1OWQA

Crystal structure of a 40 kda signalling protein (spc-40) secreted during involution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNFGSERFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVPAGKIAIDRGYDIAQISRHLDFISLLTYDFHGGWRGTVGHHSPLFRGNSDGSSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGQFTKEKGTLAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords signal processing protein
publication title Crystal structure of a 40 kDa signalling protein (SPC-40) secreted during involution
rcsb
molecule tags Signaling protein
total genus 119
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2003-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1owqA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1owqA01
3WEOA 1UKOA 1HP4A 5IFPA 3WNOA 1OT1A 4GKLA 2V3EA 3CZJA 1FHDA 1Q4NX 2YBUA 3WEMA 1WO2A 1H3GA 3L4TA 4MNLA 4H8UA 4TX8A 1OB0A 3BLKA 2ZXBA 4X0VA 2OSWA 4PMXA 3APGA 5D9PA 3AS1A 4P8WA 3WNKA 3AIVA 1AVAA 2FGLA 4MB1A 3O6AA 1QHPA 2J62A 4U31A 3HJEA 3M7SA 4AD3A 3RJXA 1GHRA 3O2LA 5BXPA 4RE3A 1Q6DA 2ZUNA 3VPLA 3MMWA 1UH3A 2VRKA 1M7XA 4PTMA 3CZGA 4N0RA 3WN6A 1JG9A 4AZ7A 1UA3A 1OGGA 4PSPA 3MMDA 1UWUA 3QOMA 1BAGA 1XGZA 1U2YA 4AIOA 4PEEA 1BYAA 3BAJA 2C8NA 3CMJA 2BY1A 4J3SA 3KWXA 4UFHA 5AY7A 4F8XA 1D3CA 1V0NA 1UQYA 2OYMA 4MDOA 1CXIA 4W5UA 3N15A 5DT5A 1WZAA 1TCMA 2ZX9A 5LA1A 1CGYA 2UY4A 2E9MA 3KEHA 1EIBA 1BLIA 1JF6A 3GBDA 4DWSB 1JI2A 3GH5A 5BXSA 1JXKA 3AS3A 2WC3A 5A8PA 3VMPA 4D1IA 4PMOA 2E0PA 4M56A 5CLWA 1H5VA 4MNJA 2XVLA 1QW8A 4CGTA 4GO9A 4XX6A 3W0KA 1ISWA 3OBAA 2FHCA 4BZYA 3TP4A 4MJ2A 3WNLA 3WNMA 3MO4A 1W3JA 4EANA 4B15A 2J25A 2QHAA 3PTKA 4PCTA 3WBEA 4H7VA 5A6BA 1E5JA 3UG4A 1B3XA 3AHYA 4JIEA 3GTNA 1UHVA 5HNNA 4BA0A 1E0XA 2V3DA 2W61A 1E9LA 4ATLA 1KR0A 3K8KA 1B3VA 5C8BB 4Z2GA 3CIVA 3PZVA 5M3WA 1PAMA 1KFWA 3ZIZA 4ZENA 3VIKA 3L4ZA 1CIUA 1H0GA 1O6IA 4FLSA 4LX4A 1OGBA 8CGTA 4X9YA 1PPIA 5HPCA 2VX5A 4AXNA 1DTUA 5I77A 1XYZA 4U3AA 2PF0A 3MUY1 3WSUA 4UQBA 2DT2A 5DFAA 2WMJA 1US2A 4M24A 2JALA 3WFZA 2QV4A 1XH1A 4CN4A 2J4GA 3AMGA 1J0HA 2X1IA 2A3CA 4OKDA 3QHOA 3VX0A 4LYPA 2QPSA 3WQWA 3CGTA 4P7RA 1LJYA 1WB0A 2D0FA 1JZ6A 2J74A 1PJ9A 3F5KA 3NCOA 3VGGA 3ZQ9A 1NH6A 5A2AA 2XTKA 1OT2A 3MKKA 4AD2A 1LL4A 1CYGA 5IFTA 4E8DA 1HNYA 4D1JA 4ML4A 2D24A 2OWCA 4AD4A 4W87A 1TA3A 1V6YA 5CGMA 2DSUA 1JXJA 2E8ZA 2J8FA 4PTXA 1OBAA 4TVCA 3ZJKA 2VR5A 4Z2LA 2UY2A 4W5ZA 1HXJA 4RL3A 3WH5A 2EXOA 4PCSA 5CSUA 4ZXLA 1JL8A 2CKRA 1UKTA 8A3HA 3AXXA 2J7BA 5FD0A 1GQKA 2WVTA 1ISVA 1WZMA 4XZBA 2CBUA 4W89A 3IANA 3NIYA 5E6YA 5E9AA 1E6SM 3KL3A 2XVKA 1JD9A 3AS2A 4E8CA 1OCQA 2YL8A 1VJZA 3LPGA 1UH4A 1XC6A 2W67A 1QI2A 2VQUA 1HF6A 1EDQA 3ARVA 2VCAA 1CTNA 1NQ6A 2X09A 1CXLA 3VNYA 1BG4A 2MANA 4IUGA 1JZ2A 1JAEA 3AHZA 4ATDA 1J0ZA 2VNCA 1DEDA 3TTSA 2GDVA 4GINA 2VI0A 4MB4A 1L0PA 4U2YA 2JEPA 1F4AA 1B3WA 1FHLA 2VO5A 2O9TA 3LMYA 1BSIA 2BXZA 3AIBA 3N13A 5BRPA 1E4NA 4J3WA 1JZ4A 3IAPA 3ZT5A 1QVBA 3MSDA 1R85A 3VILA 1CXFA 2XVGA 3AIWA 4WF7A 4W85A 1U33A 4Z2HA 4HA4A 2J47A 1H09A 3BAYA 3VUPA 5I5RA 3W26A 2NT0A 3T08A 3ZMRA 4GZEA 3VU2A 1QBBA 3GH4A 3ZT6A 3GNOA 2FDMA 2HVMA 1CWYA 1EDGA 5TD4A 7CGTA 1FH9A 1HJVA 5DT7A 2DT1A 3CHEA 1ITXA 1RD6A 2XIBA 3WFLA 3NYDA 4N42A 1KBKA 5A2CA 3PZQA 1NP0A 4Y7EA 2WZIA 2OYKA 4WSKA 3F5JA 5I24A 2BVTA 4W93A 3ZO9A 1H49A 3FAWA 3AROA 4OBRA 1ECEA 2E9LA 1CGXA 1HKKA 4PSRA 1IZKA 2JF6A 4H8VA 5AYBA 2YL9A 1E55A 2V5CA 5A94A 1W3LA 3MANA 3DYMA 4GIAA 1HIZA 2VZUA 3BXWA 1MQRA 2YL6A 2ZUVA 2XFRA 3UETA 3RCNA 5IDIA 1Q6FA 4LYRA 1N82A 2OWWA 1BFNA 2WKGA 2D0HA 1UZ4A 2OSXA 4TVDA 1V3KA 2FHFA 1CGVA 1FFRA 3RM4A 4TX6A 2CHOA 4GO8A 4WIWA 3OA5A 3BMWA 1EH9A 3WDRA 4R5EA 1XSIA 4PMDA 1VBUA 4WKHA 4M82A 4D6EA 2J8GA 1KXTA 1WDPA 1JDAA 4PBGA 4C7GA 5I6SA 1E6XM 3RM8A 1KWGA 4PMRA 1MQQA 5CZKA 2XWEA 4TUFA 1QPKA 4J3VA 1W9UA 1X6NA 3I3DA 1HN1A 1QHOA 1GOWA 1OINA 1J12A 4QFUA 4P8XA 4Z2JA 3EDDA 4ZE4A 4DM1A 1KXQA 4J3TA 3U5YA 4NRRA 4UCFA 2VZTA 4PRWA 3VM5A 3AMKA 2WSPA 4PUDA 1BYDA 5FCZA 3BH4A 2WHLA 1EHNA 6TAAA 4J3XA 1GONA 1KXVA 5EMYA 1BPLB 4PUEA 1OD8A 2DIEA 4W7VA 1M01A 3WD3A 3PZMA 4ATWA 3VO0A 4CU7A 4HOZA 4FK9A 1BYCA 1CNVA 1KGWA 3AISA 3O9NA 3K46A 1M03A 2V3GA 5DF0A 3WELA 3MS8A 2E3ZA 1VB9A 2WHKA 1HP5A 1WDRA 3WD1A 2XWDA 3GYCA 1GOQA 2VL4A 1GPFA 3DYOA 1JGIA 3HN3A 1ZL1A 1CZ1A 3OLEA 1ZB5A 3PZ9A 3B8SA 1DHKA 1QW9A 2ESCA 4HU8A 4WKFA 3EBVA 1UA7A 3RM9A 1G5AA 4JAWA 2V3FA 1NP2A 1C93A 3AXHA 1QNPA 3ZR6A 2DQXA 2GK1B 1M04A 1TZ7A 3AJ7A 4TTGA 4V28A 2VR4A 3GXIA 2ZXAA 3SUWA 4AISA 2C7FA 3OLDA 1GJWA 1E4MM 1V0MA 3SIMA 5BXTA 2G41A 4FMVA 1VEPA 3VDCA 4TOQA 4Z2IA 2W66A 3WH7A 1NWRA 4ACZA 5HDRA 5JIWA 3L4UA 3GNRA 1K9DA 3VIHA 3AYSA 3K8MA 3TOPA 2DT0A 1E6NA 1GNXA 2TAAA 2ZOXA 3WDIA 4A3HA 3FN9A 3N17A 4ZFMA 1ZJBA 4HMEA 2EPNA 5I79A 3ZJ8A 1E6PA 4CD7A 5IXEA 5ECUA 1W9BM 2CHNA 1C8XA 1BGAA 4JFWA 1G94A 4YHGA 1JFXA 2DIJA 2WCSA 3BMVA 2PBOA 3FHAA 1WDSA 1DWGM 4GI9A 4AD1A 3D5HA 5LYRA 1MYRA 2D2OA 2BHYA 3AMCA 3IAQA 5CSYA 1HJWA 1B90A 1CENA 1KQYA 2V38A 4DWSA 5I78A 2XFFA 4HPHA 3SURA 1HT6A 3NUKA 4DM2A 2WLYA 1JYXA 1QBAA 3AHVA 5I0DA 2XPKA 1AQHA 1E43A 1CGUA 5EFFA 2WHMA 4KRUA 2D22A 3BCFA 4U5KA 4PMZA 1C8QA 2AAAA 2WSKA 2VJXA 2WBGA 3WEZA 4AC1X 3OGRA 5D9MA 2J7DA 2XUCA 3WUEA 4NRSA 3M6DA 1WZLA 3LPFA 2E40A 3CH9A 2YA2A 5CPQA 3U5UA 5I2UA 2VRJA 4C7FA 1V08A 1VEMA 4S3JA 4LPCA 1SFSA 4JHZA 3AQUA 4MB3A 4DUWA 1C7TA 4UFJA 3MUIA 1VENA 2GFTA 3B9AA 3K4AA 1CXEA 1CXHA 5ABEA 2A3AA 3B9EA 1V3MA 2J77A 1OSEA 4M1RA 3VIGA 3CBWA 3POCA 2CPUA 4HA3A 2CEQA 1JYVA 3N18A 3WD4A 1E72M 1UD8A 2VZOA 3VD9A 5A3HA 1V6XA 1ZS2A 3AMLA 2O92A 4ACZB 1U30A 2VZSA 1V3JA 3POHA 4KGJA 5CJ5A 3ARPA 4GZJA 1CGTA 3KE0A 1WPCA 4AZ5A 4BQ4A 1JDDA 1UWRA 1V03A 1EA9C 3AZSA 3FXYA 1NOWA 4CN1A 3EMQA 3ECQA 2CBJA 2QMKA 2CBVA 2ZWYA 2ZX7A 3VIFA 3UG5A 1PX8A 1V6VA 3JUGA 3WQ4A 1M53A 1TG7A 2OYLA 3WDPP 3VD5A 1H1NA 5I3DA 3SUSA 3L4YA 4CD5A 3WUFA 1IV8A 1XCXA 4NZCA 1UOKA 2YLLA 3CHFA 1GUVA 1LQ0A 4CD8A 3BLPX 1C90A 4CUCA 3THCA 1H11A 3OZOA 5BWFA 3ZSTA 1R87A 5F7UA 3TA9A 1W9VA 5M5DA 1MW2A 1AQ0A 4URIA 1SR0A 2D0GA 2EBNA 2WC4A 2UY5A 4CVWA 5DO8A 3ARWA 4V27A 2BXYA 2ZX6A 1UD2A 2WXDM 3U57A 2VRQA 3WF3A 1UR8A 2WMFA 1KQZA 3RPMA 2XM2A 5ABFA 1UKQA 2W63A 3CHDA 4XB3A 2YA1A 4KH2A 1WE5A 4UFKA 1JD7A 2F2HA 3AMDA 2WPGA 4HZ7A 2VC9A 4AY1A 2DSWA 4PTVA 1ODZA 5KEZA 2VMFA 4AW7A 2WMIA 4UFLA 3SCWA 2CESA 1E70M 4CVUA 2YBTA 1LG2A 1CXKA 3F5LA 2D1ZA 5D8ZA 5BYWA 3ZSSA 4KWUA 4TTUA 4JL2A 2VUYA 1V3IA 4QLJA 5C71A 4JFVA 1BG9A 1KB3A 3SEPA 4HZ8A 2BV9A 3L4XA 1E15A 1OM0A 4KRTA 5E70A 4B3KA 3N1AA 4PMVA 3SUUA 4AZHA 2PWGA 5LA2A 1SYTA 4ZXOA 1DWIM 1XD0A 4NF7A 4P7QA 3TTQA 4UR9A 1VFMA 1XSJA 1EQPA 1VFFA 2DT3A 2ZXDA 4R27A 1E40A 5HPOA 4JKMA 4CN6A 4H8HA 4OZOA 1E3XA 5CPSA 3NDZA 3G6LA 4JCLA 5FKYA 3T0DA 3AZTA 2Y5EA 3A4XA 1LG1A 1TUXA 1PZ2A 1I1WA 3BAWA 3WMSA 4UFMA 1H2JA 1H0IA 3VGEA 3AHXA 2ZUTA 3T09A 3A4WA 1OGSA 1J0JA 1OD0A 1CLXA 2VCCA 4EK7A 1CBGA 5D4YA 5ABGA 3QGVA 3FW6A 4AIEA 3LPPA 2D3NA 1ITCA 4IISA 2RGLA 1AQMA 1B30A 4QCFA 5ABFB 5EB8A 3FNDA 4Z2KA 3W27A 1UD5A 3N12A 1C92A 2AOSA 2F8QA 2WYSA 1E1EA 4H04A 3NSNA 2Y24A 4IPNB 3VIPA 2WMIB 3EMCA 3EDFA 3I3BA 1O7AA 3SUTA 4D6CA 1W91A 4UQAA 1UWIA 4GI8A 4MB5A 3UERA 3SCNA 2J7HA 4W8BA 3UESA 1HL8A 1KGUA 1EHAA 1QNSA 4MJ4A 2EPKX 3WH6A 6A3HA 4PN2A 4S3KA 3NSXA 3VGDA 3W25A 3W6LA 3ZJ7A 1W9PA 3UR8A 2WMGA 3BAXA 1GJUA 1LF1A 1VEOA 3AICA 3GNPA 2WCGA 3WQ6A 3I3EA 4PMNA 4NSBA 2E8YA 5EBAA 3WKZA 4JFTA 2WAGA 5CQ1A 1MWOA 2W5FA 2WCAA 1TVNA 2VVNA 3DYPA 2DSZA 3QR3A 3PBGA 3VGFA 3W53A 1FH8A 2FH8A 2XFYA 3W24A 3MSGA 4J27A 1JF5A 2BNJA 3MV11 1KGXA 4A4AA 2VTFA 3N04A 1W3HA 5GNYA 3G6MA 3W38A 1HJSA 1UQZA 4YN5A 3SCOA 4AD5A 2Q8XA 4IPLA 3TTYA 1UWSA 4MNKA 5IHSA 1EO5A 3VM7A 1B1YA 3WD0A 4PTWA 3MMUA 3IJ9A 2GK1A 4OJYA 2ZUMA 2ZUSA 2Z1SA 3WL1A 1XV8A 2G8ZA 3OGSA 2J78A 4CCEA 1W1TA 5HBFA 1HX0A 3VNZA 1PBGA 5DEZA 2D20A 3CUFA 1E6QM 4MAVA 1J9YA 2JIEA 1E1FA 4XUYA 3WD2A 4M80A 1MXGA 3VDHA 2WW5A 1V3HA 1H4PA 4AZ6A 3SCQA 3VD4A 3WDHA 2XGBA 4Q22A 2YLAA 1MW1A 2ZICA 4HTYA 1D7FA 2A3BA 2CYGA 3ARSA 1MW0A 3PZGA 3VDAA 4B9ZA 1K9TA 5IHRA 2W4XA 3T2QA 3HU7A 2PB1A 2FH6A 2BVYA 2JE8A 4C7DA 4MDPA 3RO8A 1ISYA 4PMQA 3BC9A 4P7NA 4XV0A 1B31A 2D3LA 3K8LA 1W1YA 2XGIA 5BRQA 3GXMA 1QI3A 3PZNA 1C3FA 2IXUA 3OB8A 5BCAA 2O9RA 1PX4A 1K9FA 1XH2A 4QAWA 3DC0A 1QNOA 4J28A 4CU6A 1JIBA 4FF5A 3RIKA 4EAMA 1JDCA 3W4RA 1MQPA 2WVSA 3KZSA 4J3UA 4EKJA 3A6OA 4GI6A 4CCCA 1QNQA 4ACYA 3CZKA 4GZIA 1UD4A 3UR7A 1JI1A 3WY1A 4YPJA 4AYSA 3WUGA 4F66A 5KZ6A 3PHAA 2J75A 2EPMX 1Z32X 2BY2A 1UKPA 2WC7A 2EQDA 3FHQA 5I23A 1GZJA 3WF2A 2Y8KA 1UR2A 3L2LA 2XM1A 3WH8A 4M8UA 1V0LA 1UH2A 2G3MA 1E0VA 2X05A 3AOFA 4CU8A 1VF8A 3CTTA 1Q6GA 3PTMA 2QMJA 1HVXA 2PWEA 4KMQA 1SMDA 3NSMA 3WDQA 4UFIA 4PYSA 2VX7A 4YHEA 4UQ9A 2E9BA 2IXVA 2Y8VA 4B9YA 4MNMA 1AMYA 2ZUWA 3THDA 5A6JA 4MAZA 1HKIA 3AHTA 5JIPA 4U33A 5HOSA 1LL7A 3ZR5A 1IT0A 1UD3A 1R86A 2WWDA 4BF7A 2JIWA 4W84A 3VMOA 3FAXA 2DH3A 5GQBA 3A3HA 1FFQA 2WKLA 3CMGA 2GJXB 5E6ZA 3WMBA 5A8MA 1DWHM 1HKMA 5FL1A 3QOKA 2VURA 2J7CA 2WK2A 3S2CA 3SCVA 2CXGA 1E56A 4UQCA 1HKJA 1OIFA 2ZX8A 1B0IA 4UQEA 4OOZA 3EMZA 4HMDA 3VGBA 3WH9A 1QNRA 2WLZA 3MUAA 1BQCA 3PN8A 4AZCB 1QI5A 3EYPA 1DWFM 1B3YA 2G3JA 3AIEA 4HOWA 1CPUA 4UZUA 3GXFA 5DMYA 3VGHA 3VDBA 4GQQA 1GOMA 1NWTA 1ZBKA 4HZ6A 4JCMA 1TVPA 3K4DA 3DECA 1BF2A 2O9OA 1R7AA 1UD6A 2PWFA 1HJUA 1OIMA 1VFUA 3MUZ1 4JKKA 3BSGA 3PZTA 1KBBA 1JNDA 1EXPA 2YJQA 1YHTA 2XHYA 4EE9A 4UOJA 3RDKA 4B3LA 1V02E 4JFSA 4AZBA 1WNOA 4D6FA 1V0KA 5A8OA 4F9JA 1S46A 1X6LA 3ZM8A 1VJSA 3M07A 2WMHA 3GXDA 6CGTA 1BGGA 2WWCA 1E4LA 4BQ2A 1E6RA 4FLOA 1VRXA 2PC8A 2WANA 4H2CA 1E3ZA 2J7FA 2VVSA 3EDJA 1JZ5A 1EQCA 1W9DM 4UQDA 1J0YA 5CGTA 3WF1A 3QHMA 2Y2WA 1MW3A 3CZEA 1HVQA 3ZJ6A 5A95A 5JBFA 4D6GA 4F9DA 2BVDA 2ZX5A 1JZ3A 3UCQA 2CCRA 4U3CA 3OG2A 2XJ7A 1GQJA 3SCSA 2CIPA 4FLQA 4RE2A 3WIJA 2WVVA 1GVYA 2WB5A 3VMNA 1IZJA 3CUGA 2YDSA 2YIHA 2DH2A 5A6BD 2XVPA 1LLOA 1UUQA 1R7OA 3T0AA 4CKQA 1UYQA 2CKSA 4JKLA 2WZHA 4P8UA 2ZIDA 4ZE5A 4DUXA 4W86A 1E0WA 1W9XA 1HJXA 3WF0A 1WKYA 2ZUUA 1ZJAA 2BFGA 3WUBA 2FGZA 4K68A 3KL5A 1XD1A 3ALFA 3E1F1 2XG9A 1XCWA 4DWSC 1ZU8A 5A6SA 1NWSA 2WMKA 2J7GA 1VAHA 3W82A 1CEOA 3VVGA 1ISXA 1BVZA 2OWXA 3F4VA 3ARRA 3W81A 1BTCA 4TVUA 4BS0A 2BY0A 2WZEA 2VOTA 4WJXA 3TTOA 1Q6EA 2UWFA 1V6WA 1V3LA 4L4OA 2JFEX 3VTRA 4Q7NA 2UY3A 4OBSA 1KR1A 5D9NA 1LL6A 2AMGA 4MPKA 1E5NA 1XYFA 3ZOAA 1Q6CA 2XVNA 2EJ1A 2HISA 4AD0A 2G3NA 2BS9A 1JZ7A 2WM0A 1GOKA 2DGAA 2VQTA 2C0HA 1UWQA 2JEQA 1FH7A 4LXFA 2DPEA 3MU7A 1PZ3A 1XRVA 3VKKA 1GORA 1DWJM 5JBDA 2WVVB 3IJ7A 2O9PA 5FOOA 5FL0A 5HXMA 1NWUA 4D71A 5AC4A 1PIFA 4UZSA 1ZBWA 2PI6A 1GQLA 1J01A 4P7LA 3CHCA 4MTVA 2NSXA 3OLIA 4B16A 1I75A 1TE1A 3VIIA 3T0BA 4JFUA 4OUEA 1ESWA 4UOQA 3N11A 2G4FA 4AMCA 2ZXQA 3GZAA 3UEQA 4W8AA 1UR0A 2YKKA 2OLHA 2EPOA 3HMCA 7TAAA 1BHGA 2GVYA 1G1YA 3ARZA 3VOCA 4D6DA 2QPUA 1E71M 3PZIA 2B31A 2XIIA 4JL1A 1TMQA 4GPNA 3A4AA 3IJ8A 1ZBCA 1DP0A 1QI0A 1W2VA 4GQRA 5A6LA 1A47A 2FHBA 1RPKA 1RP9A 3SCPA 3W28A 3CUJA 3BSHA 5D8WA 3ARXA 5GNXA 3WMCA 2A3EA 3CO4A 4J7RA 4P7OA 1ZBVA 4LGXA 1SMAA 3L4VA 1JFHA 4QLKA 3ARTA 2Y4SA 1MVYA 4WLCA 4E4PA 1D2KA 5A69A 5FIPA 3WENA 3T2PA 1UKSA 2CERA 2VX6A 4NI3A 3CUHA 2EEXA 2PWHA 1GOOA 4X0NA 3ARQA 3SCUA 4P8VA 2PBGA 4D6HA 2CITA 3VIMA 1RP8A 3U7BA 4QDMA 5A8QA 3S6TA 2EPLX 4V2XA 4W7WA 1A3HA 2J79A 3DHUA 1NM9A 5CPTA 4QCEA 1LWJA 3KL0A 2QF8A 4GXPA 2EO7A 1GW1A 1E4IA 1ISZA 3VD7A 4UNIA 3RJYA 5M03A 3MV01 2ZE0A 1GHSA 2ZWZA 2A3HA 3GDBA 1GOIA 1GQIA 4BCEA 2CNCA 1CLVA 1W2PA 3AI0A 2WHJA 2DSKA 1E6ZA 4PMYA 1JNEA 4PMUA 4U5IA 3FY1A 4D72A 2XYLA 1US3A 2D23A 1VBRA 3WF4A 3ZT7A 3PZOA 4AZGA 1PIGA 5A8NA 1JYWA 1E73M 3DHPA 2DSVA 5E09A 3WBAA 2X0YA 1JYNA 3VIJA 3AIUA 2GJPA 4WKAA 4U2ZA 2YOCA 1W3KA 3GM8A 1TA3B 1UWTA 3U7VA 1W1VA 1BYBA 2VCBA 4AEFA 4QP0A 1NARA 2NT1A 3SUVA 3AIQA 2GJRA 1R8LA 1JZ8A 1VIWA 3WQVA 5A6MA 7A3HA 1B9ZA 1KXHA 2OSYA 1G01A 3BAKA 4KGLA 3LPOA 3W37A 2X2YA 3EDEA 5AC5A 1YQ2A 2YDQA 1FP8A 4OOUA 1WZKA 1F4HA 1WDQA 3WNPA 3N9KA 2X0HA 4UTFA 1J11A 2RGMA 3WQ8A 4AEEA 1FOBA 1UR9A 1QI4A 3VIOA 3VX1A 5A6AA 4M81A 2GUYA 5BXRA 1ODUA 1J0IA 1Y7VA 2GJXA 4LYQA 4OIFA 2F61A 5BROA 1MFVA 4E2OA 3AYRA 1EDTA 3ARUA 1FA2A 4H41A 3SCTA 5JBEA 2X8RA 1B2YA 3UG3A 5D9OA 2YDRA 1WAWA 5E0CA 1G0CA 1H41A 4CD6A 4XZWA 3SCRA 3OIHA 2V5DA 3AXIA 1UG6A 3WDJA 5A1AA 4FLRA 3OLGA 2G3IA 2DEPA 4LQ1A 3ALGA 1K9EA 2BHZA 4AZCA 1QOXA 1W32A 4HPGA 2JF7A 2W91A 2XSAA 5JUVA 3BGAA 2PWDA 1J18A 3GBEA 1X1NA 3OGVA 1J10A 4HOXA 1VFOA 1GCYA 1B3ZA 3WL0A 3CZLA 3WQ5A 4WK9A 3AZRA 4HA1A 1P6WA 1C8YA 3VD3A 5LA0A 4JHOA 3GH7A 1QHZA 3RILA 2CETA 3L2MA 5GNZA 5A2BA 2VT0A 1XHGA 1CECA 5JH8A 5CXPA 1EGZA 5ABHA 1TR1A 1RH9A 1UR1A 4IM4A 4M29A 1LWHA 4BQ3A 5GPRA 1NOFA 3AIRA 2WBKA 1NOUA 3NDYA 3WNNA 4AZIA 1KWKA 1UR4A 4HMCA 4DWSD 3PTQA 1BVNP 1TFVA 3K1DA 2YL5A 4L4PA 2NW0A 2GSJA 4ZEPA 5C70A 2CBIA 1L8NA 1J0KA 4W88A 3AS0A 1V6UA 2IUZA 4TXEA 1DWAM 4CCDA 5E0FA 2WVUA 5EFDA 2E4TA 1I1XA 1G9HA 3CZ8A 3CPUA 4W7UA 2VZVA 1CDGA 1XH0A 3OZPA 5A6KA 2Z1KA 1JAKA 1PX3A 2GDUA 4RE4A 1HJQA 4A3YA 1K6AA 3W29A 4UOZA 4AIUA 3RMEA 4JZ5A 3D3AA 4CD4A 4QLLA 1WCGA 1C7SA 9CGTA 4W8LA 2YA0A 1MXDA 3J7HA 1UZ1A 3II1A 1FP9A 3EDKA 3ARYA 3QHNA 1CGWA 4WSJA 2BHUA 4D6JA 1WP6A 3BCDA 1MFUA 3IK2A 4D6IA 4BQ5A 3NJ3A 1V02A 2QLYA 1GVIA 3CLWA 3T2OA 4F79A 3CUIA 3PZUA 3AFBA 1EO7A 3TONA 3VINA 3M46A 2J7EA 1OWQA 1XSKA 1HL9A 5CLTA 1PEZA 4AWEA 2DDXA 2WNWA 2W62A 4DUVA 3A47A 5M17A 5CG0A 1EOKA 5AYIA 1C91A 2BY3A 4MADA 1KCKA 1KCLA 2XSBA 3BAIA 3L4WA 4HP5A 3B9DA 2W92A 4HU0A 1EOMA 2VX4A 3W6MA 1W1PA
chains in the Genus database with same CATH superfamily
3WEOA 3GXNA 1ZJIA 1UKOA 4QZVB 2FKEA 1XBYA 1W5NA 3R13A 1OYBA 2NLIA 1X6UA 3SI9A 4CNSA 4F3HA 3RU8X 3RF9A 2QCGA 5HR6A 2DG4A 4MFDA 3L4TA 2F21A 3S47A 3B8DA 2ZRYA 4X0VA 4PMXA 5D9PA 3KAGA 1VHNA 4MWAE 1TTPA 4E3VA 4P8WA 4DQWA 4GVHA 2FJUB 2XN0A 4XSMA 3RJXA 5BXPA 3R10A 1Q6DA 1IGWA 4XIMA 4PTMA 1R9ZA 3MVIA 3CZGA 1FWEC 4AZ7A 1OGGA 4PL2A 1TCDA 4YWSA 4R3UA 2PFHA 3L5AA 4JTKA 1JULA 3AALA 2C8NA 4EWND 3KWXA 4UFHA 5AY7A 2CLIA 4JX4A 3H7UA 1UQYA 4W5UA 1CXIA 1BWLA 2D73A 1WZAA 1J5SA 5LA1A 1SZRA 3JRKA 1ZHAA 2E9MA 4EXBA 3KEHA 2ATSA 3NQGA 3FDKA 4O16A 4AG0A 1OFPA 2G4JA 3EWZA 3AXKA 4HYVA 5D2YA 3F4NA 4E8GA 3C6CA 4CGTA 3U2EA 4XX6A 3EEZA 2OFNA 1VCVA 1DJYA 1W1ZA 5H2ZA 5EMKA 4BZYA 5M2FX 3FX4A 3G22A 5C7HA 3FEQA 1EWEA 4EANA 2PV3A 3W7LA 3AHYA 3FV9A 4JIEA 2GUUA 2WM1A 1VCGA 3PAOA 4BF5A 1DV7A 4WY0F 2V3DA 5BNKA 4DRNA 4ATLA 3K8KA 5AHEA 3CIVA 3PZVA 1FKKA 1BWVA 1WYIA 3ZIZA 1CIUA 4LX4A 1FCVA 4DYKA 2MF9A 5EMMA 3PPFA 3DFOA 3EOLA 4AXNA 5I77A 3PUEA 4U3AA 1W31A 3W7MA 2DT2A 1CW2A 3DG3A 3M0ZA 1OX6A 3FYOA 1AZ2A 3WFZA 2QV4A 3UF9A 4QT2A 1L6GA 3AMGA 4D9PA 3UZ5A 2BX7A 4GRSA 3VX0A 4JEQA 3CJPA 5DMMA 1WB0A 3E0VA 3SRFA 4D8AA 2F84A 3OOBA 3Q65A 3GHTA 1HGYA 3N2TA 3MKKA 1LL4A 4E8DA 2J9XA 2VUNA 2D24A 4Y6GA 4W87A 1QU4A 1UP2A 4IJBA 1JXJA 2J8FA 4RX0A 4L80A 2YZRA 1VS1A 1I6NA 3LTPA 2UY2A 2FZDA 4Y8EA 1DIOA 1RVKA 2EXOA 1XLJA 4PCSA 3BV4A 4H2HA 3CV6A 2CKRA 3P7YA 8A3HA 3AYVA 1OG0A 3CUXA 2WVTA 1ISVA 1WZMA 3WK3A 4UTHA 4XZBA 3P60A 3UWQA 3H54A 1I2RA 2Y6ZA 3W1MA 5E6YA 2QCDA 4H19A 1DJHA 1OCQA 2GVEA 3UQNA 1UH4A 2VQUA 4AU0A 1ITQA 1CTNA 1PDZA 1Q85A 3VNYA 1RLCL 1QPQA 1JZ2A 1JAEA 1J0ZA 1XIMA 1YYAA 3TTSA 4IQ2A 2PRLA 2VI0A 4MB4A 3TR2A 2VO5A 2Y85A 4K8HA 1DVJA 4HJWA 3N13A 1JZ4A 3IAPA 4DO7A 1QVBA 1IEXA 1CXFA 3STPA 4Z1DA 4JTIA 1RBOB 3AIWA 4L6HA 1H09A 3LTYA 3VUPA 4R34A 3O5IA 4O1CA 3GH4A 3ZT6A 4L72B 3DU0A 3B8VA 2HVMA 3PTDA 5TD4A 1FH9A 1HJVA 3P8JA 2DT1A 3CHEA 3WZ0E 4JOMA 3D3FA 3WFLA 2XIBA 5HWNA 3BG3A 4ERIA 1N7KA 4O0QA 2VC6A 2OYKA 3UZZA 3UNDA 5I24A 2ZZ3A 1V4YA 4W93A 1ECEA 5J8LA 1GYMA 3MJYA 3TWAA 2E9LA 2OZ8A 2J9YA 1IZKA 3GU9A 1V93A 2FPTA 4NAEB 1P6CA 5AYBA 1DQUA 4ZPVR 3CEUA 1GEQA 1WV2A 1JGMA 1W3LA 3HGJA 3U2OA 4ZPWR 4DJDC 3BXWA 1MQRA 1PO9A 3HGRA 4YTQA 2W27A 4LY8A 2ZUVA 3KCEA 3QC3A 1N82A 2ZVRA 4TVDA 4DRKA 1V3KA 4ZR8A 4WIWA 3OA5A 1VLWA 2KR7A 4R5EA 1JCMP 1XSIA 1TJPA 5B7YA 3AU2A 1VBUA 1KXTA 4WXZA 3GNXA 4C7GA 4R53A 1AODA 4B91A 1UP0A 1EPVA 3RM8A 1JPKA 2GGJA 1W9UA 1HN1A 1A7XA 1J12A 1Q6UA 4P8XA 3XINA 3O5KA 5H1WA 3IRSA 1FDZA 2QUUA 3GNNA 2ZRVA 3GUWA 4HVXA 3AMKA 3BH4A 2WHLA 4FOUA 1ZTVA 5CCZA 1B6CA 4INFA 2C1GA 3R0DA 3TLLA 4PUEA 3GR7A 1YW1A 1UR3M 1M01A 3A5VA 2PDLA 2VDHA 4CU7A 4QEEA 3E49A 1CNVA 1MNSA 4HPXA 2V3GA 5DF0A 1K03A 3MS8A 3SGUA 3DOPA 2WHKA 1RD5A 3WD1A 3FOKA 2ZZ4A 5HW8A 4I6KA 1FUYA 3DYOA 3NR0A 2GVGA 2K8IA 3LHWA 3NURA 1V6TA 1DHKA 5DX7A 2KX9A 1B54A 2FTYA 2PDUA 3APTA 4JAWA 1I4NA 2V3FA 4QXIA 1NP2A 4E2VA 1PB0A 3S9YA 2H8XA 1VKFA 1M04A 4HBKA 4V28A 2VR4A 5DCDA 1TSIA 3W1QA 3SUWA 2R8WA 5EYWA 1GT8A 4JHMA 1EP3A 1V0MA 3DBPA 1X39A 2WO5A 5H8MA 3AU6A 4ZA0A 3FJLA 3EIPA 3O0FA 1UUMA 4ACZA 2DY3A 3TFXA 5HDRA 2YCLB 3MZ2A 2ZR6A 1K9DA 1FWGC 3BLIA 3B8IA 3TOPA 1P5BA 1XYBA 3W1TA 2DT0A 3S1XA 1GNXA 4ODRA 4A3HA 3WQGA 4BR1A 3N17A 4B4FA 3A22A 2RUQA 1YADA 1TKKA 2NQ5A 1YBQB 6PTDA 3T0TA 4YHGA 2NQHA 2HS8A 2DIJA 3BMVA 2PBOA 1SZNA 1WDSA 7REQA 4GI9A 3RAOA 4UTUA 3MZNA 1ZLPA 1CENA 1FKWA 2V38A 2X16A 5I78A 3VKCA 4HPHA 3OIXA 2V67A 2J13A 3TJLA 1Q6IA 3C2FA 4QSFA 3QY8A 5I0DA 1AQHA 1S2VA 1CGUA 1V7YA 2WHMA 3BCFA 3WEZA 3W83A 3OGRA 5D9MA 4BKNA 3R43A 2R91A 3UWUA 3WUEA 3UXLA 2FZ8A 4MMWA 4NRSA 4O54A 4C65A 2YA2A 4K7YA 5I2UA 4MWAA 1OVDA 2QCMA 5FSEC 1LUCA 4I90A 4LPCA 1EUNA 4XAYA 1K70A 2G37A 4HB7A 3N6JA 2W0UA 4JS3A 4S39A 3T8QA 7TIMA 3W72A 3DI1A 4IL0A 2V5KA 1JUBA 4LAXA 2RUSA 4ICNA 4ZO7A 3P74A 1V3MA 4QSHA 4ERGA 3PM6A 1YNYA 5XIMA 3MSYA 4M0XA 3T78A 4GKTA 3N18A 3OYXA 3EY6A 3SQSA 4IPXA 1UPMB 4EX4A 4C1NB 2Y78A 1F7BA 1V3JA 4KGJA 5CJ5A 3ARPA 2PN0A 2DG3A 3CQ0A 3KE0A 3UA3A 1Q5MA 2H8ZA 1W5OA 3E0FA 2AQOA 4AZ5A 4ORMA 3RU6A 2HPMA 4NP7A 2HBXA 3MC5A 1TWIA 3AZSA 3CS2A 4ZPTR 3BV7A 4KWVA 4MYAA 2FFIA 4A8LA 1W56A 1ONWA 1O1HA 2CBVA 6XIMA 1P5QA 3AWNA 1S2TA 5HWCA 3JUGA 3PS7A 3WDPP 1FWFC 3W22A 4NJKA 1XUZA 2QUTA 3O6CA 5TAOA 3WUFA 1UOKA 3B8TA 2F6XA 3WLPA 1DOSA 1LOQA 1N1AA 3KHDA 4PEKA 4UMCA 5BWFA 3ZSTA 3E5BA 3QGKC 2P0IA 3M0JA 4ZB0A 4F0HA 4FX6M 3UYIA 3W3OA 4DXVA 2W3ZA 5CPNA 3OQEA 4URIA 2WC4A 3E9AA 4CVWA 4DRQA 5FJTA 2I7GA 5SWUA 1DIEA 1DE5A 2GQ3A 3P2VA 4XZ9A 4WX2A 4UNKA 2Z1XA 2WMFA 4JN7A 3ZXWA 4ODPA 3CHDA 2W63A 4XB3A 3NI6A 5C9ZA 5MHBA 5FJJA 1XLBA 3ZLFA 3EWCA 1XYCA 1QOQA 4FR6A 3DXIA 5GJMA 1JD7A 1TMLA 2F2HA 3MO7A 4HZ7A 1C9HA 1OZQA 1YKWA 8RUCA 3TNBA 2VC9A 5FACA 3PG9A 2Z2AA 4QM1A 2Q02A 4LANA 2CESA 4S3BA 3F5LA 4KWUA 4E4UA 4JL2A 3FVMA 2Y88A 1Y0EA 3KHJA 3A23A 1QPNA 2VC7A 3IACA 1V3IA 2Y63A 1BG9A 1H51A 1PINA 3W23A 4RXFA 3CXOA 4C1LA 2L2SA 2R82A 4AIBA 2KO7A 4V1YA 4AZHA 3H8AA 3LHZA 4Q8MA 4QDPA 1R47A 1XGDA 3CIXA 4JQ2A 5G4WA 3W1XA 1XSJA 1VFFA 2PLMA 4R27A 1E40A 5HPOA 3E0LA 4CN6A 4H9VA 2QVHA 2BODX 2PODA 5J6EA 3SN4A 2Y5EA 1LG1A 2X1SA 1PZ1A 4XIAA 3G8RA 3WMSA 3FJ6A 4IMDA 2XPBA 4QJ4B 4X22A 1R3QA 3AHXA 5BMXA 3TCSA 3A4WA 1OGSA 3PUOA 1T11A 3JYMA 1OD0A 1CLXA 2C1HA 4OUIA 1F73A 3B03A 3UBPC 2E5CA 3LM7A 4DZHA 3FW6A 4DI9A 3W87A 1W1B1 5ABFB 3FSUA 1EZWA 1UD5A 1GKRA 4J2MA 3UJFA 1TMHA 4J4NA 1J6PA 1PDYA 3DZ1A 2F8QA 1E1EA 5FA5A 1QAPA 3SBFA 4IL2A 2HNEA 4PA8A 1IEVA 4FP1A 4O4VA 1RR2A 1TJ1A 3VIPA 7PTDA 1W91A 3SGZA 1UWIA 3GTHA 2XZ7A 3F2DA 3HQNA 3FGCA 3P82A 4V15A 4UMAA 4W8BA 4JIHA 5EA9A 3TMQA 3R25A 1QNSA 3LNPA 4MJ4A 1W5MA 3W7PA 1A5NC 6A3HA 1R3WA 4QNEA 4C6CA 5C0QA 3R79A 1XRFA 2WMGA 3O05A 1GJUA 5CAHA 1RBLA 1VEOA 1PXGA 3GNPA 3WQ6A 3I3EA 3ZVHA 6REQA 2DUXA 2TMDA 3EXSA 1I8JA 2E8YA 3YPIA 4Q8WA 2C79A 4J40A 4W4QA 2WAGA 4IJCA 1MWOA 2P0OA 2ITKA 5CZJA 2WCAA 1TVNA 2VVNA 4XG1A 1FH8A 4L3NA 3L23A 2GYIA 3URNA 4C6DA 1JF5A 4ZQMA 5DITA 4R33A 3BG9A 1C9DA 1RJQA 3MV11 1KGXA 3T55A 1XWYA 2PRMA 4Y2WA 1G4TA 2VTFA 3W71A 1Q6OA 3KDNA 3I68A 2NXIA 3N04A 5TNVA 3KBSA 1S5NA 1OFBA 2ISFA 2ZA2A 1I2QA 5GNYA 2R6OA 3EWUA 3QBUA 5ENLA 3W38A 1HJSA 1UQZA 4C6MA 4AD5A 1BRLB 1LOSA 3UCDA 3EAUA 5GJPA 3BE7A 2ADAA 1B1YA 3VC5A 2ATMA 1A5LC 4LEFA 4IIEA 1K02A 2ZZ5A 3Q67A 1T0OA 1AL8A 3FK4A 4OJYA 2H9AB 5M1TA 2Z1SA 1YTKA 3PVFA 4CCEA 1W1TA 2MNRA 5HBFA 3FKKA 5BOFA 5FF2A 1ZENA 4GYPC 1E6QM 1LBFA 3BLDA 3SRDA 3TCZA 1J9YA 2JIEA 3QZ6A 1E1FA 1KM5A 2QVNA 4XUYA 4XVDA 2C15A 2WW5A 1V3HA 1DTNA 1MEHA 3KTCA 4IPPA 2AQWA 1XJBA 2DQWA 4Q22A 3L68A 1BXCA 2BBFA 2CLLA 1MW1A 2ZICA 4DO4A 1D7FA 4ILSA 2A3BA 3FA4A 3ARSA 3PZGA 1MZRA 2YB1A 5C9WA 4B9ZA 3T2QA 3TAOA 4G1NA 3B3DA 4IT4A 2BVYA 2Z29A 4EVZA 3NGJA 2Y1HA 3LEPA 4AHQA 3AXMA 4XV0A 3GQYA 1B31A 3K8LA 3ERPA 5BRQA 1TV4A 2ANUA 3OB8A 3NO1A 4XVEA 3TN6A 1FWHC 4C6PA 1XH2A 3AAMA 4H9MA 3DC0A 3QJAA 4J28A 4LUTB 3RIKA 1GVRA 3FFSA 1QTWA 3CZKA 4ZQNA 1TVLA 3WLJA 1VFSA 3PJWA 5CAKA 3PF3A 4PUUA 3UPMA 4HBEA 4M51A 1Q7ZA 4B5XA 3WY1A 4ZO9A 4NILA 1EC8A 2EQDA 4ZQRA 4AX7A 2Y8KA 3CHVA 3KBNA 4FXFA 1UR2A 3CASA 2XM1A 5H8UA 2AAMA 3W07A 2QMJA 3BLLA 2E6AA 1K3UA 1SMDA 2GDQA 1TTIA 3AJXA 4UQ9A 2IXVA 3SZ8A 1EL3A 2Y8VA 3BARA 4B9YA 4MNMA 2ZUWA 9XIMA 3UZJA 4GVIA 1FKBA 1HKVA 3IRDA 4RR4A 2PV2A 3TSBA 5HOSA 1XISA 3M0LA 2HS6A 3W9ZA 1TB3A 2AL1A 2A6NA 6TIMA 2IMRA 3FAXA 1FFQA 2WKLA 1J4RA 1V5XA 3KOZA 3UWVA 3FAPA 5FL1A 3QOKA 2J7CA 2CXGA 4DZ3A 2DP3A 1R3TA 2B7OA 3B9NA 3VAWA 1NQKA 4PRRA 2DUZA 4R0XA 4W9OA 3Q58A 4ZB5A 4IICA 3LGEA 1QNRA 1DORA 3IK8A 1XF0A 1P0EA 3M6YA 2NXGA 4QE5A 1QI5A 1K8YA 3SB0A 4NYYA 1IIHA 4HOWA 2G3JA 2WNQA 3IV3A 1VZWA 1XBXA 1CPUA 3K30A 4JYFA 1ZAJA 1KV8A 3MI3A 3VDBA 1GOMA 4HZ6A 3OW1A 4AX6A 4HNUA 2Q3RA 3DECA 3GIYA 3D46A 1XLCA 1VFUA 5DCBA 3C86A 3BDKA 2PUZA 1QUMA 5RUBA 4GMEA 3VZZA 1TQXA 1V0KA 1YXDA 2XH0A 1X6LA 2LGOA 3EPMA 4KQNA 3W86A 3SN0A 3M0VA 4XAGA 3DGBA 3GXDA 5I3IA 1TPDA 4AEOA 3NEHA 4R7OA 2HROA 4GI4A 1E6RA 2KFWA 4FLOA 3T42A 2GOKA 4DAIA 2J7FA 2RAGA 2ISVA 4IQLA 1IEIA 1JZ5A 1W9DM 3WF1A 2PDNA 4KCWA 2Y2WA 4ASTA 3MA8A 1NMWA 2IKIA 3BK0A 2HK0A 1CB7B 4UTJA 1CI1A 4JFMA 2WJDA 2CCRA 5DBUA 1GQJA 1NFGA 5CGQA 3QV7A 4RE2A 3WIJA 2V2CA 1O5QA 4O28A 1QT1A 2WB5A 4ZOEA 3CUGA 3O7UA 2OZ0A 2O55A 4H6RA 1D7HA 1NY1A 3NDOA 2XVPA 1Z41A 2TSYA 3GX9A 3MQTA 3T0AA 3BW2A 2CKSA 5CZSA 2Y7DA 3B0XA 4O50A 1LQ2A 3DKJA 4P8UA 2ZE3A 3W7GA 4ZE5A 4W86A 1W9XA 2DW6A 2Q8ZA 4REQB 4K68A 4AHPA 1TQJA 1XCWA 5CG7A 5A6SA 1NWSA 3N6QA 2R9RA 3R8GA 1VAHA 3UR5A 1JPDX 1JCTA 1ISXA 1BVZA 1VR6A 2YB4A 2WKJA 3W2UA 3VZXA 1B4EA 4QS5A 5D37A 2NX1A 3NQFA 4TVUA 4BS0A 2BY0A 4FOJA 3WLLA 4WJXA 1NDZA 3H24A 5BOOA 2YDAA 1EBHA 4DBUA 4IFKB 2OODA 4GVGA 1AZ1A 1YLVA 4LUJA 4MPKA 3BQ5A 4PB4A 4JFIA 3ITLA 3ZOAA 2DORA 2BS9A 1HTIA 1JZ7A 2WM0A 4HN4A 2PC4A 3DG7A 4GFSA 1UWQA 5C9UA 4OWGA 1FH7A 3ZVIA 4DRPA 2Y0FA 5HW6A 2QPXA 4KF1A 4ZVJA 3LRMA 1O1ZA 3I6RA 1PTAA 1LLWA 3VKKA 5AC6A 5JBDA 4HNNA 2WVVB 4H00A 2YXOA 1FDYA 3LCWA 1A5KC 5FOOA 3MYPA 1NWUA 4D71A 4NYUA 1UIPA 4UZSA 3E5PA 1J01A 4LAZA 3DGRA 4IMEA 1I75A 4PB5A 1N2VA 3EGJA 2A85A 2YCJA 3VIIA 4N6FA 4WJ8A 5E93A 4S3DA 3H21A 4GIEA 2IKJA 5DQPA 1HUVA 4OUEA 2PF8A 4BI6A 3GVQA 5L9FA 4ZOCA 1E9ZB 3EOSA 1S38A 3N11A 1G4PA 2HVNA 4WXYA 1NAL1 4GISA 3GZAA 1G7UA 4W8AA 1UR0A 2OLHA 3HMCA 2WV8A 1BHGA 4XWUA 2NUWA 1UCWA 2DIKA 3DESA 4D6DA 2QPUA 3ATZA 3IJ8A 4UR8A 2NLYA 3MYOA 5A6LA 3TZNA 2Y5SA 3NL6A 4RKAA 4EF9A 3CO4A 4K2SA 5C2GA 3DN5A 1ZBVA 1SMAA 5LIKX 3BOFA 3MCMA 3UXAA 4IPIA 5B80A 3IIVA 3H9RB 2I9EA 1X7FA 3UZWA 3TN5A 1R9HA 2Z2UA 1FKTA 4Y96A 3G18A 1DXIA 3U6WA 3E3HA 2OOGA 3CUHA 2EEXA 4LCSA 2PWHA 3P14A 1VYSX 3V5FA 1P1XA 3ARQA 4P8VA 4Q8QA 2GSEA 3MI2A 3BJTA 3U7BA 4UTKA 4Q7BA 1V79A 1SO3A 5A8QA 3RLUA 4V2XA 3ABZA 4W7WA 1A3HA 1TWZA 2J79A 1NM9A 3ITVA 3SRHA 1LWJA 4CNTA 2EO7A 1E4IA 1SZEA 4IUOA 4UNIA 5M03A 5D2VA 4UMBA 3GDBA 3VDGA 1GQIA 4BCEA 1BKFA 2CNCA 1W2PA 2NQJA 2WHJA 3O5DA 4IP5A 1AK5A 4D72A 1US3A 4DY1A 2Y70A 3ZT7A 5BWAA 3WH0A 1E73M 4DVOA 3UY7A 2DSVA 1IXQA 4DBSA 2X0YA 3WJSA 4XZLX 3VIJA 1BD0A 3C2RA 1IE7C 1UWTA 1FQ0A 1ZALA 5U4NA 3EWBX 1F6YA 4XTIA 1VPXA 1VIWA 4C6BA 5DY2A 5A6MA 1B9ZA 3O5JA 4EPEC 2P10A 1KD0A 2X2YA 1ME9A 5I3GA 5HUOA 1F4HA 4NZJA 2CLEA 4H6EA 3N9KA 2X0HA 1GVSA 2RGMA 3NVTA 3WQ8A 4J4KA 1SW3A 1M5YA 1P0NA 3K2GA 5I09A 3VIOA 3VX1A 3RG6A 3TZFA 2JZVA 1MMFA 1J0IA 3CQIA 3GE7A 5BROA 5C2XA 2VOMA 5EL1A 1XXXA 3EEGA 1FHVA 4E2OA 3AYRA 3ARUA 1FWBC 4UTWA 1B2YA 4NIRA 3M0YA 3AYTA 5D9OA 2GWNA 3I6TA 5HTGA 1DJXA 4DEFA 1H41A 1FKHA 3WLOA 3U2CA 2V5DA 1NIUA 4IG2A 2DZWA 3AXIA 4WDWA 4FLRA 1A53A 3OLGA 7ENLA 4WDXA 3R7MA 1J4EA 1K9EA 3QPEA 3TN3A 1EJXC 1QOXA 1ZAIA 2PLCA 3LI0A 4FXRA 2JF7A 4JNZA 5TIMA 5JUVA 3BGAA 3U8GA 1J18A 3ES8A 2PMQA 2W9MA 1RVGA 3WQ5A 3EB2A 4DX3A 1ML1A 3H2OA 5REQA 5LA0A 3KVJA 3ITCA 4GXMA 5F4SA 4L7ZA 1EYWA 3VNJA 3L2MA 4RCXA 1A5UA 4WOZA 4Q3MA 2GQ9A 3JU2A 1CECA 5JH8A 3RMJA 1TR1A 5GPRA 3AIRA 2DW7A 4NZ1A 3W7KA 4A05A 2I14A 4HMCA 3OHIA 4D8LA 2ZRXA 2YL5A 3K1DA 1OX5A 2GGGA 3HBLA 2GLKA 1L8NA 3TDFA 4ICCX 4W88A 4X3ZA 2IUZA 3NZPA 4NY2A 3I4EA 1DWAM 2PGFA 4MJZA 3CQHA 3QMSA 3B06A 5CJNA 1I1XA 1G9HA 3PBVA 1UZDA 3P93A 4RXGA 4DBDA 1YX1A 1CDGA 5A6KA 4MWAD 4WHBA 2V5JA 3BOLA 3KXQA 2GZXA 3BJFA 4RE4A 5JH1A 4GD0A 4B5TA 1UZHA 2AQVA 1LWIA 3CAWA 1UP3A 2V82A 4HN8A 3QM3A 3RMEA 3FDGA 2DZPA 1NELA 3FJ4A 3NQMA 3L0GA 1MXDA 3E0IA 1A5CA 1UZ1A 3II1A 2PRHA 1CGWA 3M5XA 4WSJA 4D6IA 4QT3A 2G96A 1L2QA 5DO2A 4MFEA 2QLYA 1GVIA 2HPIA 3HG2A 4F79A 1EO7A 3NNTA 3HG4A 1XUUA 1GOXA 1T5AA 3IIPA 1HL9A 5CLTA 4AWEA 5JU6A 4LW7A 2W62A 3A47A 2AWGA 1FKXA 1DKWA 3KLLA 3BAIA 4HP5A 2OXNA 4ZMGA 4ZOBA 3S1WA 1W1PA 3O5LA 3PA7A 3KW3A 4RNJA 1HP4A 4RDVA 2FB2A 3B8WA 4IQEA 3WNOA 1UASA 1CB2A 4NU7A 2V3EA 2ZC1A 3USBA 4HZMA 4PC8A 1Q4NX 4FB7A 1WO2A 1H3GA 2IQ0A 4H8UA 4TX8A 1KCXA 1X7IA 1TCOC 2ZC8A 4HK7A 3MMTA 1IGSA 1EJRC 4H9TA 4MJMA 4L5ZA 3WNKA 5C9XA 5I3JA 4LRSA 3W01A 3O6AA 2I57A 3HJEA 1J2WA 3M7SA 3CGNA 3OYZA 4XAPA 4PUWA 2ZUNA 3VPLA 3KBVA 1S2UA 1M7XA 2Q3OA 3M0MA 3NQ6A 1R9YA 4CEXC 1R2TA 1JG9A 4U86A 3KRUA 3S5OA 5AHLA 1U2YA 2B7NA 1BYAA 3CT2A 3L66A 2BY1A 4MLJA 4GCAA 3C56A 3S8HA 2J27A 1P0KA 4AYGA 2REQB 1JCNA 3STFA 2OYMA 2PU0A 5DT5A 4HHHA 3T4CA 2ZX9A 4ODQA 1CGYA 3KADA 1AMKA 1XS2A 1PZ0A 1EIBA 1KT1A 2WJEA 1JF6A 4GHRA 1JI2A 3A5FA 3GH5A 1PHWA 3QN3A 2VGGA 1F07A 3AS3A 1TJ2A 1OF6A 3MUCA 3LX9A 1UB3A 5AYZA 2VD9A 2QGYA 3TYUA 2PPGA 4L9XA 4ONVA 3PPGA 2A7PA 4UTLA 5K9CA 1W17A 3W0KA 1WKEA 2FHCA 4G1KA 3LV6A 3TP4A 3EX6A 3NQCA 1Z9AA 3MO4A 4DH0A 2QHAA 4MWAB 4PCTA 3WBEA 5C54A 5A6BA 3VNMA 3WLSA 1E5JA 2QULA 4LOCA 3R1ZA 3VNIA 4DPQA 2YW3A 1D7IA 4TV5A 5HNNA 3RR4A 5G2WA 2W61A 2DJXA 1E9LA 1B3VA 5C8BB 2IW0A 4RUBA 1XYAA 4O14A 4GA8A 1KFWA 3O0KA 4P2VA 2C19A 3L4ZA 1H0GA 3NYZA 1SJBA 2OO0A 3S83A 3OODA 1DIDA 1Z8AA 3WSUA 3S3GA 5DFAA 2PDYA 4UTTC 1US2A 1NFPA 1XYMA 3RN6A 1F6KA 2FTWA 3W70A 1XH1A 4NX0A 1EEXA 2C14A 4MSSA 4GIRA 3FA3A 3LN3A 4GE8A 1ZFJA 4LYPA 2W6RA 4P7RA 5EKYA 4JIPA 2J74A 1PJ9A 3NCOA 1NH6A 1NSGA 1NF0A 2XTKA 4AD2A 3LERA 3G1RA 3GK0A 3PG8A 5HATA 1PBKA 1HNYA 1XPYA 4D1JA 4WQ6A 4O2TA 4GOAA 3MKCA 4XD4A 1W26A 4DJEA 3FA5A 2VHLA 4NNAA 2CZDA 2E8ZA 3KLKA 1XI3A 2YPIA 1OBAA 4TVCA 2VR5A 1AW5A 4GYFA 1JRCA 3U0HA 2PZNA 5CSUA 3E38A 4NAEA 1JL8A 2HCVA 2Z1WA 3KOYA 3BSMA 4HNLA 4AB4A 2J7BA 1JJKA 3QKEA 2A21A 3LHVA 3GNDA 5IBXC 4XKYB 3C8NA 4NZ5A 3IANA 3NIYA 5E9AA 1E6SM 2XVKA 3AS2A 1MO0A 3LMZA 4E8CA 2VGIA 4YCPA 3LLDA 3LPGA 4D8ZA 2W67A 1QI2A 4V1XA 2EGZA 2IPJA 1G4SA 2CZFA 2VN1A 1EDQA 4P5UA 1DHPA 1CXLA 3W74A 3PUGA 2MANA 4IUGA 3AHZA 4ATDA 1T6MA 3ZWTA 1DEDA 2GDVA 1RAKA 3NRKA 4ALDA 4LUYA 3F4DA 4K1GA 2QIWA 4DO5A 3N4AA 1BSIA 3DFSA 3QTPA 1UJQA 1TV8A 1E4NA 1OEPA 4J3WA 1FKRA 4DZAA 3ZT5A 3R2GA 3C52A 2XVGA 4WF7A 1U33A 4Z2HA 1YXYA 2J47A 2YXGA 1MDRA 5TQLA 3ATYA 4GZEA 2Y7GA 2FDMA 2X1UA 1CWYA 1EDGA 3DH7A 4LALA 7CGTA 2QCEA 4IIGA 4TYOA 1RD6A 5LNRA 3M0HA 2FB3A 3PBUA 4GABA 3G24A 2C3ZA 3PZQA 1NP0A 3PR9A 4XD5A 2A2IA 3CL7A 3F5JA 2YCIX 2A7NA 5DMLA 2HRWA 4OBRA 2WNNA 1KNWA 4XTDA 3KS5A 1HKKA 2OT0A 3MDUA 3IJ6A 4H8VA 3GXTA 1PV8A 4TX9A 2Z2BA 3VUSA 1Y5WA 1SO4A 2E6DA 1HIZA 2VZUA 3V18A 4NJJA 1CCWB 4PUKA 3CL6A 2YL6A 3T9PA 4FSAA 2XFRA 3FVDA 1UW9A 4ZGYA 1JUEA 2OWWA 3GDRA 5AHNA 3PBWA 1S2CA 2ZZ1A 5LIXX 1FFRA 3VOJA 3BMWA 2CW6A 2H90A 5EPDA 4Z42C 3N3MA 4D6EA 1WDPA 4PBGA 1JDAA 5I6SA 1E6XM 3PBYA 2Z24A 3BURA 4RV3A 1MQQA 5CZKA 4GJ1A 4Q6XA 1X6NA 3I3DA 4C5YA 1QHOA 2N87A 3STGA 5G1TA 1YBQA 1HGWA 4QFUA 4HHMA 3EDDA 4DM1A 4C6FA 3U5YA 4PRWA 3PANA 3VM5A 5E1QA 4XSLA 2WSPA 5FCZA 6ENLA 3SY5A 1FJDA 3ZVHB 6REQB 5KSWA 1KXVA 4GG9A 4C91A 2DIEA 4W7VA 1TPWA 4JTSA 4QNWA 1Z6KA 4H83A 4BI7A 4C02B 3KBMA 1JCLA 1KGWA 3K1GA 3K46A 4XO7A 3TYCA 4HHLA 4DRHA 1YE6A 1VB9A 1SQ7A 4ERAA 2XWDA 1OQFA 1DQXA 1GPFA 2DZBA 4HGXA 1JGIA 3HN3A 3SIZA 3BL3A 2I5GA 1ZL1A 1SW0A 5I7GA 4X9SA 3B8SA 1B3OA 1NTHA 4HU8A 4WKFA 3R5EA 4HSNA 1E9YB 3KOWA 3M41A 4LV4A 2CLOA 3O8AA 3W2JA 4GGBA 1TZ7A 3WLNA 4AISA 3OLDA 1GJWA 1W5PA 1OFOA 8XIAA 3SIMA 1VJIA 2G41A 1PL9A 1VEPA 1VCFA 1I2PA 1NDVA 3IJIA 3S5YA 3L4UA 1Y65A 1W8GA 2IQDA 4KS0A 3KCLA 4R85A 1RZMA 1SJCA 4AWUA 4L64A 1E6PA 5ECUA 3D0CA 3K4WA 1GW9A 1LP6A 3FHAA 3AMCA 2NWRA 3IAQA 1HJWA 5FEXA 1KTCA 1XCFA 3DUGA 1KQYA 3GDTA 1IT8A 3SJNA 3GXPA 2XFFA 3HA1A 3REQA 1J93A 1R2RA 3L9CA 3NQ8A 1VD6A 1AD1A 1QBAA 2XPKA 1OZMA 4GY1A 3KOFA 4FNPA 1E43A 5EFFA 3MWAA 1IT7A 4NXKA 1P7TA 4U5KA 4GNVA 4GUJA 4AC1X 1SR9A 2OGJA 2XUCA 4XAZA 3ZZ1A 4RPPA 3M6DA 2FYMA 5B8IC 3U5UA 4PTDA 1IR2A 4CQAA 3V75A 3LU2A 1EX1A 1EPXA 1UC5A 3XISA 4NNBA 4W9QA 1C7TA 4UFJA 1VENA 2F6UA 2RHGA 2ZQSA 3MUIA 5AZ0A 1KM6A 3QQ1A 1CXEA 2A3AA 2J77A 2GGIA 4M1RA 3CBWA 2FFCA 3POCA 2DZSA 3BICA 2NUYA 4HKPA 3DG6A 1E72M 4IWWA 1UD8A 1EGVA 5HUPA 4F2BA 1H7WA 1ZS2A 2O92A 4X2PA 4J1OA 3W2KA 1U30A 2VZSA 3HPAA 3UP8A 3BLFA 1R0MA 1S5MA 2Z00A 1CGTA 3RGCA 3OZYA 4KWOA 1JDDA 1UWRA 1V03A 1D7JA 3FXYA 5T26A 4WY0A 3EMQA 1YDYA 1N8WA 3E2RA 3ECQA 4G2PA 3ZFHA 2ZR5A 1Q6RA 2IS7A 2ZWYA 2ZX7A 4QQUA 3VIFA 3P62A 4L6OA 1V6VA 4XD3A 5T9CE 1TG7A 2OYLA 3R8HA 2BZNA 1F3EA 3DIPA 5I3DA 1GUVA 3UNTA 4C6KA 4CD8A 3MKVA 4HYRA 3MP3A 2QCCA 1R87A 2P3EA 3N2BA 1KRMA 5M5DA 2V68A 1MW2A 1Q63A 2D69A 1AQ0A 2D0GA 2EBNA 1SGJA 3NWRA 2UY5A 3F2BA 5DO8A 2CLPA 3N4EA 2BXYA 2ZX6A 3CAKA 1OJXA 3RLHA 2VRQA 4LT9A 2QCNA 1KQZA 3RPMA 1ZNNA 5ABFA 1UKQA 1QASA 3QR0A 3GG1A 3MHFA 1WE5A 1ZZMA 4UFKA 4PE8A 4GFIA 2IKHA 3L21A 3HFYA 5DANA 1EZ2A 1ODZA 2R1MA 4POCA 4AW7A 1A5BA 3H6OA 1UBPC 3TW7A 2YBTA 1LG2A 5D09A 5DBTA 2VEKA 1A0CA 3OO2A 4MGVA 4KT2A 1ZCOA 4GYJA 4L1GA 1X8FA 4JFVA 3PB0A 2PTDA 2BV9A 1TV2A 1E15A 2HEJA 4KRTA 5CPMA 5D75A 5E70A 4B3KA 3N4FA 4N6EA 4NI8A 4WDTA 1TO3A 5LA2A 3GG0A 4ZXOA 2B81A 3S2LA 4Q6JA 3URBA 4NJIA 3TTQA 3BLEA 4ZQOA 1PCWA 1EQPA 2IPGA 5CPLA 3W7QA 4OV9A 4HD5A 4MKNA 1KFLA 2PU1A 3ZR4A 3R11A 2QGHA 4ROQA 1M41A 4KETA 1YPXA 4H8HA 3MPGA 4OZOA 3ZYZA 1A3XA 4UNLA 4FO4A 1SUXA 4FEZA 3T0DA 3GC4A 3GFYA 1J96A 3VNDA 2MUCA 4DF1A 3TQVA 4QTGA 4IHCA 4MLRA 2XP6A 3VFCA 2CZ5A 1G67A 1H0IA 2FIQA 4BF9A 1KLYA 1HZYA 3R58A 3RX4A 1J0JA 3TTEA 3L12A 3GU0A 1CBGA 5D4YA 2Z6JA 3NO5A 1DQWA 4F40A 3QZEA 1ALDA 4IMAA 3EA1A 3FYYA 5ECVA 4Z2KA 1WQ5A 1L6WA 1L9WA 3C2YA 2PCQA 3W1RA 4KQZA 3B4YA 4W9TA 2WYSA 3LHTA 3E12A 3GU2A 2NX3A 2WMIB 5K4ZA 3EMCA 5HUAA 3I3BA 4PCPA 4D6CA 1XLAA 4UQAA 3CK5A 5HANA 1TWSA 1XGEA 2J7HA 3LY0A 3UESA 3PK7A 2OJPA 4JTHA 3NSXA 3LZ3A 4O1BA 1LLZA 3TSMA 1XQLA 3COTA 1LF1A 4HHPA 3P80A 5G4HC 4PMNA 5EBAA 3WKZA 4JFTA 3UW6A 4UIOA 2W5FA 3VGFA 3W53A 2FH8A 2P88A 2XFYA 1WXJA 2WSQA 2C6QA 4M5PA 2WSYA 3B0PA 1NVMA 1K77A 1LYXA 4OTKA 2Y89A 1X38A 4PUNA 4MZ8A 4MKVA 4AFYA 1U1UA 3WJWA 1AW2A 4YTTA 5F4XA 4LB3A 2PE4A 1D3GA 4A35A 1Q7QA 4C6IA 2ONEA 3SCOA 3UCCA 3QLLA 3GFZA 4IPLA 3TTYA 3FKRA 1EYEA 1X96A 5FAJA 3T44A 4H1ZA 2RDTA 3WD0A 4PTWA 3PJTA 3IJ9A 2GK1A 4E2DA 1R3YA 3HF3A 3EA2A 3O5FA 1XV8A 2G8ZA 2J78A 2CWNA 3V0UA 2INZA 2QCHA 3VNZA 1PBGA 5DEZA 2D20A 3VE7A 3OEXA 2BB0A 3S2NA 5JXQA 3W2MA 3WD2A 4M80A 3DDMA 3GIPA 4F2TA 2PDIA 1SJDA 2X0SA 2XGBA 4B2DA 3RX3A 4HTYA 5C6MA 4RDWA 2CYGA 3HU7A 4J9JA 4XZNX 1ZQ5A 2EPHA 3TU9A 2G0WA 4C7DA 4NJGA 2EF9A 5D2TA 3LGGA 3B97A 4QAIA 1ZJHA 4P61A 1H7OA 1L2UA 3R12A 4UUIA 4PMQA 5CJMA 1EXBA 4P7NA 4B5NA 1O66A 4NG3A 3UA4A 3E0WA 3OOQA 3HV9A 4HNTA 3GXMA 4N9BA 3MW7A 1C3FA 5FEZA 4FHAA 3GW0A 2BMBA 1V8EA 3W4RA 1MQPA 3KZSA 4J3UA 4EKJA 4PH6A 1AQFA 5D33A 1TRIA 4GI6A 4ACYA 4Q8NA 2A5HA 3NGFA 1BVWA 3UR7A 1TPUA 4RK8A 1Q2RA 4Y9AA 4F66A 2J75A 3W00A 1UKPA 2PTXA 3HPXA 4GVFA 3L2LA 4HNVA 1V0LA 2G3MA 2J88A 4ZCWA 1E0VA 2AGTA 3AOFA 4CU8A 4MIMA 4JTRA 1Q6GA 3JYJA 3IWPA 5BW6A 5C2CA 2POZA 3GIQA 1GGOA 4UFIA 4JTQA 3UQBA 3OU8A 3ES7A 1VPYA 4H9ZA 1TUFA 2HMCA 3T40A 2CLKA 4Q4PA 5HJYA 4G8TA 1MRAA 3O16A 4AWSA 1IT0A 1IZCA 1W8SA 1R86A 2EG8A 4O17A 2JIWA 2PURA 1R3SA 4W84A 3PRBA 4IH3A 3A3HA 4JTJA 1G4EA 3TUUA 4MY8A 2OZTA 5A8MA 3UVAA 1DWHM 1XIJA 2WK2A 3SCVA 1MXSA 5T9BG 1E56A 1RPXA 1FWCC 4CNPA 2ZX8A 3QH2A 4UQEA 3EMZA 2DVTA 4HMDA 3ABQA 2WLZA 3OBKA 2SFPA 2VD8A 2GWGA 3MUAA 1BQCA 4LF2A 1H5YA 3IV8A 1B3YA 2PPPA 1OK4A 1BSLA 3U48A 1V77A 3GXFA 4IOTA 4GQQA 1ZBKA 4FXSA 3PPHA 1L6SA 2RQSA 4JCMA 3RYSA 3NVDA 2PWFA 3E2QA 1OIMA 2X2GA 3MUZ1 4X63A 2R24A 4K39A 1JNDA 3W02A 1YHTA 4EE9A 4UOJA 4MF4A 2DG9A 5DMNA 3W7JA 1V02E 3ZLHA 4JFSA 2D2GA 4G50A 1XIGA 4GGHA 3LUOA 3W7IA 5A8OA 4F9JA 4M3PA 4IFKA 1W37A 3ZM8A 2WMHA 4FZIA 2OKTA 1FVPA 2M2AA 2RH9A 1E4LA 4BQ2A 1RQHA 4X61A 2PC8A 3MCNA 1X1ZA 1E3ZA 2VVSA 4KEMA 4UQDA 3EOUA 3MB9A 5CGTA 3CZEA 1HVQA 1DJIA 3ZJ6A 4JTFA 2XGZA 5JBFA 4D6GA 2O4MA 3H2NA 2QNEA 1P43A 2ZYFA 2BVDA 2ZX5A 1JZ3A 4I5XA 1F3WA 2HDJA 3UCQA 2XJ7A 4A3UA 2VEIA 2CIPA 1W3IA 1FY6A 4UC5A 3HGOA 1W3NA 2WVVA 3IJQA 3W7HA 2WPBA 2V69A 3LOTA 4F0LA 3ICJA 3EB4A 3VMNA 1IZJA 2BOGX 5CBIA 2VEFA 2EG6A 5A6BD 2HSAA 1UYQA 4UTIA 4BI5A 2WZHA 3C4UA 1LDCA 1E0WA 3ITTA 2DJLA 3GWQA 1D7KA 1WKYA 3QLDA 3UF8A 3G1SA 2ZUUA 1U79A 1FWRA 1XIFA 1FWNA 3G1FA 4GH3A 4WGHA 3SY1A 5HW7A 3UQIA 3LLFA 1CEOA 2QF7A 4NHVA 4OE7A 3S5SA 3F4VA 2XU2A 3QGAC 3W81A 5DY3A 1FWDC 3PUDA 1S5WA 1GQNA 1HQTA 2E7FA 2WZEA 4EPKA 3S9ZA 1TR9A 3TTOA 1Q6EA 4H4IA 2JFEX 4MWAC 3VTRA 5A8GA 2DZXA 2UY3A 1KR1A 3M7WA 1LL6A 4TR9A 4DJED 2XVNA 2OB3A 2PGEA 4GUIA 3TYAA 2FVKA 2VXNA 1DL3A 4I7WA 1TPVA 5AC7A 1VLIA 4K8GA 3SJ3A 2OEMA 2MLYA 3MU7A 5HINA 1PZ3A 2X7VA 3BOXA 3P8IA 1GORA 2AL2A 3LCFA 3EX3A 3KABA 5F1VA 3ITGA 1M7PA 5FL0A 1H1YA 5HXMA 4GYKA 1UMLA 4S1FA 1QPRA 1ZBWA 3M44A 1WA3A 3EX4A 2F6KA 4OVXA 3OLIA 4NZ4A 1TE1A 3T0BA 1ONEA 2C16A 1P1MA 3N2XA 1WX0A 2QDGA 1T96A 4Q8VA 2F7FA 3GTFA 1CT5A 3ITYA 1P6BA 3RUBL 5KETA 2OEJA 4AMCA 2ZXQA 3UEQA 3ISIX 4IMGA 3KVMA 1ONRA 3ARZA 1OY0A 1E71M 2B31A 4IZGA 2XIIA 4JL1A 3C8FA 1OC6A 1Y8BA 4GPNA 3A4AA 1DJZA 1QI0A 1PTGA 5I03A 4LS0A 3UI6A 3T6CA 4LFYA 1U5HA 4BFAA 4J7RA 1OFQA 1POJA 3L4VA 4IXHA 1WXYA 4QLKA 5FAGA 2ZTJA 4FA3A 3IVTA 3M47A 1O5RA 4WLCA 4E4PA 3EX2A 4LCQA 4O53A 1D2KA 5A69A 3IJLA 2LKNA 3WENA 4IQDA 2VX6A 4IFRA 2RJGA 4NAFA 2I9UA 4H9XA 5CSRA 2ZFAA 3EKLA 3PRDA 1XP3A 3G3DA 3BW4A 4UCGA 5H6HA 4AAJA 4D6HA 1RP8A 3S6TA 1O60A 3QF0A 2GPTA 4J5NA 3CB8A 3KL0A 4JDYA 3RO6A 1IXNA 2NWSA 4TW8A 3IGUA 4H9YA 4I9JA 4C90A 4EOUA 2C91A 4Y9NA 4RW3A 1CLVA 1W1IE 3D6NA 3M1ZA 3FY1A 4U5IA 1KRAC 1O12A 2D23A 2XH7A 4GY0A 1GJPA 4ADSA 5E09A 3VK5A 3WBAA 4LVAA 4OBTA 2XP8A 1WUFA 4WKAA 1GEHA 2YOCA 2VWSA 3E6EA 1A80A 5FF0A 3IJDA 1OC7A 3GM8A 3UJSA 2Z7GA 4YYFA 1YATA 2YFOA 4QP0A 3PAJA 3AIQA 4CEUC 3PY2A 1R8LA 5AFDA 1JZ8A 3N3TA 3WQVA 5A5WA 1JPIA 1DXEA 3KCOA 1O5XA 3LB0A 2KE0A 3BAKA 4DPPA 2PLJA 3TJIA 5AC5A 3G0SA 1PHQA 1EWDA 3KBWA 4OOUA 5I3KA 1WZKA 1L6FA 5LNVA 1ME7A 1ZP3A 1YDVA 4AEEA 1FOBA 4ROPA 1UR9A 3VOIA 1QI4A 1TX2A 1M1BA 4EXAA 4KPLA 5BXRA 1ODUA 4OIFA 2QJGA 1EDTA 1FA2A 4H41A 3SCTA 2EG7A 1IEQA 1Z3NA 3CTLA 3UG3A 5LGXA 3O5MA 3ZLGA 1WAWA 5LIWX 1G0CA 2ABAA 1TELA 2WNZA 5LXXA 3TW9A 4ZB2A 4W9PA 1XG4A 3WDJA 1TIMA 3R4IA 2G3IA 2DEPA 3ALGA 2QT3A 4PL1A 1W32A 2XPAA 1RALA 2B7QA 1TREA 3SFWA 4HPGA 3GBEA 5K3VA 1GCYA 1B3ZA 2CFFA 3AZRA 1TTQA 1IXOA 4HA1A 1C8YA 3O07A 1GWJA 4WCJA 1QHZA 1KA9F 4Q7IA 5HNTA 4JTAA 1ELSA 4GK8A 3V7PA 1XLKA 2VFEA 5GNZA 3S4TA 1EC7A 2VT0A 2WSRA 1AH3A 1XHGA 2ALDA 5F2IA 4HMNA 2OELA 1EJSC 3KS6A 4PCNA 3GVGA 1AH0A 1NOUA 3IUHA 3NDYA 1MI3A 1UR4A 3BZJA 3I4KA 3VCRA 1BVNP 1J8VA 3HPZA 1BTMA 2CZEA 3W84A 1L6YA 2CBIA 1RUSA 3QSRA 5U7SA 4TXEA 3TK7A 4CCDA 4AHOA 2WVUA 4QG9A 4JGDA 7ODCA 2PTZA 2CXEA 3CZ8A 3CPUA 3NAVA 4W7UA 3NPUA 4O8RA 1FX6A 1QOPA 3DHFA 1AJ0A 1QPOA 2ALRA 1I2OA 2P8CA 4K3ZA 1JAKA 3TA6A 4GLEA 2MPHA 3KWSA 4UOZA 1BKSA 3TC6A 2OQHA 4PCFA 4AMAA 4JZ5A 1N55A 2OFJA 4ZSUA 3J7HA 4IF2A 3EDKA 5KINA 3LBCA 2RDWA 4DWDA 5HT1A 5FI8A 2BHUA 2REQA 4E3TA 4BQ5A 3NJ3A 3OZMA 1KKRA 1EBGA 1V02A 3SM0A 4OV4A 3LCGA 5I98A 3TONA 4JEJA 1FCBA 3RCMA 3M46A 3H4XA 1XSKA 3UVIA 4JIRA 1HKWA 5AHIA 3D47A 1PCKA 2DDXA 5HMSA 5M17A 2V0TA 1EOKA 4AC7C 2BY3A 1QPFA 3BW3A 4MADA 1KCLA 2XSBA 3L4WA 1XIDA 5G1MA 1X8CA 1FWTA 3TYZA 2TPSA 3W6MA 2Z1BA 1XINA 1WBHA 2NV2A 2XFWA 3P0WA 3G8EA 3B05A 3AC0A 1OT1A 2O4QA 4GKLA 4XUGA 4Q8OA 3SAZA 1F2JA 1EF3A 1A5SA 5F2LA 1FHDA 3PULA 3U9IA 2DVUA 3WEMA 1H7PA 4MNLA 1H7RA 2BASA 1OB0A 4EPBC 3BLKA 2VGFA 2ZXBA 3RK8A 1Q4WA 3KRBA 3APGA 5D38A 2WQDA 5I00A 2V9DA 3TQ0A 1EC9A 5HA7A 1MDLA 2FGLA 3ITOA 5AVHA 4MB1A 1OFRA 1JCXA 4RZ6A 2J62A 5LZLA 1PKYA 2TRSA 1X98A 3O2LA 1PKMA 3KVLA 3QW3A 2ZDRA 3Q37A 4UDMA 2MLXA 3O5GA 5DELA 2QR6A 3IK4A 4JTLA 3WN6A 1UA3A 2HTMA 3MMDA 3QOMA 2YFNA 1S5VA 5HMDA 1XGZA 4PEEA 1TZ9A 1Q8AA 3CMJA 2RUDA 1GVEA 1A0DA 2D9FA 3KZPA 4RNIA 5CZ0A 1V0NA 4XZIA 1HG3A 1TCMA 4LVGA 2UY4A 3QZAA 1G6CA 3OG3A 4N02A 4TU1A 3MHGA 2FLIA 5BXSA 4K7VA 3REQB 3EX1A 1JXKA 1YNPA 2WC3A 2V5LA 1KM3A 4D1IA 3TQPA 3JR2A 4YNGA 4DT4A 4B92A 4HSHA 4MNJA 1QW8A 1P7TB 2R1NA 1LTDA 4GO9A 4LBUA 2XIOA 4L6DA 3WQDA 4MSPA 2ZTKA 3M0XA 4MJ2A 3WNLA 4QQ3A 1W3JA 4B15A 3G5EA 4XKYA 2HWGA 3PTKA 4ZODA 4H7VA 3UG4A 4E0CA 1FKDA 4CQ8A 1XLIA 1P0DA 1UHVA 4M6QA 3PB2A 4BA0A 3TC3A 2EKGA 3V3WA 4A3QA 5LHEA 4DXKA 4DBWA 4Z2GA 3TKFA 5F2MA 2HK1A 3VZYA 5I07A 2J9ZA 3MWCA 1PAMA 4FS9A 2P76A 3PWGA 5G2HA 3B7XA 3TE9A 3S1VA 1Z44A 4ZENA 3VIKA 1O6IA 4FLSA 1OGBA 1PPIA 3EKGA 3GKAA 2PP3A 2XH2A 3M64A 1E0TA 2G95A 5DXXA 3W7NA 4BEUA 2JALA 2OX1A 1C9WA 4JIIX 4PODA 1J0HA 4DZIA 2A3CA 4N9CA 4OKDA 5XINA 3QHOA 2QPSA 3WQWA 1LJYA 4WY0B 2Z26A 1JZ6A 4IIDA 1XG3A 4TV6A 3Q45A 3VGGA 4YCOA 5A2AA 3MHUA 1OT2A 1FKJA 3QY7A 2CWXA 2P4VA 2ABBA 3LDVA 3N9RA 3QW4B 2J8TA 4GJJA 4N9DA 3ORWA 1D6OA 4LNYA 4PTXA 3IS4A 1PKNA 4Z2LA 4W5ZA 2J24A 1HXJA 4JR5A 3WH5A 1F8AB 4PFMA 2P5NA 4OQVA 1KO0A 2FGBA 4DF0A 1UKTA 4A22A 5FD0A 3H12A 3W1UA 1GQKA 4YIWA 1WBJA 1CLKA 2CBUA 2Q09A 1EP2A 2Z0IA 2YL8A 2ZRZA 4Q8TA 2HJPA 1JNSA 2VCAA 3AWOA 1NQ6A 2X09A 1UJPA 5D02A 2VEMA 4CNOA 2V30A 1YTDA 1OYAA 2OZ3A 5IOBA 1TPC1 4O8AA 2ODOA 4QHRA 1PWMA 1K4HA 4GINA 3IHZA 1L0PA 2CLFA 2OLSA 1FHLA 3W7EA 2O9TA 2HNHA 4QITA 1M9HA 2VGBA 2X1TA 3AIBA 4G6CA 3NL5A 5BRPA 4IX2A 3TVAA 5HKGA 2RDUA 1ZPTA 1R85A 3VILA 3BG5A 3GPKA 4DUOA 1FWAC 4W85A 4PZVA 4LSBA 4O0ZA 4C6NA 3QXBA 3BAYA 5I5RA 2WJFA 4MZYA 3W26A 3QMRA 3T08A 5J5RA 3O5OA 1BEUA 4B2DD 1F5ZA 2JK2A 4E6MA 3W1NA 5DT7A 3BJSA 1ITXA 2QJIA 3N34A 3UQAA 3STCA 1U83A 3T07A 1KBKA 3GZ3A 1OK6A 2WZIA 4WSKA 4HNCA 3A64A 2BVTA 3ZO9A 1H49A 3FAWA 3AROA 3LCXA 1KM1A 2Y7FA 4PSRA 3NQVA 5KZDA 1K8CA 4GZ7A 2JF6A 2Y62A 4XBSA 1E55A 5A94A 4N9EA 3DYMA 1RY8A 3URQA 3UETA 5AOUA 2R1KA 1Q6FA 4B5WA 1BFNA 2Z27A 2WKGA 1WDWA 2D0HA 1UZ4A 2OSXA 1T8QA 3M5VA 4LAOA 1CGVA 4TX6A 4GO8A 1EB3A 3E96A 3CMFA 4WKHA 1DJWA 2J8GA 3WLQA 4J3ZA 3IGSA 1KWGA 4UBPC 3P84A 5BRBA 3CQJA 2E28A 5MKGA 4J3VA 4FXJA 1SSGA 1GRJA 1Q6HA 2E67A 3S6OA 5K9XA 4Z2JA 4MG4A 4US5A 4ZE4A 2X41A 2V5BA 1WOAA 2AKMA 1KXQA 1SZFA 4UCFA 2I17A 4ZZ9A 3MCOA 3I7QA 1EHNA 6TAAA 1UOZA 4J3XA 1U1HA 1UWAA 1GONA 4PUJA 1D8WA 3QV8A 4Y9PA 3DBNA 5EMYA 4PR4A 3EWDA 1BPLB 1OD8A 5HWJA 3IARA 1KM0A 3TOYA 4ATWA 3ELFA 3F4WA 3VO0A 3THAA 4BWLA 2OO6A 4KEZA 4HOZA 4S3AA 4FK9A 1DXFA 3PJXA 2YR1A 3KM8A 3AISA 1YPFA 2ZQVA 1M03A 3WELA 1HP5A 1WDRA 4ODOA 4O1EA 1TJRA 3O3RA 3W7RA 2Y8UA 4LS2A 2X40A 2BGSA 1ZB5A 3PZ9A 1QW9A 5AKQA 2ESCA 3EBVA 2VM8A 4MPQA 1UA7A 1G5AA 2GGEA 1W6TA 1FD9A 3UXKA 1C93A 4LAVA 2GK1B 3AJ7A 3VKAA 1XKJA 3GXIA 2ZR4A 2ZXAA 1GG0A 2C7FA 1E4MM 3TXZA 3CV2A 3HO8A 3TMLA 2FKPA 4DIPA 1US0A 5BXTA 3M43A 2ICSA 4Z2IA 2W66A 4Z1BA 1NWRA 4UTWC 4KRZA 5JIWA 3O5PA 3A3WA 3VIHA 3A21A 1E6NA 2RURA 2TAAA 2ZOXA 2YCEA 4IGSA 3FN9A 4ZFMA 2TYSA 3WLMA 4NNRA 5I79A 3ZJ8A 4JQ1A 1YW5A 2OX4A 3RX2A 4CD7A 5IXEA 4ZFCA 3NEVA 1G94A 4PRTA 2XP3A 4AY8A 3BZGA 3QSTA 1FDJA 3D5HA 5LYRA 5FSDC 1MYRA 2D2OA 4GJIA 2BHYA 5CSYA 3DCPA 1GPWA 4MGGA 4IT1A 4DWSA 3PNUA 1M3UA 1HT6A 1OABA 5H8PA 3NUKA 5KTLA 4KBXA 2WLYA 1Q1CA 4IIHA 4Q4SA 2PDCA 4DAFA 1RHCA 6XIAA 5FESA 3N2MA 1DE6A 3VA8A 2WJZA 1C8QA 4GGQA 2VJXA 3UXDA 3HGSA 4PTNA 5C7VA 4DF2A 2J7DA 4L56A 2VEPA 3LPFA 2D2JA 5IM51 3OVRA 2VRJA 3N14A 1VEMA 4S3JA 4QG8A 3AQUA 3KAIA 1RJRA 4FAMA 1FWWA 2GFTA 3B9AA 1J5TA 5LIYX 4DJFA 1DJNA 4AVNA 4XAFA 3G1HA 1EJVC 3LQLA 3VIGA 1EIXA 4GUGA 3EOOA 3H2FA 4BK9A 2FVMA 2CPUA 3VE9A 4LUSA 3R0UA 4HA3A 2CEQA 3WFAA 2ZDSA 1JYVA 4IFOA 3WD4A 1QMLA 2VZOA 4A2RA 5AHFA 3LSBA 3VD9A 5A3HA 3BO9A 3DFTA 1V6XA 3AMLA 1ZP4A 4YWIA 1RK5A 3POHA 3U4FA 1QZ2A 4GZJA 3CUZA 1WPCA 2OR2A 4BQ4A 5KITA 3BWWA 5PTDA 2ZZ6A 3JZUA 1ZSXA 1L8PA 5LIUX 2QMKA 1W3TA 2XN2A 5HNUA 1G69A 1VH7A 3WLKX 2XIJA 3W1LA 5HJLA 4QE1A 4YJ5A 3WQ4A 3E2VA 1H1NA 1QK2A 4A3RA 3SUSA 3RRAA 4CD5A 2O56A 1XCXA 2NQ9A 4NZCA 1LQ0A 3O5QA 2OOFA 4FNQA 1C90A 4CUCA 4ZSTA 2QAFA 2ISDA 1UROA 4MYXA 1VFHA 5E0KA 1RXOB 5F1UA 2Q8LA 1UC4A 5L6UA 5LNSA 3VCNA 3SADA 4ZS6A 1NU5A 4QROA 3JS3A 3KP1A 2IPFA 3A24A 3LCHA 1Q45A 3TJXA 1I0DA 4ICMA 3OP2A 2PDGA 4HBOA 1GVOA 2BP1A 2WXDM 4F48A 3HFTA 1XM3A 3HTWA 2YW4A 1ZCNA 4KIEA 3O63A 4LBRA 4KH2A 1YNQA 3CNYA 2WPGA 2OQYA 3G1YA 3DERA 2BGNE 5KEZA 2VMFA 2WMIA 5K4XA 5K9DA 1E70M 3PSVA 2D1ZA 4RLIA 5D8ZA 1FTXA 4R9OA 4TTUA 1A5MC 1E51A 4N2YA 5GJNA 4IXXA 4QLJA 3KAOA 1KB3A 1ZY9A 4S23A 4HZ8A 4LJ3A 3N73A 1OM0A 1F9CA 4NNCA 1NF7A 4G7FA 3N1AA 4PMVA 4JN8A 2PWGA 1SYTA 5E9XA