3CGNA

Crystal structure of thermophilic slyd
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
151
structure length
151
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure Determination and Functional Characterization of the Metallochaperone SlyD from Thermus thermophilus
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase
total genus 28
structure length 151
sequence length 151
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3cgnA00
3UI6A 3PA7A 1FAPA 4NNRA 2XP4A 2LPVA 5DITA 5GPGA 3RFWA 3O5JA 3GPKA 1M5YA 1KT0A 1F8AB 2PPOA 4N19A 2VCDA 2ZR4A 1FD9A 1TCOC 4QIBA 1D7JA 3O5OA 4G2PA 2KI3A 1JNTA 3H9RB 4IQCA 1J4RA 2MF9A 2LKNA 1Y0OA 2ITKA 5J6EA 3O5QA 4U84A 4O2TA 4G50A 2DG3A 4TW6A 4DRMA 2MLYA 3UQAA 5DIUA 3KCEA 2ZR5A 1FKLA 2Y78A 3VAWA 2KR7A 4DT4A 5DIVA 1NMWA 1EYMA 2MNTA 1L1PA 2XP9A 1J4IA 3IK8A 2ZR6A 3O5GA 4ODOA 3I6CA 1JNSA 3KZ7A 3ODKA 4LAVA 4R0XA 2FKEA 3NI6A 1B6CA 4QT2A 3NRKA 1JVWA 4U86A 2DG4A 2LJ4A 3CGNA 4DROA 4DZ3A 1D7HA 5HWBA 3KACA 1C9HA 2XPAA 3UI4A 1A7XA 5B8IC 1PINA 4DZ2A 4JFLA 5HWCA 1YW5A 4DRQA 2AWGA 2RUDA 1BKFA 1W26A 2XP5A 2N87A 5HKGA 4IQ2A 3TDBA 1FKRA 3B7XA 4TX0A 2XP6A 2VN1A 2PV1A 3O5FA 4ODLA 3O5MA 3KAIA 1Q1CA 4ODPA 5HW6A 1FKJA 3UQIA 2PBCA 2UZ5A 2XP3A 4LAYA 1NMVA 2PV3A 3JYMA 3FAPA 4IPXA 3KAFA 4JFJA 4ODRA 1J4HA 3KADA 4J4NA 3NTPA 4JYSA 4MGVA 2L2SA 4DRKA 3KAGA 4ITZA 4W9PA 1FKIA 1U79A 4DRNA 1QZ2A 3MDYB 3UQBA 2KGJA 3UI5A 3LUOA 2PPNA 3IKDA 4MSPA 4DIPA 2RURA 3O5IA 1ROTA 1FKSA 3PRBA 1D7IA 2MLXA 4W9OA 1F40A 1T11A 3O5DA 5HTGA 3O5RA 2MPHA 2F21A 3CGMA 4FAPA 1Q6UA 4GIVA 3RGCA 4FN2A 2JZVA 3IKGA 4DRHA 2F2DA 4TYOA 3O5KA 5HW7A 3IHZA 1PBKA 2XPBA 3JXVA 5HT1A 1P5QA 5HW8A 2MLZA 4TW8A 2FAPA 4ODMA 2ZQVA 3KAHA 2RQSA 1FKFA 3O5LA 3EY6A 1FKKA 1BL4A 1QPLA 4LAXA 1HXVA 2OFNA 4DRJA 1FJDA 1QPFA 2F4EA 2RSEA 3O5EA 1ROUA 2IF4A 2M08A 2K8IA 1ZCNA 2RUCA 2XP8A 4C02B 1FKBA 5HUAA 2LGOA 3KABA 4JFKA 4ODQA 4ODNA 2XP7A 4JFIA 4U85A 2D9FA 1FKGA 1R9HA 2ZQTA 1FKDA 3OOBA 1FKHA 5I98A 1FKTA 2ZQUA 4BF8A 4W9QA 4LAWA 4ODKA 5D75A 1J6YA 4TW7A 2PPPA 1Q6IA 2ZQSA 2DG9A 2KE0A 4DRPA 2KO7A 2KFWA 3JYJA 3UF8A 3PRDA 2PV2A 1EQ3A 4J4OA 2RUQA 4TNSA 1NSGA 4JFMA 5BXJA 2M2AA 1KT1A 2M1IA 3O5PA 4QT3A 3TC5A 1N1AA 3TCZA 1Q6HA 3WH0A 4DH0A 4DRIA 2Q5AA 4GGQA 1ZK6A 1YATA 1D6OA
chains in the Genus database with same CATH superfamily
3UI6A 1KFWA 2LPVA 3O5JA 3GPKA 1M5YA 1LL4A 3CHDA 2VCDA 1HKJA 4ML4A 4Q7NA 1TCOC 1HJWA 3PRAA 2KI3A 1ITXA 4WKFA 1HKMA 3B9AA 2LKNA 2ITKA 4IT6A 2DG3A 2MLYA 5DIUA 2Y78A 2KR7A 4DT4A 5DIVA 1NMWA 1NWTA 1GRJA 2F23A 2XP9A 1LL6A 4LAVA 4R0XA 2FKEA 3NRKA 4DROA 3ARPA 1H0GA 1C9HA 3GU0A 4DZ2A 4JFLA 1GUVA 5HKGA 2XP5A 2N87A 5DEZA 4S3JA 1FKRA 4NZCA 3AS1A 3O5MA 4PTMA 3AROA 4ODPA 5HW6A 2XP3A 4LAYA 4IPXA 4MGVA 3CH9A 1RD6A 3OA5A 1QZ2A 1W9VA 2KGJA 3UI5A 2PPNA 2IUZA 3PRBA 3ARUA 4URIA 3O5DA 3AS3A 1K9TA 2MPHA 2F21A 1Q6UA 4MNJA 1JNEA 3CHCA 1ZB5A 3IHZA 5HT1A 4DWSC 1LG2A 2WLZA 5GQBA 2RQSA 1WAWA 4P8VA 3WL0A 4P8WA 1QPLA 1HXVA 2OFNA 3ARZA 3BXWA 3ARXA 2DT1A 2O92A 2D9FA 1FKDA 1FKTA 4BF8A 3ARWA 4ODKA 2ZQSA 2DG9A 2PV2A 2DT3A 3WQWA 1E6ZA 4JFMA 5BXJA 2EULA 3CHFA 3O5PA 3TC5A 1GPFA 3WH0A 3CHEA 2Q5AA 2PI6A 4GGQA 1YATA 4NNRA 4DWSA 2WLYA 5GPGA 1W1VA 3B9EA 3ARYA 2PPOA 4N19A 1FD9A 4IT4A 1D7JA 3EIPA 1OGBA 1JCHB 3AS2A 1J4RA 4HARA 4G50A 1ZBKA 4WJXA 1IX5A 2OLHA 1EYMA 1L1PA 3O5GA 2ZR6A 4MAVA 3KZ7A 4UDMA 4QT2A 1JVWA 4U86A 2LJ4A 5HWBA 3WQVA 2B5UB 1CTNA 1YW5A 2AWGA 1BKFA 4IQ2A 3TDBA 3B7XA 1E44A 4KQZA 2P4VA 2PV1A 4HBEA 3UQIA 1W1YA 2UZ5A 2DSZA 1NMVA 2PV3A 3FAPA 1HKKA 4DRKA 3KAGA 4ITZA 3CZ8A 2G8ZA 3RM9A 1LL7A 3IKDA 4MSPA 3RM8A 3O5IA 4W9OA 3WD4A 1F40A 5HTGA 4AY1A 3O5RA 3RGCA 1NWSA 1SYTA 4DRHA 4KR0B 2F2DA 4TYOA 1PBKA 1EIBA 1ZBCA 1OWQA 1FKKA 1BL4A 4DRJA 3ARQA 1QPFA 2F4EA 4Z2KA 2IF4A 2M08A 2RUCA 4C02B 5HUAA 4ODNA 2XP7A 1FKGA 3OOBA 1E6PA 4LAWA 5D75A 1J6YA 4TW7A 4Z2HA 2PPPA 2KO7A 3WKZA 2RUQA 3QOKA 3ALFA 2M1IA 1UR9A 4QT3A 2DT2A 4XAKA 1EDQA 3AQUA 4DH0A 4DRIA 4ZPTR 2YBUA 4ZPWR 4ZS6A 4L72B 2DSVA 2XP4A 3G6LA 4QIBA 2ESCA 4MNLA 4IQCA 5J6EA 4O2TA 1ZL1A 4W5UA 4Z2IA 3WD1A 3UQAA 3KCEA 2ZR5A 3W4RA 3VAWA 2MNTA 3ALGA 2A3EA 1J4IA 3B8SA 4MNMA 5JH8A 3ODKA 2DSWA 2WK2A 1B6CA 3CGNA 3WIJA 4DZ3A 3UI4A 2PN0A 1A7XA 1PINA 4P8UA 3BMBA 1NH6A 1VF8A 4R5EA 3WD3A 1W9PA 4ODLA 3KAIA 4Q22A 4JFJA 4ODRA 4NSBA 3KADA 4J4NA 3NTPA 4JYSA 2DPEA 1UR8A 1FKIA 1D2KA 1WB0A 3GTYX 4P8XA 3UQBA 3MDYB 5HBFA 3LUOA 4DIPA 2RURA 1ROTA 1FKSA 4Z2LA 4MTVA 1D7IA 2MLXA 2B31A 2AOSA 1T11A 4WKHA 5DO2A 3CGMA 4GIVA 3IKGA 3O5KA 1X6NA 5HW7A 2XPBA 1P5QA 3WD2A 4TW8A 3O5LA 3EY6A 1FJDA 1OGGA 3O5EA 4DRPA 2RSEA 2XP8A 2K8IA 1ZCNA 1E9LA 1JNDA 2QF8A 3KABA 4ODQA 1XHGA 2ZQTA 3PR9A 1WNOA 2A3CA 3RM4A 5I98A 4W9QA 1NWUA 4LGXA 3JYJA 1W1TA 4L3NA 3PRDA 1EQ3A 4WK9A 4J4OA 4TNSA 1LG1A 1KT1A 2FDMA 3WL1A 4QZVB 3TCZA 1Q6HA 1ZK6A 1D6OA 3PA7A 1FAPA 5DITA 3RFWA 1KT0A 1F8AB 2ZR4A 1ZU8A 5GPRA 3O5OA 4G2PA 4DWSB 3ARTA 1JNTA 5DF0A 3H9RB 2WM0A 2MF9A 4MNKA 1Y0OA 3ARVA 3O5QA 1ZBWA 4U84A 4TW6A 4DRMA 1FKLA 1W1PA 1FFRA 1NWRA 3IK8A 4ODOA 4ZPVR 3I6CA 1JNSA 4HBOA 1HKIA 3NI6A 2DG4A 1D7HA 3G6MA 3KACA 2XPAA 5B8IC 5HWCA 4DRQA 2RUDA 1W26A 2YBTA 3B9DA 4TX0A 1SR0A 2DT0A 4WIWA 2XP6A 2VN1A 3O5FA 2A3BA 1Q1CA 1FKJA 2PBCA 3JYMA 3KAFA 1E15A 1J4HA 3ARSA 2ETNA 2L2SA 4W9PA 1H0IA 1U79A 4DRNA 1HJVA 2DSUA 1E6NA 1LQ0A 4MPKA 4FAPA 4FN2A 2JZVA 3JXVA 1EHNA 5HW8A 2MLZA 2FAPA 4ODMA 2ZQVA 3KAHA 4S3KA 3RMEA 1FKFA 1W9UA 1ZBVA 1FFQA 2O9OA 4LAXA 1GOIA 3FXYA 4Z2GA 1HJXA 1ROUA 1FKBA 2LGOA 4JFKA 1O6IA 4U85A 4JFIA 1X6LA 3WD0A 2G41A 3FY1A 1R9HA 1FKHA 2ZQUA 4WKAA 2A3AA 1Q6IA 2KE0A 2KFWA 3UF8A 3AS0A 1TFVA 1NSGA 4Z2JA 2M2AA 4DWSD 1XRVA 1N1AA 1LJYA 1E6RA 3ARRA
chains in the Genus database with same CATH topology
3UI6A 1KFWA 2LPVA 3O5JA 3GPKA 1M5YA 1LL4A 3CHDA 2VCDA 1HKJA 4ML4A 4Q7NA 1TCOC 1HJWA 3PRAA 2KI3A 1ITXA 4WKFA 1HKMA 3B9AA 2LKNA 2ITKA 4IT6A 2DG3A 2MLYA 5DIUA 2Y78A 2KR7A 4DT4A 5DIVA 1NMWA 1NWTA 2XP9A 1LL6A 4LAVA 4R0XA 2FKEA 3NRKA 4DROA 3ARPA 1H0GA 1C9HA 4DZ2A 4JFLA 1GUVA 5HKGA 2XP5A 2N87A 5DEZA 4S3JA 1FKRA 4NZCA 3AS1A 3O5MA 4PTMA 3AROA 4ODPA 5HW6A 2XP3A 4LAYA 4IPXA 4MGVA 3CH9A 1RD6A 3OA5A 1QZ2A 1W9VA 2KGJA 3UI5A 2PPNA 2IUZA 3PRBA 3ARUA 4URIA 3O5DA 3AS3A 1K9TA 2MPHA 2F21A 1Q6UA 4MNJA 1JNEA 3CHCA 1ZB5A 3IHZA 5HT1A 4DWSC 1LG2A 2WLZA 5GQBA 2RQSA 1WAWA 4P8VA 3WL0A 4P8WA 1QPLA 1HXVA 2OFNA 3ARZA 3BXWA 3ARXA 2DT1A 2O92A 2D9FA 1FKDA 1FKTA 4BF8A 3ARWA 4ODKA 2ZQSA 2DG9A 2PV2A 2DT3A 3WQWA 1E6ZA 4JFMA 5BXJA 3CHFA 3O5PA 3TC5A 1GPFA 3WH0A 3CHEA 2Q5AA 2PI6A 4GGQA 1YATA 4NNRA 4DWSA 2WLYA 5GPGA 1W1VA 3B9EA 3ARYA 2PPOA 4N19A 1FD9A 4IT4A 1D7JA 1OGBA 3AS2A 1J4RA 4HARA 4G50A 1ZBKA 4WJXA 1IX5A 2OLHA 1EYMA 1L1PA 3O5GA 2ZR6A 4MAVA 3KZ7A 4QT2A 1JVWA 4U86A 2LJ4A 5HWBA 3WQVA 1CTNA 1YW5A 2AWGA 1BKFA 4IQ2A 3TDBA 3B7XA 4KQZA 2PV1A 4HBEA 3UQIA 1W1YA 2UZ5A 2DSZA 1NMVA 2PV3A 3FAPA 1HKKA 4DRKA 3KAGA 4ITZA 3CZ8A 2G8ZA 3RM9A 1LL7A 3IKDA 4MSPA 3RM8A 3O5IA 4W9OA 3WD4A 1F40A 5HTGA 4AY1A 3O5RA 3RGCA 1NWSA 1SYTA 4DRHA 4KR0B 2F2DA 4TYOA 1PBKA 1EIBA 1ZBCA 1OWQA 1FKKA 1BL4A 4DRJA 3ARQA 1QPFA 2F4EA 4Z2KA 2IF4A 2M08A 2RUCA 4C02B 5HUAA 4ODNA 2XP7A 1FKGA 3OOBA 1E6PA 4LAWA 5D75A 1J6YA 4TW7A 4Z2HA 2PPPA 2KO7A 3WKZA 2RUQA 3QOKA 3ALFA 2M1IA 1UR9A 4QT3A 2DT2A 4XAKA 1EDQA 3AQUA 4DH0A 4DRIA 4ZPTR 2YBUA 4ZPWR 4ZS6A 4L72B 2DSVA 2XP4A 3G6LA 4QIBA 2ESCA 4MNLA 4IQCA 5J6EA 4O2TA 1ZL1A 4W5UA 4Z2IA 3WD1A 3UQAA 3KCEA 2ZR5A 3W4RA 3VAWA 2MNTA 3ALGA 2A3EA 1J4IA 3B8SA 4MNMA 5JH8A 3ODKA 2DSWA 2WK2A 1B6CA 3CGNA 3WIJA 4DZ3A 3UI4A 1A7XA 1PINA 4P8UA 1NH6A 1VF8A 4R5EA 3WD3A 1W9PA 4ODLA 3KAIA 4Q22A 4JFJA 4ODRA 4NSBA 3KADA 4J4NA 3NTPA 4JYSA 2DPEA 1UR8A 1FKIA 1D2KA 1WB0A 4P8XA 3UQBA 3MDYB 5HBFA 3LUOA 4DIPA 2RURA 1ROTA 1FKSA 4Z2LA 4MTVA 1D7IA 2MLXA 2B31A 2AOSA 1T11A 4WKHA 5DO2A 3CGMA 4GIVA 3IKGA 3O5KA 1X6NA 5HW7A 2XPBA 1P5QA 3WD2A 4TW8A 3O5LA 3EY6A 1FJDA 1OGGA 3O5EA 4DRPA 2RSEA 2XP8A 2K8IA 1ZCNA 1E9LA 1JNDA 2QF8A 3KABA 4ODQA 1XHGA 2ZQTA 3PR9A 1WNOA 2A3CA 3RM4A 5I98A 4W9QA 1NWUA 4LGXA 3JYJA 1W1TA 4L3NA 3PRDA 1EQ3A 4WK9A 4J4OA 4TNSA 1LG1A 1KT1A 2FDMA 3WL1A 4QZVB 3TCZA 1Q6HA 1ZK6A 1D6OA 3PA7A 1FAPA 5DITA 3RFWA 1KT0A 1F8AB 2ZR4A 1ZU8A 5GPRA 3O5OA 4G2PA 4DWSB 3ARTA 1JNTA 5DF0A 3H9RB 2WM0A 2MF9A 4MNKA 1Y0OA 3ARVA 3O5QA 1ZBWA 4U84A 4TW6A 4DRMA 1FKLA 1W1PA 1FFRA 1NWRA 3IK8A 4ODOA 4ZPVR 3I6CA 1JNSA 4HBOA 1HKIA 3NI6A 2DG4A 1D7HA 3G6MA 3KACA 2XPAA 5B8IC 5HWCA 4DRQA 2RUDA 1W26A 2YBTA 3B9DA 4TX0A 1SR0A 2DT0A 4WIWA 2XP6A 2VN1A 3O5FA 2A3BA 1Q1CA 1FKJA 2PBCA 3JYMA 3KAFA 1E15A 1J4HA 3ARSA 2L2SA 4W9PA 1H0IA 1U79A 4DRNA 1HJVA 2DSUA 1E6NA 1LQ0A 4MPKA 4FAPA 4FN2A 2JZVA 3JXVA 1EHNA 5HW8A 2MLZA 2FAPA 4ODMA 2ZQVA 3KAHA 4S3KA 3RMEA 1FKFA 1W9UA 1ZBVA 1FFQA 2O9OA 4LAXA 1GOIA 3FXYA 4Z2GA 1HJXA 1ROUA 1FKBA 2LGOA 4JFKA 1O6IA 4U85A 4JFIA 1X6LA 3WD0A 2G41A 3FY1A 1R9HA 1FKHA 2ZQUA 4WKAA 2A3AA 1Q6IA 2KE0A 2KFWA 3UF8A 3AS0A 1TFVA 1NSGA 4Z2JA 2M2AA 4DWSD 1XRVA 1N1AA 1LJYA 1E6RA 3ARRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UI6 A;  3PA7 A;  1FAP A;  4NNR A;  2XP4 A;  2LPV A;  5DIT A;  5GPG A;  3RFW A;  3O5J A;  3GPK A;  1M5Y A;  1KT0 A;  1F8A B;  2PPO A;  4N19 A;  2VCD A;  2ZR4 A;  1FD9 A;  1TCO C;  4QIB A;  1D7J A;  3O5O A;  4G2P A;  2KI3 A;  1JNT A;  3H9R B;  4IQC A;  1J4R A;  2MF9 A;  2LKN A;  1Y0O A;  2ITK A;  5J6E A;  3O5Q A;  4U84 A;  4O2T A;  4G50 A;  2DG3 A;  4TW6 A;  4DRM A;  2MLY A;  3UQA A;  5DIU A;  3KCE A;  2ZR5 A;  1FKL A;  2Y78 A;  3VAW A;  2KR7 A;  4DT4 A;  5DIV A;  1NMW A;  1EYM A;  2MNT A;  1L1P A;  2XP9 A;  1J4I A;  3IK8 A;  2ZR6 A;  3O5G A;  4ODO A;  3I6C A;  1JNS A;  3KZ7 A;  3ODK A;  4LAV A;  4R0X A;  2FKE A;  3NI6 A;  1B6C A;  4QT2 A;  3NRK A;  1JVW A;  4U86 A;  2DG4 A;  2LJ4 A;  3CGN A;  4DRO A;  4DZ3 A;  1D7H A;  5HWB A;  3KAC A;  1C9H A;  2XPA A;  3UI4 A;  1A7X A;  5B8I C;  1PIN A;  4DZ2 A;  4JFL A;  5HWC A;  1YW5 A;  4DRQ A;  2AWG A;  2RUD A;  1BKF A;  1W26 A;  2XP5 A;  2N87 A;  5HKG A;  4IQ2 A;  3TDB A;  1FKR A;  3B7X A;  4TX0 A;  2XP6 A;  2VN1 A;  2PV1 A;  3O5F A;  4ODL A;  3O5M A;  3KAI A;  1Q1C A;  4ODP A;  5HW6 A;  1FKJ A;  3UQI A;  2PBC A;  2UZ5 A;  2XP3 A;  4LAY A;  1NMV A;  2PV3 A;  3JYM A;  3FAP A;  4IPX A;  3KAF A;  4JFJ A;  4ODR A;  1J4H A;  3KAD A;  4J4N A;  3NTP A;  4JYS A;  4MGV A;  2L2S A;  4DRK A;  3KAG A;  4ITZ A;  4W9P A;  1FKI A;  1U79 A;  4DRN A;  1QZ2 A;  3MDY B;  3UQB A;  2KGJ A;  3UI5 A;  3LUO A;  2PPN A;  3IKD A;  4MSP A;  4DIP A;  2RUR A;  3O5I A;  1ROT A;  1FKS A;  3PRB A;  1D7I A;  2MLX A;  4W9O A;  1F40 A;  1T11 A;  3O5D A;  5HTG A;  3O5R A;  2MPH A;  2F21 A;  3CGM A;  4FAP A;  1Q6U A;  4GIV A;  3RGC A;  4FN2 A;  2JZV A;  3IKG A;  4DRH A;  2F2D A;  4TYO A;  3O5K A;  5HW7 A;  3IHZ A;  1PBK A;  2XPB A;  3JXV A;  5HT1 A;  1P5Q A;  5HW8 A;  2MLZ A;  4TW8 A;  2FAP A;  4ODM A;  2ZQV A;  3KAH A;  2RQS A;  1FKF A;  3O5L A;  3EY6 A;  1FKK A;  1BL4 A;  1QPL A;  4LAX A;  1HXV A;  2OFN A;  4DRJ A;  1FJD A;  1QPF A;  2F4E A;  2RSE A;  3O5E A;  1ROU A;  2IF4 A;  2M08 A;  2K8I A;  1ZCN A;  2RUC A;  2XP8 A;  4C02 B;  1FKB A;  5HUA A;  2LGO A;  3KAB A;  4JFK A;  4ODQ A;  4ODN A;  2XP7 A;  4JFI A;  4U85 A;  2D9F A;  1FKG A;  1R9H A;  2ZQT A;  1FKD A;  3OOB A;  1FKH A;  5I98 A;  1FKT A;  2ZQU A;  4BF8 A;  4W9Q A;  4LAW A;  4ODK A;  5D75 A;  1J6Y A;  4TW7 A;  2PPP A;  1Q6I A;  2ZQS A;  2DG9 A;  2KE0 A;  4DRP A;  2KO7 A;  2KFW A;  3JYJ A;  3UF8 A;  3PRD A;  2PV2 A;  1EQ3 A;  4J4O A;  2RUQ A;  4TNS A;  1NSG A;  4JFM A;  5BXJ A;  2M2A A;  1KT1 A;  2M1I A;  3O5P A;  4QT3 A;  3TC5 A;  1N1A A;  3TCZ A;  1Q6H A;  3WH0 A;  4DH0 A;  4DRI A;  2Q5A A;  4GGQ A;  1ZK6 A;  1YAT A;  1D6O A; 
#chains in the Genus database with same CATH topology
 3UI6 A;  1KFW A;  2LPV A;  3O5J A;  3GPK A;  1M5Y A;  1LL4 A;  3CHD A;  2VCD A;  1HKJ A;  4ML4 A;  4Q7N A;  1TCO C;  1HJW A;  3PRA A;  2KI3 A;  1ITX A;  4WKF A;  1HKM A;  3B9A A;  2LKN A;  2ITK A;  4IT6 A;  2DG3 A;  2MLY A;  5DIU A;  2Y78 A;  2KR7 A;  4DT4 A;  5DIV A;  1NMW A;  1NWT A;  1GRJ A;  2F23 A;  2XP9 A;  1LL6 A;  4LAV A;  4R0X A;  2FKE A;  3NRK A;  4DRO A;  3ARP A;  1H0G A;  1C9H A;  3GU0 A;  4DZ2 A;  4JFL A;  1GUV A;  5HKG A;  2XP5 A;  2N87 A;  5DEZ A;  4S3J A;  1FKR A;  4NZC A;  3AS1 A;  3O5M A;  4PTM A;  3ARO A;  4ODP A;  5HW6 A;  2XP3 A;  4LAY A;  4IPX A;  4MGV A;  3CH9 A;  1RD6 A;  3OA5 A;  1QZ2 A;  1W9V A;  2KGJ A;  3UI5 A;  2PPN A;  2IUZ A;  3PRB A;  3ARU A;  4URI A;  3O5D A;  3AS3 A;  1K9T A;  2MPH A;  2F21 A;  1Q6U A;  4MNJ A;  1JNE A;  3CHC A;  1ZB5 A;  3IHZ A;  5HT1 A;  4DWS C;  1LG2 A;  2WLZ A;  5GQB A;  2RQS A;  1WAW A;  4P8V A;  3WL0 A;  4P8W A;  1QPL A;  1HXV A;  2OFN A;  3ARZ A;  3BXW A;  3ARX A;  2DT1 A;  2O92 A;  2D9F A;  1FKD A;  1FKT A;  4BF8 A;  3ARW A;  4ODK A;  2ZQS A;  2DG9 A;  2PV2 A;  2DT3 A;  3WQW A;  1E6Z A;  4JFM A;  5BXJ A;  2EUL A;  3CHF A;  3O5P A;  3TC5 A;  1GPF A;  3WH0 A;  3CHE A;  2Q5A A;  2PI6 A;  4GGQ A;  1YAT A;  4NNR A;  4DWS A;  2WLY A;  5GPG A;  1W1V A;  3B9E A;  3ARY A;  2PPO A;  4N19 A;  1FD9 A;  4IT4 A;  1D7J A;  3EIP A;  1OGB A;  1JCH B;  3AS2 A;  1J4R A;  4HAR A;  4G50 A;  1ZBK A;  4WJX A;  1IX5 A;  2OLH A;  1EYM A;  1L1P A;  3O5G A;  2ZR6 A;  4MAV A;  3KZ7 A;  4UDM A;  4QT2 A;  1JVW A;  4U86 A;  2LJ4 A;  5HWB A;  3WQV A;  2B5U B;  1CTN A;  1YW5 A;  2AWG A;  1BKF A;  4IQ2 A;  3TDB A;  3B7X A;  1E44 A;  4KQZ A;  2P4V A;  2PV1 A;  4HBE A;  3UQI A;  1W1Y A;  2UZ5 A;  2DSZ A;  1NMV A;  2PV3 A;  3FAP A;  1HKK A;  4DRK A;  3KAG A;  4ITZ A;  3CZ8 A;  2G8Z A;  3RM9 A;  1LL7 A;  3IKD A;  4MSP A;  3RM8 A;  3O5I A;  4W9O A;  3WD4 A;  1F40 A;  5HTG A;  4AY1 A;  3O5R A;  3RGC A;  1NWS A;  1SYT A;  4DRH A;  4KR0 B;  2F2D A;  4TYO A;  1PBK A;  1EIB A;  1ZBC A;  1OWQ A;  1FKK A;  1BL4 A;  4DRJ A;  3ARQ A;  1QPF A;  2F4E A;  4Z2K A;  2IF4 A;  2M08 A;  2RUC A;  4C02 B;  5HUA A;  4ODN A;  2XP7 A;  1FKG A;  3OOB A;  1E6P A;  4LAW A;  5D75 A;  1J6Y A;  4TW7 A;  4Z2H A;  2PPP A;  2KO7 A;  3WKZ A;  2RUQ A;  3QOK A;  3ALF A;  2M1I A;  1UR9 A;  4QT3 A;  2DT2 A;  4XAK A;  1EDQ A;  3AQU A;  4DH0 A;  4DRI A;  4ZPT R;  2YBU A;  4ZPW R;  4ZS6 A;  4L72 B;  2DSV A;  2XP4 A;  3G6L A;  4QIB A;  2ESC A;  4MNL A;  4IQC A;  5J6E A;  4O2T A;  1ZL1 A;  4W5U A;  4Z2I A;  3WD1 A;  3UQA A;  3KCE A;  2ZR5 A;  3W4R A;  3VAW A;  2MNT A;  3ALG A;  2A3E A;  1J4I A;  3B8S A;  4MNM A;  5JH8 A;  3ODK A;  2DSW A;  2WK2 A;  1B6C A;  3CGN A;  3WIJ A;  4DZ3 A;  3UI4 A;  2PN0 A;  1A7X A;  1PIN A;  4P8U A;  3BMB A;  1NH6 A;  1VF8 A;  4R5E A;  3WD3 A;  1W9P A;  4ODL A;  3KAI A;  4Q22 A;  4JFJ A;  4ODR A;  4NSB A;  3KAD A;  4J4N A;  3NTP A;  4JYS A;  2DPE A;  1UR8 A;  1FKI A;  1D2K A;  1WB0 A;  3GTY X;  4P8X A;  3UQB A;  3MDY B;  5HBF A;  3LUO A;  4DIP A;  2RUR A;  1ROT A;  1FKS A;  4Z2L A;  4MTV A;  1D7I A;  2MLX A;  2B31 A;  2AOS A;  1T11 A;  4WKH A;  5DO2 A;  3CGM A;  4GIV A;  3IKG A;  3O5K A;  1X6N A;  5HW7 A;  2XPB A;  1P5Q A;  3WD2 A;  4TW8 A;  3O5L A;  3EY6 A;  1FJD A;  1OGG A;  3O5E A;  4DRP A;  2RSE A;  2XP8 A;  2K8I A;  1ZCN A;  1E9L A;  1JND A;  2QF8 A;  3KAB A;  4ODQ A;  1XHG A;  2ZQT A;  3PR9 A;  1WNO A;  2A3C A;  3RM4 A;  5I98 A;  4W9Q A;  1NWU A;  4LGX A;  3JYJ A;  1W1T A;  4L3N A;  3PRD A;  1EQ3 A;  4WK9 A;  4J4O A;  4TNS A;  1LG1 A;  1KT1 A;  2FDM A;  3WL1 A;  4QZV B;  3TCZ A;  1Q6H A;  1ZK6 A;  1D6O A;  3PA7 A;  1FAP A;  5DIT A;  3RFW A;  1KT0 A;  1F8A B;  2ZR4 A;  1ZU8 A;  5GPR A;  3O5O A;  4G2P A;  4DWS B;  3ART A;  1JNT A;  5DF0 A;  3H9R B;  2WM0 A;  2MF9 A;  4MNK A;  1Y0O A;  3ARV A;  3O5Q A;  1ZBW A;  4U84 A;  4TW6 A;  4DRM A;  1FKL A;  1W1P A;  1FFR A;  1NWR A;  3IK8 A;  4ODO A;  4ZPV R;  3I6C A;  1JNS A;  4HBO A;  1HKI A;  3NI6 A;  2DG4 A;  1D7H A;  3G6M A;  3KAC A;  2XPA A;  5B8I C;  5HWC A;  4DRQ A;  2RUD A;  1W26 A;  2YBT A;  3B9D A;  4TX0 A;  1SR0 A;  2DT0 A;  4WIW A;  2XP6 A;  2VN1 A;  3O5F A;  2A3B A;  1Q1C A;  1FKJ A;  2PBC A;  3JYM A;  3KAF A;  1E15 A;  1J4H A;  3ARS A;  2ETN A;  2L2S A;  4W9P A;  1H0I A;  1U79 A;  4DRN A;  1HJV A;  2DSU A;  1E6N A;  1LQ0 A;  4MPK A;  4FAP A;  4FN2 A;  2JZV A;  3JXV A;  1EHN A;  5HW8 A;  2MLZ A;  2FAP A;  4ODM A;  2ZQV A;  3KAH A;  4S3K A;  3RME A;  1FKF A;  1W9U A;  1ZBV A;  1FFQ A;  2O9O A;  4LAX A;  1GOI A;  3FXY A;  4Z2G A;  1HJX A;  1ROU A;  1FKB A;  2LGO A;  4JFK A;  1O6I A;  4U85 A;  4JFI A;  1X6L A;  3WD0 A;  2G41 A;  3FY1 A;  1R9H A;  1FKH A;  2ZQU A;  4WKA A;  2A3A A;  1Q6I A;  2KE0 A;  2KFW A;  3UF8 A;  3AS0 A;  1TFV A;  1NSG A;  4Z2J A;  2M2A A;  4DWS D;  1XRV A;  1N1A A;  1LJY A;  1E6R A;  3ARR A; 
#chains in the Genus database with same CATH homology
 3UI6 A;  1KFW A;  2LPV A;  3O5J A;  3GPK A;  1M5Y A;  1LL4 A;  3CHD A;  2VCD A;  1HKJ A;  4ML4 A;  4Q7N A;  1TCO C;  1HJW A;  3PRA A;  2KI3 A;  1ITX A;  4WKF A;  1HKM A;  3B9A A;  2LKN A;  2ITK A;  4IT6 A;  2DG3 A;  2MLY A;  5DIU A;  2Y78 A;  2KR7 A;  4DT4 A;  5DIV A;  1NMW A;  1NWT A;  2XP9 A;  1LL6 A;  4LAV A;  4R0X A;  2FKE A;  3NRK A;  4DRO A;  3ARP A;  1H0G A;  1C9H A;  4DZ2 A;  4JFL A;  1GUV A;  5HKG A;  2XP5 A;  2N87 A;  5DEZ A;  4S3J A;  1FKR A;  4NZC A;  3AS1 A;  3O5M A;  4PTM A;  3ARO A;  4ODP A;  5HW6 A;  2XP3 A;  4LAY A;  4IPX A;  4MGV A;  3CH9 A;  1RD6 A;  3OA5 A;  1QZ2 A;  1W9V A;  2KGJ A;  3UI5 A;  2PPN A;  2IUZ A;  3PRB A;  3ARU A;  4URI A;  3O5D A;  3AS3 A;  1K9T A;  2MPH A;  2F21 A;  1Q6U A;  4MNJ A;  1JNE A;  3CHC A;  1ZB5 A;  3IHZ A;  5HT1 A;  4DWS C;  1LG2 A;  2WLZ A;  5GQB A;  2RQS A;  1WAW A;  4P8V A;  3WL0 A;  4P8W A;  1QPL A;  1HXV A;  2OFN A;  3ARZ A;  3BXW A;  3ARX A;  2DT1 A;  2O92 A;  2D9F A;  1FKD A;  1FKT A;  4BF8 A;  3ARW A;  4ODK A;  2ZQS A;  2DG9 A;  2PV2 A;  2DT3 A;  3WQW A;  1E6Z A;  4JFM A;  5BXJ A;  3CHF A;  3O5P A;  3TC5 A;  1GPF A;  3WH0 A;  3CHE A;  2Q5A A;  2PI6 A;  4GGQ A;  1YAT A;  4NNR A;  4DWS A;  2WLY A;  5GPG A;  1W1V A;  3B9E A;  3ARY A;  2PPO A;  4N19 A;  1FD9 A;  4IT4 A;  1D7J A;  1OGB A;  3AS2 A;  1J4R A;  4HAR A;  4G50 A;  1ZBK A;  4WJX A;  1IX5 A;  2OLH A;  1EYM A;  1L1P A;  3O5G A;  2ZR6 A;  4MAV A;  3KZ7 A;  4QT2 A;  1JVW A;  4U86 A;  2LJ4 A;  5HWB A;  3WQV A;  1CTN A;  1YW5 A;  2AWG A;  1BKF A;  4IQ2 A;  3TDB A;  3B7X A;  4KQZ A;  2PV1 A;  4HBE A;  3UQI A;  1W1Y A;  2UZ5 A;  2DSZ A;  1NMV A;  2PV3 A;  3FAP A;  1HKK A;  4DRK A;  3KAG A;  4ITZ A;  3CZ8 A;  2G8Z A;  3RM9 A;  1LL7 A;  3IKD A;  4MSP A;  3RM8 A;  3O5I A;  4W9O A;  3WD4 A;  1F40 A;  5HTG A;  4AY1 A;  3O5R A;  3RGC A;  1NWS A;  1SYT A;  4DRH A;  4KR0 B;  2F2D A;  4TYO A;  1PBK A;  1EIB A;  1ZBC A;  1OWQ A;  1FKK A;  1BL4 A;  4DRJ A;  3ARQ A;  1QPF A;  2F4E A;  4Z2K A;  2IF4 A;  2M08 A;  2RUC A;  4C02 B;  5HUA A;  4ODN A;  2XP7 A;  1FKG A;  3OOB A;  1E6P A;  4LAW A;  5D75 A;  1J6Y A;  4TW7 A;  4Z2H A;  2PPP A;  2KO7 A;  3WKZ A;  2RUQ A;  3QOK A;  3ALF A;  2M1I A;  1UR9 A;  4QT3 A;  2DT2 A;  4XAK A;  1EDQ A;  3AQU A;  4DH0 A;  4DRI A;  4ZPT R;  2YBU A;  4ZPW R;  4ZS6 A;  4L72 B;  2DSV A;  2XP4 A;  3G6L A;  4QIB A;  2ESC A;  4MNL A;  4IQC A;  5J6E A;  4O2T A;  1ZL1 A;  4W5U A;  4Z2I A;  3WD1 A;  3UQA A;  3KCE A;  2ZR5 A;  3W4R A;  3VAW A;  2MNT A;  3ALG A;  2A3E A;  1J4I A;  3B8S A;  4MNM A;  5JH8 A;  3ODK A;  2DSW A;  2WK2 A;  1B6C A;  3CGN A;  3WIJ A;  4DZ3 A;  3UI4 A;  1A7X A;  1PIN A;  4P8U A;  1NH6 A;  1VF8 A;  4R5E A;  3WD3 A;  1W9P A;  4ODL A;  3KAI A;  4Q22 A;  4JFJ A;  4ODR A;  4NSB A;  3KAD A;  4J4N A;  3NTP A;  4JYS A;  2DPE A;  1UR8 A;  1FKI A;  1D2K A;  1WB0 A;  4P8X A;  3UQB A;  3MDY B;  5HBF A;  3LUO A;  4DIP A;  2RUR A;  1ROT A;  1FKS A;  4Z2L A;  4MTV A;  1D7I A;  2MLX A;  2B31 A;  2AOS A;  1T11 A;  4WKH A;  5DO2 A;  3CGM A;  4GIV A;  3IKG A;  3O5K A;  1X6N A;  5HW7 A;  2XPB A;  1P5Q A;  3WD2 A;  4TW8 A;  3O5L A;  3EY6 A;  1FJD A;  1OGG A;  3O5E A;  4DRP A;  2RSE A;  2XP8 A;  2K8I A;  1ZCN A;  1E9L A;  1JND A;  2QF8 A;  3KAB A;  4ODQ A;  1XHG A;  2ZQT A;  3PR9 A;  1WNO A;  2A3C A;  3RM4 A;  5I98 A;  4W9Q A;  1NWU A;  4LGX A;  3JYJ A;  1W1T A;  4L3N A;  3PRD A;  1EQ3 A;  4WK9 A;  4J4O A;  4TNS A;  1LG1 A;  1KT1 A;  2FDM A;  3WL1 A;  4QZV B;  3TCZ A;  1Q6H A;  1ZK6 A;  1D6O A;  3PA7 A;  1FAP A;  5DIT A;  3RFW A;  1KT0 A;  1F8A B;  2ZR4 A;  1ZU8 A;  5GPR A;  3O5O A;  4G2P A;  4DWS B;  3ART A;  1JNT A;  5DF0 A;  3H9R B;  2WM0 A;  2MF9 A;  4MNK A;  1Y0O A;  3ARV A;  3O5Q A;  1ZBW A;  4U84 A;  4TW6 A;  4DRM A;  1FKL A;  1W1P A;  1FFR A;  1NWR A;  3IK8 A;  4ODO A;  4ZPV R;  3I6C A;  1JNS A;  4HBO A;  1HKI A;  3NI6 A;  2DG4 A;  1D7H A;  3G6M A;  3KAC A;  2XPA A;  5B8I C;  5HWC A;  4DRQ A;  2RUD A;  1W26 A;  2YBT A;  3B9D A;  4TX0 A;  1SR0 A;  2DT0 A;  4WIW A;  2XP6 A;  2VN1 A;  3O5F A;  2A3B A;  1Q1C A;  1FKJ A;  2PBC A;  3JYM A;  3KAF A;  1E15 A;  1J4H A;  3ARS A;  2L2S A;  4W9P A;  1H0I A;  1U79 A;  4DRN A;  1HJV A;  2DSU A;  1E6N A;  1LQ0 A;  4MPK A;  4FAP A;  4FN2 A;  2JZV A;  3JXV A;  1EHN A;  5HW8 A;  2MLZ A;  2FAP A;  4ODM A;  2ZQV A;  3KAH A;  4S3K A;  3RME A;  1FKF A;  1W9U A;  1ZBV A;  1FFQ A;  2O9O A;  4LAX A;  1GOI A;  3FXY A;  4Z2G A;  1HJX A;  1ROU A;  1FKB A;  2LGO A;  4JFK A;  1O6I A;  4U85 A;  4JFI A;  1X6L A;  3WD0 A;  2G41 A;  3FY1 A;  1R9H A;  1FKH A;  2ZQU A;  4WKA A;  2A3A A;  1Q6I A;  2KE0 A;  2KFW A;  3UF8 A;  3AS0 A;  1TFV A;  1NSG A;  4Z2J A;  2M2A A;  4DWS D;  1XRV A;  1N1A A;  1LJY A;  1E6R A;  3ARR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...