1OWQA

Crystal structure of a 40 kda signalling protein (spc-40) secreted during involution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNFGSERFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVPAGKIAIDRGYDIAQISRHLDFISLLTYDFHGGWRGTVGHHSPLFRGNSDGSSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGQFTKEKGTLAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a 40 kDa signalling protein (SPC-40) secreted during involution
rcsb
molecule tags Signaling protein
molecule keywords signal processing protein
total genus 119
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2003-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1owqA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1owqA01
2QMKA 1G1YA 1E43A 1ZB5A 3AOFA 1UKSA 3MV01 1B3YA 1LL4A 2YDRA 1UUQA 1BGAA 4AWEA 4S3JA 3RIKA 4RE2A 3GNOA 4KGJA 1GOWA 2QF8A 1K9FA 3II1A 1UQYA 4U3CA 2CIPA 5KEZA 1CTNA 3PZTA 1XSKA 3UG4A 4ACZA 1Q6FA 1JFHA 4F9DA 2E40A 5IFTA 5JIWA 8CGTA 4X9YA 1EDTA 2EBNA 5CZKA 1J0IA 3GH5A 3SUVA 4HOZA 4JFTA 1PIFA 5DT7A 1FH8A 3N11A 4Z2HA 1QBAA 1OINA 1U2YA 1B3VA 3TP4A 5DT5A 1RH9A 1EHNA 4MNJA 3WD3A 4W7VA 2JFEX 1C91A 2WMHA 1F4HA 7A3HA 3NSXA 2YLLA 4OUEA 1CGYA 3S6TA 1MFVA 3ARSA 3N1AA 4PUEA 2GUYA 1ITXA 3VPLA 1OB0A 4UZSA 4AC1X 3AMKA 3OLIA 5A6LA 3AS0A 2HISA 3K8LA 1UOKA 3AZRA 4LYQA 2Y8KA 1HVQA 1BYAA 2BY0A 2VCCA 1JXJA 1QOXA 3OG2A 4W8LA 4PMVA 4PBGA 3ZIZA 5GPRA 1ZU8A 2WLZA 2DEPA 2JF6A 1OWQA 2PF0A 1E4LA 3EDJA 4UFKA 1M03A 3CIVA 1EQPA 3TA9A 3UCQA 4UZUA 1ZS2A 1FH9A 2WMKA 1J0HA 2JE8A 5BCAA 1GVIA 2E4TA 1M53A 2WW5A 1JI1A 4JFUA 2XIIA 1V0MA 2VZVA 1WCGA 1CLVA 3N04A 1W1TA 4GI9A 4BCEA 3A4AA 4PCTA 1V6VA 2GJPA 4F8XA 1YQ2A 2FHBA 1UD4A 3AMLA 1W9DM 3CZKA 1RP9A 3N18A 1V6XA 5A6SA 2WVUA 1H49A 4PTVA 1GNXA 5LYRA 3CUFA 2PWFA 3VIKA 3WDQA 1ITCA 1C7TA 3W25A 3AJ7A 4JFWA 1GOMA 1H4PA 3CUIA 1CZ1A 3PN8A 2CHNA 1ZL1A 3FAWA 3CZ8A 1G0CA 1UKOA 1TVNA 3ZMRA 2A3BA 1EGZA 5I77A 2WCAA 4M82A 1QI3A 1TMQA 3HJEA 4W93A 2PWHA 1V3IA 3IK2A 3OGSA 4HTYA 4BQ2A 4BA0A 1M7XA 2VZTA 3EDDA 4JFVA 4WKHA 1FP8A 3L4UA 4KMQA 3CMJA 4PUDA 1X6LA 4RE4A 3U7BA 4W85A 3BAXA 2OYLA 1JZ3A 3AHVA 3EMQA 3WQ5A 2DSWA 4ML4A 3VIIA 1JL8A 4GI8A 2YLAA 3MMDA 2CKSA 4TVCA 1IZJA 4W84A 5GNZA 1QW9A 4AZHA 1MW0A 1DWJM 1DP0A 3AMDA 3BMVA 3TTOA 4CCEA 1ODUA 3TTQA 5BRPA 3NJ3A 3O9NA 3VM7A 2OYMA 2J4GA 1CBGA 1Q6GA 1GW1A 1NP0A 1GQJA 1HJXA 5EFDA 3W24A 4W5UA 5AC4A 1C92A 5GNXA 1UWIA 4A3HA 1BYCA 4Z2JA 2Z1KA 3U57A 4AIOA 4MB1A 3K8KA 2OWXA 3CUGA 3MUAA 4P8XA 4WKAA 3UR8A 2NT0A 2VOTA 4QP0A 4XUYA 3WUFA 1OD0A 3SCSA 2J8FA 2ZX9A 4MNKA 1I1XA 1TCMA 5DO8A 2Z1SA 2X2YA 3L4YA 1C8QA 3W0KA 3TOPA 4AZCA 1JF5A 4OZOA 2MANA 2YDSA 1W9PA 2WKLA 2Y8VA 4CVUA 2WPGA 3OLDA 2W5FA 1E71M 3W82A 3VUPA 2O9RA 5HDRA 1B3WA 3PZOA 4TX8A 2J7GA 1EHAA 3PZGA 5FCZA 2XJ7A 2NW0A 1EIBA 4W87A 4E2OA 2VZSA 3SCRA 1E6RA 2CCRA 4MB5A 1EXPA 1E1FA 5LA2A 2D22A 3GBDA 3WH6A 1VFUA 1N82A 2V3GA 5M5DA 4HZ6A 3VTRA 1CXEA 1OGGA 3N17A 2PB1A 2VVNA 4D6CA 3MANA 1A3HA 2W62A 3RPMA 1VRXA 3ARZA 3VD7A 4UTFA 4ATWA 3AYSA 2X1IA 2ZXAA 2YA1A 3FY1A 2BHZA 3AS2A 2YL6A 5A95A 5CGTA 1GJUA 4CU6A 5BYWA 1AQMA 4W7UA 3ZOAA 2YKKA 2NSXA 2FDMA 3ARYA 3VDCA 3SEPA 2D0GA 1C8XA 3AIRA 3W6LA 4EK7A 1E3ZA 1TE1A 4MAZA 4PMZA 3JUGA 2A3EA 1JZ5A 1W9XA 3WDHA 3UESA 1UH4A 3WD0A 1BGGA 5EFFA 4AIUA 1VEMA 2XGIA 1OGSA 3OGVA 2J62A 3BAYA 1UH2A 2XVKA 4BF7A 3IAQA 3ARRA 2XVPA 1ZBCA 6A3HA 4F9JA 3NSMA 5IHRA 4XB3A 1WNOA 1V0LA 1EO7A 3VNYA 3OIHA 3WEZA 2BVDA 2VR4A 3WD2A 1FP9A 1NOUA 4QAWA 3SUWA 4OBRA 3VOCA 2XHYA 3ARQA 3WMSA 1FHDA 3W38A 2XWDA 1KXVA 4HOWA 5I3DA 1E5NA 4PMDA 3B9EA 2Q8XA 4KRUA 1QNQA 2X8RA 2UY4A 1KXHA 1V3HA 3RILA 2CBVA 3N12A 5I5RA 5ABFA 6CGTA 4PTWA 2G8ZA 1HJVA 1GCYA 4OIFA 5E6ZA 3WSUA 2GVYA 5M03A 3WFZA 3CBWA 1K9EA 3W81A 5FIPA 4AIEA 2EJ1A 5AC5A 4RE3A 2JEPA 3WIJA 5BXRA 2VZUA 3L4XA 1TG7A 1CXHA 1UHVA 3RM4A 1QHZA 1UWQA 3ZJ7A 3VKKA 4U5IA 4AZBA 2VMFA 1RD6A 1QHPA 4AD2A 1J01A 1V3KA 4ZFMA 1RPKA 2BS9A 2YOCA 4IPLA 1NWUA 5E0FA 4TVUA 4PMRA 1JZ7A 3LPGA 1OIFA 1RP8A 5AYIA 5I6SA 3GNPA 1WAWA 1E70M 5A8MA 3DHPA 3RJYA 1JI2A 3BH4A 3WELA 6TAAA 3MUIA 1UD2A 2CBIA 1B1YA 4WK9A 4H04A 3U5YA 1V03A 1Q4NX 1ISXA 3SIMA 1KBKA 5D8ZA 5M3WA 3VM5A 4M24A 1EOMA 4QLKA 2E0PA 3BCFA 1LQ0A 4DWSC 1G9HA 3W6MA 3OZPA 2GK1A 4F66A 1UD5A 2CYGA 3VX0A 1CWYA 5CLWA 2ZXDA 4LQ1A 2G41A 3CZLA 4PN2A 2J7EA 3IJ7A 1JG9A 2WMIB 5IXEA 1PX4A 3QR3A 4OJYA 1CDGA 2C8NA 3BSGA 4JHZA 1W2VA 1JYNA 4Q22A 4P7NA 4DM1A 4AZ5A 3WFLA 3AHYA 1BSIA 3ZJ8A 1KFWA 5D9OA 1M01A 1U33A 1QNRA 2VX4A 3WNPA 4HZ8A 4UOQA 3DYOA 4LX4A 1PIGA 1LL6A 3UG5A 2OSYA 2ZX7A 2ZWYA 2E8YA 1W3LA 3AMCA 1O6IA 1CGWA 4GZEA 1WPCA 3L4WA 5E09A 4U31A 1ISZA 4PMQA 4GO8A 4FLQA 2ZUVA 2NT1A 3ZJKA 1W3HA 3UR7A 2J7FA 4HMEA 3PZNA 5EMYA 4E4PA 1WDSA 3W37A 3VGEA 2J74A 5GNYA 2DDXA 1GUVA 4AEEA 2WZEA 2BNJA 3AHZA 3CTTA 3SCTA 3ARUA 2CXGA 1CGVA 1QI2A 3VIHA 2DT1A 2YIHA 4JZ5A 1WZLA 3ALFA 3WNMA 4H7VA 3AHTA 4NF7A 4WSKA 5HPCA 3WY1A 3L4VA 4UFJA 2WC3A 4V2XA 1CXKA 3IJ8A 2VL4A 4F79A 3B9AA 2IXVA 1XV8A 2ZX8A 3WBEA 2AOSA 1Q6EA 3EBVA 1J10A 1LLOA 3G6LA 3OZOA 4OBSA 1UKPA 1DTUA 1XCXA 4J7RA 4GKLA 2X05A 3ALGA 3AYRA 1V6YA 3T2QA 2EPLX 4AZIA 1J0KA 1H3GA 4L4PA 3WQ4A 2XWEA 1HKMA 1S46A 4LYPA 4HMCA 5A2CA 3SCUA 3ARPA 2D3NA 5I78A 1W32A 3BC9A 1JDCA 1GJWA 2Y4SA 2WB5A 4BQ5A 4XV0A 2WAGA 3ZT5A 1VJSA 1JFXA 5C71A 4MPKA 1MQQA 1H41A 3BCDA 1GZJA 1E4MM 3A6OA 4BQ3A 9CGTA 3VU2A 3WQWA 1W3KA 4PMXA 4OOZA 2WLYA 1CGTA 2VQUA 3GXFA 1KCKA 4AD0A 1J0JA 1HF6A 1ZBKA 1V02E 4FLRA 1E5JA 1PX8A 4NRRA 4J28A 2CEQA 2DSZA 3WDPP 2CETA 3PZMA 4E8DA 4JCMA 4P8UA 5CPQA 4ZE4A 2V5DA 3PTMA 1KGWA 2FHCA 2CERA 4AZCB 3DC0A 5DFAA 3RDKA 1G94A 1UH3A 1CNVA 4AYSA 4Z2IA 3D3AA 4P8VA 3KE0A 3PZ9A 4EAMA 3WQ8A 4B9ZA 2BVYA 1E3XA 4WJXA 3F5KA 2D0HA 2WWCA 4IUGA 3IANA 3N15A 3M7SA 1C93A 4V27A 3KL3A 4P8WA 4GZIA 2WNWA 3CH9A 1XYZA 3B8SA 3WF2A 2DSKA 2YL5A 2DT0A 3VILA 4AZGA 3SCNA 4D6IA 4B3KA 1EA9C 3VDBA 1GQKA 1LF1A 3FHAA 1V08A 1Y7VA 4MB4A 3BAJA 5A8OA 1W3JA 3HN3A 2BY3A 4AMCA 3VD4A 1H0GA 3ZO9A 3GH4A 1NOWA 2WYSA 4NRSA 2DQXA 1CIUA 2ZUNA 1D2KA 5E70A 2BXYA 3FW6A 2JF7A 1NWRA 3CZGA 4TXEA 1LG2A 1H5VA 1CXIA 1W1PA 3AS3A 1VENA 1QNSA 1UR9A 4MJ4A 1WO2A 4MDOA 3W53A 1H0IA 1PBGA 4Z2LA 2DIJA 2VC9A 2FGZA 1PZ2A 3AZTA 1B90A 3GTNA 4D1JA 2ZOXA 3WH9A 4CD6A 1MXDA 1E4IA 3WL1A 1UR1A 1OCQA 3EMCA 1J12A 2TAAA 4HP5A 3PTQA 4JKKA 4HPGA 3M46A 1HJUA 4U2ZA 1DWHM 3MSGA 5C8BB 2RGLA 1E0VA 3QHMA 3WDJA 1BHGA 2W63A 2BHYA 1E6NA 3APGA 1JD7A 4CUCA 3POHA 3WH8A 4PTMA 2JIEA 4LPCA 1P6WA 1VBRA 3MUZ1 1L0PA 2WBGA 5HNNA 4QCFA 2OYKA 1JYVA 1CECA 4H8VA 2UY2A 5A6BA 4CD5A 3I3EA 4GQQA 4UCFA 2D23A 2J75A 1E4NA 2VI0A 4K68A 1E40A 2XFFA 3QGVA 3GYCA 4EKJA 4R5EA 1KGXA 1HXJA 2OLHA 1KR1A 2J7HA 3WNLA 5JUVA 3MO4A 4B15A 1OT2A 3AMGA 1JYWA 3AQUA 4PSRA 3W27A 1JZ4A 2F8QA 1J11A 4D6HA 2EPMX 2J47A 3CHCA 3O6AA 2J7DA 1KCLA 4B3LA 2WCGA 3SURA 3MUY1 1NOFA 3K8MA 3WF1A 4DM2A 3F5JA 5FKYA 4TVDA 2XUCA 3BXWA 2X0YA 3CZJA 1OT1A 1PX3A 2F61A 1NM9A 5A8NA 5A8QA 4WIWA 1J0ZA 1BYDA 3WH5A 4DWSA 5GQBA 4HPHA 3A47A 2WMIA 4J27A 2PWEA 1H09A 4A4AA 5I2UA 1U30A 4M80A 3WEMA 3AI0A 2FH8A 1V0NA 4J3SA 3CLWA 4N0RA 5LA0A 1QVBA 2WC4A 4M56A 3OLEA 1CENA 4W88A 3UETA 1ISWA 2WVVA 3CHEA 1CPUA 3CUHA 2QMJA 1E6XM 2O9PA 1TUXA 1ESWA 1QNPA 3QOKA 3ECQA 1HX0A 1UR0A 2JIWA 5A69A 5I23A 1BG4A 2VZOA 1OGBA 1MQRA 5ABGA 1R8LA 1UYQA 4D6DA 3GZAA 1BAGA 1HNYA 2CBUA 4AD5A 1BPLB 1V0KA 4J3TA 1JZ2A 1TR1A 2BV9A 2VCAA 3VGHA 3AHXA 1BVNP 3VGDA 4WSJA 3BLPX 4BS0A 4D6JA 3OA5A 3N9KA 5C70A 4H2CA 1JZ8A 1US2A 1SFSA 3T2PA 1FA2A 3ZSSA 3RJXA 1XSJA 2E3ZA 3M07A 5A94A 1E6QM 1SYTA 1UR4A 2ZUSA 4IM4A 3T08A 2VVSA 3VIGA 2VX6A 2E9LA 3NDZA 2D20A 3BLKA 3EMZA 5BROA 3PBGA 1XH0A 4CN6A 4KGLA 3A3HA 3J7HA 3RMEA 1JD9A 1CLXA 4DWSB 4A3YA 4UFIA 4U2YA 4QLLA 3VVGA 1JIBA 1HIZA 1VFFA 5BXSA 2QV4A 2WMJA 2XYLA 4D6EA 4OOUA 4H41A 1JGIA 5A6BD 4FMVA 1JAKA 4RL3A 4PMOA 3VDAA 2PWGA 1MW3A 4NSBA 2FGLA 2OWCA 2W91A 1PEZA 2OWWA 4D6GA 2BVTA 1E55A 3BAIA 3FHQA 2VRKA 1SR0A 5D9MA 2J77A 4BZYA 4J3WA 1NARA 4CU7A 4AISA 3POCA 1OIMA 2W92A 3ZR5A 4HA4A 1BLIA 2A3CA 4GIAA 2VO5A 4JHOA 2VCBA 2E9BA 4EANA 4HA1A 1E0WA 2DH2A 2WZHA 3IJ9A 3VD5A 2WMGA 1W9VA 4MNMA 2E8ZA 1HL9A 4JIEA 2WKGA 1VFMA 4ZXLA 2DSVA 1HKKA 4Y7EA 1GQIA 1XC6A 1B3XA 4LGXA 3T09A 3WNKA 1XH1A 3DYMA 2BHUA 4UOJA 4W86A 4X0NA 1B2YA 1UKTA 2W66A 2ZWZA 2GJRA 3HU7A 1V3JA 2JEQA 3DYPA 3SUUA 1WDQA 5CSUA 1E6ZA 3WL0A 2XGBA 2IUZA 3LPFA 1BQCA 1E72M 1MVYA 5FD0A 5FL0A 2ESCA 4M1RA 2OSWA 5CXPA 1ZBVA 4WKFA 2UY5A 4ZE5A 3A4XA 1UD6A 4P7QA 2VNCA 5ECUA 4KRTA 3ZSTA 1ZJAA 3CMGA 1GQLA 1PAMA 1WE5A 1WKYA 3ARTA 3CUJA 1OM0A 1ECEA 3AIBA 1FOBA 1KR0A 5CG0A 3MMUA 3TTSA 4YN5A 3HMCA 2CNCA 3VIOA 5CJ5A 1DEDA 3SCPA 1E1EA 2GK1B 7TAAA 1WDPA 5E0CA 3OGRA 3BMWA 1VAHA 5HPOA 3AROA 5E6YA 2XFYA 3KL5A 4QFUA 4AD1A 2D24A 5CGMA 4CKQA 4X0VA 4JKLA 4XZBA 1MFUA 1Q6DA 4CD4A 3RM8A 5AYBA 4JCLA 1QI0A 1UR8A 3WUBA 3CHDA 3VX1A 3MMWA 3FN9A 4EE9A 1OSEA 3MKKA 4HA3A 2YL8A 1R85A 4LYRA 3VIJA 5A6MA 2EXOA 3GXMA 5A3HA 4PMNA 4DWSD 2YBUA 1IT0A 1X6NA 2VRQA 4PYSA 5M17A 1GORA 2ZIDA 1HJSA 3IAPA 1C90A 4MNLA 4CCCA 1Z32X 3VNZA 1LJYA 1HVXA 2BFGA 2CHOA 4R27A 1XH2A 3PZIA 5A8PA 3CO4A 1VB9A 1R7OA 1TA3B 1W9UA 1VBUA 3WDRA 5EBAA 1CXLA 3N13A 1IZKA 2BY1A 4DUXA 1EDQA 4GI6A 2XM1A 1UD8A 3BAWA 4U33A 1V6WA 1E6PA 3NUKA 1XRVA 3WBAA 3NSNA 4GPNA 3T0AA 2YA2A 1XHGA 1NP2A 3UEQA 2C0HA 1B31A 2XG9A 3WD1A 1UZ1A 4JL2A 4PMUA 1MW1A 3PZQA 3AXHA 1KWKA 1E9LA 2A3HA 1UKQA 1AMYA 1UWRA 3AIVA 3M6DA 4QDMA 2CKRA 3FNDA 3EDKA 4U5KA 2J79A 3VO0A 2J25A 3SCOA 2WWDA 1HP5A 4J3VA 3WF0A 1JNDA 1FH7A 3A4WA 1E6SM 3OLGA 2GSJA 2V38A 4J3UA 1HP4A 3NCOA 4CD8A 4WLCA 3ZT7A 2VR5A 3L4ZA 3L2LA 1BYBA 1I1WA 3GXDA 3VGGA 4Z2GA 3ZR6A 1WB0A 3RO8A 3WNNA 1SMAA 2D2OA 3GBEA 2YDQA 1KQZA 1UWSA 2ZUWA 3CZEA 5BXPA 1VIWA 4JKMA 2XVGA 4UQEA 3SCQA 4DUWA 1H2JA 3VDHA 3WH7A 4CCDA 3L4TA 5DMYA 1CXFA 1GOQA 3WNOA 1MW2A 4MADA 3WENA 2V3FA 1XD1A 1W2PA 4XZWA 5BXTA 2WXDM 5KZ6A 1R87A 4MTVA 3O2LA 4PEEA 3AIEA 3ARWA 1KXQA 3ZJ6A 2X0HA 3AIWA 1I75A 3TONA 3GXIA 1HL8A 3L2MA 3GDBA 2WSKA 4H8UA 4N42A 3AS1A 1E56A 3GM8A 3ZM8A 4HU8A 2YBTA 3OB8A 1DHKA 2Y2WA 4YHEA 2V3EA 5HXMA 2ZE0A 4UQCA 1KQYA 1O7AA 1R7AA 4Z2KA 1V3MA 4UFMA 4C7DA 1WZAA 5JH8A 1C3FA 1E0XA 4PRWA 3GH7A 3B9DA 4YPJA 5LA1A 8A3HA 5HOSA 1XSIA 1UD3A 1WP6A 2BY2A 2F2HA 2DGAA 3WDIA 2ZX5A 2WCSA 4FK9A 4ZXOA 3DHUA 2EO7A 1MQPA 1JYXA 3AFBA 2EEXA 3PHAA 2XTKA 4B9YA 2PC8A 4GXPA 4J3XA 1HKIA 4JFSA 4L4OA 5D9PA 4W89A 3GNRA 1H1NA 4M81A 4W8BA 4TTUA 4DUVA 1CGUA 1C7SA 2AAAA 2XVLA 3WQ6A 4URIA 3WQVA 3KEHA 1IV8A 4D6FA 1E73M 3UERA 1VEOA 4ATLA 3VGBA 3E1F1 1BF2A 1J9YA 2GJXA 2WHLA 4NZCA 1PZ3A 3WKZA 2EPKX 5E9AA 3AIQA 2J7BA 1A47A 1MYRA 1ZJBA 1QBBA 3WF4A 3QHNA 1TA3A 3VGFA 2GDUA 1PJ9A 5JBFA 1B9ZA 1HT6A 4XX6A 2OSXA 3AXIA 1V3LA 3F5LA 1FHLA 2IXUA 2VX7A 4OKDA 3EDFA 3THCA 5A1AA 1ISVA 1D3CA 2XSAA 3WEOA 3SUTA 1QI4A 4FLOA 5JIPA 3S2CA 2UWFA 3PZUA 3W4RA 1VF8A 1JDDA 4KH2A 1JDAA 2O9OA 3FXYA 4AZ7A 3PZVA 1YHTA 4MDPA 4CU8A 4UOZA 1QI5A 1VFOA 5DF0A 2WANA 1B0IA 1TZ7A 5A2AA 2VX5A 2VJXA 4CGTA 2E9MA 3T0DA 4GZJA 1MWOA 1DWAM 2CESA 2Y24A 3ARVA 2XFRA 1NWSA 2G3JA 1BG9A 3WMCA 4S3KA 3NIYA 4C7FA 3OBAA 3VINA 2VUYA 4P7RA 3I3BA 3AZSA 2WM0A 1UA3A 3K1DA 1V02A 2VURA 4NI3A 5IFPA 2ZUUA 3DECA 1XD0A 2C7FA 2O9TA 2EQDA 4ATDA 3MV11 3BAKA 1UQZA 3U5UA 5BWFA 4MAVA 3WF3A 1JZ6A 4Q7NA 1EDGA 4UFLA 2WVVB 1UG6A 5CLTA 4E8CA 2ZXQA 2X09A 5CPSA 1ODZA 2QLYA 3KL0A 2DH3A 2W4XA 2BXZA 1AQHA 1EH9A 3EYPA 1G5AA 3MU7A 2D0FA 5CQ1A 2WVSA 3VIPA 1LWJA 4JL1A 1QNOA 3CGTA 4LXFA 4UNIA 5I24A 1XCWA 4ZENA 5A6JA 3VD9A 1K9TA 4CN1A 1GOKA 4TUFA 1DWFM 3CHFA 3NDYA 3BGAA 1KWGA 1AVAA 4U3AA 2VQTA 5D8WA 4D1IA 1JNEA 1UWTA 1GPFA 1WZMA 1C8YA 1LWHA 2XM2A 4AXNA 2WHJA 2W61A 1ZBWA 3LMYA 3MSDA 2GDVA 3VIMA 1B3ZA 2O92A 1WZKA 3RM9A 1CGXA 1DWIM 1UA7A 1VEPA 3PTKA 1QHOA 1HJQA 2CBJA 2VTFA 4TX6A 3AICA 1J18A 4D71A 2DT3A 4AY1A 2GJXB 4GINA 3THDA 1EO5A 2PBGA 3WUEA 3KZSA 2WK2A 4C7GA 2WHKA 1G01A 1QPKA 2HVMA 2XSBA 3AXXA 4P7LA 5CSYA 3WD4A 4CN4A 3NYDA 1KXTA 1W91A 4H8HA 1BVZA 4B16A 2W67A 2DSUA 2QHAA 5F7UA 5ABFB 4AZ6A 1OBAA 2FH6A 4TOQA 1W1VA 1K6AA 4P7OA 1WDRA 1CYGA 3SCVA 1R86A 4HMDA 2GFTA 3K4DA 2VRJA 1JF6A 4AW7A 1UR2A 4PSPA 2DIEA 3K46A 4UFHA 4MJ2A 4IISA 1US3A 2YL9A 4IPNB 3MS8A 1B30A 4KWUA 4UQBA 5I0DA 1CEOA 3G6MA 2YA0A 4HOXA 2ZXBA 4AD4A 3SCWA 1L8NA 4UQAA 4PTXA 5JBEA 4WF7A 2EPOA 4PMYA 1MXGA 1UWUA 2WVTA 2WBKA 1PPIA 2J78A 2ZX6A 2G3IA 5CPTA 3U7VA 2D3LA 1FFRA 2WC7A 2QPUA 4M8UA 1VJZA 2VT0A 3ZT6A 1K9DA 2WMFA 4ACZB 4GQRA 3VMNA 3WMBA 1GHRA 4BQ4A 4W8AA 1KGUA 1AQ0A 2DPEA 5A6KA 5HBFA 2PI6A 4QCEA 2RGMA 5IDIA 1J0YA 4TTGA 3ZQ9A 5ABHA 3RCNA 2B31A 3I3DA 3F4VA 1V6UA 4UQDA 4AD3A 1EQCA 5I79A 1F4AA 2ZICA 5BRQA 1GONA 1OD8A 3QHOA 4AEFA 4W5ZA 5IHSA 4FF5A 5EB8A 2G3MA 1HJWA 4UR9A 3KWXA 2QPSA 3UG3A 2YJQA 4W7WA 3QOMA 2ZUMA 1W9BM 3VD3A 2WHMA 5ABEA 2J8GA 5FL1A 3AIUA 4GO9A 4HU0A 1LL7A 1E15A 3W29A 1ISYA 3EDEA 2ZUTA 3ARXA 3W26A 1LG1A 2DT2A 3W28A 1D7FA 4MB3A 3VIFA 2XVNA 2JALA 2CITA 2V3DA 1NQ6A 1BFNA 3SUSA 3BSHA 1DWGM 5FOOA 3LPOA 4D72A 1JAEA 1GOIA 2EPNA 4UQ9A 1Q6CA 1NH6A 1FFQA 3WN6A 1HKJA 1JXKA 2PWDA 3T2OA 3LPPA 2FHFA 1H11A 5TD4A 1KB3A 1EOKA 1XYFA 4JAWA 4YHGA 4ZEPA 3TTYA 2A3AA 3CPUA 1GVYA 4PCSA 3VMPA 2UY3A 5D4YA 2XIBA 2WZIA 4FLSA 1NWTA 3VMOA 1BTCA 5JBDA 2AMGA 1SMDA 2WSPA 2G3NA 5DEZA 4CD7A 5D9NA 1X1NA 3D5HA 2G4FA 4QLJA 1TVPA 2CPUA 4HZ7A 3WUGA 2XPKA 1KBBA 4ACYA 1QW8A 1TFVA 2J7CA 3AISA 1UZ4A 2Y5EA 7CGTA 4M29A 1W1YA 2PBOA 5AY7A 5A6AA 2V5CA 2D1ZA 5A2BA 1GHSA 4V28A 3K4AA 1GOOA 3T0BA 1M04A 3FAXA 4CVWA 1XGZA 1HN1A
chains in the Genus database with same CATH superfamily
1JUEA 1QPQA 4XIMA 1EJVC 3ZXWA 1B3YA 1LL4A 2YDRA 2F38A 4WXYA 3P80A 3GNOA 2RQSA 1K9FA 2AQOA 3W7QA 3II1A 1A3XA 3PZTA 1XSKA 4ACZA 1JFHA 1H51A 1SO3A 1JUKA 2E40A 4F9DA 1EDTA 1IXNA 3KCOA 1KRAC 4JFTA 1PIFA 1YDNA 4LNCA 1F74A 4IFKA 4QDPA 2H9AA 6XIMA 3G1VA 4J2MA 4I5UA 3EWWA 3LM7A 1XI3A 1YPFA 1RH9A 4MNJA 2JFEX 5G4EA 4JTIA 3NSXA 4JTGA 4OUEA 1BF6A 3NVDA 2HCVA 1MFVA 2OZ8A 3NDOA 4PUEA 1ECQA 3VPLA 2PWUA 3LZ3A 2FYMA 1Q63A 4AC1X 2QUUA 4RZBA 5G2HA 5A6LA 3AS0A 3KCLA 2HISA 4LYQA 2IKHA 1HVQA 1UC4A 2BY0A 2VCCA 1JXJA 3NQVA 3OG2A 1Z9AA 1VR6A 3SGGA 1ZU8A 3UZXA 2NVDA 3UY7A 3C3NA 3TR9A 5JH2A 2YGYA 4U84A 3TA9A 3UCQA 3U4FA 1FH9A 2GGJA 3GG8A 1Y0EA 1BRLB 3IIVA 1M53A 8RUCA 4JFUA 2OB3A 2VZVA 4X22A 3LDVA 3HFYA 1L6WA 1V6VA 1UP0A 3LS9A 3VI2A 4O16A 3UNTA 1UD4A 3CZKA 1FRBA 3DFYA 2F4EA 4M6PA 3TJXA 4PTVA 3RCMA 4GD0A 2PWFA 1ME8A 1XIMA 1W3NA 5CC3A 3WDQA 5BOEA 3W25A 4A8RA 2Z7KA 2ISDA 3W7EA 3PN8A 1ZL1A 2C14A 1TWSA 4O1DA 3QR1A 3BMXA 1RALA 3SECA 4FNPA 2POZA 2AMXA 2ACSA 1LLZA 4W93A 2VEFA 4DLMA 3DH7A 4IIGA 4B4HA 4HTYA 1S1RA 4BQ2A 4BA0A 4N9EA 4H9VA 3FKKA 8TIMA 5GJNA 4PUDA 2ZKMX 3NVTA 2G0WA 1QTWA 1R9YA 1J5SA 5FSDC 3HGSA 4W85A 2OYLA 1R30A 3CTLA 3AHVA 4LUIA 4U86A 3VOFA 3T9PA 2HQAA 1AQFA 2QDDA 4A3UA 3RFAA 4FOJA 2E1WA 3MMDA 2CKSA 3BLOA 1E9IA 1IZJA 4W84A 4ZQPA 4MKSA 3RLUA 4ZPWR 1PV8A 3F4WA 4DH0A 4UTLA 2Z0IA 5K4XA 3PM6A 3A23A 3UT0A 2YBVA 3CB8A 3AWNA 8XIMA 5FI8A 3TVAA 1GQJA 5AYZA 1O1HA 3FSUA 5EFDA 3W24A 3HQOA 4MY9A 5AC4A 3GIYA 1UWIA 1BYCA 2OWXA 3TR2A 3CUGA 2G95A 3FIGA 1A0DA 3L23A 1UZDA 3SCSA 2P76A 2J6VA 1XGDA 2CLMA 4RW5A 5CAKA 2VGBA 4OZOA 4GYPA 3GHUA 3P82A 2ISFA 4LV4A 4XD5A 5D2WA 1P0EA 1E71M 4MUZA 3W73A 1RK6A 1B3WA 3UR2A 4AAJA 1EHAA 4IP5A 4Q4SA 2VZSA 3SCRA 3T4WA 3GD6A 1OEPA 5LA2A 2D22A 5HJYA 5EMLA 3T4CA 1VFUA 2CZDA 3T8QA 4HZ6A 3VTRA 1PCWA 3N17A 4MY1A 2PB1A 4DJDA 2W62A 3AYSA 3FGCB 2X1IA 1F7BA 2ZXAA 2BHZA 3UBPC 3AS2A 1WOBA 5BWAA 4Z1BA 4GKTA 1HGYA 3V36A 2D0GA 3CYVA 3W6LA 4MAZA 1JPIA 2XIMA 4DLFA 3JUGA 4R7JA 3V0SA 3G22A 1BD0A 1RQBA 3WDHA 5KSWA 4ZQRA 3ISIX 4GLEA 3WD0A 1BGGA 3C0QA 5D2TA 5K9XA 4AIUA 3P60A 4WRHA 1OGSA 2XVKA 4BF7A 1FKLA 2PDIA 1ZBCA 6A3HA 4UTJA 5AC6A 4F9JA 5CBBA 3E9AA 3NSMA 4XB3A 3S0CA 2VXNA 2BVDA 3WD2A 3PWAA 4QAWA 4OBRA 1LBMA 4G2PA 4XVDA 2C71A 2XHYA 3W72A 2QCEA 3TIMA 3GE7A 1TV5A 2DZBA 1B4KA 3M0VA 2BOGX 4J1OA 1V3HA 2XN2A 5ABFA 6CGTA 4PTWA 4K1WA 1GVFA 1NU5A 2GVYA 5M03A 4LTSA 3W81A 5FIPA 4AXKA 4G8TA 1Q6HA 4US5A 4YMZA 1V8EA 4JQ3A 1XBYA 3WIJA 4NG3A 4Z0SA 1AG1O 1UHVA 4HT3A 3RM4A 1UWQA 3WLLA 2Q09A 4O1BA 4QROA 4U5IA 2AGKA 2R24A 3IIPA 2VMFA 1QHPA 1V3KA 4PUNA 2BS9A 3GK0A 1NWUA 4MHBA 1VBHA 4ORIA 1JZ7A 3LPGA 1RP8A 2UZ5A 4EPBC 4ZOBA 1DORA 1JQXA 4UTMA 3DHPA 4B5VA 2C1IA 2J9ZA 1TMLA 1JDFA 3NQEA 3WQCA 4GJ1A 1SQ7A 1B1YA 3KX6A 4H04A 4BEUA 1FCUA 2XP3A 1XCFA 3O05A 4K39A 3VM5A 4FZIA 2VWTA 3W87A 2F84A 3M16A 2O7SA 2OR2A 4LNYA 1RSCA 3F2BA 1ZAIA 3W6MA 4PE8A 1FKHA 5CG7A 5FEXA 1G67A 1UD5A 3VX0A 1CWYA 3A24A 2VELA 3NNTA 1VHCA 2ZXDA 2G41A 3CZLA 4PN2A 3IJ7A 2WMIB 4TX0A 1OF6A 1PX4A 3F2DA 3QR3A 3WG6A 2VDGA 3TNBA 1AMKA 3H4WA 3BSGA 1P4CA 4L64A 4GCAA 3ZYZA 3OO2A 1JVNA 3WFLA 4QG9A 5D9OA 3MDUA 1QNRA 3S5OA 2VX4A 2WM1A 3WNPA 4UOQA 4U85A 4LUSB 2ZWYA 2E8YA 3U2CA 3AMCA 3GQYA 2R1KA 3L4WA 2Z4GA 4U31A 3P61A 2ZUVA 1QU4A 3ZJKA 4KEVA 2J7FA 5DX7A 5EMYA 5DMNA 2E09A 3W2UA 2NLYA 3W37A 3UXLA 4HKPA 2ZQTA 4R85A 5CZ0A 3QJAA 1YATA 1MNSA 2OFNA 4AEEA 2E5BA 2NQHA 4HNCA 6ENLA 4CNOA 5DN1A 3ONCA 3ERPA 1YNYA 1CX9A 1TPB1 1QI2A 2QQ6A 4QBXA 5CCZA 2QDEA 4JZ5A 3NOEA 1D3GA 3SRKA 4H7VA 1JQVA 5HPCA 1FWDC 3GDLA 4ZO8A 1CXKA 2HVOA 3B8UA 4CQDA 1S5WA 2OODA 1Q6EA 3UJSA 5CZTA 1LLOA 3NQ2A 1PUDA 5IBXA 4IL2A 4ZO7A 4N4QA 1XCXA 3HA1A 3GXNA 3EA3A 2X05A 4TR9A 4JIRA 1KBJA 5K2ZA 1X97A 3K2GA 1BWKA 5F4SA 4L4PA 1S46A 1XLCA 1M7JA 3SCUA 4LAMA 4OVXA 3BC9A 4OT7A 1GKRA 2E6YA 2WB5A 4BQ5A 4XV0A 1MDLA 2ZZ2A 1DL3A 1FWCC 3BCDA 1GZJA 1EWEA 3LQLA 3C0JA 1W3KA 4H01A 1CT5A 4YVPA 3VCCA 1S39A 3KLKA 3RLGA 4HNVA 1HF6A 3B9OA 2B7QA 1V02E 2HVNA 3NQ7A 4B92A 3BG9A 4P61A 1PX8A 1ME9A 5AECA 2PDUA 4P8UA 2PD5A 2H6RA 1GG1A 3LGEA 3YPIA 1EUAA 2FHCA 1OX5A 3W2KA 3H12A 4AZCB 1J8VA 5CJMA 1VYSX 1MSSA 2PN0A 1V79A 2OMAA 4GYJA 1W5NA 3HGJA 4HNLA 4Z2IA 2NVAA 4MZYA 4O10A 4P8VA 3CK5A 1PIIA 3H9RB 4WJXA 3F5KA 2WWCA 1CB7B 4ODRA 3TMLA 2DZAA 4V27A 3LCIA 3QY8A 3WF2A 4H83A 2YL5A 1EQ3A 3DC8A 2X1SA 4HARA 3CT2A 3FHAA 1Y7VA 4DQWA 5A8OA 1W3JA 2QCDA 2BY3A 3HN3A 4AMCA 1H0GA 3NQ6A 1LBLA 4LBSA 3PBVA 2WYSA 3LEPA 1D2KA 2BXYA 3MJYA 3CZGA 3L0KA 1CXIA 1S2TA 5I06A 4JXCA 1THFD 4MJ4A 2JKPA 4AVNA 3O0KA 2M1IA 3QYQA 3TA6A 1YNQA 2NV1A 2QUNA 1T40A 3PUDA 1I0BA 1PZ2A 4NZ4A 2IPFA 3AZTA 1B90A 1OCJA 1FKJA 3PRDA 2BGNE 1IZCA 2ZOXA 3ZVHB 3DENA 1MXDA 1E4IA 1OCQA 4FX7A 4NVTA 2TAAA 3COTA 1A4LA 3MSGA 3SGUA 5C8BB 1E0VA 3C2YA 4ML9A 5G2IA 3B8TA 4DXKA 1Z44A 3B0XA 1KM1A 3DFSA 4XBKA 4NNBA 3WH8A 4PTMA 4LPCA 1VBRA 5HNNA 1OX4A 3DUGA 2OYKA 3O8AA 4H8VA 2UY2A 2VD8A 3MKVA 1K7FA 4GQQA 4PBEA 3TC7A 4F3HA 5I07A 1K8ZA 4XO6A 3N2CA 2XFFA 4JX6A 4QAIA 4GNKB 3KZPA 1KR1A 2J7HA 3SR7A 3AMGA 1JYWA 3W27A 2OFJA 2F8QA 3N19B 4WOZA 2J47A 4E38A 2P8BA 1V6TA 1KCLA 4B3LA 2WCGA 3SURA 1XIFA 4JTQA 4CNUA 2B81A 3UU0A 4DM2A 3F5JA 4TVDA 3DGBA 4CNSA 4YVVA 2X0YA 1KRBC 3KAIA 4IQLA 4F2BA 4DIAA 4WIWA 3CLMA 4LANA 4IIBA 4WOQA 2VM8A 3QGAC 5LNSA 1EJRC 4DI8A 4HPHA 3A47A 2PODA 1QCWA 1H62A 2PWEA 4J27A 3W88A 4A4AA 5I2UA 3ID7A 3UF8A 2XH4A 4WQ6A 1GEQA 1P1MA 3EEZA 4QITA 2PV1A 5DCEA 4FF7A 3CLWA 1VKFA 2E67A 4N0RA 4DJDC 3BJSA 3LQGA 4J9JA 4Q4QA 3UWZA 3DHFA 4K6AA 1ISWA 2WVVA 1CPUA 3R7MA 4M3PA 1PVNA 3C2VA 3KP0A 1ESWA 1QNPA 3B8WA 2PV2A 2JIWA 3MP3A 3H23A 1BG4A 5GJMA 1MQRA 4ZQOA 1UYQA 2C3ZA 3KOFA 5TIMA 2VFFA 1IIGA 1QFEA 2Y7EA 2QCHA 5H91A 1HNYA 3UJEA 1BPLB 1V0KA 1FDYA 1JZ2A 4F0RA 1TR1A 3VGHA 2NUXA 3AHXA 2J9YA 4BS0A 3BLPX 4D6JA 4H7ZA 3M5ZA 1TO3A 4H2CA 4K38A 4IMCA 4CQBA 4LS0A 2ZFAA 3O6DA 4KWVA 3HG2A 1S5TA 4O4VA 2HS8A 3M07A 5A94A 3NQBA 1KM4A 1XFBA 3W2JA 4IM4A 2VVSA 1TQXA 2E1DA 3MPGA 3W7RA 3TW6A 2J6XA 1IWPA 5BROA 3PBGA 3R1ZA 4O1FA 1H1YA 3S5YA 3RMEA 3GAYA 3H2MA 2ATSA 2PE4A 4GG9A 5JVLA 2VP8A 1N1AA 4QLLA 1N8WA 1JIBA 4BI5A 1VFFA 4YTUA 4GC4A 3L65A 4S38A 1NTHA 2REQA 4H41A 1JGIA 4G2DA 4PMOA 3VDAA 3ZZ1A 3S9ZA 3S4TA 4R53A 4QGCA 4R9OA 4NSBA 3QMTA 5T9BG 3R0KA 2W91A 2Y62A 4HCDA 2BVTA 5D9MA 3BAIA 3FHQA 1NARA 4MGVA 1ZQ5A 4AISA 1OIMA 2W92A 1X8FA 3S2JA 1KNWA 3ZR5A 4HA4A 1BLIA 2A3CA 3M41A 3ENLA 2E9BA 5I02A 2DH2A 1OF8A 2AKZA 1W9VA 3CV2A 1PZ1A 1VFMA 4RJEA 3USBA 4ZXLA 2DSVA 1YXYA 1HKKA 4WVXA 1XC6A 1IEWA 1BSLA 3QPYA 3V75A 4BI7A 1U83A 4HBOA 3WNKA 4IT6A 1EZ2A 1S3HA 4EOUA 1MZRA 2PF8A 1B2YA 2QT3A 4FAMA 1VFHA 1BQGA 1V3JA 4GK8A 1OK6A 1WDQA 2XGBA 4BK9A 1MVYA 2PDFA 2WO5A 3EXSA 1ZBVA 3TTEA 1NFBA 3GAKA 1XDMA 2GLKA 2VNCA 2Y0FA 2PGRA 3BVJA 2A7PA 4KRTA 3ZSTA 1A5CA 1BWVA 1GQLA 5CG0A 1YNPA 1AH4A 3N4FA 4LS1A 3BZGA 4YN5A 2P10A 4X60A 3VIOA 3EB2A 1IR1A 1YLVA 2XU2A 1SZGA 4A8NA 3TCZA 1W1IE 3AROA 4PRRA 2IQ0A 4AF0B 3QBUA 3S5ZA 2D24A 4PB4A 4TNSA 3VKAA 4X0VA 5LSMA 2TYSA 1AD4A 1Q6DA 3VOJA 5AYBA 2GPTA 4WX2A 3LV6A 3MKKA 3NPUA 4F4RA 2IPWA 1I8JA 5AVNA 2XISA 3GTFA 3VIJA 1WV2A 3B0VC 4JTSA 4FOKA 4KQZA 5HR6A 4O8RA 2I5IA 4DWSD 1ADOA 3GR7A 4PYSA 5HW8A 5M17A 5CGQA 2QCDB 5HQEA 4O28A 1U1HA 3EWZA 1PTAA 2NXHA 1VPXA 3NQDA 1BWLA 3PZIA 1T8XA 2PGWA 3CO4A 4LUTB 5BU9A 4XAKA 1QK0A 1X8CA 3O5KA 3BSMA 2WKJA 3TC3A 2CHRA 3OBEA 2DY3A 1R7OA 3VCNA 2E77A 3NQCA 3NGFA 3CNYA 4LALA 5CKSA 1IZKA 3PPCA 1I45A 1OHLA 2XM1A 1UD8A 3BAWA 3S5SA 5H8PA 3NSNA 4GPNA 1WDDA 3T0AA 3RYSA 1GYNA 1KRCC 2VWSA 3M5XA 2ZZ5A 4KEUA 1B31A 5AN7A 1B57A 1QOQA 3AXHA 1P0KA 2XP4A 4DIPA 3FJ4A 2XN0A 3Q37A 5DIUA 4LRSA 2V68A 3P3BA 4M5PA 2FMOA 3U2ZA 1F8AB 2BGSA 4BF9A 1UOZA 1WX0A 5DBUA 4DZ2A 5H6HA 2Y7GA 2GSJA 2AQWA 2YFOA 3EPOA 3L2LA 1BYBA 4Z2GA 3WNNA 4O57A 3CEPA 3C0LA 4GISA 1QNVA 4O15A 3E38A 4UQEA 4JD4A 4JY9A 3QMRA 4X63A 2Z28A 4H6RA 2HNHA 1GVRA 5D33A 3TLLA 3L4TA 4H9UA 4JTCA 3USZA 3O63A 1GOQA 3TN5A 3A3WA 2XINA 4Q4KA 4JX4A 4XZWA 5BXTA 5KZ6A 1R87A 4ONVA 1M6JA 1YDYA 1KXQA 3ZJ6A 2X0HA 4QT2A 2HPIA 2PU1A 3U4AA 1TTPA 2KX9A 4Q6JA 1ZP4A 3GY1A 3GDBA 4FX8A 4H8UA 3GU0A 3AS1A 4QQ3A 2ZRXA 3ZM8A 4QJ4B 5C9ZA 4DBWA 1W5QA 4FNTA 2WZTA 2QAFA 2VC6A 2EPHA 2V3EA 5HWJA 3BW4A 4C7DA 1XBZA 5JH8A 2RHGA 3R79A 5DLCA 1G6CA 5CSRA 4HJFA 3B9DA 3APTA 5LA1A 3LA4A 4N7QA 1SJDA 4JTKA 3WDIA 2WCSA 3QZ6A 4FK9A 4ZXOA 5HUPA 4JFKA 2CC0A 3QSRA 2OZTA 2ZQUA 3O5FA 3LNMA 1JPKA 4UTTA 1EZWA 2EEXA 4H9XA 2XTKA 4B9YA 2PC8A 2RSEA 4US5D 7REQB 4DBDA 4O0QA 1X7FA 3RX3A 4Q8WA 4YCOA 3UJRA 4WDWA 3P67A 1H1NA 4REQB 2GVGA 4GXMA 4DUVA 1FAPA 2RURA 3OTRA 1C7SA 5K9CA 4NZFA 3NA8A 4XSMA 1X98A 1VEOA 5DRCA 2GJXA 1JCJA 4EXQA 3NFUA 2CZ5A 3T40A 1ZJBA 3RUBL 1QBBA 4WGXA 4FXFA 3VGFA 1Z41A 4K3ZA 4LSBA 3URQA 2OSXA 2PRHA 2XP6A 3F4CA 1V3LA 1FHLA 3EWYA 1R0MA 5C0QA 2VX7A 3THCA 3AWOA 1A5OC 3MHFA 3SUTA 3B8VA 4GUHA 1ZCNA 3S46A 4S23A 4HNOA 2HE8A 2O9OA 3MQTA 4DRKA 1RAKA 2G96A 3GR4A 4G7EA 4G56A 2IKIA 1TRIA 4O18A 4LVGA 3UI4A 4KEZA 2ZRYA 1SZEA 4UOZA 4CGTA 4HNUA 1H7RA 4WSHA 1XIIA 1MWOA 4GZJA 2Y24A 2P4VA 1YMYA 4GUGA 1O68A 2XFRA 1NWSA 2DJLA 4GVFA 4HNNA 3T0CA 4A35A 1BG9A 2YCKX 4C7FA 3OBAA 3WK3A 2VUYA 3TWAA 3O5JA 3I3BA 1NDZA 1ADDA 1UA3A 4H4IA 1ICPA 3UQNA 3E74A 2P8CA 4N2YA 1ALDA 3ITTA 4IFRA 3SN1A 2EQDA 1KTCA 3U5UA 5BWFA 2BBFA 3LGGA 2F2KA 4LY8A 4NZJA 3ZLFA 5CLTA 3GTYX 4Z1YA 4Z1AA 3TAOA 2X09A 5C5YA 5AYYA 5CPSA 3FJLA 2QLYA 2DH3A 4ZOAA 4ZB5A 5D2XA 1OC5A 3P0WA 4Q7IA 4O0ZA 3SY5A 4UMBA 4Y6GA 1MZHA 3ABQA 4ADSA 4S1FA 4JOMA 2CLEA 1G5AA 1LT8A 2O55A 2WVSA 3DU0A 4L1WA 4I9MA 2DZTA 3CGTA 3DI0A 1ELSA 5DELA 1XCWA 3VD9A 1K9TA 1FWFC 3NPVA 3LHYA 5ABTA 4XAGA 3TJ4A 1X1OA 3G8RA 3RRXA 4XAYA 1AW5A 1IT7A 3FA3A 2RJHA 1PZ0A 1GPFA 1C8YA 1LWHA 3O6CA 1AH0A 1ZBWA 3LMYA 3MSDA 1XLIA 2J27A 1HJQA 2CBJA 4NX0A 3UJFA 4ZPVR 1VFSA 3QQ1A 1EO5A 1LZOA 4RKAA 2ZR6A 4JTJA 3G1XA 1DJIA 1G01A 4U4MA 3ME3A 4NXKA 4CN4A 4OWGA 3LTSA 1F6KA 1A7XA 4B16A 1NSGA 2B7PA 5D32A 5DBTA 3OIXA 4RZ5A 1MI3A 1W1VA 1K6AA 1R9XA 3PY2A 2GSHA 1GRJA 4X61A 4GJJA 1JF6A 2BDQA 3PPGA 2F7FA 2DIEA 3K46A 4MJ2A 4PTDA 4O1AA 4N9CA 3H2AA 3L9CA 4MFDA 4HYRA 3BDKA 3ANVA 5FAGA 1NIUA 2ZA1A 4C91A 4Q4PA 1DJQA 4AD4A 4UQAA 4GJIA 2D2GA 1UWUA 4LUJA 1L6SA 2ATMA 1Q6OA 1PPIA 2X30A 4GZ7A 3EOEA 1GTEA 4GIRA 1E1CB 3HZ3A 4HVXA 3TN6A 5CPTA 4DZ3A 1FFRA 1FWWA 5I98A 2PPPA 1VJZA 3CAWA 1POJA 1H7WA 1SO5A 3FFSA 3WMBA 1KFBA 4HGXA 4IP4A 2PC4A 5HULA 1A5SA 1L6FA 4IJBA 3H70A 4ODNA 1KGUA 4C90A 2V82A 5A6KA 5K9DA 5HBFA 2PI6A 4GUIA 3S1XA 4DUOA 4I8DA 3QFWA 3RCNA 1W0MA 1Q4WA 3F4VA 3I3DA 4UDMA 2RDXA 4AD3A 1UR3M 1EQCA 1F4AA 2HJPA 2ZICA 5BRQA 4ITZA 1OABA 4JNYA 1V77A 3UQIA 4W5ZA 4MZ8A 2QCNA 3APYA 4MWAD 1V4YA 2G3MA 3PVFA 3PBMA 5A8GA 1DPMA 3QOMA 2ZUMA 1OC7A 1W9BM 4C6EA 1X7IA 3A21A 3VD3A 3KTCA 5ABEA 4X9SA 6ALDA 7ENLA 4HU0A 3W2NA 3DOPA 3G3MA 4IG2B 1E15A 3EWBX 3W29A 3UCCA 3EDEA 3W26A 4XKYB 4LB3A 3GC4A 3L67A 3L21A 3GDRA 3WFAA 4NT0A 2JALA 2CITA 2V3DA 4L9ZA 2ISVA 1Q65A 2YX0A 3SUSA 2EG6A 2W6RA 1R3YA 5EA9A 3P84A 3KBVA 3LXBA 5FOOA 4KBXA 3LPOA 4JICA 4DBSA 2GVLA 1GOIA 3KOYA 3M5VA 1Q7QA 1Q6CA 2BMBA 4ECLA 4IIEA 4N9DA 2P5NA 3EX6A 3E0IA 3BPWA 2PWDA 4MY8A 3T2OA 3UGVA 2FHFA 5CPLA 1H11A 1I2OA 3LLDA 1FWEC 5TD4A 1XYFA 1GKPA 1MUMA 4JAWA 3DFNA 4L5ZA 1J4RA 1GVYA 3MW7A 3QQ0A 3C4UA 3T6CA 1FWAC 2WZIA 3VMOA 2NZLA 2V81A 5JBDA 1TSIA 2WSPA 4R9XA 3WK2A 4U28A 4CD7A 4HHHA 4H6QA 4FI4A 4ZA0A 2RUDA 2GQ8A 5PTDA 4HZ7A 1W6TA 3S42A 4ACYA 3ABZA 1QW8A 1TFVA 5ENLA 3CUXA 2A7NA 2E68A 4M29A 2D9FA 1RR2A 2PBOA 1O5KA 2CZFA 5HTGA 2ZYFA 1KT0A 4C65A 1M68A 4EF9A 3K4AA 3TXVA 1XKJA 2QMKA 1FJDA 4Z42C 3P93A 3AXMA 4LAWA 3DFTA 3N25A 1UKSA 2OELA 3QYSA 3MV01 4DF2A 1UUQA 4IWWA 4ZTXA 3U48A 5GVJA 3N6QA 3SZ8A 2QAPA 4C02B 3VNLA 3WQEA 1GOWA 4UIOA 2QVHA 2IF4A 5KEZA 3DG3A 1Q6FA 5IFTA 1KW1A 3HQPA 5D37A 2PP0A 3GH5A 4QISA 3SUVA 4KWWA 2VN1A 2V8ZA 1P48A 2TPSA 3CS2A 4MPQA 3FS2A 1I9CB 5T91A 2E6DA 2X7VA 3B03A 1OINA 1U2YA 3LY0A 3QR0A 4W7VA 1YTKA 2WMHA 1XICA 3PWIA 2EKCA 2C18A 3MJMA 5HJLA 3D47A 5FAJA 1WXYA 2GUYA 2AAMA 4M19A 2WJFA 3CYJA 9XIMA 1TTQA 4U10A 4HIBA 1VBJA 1UOKA 2ZBTA 5BMWA 4GQ0A 1QOXA 5J8LA 3I6TA 4RXFA 4ZQCA 4ROPA 4PBGA 2WLZA 2DEPA 1OWQA 2RH9A 2HMCA 2PF0A 5CH9A 4UFKA 4MG4A 1K1DA 1EQPA 4IPPA 3QV8A 1ZS2A 1OQFA 1J0HA 2JE8A 1DYSA 1GVIA 2I5GA 3FYOA 3L5LA 1Q5MA 3W7CA 2WW5A 3CQKA 2E25A 3G1HA 2PDMA 1JI1A 1KRMA 1X6UA 1Z3NA 4DN1A 4BCEA 3S47A 3CU2A 3A4AA 2GJPA 4F8XA 2FHBA 3AMLA 1R3VA 3NI6A 3TQKA 3UXIA 4C6OA 1XYBA 3N18A 1EX1A 3E2RA 4A3RA 5LKYA 3HG3A 5B7YA 4Q8UA 1GNXA 1L2UA 5LYRA 4ERIA 5HKGA 1ITCA 3NR0A 3HMJG 4GFSA 1DIDA 2ZE3A 3AJ7A 4JFWA 3OYXA 3CMFA 1GOMA 2G50A 4E3TA 1CZ1A 2V0TA 4NILA 1KD0A 4F0SA 4HYVA 1SO4A 2A3BA 1EGZA 3WLRA 3VOHA 1TMQA 1AJ2A 3IK2A 3H24A 4DELA 2W27A 3HPXA 4JFVA 4WKHA 1FP8A 3EA1A 3L4UA 4NP7A 5LHFA 4KMQA 2FFCA 3UVAA 1MEHA 1VJIA 3TKFA 1YYAA 2OX1A 1LLWA 3BAXA 1JZ3A 4XSLA 3WQ5A 4S3BA 3E3HA 4GI8A 2CW6A 2PLCA 3LZ5A 5GNZA 4DX3A 1AJ0A 3XIMA 2PWVA 1DWJM 1ODUA 4GBUA 3IIZA 2ONEA 1Q6GA 1GW1A 1O95A 1NP0A 3TV8A 3UCDA 4W5UA 5LIXX 1LRQA 3UQBA 2Q01A 4AIOA 1DVJA 4MB1A 3AXKA 5G1TA 2YR1A 4P8XA 4WKAA 1I6NA 4XUYA 3WUFA 1OD0A 4R7OA 3I68A 5DO8A 1TCMA 1XL9A 3M44A 3A4JA 4L1GA 4F0LA 3N9SA 3QN3A 1C8QA 3VE7A 5L9FA 2BG5A 1SSDA 2FKPA 4CVUA 2WPGA 2W5FA 3BGJA 3BURA 3T0TA 5HDRA 1O94A 4YWIA 4UR7A 1V5XA 2NW0A 4E2OA 3W1AA 1VC4A 1E6RA 1HO4A 4JIPA 3LSBA 2JQXA 1YBQA 2X7WA 2V3GA 5M5DA 1UROA 2GJLA 4DT4A 4YJ5A 1OGGA 3H2NA 2VVNA 4RDWA 4D6CA 3MANA 3RPMA 1VRXA 3ARZA 2R8WA 3LCWA 2CLHA 1VLWA 1IHIA 3T1GA 3QFEA 5A95A 4DJEA 2WV8A 4CU6A 5BYWA 4XBJA 4W7UA 5FEPA 1JCXA 3TZNA 3HF3A 4EK7A 1E3ZA 2GGEA 4PMZA 1GVSA 2A3EA 1JZ5A 1JVWA 3IKGA 4ZFCA 3UESA 3W1TA 4RNJA 4DO4A 1VEMA 5EYWA 2J62A 5LXXA 4IIDA 3IAQA 3ARRA 1OFPA 5IHRA 1WNOA 1OC6A 4K8EA 1EO7A 4BKNA 5J6EA 1K7XA 1PCKA 4UWMA 4FX6M 1NOUA 4NIRA 3W1NA 3KLLA 3VOCA 4XZIA 1GZGA 3VNMA 1QPFA 1FHDA 2V5JA 3W38A 3G0XA 4FR6A 1XRFA 2V2DA 5I3DA 1E5NA 1TYGA 3REQB 3B9EA 3BOLA 1PXGA 5J5RA 4KCVA 4JIQA 3DXIA 2UY4A 1S3TC 3RILA 5I5RA 1HJVA 5D05A 2F2DA 4L9YA 2AQVA 3WSUA 3WFZA 3LU2A 3R5EA 1VCFA 4AIEA 3UVIA 1M5YA 2JEPA 2POTA 4LY4A 2VZUA 1TG7A 4MLRA 2ZDRA 5RUBA 1O60A 3MBFA 3ZJ7A 1KV5A 4UTIA 1LOSA 5T8GA 2A7RA 3W6YA 3MDYB 3NZQA 1J01A 4ZFMA 3VKBA 2ON3A 1ML1A 4HK7A 3SFWA 3FCPA 1AZ2A 4TVUA 3EWCA 5I6SA 1OIFA 3N14A 1LBFA 2VFIA 1WAWA 3VABA 3IUHA 5A8MA 4EXBA 3RJYA 3BH4A 4OV9A 4DJDD 1FWJC 1BXCA 1UD2A 2CBIA 2R1NA 5D04C 3BARA 3CASA 2F6XA 3OU8A 2B5UB 4WK9A 3HQNA 5CBJA 2QJIA 1V03A 1KLZA 2QCFA 3ABOA 4DRQA 4EXAA 1EOMA 4J2PA 4QLKA 4NJIA 5C7VA 3LTPA 2BWGA 4DWSC 3BCJA 3W7OA 1I60A 3N2XA 1QAPA 4Y8FA 3S6OA 1N2VA 3W7HA 3KTSA 4LEQA 5AKQA 3EWDA 3IKDA 4C6IA 2G97A 3UY8A 1CDGA 2OOFA 2C8NA 2VFHA 3HPZA 4GGBA 3W7GA 4DF0A 1XXXA 4K7VA 3M0IA 3AHYA 1PKMA 4MSSA 4AG0A 3N29A 3UPWA 1N7KA 3UI5A 1BSIA 2J8TA 4ILSA 1M01A 2YZ5A 1U33A 1FKBA 1GW9A 1EJTC 4HZ8A 3QSTA 3AYVA 3R43A 3IEBA 3LHZA 3VKCA 1YKWA 1TMHA 2GUUA 2ANUA 1FCBA 3MTWA 3BW3A 2L2SA 4AHPA 2V9DA 1WPCA 2A85A 5KMYA 3F03K 1ISZA 3LSCA 4FLQA 5AC8A 5HUOA 3N2MA 3PZNA 2PCEA 2PRMA 2PDWA 4C6PA 3WQDA 4EACA 2C19A 4ALDA 1AL7A 1VRDA 3WH0A 2BNJA 3AHZA 3SCTA 2YYTA 1FWBC 2CXGA 4QT3A 3G3DA 1OCNA 3VIHA 2DT1A 2YIHA 1DTNA 3PK7A 2QJGA 4XAZA 1EF2A 3WNMA 3LERA 1C9DA 5AHMA 4NF7A 3FDGA 2E6AA 2RFGA 4YNGA 3KBWA 1FKDA 3L4VA 3U2OA 2OXNA 2WC3A 3UD6A 4AIBA 4ENLA 4HPJA 3IJ8A 4ROQA 5I3GA 4H9ZA 3SDOA 1J10A 3FJ6A 3MCMA 5C7HA 1UKPA 1DTUA 1XLMA 1IGSA 1EC7A 3LYEA 5F2LA 4DJFC 1ONXA 3ATZA 1GZ1A 3AYRA 5F1UA 4MIMA 3T07A 4AZIA 4B91A 4I8YA 2R9RA 3WQ4A 1HKMA 4JFIA 1LP6A 4LYPA 4HMCA 5TQLA 3RNDA 3THQA 2BB0A 3BICA 3T78A 3LHWA 2XZ7A 4D2JA 1EEXA 1M7PA 1XLLA 3GTXA 4MWAB 3ZT5A 5C71A 4MPKA 3GB6A 1ONWA 3Q67A 3A6OA 3R0UA 9CGTA 4PTNA 2FTYA 4PMXA 2JKAA 2WLYA 1CGTA 4REQA 1KCKA 1ICQA 1F3EA 1J0JA 1UJQA 1ZBKA 6TIMA 4FLRA 4MM1A 3ODKA 1E5JA 3N73A 1JEZA 1TTJA 1OY0A 4E8DA 1MXSA 4ICMA 3ZWTA 1T41A 4OECA 1YE6A 3DC0A 3MUCA 1A5AA 3GO2A 3I4EA 2Y6ZA 3KBSA 1QWGA 1VFTA 3SSZA 1UH3A 4AVOA 1CNVA 1DQUA 4YXGA 4G1KA 4QR6A 5HQLA 3NPXA 3PZ9A 1J6OA 3H8AA 4RNFA 2E5CA 5DXYA 4B9ZA 3A22A 1LOLA 2Q3RA 1DV7A 4P8WA 4NJHA 1D7IA 3W1PA 3CH9A 1GT8A 2DSKA 1OZQA 2DZXA 3A5FA 2Z00A 2DT0A 4AZGA 1EA9C 3VDBA 1LF1A 4FB7A 4QE4A 3BMBA 5AHFA 3ZO9A 4C6LA 3H21A 4O14A 5M2FX 3GH4A 1NOWA 4IF2A 4YS1A 4NHVA 3R94A 2JF7A 1PKNA 3HGOA 4M0XA 3S5NA 1H5VA 3C0SA 1QASA 5FA5A 3P5YA 5AVHA 4HCHA 3SQSA 1UR9A 3RHGA 1WO2A 3W53A 3DHDA 4A2SA 4KETA 2DIJA 2VC9A 3S1WA 4O50A 1RLDA 1K8CA 4FO4A 1Y5VA 4H3DA 2V5LA 3O3RA 1J12A 4CQ8A 3PTQA 3KFTA 4HPGA 4C1NB 1TCOC 1HJUA 1DWHM 3EOUA 4IT1A 5EMUA 2GL5A 3BUVA 3QHMA 3DGRA 3DBPA 2GOUA 2QJHA 1XLAA 5CJNA 2BHYA 3APGA 1JD7A 1DXIA 1HZYA 2D2HA 1U1UA 1RJRA 4TV5A 3M5YA 2QJMA 1CECA 1W1A1 1PHWA 4I5RA 3I3EA 4M6UA 2RAGA 1XIHA 3UJ2A 4Q33A 3DG7A 4EKJA 4R5EA 3R25A 1KGXA 3P81A 1HXJA 1Q1CA 5JUVA 1GK8A 4B15A 2YCLB 3AUOA 3LCGA 2EPMX 5U7SA 3DFOA 3HB9A 3O6AA 2P0IA 1WBHA 1TV8A 3DKJA 2V30A 1HXVA 2ZTJA 5LIKX 3WF1A 2IQDA 5FKYA 3WQFA 3C52A 1RJPA 4BWLC 1R3TA 1PX3A 2F61A 1Q8JA 1WA3A 1NM9A 1JJKA 1FHUA 3WH5A 5GQBA 2E28A 3QW4B 1YXDA 3BLLA 2HS6A 1U30A 5HINA 2YSWA 2FH8A 3P74A 1KBIA 1J2WA 3E0WA 5D38A 3NWRA 4F2UA 4FHAA 1UBPC 4S2BA 1TR9A 2Z7GA 5EGRA 3OLEA 1CENA 4W88A 2B7NA 4RPQA 2PPGA 1O5XA 4G7EB 4YLWA 1ZAJA 2QMJA 1E6XM 2O9PA 1TUXA 3LHTA 1U5JA 2ZA2A 3S1GA 5I23A 2VZOA 4PFHA 4UUIA 4ERAA 4D6DA 3GZAA 1F6PA 3GU1A 4J4NA 4NQ1A 3TQ0A 3LCHA 4J3TA 3WMLA 4JBRA 3VGDA 3T44A 4WSJA 2NX1A 3VNDA 3C2FA 4IFOA 2VDHA 3OA5A 3WBYA 4QTGA 1SFSA 3QTPA 3ZSSA 2YCJA 4ZO9A 1S38A 1UW9A 4HN4A 1GTHA 2E3ZA 5CC6A 4XG1A 1SYTA 1UR4A 4ODKA 4OGZA 4C6CA 3VIGA 3OVGA 1UJPA 1J79A 2FZ9A 2E9LA 3TYCA 3IK4A 4GY0A 3BLKA 3RFWA 2CLKA 1A5MC 3CWNA 4E5TA 1XH0A 1GVOA 1A80A 1R9ZA 2MNRA 3J7HA 3ZVHA 3U6WA 1JD9A 1ZFJA 4A3YA 1FWRA 1EP2A 4U2YA 3O5IA 1HIZA 2QV4A 2WMJA 3IJDA 3R8HA 2OGYA 2Y89A 1XLJA 1IQ8A 1SZRA 2ZRZA 3W85A 1E0UA 1PEZA 2OWWA 3KBNA 4D6GA 4WDXA 2Q3OA 3O7UA 3TEVA 2VRKA 2J77A 4QIBA 1KFKA 5KETA 3KBJA 4J3WA 2GGIA 3TMQA 1G69A 3HPSA 1D9EA 3URBA 4CQCA 3EKLA 3STGA 1PTDA 1TPH1 1HKVA 1QJWA 3IJ9A 4S3CA 3VD5A 5XINA 3GG0A 1S5VA 4MGGA 4Y2WA 1JCNA 1H1ZA 2ZA3A 4IXHA 2REQB 2MLZA 1TV2A 1LRTA 3CXOA 1GVEA 2Z1BA 2BHUA 4UOJA 1DJWA 2JEQA 3RLHA 4R7WA 3DYPA 3KS5A 2GGHA 4NXSA 3IGSA 1RY8A 4XD4A 3CM4A 3NXLA 2P3EA 4WKFA 2UY5A 4IQEA 2WQDA 4ZE5A 5T26A 1AK5A 3A4XA 5HMEA 3CMGA 1WE5A 3F4DA 4IPIA 2QIWA 3AIBA 1FOBA 1KR0A 3MMUA 3HMCA 4DZAA 5CJ5A 1DEDA 3SCPA 3P2VA 3A5VA 4MJZA 2GK1B 1PDYA 4C1LA 4LVFA 1WDPA 4IX2A 2DG4A 4AQLA 3M6YA 5E6YA 4QFUA 1KC7A 4M1BA 3M0MA 5KZEA 4ERGA 2VFEA 4CD4A 3C5QA 3KVMA 4EPEC 1UR8A 3V0TA 3C2OA 4IFKB 1J6YA 4N4PA 1R85A 2INEA 4JN8A 2RDUA 2PU0A 3MYPA 1K6WA 4OV4A 4NL1A 5A3HA 4PA8A 3EIPA 1SSGA 5AB3A 1IT0A 1X6NA 1GORA 2ZIDA 1HJSA 1C90A 1Y5XA 4JFJA 4MNLA 1ROTA 4CCCA 1EP3A 5C9RA 5CC7A 1AH3A 1HVXA 2CHOA 5SWUA 4JHMA 1B4EA 1XH2A 4K7YA 5A8PA 3BE7A 3WK1A 2PBCA 1B6CA 1DXFA 3Q58A 2A5HA 4GHRA 2ETNA 4HHPA 3SSJA 1R46A 2Q6ZA 1VBUA 4IGNA 3PNUA 1CXLA 2BY1A 4WDUA 4A05A 1EDQA 3RPTA 3WBWA 3EWXA 1XRVA 3G1SA 3WBAA 3SRHA 2DG3A 3EKZA 1XHGA 1NP2A 3MYOA 3UEQA 3C2RA 2QUVA 4WUIA 2C0HA 2ZRVA 2BGQA 3WD1A 2IPJA 3LRLA 1U5VA 2DZUA 3WLSA 4RX0A 3TLQA 1E9LA 4MWAE 1RCOB 3N6JA 1TPFA 1AMYA 1UWRA 2ASHA 3M6DA 4LH8A 3IV8A 3C2EA 2LLEA 3MBDA 1IEQA 2J79A 4A21A 2MUCA 3V5OA 2WWDA 2OCZA 4L61A 3IIOA 4GOAA 1HP5A 4IIFA 4J3VA 3WF0A 3H2OA 3OLGA 3B0PA 1HP4A 4J3UA 2I9UA 4CD8A 2Y85A 3ZT7A 2V67A 4ZOCA 3GXDA 3ORWA 3T7VA 5G1MA 1HFBA 3RO8A 3FA4A 1SMAA 3GBEA 4IOTA 4HSHA 1UWSA 2ZUWA 3CZEA 4UNKA 3M0JA 2XVGA 2PEVA 3DX5A 4DUWA 7REQA 4B5TA 2PTYA 3NZPA 4W4QA 3UWEA 4NZ1A 3G24A 3WH7A 5DMYA 1X38A 1XS2A 1XJBA 2C0AA 3NG3A 3OZYA 4FXSA 1W2PA 3RG6A 4FIRA 7TIMA 4G6CA 2WXDM 3IACA 4MTVA 1AL8A 3WJSA 4WD0A 3NL2A 4PEEA 3TYDA 3G77A 2CZVA 2FJKA 1ICSA 3AIEA 3ES7A 2YZRA 5KINA 1I75A 3S9IA 1OG0A 3PBWA 3GR8A 4NNRA 1NAL1 1DIOA 4JPGA 4LVAA 1F8MA 3URNA 4N42A 1ZHAA 4QS6A 1FD9A 1QPRA 2V63A 4HU8A 4TMCA 4GX8A 3W2LA 1HQTA 3HQ1A 3GZ3A 1DHKA 3HTWA 3LBOA 3CAQA 1KQYA 1I4NA 1R7AA 4GY7A 1KM6A 1E0XA 1PO9A 3F2CA 3O5DA 4PRWA 1E9YB 2X40A 4YPJA 1TIMA 2MPHA 1KCZA 1ZUAX 2DGAA 2CZEA 3H4GA 1O66A 3ITXA 3MDWA 5EL1A 2OEJA 4Y8EA 4NNCA 2J66A 4RLIA 3O07A 1MRQA 4JTEA 2OQYA 3LV5A 5DMLA 4LB4A 1Q2SA 5HMFA 3NL6A 4H9MA 2KO7A 1DJYA 4J3XA 1P0BA 3I7QA 4JFSA 3SAZA 4OUIA 1RBOB 2K8IA 3W1XA 3L12A 4W89A 3HO8A 5FF4A 2XVLA 4URIA 2EKGA 3WQVA 3KEHA 4HHMA 2YB1A 2GZXA 1FKWA 3VGBA 2C1GA 4GCXA 2WHLA 1W1ZA 4O12A 2Z6IA 1PZ3A 3WKZA 2EPKX 4R88A 3AIQA 4A2RA 4OQVA 2J7BA 1MYRA 1OK4A 3OVRA 5DCBA 5B80A 4YTTA 4RZ6A 3CEUA 5JBFA 4TO8A 1HT6A 3I4KA 3AXIA 2NX9A 2IXUA 1E1CA 2R14A 5BRBA 3EDFA 2PDXA 1PINA 1ISVA 3PZUA 3A12A 2FJUB 4DJEC 1VF8A 2HK1A 4Q4RA 3OPSA 3KCJA 2PP3A 4KH2A 2Z1WA 3PUOA 1SR9A 1YTEA 1SVDA 4OHQA 5JQ9A 2XP5A 4FS9A 2Z26A 1KV8A 2P0OA 1M9HA 4AZ7A 2HDJA 3SADA 1R47A 4QNWA 5AHIA 4AHQA 3GNDA 1TZ7A 4Z1CA 5A2AA 2VX5A 1VGAA 2WJZA 2E9MA 3T0DA 4Z1DA 1DWAM 3IS4A 3N34A 3ARVA 3MHUA 4E4FA 1M7OA 3RK8A 1QO2A 1BEUA 2P1FA 3PBYA 3WMCA 4S3KA 3NIYA 4O11A 3TXZA 2GVEA 1JNTA 4DROA 3AZSA 2WM0A 3D0CA 1V02A 4NI3A 5IFPA 4LBUA 1FKKA 4AUBA 3DECA 2FFIA 2C7FA 3B8IA 1TELA 1MMFA 3BAKA 1UQZA 3KHJA 3WF3A 4Q7NA 1XW8A 1EDGA 3BJFA 5E1QA 5FJJA 2DZPA 4K8HA 1ODZA 3UFYA 3WLPA 2LPVA 3W7NA 1AQHA 2GUBA 1Y0OA 3R8GA 1JNSA 1ZSXA 5G1YA 3FGCA 1JPDX 3VIPA 1LWJA 3CAVA 4JL1A 1F3XA 2GVJA 5A6JA 4AB4A 4R34A 4CN1A 1YXCA 4C6FA 4AX6A 1CLKA 1UP2A 1DWFM 5LIUX 4KRZA 3NDYA 1AVAA 4U3AA 2VQTA 2FZDA 5D8WA 4Z0JA 1YIXA 2A0NA 2O7QA 1WZMA 2XM2A 4AXNA 3UWUA 4JTTA 1D6OA 1Z6KA 2W61A 4O52A 2I17A 1B3ZA 2V2HA 5LGXA 1WZKA 3RM9A 1DWIM 1EGVA 1VEPA 1SFTA 1QHOA 1J18A 4D71A 4AY1A 3QV6A 2FZNA 3THDA 3W22A 3LLFA 5EU9A 3M7WA 4FIQA 3UP8A 5DIVA 1KA9F 4E6MA 4GVGA 2B0MA 3NYDA 4FN2A 3W71A 3QVQA 3CC1A 1IXPA 1KXTA 4H8HA 3N4AA 2W67A 2XDFA 2DSUA 3S2NA 4A8LA 1ZAHA 5ABFB 3NYZA 5M1TA 2ADAA 1S5MA 4C5ZA 3KVKA 4P7OA 3EX1A 1XLEA 1CYGA 3SCVA 4HMDA 3K4DA 4Q8MA 4AW7A 4GE8A 5C55A 1MRAA 4DYJA 4IISA 4AMAA 5EMJA 1T8QA 2UZ9A 4XKYA 3R58A 2YL9A 3V5CA 1B30A 1FTXA 1RLCL 4KWUA 4UQBA 4O53A 3QTGA 4XKMA 3WJYA 3G6MA 4Q4MA 2OLAA 3WJXA 3SCWA 4CEXC 4W9QA 1H7NA 4WF7A 1NVMA 3Q4DA 1MXGA 4N6EA 4UTWA 1EIXA 4YVXA 5K7JA 2XPBA 2QPUA 4M8UA 3OG3A 1EYMA 1NDVA 3E49A 3ZT6A 1K9DA 3VMNA 1GHRA 5LIYX 3STEA 5JMUA 2A4AA 3WBXA 2DPEA 1P6BA 2VEMA 3PUEA 3FSTA 3LI1A 4HBKA 3ZQ9A 3MZNA 5ABHA 2WSYA 3TYZA 2B31A 6XIAA 1X39A 3UYCA 1GONA 3FEMA 4C6KA 1W56A 3EKGA 4FF5A 4Y96A 1HJWA 2C91A 3TYAA 1D7JA 3BQ5A 3BV7A 4MYXA 2J8GA 2A21A 3KAHA 4I7UA 1IE7C 5C6MA 1LL7A 1K70A 1P0DA 3N3TA 3SB0A 1ISYA 2OT0A 2ZUTA 4PUJA 3ARXA 1TJ0A 3H26A 2OPJA 1REQB 1HL2A 1BKSA 4I5XA 3ITYA 3QH2A 3W28A 4LUTA 2PRLA 1NDYA 1XPGA 2VEKA 1I2RA 4N9BA 1YW1A 1BFNA 3GPKA 3TN3A 4N6FA 3BSHA 3SM0A 4PUMA 3EX4A 2EPNA 2TRSA 5C2CA 4UQ9A 4L4LA 1FKIA 1SW0A 3BOFA 2CWXA 1JXKA 3DESA 3JRKA 2VC5A 3W3OA 3JW7A 4HU3A 3NRKA 3A9BA 4ZZ9A 4JN6A 1KB3A 2QDGA 3S9YA 2ISWA 3E2QA 3TTYA 4GH3A 3W76A 5FJTA 4FLSA 1NFPA 3BL3A 4QE5A 1ZLPA 3RX4A 3NPWA 2O4QA 5C2XA 4TYOA 3H2EA 5HJXA 4JTUA 1XYLA 1NSJA 3BG5A 3WUGA 2XPKA 3AISA 2Y5EA 2TMDA 4FNUA 2VEGA 2GQAA 4IMGA 2V5CA 3EPNA 2D1ZA 1GHSA 4V28A 3G1AA 1GOOA 3FAXA 1DOSA 1LCOA 3TC6A 1G1YA 1E43A 3WQOA 3BLFA 1K4GA 1ZB5A 1BKFA 4ODOA 3AOFA 4EX4A 1A50A 1BGAA 4DRJA 2ZC8A 4AWEA 3RXZA 4RE2A 5C9XA 3CHVA 3HV9A 4LOCA 1UQYA 4U3CA 3FV9A 4X2RA 3LBCA 3AJXA 4K36A 3UG4A 2H3BA 4B2DD 1EPVA 3OVQA 1PE1A 3NURA 2PGEA 5JIWA 8CGTA 4X9YA 1A53A 2GDQA 3MI6A 5XIAA 5DT7A 1Z7AA 4Z2HA 1K8YA 2WQPA 1H7PA 1B3VA 3W01A 3KVLA 5IDZA 1EHNA 3QF0A 2I1OA 3LNPA 3KVJA 1YADA 2YLLA 4NZ5A 4UTKA 3S6TA 3RX2A 4XWUA 3N1AA 1FDJA 4WZHA 1ITXA 4KWSA 4UZSA 3WLJA 1TV7A 3OLIA 3N4EA 4LC8A 3D46A 4LVDA 2PMQA 1PHQA 4ZGYA 3AZRA 4I6KA 3I65A 2Y8KA 1BYAA 4IUOA 1QWKA 1VQTA 3EPMA 3OODA 2I56A 1ZCCA 4B5UA 1K3UA 4PMVA 3ZIZA 5GPRA 2YCLA 4H6EA 2JF6A 4B3ZA 1GYMA 3ZFHA 2ALRA 1E4LA 3PSWA 4HSOA 3WK0A 1M03A 3CIVA 4ORMA 1A0EA 5DXXA 5BCAA 2E4TA 3ABXA 2XIIA 1V0MA 3KZ7A 1N55A 4YCPA 4HPNA 1WCGA 2BZNA 1CLVA 3N04A 5E93A 5HA7A 3RLVA 3NTPA 1YQ2A 2BXVA 4NNAA 2NQZA 2AL2B 2AKMA 1RP9A 3REQA 1V6XA 5A6SA 4J35A 3EX2A 4S3FA 3TQPA 1KM5A 8XIAA 3VIKA 1C7TA 2CXEA 2PLKA 3FLUA 4J5NA 2CHNA 1DXEA 2IS7A 4PUWA 3CZ8A 1G0CA 2YXOA 3LGDA 3MKCA 1MUCA 2NV9A 1TVNA 3TAKA 3ZMRA 1R6WA 5JXQA 2WCAA 1QI3A 1XFCA 3HPAA 1JULA 4IGSA 4ZVJA 3OGSA 1TJRA 4HD5A 1M7XA 4PCPA 2VZTA 3EDDA 1TZZA 3IGXA 2DQWA 1YBQB 1RCXB 3CMJA 1PTGA 1BKHA 1X6LA 4HK5A 4RE4A 2GOKA 3QPEA 3U7BA 3A3XA 4CQ9A 4WGHA 2XFWA 1OX4B 2DSWA 4ML4A 4LAYA 2FPVA 2XP8A 1W1B1 1JL8A 2YLAA 4JYFA 3WLTA 3M1ZA 4DRHA 1QW9A 2N87A 1Z8AA 1MW0A 2FZ8A 1DP0A 3LM3A 3TTQA 3NJ3A 5TF0A 3O9NA 2OYMA 1CBGA 3K1GA 1KM2A 1ZY9A 3M64A 3W7LA 1EXBA 1C92A 1J93A 1UZHA 5GNXA 1XC4A 3E6EA 1R3WA 3VNIA 3MUAA 3UR8A 5U4NA 4C6DA 4QP0A 1UMLA 2J8FA 2ZADA 5F4WA 4MNKA 1I1XA 2Z1SA 1Q7ZA 4GUJA 1TQJA 4B4FA 2Z27A 3TOPA 4AZCA 1F5ZA 2MANA 2YDSA 4GY1A 3GS6A 3L7RA 1W9PA 4ODPA 2Y8VA 3CV1A 1XLFA 5G4WA 2ICSA 1KM0A 1QDSA 3LCLA 3W82A 7PTDA 3AALA 1XYAA 4US6A 3PZOA 2GWNA 2YCIX 3PZGA 2QZRA 3UZYA 4KF1A 1KT1A 1FWGC 3N2OA 1JUBA 1E1FA 2YFNA 3GBDA 3WH6A 3PC0A 1H50A 1N82A 3B40A 1CXEA 4MOZA 3OQEA 3IJQA 1A3HA 1KKRA 3C8FA 4ATWA 4JYEA 5I3KA 4LUYA 3GX9A 1WDWA 2YA1A 3FY1A 3PFRA 4GQGA 4IP7A 1PSCA 3ZOAA 3CB3A 4R33A 4PULA 3VDCA 3O5OA 3AUJA 4NZ3A 3AIRA 4Y9MA 3LRMA 4LJ3A 1V51A 1ME7A 5HNTA 3G8EA 4JIIX 2Z24A 2FZBA 2OX4A 3PPFA 4N19A 2YW4A 1F9CA 1W9XA 3L66A 1XQLA 1L8PA 3IVSA 5K4ZA 4G1NA 1F40A 1UH2A 1AD1A 3VDGA 2VGGA 1T7LA 5AHLA 1V0LA 1GPWA 1FWTA 4XD6A 3VNYA 3OIHA 3WEZA 3M4HA 2VR4A 1FP9A 3M0KA 4L80A 3SUWA 3W1QA 3HGRA 5L6UA 1NF0A 4L6HA 1YDOA 2YW3A 2XWDA 4MKNA 4UCGA 4H2HA 2PLMA 3PR9A 2Q8XA 4PMDA 1GOXA 2X8RA 5TNVA 4NX5A 1FQ0A 3JXVA 3ELFA 2G8ZA 1GCYA 4DO7A 4LS2A 5E6ZA 3EZ4A 1VIZA 2JGQA 1VCVA 2XSXA 1IWBA 5AC5A 2G37A 1FDZA 5FSEC 1EC8A 3SY1A 1YTDA 3H6OA 1RXOB 4W9PA 5BXRA 3GHRA 3SN4A 3L4XA 1L9WA 1KFJA 3UA4A 1FWHC 1QHZA 1EGMA 3VKKA 4FXJA 5CZSA 4JTDA 1RD6A 5F2IA 1RPKA 2ZQSA 2YOCA 4IPLA 5KZMA 2R6OA 5E0FA 4N02A 2PDJA 3IVTA 1ZZMA 2NUYA 2XIJA 5AYIA 2IPGA 1PS9A 2KGJA 1GGOA 1R3RA 2OGJA 2ALDA 3DFQA 2VCDA 3CV7A 1JI2A 4EVZA 5DQPA 1K4HA 2OZ0A 4IQCA 1UPPA 3PAJA 4GFIA 1FKFA 1IT8A 4YYFA 3U5YA 1FCQA 1Q4NX 1ISXA 5M3WA 5D8ZA 2OOGA 1JCLA 4M24A 2E0PA 3BCFA 1LQ0A 3O5RA 1Q85A 3P0XA 3GDKA 4ES4A 3QGKC 3OZPA 2GK1A 4F66A 4LQ1A 4H7CA 2J7EA 3TK7A 1JG9A 4LCSA 4OJYA 3Q94A 3VC6A 3PAOA 4HQVA 2QJNA 4JHZA 4HMNA 3BWWA 3M9YA 4DJFA 1XG3A 4PODA 2QDHA 1JYNA 4P7NA 3BGGA 5CC5A 4IHCA 2DZVA 3PWGA 4AF0A 3ZJ8A 3W7JA 1KFWA 3PP7A 4MKVA 2V5BA 1HTIA 1L6YA 2BODX 4LAZA 3G0UA 4LX4A 3SFKA 1PIGA 1LL6A 4GBDA 3UG5A 3QY6A 5FJRA 2ZX7A 2ZVIA 3UQAA 1W3LA 3VUSA 2VYOA 4GZEA 4HTBA 5E09A 4J3ZA 1L1PA 3FK4A 3DERA 4PMQA 4GO8A 2DP3A 2RJGA 2KR7A 1W3HA 3UR7A 4EP8C 4HMEA 1RY0A 3VGEA 2J74A 5GNYA 1GUVA 3E0VA 3Q65A 1IWAA 3V4BA 5I3JA 3NO1A 2BOEX 3IARA 4LF2A 1T96A 1CGVA 2OO0A 4DXXA 2XH7A 4XUGA 3UF9A 1F3TA 3GTIA 1HG3A 2ZRUA 1H5YA 3XINA 2VEIA 3AHTA 4JIHA 3WY1A 4QG6A 5C54A 3NL3A 3XISA 3B9AA 2IXVA 1XV8A 2ZX8A 7ODCA 2W9MA 2AOSA 3EBVA 2ZC1A 3H7UA 4WR3A 2FKEA 1V93A 1DIKA 2NXIA 4DRNA 4GKLA 1WAUA 3ALGA 1QZ2A 3KP1A 2PTDA 2EPLX 1ZALA 1J0KA 1H3GA 2IMRA 5BW6A 1TPVA 3I6EA 3ARPA 1KBLA 1IYXA 2D3NA 1W32A 1JDCA 1GJWA 2Y4SA 1QMLA 4GRSA 2FLIA 1TRDA 5D02A 1H61A 4QNEA 1MQQA 4B2DA 4IJRA 4CQAA 2Y8UA 1FY6A 3QC3A 1J96A 3QPZA 3VU2A 3WQWA 1AODA 1EBGA 4OOZA 2P88A 3MA8A 4LAVA 4WDTA 3MI2A 2VQUA 2PV3A 2NSOA 3QY7A 2PGFA 4PGLA 2RUSA 5MHBA 4NRRA 4J28A 4AX7A 2X1RA 3VNJA 2INZA 4IH3A 4I9JA 2Z1VA 3MMTA 3VXGA 5CPQA 3EX3A 4V33A 3PTMA 1KGWA 1UBSA 2PP1A 1EB3A 4E4UA 1D8WA 2WJEA 5DFAA 2VR2A 3C61A 4GGHA 3VAWA 2HSAA 4TW6A 2DZWA 4GIEA 3KE0A 3TDFA 3CQIA 2X2GA 4Q7BA 4PB3A 3WQ8A 3W23A 1H7OA 2OVLA 3O5GA 2BVYA 4RXGA 4GYKA 3IANA 3N15A 3M7SA 1X1ZA 2RKXA 3KL3A 4IGHA 1J2BA 3S6DA 1LORA 3EXRA 3IIXA 1XYZA 3O15A 4H9YA 4NY2A 4CNPA 1BRLA 1F07A 1VHNA 3MY9A 2E7FA 3SCNA 4JN7A 4D6IA 3CWHA 4B3KA 3E2VA 1GQKA 2C1HA 1V08A 1ONEA 1XLBA 4MB4A 1Q7MA 3KACA 1Q45A 1MUWA 1A5KC 3GG1A 3N3MA 2VC7A 2MLXA 2DQXA 3NQAA 1CIUA 1FKGA 3OJGA 1NELA 2G5WA 4L6DA 1LG2A