3CGNA

Crystal structure of thermophilic slyd
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
151
structure length
151
Chain Sequence
b'MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase
publication title Crystal Structure Determination and Functional Characterization of the Metallochaperone SlyD from Thermus thermophilus
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase
total genus 28
structure length 151
sequence length 151
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3cgnA00
2PPPA 3EY6A 5DIUA 3UQBA 1Q1CA 2K8IA 1A7XA 1KT1A 4FN2A 1TCOC 1D6OA 2FAPA 2PV3A 4TNSA 4DRQA 3KACA 2IF4A 4JYSA 1FKLA 1U79A 3O5QA 2LJ4A 3O5PA 3TC5A 2XP7A 3OOBA 2RUQA 4ODNA 1QPFA 3H9RB 3NI6A 4DZ3A 3JXVA 4U85A 4O2TA 3VAWA 4DT4A 1L1PA 2AWGA 1FKTA 3B7XA 2PPOA 4TW7A 2Y78A 1ROTA 3WH0A 2RQSA 1D7HA 2MLZA 2ZQUA 3KZ7A 3O5EA 5HTGA 4N19A 1EYMA 1ZK6A 3IHZA 3IK8A 3O5OA 1Y0OA 4G50A 4JFIA 4IPXA 4ODMA 3KAHA 3UI6A 4ODKA 3TDBA 5HUAA 2DG3A 3PA7A 2N87A 2VN1A 1R9HA 4J4OA 2KR7A 4NNRA 5DITA 4J4NA 3TCZA 2FKEA 3MDYB 1FAPA 1J4HA 3RGCA 4DRNA 1T11A 2VCDA 1FKKA 4DIPA 5DIVA 4W9OA 4QT3A 4W9PA 2LKNA 2KFWA 3LUOA 4FAPA 3PRDA 2XP3A 2XPBA 2D9FA 2ITKA 3KABA 4TW8A 3UF8A 4U84A 2Q5AA 2XPAA 1PINA 1Q6HA 3IKDA 4C02B 1Q6UA 5HW8A 1BL4A 3O5DA 1FJDA 5HT1A 5HW7A 4W9QA 4LAWA 4QIBA 3KADA 4TW6A 4DRJA 2MLYA 5HWBA 2UZ5A 2JZVA 1FKDA 2KE0A 3O5JA 2PPNA 1B6CA 1PBKA 2PBCA 3O5MA 1F8AB 3UQAA 4MSPA 1ROUA 1FKJA 5GPGA 2L2SA 3RFWA 1EQ3A 1FKBA 2ZQVA 1NMVA 2F2DA 3I6CA 4TYOA 2XP8A 3O5RA 1QZ2A 2ZR4A 4JFMA 4DRMA 5J6EA 3KAIA 1J4RA 3O5FA 3UI4A 2ZQTA 1M5YA 3GPKA 2MF9A 2MPHA 1NSGA 2XP4A 2M2AA 3NRKA 2DG4A 4JFJA 4ODLA 1C9HA 1Q6IA 3JYMA 2ZR6A 1FKRA 1D7JA 2LPVA 4DRKA 1FD9A 1P5QA 1YATA 1D7IA 3FAPA 2RSEA 4GIVA 4JFKA 3KAFA 4ODRA 3KCEA 4R0XA 3O5LA 1FKSA 2F4EA 2OFNA 4ODPA 5I98A 2LGOA 1JVWA 3O5GA 2XP6A 5HKGA 2MNTA 1QPLA 1F40A 3O5KA 1NMWA 4IQCA 2RUDA 1BKFA 4JFLA 1JNSA 5D75A 4ITZA 2XP9A 1YW5A 2XP5A 1FKFA 1ZCNA 3UQIA 2KI3A 3NTPA 2ZR5A 3ODKA 1W26A 2PV2A 4ODOA 1N1AA 3CGMA 5BXJA 4LAYA 2MLXA 3PRBA 4TX0A 4GGQA 4MGVA 4DZ2A 5B8IC 4ODQA 2RURA 5HWCA 2PV1A 4DRPA 1HXVA 4LAXA 4DRHA 1KT0A 3KAGA 1FKHA 3JYJA 2F21A 1J6YA 3CGNA 3IKGA 4G2PA 1JNTA 4DROA 2M1IA 1FKIA 4LAVA 2ZQSA 4IQ2A 3UI5A 1J4IA 1FKGA 4BF8A 2RUCA 2KGJA 4QT2A 4DH0A 5HW6A 2DG9A 4U86A 4DRIA 2KO7A 2M08A 3O5IA
chains in the Genus database with same CATH superfamily
3EY6A 4HBEA 2A3CA 3B8SA 1EDQA 1HKIA 5DEZA 3KACA 3TC5A 2DT0A 2RUQA 2QF8A 1QPFA 4NZCA 3H9RB 3JXVA 1FFQA 3B7XA 4TW7A 3WH0A 1GRJA 2RQSA 2ZQUA 4ZPVR 3O5EA 3AS2A 4IPXA 4WKFA 2DG3A 4QZVB 1R9HA 1W1TA 4NNRA 3RGCA 1T11A 4W9OA 2LKNA 4FAPA 2XP3A 2D9FA 3KABA 1PINA 3G6MA 1ITXA 5HT1A 3B9DA 2DSUA 1D2KA 4MAVA 2JZVA 3ARYA 2KE0A 3CZ8A 1F8AB 4MNKA 4MPKA 3UQAA 4MSPA 1ROUA 5GPGA 1LQ0A 3RFWA 3FXYA 1XRVA 1H0GA 1QZ2A 2ZR4A 3CHDA 3GPKA 1ZBKA 2OLHA 5GQBA 3WD1A 4JFJA 1FKRA 1D7JA 1FD9A 3ARQA 1YATA 2RSEA 3KAFA 4Z2HA 1GPFA 1FKSA 4ZPWR 2OFNA 3O5GA 1ZBCA 2XP6A 3CH9A 1OGGA 5D75A 2XP5A 3UQIA 3NTPA 2ZR5A 4HARA 3PRBA 3WD4A 3AROA 2PV1A 3OA5A 4DRPA 4DWSD 3RM4A 1KT0A 2FDMA 3ARZA 3IKGA 5HUAA 4BF8A 3BXWA 2RUCA 4QT2A 2MLXA 1NWUA 5DIUA 1Q1CA 3PRAA 2P4VA 4FN2A 4DRQA 1E6NA 2FAPA 1LJYA 2PV3A 1U79A 3OOBA 4DWSC 4WKAA 4DZ3A 2EULA 5DO2A 4DT4A 4KQZA 4Z2JA 2Y78A 3ARPA 2MLZA 5HTGA 2G41A 3GTYX 1EYMA 2A3EA 4G50A 4JFIA 3KAHA 2N87A 1WNOA 4J4OA 2KR7A 5DITA 3ARSA 1J4HA 4HBOA 4IT4A 5DIVA 2DSVA 2KFWA 4Z2LA 1GUVA 2XPBA 3UF8A 4LGXA 5JH8A 1W9PA 4L72B 1Q6HA 3IKDA 1BL4A 3RM8A 1XHGA 1E15A 4P8UA 4XAKA 4URIA 4LAWA 2MLYA 4MNJA 3WKZA 1NH6A 3O5JA 1B6CA 1W9VA 1NWTA 2XP8A 3O5RA 1ZU8A 1SR0A 4JFMA 5J6EA 3KAIA 3UI4A 2MPHA 3CHCA 1NSGA 3PR9A 1CTNA 1E44A 2ESCA 4DRKA 5DF0A 1D7IA 3WL1A 4U86A 4Q22A 4S3KA 2DT3A 4WKHA 1F40A 4IQCA 2RUDA 1BKFA 2WK2A 4ITZA 1YW5A 1HKJA 1ZCNA 2KI3A 2A3BA 1W26A 2PV2A 1N1AA 3CGMA 5BXJA 4TX0A 5B8IC 4AY1A 5HWCA 1HXVA 4ML4A 4DRHA 3JYJA 3CGNA 1JNDA 4DROA 1JNTA 3B9AA 2M1IA 1FKIA 3ALGA 2ZQSA 2KGJA 4DH0A 1IX5A 3AS1A 4IT6A 4Q7NA 2DG9A 4DRIA 2M08A 1LG1A 2PPPA 3UQBA 3RMEA 1TCOC 4TNSA 3WD0A 1WB0A 4JYSA 1FKLA 3O5PA 2XP7A 1H0IA 4ODNA 1K9TA 3NI6A 4U85A 3ARTA 4O2TA 3VAWA 1L1PA 1FKTA 2PPOA 1ROTA 3KZ7A 1GOIA 4N19A 1ZK6A 2O92A 3IHZA 3O5OA 3EIPA 4ODMA 3UI6A 2G8ZA 2F23A 4ODKA 1O6IA 3PA7A 3TCZA 2FKEA 3MDYB 1FAPA 1X6NA 2YBUA 2VCDA 4DRNA 1FKKA 1HKMA 2WLZA 4DIPA 4QT3A 3PRDA 3W4RA 4TW8A 1UR8A 3ARXA 4L3NA 4U84A 2Q5AA 1Q6UA 4DWSA 5HW8A 1FJDA 4ZPTR 1LG2A 4QIBA 4DRJA 5HWBA 2UZ5A 3GU0A 1FKDA 2PPNA 1SYTA 2DSWA 2L2SA 1EQ3A 1FKBA 1E6PA 1NMVA 2F2DA 3I6CA 2DSZA 3WD2A 4DRMA 3O5FA 1J4RA 2ZQTA 2B5UB 3B9EA 2MF9A 1OWQA 2XP4A 2M2AA 3NRKA 2DG4A 4ODLA 1C9HA 3JYMA 2LPVA 4S3JA 1UR9A 3KCEA 3O5LA 3ALFA 2F4EA 3WQWA 4ODPA 5I98A 2LGOA 3QOKA 5HKGA 2MNTA 1QPLA 2ETNA 3O5KA 1NMWA 2DT2A 4P8WA 1JNEA 2XP9A 3FY1A 4KR0B 4MTVA 4LAYA 3WQVA 4DZ2A 4GGQA 4MGVA 4ODQA 1FFRA 4MNMA 4LAXA 3KAGA 1FKHA 4UDMA 2F21A 3ARUA 4MNLA 3AQUA 4G2PA 3CHEA 4LAVA 4PTMA 4IQ2A 3UI5A 1W1YA 3BMBA 4WJXA 2K8IA 1A7XA 1KT1A 1D6OA 2IF4A 3O5QA 2LJ4A 1W1PA 3AS0A 4NSBA 4WK9A 1LL7A 1W9UA 3WL0A 1TFVA 2AWGA 5HBFA 1D7HA 4WIWA 3IK8A 1Y0OA 1VF8A 2YBTA 1EIBA 3TDBA 2VN1A 3ARRA 4J4NA 3G6LA 3WD3A 1E9LA 4W9PA 1HKKA 3LUOA 2ITKA 3RM9A 2DPEA 1ZL1A 2B31A 2WLYA 2XPAA 4C02B 1ZBVA 3O5DA 5HW7A 4W9QA 1E6ZA 1RD6A 1ZBWA 3AS3A 4TW6A 1OGBA 3KADA 5GPRA 1PBKA 2PBCA 3ARVA 3O5MA 2PN0A 1FKJA 4P8VA 1ZB5A 2O9OA 2ZQVA 4DWSB 4TYOA 2DT1A 1M5YA 1LL6A 2PI6A 1NWSA 1Q6IA 4P8XA 2ZR6A 2IUZA 1P5QA 4Z2IA 4Z2KA 3FAPA 4GIVA 4JFKA 4ODRA 4R0XA 1HJXA 4Z2GA 1JVWA 1EHNA 2AOSA 1WAWA 3WIJA 4JFLA 1JCHB 1FKFA 4ZS6A 1E6RA 1KFWA 3ODKA 4ODOA 1HJVA 2RURA 1LL4A 4R5EA 1W1VA 1NWRA 4W5UA 1X6LA 3CHFA 1HJWA 1JNSA 2A3AA 3ARWA 1J4IA 1FKGA 5HW6A 2WM0A 1J6YA 2KO7A 3O5IA
chains in the Genus database with same CATH topology
3EY6A 4HBEA 2A3CA 3B8SA 1EDQA 1HKIA 5DEZA 3KACA 3TC5A 2DT0A 2RUQA 2QF8A 1QPFA 4NZCA 3H9RB 3JXVA 1FFQA 3B7XA 4TW7A 3WH0A 2RQSA 2ZQUA 4ZPVR 3O5EA 3AS2A 4IPXA 4WKFA 2DG3A 4QZVB 1R9HA 1W1TA 4NNRA 3RGCA 1T11A 4W9OA 2LKNA 4FAPA 2XP3A 2D9FA 3KABA 1PINA 3G6MA 1ITXA 5HT1A 3B9DA 2DSUA 1D2KA 4MAVA 2JZVA 3ARYA 2KE0A 3CZ8A 1F8AB 4MNKA 4MPKA 3UQAA 4MSPA 1ROUA 5GPGA 1LQ0A 3RFWA 3FXYA 1XRVA 1H0GA 1QZ2A 2ZR4A 3CHDA 3GPKA 1ZBKA 2OLHA 5GQBA 3WD1A 4JFJA 1FKRA 1D7JA 1FD9A 3ARQA 1YATA 2RSEA 3KAFA 4Z2HA 1GPFA 1FKSA 4ZPWR 2OFNA 3O5GA 1ZBCA 2XP6A 3CH9A 1OGGA 5D75A 2XP5A 3UQIA 3NTPA 2ZR5A 4HARA 3PRBA 3WD4A 3AROA 2PV1A 3OA5A 4DRPA 4DWSD 3RM4A 1KT0A 2FDMA 3ARZA 3IKGA 5HUAA 4BF8A 3BXWA 2RUCA 4QT2A 2MLXA 1NWUA 5DIUA 1Q1CA 3PRAA 4FN2A 4DRQA 1E6NA 2FAPA 1LJYA 2PV3A 1U79A 3OOBA 4DWSC 4WKAA 4DZ3A 5DO2A 4DT4A 4KQZA 4Z2JA 2Y78A 3ARPA 2MLZA 5HTGA 2G41A 1EYMA 2A3EA 4G50A 4JFIA 3KAHA 2N87A 1WNOA 4J4OA 2KR7A 5DITA 3ARSA 1J4HA 4HBOA 4IT4A 5DIVA 2DSVA 2KFWA 4Z2LA 1GUVA 2XPBA 3UF8A 4LGXA 5JH8A 1W9PA 4L72B 1Q6HA 3IKDA 1BL4A 3RM8A 1XHGA 1E15A 4P8UA 4XAKA 4URIA 4LAWA 2MLYA 4MNJA 3WKZA 1NH6A 3O5JA 1B6CA 1W9VA 1NWTA 2XP8A 3O5RA 1ZU8A 1SR0A 4JFMA 5J6EA 3KAIA 3UI4A 2MPHA 3CHCA 1NSGA 3PR9A 1CTNA 2ESCA 4DRKA 5DF0A 1D7IA 3WL1A 4U86A 4Q22A 4S3KA 2DT3A 4WKHA 1F40A 4IQCA 2RUDA 1BKFA 2WK2A 4ITZA 1YW5A 1HKJA 1ZCNA 2KI3A 2A3BA 1W26A 2PV2A 1N1AA 3CGMA 5BXJA 4TX0A 5B8IC 4AY1A 5HWCA 1HXVA 4ML4A 4DRHA 3JYJA 3CGNA 1JNDA 4DROA 1JNTA 3B9AA 2M1IA 1FKIA 3ALGA 2ZQSA 2KGJA 4DH0A 1IX5A 3AS1A 4IT6A 4Q7NA 2DG9A 4DRIA 2M08A 1LG1A 2PPPA 3UQBA 3RMEA 1TCOC 4TNSA 3WD0A 1WB0A 4JYSA 1FKLA 3O5PA 2XP7A 1H0IA 4ODNA 1K9TA 3NI6A 4U85A 3ARTA 4O2TA 3VAWA 1L1PA 1FKTA 2PPOA 1ROTA 3KZ7A 1GOIA 4N19A 1ZK6A 2O92A 3IHZA 3O5OA 4ODMA 3UI6A 2G8ZA 4ODKA 1O6IA 3PA7A 3TCZA 2FKEA 3MDYB 1FAPA 1X6NA 2YBUA 2VCDA 4DRNA 1FKKA 1HKMA 2WLZA 4DIPA 4QT3A 3PRDA 3W4RA 4TW8A 1UR8A 3ARXA 4L3NA 4U84A 2Q5AA 1Q6UA 4DWSA 5HW8A 1FJDA 4ZPTR 1LG2A 4QIBA 4DRJA 5HWBA 2UZ5A 1FKDA 2PPNA 1SYTA 2DSWA 2L2SA 1EQ3A 1FKBA 1E6PA 1NMVA 2F2DA 3I6CA 2DSZA 3WD2A 4DRMA 3O5FA 1J4RA 2ZQTA 3B9EA 2MF9A 1OWQA 2XP4A 2M2AA 3NRKA 2DG4A 4ODLA 1C9HA 3JYMA 2LPVA 4S3JA 1UR9A 3KCEA 3O5LA 3ALFA 2F4EA 3WQWA 4ODPA 5I98A 2LGOA 3QOKA 5HKGA 2MNTA 1QPLA 3O5KA 1NMWA 2DT2A 4P8WA 1JNEA 2XP9A 3FY1A 4KR0B 4MTVA 4LAYA 3WQVA 4DZ2A 4GGQA 4MGVA 4ODQA 1FFRA 4MNMA 4LAXA 3KAGA 1FKHA 2F21A 3ARUA 4MNLA 3AQUA 4G2PA 3CHEA 4LAVA 4PTMA 4IQ2A 3UI5A 1W1YA 4WJXA 2K8IA 1A7XA 1KT1A 1D6OA 2IF4A 3O5QA 2LJ4A 1W1PA 3AS0A 4NSBA 4WK9A 1LL7A 1W9UA 3WL0A 1TFVA 2AWGA 5HBFA 1D7HA 4WIWA 3IK8A 1Y0OA 1VF8A 2YBTA 1EIBA 3TDBA 2VN1A 3ARRA 4J4NA 3G6LA 3WD3A 1E9LA 4W9PA 1HKKA 3LUOA 2ITKA 3RM9A 2DPEA 1ZL1A 2B31A 2WLYA 2XPAA 4C02B 1ZBVA 3O5DA 5HW7A 4W9QA 1E6ZA 1RD6A 1ZBWA 3AS3A 4TW6A 1OGBA 3KADA 5GPRA 1PBKA 2PBCA 3ARVA 3O5MA 1FKJA 4P8VA 1ZB5A 2O9OA 2ZQVA 4DWSB 4TYOA 2DT1A 1M5YA 1LL6A 2PI6A 1NWSA 1Q6IA 4P8XA 2ZR6A 2IUZA 1P5QA 4Z2IA 4Z2KA 3FAPA 4GIVA 4JFKA 4ODRA 4R0XA 1HJXA 4Z2GA 1JVWA 1EHNA 2AOSA 1WAWA 3WIJA 4JFLA 1FKFA 4ZS6A 1E6RA 1KFWA 3ODKA 4ODOA 1HJVA 2RURA 1LL4A 4R5EA 1W1VA 1NWRA 4W5UA 1X6LA 3CHFA 1HJWA 1JNSA 2A3AA 3ARWA 1J4IA 1FKGA 5HW6A 2WM0A 1J6YA 2KO7A 3O5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PPP A;  3EY6 A;  5DIU A;  3UQB A;  1Q1C A;  2K8I A;  1A7X A;  1KT1 A;  4FN2 A;  1TCO C;  1D6O A;  2FAP A;  2PV3 A;  4TNS A;  4DRQ A;  3KAC A;  2IF4 A;  4JYS A;  1FKL A;  1U79 A;  3O5Q A;  2LJ4 A;  3O5P A;  3TC5 A;  2XP7 A;  3OOB A;  2RUQ A;  4ODN A;  1QPF A;  3H9R B;  3NI6 A;  4DZ3 A;  3JXV A;  4U85 A;  4O2T A;  3VAW A;  4DT4 A;  1L1P A;  2AWG A;  1FKT A;  3B7X A;  2PPO A;  4TW7 A;  2Y78 A;  1ROT A;  3WH0 A;  2RQS A;  1D7H A;  2MLZ A;  2ZQU A;  3KZ7 A;  3O5E A;  5HTG A;  4N19 A;  1EYM A;  1ZK6 A;  3IHZ A;  3IK8 A;  3O5O A;  1Y0O A;  4G50 A;  4JFI A;  4IPX A;  4ODM A;  3KAH A;  3UI6 A;  4ODK A;  3TDB A;  5HUA A;  2DG3 A;  3PA7 A;  2N87 A;  2VN1 A;  1R9H A;  4J4O A;  2KR7 A;  4NNR A;  5DIT A;  4J4N A;  3TCZ A;  2FKE A;  3MDY B;  1FAP A;  1J4H A;  3RGC A;  4DRN A;  1T11 A;  2VCD A;  1FKK A;  4DIP A;  5DIV A;  4W9O A;  4QT3 A;  4W9P A;  2LKN A;  2KFW A;  3LUO A;  4FAP A;  3PRD A;  2XP3 A;  2XPB A;  2D9F A;  2ITK A;  3KAB A;  4TW8 A;  3UF8 A;  4U84 A;  2Q5A A;  2XPA A;  1PIN A;  1Q6H A;  3IKD A;  4C02 B;  1Q6U A;  5HW8 A;  1BL4 A;  3O5D A;  1FJD A;  5HT1 A;  5HW7 A;  4W9Q A;  4LAW A;  4QIB A;  3KAD A;  4TW6 A;  4DRJ A;  2MLY A;  5HWB A;  2UZ5 A;  2JZV A;  1FKD A;  2KE0 A;  3O5J A;  2PPN A;  1B6C A;  1PBK A;  2PBC A;  3O5M A;  1F8A B;  3UQA A;  4MSP A;  1ROU A;  1FKJ A;  5GPG A;  2L2S A;  3RFW A;  1EQ3 A;  1FKB A;  2ZQV A;  1NMV A;  2F2D A;  3I6C A;  4TYO A;  2XP8 A;  3O5R A;  1QZ2 A;  2ZR4 A;  4JFM A;  4DRM A;  5J6E A;  3KAI A;  1J4R A;  3O5F A;  3UI4 A;  2ZQT A;  1M5Y A;  3GPK A;  2MF9 A;  2MPH A;  1NSG A;  2XP4 A;  2M2A A;  3NRK A;  2DG4 A;  4JFJ A;  4ODL A;  1C9H A;  1Q6I A;  3JYM A;  2ZR6 A;  1FKR A;  1D7J A;  2LPV A;  4DRK A;  1FD9 A;  1P5Q A;  1YAT A;  1D7I A;  3FAP A;  2RSE A;  4GIV A;  4JFK A;  3KAF A;  4ODR A;  3KCE A;  4R0X A;  3O5L A;  1FKS A;  2F4E A;  2OFN A;  4ODP A;  5I98 A;  2LGO A;  1JVW A;  3O5G A;  2XP6 A;  5HKG A;  2MNT A;  1QPL A;  1F40 A;  3O5K A;  1NMW A;  4IQC A;  2RUD A;  1BKF A;  4JFL A;  1JNS A;  5D75 A;  4ITZ A;  2XP9 A;  1YW5 A;  2XP5 A;  1FKF A;  1ZCN A;  3UQI A;  2KI3 A;  3NTP A;  2ZR5 A;  3ODK A;  1W26 A;  2PV2 A;  4ODO A;  1N1A A;  3CGM A;  5BXJ A;  4LAY A;  2MLX A;  3PRB A;  4TX0 A;  4GGQ A;  4MGV A;  4DZ2 A;  5B8I C;  4ODQ A;  2RUR A;  5HWC A;  2PV1 A;  4DRP A;  1HXV A;  4LAX A;  4DRH A;  1KT0 A;  3KAG A;  1FKH A;  3JYJ A;  2F21 A;  1J6Y A;  3CGN A;  3IKG A;  4G2P A;  1JNT A;  4DRO A;  2M1I A;  1FKI A;  4LAV A;  2ZQS A;  4IQ2 A;  3UI5 A;  1J4I A;  1FKG A;  4BF8 A;  2RUC A;  2KGJ A;  4QT2 A;  4DH0 A;  5HW6 A;  2DG9 A;  4U86 A;  4DRI A;  2KO7 A;  2M08 A;  3O5I A; 
#chains in the Genus database with same CATH topology
 3EY6 A;  4HBE A;  2A3C A;  3B8S A;  1EDQ A;  1HKI A;  5DEZ A;  3KAC A;  3TC5 A;  2DT0 A;  2RUQ A;  2QF8 A;  1QPF A;  4NZC A;  3H9R B;  3JXV A;  1FFQ A;  3B7X A;  4TW7 A;  3WH0 A;  1GRJ A;  2RQS A;  2ZQU A;  4ZPV R;  3O5E A;  3AS2 A;  4IPX A;  4WKF A;  2DG3 A;  4QZV B;  1R9H A;  1W1T A;  4NNR A;  3RGC A;  1T11 A;  4W9O A;  2LKN A;  4FAP A;  2XP3 A;  2D9F A;  3KAB A;  1PIN A;  3G6M A;  1ITX A;  5HT1 A;  3B9D A;  2DSU A;  1D2K A;  4MAV A;  2JZV A;  3ARY A;  2KE0 A;  3CZ8 A;  1F8A B;  4MNK A;  4MPK A;  3UQA A;  4MSP A;  1ROU A;  5GPG A;  1LQ0 A;  3RFW A;  3FXY A;  1XRV A;  1H0G A;  1QZ2 A;  2ZR4 A;  3CHD A;  3GPK A;  1ZBK A;  2OLH A;  5GQB A;  3WD1 A;  4JFJ A;  1FKR A;  1D7J A;  1FD9 A;  3ARQ A;  1YAT A;  2RSE A;  3KAF A;  4Z2H A;  1GPF A;  1FKS A;  4ZPW R;  2OFN A;  3O5G A;  1ZBC A;  2XP6 A;  3CH9 A;  1OGG A;  5D75 A;  2XP5 A;  3UQI A;  3NTP A;  2ZR5 A;  4HAR A;  3PRB A;  3WD4 A;  3ARO A;  2PV1 A;  3OA5 A;  4DRP A;  4DWS D;  3RM4 A;  1KT0 A;  2FDM A;  3ARZ A;  3IKG A;  5HUA A;  4BF8 A;  3BXW A;  2RUC A;  4QT2 A;  2MLX A;  1NWU A;  5DIU A;  1Q1C A;  3PRA A;  2P4V A;  4FN2 A;  4DRQ A;  1E6N A;  2FAP A;  1LJY A;  2PV3 A;  1U79 A;  3OOB A;  4DWS C;  4WKA A;  4DZ3 A;  2EUL A;  5DO2 A;  4DT4 A;  4KQZ A;  4Z2J A;  2Y78 A;  3ARP A;  2MLZ A;  5HTG A;  2G41 A;  3GTY X;  1EYM A;  2A3E A;  4G50 A;  4JFI A;  3KAH A;  2N87 A;  1WNO A;  4J4O A;  2KR7 A;  5DIT A;  3ARS A;  1J4H A;  4HBO A;  4IT4 A;  5DIV A;  2DSV A;  2KFW A;  4Z2L A;  1GUV A;  2XPB A;  3UF8 A;  4LGX A;  5JH8 A;  1W9P A;  4L72 B;  1Q6H A;  3IKD A;  1BL4 A;  3RM8 A;  1XHG A;  1E15 A;  4P8U A;  4XAK A;  4URI A;  4LAW A;  2MLY A;  4MNJ A;  3WKZ A;  1NH6 A;  3O5J A;  1B6C A;  1W9V A;  1NWT A;  2XP8 A;  3O5R A;  1ZU8 A;  1SR0 A;  4JFM A;  5J6E A;  3KAI A;  3UI4 A;  2MPH A;  3CHC A;  1NSG A;  3PR9 A;  1CTN A;  1E44 A;  2ESC A;  4DRK A;  5DF0 A;  1D7I A;  3WL1 A;  4U86 A;  4Q22 A;  4S3K A;  2DT3 A;  4WKH A;  1F40 A;  4IQC A;  2RUD A;  1BKF A;  2WK2 A;  4ITZ A;  1YW5 A;  1HKJ A;  1ZCN A;  2KI3 A;  2A3B A;  1W26 A;  2PV2 A;  1N1A A;  3CGM A;  5BXJ A;  4TX0 A;  5B8I C;  4AY1 A;  5HWC A;  1HXV A;  4ML4 A;  4DRH A;  3JYJ A;  3CGN A;  1JND A;  4DRO A;  1JNT A;  3B9A A;  2M1I A;  1FKI A;  3ALG A;  2ZQS A;  2KGJ A;  4DH0 A;  1IX5 A;  3AS1 A;  4IT6 A;  4Q7N A;  2DG9 A;  4DRI A;  2M08 A;  1LG1 A;  2PPP A;  3UQB A;  3RME A;  1TCO C;  4TNS A;  3WD0 A;  1WB0 A;  4JYS A;  1FKL A;  3O5P A;  2XP7 A;  1H0I A;  4ODN A;  1K9T A;  3NI6 A;  4U85 A;  3ART A;  4O2T A;  3VAW A;  1L1P A;  1FKT A;  2PPO A;  1ROT A;  3KZ7 A;  1GOI A;  4N19 A;  1ZK6 A;  2O92 A;  3IHZ A;  3O5O A;  3EIP A;  4ODM A;  3UI6 A;  2G8Z A;  2F23 A;  4ODK A;  1O6I A;  3PA7 A;  3TCZ A;  2FKE A;  3MDY B;  1FAP A;  1X6N A;  2YBU A;  2VCD A;  4DRN A;  1FKK A;  1HKM A;  2WLZ A;  4DIP A;  4QT3 A;  3PRD A;  3W4R A;  4TW8 A;  1UR8 A;  3ARX A;  4L3N A;  4U84 A;  2Q5A A;  1Q6U A;  4DWS A;  5HW8 A;  1FJD A;  4ZPT R;  1LG2 A;  4QIB A;  4DRJ A;  5HWB A;  2UZ5 A;  3GU0 A;  1FKD A;  2PPN A;  1SYT A;  2DSW A;  2L2S A;  1EQ3 A;  1FKB A;  1E6P A;  1NMV A;  2F2D A;  3I6C A;  2DSZ A;  3WD2 A;  4DRM A;  3O5F A;  1J4R A;  2ZQT A;  2B5U B;  3B9E A;  2MF9 A;  1OWQ A;  2XP4 A;  2M2A A;  3NRK A;  2DG4 A;  4ODL A;  1C9H A;  3JYM A;  2LPV A;  4S3J A;  1UR9 A;  3KCE A;  3O5L A;  3ALF A;  2F4E A;  3WQW A;  4ODP A;  5I98 A;  2LGO A;  3QOK A;  5HKG A;  2MNT A;  1QPL A;  2ETN A;  3O5K A;  1NMW A;  2DT2 A;  4P8W A;  1JNE A;  2XP9 A;  3FY1 A;  4KR0 B;  4MTV A;  4LAY A;  3WQV A;  4DZ2 A;  4GGQ A;  4MGV A;  4ODQ A;  1FFR A;  4MNM A;  4LAX A;  3KAG A;  1FKH A;  4UDM A;  2F21 A;  3ARU A;  4MNL A;  3AQU A;  4G2P A;  3CHE A;  4LAV A;  4PTM A;  4IQ2 A;  3UI5 A;  1W1Y A;  3BMB A;  4WJX A;  2K8I A;  1A7X A;  1KT1 A;  1D6O A;  2IF4 A;  3O5Q A;  2LJ4 A;  1W1P A;  3AS0 A;  4NSB A;  4WK9 A;  1LL7 A;  1W9U A;  3WL0 A;  1TFV A;  2AWG A;  5HBF A;  1D7H A;  4WIW A;  3IK8 A;  1Y0O A;  1VF8 A;  2YBT A;  1EIB A;  3TDB A;  2VN1 A;  3ARR A;  4J4N A;  3G6L A;  3WD3 A;  1E9L A;  4W9P A;  1HKK A;  3LUO A;  2ITK A;  3RM9 A;  2DPE A;  1ZL1 A;  2B31 A;  2WLY A;  2XPA A;  4C02 B;  1ZBV A;  3O5D A;  5HW7 A;  4W9Q A;  1E6Z A;  1RD6 A;  1ZBW A;  3AS3 A;  4TW6 A;  1OGB A;  3KAD A;  5GPR A;  1PBK A;  2PBC A;  3ARV A;  3O5M A;  2PN0 A;  1FKJ A;  4P8V A;  1ZB5 A;  2O9O A;  2ZQV A;  4DWS B;  4TYO A;  2DT1 A;  1M5Y A;  1LL6 A;  2PI6 A;  1NWS A;  1Q6I A;  4P8X A;  2ZR6 A;  2IUZ A;  1P5Q A;  4Z2I A;  4Z2K A;  3FAP A;  4GIV A;  4JFK A;  4ODR A;  4R0X A;  1HJX A;  4Z2G A;  1JVW A;  1EHN A;  2AOS A;  1WAW A;  3WIJ A;  4JFL A;  1JCH B;  1FKF A;  4ZS6 A;  1E6R A;  1KFW A;  3ODK A;  4ODO A;  1HJV A;  2RUR A;  1LL4 A;  4R5E A;  1W1V A;  1NWR A;  4W5U A;  1X6L A;  3CHF A;  1HJW A;  1JNS A;  2A3A A;  3ARW A;  1J4I A;  1FKG A;  5HW6 A;  2WM0 A;  1J6Y A;  2KO7 A;  3O5I A; 
#chains in the Genus database with same CATH homology
 3EY6 A;  4HBE A;  2A3C A;  3B8S A;  1EDQ A;  1HKI A;  5DEZ A;  3KAC A;  3TC5 A;  2DT0 A;  2RUQ A;  2QF8 A;  1QPF A;  4NZC A;  3H9R B;  3JXV A;  1FFQ A;  3B7X A;  4TW7 A;  3WH0 A;  2RQS A;  2ZQU A;  4ZPV R;  3O5E A;  3AS2 A;  4IPX A;  4WKF A;  2DG3 A;  4QZV B;  1R9H A;  1W1T A;  4NNR A;  3RGC A;  1T11 A;  4W9O A;  2LKN A;  4FAP A;  2XP3 A;  2D9F A;  3KAB A;  1PIN A;  3G6M A;  1ITX A;  5HT1 A;  3B9D A;  2DSU A;  1D2K A;  4MAV A;  2JZV A;  3ARY A;  2KE0 A;  3CZ8 A;  1F8A B;  4MNK A;  4MPK A;  3UQA A;  4MSP A;  1ROU A;  5GPG A;  1LQ0 A;  3RFW A;  3FXY A;  1XRV A;  1H0G A;  1QZ2 A;  2ZR4 A;  3CHD A;  3GPK A;  1ZBK A;  2OLH A;  5GQB A;  3WD1 A;  4JFJ A;  1FKR A;  1D7J A;  1FD9 A;  3ARQ A;  1YAT A;  2RSE A;  3KAF A;  4Z2H A;  1GPF A;  1FKS A;  4ZPW R;  2OFN A;  3O5G A;  1ZBC A;  2XP6 A;  3CH9 A;  1OGG A;  5D75 A;  2XP5 A;  3UQI A;  3NTP A;  2ZR5 A;  4HAR A;  3PRB A;  3WD4 A;  3ARO A;  2PV1 A;  3OA5 A;  4DRP A;  4DWS D;  3RM4 A;  1KT0 A;  2FDM A;  3ARZ A;  3IKG A;  5HUA A;  4BF8 A;  3BXW A;  2RUC A;  4QT2 A;  2MLX A;  1NWU A;  5DIU A;  1Q1C A;  3PRA A;  4FN2 A;  4DRQ A;  1E6N A;  2FAP A;  1LJY A;  2PV3 A;  1U79 A;  3OOB A;  4DWS C;  4WKA A;  4DZ3 A;  5DO2 A;  4DT4 A;  4KQZ A;  4Z2J A;  2Y78 A;  3ARP A;  2MLZ A;  5HTG A;  2G41 A;  1EYM A;  2A3E A;  4G50 A;  4JFI A;  3KAH A;  2N87 A;  1WNO A;  4J4O A;  2KR7 A;  5DIT A;  3ARS A;  1J4H A;  4HBO A;  4IT4 A;  5DIV A;  2DSV A;  2KFW A;  4Z2L A;  1GUV A;  2XPB A;  3UF8 A;  4LGX A;  5JH8 A;  1W9P A;  4L72 B;  1Q6H A;  3IKD A;  1BL4 A;  3RM8 A;  1XHG A;  1E15 A;  4P8U A;  4XAK A;  4URI A;  4LAW A;  2MLY A;  4MNJ A;  3WKZ A;  1NH6 A;  3O5J A;  1B6C A;  1W9V A;  1NWT A;  2XP8 A;  3O5R A;  1ZU8 A;  1SR0 A;  4JFM A;  5J6E A;  3KAI A;  3UI4 A;  2MPH A;  3CHC A;  1NSG A;  3PR9 A;  1CTN A;  2ESC A;  4DRK A;  5DF0 A;  1D7I A;  3WL1 A;  4U86 A;  4Q22 A;  4S3K A;  2DT3 A;  4WKH A;  1F40 A;  4IQC A;  2RUD A;  1BKF A;  2WK2 A;  4ITZ A;  1YW5 A;  1HKJ A;  1ZCN A;  2KI3 A;  2A3B A;  1W26 A;  2PV2 A;  1N1A A;  3CGM A;  5BXJ A;  4TX0 A;  5B8I C;  4AY1 A;  5HWC A;  1HXV A;  4ML4 A;  4DRH A;  3JYJ A;  3CGN A;  1JND A;  4DRO A;  1JNT A;  3B9A A;  2M1I A;  1FKI A;  3ALG A;  2ZQS A;  2KGJ A;  4DH0 A;  1IX5 A;  3AS1 A;  4IT6 A;  4Q7N A;  2DG9 A;  4DRI A;  2M08 A;  1LG1 A;  2PPP A;  3UQB A;  3RME A;  1TCO C;  4TNS A;  3WD0 A;  1WB0 A;  4JYS A;  1FKL A;  3O5P A;  2XP7 A;  1H0I A;  4ODN A;  1K9T A;  3NI6 A;  4U85 A;  3ART A;  4O2T A;  3VAW A;  1L1P A;  1FKT A;  2PPO A;  1ROT A;  3KZ7 A;  1GOI A;  4N19 A;  1ZK6 A;  2O92 A;  3IHZ A;  3O5O A;  4ODM A;  3UI6 A;  2G8Z A;  4ODK A;  1O6I A;  3PA7 A;  3TCZ A;  2FKE A;  3MDY B;  1FAP A;  1X6N A;  2YBU A;  2VCD A;  4DRN A;  1FKK A;  1HKM A;  2WLZ A;  4DIP A;  4QT3 A;  3PRD A;  3W4R A;  4TW8 A;  1UR8 A;  3ARX A;  4L3N A;  4U84 A;  2Q5A A;  1Q6U A;  4DWS A;  5HW8 A;  1FJD A;  4ZPT R;  1LG2 A;  4QIB A;  4DRJ A;  5HWB A;  2UZ5 A;  1FKD A;  2PPN A;  1SYT A;  2DSW A;  2L2S A;  1EQ3 A;  1FKB A;  1E6P A;  1NMV A;  2F2D A;  3I6C A;  2DSZ A;  3WD2 A;  4DRM A;  3O5F A;  1J4R A;  2ZQT A;  3B9E A;  2MF9 A;  1OWQ A;  2XP4 A;  2M2A A;  3NRK A;  2DG4 A;  4ODL A;  1C9H A;  3JYM A;  2LPV A;  4S3J A;  1UR9 A;  3KCE A;  3O5L A;  3ALF A;  2F4E A;  3WQW A;  4ODP A;  5I98 A;  2LGO A;  3QOK A;  5HKG A;  2MNT A;  1QPL A;  3O5K A;  1NMW A;  2DT2 A;  4P8W A;  1JNE A;  2XP9 A;  3FY1 A;  4KR0 B;  4MTV A;  4LAY A;  3WQV A;  4DZ2 A;  4GGQ A;  4MGV A;  4ODQ A;  1FFR A;  4MNM A;  4LAX A;  3KAG A;  1FKH A;  2F21 A;  3ARU A;  4MNL A;  3AQU A;  4G2P A;  3CHE A;  4LAV A;  4PTM A;  4IQ2 A;  3UI5 A;  1W1Y A;  4WJX A;  2K8I A;  1A7X A;  1KT1 A;  1D6O A;  2IF4 A;  3O5Q A;  2LJ4 A;  1W1P A;  3AS0 A;  4NSB A;  4WK9 A;  1LL7 A;  1W9U A;  3WL0 A;  1TFV A;  2AWG A;  5HBF A;  1D7H A;  4WIW A;  3IK8 A;  1Y0O A;  1VF8 A;  2YBT A;  1EIB A;  3TDB A;  2VN1 A;  3ARR A;  4J4N A;  3G6L A;  3WD3 A;  1E9L A;  4W9P A;  1HKK A;  3LUO A;  2ITK A;  3RM9 A;  2DPE A;  1ZL1 A;  2B31 A;  2WLY A;  2XPA A;  4C02 B;  1ZBV A;  3O5D A;  5HW7 A;  4W9Q A;  1E6Z A;  1RD6 A;  1ZBW A;  3AS3 A;  4TW6 A;  1OGB A;  3KAD A;  5GPR A;  1PBK A;  2PBC A;  3ARV A;  3O5M A;  1FKJ A;  4P8V A;  1ZB5 A;  2O9O A;  2ZQV A;  4DWS B;  4TYO A;  2DT1 A;  1M5Y A;  1LL6 A;  2PI6 A;  1NWS A;  1Q6I A;  4P8X A;  2ZR6 A;  2IUZ A;  1P5Q A;  4Z2I A;  4Z2K A;  3FAP A;  4GIV A;  4JFK A;  4ODR A;  4R0X A;  1HJX A;  4Z2G A;  1JVW A;  1EHN A;  2AOS A;  1WAW A;  3WIJ A;  4JFL A;  1FKF A;  4ZS6 A;  1E6R A;  1KFW A;  3ODK A;  4ODO A;  1HJV A;  2RUR A;  1LL4 A;  4R5E A;  1W1V A;  1NWR A;  4W5U A;  1X6L A;  3CHF A;  1HJW A;  1JNS A;  2A3A A;  3ARW A;  1J4I A;  1FKG A;  5HW6 A;  2WM0 A;  1J6Y A;  2KO7 A;  3O5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...