1OWQA

Crystal structure of a 40 kda signalling protein (spc-40) secreted during involution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
361
structure length
361
Chain Sequence
b'YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNFGSERFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVPAGKIAIDRGYDIAQISRHLDFISLLTYDFHGGWRGTVGHHSPLFRGNSDGSSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGQFTKEKGTLAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords signal processing protein
publication title Crystal structure of a 40 kDa signalling protein (SPC-40) secreted during involution
rcsb
molecule tags Signaling protein
total genus 119
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2003-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1owqA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1owqA01
3WD4A 3VO0A 2WVSA 4AW7A 7TAAA 1X1NA 1CGTA 1W9PA 4ATLA 1MXGA 2X8RA 4AZCB 3VGDA 4P7QA 2WM0A 4P7LA 3W27A 3E1F1 3WQ4A 1R7AA 4D71A 2HISA 1QI4A 4WLCA 1XV8A 3GNRA 4IPNB 1FFRA 3U57A 5C71A 1H09A 4AC1X 2OYLA 4AD4A 1HP4A 2X1IA 2NW0A 2GJXB 4Z2IA 2XIIA 1E6XM 2XVGA 1JZ5A 5ECUA 5BYWA 1W3HA 1EDTA 1H49A 4AIOA 4CD6A 1GNXA 1R8LA 5HBFA 1M53A 4CGTA 1QBAA 1WDPA 3MV01 3S6TA 3WUEA 4IUGA 1CZ1A 1VEMA 3WD2A 1OT2A 3F5KA 1NWTA 2NT1A 1RH9A 3W82A 1AQMA 1NOUA 1KB3A 3L2LA 1WKYA 3W26A 3N9KA 2J8GA 2J7DA 1QHOA 1N82A 1OD0A 1HJWA 2XFRA 4Z2LA 1SMDA 2WLYA 3BAWA 5BXRA 1J9YA 4UQCA 3ZOAA 4MNMA 3AXIA 4AZ7A 4HMEA 3SCVA 4V27A 4M8UA 3ARVA 1Q6GA 2ZX7A 2X09A 1C7SA 3RDKA 4Z2GA 1JNDA 4Z2JA 3L4ZA 1ZBCA 1J10A 1TMQA 2CESA 3BMVA 2UY3A 1XSIA 3CZLA 2PBGA 3MU7A 3GNOA 1NP0A 3IJ9A 1V6UA 3PTQA 1XHGA 1OGSA 3ZT5A 2BVTA 4IISA 2VMFA 1CGVA 1UWRA 2W91A 3NDYA 3W81A 1D3CA 3U7VA 3IAPA 1OSEA 5I79A 4CUCA 3UR8A 4U2ZA 4D6GA 1EO5A 2WMIA 1C91A 3AIRA 3QHNA 4C7FA 4GZJA 1UD5A 4HA1A 3WQ6A 1UKOA 5BXPA 1UD4A 5I0DA 3UESA 5BWFA 4S3JA 2QLYA 1E4NA 3KL3A 1BLIA 1HP5A 5DT7A 1G94A 1EHNA 2J74A 1HJVA 5IHRA 2VNCA 2WZHA 3T08A 2X0HA 4JL1A 4QLJA 1LF1A 4JFSA 1ODZA 2D22A 2VX7A 2YDSA 2OWWA 3WDRA 1UKQA 1V0MA 1V03A 2VVNA 4HA3A 3DYPA 3RIKA 5BRPA 3WH6A 3WL0A 3CLWA 5GNZA 2WMKA 3BGAA 2J7HA 3VD4A 3MANA 3AHTA 2GK1B 3AHVA 1CGUA 1JFXA 1VFMA 5CLTA 4X9YA 3SCNA 1BVNP 1UH4A 1VEPA 3OZOA 4UNIA 4AD1A 2EBNA 1XYZA 3IANA 2F61A 3RPMA 4JKKA 1DWIM 2JALA 1UQYA 1V0KA 2EPOA 3WUBA 4PSRA 3NSNA 2J7EA 5EFFA 2ZXAA 1ZU8A 3PZMA 4DM1A 6A3HA 2WLZA 4NRSA 2XJ7A 1EGZA 2WHLA 4CD7A 1JAEA 2D1ZA 1F4HA 2AOSA 4DM2A 1X6NA 3VMOA 3HU7A 4J7RA 3FHAA 2EPMX 1UH3A 3PHAA 3K1DA 2CIPA 2QHAA 4PMXA 2IUZA 5M5DA 4M1RA 5M03A 3N17A 3GTNA 2E9BA 4UQAA 4W8BA 4IM4A 1W3KA 1E70M 2YA0A 2YLAA 2DGAA 3GXDA 3POHA 4P7RA 4GI9A 1XD0A 3ZQ9A 1ITXA 1PJ9A 2CKSA 3WF0A 3UR7A 2XFYA 4ACZA 1KGWA 1OM0A 1XH1A 3LPGA 3W6LA 2CXGA 3D5HA 3VIKA 3WDJA 3IAQA 4PCTA 1QI2A 3SIMA 4DUXA 2G3JA 1UKPA 3ZT6A 4M80A 2WVUA 1E4LA 7A3HA 1GVYA 1VRXA 1W2VA 4KRUA 3ZO9A 1E3XA 2OYKA 2D24A 4FK9A 1EQPA 3VIHA 4HOZA 1D2KA 4PMVA 4HMDA 4H8VA 3AS0A 4UR9A 1DWFM 2XM2A 4AIUA 4GPNA 1HJSA 3RCNA 3RM9A 1UA7A 3DC0A 1GJWA 2EJ1A 1ISVA 3BXWA 1E43A 3DHPA 3VDCA 5LYRA 5HPOA 4UQEA 4KH2A 1WNOA 1C7TA 3QHOA 4QFUA 4QCEA 1M7XA 4GQRA 1VB9A 1HKJA 2YL9A 1TVPA 4IPLA 1PPIA 3VDHA 1GQLA 3L4VA 4UFIA 1PAMA 3VDAA 3OB8A 2CERA 3CGTA 4JHOA 3AMGA 5A8NA 3VIIA 1Q6DA 4W89A 3ZR5A 3TP4A 4B3LA 3N04A 1KCLA 8A3HA 1XSJA 1WZMA 1EXPA 1DWJM 1ISYA 4HZ6A 3OBAA 4XV0A 2IXUA 3VIFA 4AWEA 3MO4A 5E9AA 2UWFA 1I1WA 1KFWA 2VOTA 3O2LA 1MXDA 4KGJA 4OOUA 3RJXA 5IFPA 4GQQA 1BYCA 4ZXLA 3AIEA 1C93A 3PTMA 2G8ZA 1KBKA 1E5NA 1C90A 2E8YA 2WXDM 5I2UA 3VGHA 3CZGA 1UWSA 4WSJA 5A6BD 1EOKA 1UD2A 2CCRA 4MNKA 1V02A 2EQDA 1ZBKA 2JF6A 4YN5A 1ECEA 4ACZB 1US2A 1MQQA 4QCFA 1J0IA 2ZOXA 4UFLA 3WNKA 5BCAA 1CXEA 5FL1A 4HU0A 4H04A 4DWSD 5JBFA 2WMFA 3WDQA 3L4YA 1HVXA 1CTNA 2ZUNA 2WC4A 4NI3A 4F9JA 3CUGA 1GUVA 5ABEA 1J0ZA 1G5AA 3WDPP 1JYNA 4LQ1A 1HJXA 1R85A 1TZ7A 1GHRA 3ZJ7A 2PWFA 3DHUA 3RMEA 2NSXA 3KZSA 2FHFA 1FOBA 1NARA 4TX6A 2J4GA 2XGBA 1ISWA 1UG6A 4UQDA 4EANA 4F66A 2WHMA 3IJ8A 3SCOA 5CZKA 1U33A 2VCBA 1FH8A 3VPLA 4WSKA 5I24A 2XPKA 2DT0A 4OUEA 4J3XA 1SFSA 2UY4A 2W4XA 3WMCA 5A6AA 1PIFA 2CBVA 4E2OA 5A6MA 3I3EA 3W6MA 2ZIDA 2OLHA 3ZSSA 3AICA 4AMCA 3VOCA 3FXYA 4P8WA 2AMGA 2XSBA 3NCOA 2JF7A 3SCQA 2YIHA 2J8FA 3WN6A 3FAXA 3QR3A 4N0RA 3PZTA 3WNOA 4OBRA 2Y2WA 1XD1A 3I3DA 2ZUTA 3AIWA 4M29A 5A1AA 4NSBA 4TVCA 4UOQA 2BHUA 3A4AA 1EIBA 4BS0A 3LPPA 4X0VA 1E56A 2QPUA 1M03A 4HZ7A 3G6MA 3ARXA 1QW8A 4Y7EA 3BH4A 3VNZA 3ZMRA 3WH9A 1W3JA 4WKFA 3TTYA 1V08A 3HJEA 2WW5A 4AISA 4DWSC 2YBUA 1TR1A 1OT1A 4HPGA 2FH8A 2O9OA 1KXVA 3MMWA 2VJXA 3CZKA 1MFUA 2WSPA 1W2PA 5IDIA 3VIPA 3B9EA 1CBGA 3KEHA 4CD5A 3T0BA 5F7UA 2VQUA 4HPHA 2DSKA 4JHZA 5GPRA 1BTCA 4PMYA 4OZOA 4P7OA 2J78A 1NWUA 3RILA 5D9PA 3ZM8A 4EAMA 5DF0A 1KXHA 3WY1A 3SUSA 1UYQA 2ZXQA 4LYQA 2VCAA 1FH9A 1OGGA 3W0KA 2D0HA 1V6VA 1Q6EA 3PBGA 3ARQA 3WUFA 2FDMA 3GYCA 1VBUA 5FIPA 1ZS2A 1B3WA 5CSYA 4QP0A 2A3BA 2JIEA 2VUYA 3N1AA 1GZJA 1C92A 1D7FA 3T2OA 4AD2A 3PZGA 2ZWYA 5FCZA 3MUIA 1VF8A 4W5UA 4CKQA 2JEQA 2OSWA 1H0IA 3SUTA 5CG0A 2DH2A 5AC5A 1BFNA 5D8WA 3PN8A 3MSGA 4H8HA 2ZX8A 3UG3A 4KGLA 3VDBA 4D6HA 1UUQA 2NT0A 4JCLA 5HNNA 1TA3B 1CEOA 2WBKA 3MUY1 1MW2A 5A3HA 2WMJA 5E0CA 5CLWA 5DMYA 1AQHA 2XVLA 2E9MA 2XVKA 4GINA 1Q4NX 4XZBA 1BPLB 3M07A 5CPTA 1KCKA 3AIBA 4AZIA 8CGTA 1NOFA 3AXXA 3T2QA 1UA3A 3CZEA 4UZSA 3W53A 5E09A 5CPQA 4BA0A 2WKLA 4GIAA 1MVYA 1NP2A 4LYRA 3MMUA 4HU8A 1K9TA 4FLQA 3TONA 4TOQA 1VBRA 1K9FA 1OWQA 3BMWA 4JIEA 2BY3A 3UETA 2WWDA 3VVGA 1C8YA 3D3AA 2J7BA 3AI0A 2WZEA 1UD3A 2WMGA 2PF0A 1US3A 3GNPA 1FHDA 5GNXA 3T2PA 3VD3A 2WKGA 1QPKA 4CU6A 4UTFA 3OLDA 1QBBA 1JZ8A 3F4VA 1JI2A 4AEFA 4UFJA 2D3LA 3L4TA 3BCFA 5HOSA 3KL0A 4D72A 5A6JA 5I23A 5I78A 4JZ5A 3W28A 1UR4A 2E0PA 2G41A 1OINA 1JI1A 2XSAA 3CHFA 3ALGA 3OGSA 1MYRA 5A2CA 2J7FA 3VM7A 3WMBA 1Q6CA 4OKDA 4GZEA 4PUEA 4WK9A 3T0DA 4XB3A 5JIWA 4YPJA 1JFHA 3NJ3A 4W5ZA 5HXMA 1V3LA 1E6RA 4UFMA 2VRKA 1GOWA 1UWIA 1E0WA 3CZJA 3WFLA 2ZICA 1XRVA 1FH7A 5M17A 3VGEA 3AROA 3GXIA 1W32A 1KBBA 1CPUA 4X0NA 1ISXA 1OCQA 4MJ2A 2UY2A 3BSGA 5AYBA 4R5EA 5A8OA 1WDRA 1XCXA 3T0AA 1JYWA 4JFUA 1H1NA 1UD6A 1HT6A 1W1PA 2V5DA 1NWSA 2PWGA 4DUVA 3QGVA 3O6AA 3WF1A 1ZL1A 4MJ4A 1V3IA 3GXFA 3EBVA 1F4AA 2VQTA 4F8XA 3PTKA 1K6AA 2VZOA 2WVVA 3MS8A 1AQ0A 5CGTA 2DIJA 2A3HA 4F79A 1TE1A 2PWDA 4P8XA 4WKAA 4E8CA 1B0IA 3AHYA 1B3VA 3CHEA 1NOWA 3AHXA 1MW3A 2W5FA 2X2YA 4LX4A 3MKKA 3EMCA 4EK7A 3SCUA 2YA1A 5D9NA 3NSMA 4HOWA 4NZCA 3K8MA 2VR4A 1E1EA 4BQ2A 1GQKA 4PTXA 1MWOA 1VJZA 4P8UA 3CO4A 3UCQA 2WSKA 2WK2A 1XSKA 1QNSA 2GFTA 2ZUMA 3SUVA 5I3DA 3OLGA 1JNEA 2Y8VA 2ZWZA 3NUKA 1CWYA 1YQ2A 1W9UA 3GH7A 3VKKA 5ABFA 1JXJA 1DP0A 3AHZA 1LL4A 3VX0A 1SMAA 3ZR6A 2BY1A 3RM8A 3EDEA 2CHNA 1OBAA 2VCCA 4MB5A 1KR1A 5C70A 1Z32X 1GCYA 4MDOA 1HVQA 4MDPA 3M7SA 2J7GA 2XYLA 1BGAA 3N15A 4UOZA 3W37A 1G0CA 2G3MA 1J0YA 1PX4A 1KQYA 1WPCA 3VINA 3BLPX 4CCCA 2BHZA 2WMIB 3RO8A 4RE4A 1RP9A 3THCA 2VZVA 1HJQA 2BS9A 4FLSA 4CVUA 2ZUVA 3WH5A 4C7GA 1UKSA 4FLRA 4PRWA 2YLLA 4AZ5A 2VO5A 2DDXA 2CPUA 1VFFA 2CHOA 2WCGA 5DT5A 2FH6A 4HTYA 2E9LA 1UH2A 3VD7A 3MUAA 1BG9A 1JYXA 3AMCA 1B90A 1W9VA 2JFEX 4H8UA 2YL5A 1LL7A 1UR9A 3BLKA 4PTVA 4E8DA 1TVNA 3SCTA 4B16A 1P6WA 1GJUA 3K4DA 2BXYA 1B3ZA 1BVZA 1J0KA 2DT2A 1ITCA 1J0HA 1V0LA 2W62A 3WUGA 2DT3A 4GI8A 1SR0A 5A6BA 2VZUA 2CKRA 4PMQA 1BF2A 3WD1A 1QHZA 2ZX6A 2D20A 1NM9A 4EKJA 3BSHA 1QVBA 4J3VA 4QAWA 3OG2A 3AJ7A 3WDHA 5CSUA 3BAJA 3K46A 1V3MA 1QI3A 1C8XA 3MMDA 4GO9A 2ZXBA 1PZ3A 4DWSA 1K9EA 4Q22A 1DWHM 3MSDA 4UQBA 3GH4A 1E0XA 3PZVA 3I3BA 1QNRA 4L4PA 2XVNA 1ZJAA 2A3AA 2XWDA 5ABFB 2UY5A 3KWXA 3VMNA 3M46A 3ALFA 4JL2A 2XGIA 4D6FA 1JIBA 1G9HA 1H5VA 2XWEA 5A8PA 5AY7A 3ARZA 2FHCA 1PBGA 3BAYA 1MW0A 3WF4A 2WWCA 4BQ5A 4AZ6A 1J01A 3ZJ6A 1JXKA 1VFUA 2J75A 2VURA 3BCDA 4GO8A 4AZHA 3K8KA 5EB8A 4PTWA 1GPFA 1O6IA 3BAIA 1L0PA 3WDIA 2F8QA 4L4OA 1M01A 2YDRA 3VGBA 4P7NA 4TVUA 3VILA 1E6NA 3EYPA 2ZUWA 1UOKA 4J3UA 1CYGA 2BY0A 1GQJA 1CXKA 2PI6A 1V6WA 1E72M 2F2HA 1BQCA 1QI5A 2AAAA 4MNJA 3WMSA 4XX6A 4D6DA 2QPSA 3WQ5A 1JDCA 1E40A 1UWQA 4AYSA 4AEEA 1EO7A 4AZGA 4JFWA 1KQZA 4MAVA 1DTUA 5D8ZA 1WO2A 3FN9A 4WKHA 1E73M 3IJ7A 1GOQA 1GONA 1WB0A 4RL3A 1W9XA 3AS2A 4HZ8A 2WB5A 4TTUA 3RJYA 2E4TA 1W1VA 4A3YA 3WNPA 5BRQA 1LQ0A 3SUWA 1WCGA 4ATDA 3APGA 4HP5A 3VGGA 3N13A 4J27A 2PB1A 2D0FA 2VR5A 4UQ9A 1GOIA 3L2MA 1BYAA 4ZE4A 4DWSB 1BYDA 3SCPA 1BYBA 3S2CA 1UR0A 2B31A 2DIEA 2GJPA 3T09A 1W1YA 2DSVA 4PMUA 1CGXA 3GM8A 4A4AA 4UZUA 5TD4A 2GJXA 4BZYA 1JL8A 3J7HA 1CLVA 3DYMA 1UQZA 3AIQA 4CD8A 2O92A 4YHGA 1LL6A 4CU7A 5BXSA 1QNQA 4M81A 1EQCA 1PX8A 2GSJA 4TX8A 5LA2A 3WF3A 4ZE5A 5KZ6A 1BG4A 4E4PA 1IZKA 4W84A 3DYOA 2VTFA 2XIBA 4FMVA 2W92A 4NRRA 3VIJA 3VU2A 1BGGA 5ABHA 1HKMA 1UWUA 2EPLX 3ECQA 4P8VA 4HA4A 2V3DA 1JYVA 1ZBVA 5A6KA 4D6EA 3ZJ8A 3GBEA 1JZ6A 4PMNA 6CGTA 3AS3A 1E55A 1GVIA 1L8NA 1PX3A 3PZUA 3BAXA 3CPUA 4KRTA 4WF7A 4MADA 2D3NA 3VIGA 3GDBA 4C7DA 1IT0A 4TUFA 3WF2A 4ATWA 3OZPA 2VZSA 4PUDA 3ZJKA 2J25A 1VJSA 3VD5A 5FOOA 4WIWA 1VAHA 1KXTA 5A95A 3FNDA 1WDSA 4CVWA 3VIMA 2VX4A 3LPOA 4LXFA 2V3EA 3TTSA 4NF7A 3CUJA 2WAGA 1HNYA 3UG5A 4ZFMA 3FW6A 1XC6A 3RM4A 4BCEA 4GI6A 5FL0A 3CBWA 4AD3A 1VIWA 4ZENA 4AIEA 1WE5A 1V3KA 1VENA 2BY2A 4OJYA 3ZIZA 3GBDA 1UZ4A 4BQ4A 2WC3A 6TAAA 5JBDA 4PMOA 1B30A 3OLEA 2ZX9A 3VUPA 4A3HA 4W87A 4J3SA 3TTQA 3AZSA 1CIUA 1Q6FA 1H0GA 3F5JA 3EDJA 4JCMA 5I6SA 1E4MM 2E3ZA 1DWGM 1B2YA 5LA1A 1UR8A 3WQVA 3SEPA 3IK2A 2V3GA 1CENA 1C3FA 2CBJA 4W7UA 2WCAA 4OOZA 4W7VA 3AISA 3ARRA 2GK1A 2V3FA 2VC9A 1EOMA 3A47A 4M56A 2YL8A 3VM5A 1ODUA 1AMYA 1MFVA 1YHTA 3AS1A 1UHVA 4CN4A 1HL8A 4CN1A 5E70A 1RD6A 3M6DA 5DEZA 3PZQA 3SCWA 4Z2KA 1CNVA 2WYSA 4V2XA 1E6PA 4UFKA 1V02E 4URIA 1Y7VA 2XHYA 1IZJA 1OB0A 4LGXA 2G4FA 1U2YA 3AFBA 1M04A 3CMGA 1V0NA 5ABGA 4DUWA 1GOMA 2BXZA 1JD7A 3KE0A 3UEQA 2FGLA 1OGBA 5A6SA 2PWEA 3CMJA 2EPNA 3G6LA 1WP6A 4RE2A 1E6QM 1DWAM 3CZ8A 1UR2A 2D0GA 5A8MA 3AYSA 1BSIA 1MQRA 5D9MA 1WDQA 2CEQA 1EA9C 2V38A 1KWGA 4QLKA 1B3YA 3CHDA 4S3KA 1W9DM 2Z1SA 3EDDA 4MPKA 4D6IA 3W38A 1CXIA 1J18A 1WZAA 2BV9A 2XM1A 2ZUSA 5AYIA 4PBGA 5GQBA 3BC9A 1CECA 3WIJA 1QOXA 2XTKA 2XG9A 3OLIA 2YOCA 1B3XA 2D23A 2OWCA 2ESCA 2FHBA 3ARTA 2WPGA 2J47A 4AXNA 1UR1A 4W85A 2WVTA 1LG1A 2GDUA 5BROA 1WZLA 2BHYA 3PZIA 5DO8A 2ZUUA 3AIVA 1ZB5A 2CBIA 2YKKA 1B1YA 1HKIA 3PZ9A 5I5RA 3VMPA 4J3WA 1O7AA 1K9DA 3ARWA 2C7FA 1E1FA 3B9AA 3WBAA 1H2JA 3PZNA 4FLOA 3DECA 4W86A 2WHJA 3U7BA 3CHCA 1HJUA 1OD8A 3WKZA 3F5LA 1QNOA 3L4UA 1XYFA 4MB4A 3B9DA 4M82A 2C8NA 2OYMA 7CGTA 1RP8A 5IFTA 2XUCA 1NH6A 3FAWA 4W7WA 4W88A 4ACYA 2Y24A 4D6JA 1NWRA 1JZ3A 3FHQA 1HKKA 3VIOA 3SCSA 3JUGA 5CGMA 1KWKA 1DEDA 4LYPA 4N42A 3POCA 2DPEA 4JAWA 2QMKA 5C8BB 2PBOA 2BVDA 1G1YA 2ZE0A 2C0HA 3WBEA 2J79A 2CNCA 1HX0A 2V5CA 5IHSA 3WENA 4H41A 1JD9A 1XH2A 1VEOA 3A4XA 1E9LA 3WH8A 4PYSA 1E4IA 1W1TA 2YBTA 4D1JA 3B8SA 1I1XA 2WMHA 4MB1A 1WZKA 4H7VA 1LG2A 1DHKA 1WAWA 1J0JA 4JFTA 1NQ6A 3QHMA 1JAKA 4U5IA 5EFDA 1JDAA 1EH9A 4JKLA 4B3KA 3OIHA 1H11A 3VGFA 1E15A 1C8QA 2RGMA 1XH0A 3WQWA 3VX1A 3ARYA 4J3TA 3K4AA 5JBEA 2QV4A 1JZ4A 3CTTA 3NYDA 4WJXA 3N12A 3GZAA 3AMDA 3SCRA 2O9PA 2QMJA 4XUYA 1LWHA 1CGYA 2WNWA 2W63A 2EEXA 3CH9A 1EDGA 4M24A 3WH7A 2CITA 2CYGA 2E40A 4AD0A 4CCEA 4H2CA 5E6ZA 4CD4A 3AOFA 2W61A 2WVVB 4RE3A 3U5YA 5KEZA 2VZTA 4TVDA 2G3NA 3QOKA 4PSPA 1UD8A 1B31A 5HDRA 1CGWA 1EHAA 5JIPA 4W93A 1I75A 4Z2HA 3OGVA 3WL1A 4PMZA 2OSYA 4MB3A 2WZIA 1JG9A 2DQXA 3AXHA 3L4XA 3MV11 1FFQA 1JF6A 5A2AA 1E6SM 4MNLA 1JZ7A 2G3IA 3ZT7A 4FF5A 1CXHA 5JH8A 1KGXA 1V3HA 2DSWA 2FGZA 2Y5EA 4U31A 1ESWA 5M3WA 4LPCA 1GOOA 5CQ1A 1X6LA 1RPKA 1E3ZA 3THDA 4AD5A 3VTRA 4BF7A 4MAZA 3NDZA 1GORA 1KXQA 1G01A 1JDDA 5CXPA 3U5UA 3HN3A 4ZEPA 1R87A 3II1A 2WHKA 3KL5A 5E0FA 5FKYA 3WFZA 5EBAA 5A8QA 5E6YA 1H4PA 3PZOA 1QW9A 3TA9A 2XVPA 5A94A 4Q7NA 1IV8A 2HVMA 1ZJBA 4CCDA 4R27A 4D1IA 2ZXDA 1JGIA 2EPKX 1R86A 3A4WA 2PWHA 2IXVA 2YA2A 3AQUA 1W9BM 5HPCA 4PTMA 9CGTA 2OSXA 3N18A 1UKTA 3L4WA 4PMDA 3A3HA 1FHLA 2WC7A 4XZWA 4ZXOA 4QDMA 1MQPA 2CETA 2WANA 3HMCA 1XGZA 4JKMA 3VNYA 5EMYA 1BHGA 4UOJA 4B9ZA 1V3JA 3SURA 1CXFA 2GVYA 3WD3A 1GW1A 4BQ3A 4CU8A 2A3CA 1E5JA 1TCMA 1PEZA 5LA0A 3WNNA 4QLLA 4OBSA 3AYRA 4B15A 3EMQA 3CUIA 1A3HA 1FP8A 1TUXA 2YDQA 3NSXA 4D6CA 1HXJA 5GNYA 1LWJA 2E8ZA 5A6LA 3AIUA 3EMZA 1ZBWA 2W67A 3WEZA 1OIMA 5CJ5A 2VX6A 3BAKA 4F9DA 2MANA 1GOKA 2TAAA 4UFHA 4B9YA 5I77A 2X0YA 2DEPA 2JEPA 4TTGA 2ZX5A 4CN6A 1VFOA 2XFFA 1AVAA 2J62A 3FY1A 3WD0A 1UZ1A 3CUHA 3WNLA 3ZSTA 3ARPA 2J77A 3CUFA 1A47A 1KGUA 5FD0A 1UWTA 4GXPA 1XCWA 2JIWA 2DSZA 4AZCA 4ML4A 1J11A 4K68A 1JF5A 1HN1A 1PZ2A 2EO7A 2YJQA 3W24A 2D2OA 1LJYA 1LLOA 2BNJA 4PN2A 3MUZ1 5DFAA 4PCSA 2A3EA 4J28A 2GUYA 2DH3A 2DT1A 4U33A 2VL4A 4TXEA 1HF6A 3GXMA 4OIFA 3ARSA 2W66A 4HOXA 1CDGA 1S46A 3AZTA 3WQ8A 1E6ZA 3A6OA 2OWXA 1TA3A 4W8LA 4U2YA 1OIFA 1BAGA 4GKLA 3O9NA 1FA2A 4PMRA 2VVSA 4JFVA 2O9RA 1EDQA 2DSUA 4AZBA 2Q8XA 1J12A 1CXLA 5A69A 1SYTA 2JE8A 2RGLA 3SUUA 2VRQA 4AY1A 3W25A 4HMCA 1PIGA 3TOPA 2EXOA 4KWUA 1QHPA 2QF8A 2VI0A 1V6YA 1V6XA 2GJRA 2Y8KA 4V28A 4EE9A 3TTOA 1JZ2A 3EDFA 5AC4A 4PEEA 2CBUA 1E71M 3EDKA 2VRJA 1GQIA 5D9OA 3LMYA 2X05A 2Y4SA 1HIZA 2PC8A 1MW1A 4GZIA 3WELA 3VD9A 3OA5A 3W4RA 4MTVA 1U30A 3NIYA 1W91A 1ISZA 1HL9A 4W8AA 4U3CA 3UG4A 5CPSA 4U3AA 2VX5A 2WBGA 2YL6A 2WCSA 3N11A 4YHEA 3OGRA 3W29A 2O9TA 5JUVA 1H41A 3LPFA 3K8LA 2BFGA 4U5KA 3UERA 1H3GA 1R7OA 3WSUA 2BVYA 1E0VA 5A2BA 3AZRA 3AMKA 1B9ZA 3CIVA 5IXEA 1QNPA 2VT0A 3WNMA 1TG7A 1TFVA 5BXTA 3QOMA 1W3LA 2GDVA 1KR0A 4UCFA 3ARUA 1FP9A 1GHSA 3WEOA 3GH5A 1QI0A 2J7CA 3WEMA 2Z1KA 3AMLA 5D4YA 1CLXA 4KMQA
chains in the Genus database with same CATH superfamily
1J5SA 2DG9A 4AW7A 1SZNA 1QFEA 3GU1A 3P8JA 3MW7A 4K39A 1IWAA 3NL5A 4IMEA 4P7QA 3UPWA 3W27A 4C1KA 4B5WA 3E1F1 1AW5A 3I6EA 5H1WA 1XRSA 3ISIX 3CIXA 1R7AA 3GXTA 2HISA 2ODOA 4H9ZA 4WLCA 1KM5A 3GNRA 4IPNB 2QVHA 3WQGA 1ADOA 1H09A 4PH6A 4AC1X 3R43A 1HP4A 4HNOA 5DBTA 3F4NA 2GJXB 4Z2IA 4CNSA 3SO7A 3UZZA 5BYWA 1W3HA 1EDTA 4E4FA 1GNXA 4HSNA 1R8LA 5HBFA 3N9RA 2PDGA 3FYPA 1QBAA 3S6TA 3PPCA 3IK8A 1GTEA 3P82A 1CZ1A 1VEMA 4O1AA 3WD2A 1OT2A 1NWTA 3S6DA 3V5CA 2ZR5A 3I65A 5J8LA 3SY5A 4GIVA 1F61A 1AQMA 3L12A 4DIAA 1HXVA 4IUOA 3HJZA 1XLKA 2WLYA 1J9YA 4JYSA 4UQCA 3VZYA 4MNMA 4AZ7A 5CSSA 3ARVA 4PB5A 2ZX7A 1W54A 3NL6A 4LCQA 5HMFA 1YEYA 1C7SA 1JNDA 2YBVA 3PC0A 5GJPA 1TMQA 3IPWA 1XSIA 1XISA 2PBGA 1KKOA 4NZFA 4MUZA 3E5PA 4XG1A 1QWGA 4B90A 1XIDA 3RG6A 4IJBA 4IISA 2QDDA 2QV5A 1UWRA 1IXPA 2W91A 3W81A 3WLOA 1GG1A 2POZA 5I79A 4CUCA 3WLHA 4YWIA 2QEZA 2YR1A 4V1YA 2C91A 3AIRA 2CZFA 3QHNA 5HWMA 1TR9A 4IP4A 4O1CA 5G1YA 1R9XA 2V5BA 4M6VA 5I0DA 3AWNA 2Z1WA 1GYNA 1GVQA 3MCNA 3KL3A 5AYZA 3BW2A 2B7PA 3H4GA 1EHNA 1U1UA 3QJAA 2J74A 3LMZA 2VNCA 2X0HA 2VX7A 3BL3A 1OCNA 3WDRA 1V03A 4HA3A 5BRPA 3WH6A 1XYCA 1TPC1 1IIHA 3CLWA 3QY7A 3SRHA 1FKDA 1XI3A 2HQAA 2DQWA 3RYSA 1S2CA 1VFMA 1SO5A 3ES8A 4I90A 3EZ4A 4WOZA 1S2TA 3SCNA 1DVJA 3TCSA 4UNIA 4AVOA 3WK2A 3S1VA 2F61A 4JKKA 2JALA 4HU3A 1R47A 5GJNA 4MSPA 1ZU8A 3IRSA 2OQLA 3PZMA 4DXKA 2DUAA 3UZXA 2CWXA 4YJ5A 4QEHA 3LSCA 3KABA 1RJQA 2Q71A 4JNYA 2OVLA 3TJ4A 4OBTA 4Z1DA 3W70A 1UP3A 3M0LA 4A8IA 3UA3A 1WX0A 3LTSA 1X6NA 3B3DA 3FHAA 3PS7A 2FKEA 3V75A 4S3EA 1XR2A 5AHEA 3GHRA 2A0NA 5M5DA 4DY1A 1OEPA 5JXQA 5M03A 1S1RA 1BXNA 3GTNA 3NQFA 1E70M 4PUKA 2DGAA 3GXDA 2QUVA 2AQOA 4DNHA 3CWNA 2VENA 1V93A 1PJ9A 4O53A 2F6XA 3WF0A 3KOZA 3W7QA 5JQ9A 1XH1A 4PUWA 2NLIA 2YYTA 1JJKA 4IQDA 2F2KA 4PCTA 2YXXA 1TIMA 3KVLA 5EBUA 2WVUA 4JNZA 2P0OA 1MUCA 1W2VA 3Q58A 3ZO9A 2OYKA 3LOTA 1LRTA 1XLBA 2R14A 1J79A 1D2KA 2GVLA 4PMVA 4HMDA 1PKMA 4UR9A 3EX2A 2E7FA 2PTWA 1Y65A 4JD4A 1V7YA 4AIUA 4GPNA 1TMHA 3DC0A 4O57A 4IICA 1QNVA 1EJ7L 1E43A 3VDCA 3N2MA 5LYRA 1I2PA 3UQNA 4PRTA 4DUOA 2XN1A 4DQWA 5D2TA 3QHOA 5HJYA 2BXVA 4RZBA 4QFUA 3I6TA 5TAOA 1VB9A 2RDTA 1AD1A 5FI8A 4IPLA 1PPIA 1D7JA 3VDAA 3OB8A 4JHOA 5A8NA 3VIIA 5IDZA 3D6NA 3HGJA 3ZR5A 3TP4A 1KCLA 3N04A 1XSJA 4L1GA 4J3ZA 3OBAA 1JUEA 2Y61A 3PFMA 3MO4A 1V7AA 4IMCA 5E9AA 1F8IA 3IGSA 1TWWA 1I1WA 2VOTA 2Z2AA 3OVRA 4KGJA 2NVAA 4OOUA 3RJXA 3B0YA 4PFHA 1ME8A 4QJ4B 3AIEA 1C93A 3CGMA 1FQ0A 1UASA 4F0RA 1C90A 2E8YA 3NTPA 4IFKB 4HYRA 3VGHA 3TXZA 1EOKA 2CCRA 1XX1A 3THUA 4PFMA 2EQDA 3S4TA 4MMWA 4YN5A 2E1WA 3M16A 2C13A 2IKHA 1US2A 1J0IA 4UFLA 1BXCA 3R2GA 4J4OA 1DXEA 3LCGA 1PWMA 1RAKA 4UDMA 3C86A 1G4PA 4HBKA 3HMJG 1CTNA 3FYOA 4JQ4A 4G1NA 4NI3A 2Z6JA 3FGCA 5ABEA 2RUQA 4YMZA 2AWGA 4QG6A 1R85A 3WBYA 1TZ7A 3NVTA 3RMEA 5G1TA 3KZSA 1L6FA 1PKYA 4TW7A 3VCCA 2PDBA 3CEPA 1EWDA 2IMRA 1EPVA 2V69A 2WHMA 3G1RA 3SCOA 4PL1A 2BTMA 2PD5A 3U6WA 1OY0A 3PP7A 3QH2A 5D09A 1H7OA 2DT0A 2QJMA 3PK7A 4N9EA 2C1GA 3WMCA 4G7EA 4HN4A 1DHPA 3FXGA 3URQA 4L65A 1OFDA 3OVGA 3W1XA 1UZDA 3UFYA 2JF7A 5FJPA 2J8FA 3G8RA 5F1VA 3MKCA 4CNNA 1GVRA 2MF9A 3WNOA 1TVLA 4MZ1A 5LIYX 1K4HA 3LY0A 4NSBA 1O4UA 4TVCA 2BHUA 3A4AA 1RLDA 4BS0A 1VJIA 3KHJA 3LPPA 4U4MA 1M03A 4NAFA 3RX4A 3S5YA 3ARXA 4WQ6A 3SZ8A 1DV7A 5F4XA 1QPOA 1R30A 3P6LA 3S1UA 3STGA 3K4WA 3SJ3A 1M65A 3HJEA 2F7FA 1A5BA 4HPGA 1R2TA 2FH8A 4JYEA 3MMWA 4KW2A 3NPWA 1XBXA 5L9FA 1MFUA 1A5SA 4GQGA 4HBOA 2PF8A 3MBDA 2E5BA 1XLDA 3IGUA 3ZR4A 4PMYA 2PDLA 2J78A 1NWUA 2XIMA 2OZ3A 2ACUA 2IQTA 5HWCA 5DF0A 1KXHA 2XISA 2R94A 5FEWA 1FH9A 2OXNA 1PXGA 1IXNA 3W7NA 3UWUA 1VLWA 3ARQA 5DX7A 3C0JA 4US5D 5HANA 2FDMA 3GYCA 1VBUA 3UCCA 1XL9A 1ZS2A 3T78A 3HQNA 2VUYA 4X2PA 1D7FA 4JXCA 5FCZA 3G0SA 4W5UA 1KM2A 1LROA 3B8UA 4BF8A 3MWCA 2YYUA 2PEVA 4H8HA 1NIUA 4HK5A 2PMQA 3TROA 1UUQA 2NT0A 4JCLA 3KTSA 2OT0A 3CB8A 4L5ZA 3GK0A 5E0CA 1AQHA 2E9MA 3OO2A 4GINA 4XZBA 1ROTA 1EF2A 4AZIA 1NOFA 2ZQTA 2C3ZA 3T2QA 3ANUA 3CZEA 4YTTA 5CPQA 3SAZA 4JNMA 4GIAA 1MVYA 4IIDA 5HT1A 4MWAD 2OOGA 4AWUA 3MHGA 4EPDC 2MUCA 3MMUA 1K9TA 1XYAA 2QCHA 4FLQA 2GGIA 4AFYA 1VBRA 3BMWA 3N25A 2YDAA 2Y5SA 4MIMA 3BW3A 4TMBA 3KLKA 4A8RA 1LLZA 2F9RA 3VVGA 1POKA 1C8YA 1J4HA 2RDWA 2PF0A 3QPYA 1KRBC 4Y8FA 4YCOA 2W6RA 5EMJA 1VBJA 1EEXA 3OLDA 1QBBA 2ISWA 4ZB0A 3AC0A 3WJXA 4IMDA 3MHFA 3U0HA 3L4TA 3BCFA 4MZYA 2C6QA 4ONVA 5I3IA 4DB7A 4XZ9A 4L9YA 4F0SA 4KT2A 4YWSA 1XLHA 3W28A 1OF8A 1V6TA 3OG3A 2KFWA 4PGLA 3OGSA 5A2CA 5DRIA 3T0DA 3STFA 5JIWA 5FAGA 1XIFA 4W5ZA 4GI4A 4Q6JA 4NXSA 3RAOA 2P50A 1UWIA 2ZICA 2J6XA 3VGEA 4PZVA 1KBBA 3UGVA 4MJ2A 2QAFA 5BMWA 1IGWA 2CLKA 2PTZA 1XCXA 3O6YX 4AEOA 5HATA 4UTWC 3JXVA 3VKAA 3AXKA 1OABA 3Q45A 3L68A 2A7NA 1WUFA 4DUVA 3WF1A 1P1XA 4MJ4A 3W1UA 5AHNA 3BG3A 1SW3A 1K6AA 2VZOA 2WVVA 3NZGA 4F79A 3OU8A 4GX8A 4FAPA 4I7UA 3AHYA 3NVDA 1ADDA 1B3VA 1NOWA 3O16A 4JYFA 2P1FA 3W2KA 3SCUA 3KRZA 5D9NA 3I10A 2ZZ5A 4UTHA 4NZCA 1E1EA 1IEWA 1FDZA 1A5AA 1VYPX 3JRKA 1YMYA 1VP5A 2NQHA 4FZIA 2ZUMA 2VD8A 1XS2A 2ZWZA 1JNEA 4JN7A 1K8ZA 1CWYA 3NUKA 1OQFA 3GH7A 1RLCL 1PKNA 3QLDA 1VRDA 1JDEA 3VX0A 4JEJA 4LUTB 1A3WA 1DL3A 4O18A 3FJ4A 3CQJA 3ZR6A 4QQUA 5HMDA 2BY1A 4RNHA 3TUUA 2CHNA 3W7OA 4KIRA 1Z3NA 1ZSXA 2CLOA 1Z32X 1F76A 1NFGA 3GR4A 4ERIA 3F7JA 4UOZA 2ZRVA 1GZ1A 4JTJA 4D9PA 2G3MA 9XIMA 4EX4A 2HXUA 4LAZA 3NOYA 4LAWA 1PINA 3LYEA 3O5JA 4ZS6A 2VFGA 2FB3A 4MLRA 4DX3A 2J8TA 2PTDA 4RE4A 3THCA 4WX2A 1HJQA 2ZZ7A 4ZZ9A 1H63A 2ZUVA 3WH5A 5B7YA 4FLRA 5C9XA 3B06A 5FJOA 2YLLA 4AZ5A 2VO5A 2DDXA 3CO8A 2XIJA 3HFTA 4MG4A 3WQFA 1M3UA 3BLIA 4JN8A 3MUAA 3RRAA 3T8QA 2R8WA 2Y5JA 2QZRA 1B90A 2WSQA 3F2DA 2JFEX 4GVHA 1RK6A 3MJYA 4KEZA 1IX5A 1F7BA 4IWWA 1XLFA 4PTVA 4E8DA 1TVNA 1Q13A 1R3VA 2HVNA 2R9RA 2RHGA 1V0LA 1J0KA 1J0HA 1R38A 4M6PA 5D2WA 3UPBA 3WUGA 4DHGA 3E2QA 4C6MA 2VEPA 1NDZA 3W7EA 1J93A 3REQA 4JOMA 3EXRA 3FX4A 5FACA 4C65A 3BSHA 3OG2A 3AJ7A 4LF1A 4TX9A 1V3MA 2PZ0A 1Q8JA 3S5ZA 1PZ3A 2OOFA 5IM51 3DOPA 3NOEA 1DWHM 3MSDA 3L0KA 3M7WA 3B8WA 3PZVA 1QNRA 4FA3A 2XVNA 4GUFA 1ZJAA 4YVPA 3FK4A 5ABFB 3KWXA 5LNSA 4K6AA 3VMNA 4NX5A 3E0WA 3DX5A 3FFSA 4MHBA 3SADA 1H5VA 1W5NA 2PDMA 5A8PA 1U1JA 3LLFA 5AY7A 4ENLA 2FHCA 4H9XA 1DIEA 2GOUA 3WF4A 3V5FA 3GQYA 2WZMA 1Q6LA 1XDJA 1EC7A 1VFUA 3B8VA 3BCDA 2VURA 5D30A 4GO8A 5EB8A 1GPFA 4DIPA 1SJCA 5DCBA 2F8QA 4EWJA 2YDRA 1N7KA 1YPXA 3E02A 3SGGA 1ZENA 1E6NA 1R2SA 4EWND 3EYPA 1UOKA 1CYGA 4KQNA 1CXKA 2Q02A 1V6WA 5AVNA 1E72M 3P74A 5BXJA 2PRLA 1QI5A 3NO5A 3MI6A 3WMSA 4K37A 4D6DA 1XPGA 1E40A 1UWQA 3KM8A 3CL7A 1EO7A 4AZGA 4GE8A 4QSHA 2BB0A 4NNCA 3BLLA 1KQZA 3R1ZA 2PTYA 5HAOA 2V67A 1PIIA 2PV3A 1W9XA 1TKKA 4N2YA 4Y6GA 3D3FA 2RJGA 3QMRA 1LQ0A 2PGWA 3APGA 1TJ0A 1HO4A 5EU9A 2QPXA 4DNMA 1XIJA 2P53A 2YX0A 3LV5A 6PTDA 1GOIA 3S2NA 4RDVA 5LNWA 4ZSTA 4DWSB 3SCPA 1BYBA 5DITA 1PTGA 3GDKA 3D46A 3GIPA 2PDKA 2DSVA 4PMUA 1N8WA 2EG6A 1DJZA 1CGXA 2OQYA 3M0IA 4B5TA 4JTDA 3DFYA 4BZYA 3R12A 4IQEA 4JQ2A 3DFSA 2PRHA 1A80A 2QDEA 1UQZA 2R1MA 1LL6A 3MZ2A 5BXSA 1FWEC 4M81A 3WQPA 4WR3A 4NJKA 3O5LA 1JCMP 4GXWA 5LNUA 4QT2A 3WF3A 1C8VA 5KZ6A 1BG4A 4LJ3A 2BVWA 4GFIA 3OTRA 1DXIA 2W92A 1QPNA 2NWSA 5FSDC 5CBJA 4HA4A 4LUIA 4PA8A 4HTBA 4J1OA 2P4VA 3ZJ8A 4UTWA 1TQJA 2ZRUA 4WCJA 4LEQA 1OG0A 1I4NA 3NQDA 1VLIA 3WK0A 3PZUA 5FAJA 4WOQA 4EXQA 4EXBA 4NZ3A 3V0SA 3VIGA 2TODA 1WXZA 2POTA 3KBWA 4FPSA 3SN4A 2VZSA 2QCLA 5JH1A 3EOOA 1NY1A 4WIWA 2O55A 4G7EB 1KXTA 3UR2A 1WDSA 2A85A 1TRDA 2QCNA 3HM7A 2V3EA 1XIMA 3M1ZA 1YNQA 2K8IA 1XC6A 1X6UA 3RM4A 4GI6A 3VABA 1PWLA 4KS0A 1KTBA 1VIWA 2EG8A 1GYMA 1WE5A 3LCIA 1PUDA 4ZB2A 4HBEA 4HN8A 4PMOA 1B30A 3BW4A 1DIKA 4H6KA 4A3HA 4L9ZA 1UP0A 1E0UA 4J3SA 3TTQA 3AZSA 4U85A 3F5JA 1FKRA 3ZVHB 1Y0EA 4Q8MA 4TX0A 4O2TA 4LU0A 4KCUA 4LVDA 1W6TA 2E3ZA 2BX7A 1LYXA 5LA1A 4W9OA 1W5PA 3YPIA 4FOKA 1VCVA 2X7VA 2V3GA 4QGCA 3WQOA 1C3FA 3MI2A 2GOKA 2XH0A 3O6CA 2GGJA 2WCAA 3NL3A 1MSSA 3AISA 2GK1A 3A47A 4M56A 3PNUA 1EIXA 2YL8A 2XZ9A 3EX6A 1ODUA 3R94A 2NVCA 3AS1A 2QCFA 3HGRA 2FJUB 4CN1A 5C5YA 3MVIA 4C6NA 4H9TA 3MB9A 4FOUA 1A49A 3PZQA 3SCWA 1OYAA 2HBVA 4LB4A 2VP8A 1LBLA 1KM0A 1WUEA 3KRBA 5A6SA 3DIPA 4ZO9A 4POCA 1JQXA 2QIIA 3KFTA 4M7SA 4EAYA 2EPNA 3BV7A 5HUOA 3N2BA 2D0GA 8XIMA 3HURA 3AYSA 4Z08A 2W9MA 2QUUA 4M19A 3EOUA 4QLKA 3CHDA 3PUEA 4LTSA 4MLJA 1R3RA 1O60A 1J18A 1WZAA 2NXIA 2XM1A 5I7GA 3QEZA 3BC9A 1CECA 1EJWC 1X1OA 3ITXA 2XG9A 1ZPTA 1B3XA 1Q7QA 1WXJA 3CWHA 4AXNA 1TB3A 2WVTA 1LG1A 2ON3A 5BROA 1TJ2A 2P3ZA 1FJDA 4FNTA 5DO8A 2ZUUA 2QCEA 1ZB5A 3HPZA 2CBIA 1J2WA 1B1YA 3PZ9A 5I5RA 3RLGA 2D2HA 4IP7A 1D8CA 3VMPA 1EJVC 3SY1A 4AWTA 4O12A 3B9AA 1Z8AA 2VEMA 3PZNA 1S1PA 3UR5A 1X98A 1LBMA 1XLEA 1OD8A 3WKZA 2Z2BA 4DO6A 4XIMA 3PFRA 4MB4A 3BLDA 3C6CA 1EJRC 3GPKA 1QRQA 3B9DA 4LOCA 1RP8A 5K9DA 1TCDA 3GIYA 4W88A 2Y24A 3ITOA 3OZMA 1JZ3A 3SW6A 3LERA 1DEDA 4LYPA 2YCEA 1AJZA 1Q7ZA 4M1BA 2QIWA 2C0HA 4GJ1A 5GVJA 3PVFA 3WX7A 1T7LA 4RXFA 1JD9A 3T8LA 2OR2A 3W3OA 2ZZ3A 1VEOA 4W4QA 3V0TA 2HE8A 1XIHA 3EWWA 1PB0A 4S3AA 1W1TA 2YBTA 4LS0A 2WO5A 1NEYA 2WMHA 1E51A 5BW6A 1WZKA 1GTHA 3GHUA 3R5EA 1LG2A 3VNJA 7REQB 5LKYA 1W3NA 1KFBA 3KCEA 3RNDA 2YPIA 1J4EA 3MI3A 1W8SA 3OIHA 1E15A 4OUIA 3GWQA 3S2JA 1XH0A 1EJXC 1O66A 3QYSA 4J3TA 1K7XA 1JZ4A 1FCBA 1SO3A 2VC6A 3AMDA 2QMJA 3H8AA 4HNTA 1DIOA 2EEXA 3KRSA 1EDGA 4LS1A 2E40A 2ZQSA 1LQ2A 2Z1BA 3RR1A 3UJRA 3AOFA 2WVVB 3U5YA 2RSEA 1V5XA 3QOKA 4XZMX 1TV3A 3FKKA 4DJED 4QITA 1LTDA 2QKFA 2EAWA 3LCXA 1V79A 3EB2A 4RKAA 1RZMA 2WZIA 3AXHA 1R5YA 3HGSA 1JF6A 3TQVA 4MNLA 3M41A 3VK5A 5AN7A 4FF5A 1CXHA 5CGQA 1KGXA 3VAVA 1YTKA 3FEMA 4WY0F 3IGHX 3LCLA 2OPJA 2D2GA 5LSMA 1B54A 4HHLA 3KAFA 1E3ZA 3LCWA 2ZA3A 4AD5A 1FX6A 4BF7A 1SU5A 1GORA 1KXQA 2QYGA 1XGDA 3II1A 5D04C 3KL5A 2Z1VA 4DZ3A 2NQLA 3O5RA 3QQ0A 3W83A 1H4PA 5A94A 4Q7NA 2HVMA 3K1GA 1OVDA 2QJNA 3RFWA 3BURA 1R86A 1XBZA 4GOAA 2PBCA 5KITA 2NWRA 1I2RA 2MNRA 2YA2A 6REQA 3GHTA 1XQLA 2O7QA 5DY2A 2WC7A 1SZEA 3R0UA 1DJXA 3H21A 2FKPA 2CETA 3SRKA 3HMCA 2X2GA 4JKMA 2FQIA 5EMYA 1BHGA 1ZJHA 4Z0JA 3N6QA 2YCJA 1CXFA 3WD3A 1GW1A 1PBKA 1WBHA 1Q66A 2MLYA 4G2PA 3CMFA 2Y7DA 4IZGA 1E5JA 3S1XA 1HUVA 1KM4A 1TCMA 3V36A 4QTGA 4LV4A 3B0XA 3CUIA 2V5JA 2ZA1A 3NSXA 2GUBA 1U1HA 5FF7A 4LVBA 2V81A 2WM1A 1YPFA 3EMZA 5AC6A 4Q8PA 1OIMA 2P88A 1GOKA 1I2NA 2RAGA 4UFHA 1UIPA 3VFLA 2QT3A 2FTWA 1QPLA 2ZX5A 4MFDA 2J62A 3CUHA 1QU4A 2KR7A 5LIKX 1LOSA 3UYIA 1KGUA 3F4WA 4GXPA 2KGJA 3KAHA 1IWBA 5U4NA 4PUNA 1ICPA 1XCWA 3UD6A 1EEPA 1SFLA 2JIWA 4KCVA 1J11A 3XISA 3O63A 1PZ2A 2YJQA 1LJYA 4PN2A 3MUZ1 5DFAA 4PCSA 4J28A 1UPPA 2WZTA 4U33A 3UCDA 3O5GA 4OIFA 4HOXA 1CDGA 1S46A 3CNYA 1E6ZA 3GTIA 4W8LA 1TA3A 1RR2A 2WQDA 2Z0IA 4U2YA 4GKLA 2VVSA 4NJJA 2Q8XA 4ROPA 3H26A 3FSTA 5PTDA 1F5ZA 2FJKA 2VRQA 3O0FA 3C2VA 3E6EA 3TOPA 2FPTA 3LRLA 1V6YA 3LGDA 1K77A 3IHZA 2Y8KA 1JZ2A 3CS2A 5BOEA 1A7XA 3GVWA 3NNTA 2CBUA 1S2UA 1GOXA 4HHMA 2Y4SA 1HIZA 2PC8A 1MW1A 3OBEA 3WELA 3VD9A 3STCA 3P5YA 1C9HA 1W91A 3EY6A 1HL9A 3GC4A 4W8AA 3NXFA 3DERA 4U3CA 4RNJA 3C0QA 3GNDA 1N1AA 1UPMB 4O10A 2VX5A 2YL6A 1QW7A 5M1TA 3EIPA 3OGRA 4H6QA 3W29A 2ACSA 1H41A 4K8EA 1LBFA 7PTDA 4Q4PA 1VYSX 3UERA 5REQB 3WSUA 3N2TA 2BVYA 4NI8A 1E0VA 5A2BA 2VGFA 2G96A 4GWEA 1QNPA 2JGYA 3WNMA 3WYZA 1BD0A 1YE4A 5BU6A 2Z27A 3CV7A 1H62A 4HCLA 4NZ4A 1CLXA 3N4EA 2EPHA 3VO0A 2WVSA 4LUSA 2NZLA 1X1NA 1EPXA 1CGTA 2EULA 5I3FA 4PUJA 3VGDA 2PDWA 2WM0A 3WQ4A 1FXQA 3BOXA 3L65A 1VKFA 1G67A 4D71A 1VBHA 3URBA 5C71A 4ZPVR 3DC8A 5JVLA 2OYLA 4V1XA 3DEQA 3WH0A 1WQ5A 2XIIA 1E6XM 5DRCA 2REQA 1JZ5A 1H49A 4XVEA 4AIOA 4FXRA 5C9UA 3R7MA 1M53A 4JY8A 4C90A 4ODOA 1FWRA 2FMOA 5HMEA 1WDPA 4PMJA 4AX6A 4DWDA 4I9MA 3WUEA 2X1TA 3IUIA 3TZFA 4MGVA 3WO8A 1NOUA 4GKTA 2C71A 1WKYA 1QHOA 1N82A 1O5KA 1SSGA 3DFOA 3LM3A 3N34A 4LV9A 3SBFA 3T81A 5T9CE 2XFRA 2GUUA 2RDXA 1SMDA 3BAWA 2GPTA 1KKRA 2QDGA 2VUNA 2O4QA 4QJ3B 2GQ9A 3URAA 2G3FA 4M8UA 3GAKA 5HW8A 1Q6GA 2D9FA 4Z2GA 2QXWA 1E1CB 4BKNA 1ZBCA 1J10A 3GS6A 2UY3A 3PUDA 3ZS4A 3GNOA 3LQGA 1SFJA 1MI3A 3IJ9A 3WJWA 3TWAA 2OB3A 1HL2A 5CPNA 1F3WA 1YTDA 1AA1B 1RVGA 1W1IE 2ZZ2A 4HYWA 1RV8A 1ENUA 2VMFA 1CGVA 3CC1A 3U7VA 1D6OA 2NUWA 2B0MA 4U2ZA 4D6GA 1EO5A 4Z1AA 3SJNA 1UD5A 1XLJA 4HA1A 3OODA 5BXPA 3PJWA 3UQBA 5BWFA 4WDUA 2H9AB 1E4NA 1KM6A 1BLIA 3C52A 3W7PA 5DT7A 1N8IA 2J24A 1RBAA 3T08A 4QLJA 1LOLA 1XRFA 3UJFA 4ASTA 3ABOA 2VVNA 2X41A 2RUSA 2FPYA 2GSHA 4GCXA 2WMKA 3BGAA 4XTIA 1FKSA 4F0KA 3HPSA 5TBOA 4MM1A 3GW0A 2GK1B 4HNLA 3TWBA 2BODX 3MCMA 5HNRA 1BVNP 3F4CA 4IX0A 1VEPA 3TTEA 2EBNA 1XYZA 4MWAC 1A5CA 2Q8ZA 3HBLA 4HCHA 4HZMA 2DUZA 4A05A 3GRIA 4M6UA 2V9DA 1YBQA 4A21A 3NSNA 3WG6A 4IPXA 1K3UA 3F1QA 4I5RA 2WLZA 3RPTA 5HULA 4Q32A 1EGZA 2WHLA 2ALDA 4CD7A 1RJPA 4TNSA 1IR2A 3SGZA 4RJEA 2D1ZA 1F4HA 2AOSA 4J7RA 2QNEA 1XKJA 4L80A 1M41A 4KEUA 3IIVA 1TPVA 2QVNA 4M1RA 4HQVA 4H7CA 3LLXA 4YTSA 4IP5A 4MVAA 5HNTA 2YLAA 3S42A 1BEUA 1F3EA 2Q5AA 1I2OA 1EKOA 1PE1A 2JKEA 4DXXA 4A29A 3W6LA 3VNMA 1D7HA 3W1AA 3D5HA 3PWGA 4C6OA 1EBHA 2BOEX 4EPEC 4Z1YA 4L4LA 4L6OA 2GQ8A 4C6LA 1W1A1 2V30A 3QVQA 4M80A 1S5WA 3DUGA 3QV6A 1PCWA 3LN3A 5JH2A 1NMVA 2Y62A 1EQPA 3VIHA 4H8VA 3FV9A 3AS0A 3R13A 4OHQA 2X42A 5FJIA 3UQAA 1TELA 1HJSA 3CAWA 5C2XA 3RM9A 4NAEA 1DKWA 4PUUA 3QV7A 1ISVA 3BXWA 1T8XA 3DHPA 4JX6A 3DH7A 4KH2A 1WNOA 1F73A 1C7TA 3UWYA 2Z29A 2QCMA 4GQRA 4C6BA 1TVPA 1HW6A 3GHSA 4R9OA 4KWSA 2VYOA 4R85A 1IF2A 1W1B1 3KWSA 2YW3A 4AY8A 1U22A 1TWSA 3AMGA 1WAUA 4ZO6A 5AB3A 3S9YA 4FSAA 1DWJM 4HZ6A 4GBDA 2HNHA 4AWEA 2FVMA 3LHWA 2YCLB 4H8NA 3K13A 4I9AA 3O2LA 4XSLA 3OP2A 4JTQA 4GQQA 4ZXLA 2A3LA 4K8HA 3W1LA 2G8ZA 3T40A 4EVZA 1E5NA 3I4KA 3MYPA 4M0XA 2F38A 3CZGA 3GE7A 2C0AA 3KOWA 1UD2A 2HEJA 1HGYA 2CLFA 4M3PA 4MNKA 1V02A 3GY1A 3U2CA 3VCNA 1A5OC 1ZBKA 2JF6A 4ACZB 4AMAA 3G1SA 3QPEA 1QOQA 2ZOXA 3TQPA 3WNKA 5BCAA 2WJDA 4Q4QA 4H04A 4L7ZA 4A2SA 3L4YA 2M1IA 3TFCA 1HVXA 3SFKA 2VHLA 3QKZA 1ITUA 4GCAA 1XIIA 3CUGA 3KCOA 1AJ2A 3EEZA 3Q2DA 4Q8NA 1G5AA 3LCHA 1XP3A 1JYNA 3MWAA 1HJXA 2PWFA 4CQCA 1FBAA 3FJ6A 3SRDA 5AHIA 1PDYA 4TX6A 2J4GA 4P2VA 3FVDA 1ISWA 1UG6A 3IJIA 2ZRYA 3O5PA 4FS9A 4F66A 5CH9A 1A5KC 1FCVA 4WSKA 3LCFA 2XPKA 3M0XA 4GYKA 1JULA 2UY4A 2FVKA 1TTPA 3BOLA 4XVDA 1PIFA 2CBVA 4DRJA 1E9YB 3P5ZA 4OTKA 3DG6A 1ZHAA 4YVVA 3ZSSA 2V8ZA 3VOCA 3FXYA 3DZ1A 2YZRA 1A5LC 3N2XA 1YX1A 3WN6A 1SO4A 3FAXA 4N0RA 3VUSA 3R8HA 4RZ4A 2Y2WA 4JTRA 3EB3A 1UCWA 3B8TA 1J4RA 2PP0A 4UOQA 6REQB 4TMCA 1TPFA 2HROA 4IIFA 3H53A 3W2NA 4RK8A 3VOIA 2QPUA 4HZ7A 2W3ZA 1S39A 4B5XA 4Y7EA 1REQA 3BH4A 4US5A 1PSCA 1H7WA 3IJLA 4JEQA 2OO6A 3CPRA 3ZMRA 3WH9A 4B2DA 2PC4A 4GBUA 3GFZA 4IPJA 4AISA 3IJDA 5FESA 3T7VA 5CZJA 4C6EA 1F05A 3QY8A 1ZLPA 2VJXA 2W0UA 1P7TA 1ZAHA 3CZKA 3VIPA 3COTA 4E2VA 2GYIA 3KEHA 1DBTA 4A3QA 3HG2A 3R4IA 3HOJA 5F7UA 4HPHA 5GPRA 1J4IA 4OZOA 4P7OA 3ZM8A 5AFDA 4EAMA 2Y8UA 1TX2A 3DFTA 4J2PA 4C6QA 2VCAA 3TX9A 1OGGA 1NFBA 4DI8A 3PG9A 4DVOA 3GR8A 1W5QA 1DPMA 1U79A 4CCZA 3BMBA 1LZOA 1EBGA 3CM4A 3KTXA 4MWAA 1KD0A 4DRKA 2JEQA 2OSWA 2JKPA 5CG0A 2NVDA 2OX4A 4JQ1A 5D8WA 3PN8A 5EKYA 3B04A 3O05A 1AMKA 3MSGA 4GZ7A 2Q3RA 4JTAA 4ZQPA 3TIMA 1W3IA 1XIEA 4NYUA 1LT7A 4KGLA 3VDBA 4Q8WA 5HNNA 3TVAA 1TA3B 3G8EA 5SWUA 3MUY1 4TU1A 3QSTA 5DMYA 4UNKA 2XVKA 2H3DA 3EPOA 1Q4NX 3GC5A 1BPLB 3E12A 3L66A 3W22A 2HE5A 3K30A 2FZNA 1KCKA 1B6CA 8CGTA 3AXXA 3RGCA 3HGOA 1KTCA 4K1GA 3STPA 4KBXA 5E09A 4BA0A 1FWNA 3FS2A 4C1NB 2R91A 3QZ6A 1NP2A 4XO6A 2VWTA 3DN5A 4LYRA 4HK6A 1VD6A 1K9FA 1OWQA 4JIEA 2JBMA 2BY3A 3LV6A 1OCJA 3D3AA 3V7PA 1FKLA 4O15A 4MYAA 1UD3A 5DCDA 3EWCA 2C19A 3VD3A 4F2UA 2WKGA 4I5XA 4O17A 3F4VA 3HQ1A 4BF5A 2Y89A 4UFJA 3AU6A 4YXGA 4QDPA 3DU0A 5I23A 2XH2A 5I78A 2G41A 1JI1A 3EA2A 2BBFA 2QUMA 4FP1A 3VM7A 1DQUA 5LXXA 4GZEA 5H91A 5D38A 4PUEA 2ZTKA 3S47A 4DF1A 2VEGA 3NJ3A 3RMJA 2PDCA 4GQ0A 1E6RA 1AH0A 4GNKB 4YTRA 1AH3A 1EJTC 3BJSA 3BUVA 3L0NA 3MQTA 1FH7A 1QK0A 3DKLA 5M17A 2A1YA 5HR7A 3GXIA 4X0NA 1Y5WA 1ISXA 3OA3A 2UY2A 1I2QA 1JPHA 1NFPA 2R1LA 3GTXA 3IVSA 5AYBA 3TSDA 1WDRA 4F0MA 3T0AA 4Q33A 3WCZA 1H1NA 1UD6A 3RO6A 1HT6A 2YCIX 2RUCA 2GVEA 3TAOA 1ZL1A 4MKSA 2VQTA 3MS8A 3G1AA 4AVNA 3VCRA 2CHRA 1TE1A 3NQGA 4WKAA 4E8CA 2DVTA 4PL2A 3VA8A 3TYCA 3CHEA 4NJIA 2W5FA 2X2YA 1DIDA 4WDTA 3HA1A 1VBGA 3V1PA 3NSMA 1R46A 1T99A 2VR4A 1DJYA 3KAGA 4ODQA 4NNRA 2HS6A 1E0TA 3RF9A 1TPB1 4IJRA 4P8UA 3CO4A 3UCQA 2WSKA 1XSKA 2Q8LA 1SFTA 1IQ8A 1C9WA 1XF0A 1ZP3A 4DZHA 1WBJA 3OLGA 4IQLA 2PCQA 1VFSA 2WJFA 3KRUA 1P5BA 2E68A 3JYMA 3KAOA 1EQ3A 1ZUAX 2WSRA 1JNTA 3RM8A 3KX6A 4MB5A 2VCCA 5D02A 4I6VA 5J04A 1ZCNA 4HVXA 3QGAC 1FWTA 5C70A 4D2JA 3N2CA 3O15A 1HVQA 4UR8A 3M7SA 1BGAA 2UZ9A 4MFEA 5ENLA 3TMQA 2WV8A 1XYBA 4CEUC 3O5MA 4FXJA 3VINA 3BLPX 4A6GA 3DHDA 1EYWA 3CV6A 1J6YA 4Q8UA 4JIQA 3RGTA 3CQIA 4G9PA 4N7QA 1RP9A 2QW5A 5BWAA 3XINA 1J8VA 2FYMA 4FLSA 4CVUA 1TTIA 3KP1A 1WKFA 3I4EA 3THQA 3LG3A 3TR2A 5DT5A 4HTYA 2PLCA 4PEKA 5CZ0A 2M2AA 3KW3A 3E74A 3A4JA 5F4SA 5HW7A 1AQFA 2RUDA 2XH4A 3V5OA 3PSVA 1MDLA 4H8UA 1L8PA 3KVJA 1JPIA 4ERAA 1JPDX 2J27A 3SCTA 1TUFA 4B16A 1QWKA 3K4DA 1OX4B 4WJEA 1B3ZA 1TIWA 3LNMA 3PTDA 1TZZA 4L61A 1BVZA 1RJRA 1ITCA 2X1RA 2DT3A 1A53A 1SR0A 1M7OA 5A6BA 2RQSA 3B05A 3WD1A 1WOBA 5FJTA 1NM9A 2PTXA 4EKJA 4DRIA 1YBQB 2I14A 3PJUA 3UPMA 2PWUA 4J3VA 3M0HA 3GVQA 4QAWA 4UTMA 5CSUA 3K46A 1QI3A 1JPKA 2PLMA 1X97A 3QC3A 1S5TA 5CPLA 1E0XA 1GK8A 4XAFA 3AYVA 1MRAA 2UY5A 5DIUA 2ZR6A 4F2TA 3FDGA 3DFHA 3ALFA 8RUCA 4D6FA 3CXOA 2UV8G 4ADSA 4BI7A 1RY8A 2P8BA 2PCEA 1V51A 2W79A 4J9JA 1PBGA 1MW0A 2GWNA 4C91A 4KEVA 3WFAA 4ECLA 3DBPA 2VM8A 3MKVA 1S38A 5IRPA 2FZDA 1EZ2A 3UXAA 1KRMA 3T4WA 3E0FA 1SO6A 1M1BA 4DRPA 3T0TA 1CLKA 2QF7A 2XIQA 3VILA 3OQEA 3PPGA 3BLEA 2ZUWA 4JTUA 4J3UA 1CW2A 3R25A 2QUTA 1BQCA 2DJLA 2FAPA 3G2GA 3VOHA 1FAPA 4GD0A 2PGEA 2Z4GA 1YNPA 2ZCGA 3LM7A 4YIWA 3QSRA 3UF9A 2D2JA 4FF7A 1A0EA 3FYYA 3F2CA 4AYSA 3G0UA 3VXGA 4DJEC 1HQTA 5D37A 4QZVB 1DTUA 3MHUA 1E73M 2W27A 3WLRA 4PC8A 3WNPA 5BRQA 3W86A 1SZGA 4UIOA 1AZ1A 4HB7A 4OT7A 3VGGA 2PB1A 4XZIA 3L2MA 1FHVA 3WQDA 4Z0SA 1ZJIA 1POJA 2DG4A 5L6UA 1UR0A 2B31A 4Q8QA 3TAKA 4QR6A 1W1YA 3O1NA 3GM8A 4A4AA 3E49A 3KCLA 5TD4A 2J9ZA 3J7HA 4LANA 4NKCA 4OVXA 3DYMA 2YB1A 3AIQA 4OWGA 4CD8A 2O92A 3TZNA 3QR1A 1QNQA 1EQCA 1PX8A 1Q4WA 2GSJA 4TX8A 3EA1A 5LA2A 1UUMA 1H1YA 2OCZA 3A23A 4ZE5A 3O5OA 1XIGA 1RK5A 3H23A 3KDNA 4KPLA 3MP4A 5HTGA 3VIJA 1K4GA 3TN3A 2XP9A 4FOJA 2Z1XA 1HG3A 2QJGA 5ABHA 1QR7A 1HKMA 2EPLX 4P8VA 2V3DA 1M6JA 1BKFA 1UUOA 1AH4A 5H2ZA 1JZ6A 1Q63A 3TDFA 4XD4A 2HWGA 3AS3A 1E55A 1ONEA 4KRTA 3FA5A 3WLIA 4WF7A 4MADA 5H6HA 1BXBA 2AL1A 1US0A 4IXXA 2D3NA 4K8GA 3WF2A 3ME3A 1SVDA 3ZLGA 3DESA 4HSOA 4NXKA 3PBUA 3ZJKA 1G7VA 4G6CA 3VD5A 3CT2A 4WJ8A 3LPOA 3F2BA 3CH0A 4NF7A 5XIAA 1YDYA 8TIMA 1JCJA 1HNYA 3UG5A 3FW6A 4Z1BA 2Q09A 4ES4A 1ONXA 3CQHA 3A24A 4ZENA 1U5JA 1V3KA 4H9YA 4NT0A 1UZ4A 2HVOA 3MSYA 1R6WA 1XYLA 1MUMA 4GHRA 3PF3A 3OLEA 2ZX9A 1MEWA 3H2OA 3I6CA 4S3CA 1TO3A 4HPXA 2I16A 4IQ2A 2Y1HA 2E6AA 1CIUA 1H0GA 4YTQA 3TJXA 4JCMA 2R6OA 4UTTC 4DZAA 1KRCC 3WK3A 4S1FA 3BICA 1B2YA 5EMLA 6XIMA 3SEPA 3PB0A 4RW5A 3IK2A 3GX9A 1CENA 2ZDSA 4IHCA 2CBJA 2L5HA 1DQXA 1BKSA 3O8AA 4OOZA 3E9AA 4LRSA 1REQB 4GJIA 5F4WA 3NEHA 2V3FA 2VC9A 3GUWA 1MEHA 4J2MA 4S2CA 3P80A 4HK7A 5XIMA 1UHVA 4G1KA 3UYCA 1RD6A 1FRBA 1FWWA 3N19B 1CNVA 1E6PA 4UFKA 3USZA 1V02E 1LCOA 1Y7VA 1P7TB 1ZRQA 2A79A 1XDLA 3NQMA 4LGXA 2G4FA 4O8RA 3AFBA 1M04A 3CMGA 4E6MA 5ABGA 1GOMA 2BXZA 4X9SA 3KDOA 2FGLA 3S3GA 4DAFA 5C54A 1WDWA 1WP6A 3NA8A 3PAJA 1E6QM 1DWAM 1K1DA 4Q6XA 3H7VA 3CZ8A 1UR2A 3M0VA 3S46A 1VZWA 4QE4A 5K7JA 5A8MA 1TYGA 3CV2A 1BSIA 5D9MA 1BVWA 1WDQA 2CEQA 1EA9C 4LY8A 4NG3A 4M5PA 4MWAB 4S3KA 3GDTA 3URNA 3WLQA 1R3TA 3O7UA 4P5UA 4QDWA 4CLMA 1VHCA 3GDRA 2A7PA 4JTKA 1ZFJA 4DLFA 2V2CA 1QOXA 2XTKA 3OLIA 2D23A 2OWCA 4GH1A 2WPGA 3NG3A 2GWGA 4QS5A 1UR1A 3ERPA 1WZLA 1XIBA 2PP3A 2XSXA 3C2OA 1VPYA 3AIVA 5T91A 4B91A 2DJXA 4UMCA 2ISSA 3MO7A 3IGXA 4J3WA 1FKTA 1O7AA 3BANA 5CAKA 3DECA 4DZIA 1IYXA 3U7BA 3CHCA 3IK4A 1HJUA 3VKJA 1QUMA 3L0GA 4ICNA 1QNOA 1XYFA 4W9QA 5IBXA 1EB3A 2DV0A 2OYMA 1TPH1 5IFTA 2XUCA 3RN6A 4MY8A 4GNJA 1R9YA 2CLEA 4H9UA 3VIOA 4LAXA 5DO2A 4GK8A 5CGMA 3U2OA 2Z24A 4QNEA 4ODPA 4GACA 3APYA 4KRZA 3TV8A 2ZE0A 4V33A 2V5CA 5CEWA 4OE7A 5IHSA 3WENA 1V8EA 2XP6A 4GNVA 1XH2A 3DENA 2E77A 1ALDA 1E9LA 1H7RA 3R6IA 4FXFA 3HG4A 1E4IA 3NQEA 3HTWA 3G24A 1BRLA 3PAOA 3SFWA 4H7VA 4GVFA 4WDWA 4DJEA 1J0JA 4JFTA 1NQ6A 3DXIA 4G56A 3W01A 4U5IA 1TJPA 3KBVA 1JDAA 2XN0A 4KESA 4JTFA 1PDZA 4GMEA 4JKLA 4B3KA 4XAGA 3MDWA 3KADA 4X61A 2F6KA 3ABZA 1E44A 2QV4A 3R0DA 3CTTA 4B5VA 3NYDA 4MWAE 4FNQA 3CK5A 3GZAA 4LNYA 3NQBA 3W7RA 3KHDA 2Y70A 1ROUA 1IWPA 4XUYA 1LWHA 2WNWA 2W63A 4KETA 2CITA 2CYGA 1P1MA 4AHOA 1LLWA 3V18A 2PDFA 1Z48A 4AD0A 2ISVA 1GVFA 1UMLA 3T55A 3ES7A 4IPPA 5KEZA 2G3NA 3AUJA 1OCBA 1UD8A 1G4SA 3S5OA 2C16A 4HT3A 1H7PA 2Y63A 5CAHA 3H4WA 3C3UA 3P2VA 3T0CA 4M6QA 3NZPA 3EA3A 4MJMA 1PHWA 4JICA 4E2BA 4ZCWA 2DQXA 3UNDA 1QASA 5D75A 3H7UA 2G3IA 3EX3A 3ZT7A 3PPFA 4L56A 2NQ9A 3VC6A 5JH8A 1FVPA 2DSWA 1XGEA 4GRSA 2FGZA 2PDNA 4A22A 2Y5EA 4U31A 2F4EA 3NURA 4LPCA 5CQ1A 4Y9OA 3N73A 3ZLFA 3CV1A 3THDA 4QHRA 2M08A 2PV2A 4LY4A 3R10A 1G01A 5CXPA 4JFMA 5G4HC 1MEIA 4ZEPA 3WFZA 2XDFA 4FIRA 4E5TA 5A8QA 2XVPA 4QJ1A 2E5DA 4O11A 2ZXDA 2EPKX 4G8TA 1AL7A 3EB4A 7ENLA 3L7RA 4D8ZA 4O4VA 9CGTA 4R33A 3VI2A 1FKIA 5FF3A 3UW6A 3H2AA 4LB3A 5KTLA 4PMDA 1PZ0A 1V4YA 4X63A 4ZXOA 5CG7A 1ZZMA 4PCNA 1VCFA 2WANA 3QRHA 4TV6A 1Q45A 3LZ3A 1XGZA 3EKLA 4LBRA 1G4TA 1VFLA 2BSLA 4LUJA 4DZ5A 3TYBA 1ME7A 1TJ1A 4B9ZA 4DEFA 2INFA 4BQ3A 1I0DA 2V6AA 3G1XA 5I00A 3MT1A 2DW6A 3DKJA 5CBIA 3WNNA 4GG9A 3U4FA 3AYRA 3RPDA 2ZQ0A 1A3HA 2YDQA 4D6CA 1HXJA 5I02A 2E8ZA 2V0TA 3AIUA 5A6LA 3W7MA 1JCNA 1QO5A 5FSEC 1ZBWA 1P43A 1LM1A 4UTTA 3WEZA 3BAKA 2V2HA 2MANA 3IKDA 2VELA 4H00A 3B4YA 5I77A 3EWUA 3W85A 2X0YA 4S23A 3EPMA 1ZAIA 3UJEA 1B57A 1AVAA 2KX9A 3WD0A 4LFYA 1YLVA 2V5KA 3ZSTA 3AO0A 1XM3A 1F6PA 3S9ZA 1UWTA 2A6NA 4BI6A 4MSSA 4AB4A 2OLAA 1HFBA 1QPQA 3EXSA 3TA6A 1MZHA 3H7RA 1TRIA 2X40A 1FWSA 4WVXA 4DRSA 1MXSA 4K68A 3O5KA 1JF5A 4GC4A 3KLLA 3LXCA 3DAQA 3ODKA 1LLOA 2BNJA 4O0ZA 7XIMA 2A3EA 1ZTVA 4ZGYA 2GUYA 2DH3A 2VFEA 4KIEA 3H2FA 1ICQA 3AZTA 3LDVA 4GVGA 4AUBA 1JCYA 1BAGA 1Y0OA 3BTNA 4JFVA 2DSUA 2VC5A 2JE8A 3SUUA 1K8CA 4Y9PA 4PCPA 4ITZA 4HMCA 1QOPA 3RX3A 5AYXA 2EXOA 3BZGA 1QHPA 2HPMA 3TW7A 1V6XA 5E5CA 3GTYX 3TTOA 3V16A 5AC4A 2V82A 1QTWA 4YTUA 4PEEA 3DBNA 2VRJA 1EUNA 2XU2A 3PPHA 4UTJA 1PYMA 2KO7A 4LRTA 5F2GA 1DTNA 3GYEA 3UVAA 2ATMA 4QXIA 4JQAA 4U3AA 4DJDD 4YHEA 4PB4A 5I3HA 2QULA 4HJFA 2E67A 2QS8A 2XPAA 2BFGA 4U5KA 1H3GA 1R7OA 3LLDA 3G1VA 2DZUA 3ZYZA 2H8XA 3N14A 4C5YA 3LB0A 1TG7A 3C4UA 3LHYA 3IIXA 5BXTA 3NL2A 2QDHA 3AYTA 2GDVA 1KR0A 4UCFA 3ONCA 2XIOA 4JBRA 4WSHA 2I5IA 2J7CA 2VFIA 3P81A 3AMLA 4H7ZA 3AU2A 4KMQA 1IXQA 2QCDA 1ME9A 7TAAA 1W9PA 4N6FA 4ATLA 1FY6A 2CLHA 1KC7A 4B2DD 4AZCB 1U5VA 1WV2A 2XFWA 4LVFA 4P7LA 3JU2A 3HF3A 5C0QA 4AIBA 5BMXA 2JZVA 1HKVA 1MNZA 3LHTA 3L2IA 3IUDA 1FKFA 5LIXX 4RPPA 4AD4A 2HV5A 5CKSA 1PTAA 4DLMA 2J13A 3EWBX 4JTCA 2XVGA 3C2FA 5ECUA 2V68A 3FLUA 4CD6A 4HMNA 4CGTA 4S3BA 4F4RA 3T42A 3UWZA 3VAWA 5E9XA 2ZADA 5LIWX 3QGKC 2NT1A 2HSAA 2ZZ1A 1A5UA 1MO0A 1HGWA 2WNZA 2X7WA 1KB3A 1LDCA 1BQGA 1S5MA 3N9KA 3LGEA 5AECA 3S8HA 1ZAJA 3M6YA 3GUGA 2CZ5A 1OD0A 1TV4A 4Z2LA 4DELA 5BXRA 3U2ZA 3AXIA 2ABBA 4OV4A 1KNWA 1NELA 4Q3MA 4ZBCA 4HMEA 4I7WA 3RDKA 4O1FA 3TR9A 3Q65A 1NVMA 3GG1A 4Z2JA 2E5CA 4EACA 2CESA 4FNSA 3TLQA 2DUXA 3MU7A 3PBYA 2NX3A 5MF5A 5I3GA 3CUXA 1V6UA 1AJ0A 3ITCA 3ZT5A 2MLZA 2BVTA 7ODCA 3S5SA 4KEMA 3NDYA 2FIQA 2HNEA 2J88A 4RZ6A 5AHFA 3SM0A 4HNVA 3KACA 3A64A 1OSEA 4L72B 1KA9F 3UR8A 2J9YA 2RFGA 1C91A 2AQVA 4GZJA 3HB9A 3BO9A 4GJJA 3QM3A 1KFEA 2FMNA 4PBFA 1B5TA 1KT1A 1UD4A 3UESA 1HP5A 3FJNA 4GY1A 1G94A 4JYDA 3EOEA 1HJVA 5IHRA 1Q5MA 1UB3A 1QPRA 2RDUA 2WZHA 1LF1A 3QV9A 2HTMA 1H61A 1JCLA 4LAYA 3P3BA 2TSYA 3RIKA 2G37A 1OFQA 2PU0A 1XUZA 3RITA 1EP3A 2FTYA 3H24A 4KFPA 3PR2A 4HHHA 5AYYA 2J7HA 3VD4A 3MANA 5GPGA 1OZQA 3MSRA 2NUYA 1CGUA 3TC6A 2OFJA 2YFNA 3APTA 4AD1A 4K3ZA 1FWIC 4XAPA 1DWIM 5HQEA 1D7KA 1V0KA 1BL4A 2EPOA 3WUBA 2ZXAA 2X1UA 4QE5A 1H60A 3I7SA 2OKOA 1H1ZA 1SGJA 2XJ7A 3EWDA 4ZOBA 4Y96A 4I9TA 1EYEA 1S5VA 3MC5A 3GNXA 1K7FA 4DPQA 2H6RA 1TPEA 1UJPA 2X0SA 1UH3A 3PHAA 2QHAA 3MYOA 2IUZA 1UROA 3KZPA 1P0BA 4JTLA 2BOFX 4B92A 4ZMGA 3ID7A 3CB3A 1WA3A 2E9BA 4UQAA 4W8BA 3FA3A 4IM4A 1W3KA 3W1PA 2XPBA 4E38A 3P0WA 1SJDA 3NQCA 2CZVA 1X39A 3DFQA 3UR7A 1AUSL 1OM0A 4IIGA 1FWDC 3LPGA 1AZ2A 3VIKA 2I1OA 3CGNA 3WDJA 5C2CA 1DYSA 3IAQA 1QI2A 1TJRA 2CWNA 2PDJA 4HPNA 2PS2A 1UKPA 3ZT6A 2IF4A 1E4LA 1I9CB 7A3HA 2CXEA 4KRUA 1E3XA 3TC7A 2BLEA 3W72A 4Q4SA 4HOZA 3V3WA 4WGHA 1P6CA 2I57A 1UR3M 4TIMA 3I7RA 4UXDA 1DWFM 4GIYA 3WJZA 3IIOA 2Y6ZA 4H6EA 2OG9A 1FXPA 4UTKA 1UA7A 5T26A 5EMKA 3W7CA 1GJWA 4ODMA 2PU1A 4N9BA 1XWYA 1DJHA 4UQEA 3UI5A 3DG7A 4ZQOA 3IKGA 4QCEA 1KV5A 4C6PA 3OVPA 3VZZA 3TQ0A 4ORMA 2G0WA 1GGOA 1O5QA 3H70A 3VDHA 5HQLA 1GQLA 4H19A 1BKHA 3SI9A 1A0CA 2WJZA 1PAMA 5EMUA 4TQTA 4K38A 3AXMA 2CERA 3CGTA 4JFJA 2HK1A 3W07A 4RXGA 5C7VA 2D69A 1RSCA 4W89A 8A3HA 4FX7A 2Z26A 1RCOB 3U48A 3DFPA 1BRLB 3QFWA 3VIFA 2PDQA 5HUAA 4WHBA 4ODKA 2B4GA 2N87A 3C3NA 1KFWA 3S2MA 2IKGA 2ZDRA 3OOBA 4AWSA 3I7QA 5IFPA 3CUZA 3B40A 1BYCA 2Z7KA 3CL6A 4S3GA 3FJLA 3NO3A 1ZNNA 1L2QA 3KXQA 5I2UA 4N6EA 1TPDA 5A6BD 1UWSA 4LAOA 1L6GA 2IKIA 1Q6UA 4XO7A 4EXAA 1TSIA 1ECEA 3W1NA 4QCFA 2WNQA 1KM3A 2FZBA 4HU0A 2OGJA 2DZVA 3KBSA 4O54A 1XLLA 1F40A 4R53A 4DRMA 3QBUA 2ZC8A 2ZUNA 1FKJA 3VNLA 4NIRA 4F9JA 3OW1A 1GUVA 1YYAA 4BY3A 1J0ZA 1EP2A 4HPJA 4LQ1A 3N4AA 4PULA 4MF4A 3ZJ7A 4AF0A 4K1WA 1THFD 3HZ3A 1DXFA 1NARA 2XGBA 1NU5A 2Y78A 3GG8A 5CPOA 5CZKA 1P0DA 1U33A 1FH8A 1F9CA 3E0IA 3GU2A 4FNRA 4OUEA 4J3XA 1PYFA 3UJSA 3DI0A 1LRNA 1ZK6A 1FKHA 5A6MA 3I3EA 4O14A 2R1PA 2CW6A 3W6MA 2ZIDA 4C6KA 3NDOA 3EGJA 3AICA 2B5UB 3W2LA 5DQPA 2GGGA 2AMGA 3EX4A 5EMMA 2XSBA 4H1ZA 5DMNA 4FX8A 1W5OA 4YLWA 1RALA 4OBRA 5HUPA 4H9VA 3AIWA 1XLCA 4M29A 5A1AA 3WLKX 4HD5A 2XH7A 3E0VA 3H2CA 2VXNA 2PUZA 1S3TC 2DIKA 1E56A 3RCYA 3GTFA 4CQ8A 3VDGA 1KLYA 4NP7A 4JTSA 2BGSA 3UF8A 3M0ZA 4HHPA 3VNZA 1GZGA 1HZYA 3HV9A 4CQBA 4RDYA 3TTYA 1V08A 1W17A 4U10A 1VFHA 2WW5A 2WKJA 2YSWA 4DWSC 2YBUA 4UUIA 3CQKA 3BG5A 1OYBA 5TNVA 4B3ZA 3H2MA 5IDIA 3B9EA 3BCJA 3L5LA 2VGBA 4L3NA 3T0BA 3PRDA 3CIWA 2UBPC 3FGCB 1EA0A 4IL0A 5K9XA 4RNIA 1YXYA 4DAIA 3E96A 1SZRA 5HW6A 5D9PA 3WMLA 2Q6ZA 5IOBA 3WY1A 5EA9A 1UYQA 2ZXQA 1FTXA 2FZ9A 4HYVA 3TJLA 3W0KA 1DOSA 2D0HA 4GIRA 3PBGA 4JFIA 3WUFA 2F6UA 5C6MA 3TK7A 4LS2A 2NQZA 1IE7C 1KFKA 1B3WA 5CSYA 4QP0A 2A3BA 2ZQUA 2JIEA 2P10A 3N1AA 1C92A 4O16A 1KFCA 1VS1A 5AVHA 3M0YA 3PZGA 3MUIA 4OQVA 4J4KA 4CKQA 4KWVA 1H0IA 2DH2A 3CEUA 1BFNA 2UZ5A 4G7FA 2ZX8A 1ZY9A 4MJZA 4D6HA 3LHZA 1CEOA 4O0QA 3TEVA 2WBKA 3MVTA 5A3HA 2WMJA 5CLWA 2XVLA 2JQXA 3LTYA 3NGFA 3W2MA 1WYIA 1OJXA 2CLIA 1O5RA 2PDXA 1Q2RA 4GH3A 1AL8A 5CPTA 3G3MA 5J6EA 5CJNA 4MOZA 1UA3A 4UZSA 3W53A 3BGGA 2XINA 3ICJA 1GW9A 2WKLA 2PP1A 4NAFB 4IX2A 2VEIA 4RCXA 4LT9A 2PSNA 4FB7A 3M5XA 2DZSA 3TSBA 4HKPA 4IXHA 3UETA 2G97A 2WWDA 2PN0A 3LK6A 2WMGA 1YNYA 5CZSA 2V5LA 5GNXA 4E0CA 3T2PA 4CU6A 4UTFA 4LUTA 3UNTA 1JZ8A 4UB9A 5KZMA 3IJ6A 1H50A 3H12A 1JI2A 4AEFA 4LALA 2A21A 3LBCA 2PD9A 1NMWA 5HOSA 3KL0A 3LXAA 4LWWA 1XLMA 4D72A 5A6JA 3EPNA 1UR4A 2E0PA 4A8NA 4RV3A 1AD4A 2XSAA 4E3VA 3CHFA 3GZ3A 1CCWB 2J7FA 5CJMA 1G69A 5CSRA 4WK9A 4OU1A 4XB3A 4GUGA 5HXMA 4XKYA 2O7SA 1Q6OA 2QCDB 3C2RA 3H2NA 2VRKA 4C6JA 2P5NA 3B0VC 2H90A 3CZJA 5G2IA 5DIVA 2PPPA 3AROA 1W32A 4AX7A 1GQNA 2OLSA 4IIEA 1FUYA 2PDHA 3BSGA 1S2AA 4CNPA 3IRDA 4ADTA 5A8OA 4ZPTR 3HPXA 1P0NA 4HIBA 6ALDA 1JYWA 3KAIA 1E9ZB 4S38A 1W1PA 2V5DA 1NWSA 1OFPA 5KETA 1GEHA 1V3IA 4NUWA 5F2MA 4B5UA 1W37A 3GXFA 3EBVA 1F4AA 2P8CA 4F8XA 3PTKA 1AQ0A 5CGTA 2DIJA 4R9XA 2A3HA 3ZLHA 2IPGA 1B0IA 1Z6KA 4MZ8A 5DLCA 4Q8OA 2VWSA 2P76A 4I6KA 3NO1A 3RFAA 3AHXA 4LX4A 1MW3A 4JIHA 3MKKA 4H01A 5AOUA 1GEQA 3B4UA 3EMCA 4O8AA 2BZNA 3K8MA 1FCUA