3CGNA

Crystal structure of thermophilic slyd
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
151
structure length
151
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase
publication title Crystal Structure Determination and Functional Characterization of the Metallochaperone SlyD from Thermus thermophilus
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase
total genus 28
structure length 151
sequence length 151
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3cgnA00
1FKRA 3JXVA 2XP7A 2F2DA 3KZ7A 3O5MA 3TDBA 4DH0A 1Q6HA 2XP3A 2F21A 2RQSA 2ZQVA 4LAWA 1R9HA 3UQAA 2OFNA 2ZQSA 5B8IC 4TW7A 1QZ2A 4R0XA 2FAPA 1L1PA 3JYMA 4U84A 1FKTA 4TW6A 4DROA 4GIVA 2M08A 4JFIA 2D9FA 2RURA 2PV3A 1PINA 3KAFA 4DRHA 2RUDA 1F8AB 2F4EA 1F40A 3KABA 1J4IA 2MLXA 2PPNA 4ODQA 3H9RB 4W9QA 4W9PA 3RGCA 4DRMA 5BXJA 1P5QA 3IKGA 3UF8A 2ZR6A 3UQIA 4C02B 1YW5A 1HXVA 5HW8A 4ODPA 3WH0A 3KAGA 1JNTA 2PPPA 1B6CA 1T11A 2MPHA 5HW6A 1FKHA 1JVWA 4DRJA 4IQCA 2VN1A 1C9HA 2RSEA 3IK8A 1FD9A 1EQ3A 1J4HA 4QT3A 3KACA 2LJ4A 1TCOC 2XP4A 2M2AA 1FKBA 2RUCA 2DG4A 2L2SA 3PA7A 3NTPA 4MSPA 4DRIA 1ROUA 2ZQTA 1D7IA 1ZCNA 4U86A 4LAXA 4BF8A 3OOBA 4JFLA 3FAPA 4TX0A 4QT2A 1W26A 1FKJA 2LKNA 3I6CA 1EYMA 4GGQA 5HKGA 3O5EA 3TC5A 1ROTA 3NRKA 1FKDA 1Q6IA 2KE0A 3PRBA 4DIPA 1N1AA 1PBKA 3KCEA 3NI6A 5HTGA 2K8IA 3O5LA 3O5PA 2ZR4A 3PRDA 3O5FA 4JYSA 4MGVA 1D7JA 4G50A 3UI4A 3B7XA 3O5JA 4LAYA 5HUAA 2FKEA 3O5DA 3O5KA 1NSGA 4U85A 2XP9A 3CGNA 4ODKA 1U79A 2ZQUA 3O5QA 4JFKA 4IPXA 2XPBA 5DITA 5HW7A 2N87A 4NNRA 2KI3A 1FAPA 2AWGA 2PBCA 1M5YA 2IF4A 2Y78A 2ZR5A 4W9OA 3UI5A 3O5RA 3VAWA 4IQ2A 1BKFA 2LGOA 3O5OA 1NMWA 4O2TA 1FKLA 1Y0OA 1Q1CA 2XP6A 3GPKA 4TW8A 1D7HA 2MF9A 1BL4A 2DG3A 1A7XA 4JFJA 1J4RA 4ODOA 4DRKA 4JFMA 2MLZA 4FAPA 1FKSA 2XP8A 1Q6UA 1NMVA 2DG9A 2JZVA 2M1IA 3KADA 3LUOA 4TNSA 2KGJA 3ODKA 4ODLA 1KT0A 4DRNA 4DZ3A 3O5IA 5HWCA 1QPFA 2PPOA 1FJDA 3EY6A 4ITZA 1JNSA 3CGMA 3RFWA 2MLYA 1FKIA 1J6YA 5I98A 2RUQA 4DRQA 3IHZA 4ODMA 5J6EA 1FKFA 4TYOA 2XP5A 1YATA 1ZK6A 3UI6A 4FN2A 5GPGA 2PV1A 2KO7A 5HT1A 2ITKA 2LPVA 1D6OA 3O5GA 4J4NA 5DIVA 4QIBA 5DIUA 5HWBA 3MDYB 3KAIA 4ODNA 4J4OA 2KFWA 4G2PA 1QPLA 2MNTA 2PV2A 2VCDA 1FKGA 3TCZA 4DRPA 2KR7A 3UQBA 4DZ2A 2Q5AA 3JYJA 3IKDA 1FKKA 3KAHA 2XPAA 4LAVA 4N19A 2UZ5A 4ODRA 1KT1A 4DT4A 5D75A
chains in the Genus database with same CATH superfamily
4WK9A 1GRJA 5DEZA 2ZQVA 4LAWA 1K9TA 1R9HA 1E6NA 4DWSA 1LQ0A 2PI6A 3AS3A 4DROA 4P8VA 1WNOA 4URIA 1H0IA 1H0GA 1PINA 1W9VA 3KAFA 1E44A 5GPRA 3AQUA 5JH8A 3ARWA 3KABA 3OA5A 2PPNA 4W9PA 1P5QA 1E9LA 3IKGA 4ODPA 1JNTA 2PPPA 2MPHA 1FKHA 1JVWA 4IQCA 1C9HA 4HBEA 3WIJA 1TCOC 2WLZA 1FKBA 1ZL1A 4U86A 4BF8A 2B5UB 3I6CA 4GGQA 1O6IA 2LKNA 3O5EA 3NRKA 5HTGA 3ARQA 1PBKA 2DSZA 3CZ8A 1RD6A 2K8IA 3WD3A 2ETNA 4HBOA 3O5FA 4MGVA 3ALGA 3B7XA 4LAYA 5HUAA 2FKEA 3O5DA 3AS2A 4ODKA 2XPBA 1NWSA 4DWSC 1JCHB 1LL6A 1FAPA 2ZR5A 2Y78A 2DT3A 3UI5A 3B8SA 1ZBWA 1BKFA 3RM9A 4TW8A 1D2KA 4WIWA 2P4VA 1EDQA 4JFJA 2FDMA 2MLZA 4FAPA 4Z2GA 2DG9A 1NMVA 1KFWA 3WD4A 4ODLA 2A3CA 1QPFA 1JNSA 3CGMA 1J6YA 2RUQA 4DRQA 4ODMA 1FKFA 4TYOA 4ZPWR 3CHDA 2DT2A 4J4NA 5HWBA 5DIUA 3MDYB 4MTVA 2MNTA 1W1TA 3UQBA 1TFVA 3GU0A 4FN2A 5DO2A 3JXVA 3O5MA 2F21A 3UQAA 3FXYA 2OFNA 1LG2A 4TW7A 4WKFA 2G8ZA 5B8IC 1HKIA 3JYMA 4P8WA 1FKTA 4TW6A 3EIPA 4U84A 5DF0A 4JFIA 3GTYX 4Q22A 4DRHA 4ZPTR 2F4EA 1OWQA 3WD1A 4DWSD 4W5UA 4W9QA 4MNJA 4C02B 1HXVA 5HW8A 3KAGA 2WK2A 3W4RA 4MNLA 1GOIA 2RSEA 1FD9A 1EIBA 4MAVA 2LJ4A 1JNEA 2M2AA 2RUCA 2DG4A 3PA7A 1ROUA 2G41A 4LAXA 1E15A 2A3BA 2WM0A 4TX0A 4QT2A 1FKDA 2KE0A 4NSBA 3NI6A 1HJVA 2IUZA 3PRDA 3B9AA 1JNDA 1SYTA 3ARSA 2ZQUA 3O5QA 3WKZA 4IPXA 4IT4A 5HW7A 4KR0B 2PBCA 1M5YA 4W9OA 2AOSA 2LGOA 4O2TA 1FKLA 1GUVA 4LGXA 1UR8A 2WLYA 2MF9A 1HJWA 3ARTA 2JZVA 1LL7A 4TNSA 2KGJA 1KT0A 4MPKA 5HWCA 1NWUA 1W1VA 1FKIA 1X6LA 1X6NA 3IHZA 2XP5A 3UI6A 1UR9A 3FY1A 2PV1A 2PN0A 2YBTA 5DIVA 3WQWA 2EULA 3ALFA 1ITXA 4Z2LA 1W9PA 1W1YA 1NWRA 4P8XA 3RM8A 2XPAA 4N19A 1E6PA 4ODRA 4DT4A 3TDBA 2F2DA 4DH0A 1OGBA 1W1PA 2XP3A 4Z2KA 4UDMA 1E6ZA 1LL4A 1ZBCA 4WKHA 1QZ2A 2FAPA 4GIVA 4Z2HA 2DT0A 2D9FA 2RUDA 1NH6A 2QF8A 1F8AB 1W9UA 1F40A 3H9RB 4IT6A 3RGCA 2ZR6A 1YW5A 3WH0A 3ARPA 1E6RA 5HW6A 4DRJA 3CHCA 3IK8A 1EQ3A 1J4HA 4QT3A 2XP4A 4NZCA 4L72B 2L2SA 5GQBA 3NTPA 4MSPA 1ZCNA 2DPEA 3OOBA 3PRAA 1ZB5A 3B9EA 1FKJA 3WL0A 4WKAA 3TC5A 3PRBA 3KCEA 1LG1A 1IX5A 4JYSA 1NWTA 4G50A 1HKKA 3O5JA 3O5KA 3CGNA 2ESCA 2F23A 2XP9A 1FFQA 2B31A 1OGGA 3ARYA 3CHEA 4L3NA 3WD0A 5DITA 2AWGA 4IQ2A 3O5OA 1NMWA 3ARXA 1Y0OA 1Q1CA 3ARZA 1WB0A 1BL4A 4DRKA 1A7XA 1GPFA 4ODOA 4PTMA 4JFMA 1FKSA 3KADA 3WL1A 3LUOA 3O5IA 3B9DA 2PPOA 4R5EA 3EY6A 1EHNA 2MLYA 5I98A 1ZK6A 5HT1A 2ITKA 2LPVA 4P8UA 4G2PA 2DSVA 1QPLA 2PV2A 2VCDA 3G6LA 1FKGA 4ZPVR 4DRPA 4DZ2A 2Q5AA 3G6MA 3KAHA 2UZ5A 4ZS6A 1ZBVA 1FKRA 1HKJA 2XP7A 3KZ7A 4QZVB 1Q6HA 2RQSA 1ZU8A 2ZQSA 1VF8A 4R0XA 3BMBA 1L1PA 2DSWA 3ARRA 2M08A 3AS0A 3QOKA 2RURA 2PV3A 1XHGA 4MNKA 1J4IA 2MLXA 4S3KA 1XRVA 4ODQA 4DRMA 5BXJA 3UQIA 3UF8A 1B6CA 1CTNA 1T11A 1WAWA 2DSUA 1HKMA 5HBFA 2VN1A 4MNMA 3AS1A 3KACA 3CH9A 3RMEA 2O9OA 4DRIA 2ZQTA 1D7IA 4JFLA 3FAPA 1LJYA 4WJXA 1W26A 5HKGA 3ARUA 1EYMA 1ROTA 1SR0A 4DIPA 1Q6IA 1N1AA 4Z2IA 3O5LA 4HARA 3O5PA 2ZR4A 1D7JA 3BXWA 3UI4A 4U85A 1NSGA 1U79A 4JFKA 2N87A 3CHFA 4NNRA 1HJXA 2DT1A 2KI3A 3RM4A 2IF4A 3ARVA 3O5RA 2YBUA 3VAWA 4ML4A 2XP6A 3GPKA 1D7HA 4AY1A 2DG3A 1J4RA 3AROA 2A3AA 2XP8A 1Q6UA 2M1IA 4DRNA 4DZ3A 3ODKA 3PR9A 1FJDA 1ZBKA 4ITZA 3RFWA 2A3EA 5J6EA 1YATA 5GPGA 2KO7A 4XAKA 1D6OA 3O5GA 4QIBA 4KQZA 3KAIA 2OLHA 4ODNA 4J4OA 2KFWA 4Z2JA 3WQVA 3TCZA 2KR7A 2O92A 3JYJA 3IKDA 4Q7NA 4DWSB 1FKKA 1FFRA 4S3JA 4LAVA 1KT1A 5D75A 3WD2A
chains in the Genus database with same CATH topology
4WK9A 5DEZA 2ZQVA 4LAWA 1K9TA 1R9HA 1E6NA 4DWSA 1LQ0A 2PI6A 3AS3A 4DROA 4P8VA 1WNOA 4URIA 1H0IA 1H0GA 1PINA 1W9VA 3KAFA 5GPRA 5JH8A 3AQUA 3ARWA 3KABA 3OA5A 2PPNA 4W9PA 1P5QA 1E9LA 3IKGA 4ODPA 1JNTA 2PPPA 2MPHA 1FKHA 1JVWA 4IQCA 1C9HA 4HBEA 3WIJA 1TCOC 2WLZA 1FKBA 1ZL1A 4U86A 4BF8A 3I6CA 4GGQA 1O6IA 2LKNA 3O5EA 3NRKA 5HTGA 3ARQA 1PBKA 2DSZA 3CZ8A 1RD6A 2K8IA 3WD3A 4HBOA 3O5FA 4MGVA 3ALGA 3B7XA 4LAYA 5HUAA 2FKEA 3O5DA 3AS2A 4ODKA 2XPBA 1NWSA 4DWSC 1LL6A 1FAPA 2ZR5A 2Y78A 2DT3A 3UI5A 3B8SA 1ZBWA 1BKFA 3RM9A 4TW8A 1D2KA 4WIWA 1EDQA 4JFJA 2FDMA 2MLZA 4FAPA 4Z2GA 2DG9A 1NMVA 1KFWA 3WD4A 4ODLA 2A3CA 1QPFA 1JNSA 3CGMA 1J6YA 2RUQA 4DRQA 4ODMA 1FKFA 4TYOA 4ZPWR 3CHDA 2DT2A 4J4NA 5HWBA 5DIUA 3MDYB 4MTVA 2MNTA 1W1TA 3UQBA 1TFVA 4FN2A 5DO2A 3JXVA 3O5MA 2F21A 3UQAA 3FXYA 2OFNA 1LG2A 4TW7A 4WKFA 2G8ZA 5B8IC 1HKIA 3JYMA 4P8WA 1FKTA 4TW6A 4U84A 5DF0A 4JFIA 4Q22A 4DRHA 4ZPTR 2F4EA 1OWQA 3WD1A 4DWSD 4W5UA 4W9QA 4MNJA 4C02B 1HXVA 5HW8A 3KAGA 2WK2A 3W4RA 4MNLA 1GOIA 2RSEA 1FD9A 1EIBA 4MAVA 2LJ4A 1JNEA 2M2AA 2RUCA 2DG4A 3PA7A 1ROUA 2G41A 4LAXA 1E15A 2A3BA 2WM0A 4TX0A 4QT2A 1FKDA 2KE0A 4NSBA 3NI6A 1HJVA 2IUZA 3PRDA 3B9AA 1JNDA 1SYTA 3ARSA 2ZQUA 3O5QA 3WKZA 4IPXA 4IT4A 5HW7A 4KR0B 2PBCA 1M5YA 4W9OA 2AOSA 2LGOA 4O2TA 1FKLA 1GUVA 4LGXA 1UR8A 2WLYA 2MF9A 1HJWA 3ARTA 2JZVA 1LL7A 4TNSA 2KGJA 1KT0A 4MPKA 5HWCA 1NWUA 1W1VA 1FKIA 1X6LA 1X6NA 3IHZA 2XP5A 3UI6A 1UR9A 3FY1A 2PV1A 2YBTA 5DIVA 3WQWA 3ALFA 1ITXA 4Z2LA 1W9PA 1W1YA 1NWRA 4P8XA 3RM8A 2XPAA 4N19A 1E6PA 4ODRA 4DT4A 3TDBA 2F2DA 4DH0A 1OGBA 1W1PA 2XP3A 4Z2KA 1E6ZA 1LL4A 1ZBCA 4WKHA 1QZ2A 2FAPA 4GIVA 4Z2HA 2DT0A 2D9FA 2RUDA 1NH6A 2QF8A 1F8AB 1W9UA 1F40A 3H9RB 4IT6A 3RGCA 2ZR6A 1YW5A 3WH0A 3ARPA 1E6RA 5HW6A 4DRJA 3CHCA 3IK8A 1EQ3A 1J4HA 4QT3A 2XP4A 4NZCA 4L72B 2L2SA 5GQBA 3NTPA 4MSPA 1ZCNA 2DPEA 3OOBA 3PRAA 1ZB5A 3B9EA 1FKJA 3WL0A 4WKAA 3TC5A 3PRBA 3KCEA 1LG1A 1IX5A 4JYSA 1NWTA 4G50A 1HKKA 3O5JA 3O5KA 3CGNA 2ESCA 2XP9A 1FFQA 2B31A 1OGGA 3ARYA 3CHEA 4L3NA 3WD0A 5DITA 2AWGA 4IQ2A 3O5OA 1NMWA 3ARXA 1Y0OA 1Q1CA 3ARZA 1WB0A 1BL4A 4DRKA 1A7XA 1GPFA 4ODOA 4PTMA 4JFMA 1FKSA 3KADA 3WL1A 3LUOA 3O5IA 3B9DA 2PPOA 4R5EA 3EY6A 1EHNA 2MLYA 5I98A 1ZK6A 5HT1A 2ITKA 2LPVA 4P8UA 4G2PA 2DSVA 1QPLA 2PV2A 2VCDA 3G6LA 1FKGA 4ZPVR 4DRPA 4DZ2A 2Q5AA 3G6MA 3KAHA 2UZ5A 4ZS6A 1ZBVA 1FKRA 1HKJA 2XP7A 3KZ7A 4QZVB 1Q6HA 2RQSA 1ZU8A 2ZQSA 1VF8A 4R0XA 1L1PA 2DSWA 3ARRA 2M08A 3AS0A 3QOKA 2RURA 2PV3A 1XHGA 4MNKA 1J4IA 2MLXA 4S3KA 1XRVA 4ODQA 4DRMA 5BXJA 3UQIA 3UF8A 1B6CA 1CTNA 1T11A 1WAWA 2DSUA 1HKMA 5HBFA 2VN1A 4MNMA 3AS1A 3KACA 3CH9A 3RMEA 2O9OA 4DRIA 2ZQTA 1D7IA 4JFLA 3FAPA 1LJYA 4WJXA 1W26A 5HKGA 3ARUA 1EYMA 1ROTA 1SR0A 4DIPA 1Q6IA 1N1AA 4Z2IA 3O5LA 4HARA 3O5PA 2ZR4A 1D7JA 3BXWA 3UI4A 4U85A 1NSGA 1U79A 4JFKA 2N87A 3CHFA 4NNRA 1HJXA 2DT1A 2KI3A 3RM4A 2IF4A 3ARVA 3O5RA 2YBUA 3VAWA 4ML4A 2XP6A 3GPKA 1D7HA 4AY1A 2DG3A 1J4RA 3AROA 2A3AA 2XP8A 1Q6UA 2M1IA 4DRNA 4DZ3A 3ODKA 3PR9A 1FJDA 1ZBKA 4ITZA 3RFWA 2A3EA 5J6EA 1YATA 5GPGA 2KO7A 4XAKA 1D6OA 3O5GA 4QIBA 4KQZA 3KAIA 2OLHA 4ODNA 4J4OA 2KFWA 4Z2JA 3WQVA 3TCZA 2KR7A 2O92A 3JYJA 3IKDA 4Q7NA 4DWSB 1FKKA 1FFRA 4S3JA 4LAVA 1KT1A 5D75A 3WD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKR A;  3JXV A;  2XP7 A;  2F2D A;  3KZ7 A;  3O5M A;  3TDB A;  4DH0 A;  1Q6H A;  2XP3 A;  2F21 A;  2RQS A;  2ZQV A;  4LAW A;  1R9H A;  3UQA A;  2OFN A;  2ZQS A;  5B8I C;  4TW7 A;  1QZ2 A;  4R0X A;  2FAP A;  1L1P A;  3JYM A;  4U84 A;  1FKT A;  4TW6 A;  4DRO A;  4GIV A;  2M08 A;  4JFI A;  2D9F A;  2RUR A;  2PV3 A;  1PIN A;  3KAF A;  4DRH A;  2RUD A;  1F8A B;  2F4E A;  1F40 A;  3KAB A;  1J4I A;  2MLX A;  2PPN A;  4ODQ A;  3H9R B;  4W9Q A;  4W9P A;  3RGC A;  4DRM A;  5BXJ A;  1P5Q A;  3IKG A;  3UF8 A;  2ZR6 A;  3UQI A;  4C02 B;  1YW5 A;  1HXV A;  5HW8 A;  4ODP A;  3WH0 A;  3KAG A;  1JNT A;  2PPP A;  1B6C A;  1T11 A;  2MPH A;  5HW6 A;  1FKH A;  1JVW A;  4DRJ A;  4IQC A;  2VN1 A;  1C9H A;  2RSE A;  3IK8 A;  1FD9 A;  1EQ3 A;  1J4H A;  4QT3 A;  3KAC A;  2LJ4 A;  1TCO C;  2XP4 A;  2M2A A;  1FKB A;  2RUC A;  2DG4 A;  2L2S A;  3PA7 A;  3NTP A;  4MSP A;  4DRI A;  1ROU A;  2ZQT A;  1D7I A;  1ZCN A;  4U86 A;  4LAX A;  4BF8 A;  3OOB A;  4JFL A;  3FAP A;  4TX0 A;  4QT2 A;  1W26 A;  1FKJ A;  2LKN A;  3I6C A;  1EYM A;  4GGQ A;  5HKG A;  3O5E A;  3TC5 A;  1ROT A;  3NRK A;  1FKD A;  1Q6I A;  2KE0 A;  3PRB A;  4DIP A;  1N1A A;  1PBK A;  3KCE A;  3NI6 A;  5HTG A;  2K8I A;  3O5L A;  3O5P A;  2ZR4 A;  3PRD A;  3O5F A;  4JYS A;  4MGV A;  1D7J A;  4G50 A;  3UI4 A;  3B7X A;  3O5J A;  4LAY A;  5HUA A;  2FKE A;  3O5D A;  3O5K A;  1NSG A;  4U85 A;  2XP9 A;  3CGN A;  4ODK A;  1U79 A;  2ZQU A;  3O5Q A;  4JFK A;  4IPX A;  2XPB A;  5DIT A;  5HW7 A;  2N87 A;  4NNR A;  2KI3 A;  1FAP A;  2AWG A;  2PBC A;  1M5Y A;  2IF4 A;  2Y78 A;  2ZR5 A;  4W9O A;  3UI5 A;  3O5R A;  3VAW A;  4IQ2 A;  1BKF A;  2LGO A;  3O5O A;  1NMW A;  4O2T A;  1FKL A;  1Y0O A;  1Q1C A;  2XP6 A;  3GPK A;  4TW8 A;  1D7H A;  2MF9 A;  1BL4 A;  2DG3 A;  1A7X A;  4JFJ A;  1J4R A;  4ODO A;  4DRK A;  4JFM A;  2MLZ A;  4FAP A;  1FKS A;  2XP8 A;  1Q6U A;  1NMV A;  2DG9 A;  2JZV A;  2M1I A;  3KAD A;  3LUO A;  4TNS A;  2KGJ A;  3ODK A;  4ODL A;  1KT0 A;  4DRN A;  4DZ3 A;  3O5I A;  5HWC A;  1QPF A;  2PPO A;  1FJD A;  3EY6 A;  4ITZ A;  1JNS A;  3CGM A;  3RFW A;  2MLY A;  1FKI A;  1J6Y A;  5I98 A;  2RUQ A;  4DRQ A;  3IHZ A;  4ODM A;  5J6E A;  1FKF A;  4TYO A;  2XP5 A;  1YAT A;  1ZK6 A;  3UI6 A;  4FN2 A;  5GPG A;  2PV1 A;  2KO7 A;  5HT1 A;  2ITK A;  2LPV A;  1D6O A;  3O5G A;  4J4N A;  5DIV A;  4QIB A;  5DIU A;  5HWB A;  3MDY B;  3KAI A;  4ODN A;  4J4O A;  2KFW A;  4G2P A;  1QPL A;  2MNT A;  2PV2 A;  2VCD A;  1FKG A;  3TCZ A;  4DRP A;  2KR7 A;  3UQB A;  4DZ2 A;  2Q5A A;  3JYJ A;  3IKD A;  1FKK A;  3KAH A;  2XPA A;  4LAV A;  4N19 A;  2UZ5 A;  4ODR A;  1KT1 A;  4DT4 A;  5D75 A; 
#chains in the Genus database with same CATH topology
 4WK9 A;  1GRJ A;  5DEZ A;  2ZQV A;  4LAW A;  1K9T A;  1R9H A;  1E6N A;  4DWS A;  1LQ0 A;  2PI6 A;  3AS3 A;  4DRO A;  4P8V A;  1WNO A;  4URI A;  1H0I A;  1H0G A;  1PIN A;  1W9V A;  3KAF A;  1E44 A;  5GPR A;  3AQU A;  5JH8 A;  3ARW A;  3KAB A;  3OA5 A;  2PPN A;  4W9P A;  1P5Q A;  1E9L A;  3IKG A;  4ODP A;  1JNT A;  2PPP A;  2MPH A;  1FKH A;  1JVW A;  4IQC A;  1C9H A;  4HBE A;  3WIJ A;  1TCO C;  2WLZ A;  1FKB A;  1ZL1 A;  4U86 A;  4BF8 A;  2B5U B;  3I6C A;  4GGQ A;  1O6I A;  2LKN A;  3O5E A;  3NRK A;  5HTG A;  3ARQ A;  1PBK A;  2DSZ A;  3CZ8 A;  1RD6 A;  2K8I A;  3WD3 A;  2ETN A;  4HBO A;  3O5F A;  4MGV A;  3ALG A;  3B7X A;  4LAY A;  5HUA A;  2FKE A;  3O5D A;  3AS2 A;  4ODK A;  2XPB A;  1NWS A;  4DWS C;  1JCH B;  1LL6 A;  1FAP A;  2ZR5 A;  2Y78 A;  2DT3 A;  3UI5 A;  3B8S A;  1ZBW A;  1BKF A;  3RM9 A;  4TW8 A;  1D2K A;  4WIW A;  2P4V A;  1EDQ A;  4JFJ A;  2FDM A;  2MLZ A;  4FAP A;  4Z2G A;  2DG9 A;  1NMV A;  1KFW A;  3WD4 A;  4ODL A;  2A3C A;  1QPF A;  1JNS A;  3CGM A;  1J6Y A;  2RUQ A;  4DRQ A;  4ODM A;  1FKF A;  4TYO A;  4ZPW R;  3CHD A;  2DT2 A;  4J4N A;  5HWB A;  5DIU A;  3MDY B;  4MTV A;  2MNT A;  1W1T A;  3UQB A;  1TFV A;  3GU0 A;  4FN2 A;  5DO2 A;  3JXV A;  3O5M A;  2F21 A;  3UQA A;  3FXY A;  2OFN A;  1LG2 A;  4TW7 A;  4WKF A;  2G8Z A;  5B8I C;  1HKI A;  3JYM A;  4P8W A;  1FKT A;  4TW6 A;  3EIP A;  4U84 A;  5DF0 A;  4JFI A;  3GTY X;  4Q22 A;  4DRH A;  4ZPT R;  2F4E A;  1OWQ A;  3WD1 A;  4DWS D;  4W5U A;  4W9Q A;  4MNJ A;  4C02 B;  1HXV A;  5HW8 A;  3KAG A;  2WK2 A;  3W4R A;  4MNL A;  1GOI A;  2RSE A;  1FD9 A;  1EIB A;  4MAV A;  2LJ4 A;  1JNE A;  2M2A A;  2RUC A;  2DG4 A;  3PA7 A;  1ROU A;  2G41 A;  4LAX A;  1E15 A;  2A3B A;  2WM0 A;  4TX0 A;  4QT2 A;  1FKD A;  2KE0 A;  4NSB A;  3NI6 A;  1HJV A;  2IUZ A;  3PRD A;  3B9A A;  1JND A;  1SYT A;  3ARS A;  2ZQU A;  3O5Q A;  3WKZ A;  4IPX A;  4IT4 A;  5HW7 A;  4KR0 B;  2PBC A;  1M5Y A;  4W9O A;  2AOS A;  2LGO A;  4O2T A;  1FKL A;  1GUV A;  4LGX A;  1UR8 A;  2WLY A;  2MF9 A;  1HJW A;  3ART A;  2JZV A;  1LL7 A;  4TNS A;  2KGJ A;  1KT0 A;  4MPK A;  5HWC A;  1NWU A;  1W1V A;  1FKI A;  1X6L A;  1X6N A;  3IHZ A;  2XP5 A;  3UI6 A;  1UR9 A;  3FY1 A;  2PV1 A;  2PN0 A;  2YBT A;  5DIV A;  3WQW A;  2EUL A;  3ALF A;  1ITX A;  4Z2L A;  1W9P A;  1W1Y A;  1NWR A;  4P8X A;  3RM8 A;  2XPA A;  4N19 A;  1E6P A;  4ODR A;  4DT4 A;  3TDB A;  2F2D A;  4DH0 A;  1OGB A;  1W1P A;  2XP3 A;  4Z2K A;  4UDM A;  1E6Z A;  1LL4 A;  1ZBC A;  4WKH A;  1QZ2 A;  2FAP A;  4GIV A;  4Z2H A;  2DT0 A;  2D9F A;  2RUD A;  1NH6 A;  2QF8 A;  1F8A B;  1W9U A;  1F40 A;  3H9R B;  4IT6 A;  3RGC A;  2ZR6 A;  1YW5 A;  3WH0 A;  3ARP A;  1E6R A;  5HW6 A;  4DRJ A;  3CHC A;  3IK8 A;  1EQ3 A;  1J4H A;  4QT3 A;  2XP4 A;  4NZC A;  4L72 B;  2L2S A;  5GQB A;  3NTP A;  4MSP A;  1ZCN A;  2DPE A;  3OOB A;  3PRA A;  1ZB5 A;  3B9E A;  1FKJ A;  3WL0 A;  4WKA A;  3TC5 A;  3PRB A;  3KCE A;  1LG1 A;  1IX5 A;  4JYS A;  1NWT A;  4G50 A;  1HKK A;  3O5J A;  3O5K A;  3CGN A;  2ESC A;  2F23 A;  2XP9 A;  1FFQ A;  2B31 A;  1OGG A;  3ARY A;  3CHE A;  4L3N A;  3WD0 A;  5DIT A;  2AWG A;  4IQ2 A;  3O5O A;  1NMW A;  3ARX A;  1Y0O A;  1Q1C A;  3ARZ A;  1WB0 A;  1BL4 A;  4DRK A;  1A7X A;  1GPF A;  4ODO A;  4PTM A;  4JFM A;  1FKS A;  3KAD A;  3WL1 A;  3LUO A;  3O5I A;  3B9D A;  2PPO A;  4R5E A;  3EY6 A;  1EHN A;  2MLY A;  5I98 A;  1ZK6 A;  5HT1 A;  2ITK A;  2LPV A;  4P8U A;  4G2P A;  2DSV A;  1QPL A;  2PV2 A;  2VCD A;  3G6L A;  1FKG A;  4ZPV R;  4DRP A;  4DZ2 A;  2Q5A A;  3G6M A;  3KAH A;  2UZ5 A;  4ZS6 A;  1ZBV A;  1FKR A;  1HKJ A;  2XP7 A;  3KZ7 A;  4QZV B;  1Q6H A;  2RQS A;  1ZU8 A;  2ZQS A;  1VF8 A;  4R0X A;  3BMB A;  1L1P A;  2DSW A;  3ARR A;  2M08 A;  3AS0 A;  3QOK A;  2RUR A;  2PV3 A;  1XHG A;  4MNK A;  1J4I A;  2MLX A;  4S3K A;  1XRV A;  4ODQ A;  4DRM A;  5BXJ A;  3UQI A;  3UF8 A;  1B6C A;  1CTN A;  1T11 A;  1WAW A;  2DSU A;  1HKM A;  5HBF A;  2VN1 A;  4MNM A;  3AS1 A;  3KAC A;  3CH9 A;  3RME A;  2O9O A;  4DRI A;  2ZQT A;  1D7I A;  4JFL A;  3FAP A;  1LJY A;  4WJX A;  1W26 A;  5HKG A;  3ARU A;  1EYM A;  1ROT A;  1SR0 A;  4DIP A;  1Q6I A;  1N1A A;  4Z2I A;  3O5L A;  4HAR A;  3O5P A;  2ZR4 A;  1D7J A;  3BXW A;  3UI4 A;  4U85 A;  1NSG A;  1U79 A;  4JFK A;  2N87 A;  3CHF A;  4NNR A;  1HJX A;  2DT1 A;  2KI3 A;  3RM4 A;  2IF4 A;  3ARV A;  3O5R A;  2YBU A;  3VAW A;  4ML4 A;  2XP6 A;  3GPK A;  1D7H A;  4AY1 A;  2DG3 A;  1J4R A;  3ARO A;  2A3A A;  2XP8 A;  1Q6U A;  2M1I A;  4DRN A;  4DZ3 A;  3ODK A;  3PR9 A;  1FJD A;  1ZBK A;  4ITZ A;  3RFW A;  2A3E A;  5J6E A;  1YAT A;  5GPG A;  2KO7 A;  4XAK A;  1D6O A;  3O5G A;  4QIB A;  4KQZ A;  3KAI A;  2OLH A;  4ODN A;  4J4O A;  2KFW A;  4Z2J A;  3WQV A;  3TCZ A;  2KR7 A;  2O92 A;  3JYJ A;  3IKD A;  4Q7N A;  4DWS B;  1FKK A;  1FFR A;  4S3J A;  4LAV A;  1KT1 A;  5D75 A;  3WD2 A; 
#chains in the Genus database with same CATH homology
 4WK9 A;  5DEZ A;  2ZQV A;  4LAW A;  1K9T A;  1R9H A;  1E6N A;  4DWS A;  1LQ0 A;  2PI6 A;  3AS3 A;  4DRO A;  4P8V A;  1WNO A;  4URI A;  1H0I A;  1H0G A;  1PIN A;  1W9V A;  3KAF A;  5GPR A;  5JH8 A;  3AQU A;  3ARW A;  3KAB A;  3OA5 A;  2PPN A;  4W9P A;  1P5Q A;  1E9L A;  3IKG A;  4ODP A;  1JNT A;  2PPP A;  2MPH A;  1FKH A;  1JVW A;  4IQC A;  1C9H A;  4HBE A;  3WIJ A;  1TCO C;  2WLZ A;  1FKB A;  1ZL1 A;  4U86 A;  4BF8 A;  3I6C A;  4GGQ A;  1O6I A;  2LKN A;  3O5E A;  3NRK A;  5HTG A;  3ARQ A;  1PBK A;  2DSZ A;  3CZ8 A;  1RD6 A;  2K8I A;  3WD3 A;  4HBO A;  3O5F A;  4MGV A;  3ALG A;  3B7X A;  4LAY A;  5HUA A;  2FKE A;  3O5D A;  3AS2 A;  4ODK A;  2XPB A;  1NWS A;  4DWS C;  1LL6 A;  1FAP A;  2ZR5 A;  2Y78 A;  2DT3 A;  3UI5 A;  3B8S A;  1ZBW A;  1BKF A;  3RM9 A;  4TW8 A;  1D2K A;  4WIW A;  1EDQ A;  4JFJ A;  2FDM A;  2MLZ A;  4FAP A;  4Z2G A;  2DG9 A;  1NMV A;  1KFW A;  3WD4 A;  4ODL A;  2A3C A;  1QPF A;  1JNS A;  3CGM A;  1J6Y A;  2RUQ A;  4DRQ A;  4ODM A;  1FKF A;  4TYO A;  4ZPW R;  3CHD A;  2DT2 A;  4J4N A;  5HWB A;  5DIU A;  3MDY B;  4MTV A;  2MNT A;  1W1T A;  3UQB A;  1TFV A;  4FN2 A;  5DO2 A;  3JXV A;  3O5M A;  2F21 A;  3UQA A;  3FXY A;  2OFN A;  1LG2 A;  4TW7 A;  4WKF A;  2G8Z A;  5B8I C;  1HKI A;  3JYM A;  4P8W A;  1FKT A;  4TW6 A;  4U84 A;  5DF0 A;  4JFI A;  4Q22 A;  4DRH A;  4ZPT R;  2F4E A;  1OWQ A;  3WD1 A;  4DWS D;  4W5U A;  4W9Q A;  4MNJ A;  4C02 B;  1HXV A;  5HW8 A;  3KAG A;  2WK2 A;  3W4R A;  4MNL A;  1GOI A;  2RSE A;  1FD9 A;  1EIB A;  4MAV A;  2LJ4 A;  1JNE A;  2M2A A;  2RUC A;  2DG4 A;  3PA7 A;  1ROU A;  2G41 A;  4LAX A;  1E15 A;  2A3B A;  2WM0 A;  4TX0 A;  4QT2 A;  1FKD A;  2KE0 A;  4NSB A;  3NI6 A;  1HJV A;  2IUZ A;  3PRD A;  3B9A A;  1JND A;  1SYT A;  3ARS A;  2ZQU A;  3O5Q A;  3WKZ A;  4IPX A;  4IT4 A;  5HW7 A;  4KR0 B;  2PBC A;  1M5Y A;  4W9O A;  2AOS A;  2LGO A;  4O2T A;  1FKL A;  1GUV A;  4LGX A;  1UR8 A;  2WLY A;  2MF9 A;  1HJW A;  3ART A;  2JZV A;  1LL7 A;  4TNS A;  2KGJ A;  1KT0 A;  4MPK A;  5HWC A;  1NWU A;  1W1V A;  1FKI A;  1X6L A;  1X6N A;  3IHZ A;  2XP5 A;  3UI6 A;  1UR9 A;  3FY1 A;  2PV1 A;  2YBT A;  5DIV A;  3WQW A;  3ALF A;  1ITX A;  4Z2L A;  1W9P A;  1W1Y A;  1NWR A;  4P8X A;  3RM8 A;  2XPA A;  4N19 A;  1E6P A;  4ODR A;  4DT4 A;  3TDB A;  2F2D A;  4DH0 A;  1OGB A;  1W1P A;  2XP3 A;  4Z2K A;  1E6Z A;  1LL4 A;  1ZBC A;  4WKH A;  1QZ2 A;  2FAP A;  4GIV A;  4Z2H A;  2DT0 A;  2D9F A;  2RUD A;  1NH6 A;  2QF8 A;  1F8A B;  1W9U A;  1F40 A;  3H9R B;  4IT6 A;  3RGC A;  2ZR6 A;  1YW5 A;  3WH0 A;  3ARP A;  1E6R A;  5HW6 A;  4DRJ A;  3CHC A;  3IK8 A;  1EQ3 A;  1J4H A;  4QT3 A;  2XP4 A;  4NZC A;  4L72 B;  2L2S A;  5GQB A;  3NTP A;  4MSP A;  1ZCN A;  2DPE A;  3OOB A;  3PRA A;  1ZB5 A;  3B9E A;  1FKJ A;  3WL0 A;  4WKA A;  3TC5 A;  3PRB A;  3KCE A;  1LG1 A;  1IX5 A;  4JYS A;  1NWT A;  4G50 A;  1HKK A;  3O5J A;  3O5K A;  3CGN A;  2ESC A;  2XP9 A;  1FFQ A;  2B31 A;  1OGG A;  3ARY A;  3CHE A;  4L3N A;  3WD0 A;  5DIT A;  2AWG A;  4IQ2 A;  3O5O A;  1NMW A;  3ARX A;  1Y0O A;  1Q1C A;  3ARZ A;  1WB0 A;  1BL4 A;  4DRK A;  1A7X A;  1GPF A;  4ODO A;  4PTM A;  4JFM A;  1FKS A;  3KAD A;  3WL1 A;  3LUO A;  3O5I A;  3B9D A;  2PPO A;  4R5E A;  3EY6 A;  1EHN A;  2MLY A;  5I98 A;  1ZK6 A;  5HT1 A;  2ITK A;  2LPV A;  4P8U A;  4G2P A;  2DSV A;  1QPL A;  2PV2 A;  2VCD A;  3G6L A;  1FKG A;  4ZPV R;  4DRP A;  4DZ2 A;  2Q5A A;  3G6M A;  3KAH A;  2UZ5 A;  4ZS6 A;  1ZBV A;  1FKR A;  1HKJ A;  2XP7 A;  3KZ7 A;  4QZV B;  1Q6H A;  2RQS A;  1ZU8 A;  2ZQS A;  1VF8 A;  4R0X A;  1L1P A;  2DSW A;  3ARR A;  2M08 A;  3AS0 A;  3QOK A;  2RUR A;  2PV3 A;  1XHG A;  4MNK A;  1J4I A;  2MLX A;  4S3K A;  1XRV A;  4ODQ A;  4DRM A;  5BXJ A;  3UQI A;  3UF8 A;  1B6C A;  1CTN A;  1T11 A;  1WAW A;  2DSU A;  1HKM A;  5HBF A;  2VN1 A;  4MNM A;  3AS1 A;  3KAC A;  3CH9 A;  3RME A;  2O9O A;  4DRI A;  2ZQT A;  1D7I A;  4JFL A;  3FAP A;  1LJY A;  4WJX A;  1W26 A;  5HKG A;  3ARU A;  1EYM A;  1ROT A;  1SR0 A;  4DIP A;  1Q6I A;  1N1A A;  4Z2I A;  3O5L A;  4HAR A;  3O5P A;  2ZR4 A;  1D7J A;  3BXW A;  3UI4 A;  4U85 A;  1NSG A;  1U79 A;  4JFK A;  2N87 A;  3CHF A;  4NNR A;  1HJX A;  2DT1 A;  2KI3 A;  3RM4 A;  2IF4 A;  3ARV A;  3O5R A;  2YBU A;  3VAW A;  4ML4 A;  2XP6 A;  3GPK A;  1D7H A;  4AY1 A;  2DG3 A;  1J4R A;  3ARO A;  2A3A A;  2XP8 A;  1Q6U A;  2M1I A;  4DRN A;  4DZ3 A;  3ODK A;  3PR9 A;  1FJD A;  1ZBK A;  4ITZ A;  3RFW A;  2A3E A;  5J6E A;  1YAT A;  5GPG A;  2KO7 A;  4XAK A;  1D6O A;  3O5G A;  4QIB A;  4KQZ A;  3KAI A;  2OLH A;  4ODN A;  4J4O A;  2KFW A;  4Z2J A;  3WQV A;  3TCZ A;  2KR7 A;  2O92 A;  3JYJ A;  3IKD A;  4Q7N A;  4DWS B;  1FKK A;  1FFR A;  4S3J A;  4LAV A;  1KT1 A;  5D75 A;  3WD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...