3CGNA

Crystal structure of thermophilic slyd
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
151
structure length
151
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase
publication title Crystal Structure Determination and Functional Characterization of the Metallochaperone SlyD from Thermus thermophilus
pubmed doi rcsb
source organism Thermus thermophilus
total genus 28
structure length 151
sequence length 151
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3cgnA00
1EYMA 4J4NA 5J6EA 4LAXA 1P5QA 1Q6IA 2PV3A 2LJ4A 4TW7A 2ITKA 1NMVA 1F8AB 3H9RB 3KACA 4ODLA 1Q6HA 3KCEA 1FKTA 2PPNA 4TW6A 4W9OA 4IQ2A 4JFKA 3O5OA 2VN1A 3KZ7A 3IKGA 4FN2A 1B6CA 2Y78A 3UI6A 1D6OA 4DRKA 2PPOA 1FKKA 2ZR5A 3IK8A 2PPPA 3O5JA 1J4RA 2DG4A 2IF4A 4JYSA 4U86A 2M1IA 3JYJA 1YW5A 2RUCA 5DITA 3IKDA 4DRNA 2M2AA 1KT1A 2F2DA 4NNRA 4DRQA 2KFWA 5HW8A 3O5FA 2F4EA 2ZQTA 4MSPA 4LAWA 4U84A 2KI3A 4BF8A 4DROA 4DRMA 1L1PA 4ODNA 4C02B 3O5QA 2M08A 4JFLA 3KAHA 2DG3A 4GGQA 3OOBA 2ZQSA 2ZR6A 1QPFA 3GPKA 4TNSA 5DIUA 5HUAA 4JFIA 1BL4A 3IHZA 2LPVA 1PBKA 3O5GA 4JFMA 2KGJA 2RURA 4ODPA 1BKFA 2ZQUA 2RQSA 3KADA 4G50A 2KO7A 4O2TA 1W26A 4TYOA 2XP8A 3RGCA 4DRJA 1T11A 2MNTA 3KAGA 1FKGA 3EY6A 4N19A 3TC5A 1M5YA 1FKDA 2MLXA 3O5EA 3O5PA 2XP5A 3UQIA 2PV1A 4MGVA 3TCZA 1A7XA 5BXJA 1Y0OA 3I6CA 4DT4A 3NRKA 1FD9A 3O5DA 3UQAA 3KAFA 1FJDA 3CGNA 3CGMA 4W9QA 2RUDA 1FKIA 3UF8A 1D7IA 2UZ5A 5B8IC 5HTGA 2Q5AA 1QPLA 1FAPA 1JVWA 1NSGA 2RSEA 3NI6A 3RFWA 4JFJA 1ZK6A 4LAYA 2D9FA 2L2SA 2OFNA 2XP4A 4FAPA 2MF9A 2FKEA 1C9HA 4TW8A 5D75A 3B7XA 4DRIA 1J6YA 3KABA 4LAVA 2K8IA 2MLZA 5I98A 4DH0A 3KAIA 1FKSA 4ODKA 3NTPA 1U79A 2ZR4A 3UQBA 3O5KA 1EQ3A 1FKFA 3MDYB 4IQCA 4IPXA 1HXVA 4QT2A 1QZ2A 2XP3A 1KT0A 2N87A 1FKRA 2XP7A 4J4OA 1JNSA 2KR7A 2XP9A 2XPBA 2DG9A 1D7HA 2FAPA 1Q6UA 4QT3A 1Q1CA 2AWGA 2XPAA 3O5IA 2ZQVA 3PRBA 5GPGA 4DRPA 1FKLA 5HWBA 1ZCNA 1J4HA 4DRHA 4R0XA 2PBCA 4G2PA 4GIVA 4TX0A 3ODKA 3PRDA 3FAPA 1D7JA 3LUOA 3O5MA 4U85A 4DZ3A 4DZ2A 1R9HA 4ODMA 3TDBA 3VAWA 3PA7A 3WH0A 4W9PA 4DIPA 3UI4A 2MLYA 3JXVA 4ITZA 2XP6A 5HKGA 2LKNA 1FKBA 2PV2A 2RUQA 5HWCA 3JYMA 4QIBA 1ROUA 1FKHA 5HW6A 2LGOA 5DIVA 1FKJA 2F21A 1NMWA 1ROTA 2KE0A 4ODQA 5HT1A 5HW7A 1J4IA 2MPHA 1JNTA 3O5RA 4ODOA 1F40A 1N1AA 3O5LA 2JZVA 1YATA 4ODRA 1TCOC 3UI5A 2VCDA 1PINA
chains in the Genus database with same CATH superfamily
5J6EA 2PV3A 1Q6IA 1NMVA 3KACA 4ODLA 4WKHA 4MPKA 1EIBA 4W9OA 4IQ2A 1FFRA 3KZ7A 1D6OA 4DRKA 2PPOA 2ZR5A 3IK8A 4ZPWR 2DG4A 4JYSA 2M1IA 4DRNA 1HJXA 1KT1A 1LL6A 2F4EA 4DROA 4LAWA 4U84A 4DRMA 2A3AA 3O5QA 4JFLA 2ZQSA 5HUAA 3IHZA 1PBKA 2RURA 4O2TA 4Z2LA 3ARXA 4ZS6A 1K9TA 3O5PA 1ZBKA 2WLYA 4MGVA 1Y0OA 4IT4A 2FDMA 4ML4A 2DT1A 3CGNA 1XHGA 1FKIA 2UZ5A 4ZPVR 1QPLA 2WLZA 5HBFA 4JFJA 2D9FA 4HBOA 1GPFA 4DWSD 5D75A 3B7XA 4DRIA 4L3NA 3B9AA 2K8IA 2MLZA 4WJXA 3ALGA 3KAIA 1FKSA 3WD1A 3AS1A 1ITXA 1ZU8A 4IQCA 1LL7A 1OGBA 2A3BA 2XP7A 1JNSA 3B9DA 1LG2A 1FKLA 2WM0A 1ZCNA 1J4HA 3RMEA 3WQWA 1H0IA 2DSZA 4WKAA 1OGGA 4ITZA 2PV2A 3GU0A 2ESCA 3OA5A 1O6IA 4Q22A 1FKJA 1NMWA 1TFVA 2KE0A 4ODQA 5HW7A 1J4IA 2MPHA 3O5RA 1F40A 1N1AA 3W4RA 2JZVA 3WD2A 1YATA 3AS0A 2DT3A 1PINA 4J4NA 4LAXA 3ARVA 1X6LA 2A3EA 1F8AB 1OWQA 1HKIA 2PPNA 1GRJA 4JFKA 2Y78A 5GPRA 1W9VA 2PPPA 1D2KA 3WL1A 3IKDA 3WD0A 2F2DA 1JNEA 2KFWA 5HW8A 3RM9A 3O5FA 2ZQTA 4MSPA 4HBEA 4S3KA 4C02B 3AS3A 4GGQA 1W9UA 2ZR6A 4TNSA 3O5GA 3G6MA 3UI5A 3KADA 2RQSA 4G50A 4DRJA 3RGCA 1T11A 3KAGA 1FKGA 5DO2A 2DT2A 3CHFA 2O92A 1A7XA 3O5DA 1GUVA 3KAFA 4W9QA 4Z2GA 2ETNA 1FAPA 1NSGA 2DPEA 1CTNA 1ZB5A 5DEZA 2XP4A 2MF9A 1C9HA 2YBTA 1W1TA 1NWUA 3WIJA 1VF8A 1GOIA 1WNOA 3MDYB 1ZBCA 2N87A 1FKRA 1HJVA 4DWSA 2XPBA 1D7HA 4QT3A 1LQ0A 1SYTA 1E6PA 3FY1A 4URIA 1NWTA 1UR9A 4R0XA 4TX0A 3PRDA 1D7JA 3LUOA 1R9HA 4ODMA 3VAWA 2A3CA 3PA7A 4WKFA 4W9PA 4P8WA 1HKKA 3UI4A 2MLYA 3JXVA 5HKGA 2RUQA 3CHEA 3JYMA 5HWCA 3FXYA 5HW6A 2LGOA 3G6LA 2F21A 1NH6A 4Z2KA 3ARPA 4DWSC 2G41A 4TW7A 3H9RB 1FKTA 2VN1A 4FN2A 4R5EA 3UI6A 1W1YA 1ZL1A 4P8VA 2IF4A 1WB0A 1YW5A 2RUCA 4ZPTR 2M2AA 1KFWA 4PTMA 2KI3A 2O9OA 3GTYX 3RM4A 3ARSA 4ODNA 2M08A 5GQBA 1HKMA 3KAHA 3WD4A 2DG3A 2OLHA 1H0GA 1QPFA 1E9LA 1WAWA 4JFIA 1BL4A 2B5UB 1BKFA 2KO7A 1X6NA 1W26A 4TYOA 2XP8A 1EHNA 4S3JA 4KR0B 4L72B 3EY6A 4N19A 1M5YA 1XRVA 2MLXA 2XP5A 2PV1A 3TCZA 1W1VA 4DT4A 3NRKA 1FJDA 1W1PA 3CGMA 2RUDA 4WK9A 3CHDA 2AOSA 2B31A 5HTGA 1JVWA 3NI6A 1ZK6A 3ARRA 2IUZA 4LGXA 4FAPA 4TW8A 2DSVA 1LJYA 2QF8A 4ODKA 3AROA 4UDMA 3UQBA 1EQ3A 2G8ZA 4IPXA 1QZ2A 2XP3A 4Z2HA 4J4OA 3BMBA 3ARUA 2XP9A 3ARZA 2DG9A 1E15A 1Q6UA 5GPGA 3PRBA 2XPAA 4MNLA 2ZQVA 1RD6A 3WD3A 2WK2A 4DRHA 4G2PA 3ODKA 4MNJA 3O5MA 2PN0A 4DZ3A 5DF0A 4DIPA 1FFQA 3PR9A 3BXWA 2XP6A 2LKNA 1ZBWA 4QIBA 1ROTA 4DWSB 1JNTA 3O5LA 4ODRA 2P4VA 3EIPA 1NWRA 1EYMA 3QOKA 1P5QA 2LJ4A 2ITKA 1Q6HA 3KCEA 4TW6A 3CH9A 3O5OA 3IKGA 2F23A 1B6CA 4MNKA 1FKKA 4NZCA 2PI6A 3O5JA 1J4RA 3AQUA 5DITA 4U86A 3JYJA 4DRQA 4NNRA 3ARQA 4BF8A 1HJWA 4WIWA 3AS2A 1L1PA 3ARYA 4KQZA 3PRAA 3OOBA 3GPKA 1JNDA 5DIUA 3WQVA 4JFMA 2LPVA 5JH8A 1LG1A 2KGJA 4ODPA 4DZ2A 2ZQUA 2MNTA 4Z2IA 4MNMA 3TC5A 4Z2JA 3ARWA 1FKDA 4Q7NA 3O5EA 1SR0A 2DT0A 3UQIA 1E6NA 5BXJA 3I6CA 2DSUA 2EULA 1UR8A 1FD9A 3UQAA 4P8XA 3CZ8A 3RM8A 4W5UA 3UF8A 5B8IC 1ZBVA 1D7IA 2Q5AA 1E6RA 1W9PA 2RSEA 1E6ZA 3RFWA 4LAYA 2L2SA 2OFNA 4MTVA 2FKEA 1JCHB 1IX5A 2DSWA 1J6YA 3KABA 4LAVA 5I98A 4DH0A 3NTPA 1U79A 2ZR4A 3WL0A 4HARA 3O5KA 1FKFA 1HXVA 4QT2A 3CHCA 1KT0A 1E44A 2KR7A 4NSBA 2FAPA 4P8UA 1Q1CA 2AWGA 3O5IA 4AY1A 4DRPA 5HWBA 3ALFA 2PBCA 2YBUA 4GIVA 3FAPA 3B9EA 4U85A 3WKZA 3TDBA 3ARTA 3WH0A 1HKJA 1NWSA 1FKBA 1ROUA 1FKHA 5DIVA 1EDQA 3B8SA 4MAVA 4IT6A 5HT1A 4ODOA 4QZVB 4XAKA 1LL4A 1TCOC 2VCDA
chains in the Genus database with same CATH topology
5J6EA 2PV3A 1Q6IA 1NMVA 3KACA 4ODLA 4WKHA 4MPKA 1EIBA 4W9OA 4IQ2A 1FFRA 3KZ7A 1D6OA 4DRKA 2PPOA 2ZR5A 3IK8A 4ZPWR 2DG4A 4JYSA 2M1IA 4DRNA 1HJXA 1KT1A 1LL6A 2F4EA 4DROA 4LAWA 4U84A 4DRMA 2A3AA 3O5QA 4JFLA 2ZQSA 5HUAA 3IHZA 1PBKA 2RURA 4O2TA 4Z2LA 3ARXA 4ZS6A 1K9TA 3O5PA 1ZBKA 2WLYA 4MGVA 1Y0OA 4IT4A 2FDMA 4ML4A 2DT1A 3CGNA 1XHGA 1FKIA 2UZ5A 4ZPVR 1QPLA 2WLZA 5HBFA 4JFJA 2D9FA 4HBOA 1GPFA 4DWSD 5D75A 3B7XA 4DRIA 4L3NA 3B9AA 2K8IA 2MLZA 4WJXA 3ALGA 3KAIA 1FKSA 3WD1A 3AS1A 1ITXA 1ZU8A 4IQCA 1LL7A 1OGBA 2A3BA 2XP7A 1JNSA 3B9DA 1LG2A 1FKLA 2WM0A 1ZCNA 1J4HA 3RMEA 3WQWA 1H0IA 2DSZA 4WKAA 1OGGA 4ITZA 2PV2A 2ESCA 3OA5A 1O6IA 4Q22A 1FKJA 1NMWA 1TFVA 2KE0A 4ODQA 5HW7A 1J4IA 2MPHA 3O5RA 1F40A 1N1AA 3W4RA 2JZVA 3WD2A 1YATA 3AS0A 2DT3A 1PINA 4J4NA 4LAXA 3ARVA 1X6LA 2A3EA 1F8AB 1OWQA 1HKIA 2PPNA 4JFKA 2Y78A 5GPRA 1W9VA 2PPPA 1D2KA 3WL1A 3IKDA 3WD0A 2F2DA 1JNEA 2KFWA 5HW8A 3RM9A 3O5FA 2ZQTA 4MSPA 4HBEA 4S3KA 4C02B 3AS3A 4GGQA 1W9UA 2ZR6A 4TNSA 3O5GA 3G6MA 3UI5A 3KADA 2RQSA 4G50A 4DRJA 3RGCA 1T11A 3KAGA 1FKGA 5DO2A 2DT2A 3CHFA 2O92A 1A7XA 3O5DA 1GUVA 3KAFA 4W9QA 4Z2GA 1FAPA 1NSGA 2DPEA 1CTNA 1ZB5A 5DEZA 2XP4A 2MF9A 1C9HA 2YBTA 1W1TA 1NWUA 3WIJA 1VF8A 1GOIA 1WNOA 3MDYB 1ZBCA 2N87A 1FKRA 1HJVA 4DWSA 2XPBA 1D7HA 4QT3A 1LQ0A 1SYTA 1E6PA 3FY1A 4URIA 1NWTA 1UR9A 4R0XA 4TX0A 3PRDA 1D7JA 3LUOA 1R9HA 4ODMA 3VAWA 2A3CA 3PA7A 4WKFA 4W9PA 4P8WA 1HKKA 3UI4A 2MLYA 3JXVA 5HKGA 2RUQA 3CHEA 3JYMA 5HWCA 3FXYA 5HW6A 2LGOA 3G6LA 2F21A 1NH6A 4Z2KA 3ARPA 4DWSC 2G41A 4TW7A 3H9RB 1FKTA 2VN1A 4FN2A 4R5EA 3UI6A 1W1YA 1ZL1A 4P8VA 2IF4A 1WB0A 1YW5A 2RUCA 4ZPTR 2M2AA 1KFWA 4PTMA 2KI3A 2O9OA 3RM4A 3ARSA 4ODNA 2M08A 5GQBA 1HKMA 3KAHA 3WD4A 2DG3A 2OLHA 1H0GA 1QPFA 1E9LA 1WAWA 4JFIA 1BL4A 1BKFA 2KO7A 1X6NA 1W26A 4TYOA 2XP8A 1EHNA 4S3JA 4KR0B 4L72B 3EY6A 4N19A 1M5YA 1XRVA 2MLXA 2XP5A 2PV1A 3TCZA 1W1VA 4DT4A 3NRKA 1FJDA 1W1PA 3CGMA 2RUDA 4WK9A 3CHDA 2AOSA 2B31A 5HTGA 1JVWA 3NI6A 1ZK6A 3ARRA 2IUZA 4LGXA 4FAPA 4TW8A 2DSVA 1LJYA 2QF8A 4ODKA 3AROA 3UQBA 1EQ3A 2G8ZA 4IPXA 1QZ2A 2XP3A 4Z2HA 4J4OA 3ARUA 2XP9A 3ARZA 2DG9A 1E15A 1Q6UA 5GPGA 3PRBA 2XPAA 4MNLA 2ZQVA 1RD6A 3WD3A 2WK2A 4DRHA 4G2PA 3ODKA 4MNJA 3O5MA 4DZ3A 5DF0A 4DIPA 1FFQA 3PR9A 3BXWA 2XP6A 2LKNA 1ZBWA 4QIBA 1ROTA 4DWSB 1JNTA 3O5LA 4ODRA 1NWRA 1EYMA 3QOKA 1P5QA 2LJ4A 2ITKA 1Q6HA 3KCEA 4TW6A 3CH9A 3O5OA 3IKGA 1B6CA 4MNKA 1FKKA 4NZCA 2PI6A 3O5JA 1J4RA 3AQUA 5DITA 4U86A 3JYJA 4DRQA 4NNRA 3ARQA 4BF8A 1HJWA 4WIWA 3AS2A 1L1PA 3ARYA 4KQZA 3PRAA 3OOBA 3GPKA 1JNDA 5DIUA 3WQVA 4JFMA 2LPVA 5JH8A 1LG1A 2KGJA 4ODPA 4DZ2A 2ZQUA 2MNTA 4Z2IA 4MNMA 3TC5A 4Z2JA 3ARWA 1FKDA 4Q7NA 3O5EA 1SR0A 2DT0A 3UQIA 1E6NA 5BXJA 3I6CA 2DSUA 1UR8A 1FD9A 3UQAA 4P8XA 3CZ8A 3RM8A 4W5UA 3UF8A 5B8IC 1ZBVA 1D7IA 2Q5AA 1E6RA 1W9PA 2RSEA 1E6ZA 3RFWA 4LAYA 2L2SA 2OFNA 4MTVA 2FKEA 1IX5A 2DSWA 1J6YA 3KABA 4LAVA 5I98A 4DH0A 3NTPA 1U79A 2ZR4A 3WL0A 4HARA 3O5KA 1FKFA 1HXVA 4QT2A 3CHCA 1KT0A 2KR7A 4NSBA 2FAPA 4P8UA 1Q1CA 2AWGA 3O5IA 4AY1A 4DRPA 5HWBA 3ALFA 2PBCA 2YBUA 4GIVA 3FAPA 3B9EA 4U85A 3WKZA 3TDBA 3ARTA 3WH0A 1HKJA 1NWSA 1FKBA 1ROUA 1FKHA 5DIVA 1EDQA 3B8SA 4MAVA 4IT6A 5HT1A 4ODOA 4QZVB 4XAKA 1LL4A 1TCOC 2VCDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EYM A;  4J4N A;  5J6E A;  4LAX A;  1P5Q A;  1Q6I A;  2PV3 A;  2LJ4 A;  4TW7 A;  2ITK A;  1NMV A;  1F8A B;  3H9R B;  3KAC A;  4ODL A;  1Q6H A;  3KCE A;  1FKT A;  2PPN A;  4TW6 A;  4W9O A;  4IQ2 A;  4JFK A;  3O5O A;  2VN1 A;  3KZ7 A;  3IKG A;  4FN2 A;  1B6C A;  2Y78 A;  3UI6 A;  1D6O A;  4DRK A;  2PPO A;  1FKK A;  2ZR5 A;  3IK8 A;  2PPP A;  3O5J A;  1J4R A;  2DG4 A;  2IF4 A;  4JYS A;  4U86 A;  2M1I A;  3JYJ A;  1YW5 A;  2RUC A;  5DIT A;  3IKD A;  4DRN A;  2M2A A;  1KT1 A;  2F2D A;  4NNR A;  4DRQ A;  2KFW A;  5HW8 A;  3O5F A;  2F4E A;  2ZQT A;  4MSP A;  4LAW A;  4U84 A;  2KI3 A;  4BF8 A;  4DRO A;  4DRM A;  1L1P A;  4ODN A;  4C02 B;  3O5Q A;  2M08 A;  4JFL A;  3KAH A;  2DG3 A;  4GGQ A;  3OOB A;  2ZQS A;  2ZR6 A;  1QPF A;  3GPK A;  4TNS A;  5DIU A;  5HUA A;  4JFI A;  1BL4 A;  3IHZ A;  2LPV A;  1PBK A;  3O5G A;  4JFM A;  2KGJ A;  2RUR A;  4ODP A;  1BKF A;  2ZQU A;  2RQS A;  3KAD A;  4G50 A;  2KO7 A;  4O2T A;  1W26 A;  4TYO A;  2XP8 A;  3RGC A;  4DRJ A;  1T11 A;  2MNT A;  3KAG A;  1FKG A;  3EY6 A;  4N19 A;  3TC5 A;  1M5Y A;  1FKD A;  2MLX A;  3O5E A;  3O5P A;  2XP5 A;  3UQI A;  2PV1 A;  4MGV A;  3TCZ A;  1A7X A;  5BXJ A;  1Y0O A;  3I6C A;  4DT4 A;  3NRK A;  1FD9 A;  3O5D A;  3UQA A;  3KAF A;  1FJD A;  3CGN A;  3CGM A;  4W9Q A;  2RUD A;  1FKI A;  3UF8 A;  1D7I A;  2UZ5 A;  5B8I C;  5HTG A;  2Q5A A;  1QPL A;  1FAP A;  1JVW A;  1NSG A;  2RSE A;  3NI6 A;  3RFW A;  4JFJ A;  1ZK6 A;  4LAY A;  2D9F A;  2L2S A;  2OFN A;  2XP4 A;  4FAP A;  2MF9 A;  2FKE A;  1C9H A;  4TW8 A;  5D75 A;  3B7X A;  4DRI A;  1J6Y A;  3KAB A;  4LAV A;  2K8I A;  2MLZ A;  5I98 A;  4DH0 A;  3KAI A;  1FKS A;  4ODK A;  3NTP A;  1U79 A;  2ZR4 A;  3UQB A;  3O5K A;  1EQ3 A;  1FKF A;  3MDY B;  4IQC A;  4IPX A;  1HXV A;  4QT2 A;  1QZ2 A;  2XP3 A;  1KT0 A;  2N87 A;  1FKR A;  2XP7 A;  4J4O A;  1JNS A;  2KR7 A;  2XP9 A;  2XPB A;  2DG9 A;  1D7H A;  2FAP A;  1Q6U A;  4QT3 A;  1Q1C A;  2AWG A;  2XPA A;  3O5I A;  2ZQV A;  3PRB A;  5GPG A;  4DRP A;  1FKL A;  5HWB A;  1ZCN A;  1J4H A;  4DRH A;  4R0X A;  2PBC A;  4G2P A;  4GIV A;  4TX0 A;  3ODK A;  3PRD A;  3FAP A;  1D7J A;  3LUO A;  3O5M A;  4U85 A;  4DZ3 A;  4DZ2 A;  1R9H A;  4ODM A;  3TDB A;  3VAW A;  3PA7 A;  3WH0 A;  4W9P A;  4DIP A;  3UI4 A;  2MLY A;  3JXV A;  4ITZ A;  2XP6 A;  5HKG A;  2LKN A;  1FKB A;  2PV2 A;  2RUQ A;  5HWC A;  3JYM A;  4QIB A;  1ROU A;  1FKH A;  5HW6 A;  2LGO A;  5DIV A;  1FKJ A;  2F21 A;  1NMW A;  1ROT A;  2KE0 A;  4ODQ A;  5HT1 A;  5HW7 A;  1J4I A;  2MPH A;  1JNT A;  3O5R A;  4ODO A;  1F40 A;  1N1A A;  3O5L A;  2JZV A;  1YAT A;  4ODR A;  1TCO C;  3UI5 A;  2VCD A;  1PIN A; 
#chains in the Genus database with same CATH topology
 5J6E A;  2PV3 A;  1Q6I A;  1NMV A;  3KAC A;  4ODL A;  4WKH A;  4MPK A;  1EIB A;  4W9O A;  4IQ2 A;  1FFR A;  3KZ7 A;  1D6O A;  4DRK A;  2PPO A;  2ZR5 A;  3IK8 A;  4ZPW R;  2DG4 A;  4JYS A;  2M1I A;  4DRN A;  1HJX A;  1KT1 A;  1LL6 A;  2F4E A;  4DRO A;  4LAW A;  4U84 A;  4DRM A;  2A3A A;  3O5Q A;  4JFL A;  2ZQS A;  5HUA A;  3IHZ A;  1PBK A;  2RUR A;  4O2T A;  4Z2L A;  3ARX A;  4ZS6 A;  1K9T A;  3O5P A;  1ZBK A;  2WLY A;  4MGV A;  1Y0O A;  4IT4 A;  2FDM A;  4ML4 A;  2DT1 A;  3CGN A;  1XHG A;  1FKI A;  2UZ5 A;  4ZPV R;  1QPL A;  2WLZ A;  5HBF A;  4JFJ A;  2D9F A;  4HBO A;  1GPF A;  4DWS D;  5D75 A;  3B7X A;  4DRI A;  4L3N A;  3B9A A;  2K8I A;  2MLZ A;  4WJX A;  3ALG A;  3KAI A;  1FKS A;  3WD1 A;  3AS1 A;  1ITX A;  1ZU8 A;  4IQC A;  1LL7 A;  1OGB A;  2A3B A;  2XP7 A;  1JNS A;  3B9D A;  1LG2 A;  1FKL A;  2WM0 A;  1ZCN A;  1J4H A;  3RME A;  3WQW A;  1H0I A;  2DSZ A;  4WKA A;  1OGG A;  4ITZ A;  2PV2 A;  3GU0 A;  2ESC A;  3OA5 A;  1O6I A;  4Q22 A;  1FKJ A;  1NMW A;  1TFV A;  2KE0 A;  4ODQ A;  5HW7 A;  1J4I A;  2MPH A;  3O5R A;  1F40 A;  1N1A A;  3W4R A;  2JZV A;  3WD2 A;  1YAT A;  3AS0 A;  2DT3 A;  1PIN A;  4J4N A;  4LAX A;  3ARV A;  1X6L A;  2A3E A;  1F8A B;  1OWQ A;  1HKI A;  2PPN A;  1GRJ A;  4JFK A;  2Y78 A;  5GPR A;  1W9V A;  2PPP A;  1D2K A;  3WL1 A;  3IKD A;  3WD0 A;  2F2D A;  1JNE A;  2KFW A;  5HW8 A;  3RM9 A;  3O5F A;  2ZQT A;  4MSP A;  4HBE A;  4S3K A;  4C02 B;  3AS3 A;  4GGQ A;  1W9U A;  2ZR6 A;  4TNS A;  3O5G A;  3G6M A;  3UI5 A;  3KAD A;  2RQS A;  4G50 A;  4DRJ A;  3RGC A;  1T11 A;  3KAG A;  1FKG A;  5DO2 A;  2DT2 A;  3CHF A;  2O92 A;  1A7X A;  3O5D A;  1GUV A;  3KAF A;  4W9Q A;  4Z2G A;  2ETN A;  1FAP A;  1NSG A;  2DPE A;  1CTN A;  1ZB5 A;  5DEZ A;  2XP4 A;  2MF9 A;  1C9H A;  2YBT A;  1W1T A;  1NWU A;  3WIJ A;  1VF8 A;  1GOI A;  1WNO A;  3MDY B;  1ZBC A;  2N87 A;  1FKR A;  1HJV A;  4DWS A;  2XPB A;  1D7H A;  4QT3 A;  1LQ0 A;  1SYT A;  1E6P A;  3FY1 A;  4URI A;  1NWT A;  1UR9 A;  4R0X A;  4TX0 A;  3PRD A;  1D7J A;  3LUO A;  1R9H A;  4ODM A;  3VAW A;  2A3C A;  3PA7 A;  4WKF A;  4W9P A;  4P8W A;  1HKK A;  3UI4 A;  2MLY A;  3JXV A;  5HKG A;  2RUQ A;  3CHE A;  3JYM A;  5HWC A;  3FXY A;  5HW6 A;  2LGO A;  3G6L A;  2F21 A;  1NH6 A;  4Z2K A;  3ARP A;  4DWS C;  2G41 A;  4TW7 A;  3H9R B;  1FKT A;  2VN1 A;  4FN2 A;  4R5E A;  3UI6 A;  1W1Y A;  1ZL1 A;  4P8V A;  2IF4 A;  1WB0 A;  1YW5 A;  2RUC A;  4ZPT R;  2M2A A;  1KFW A;  4PTM A;  2KI3 A;  2O9O A;  3GTY X;  3RM4 A;  3ARS A;  4ODN A;  2M08 A;  5GQB A;  1HKM A;  3KAH A;  3WD4 A;  2DG3 A;  2OLH A;  1H0G A;  1QPF A;  1E9L A;  1WAW A;  4JFI A;  1BL4 A;  2B5U B;  1BKF A;  2KO7 A;  1X6N A;  1W26 A;  4TYO A;  2XP8 A;  1EHN A;  4S3J A;  4KR0 B;  4L72 B;  3EY6 A;  4N19 A;  1M5Y A;  1XRV A;  2MLX A;  2XP5 A;  2PV1 A;  3TCZ A;  1W1V A;  4DT4 A;  3NRK A;  1FJD A;  1W1P A;  3CGM A;  2RUD A;  4WK9 A;  3CHD A;  2AOS A;  2B31 A;  5HTG A;  1JVW A;  3NI6 A;  1ZK6 A;  3ARR A;  2IUZ A;  4LGX A;  4FAP A;  4TW8 A;  2DSV A;  1LJY A;  2QF8 A;  4ODK A;  3ARO A;  4UDM A;  3UQB A;  1EQ3 A;  2G8Z A;  4IPX A;  1QZ2 A;  2XP3 A;  4Z2H A;  4J4O A;  3BMB A;  3ARU A;  2XP9 A;  3ARZ A;  2DG9 A;  1E15 A;  1Q6U A;  5GPG A;  3PRB A;  2XPA A;  4MNL A;  2ZQV A;  1RD6 A;  3WD3 A;  2WK2 A;  4DRH A;  4G2P A;  3ODK A;  4MNJ A;  3O5M A;  2PN0 A;  4DZ3 A;  5DF0 A;  4DIP A;  1FFQ A;  3PR9 A;  3BXW A;  2XP6 A;  2LKN A;  1ZBW A;  4QIB A;  1ROT A;  4DWS B;  1JNT A;  3O5L A;  4ODR A;  2P4V A;  3EIP A;  1NWR A;  1EYM A;  3QOK A;  1P5Q A;  2LJ4 A;  2ITK A;  1Q6H A;  3KCE A;  4TW6 A;  3CH9 A;  3O5O A;  3IKG A;  2F23 A;  1B6C A;  4MNK A;  1FKK A;  4NZC A;  2PI6 A;  3O5J A;  1J4R A;  3AQU A;  5DIT A;  4U86 A;  3JYJ A;  4DRQ A;  4NNR A;  3ARQ A;  4BF8 A;  1HJW A;  4WIW A;  3AS2 A;  1L1P A;  3ARY A;  4KQZ A;  3PRA A;  3OOB A;  3GPK A;  1JND A;  5DIU A;  3WQV A;  4JFM A;  2LPV A;  5JH8 A;  1LG1 A;  2KGJ A;  4ODP A;  4DZ2 A;  2ZQU A;  2MNT A;  4Z2I A;  4MNM A;  3TC5 A;  4Z2J A;  3ARW A;  1FKD A;  4Q7N A;  3O5E A;  1SR0 A;  2DT0 A;  3UQI A;  1E6N A;  5BXJ A;  3I6C A;  2DSU A;  2EUL A;  1UR8 A;  1FD9 A;  3UQA A;  4P8X A;  3CZ8 A;  3RM8 A;  4W5U A;  3UF8 A;  5B8I C;  1ZBV A;  1D7I A;  2Q5A A;  1E6R A;  1W9P A;  2RSE A;  1E6Z A;  3RFW A;  4LAY A;  2L2S A;  2OFN A;  4MTV A;  2FKE A;  1JCH B;  1IX5 A;  2DSW A;  1J6Y A;  3KAB A;  4LAV A;  5I98 A;  4DH0 A;  3NTP A;  1U79 A;  2ZR4 A;  3WL0 A;  4HAR A;  3O5K A;  1FKF A;  1HXV A;  4QT2 A;  3CHC A;  1KT0 A;  1E44 A;  2KR7 A;  4NSB A;  2FAP A;  4P8U A;  1Q1C A;  2AWG A;  3O5I A;  4AY1 A;  4DRP A;  5HWB A;  3ALF A;  2PBC A;  2YBU A;  4GIV A;  3FAP A;  3B9E A;  4U85 A;  3WKZ A;  3TDB A;  3ART A;  3WH0 A;  1HKJ A;  1NWS A;  1FKB A;  1ROU A;  1FKH A;  5DIV A;  1EDQ A;  3B8S A;  4MAV A;  4IT6 A;  5HT1 A;  4ODO A;  4QZV B;  4XAK A;  1LL4 A;  1TCO C;  2VCD A; 
#chains in the Genus database with same CATH homology
 5J6E A;  2PV3 A;  1Q6I A;  1NMV A;  3KAC A;  4ODL A;  4WKH A;  4MPK A;  1EIB A;  4W9O A;  4IQ2 A;  1FFR A;  3KZ7 A;  1D6O A;  4DRK A;  2PPO A;  2ZR5 A;  3IK8 A;  4ZPW R;  2DG4 A;  4JYS A;  2M1I A;  4DRN A;  1HJX A;  1KT1 A;  1LL6 A;  2F4E A;  4DRO A;  4LAW A;  4U84 A;  4DRM A;  2A3A A;  3O5Q A;  4JFL A;  2ZQS A;  5HUA A;  3IHZ A;  1PBK A;  2RUR A;  4O2T A;  4Z2L A;  3ARX A;  4ZS6 A;  1K9T A;  3O5P A;  1ZBK A;  2WLY A;  4MGV A;  1Y0O A;  4IT4 A;  2FDM A;  4ML4 A;  2DT1 A;  3CGN A;  1XHG A;  1FKI A;  2UZ5 A;  4ZPV R;  1QPL A;  2WLZ A;  5HBF A;  4JFJ A;  2D9F A;  4HBO A;  1GPF A;  4DWS D;  5D75 A;  3B7X A;  4DRI A;  4L3N A;  3B9A A;  2K8I A;  2MLZ A;  4WJX A;  3ALG A;  3KAI A;  1FKS A;  3WD1 A;  3AS1 A;  1ITX A;  1ZU8 A;  4IQC A;  1LL7 A;  1OGB A;  2A3B A;  2XP7 A;  1JNS A;  3B9D A;  1LG2 A;  1FKL A;  2WM0 A;  1ZCN A;  1J4H A;  3RME A;  3WQW A;  1H0I A;  2DSZ A;  4WKA A;  1OGG A;  4ITZ A;  2PV2 A;  2ESC A;  3OA5 A;  1O6I A;  4Q22 A;  1FKJ A;  1NMW A;  1TFV A;  2KE0 A;  4ODQ A;  5HW7 A;  1J4I A;  2MPH A;  3O5R A;  1F40 A;  1N1A A;  3W4R A;  2JZV A;  3WD2 A;  1YAT A;  3AS0 A;  2DT3 A;  1PIN A;  4J4N A;  4LAX A;  3ARV A;  1X6L A;  2A3E A;  1F8A B;  1OWQ A;  1HKI A;  2PPN A;  4JFK A;  2Y78 A;  5GPR A;  1W9V A;  2PPP A;  1D2K A;  3WL1 A;  3IKD A;  3WD0 A;  2F2D A;  1JNE A;  2KFW A;  5HW8 A;  3RM9 A;  3O5F A;  2ZQT A;  4MSP A;  4HBE A;  4S3K A;  4C02 B;  3AS3 A;  4GGQ A;  1W9U A;  2ZR6 A;  4TNS A;  3O5G A;  3G6M A;  3UI5 A;  3KAD A;  2RQS A;  4G50 A;  4DRJ A;  3RGC A;  1T11 A;  3KAG A;  1FKG A;  5DO2 A;  2DT2 A;  3CHF A;  2O92 A;  1A7X A;  3O5D A;  1GUV A;  3KAF A;  4W9Q A;  4Z2G A;  1FAP A;  1NSG A;  2DPE A;  1CTN A;  1ZB5 A;  5DEZ A;  2XP4 A;  2MF9 A;  1C9H A;  2YBT A;  1W1T A;  1NWU A;  3WIJ A;  1VF8 A;  1GOI A;  1WNO A;  3MDY B;  1ZBC A;  2N87 A;  1FKR A;  1HJV A;  4DWS A;  2XPB A;  1D7H A;  4QT3 A;  1LQ0 A;  1SYT A;  1E6P A;  3FY1 A;  4URI A;  1NWT A;  1UR9 A;  4R0X A;  4TX0 A;  3PRD A;  1D7J A;  3LUO A;  1R9H A;  4ODM A;  3VAW A;  2A3C A;  3PA7 A;  4WKF A;  4W9P A;  4P8W A;  1HKK A;  3UI4 A;  2MLY A;  3JXV A;  5HKG A;  2RUQ A;  3CHE A;  3JYM A;  5HWC A;  3FXY A;  5HW6 A;  2LGO A;  3G6L A;  2F21 A;  1NH6 A;  4Z2K A;  3ARP A;  4DWS C;  2G41 A;  4TW7 A;  3H9R B;  1FKT A;  2VN1 A;  4FN2 A;  4R5E A;  3UI6 A;  1W1Y A;  1ZL1 A;  4P8V A;  2IF4 A;  1WB0 A;  1YW5 A;  2RUC A;  4ZPT R;  2M2A A;  1KFW A;  4PTM A;  2KI3 A;  2O9O A;  3RM4 A;  3ARS A;  4ODN A;  2M08 A;  5GQB A;  1HKM A;  3KAH A;  3WD4 A;  2DG3 A;  2OLH A;  1H0G A;  1QPF A;  1E9L A;  1WAW A;  4JFI A;  1BL4 A;  1BKF A;  2KO7 A;  1X6N A;  1W26 A;  4TYO A;  2XP8 A;  1EHN A;  4S3J A;  4KR0 B;  4L72 B;  3EY6 A;  4N19 A;  1M5Y A;  1XRV A;  2MLX A;  2XP5 A;  2PV1 A;  3TCZ A;  1W1V A;  4DT4 A;  3NRK A;  1FJD A;  1W1P A;  3CGM A;  2RUD A;  4WK9 A;  3CHD A;  2AOS A;  2B31 A;  5HTG A;  1JVW A;  3NI6 A;  1ZK6 A;  3ARR A;  2IUZ A;  4LGX A;  4FAP A;  4TW8 A;  2DSV A;  1LJY A;  2QF8 A;  4ODK A;  3ARO A;  3UQB A;  1EQ3 A;  2G8Z A;  4IPX A;  1QZ2 A;  2XP3 A;  4Z2H A;  4J4O A;  3ARU A;  2XP9 A;  3ARZ A;  2DG9 A;  1E15 A;  1Q6U A;  5GPG A;  3PRB A;  2XPA A;  4MNL A;  2ZQV A;  1RD6 A;  3WD3 A;  2WK2 A;  4DRH A;  4G2P A;  3ODK A;  4MNJ A;  3O5M A;  4DZ3 A;  5DF0 A;  4DIP A;  1FFQ A;  3PR9 A;  3BXW A;  2XP6 A;  2LKN A;  1ZBW A;  4QIB A;  1ROT A;  4DWS B;  1JNT A;  3O5L A;  4ODR A;  1NWR A;  1EYM A;  3QOK A;  1P5Q A;  2LJ4 A;  2ITK A;  1Q6H A;  3KCE A;  4TW6 A;  3CH9 A;  3O5O A;  3IKG A;  1B6C A;  4MNK A;  1FKK A;  4NZC A;  2PI6 A;  3O5J A;  1J4R A;  3AQU A;  5DIT A;  4U86 A;  3JYJ A;  4DRQ A;  4NNR A;  3ARQ A;  4BF8 A;  1HJW A;  4WIW A;  3AS2 A;  1L1P A;  3ARY A;  4KQZ A;  3PRA A;  3OOB A;  3GPK A;  1JND A;  5DIU A;  3WQV A;  4JFM A;  2LPV A;  5JH8 A;  1LG1 A;  2KGJ A;  4ODP A;  4DZ2 A;  2ZQU A;  2MNT A;  4Z2I A;  4MNM A;  3TC5 A;  4Z2J A;  3ARW A;  1FKD A;  4Q7N A;  3O5E A;  1SR0 A;  2DT0 A;  3UQI A;  1E6N A;  5BXJ A;  3I6C A;  2DSU A;  1UR8 A;  1FD9 A;  3UQA A;  4P8X A;  3CZ8 A;  3RM8 A;  4W5U A;  3UF8 A;  5B8I C;  1ZBV A;  1D7I A;  2Q5A A;  1E6R A;  1W9P A;  2RSE A;  1E6Z A;  3RFW A;  4LAY A;  2L2S A;  2OFN A;  4MTV A;  2FKE A;  1IX5 A;  2DSW A;  1J6Y A;  3KAB A;  4LAV A;  5I98 A;  4DH0 A;  3NTP A;  1U79 A;  2ZR4 A;  3WL0 A;  4HAR A;  3O5K A;  1FKF A;  1HXV A;  4QT2 A;  3CHC A;  1KT0 A;  2KR7 A;  4NSB A;  2FAP A;  4P8U A;  1Q1C A;  2AWG A;  3O5I A;  4AY1 A;  4DRP A;  5HWB A;  3ALF A;  2PBC A;  2YBU A;  4GIV A;  3FAP A;  3B9E A;  4U85 A;  3WKZ A;  3TDB A;  3ART A;  3WH0 A;  1HKJ A;  1NWS A;  1FKB A;  1ROU A;  1FKH A;  5DIV A;  1EDQ A;  3B8S A;  4MAV A;  4IT6 A;  5HT1 A;  4ODO A;  4QZV B;  4XAK A;  1LL4 A;  1TCO C;  2VCD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...