JA 4AZ5A 5FIPA 3H6OA 1OC6A 1LRQA 4UC5A 5AC8A 2PTZA 4A3UA 3VK5A 1KCXA 4RZ4A 4QAIA 2A79A 1B1YA 4QQUA 1G1YA 2XM1A 4R33A 1XGZA 3TTSA 2DZVA 2PP3A 2GL5A 3G1RA 2DH2A 3AXMA 3LXAA 4QP0A 1E9LA 1AH3A 1FP8A 2A6NA 2O7QA 5HNTA 3VD9A 2QJHA 4S3GA 3A3XA 3CO8A 2DFAA 3DG3A 1AQMA 5KMYA 4H2CA 4K3ZA 3SDOA 2X05A 1UHVA 1XIHA 3FA4A 1U22A 3OBKA 3MP5A 4FPSA 4REQB 5D38A 1OCJA 1EJTC 1UG6A 4XZWA 3WLRA 1Z44A 1WV2A 3O5FA 5FEZA 3NO1A 5A6SA 4US5A 5AHIA 3LHWA 1MMFA 3UPBA 3O6DA 4S1FA 3LB0A 1SO6A 1U1HA 3BVJA 4OVXA 5LA1A 1W1ZA 4UB9A 4WXZA 2ZXDA 3WSUA 1XGDA 1BWLA 1UD3A 1KO0A 2WNZA 5A8PA 2V38A 3D3AA 3VIFA 3GIYA 2BWGA 3SEPA 4LW7A 4QS6A 4NX0A 3GHUA 4CQAA 4O1CA 3AC0A 3SY1A 2POTA 1OCBA 4PTNA 2CLPA 2D0FA 8TIMA 3APTA 2YYTA 1BWVA 5G1MA 3DKLA 2KO7A 4W8AA 4R27A 3EX4A 2VEIA 1SFJA 3R2GA 1W91A 1LWJA 3MUIA 4K37A 2YCJA 1UKSA 5CEWA 2I5GA 4M0XA 4DEFA 4Q4OA 1XRSA 4MWAB 1E0UA 4Q22A 2BNJA 2OO6A 1FDZA 3U5UA 3CLWA 2XVNA 5HATA 2ZRXA 4U85A 3KWSA 4XBKA 1ZFJA 1UH2A 3MO4A 3AO0A 2WJDA 4BQ3A 3L65A 1OT1A 4TTUA 3EWDA 1XIEA 5F2IA 1QNPA 1ENUA 2AQVA 5D2TA 1WAUA 1Q6LA 4HU3A 3IEBA 1JZ8A 3HIJA 3PTQA 1FKWA 2I5QA 4QEEA 1FKSA 3CQIA 3HF3A 3GVGA 1GQNA 1EPVA 3W76A 2HVNA 3GU1A 5LKYA 4HPJA 3QVQA 4H8HA 4KFNA 1HGWA 3OYXA 3AICA 3NQAA 3WZ0E 2BY1A 2WLZA 3V36A 1MSSA 3C3UA 3NVDA 2J9ZA 5DXXA 1U5HA 1R2RA 2WSKA 3RLHA 1FWEC 3W1RA 1YDYA 2QMJA 3R0DA 3M7WA 4FK9A 1UWTA 4MM1A 1EJSC 3BAWA 1RAKA 4R53A 2WHKA 3O5PA 4IQ2A 1H7NA 2OOGA 1FFRA 1N7KA 4YCPA 1BXCA 2JF7A 1F3TA 3VDBA 3FCPA 4H6EA 4TX9A 5I79A 4YTUA 5DFAA 1QR7A 4AMCA 2QVHA 2Z29A 1E6SM 3EPMA 2OFJA 2DZPA 1LCOA 1OFRA 3W1UA 1MYRA 2BXYA 4MWAE 3AHVA 2GQ3A 3BARA 1PTDA 4S3AA 3ONBA 1E70M 2XH7A 1N8IA 1NELA 3M6DA 3W3OA 4TUFA 1Q2SA 3O6CA 4FOKA 1NWUA 4RZBA 3GAKA 3VCCA 3WFAA 1HKJA 2GWGA 3S6OA 2CBJA 1AODA 1UWIA 3GTYX 1JEZA 3IJ8A 4H6QA 3OGSA 3QN3A 2E9MA 1WZKA 4XZ9A 4DWDA 2M08A 1GOXA 4U3CA 4H6RA 2Q09A 5GNXA 4KEVA 3A5FA 1XC6A 4JFWA 1GOKA 2DVTA 4OWGA 1Z8AA 4S3DA 2QCNA 5I09A 4LS2A 1GPWA 3WQ8A 2QGHA 4EAYA 1IXPA 2GSJA 3W25A 2BVYA 3WNPA 3WQGA 4UTWC 3M0YA 2E8ZA 3W2LA 3OLGA 4Q4PA 3SGUA 3GW0A 1XS2A 3P2VA 3GYCA 3R43A 1U30A 1Q7ZA 1TVLA 5DY2A 1JCTA 3MDYB 4KWUA 4F3HA 2QYGA 4UQAA 1OX4B 2QPSA 1CGUA 1SJDA 4GUGA 4MYAA 1VFOA 4W89A 4JYDA 1ITUA 4JTJA 1TPH1 3NEHA 3QZEA 1DJIA 4PL2A 1XLKA 3O5IA 4UMAA 2B7NA 5IDZA 4MTVA 3FGCB 2PGFA 3L7RA 5GNYA 1P6BA 4ES4A 4KQNA 5G2WA 4JTIA 4DJDD 1W3HA 2A85A 4N42A 3UXKA 1FBAA 2DG9A 1OD8A 4LVFA 4QE4A 5DT7A 2Q8XA 1OC7A 2UBPC 3MBDA 2V5LA 4Y2WA 1BXNA 2C8NA 4DF0A 4BA0A 2HPIA 1RBOB 4Q7IA 2QKFA 4UQCA 3KL5A 4PH6A 4MGVA 4WSHA 4KKXA 3H26A 1W8GA 5DN1A 4QNEA 5ENLA 3STEA 2OPJA 3B0PA 1TRDA 3CUFA 1LTDA 2IPJA 5M2FX 1W8SA 4GO9A 1F4AA 1XD1A 1WPCA 1S5MA 1GQIA 1W3NA 3EOUA 2ZQ0A 1XSJA 4RJEA 3DN5A 3S5YA 4HZ8A 5FAGA 4CLMA 3AIWA 1E72M 2FAPA 4GUIA 1UPMB 4ZL1A 2WBKA 5HW7A 5HQMA 1QI5A 3U2CA 3P14A 5D05A 3W71A 2ZZ4A 5FF3A 4CVWA 3G1FA 3KCLA 1QU4A 4Y9MA 4IHCA 4TYOA 1YNPA 4LPCA 4MLRA 1EC9A 1SMDA 1MW3A 2F2HA 1X39A 1XP3A 1BHGA 3T0CA 2HPMA 2OCZA 3N6HA 1VJZA 4N7QA 1A7XA 3TJXA 4HPHA 1FTXA 5FCZA 3W70A 3OBEA 1H11A 4GJ1A 1GHRA 2X30A 1WBJA 3AFBA 4DX3A 2B5UB 3A22A 3ENLA 5I98A 3QMSA 4J5NA 3WBXA 4JFVA 3CQHA 1BYCA 2G41A 2JFEX 3GK0A 2J7HA 2OLHA 4OKDA 1EH9A 1FOBA 3GR7A 2V8ZA 1XLIA 2GPTA 2CZEA 1JXKA 4ZENA 4Z2IA 1OGBA 5E70A 1F07A 1SJCA 1MWOA 4UTKA 3WNNA 4A3RA 1PBGA 3GDRA 4NNCA 4LC6A 2DZWA 4KERA 3RHGA 1EGZA 1QHPA 2HK1A 3G1XA 3G8EA 4XQ6A 2VRJA 4GNKB 1RD6A 1C92A 1Q6GA 1R3QA 1H09A 3MUCA 4A8LA 1BEUA 4QBXA 3N9RA 4DB7A 2WVVA 4C90A 4WOZA 5E1QA 3VX0A 4O0ZA 1WXYA 4Z0JA 2NV1A 3N4EA 4XKYB 4MF4A 3M5ZA 3F4WA 3TSBA 3VOGA 3GZAA 3UI6A 4C60A 1J6PA 4ORMA 2QUVA 3EPNA 2J25A 3QLLA 2GWNA 4K36A 3G0XA 1QFEA 1PKMA 1QPRA 2XFFA 3BW3A 4J28A 2RHGA 1HKWA 3WDIA 4UTHA 2ZUVA 4I9AA 4YS1A 3M5VA 2BY0A 5HNRA 3JRKA 4X61A 3KVKA 3CAKA 3LRMA 2PWHA 3TC7A 1MEIA 1S46A 3VILA 2Y63A 4GVHA 4CD7A 3ZJ6A 3VIHA 4GHRA 1X97A 1JAKA 3WQEA 2VP8A 4MSSA 1ITQA 5FJJA 1O1HA 4XD5A 2IQ0A 3O5OA 4KH2A 2QQ6A 4V27A 2IQDA 3S83A 3LQLA 4LBSA 1UWUA 2ZDRA 5IBXC 3ISIX 2WCGA 3LUTA 4DRMA 2WVSA 3C2OA 3P8JA 5JUVA 1TV2A 2J27A 3H2OA 1ME8A 2NX3A 4MNLA 4U2YA 1PUDA 4N9EA 3WQCA 3LEPA 2FHBA 3BQ6A 1OIFA 2ISFA 1JFXA 2BVDA 4IMAA 4E4FA 1CTNA 4KCUA 3OQEA 2ZA3A 3BK0A 3TCSA 4NAFB 3L0GA 1CBGA 3C3NA 1FUYA 3VGGA 3W1NA 4NG3A 4UQEA 3EWCA 1X96A 4HNNA 3RLGA 5DMMA 3H54A 4N9DA 2V5KA 2EJ1A 3RUBL 1IR2A 1VYSX 3MHFA 4TMCA 1ELSA 3K4DA 1V03A 3B05A 5E6YA 3UXAA 1PVNA