3CGNA

Crystal structure of thermophilic slyd
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
151
structure length
151
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase
publication title Crystal Structure Determination and Functional Characterization of the Metallochaperone SlyD from Thermus thermophilus
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase
total genus 28
structure length 151
sequence length 151
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3cgnA00
3IHZA 4JFMA 2LKNA 3KADA 4DROA 1D7JA 3UF8A 5HTGA 3JYJA 4O2TA 1FKIA 1NSGA 1YATA 2RUDA 2RSEA 2ZR4A 3KCEA 1ROUA 4ODMA 2PV3A 1J4RA 3IK8A 5HW8A 2M08A 2XP6A 3TC5A 1KT1A 1FKJA 4LAXA 4LAVA 3H9RB 2KFWA 5I98A 1FKRA 2MNTA 3NI6A 2Y78A 2PPNA 2JZVA 2ZQVA 2DG9A 3UI5A 1Q6IA 3KAIA 3NRKA 1D7HA 3O5MA 4JFIA 4JFLA 2K8IA 3MDYB 5DIVA 1B6CA 4ODOA 1KT0A 3JXVA 1FKDA 4FN2A 4W9OA 1BKFA 2ZQSA 1FKBA 3EY6A 4GIVA 2ITKA 4J4NA 3TCZA 4MGVA 2KE0A 3PRBA 2MLYA 1FKLA 1F8AB 1T11A 1FD9A 2XPBA 1W26A 4QT3A 4QT2A 3RFWA 4TYOA 4DRJA 1YW5A 4IQCA 2ZQUA 4ODRA 4IPXA 5BXJA 4DRNA 4DZ2A 2XP4A 5B8IC 1NMWA 4C02B 1FKGA 2LPVA 2RUQA 5HUAA 1FKHA 5GPGA 1QPFA 2N87A 1FKKA 2UZ5A 4G50A 3UQBA 2IF4A 1A7XA 4N19A 4TW7A 3JYMA 2VCDA 2MPHA 4ITZA 1P5QA 2Q5AA 3O5FA 1C9HA 3I6CA 4R0XA 4DRHA 2ZR5A 3WH0A 2XP7A 2PPOA 3UQIA 4J4OA 2XP9A 1QZ2A 3GPKA 1FKFA 3UQAA 2PV1A 3O5IA 3RGCA 1QPLA 3O5GA 1M5YA 3O5JA 5J6EA 1FJDA 3KAFA 3FAPA 1ZK6A 2MLZA 3O5DA 1BL4A 1J6YA 3PA7A 1HXVA 5HKGA 3CGNA 3O5PA 4W9QA 3TDBA 1R9HA 5DITA 3CGMA 4ODLA 2D9FA 3VAWA 2ZR6A 3B7XA 4LAYA 1FAPA 4ODKA 2MLXA 2AWGA 4TNSA 4IQ2A 3UI4A 3O5EA 1EYMA 5HW7A 2KO7A 3O5LA 1FKTA 2LJ4A 4W9PA 2XP8A 3KACA 3KABA 3LUOA 3IKDA 4TX0A 4FAPA 4TW8A 2MF9A 2KR7A 2RQSA 4DIPA 3KAGA 4MSPA 3ODKA 4ODNA 5DIUA 4ODQA 1F40A 1JVWA 2PPPA 4DRPA 4GGQA 1J4HA 4DRMA 2FAPA 4TW6A 4DRKA 4U84A 2KI3A 1PINA 3PRDA 2OFNA 2XP3A 4G2PA 4NNRA 4U85A 3KAHA 3KZ7A 1N1AA 1PBKA 3OOBA 4DH0A 1JNTA 4BF8A 1Q6HA 1D6OA 1ROTA 3O5QA 1U79A 2VN1A 4U86A 3UI6A 2M2AA 2M1IA 1NMVA 2XP5A 2F2DA 1Y0OA 2ZQTA 4LAWA 2PV2A 1TCOC 2KGJA 2XPAA 1Q6UA 4DRIA 2DG4A 2L2SA 2LGOA 2F4EA 4DRQA 2RUCA 2PBCA 3O5OA 4JYSA 5HWCA 4ODPA 4QIBA 4DZ3A 1EQ3A 1L1PA 2DG3A 2RURA 4DT4A 5HW6A 5HT1A 1JNSA 2FKEA 4JFJA 2F21A 1J4IA 1Q1CA 3IKGA 5D75A 4JFKA 5HWBA 1D7IA 3NTPA 3O5RA 1ZCNA 3O5KA 1FKSA
chains in the Genus database with same CATH superfamily
3KADA 1D7JA 5HTGA 3EIPA 4O2TA 1YATA 1NWRA 2ZR4A 2WK2A 4Z2KA 1ZBWA 1J4RA 2PV3A 5HW8A 2M08A 2XP6A 1TFVA 4ZPWR 2PPNA 2JZVA 1UR9A 3UI5A 1Q6IA 4JFIA 3NRKA 1D7HA 3ARSA 3BMBA 1GUVA 4W9OA 3ARPA 4FN2A 4GIVA 4MGVA 3BXWA 1FD9A 2ETNA 2XPBA 4MNJA 4TYOA 2ZQUA 2DSUA 4IPXA 1ZBVA 3ALGA 1KFWA 3QOKA 1NMWA 4DZ2A 4WK9A 2A3BA 4C02B 1FKGA 5HUAA 5GPGA 3GTYX 4ZPTR 1UR8A 3UQBA 2YBTA 2G8ZA 2MPHA 3I6CA 4R0XA 2ZR5A 2XP7A 1O6IA 2PN0A 2XP9A 3UQAA 3O5GA 1M5YA 5J6EA 2MLZA 1JNDA 3CGMA 4ODLA 2D9FA 1EHNA 4ODKA 1X6LA 1X6NA 4S3KA 2ESCA 5HW7A 3KACA 3KABA 4TX0A 1W1VA 4TW8A 2MF9A 4WJXA 3FY1A 1W9UA 4WKFA 3AS0A 3ODKA 3CHEA 3FXYA 1F40A 4GGQA 1J4HA 1WNOA 2DSZA 4U84A 5DO2A 4R5EA 4U85A 4P8VA 1N1AA 1PBKA 4BF8A 3ARRA 1D6OA 4DWSA 4Q7NA 3UI6A 2M2AA 2DT1A 2P4VA 2ZQTA 2F2DA 4XAKA 1ZL1A 4LGXA 2L2SA 1NH6A 4WIWA 2F4EA 2PBCA 1FFQA 5HWCA 4DZ3A 5HW6A 1GRJA 3ARZA 2FKEA 1E6NA 1Q1CA 3O5RA 1ZCNA 4Z2HA 3B9EA 3O5KA 3AQUA 2LKNA 4JFMA 1RD6A 1LL7A 4URIA 3JYJA 1FKIA 1NSGA 2RSEA 3KCEA 4ODMA 5GQBA 3TC5A 1FKJA 3WKZA 4LAXA 2KFWA 2A3EA 2MNTA 4WKHA 3O5MA 4JFLA 3MDYB 3ARYA 3WD3A 1KT0A 3JXVA 3WQWA 1BKFA 2ZQSA 2ITKA 1EDQA 3PRBA 1FKLA 4MNMA 1W9PA 1XHGA 4IT6A 1YW5A 1ITXA 2A3CA 4DRNA 4WKAA 5B8IC 1W1TA 1FKHA 1QPFA 2N87A 4MPKA 2UZ5A 4N19A 4DRHA 4MAVA 3UQIA 1FKFA 3O5IA 1FJDA 1HKMA 2WLZA 3ARWA 5DITA 3VAWA 2ZR6A 2YBUA 1NWSA 3B7XA 1GOIA 1LL4A 2MLXA 3W4RA 2AWGA 1FFRA 4IQ2A 3UI4A 3O5EA 2XP8A 3LUOA 4FAPA 1HKJA 4MNKA 2KR7A 2RQSA 5JH8A 4ODNA 2QF8A 4ODQA 4DWSC 3RM8A 1LQ0A 1E6RA 4TW6A 2KI3A 2OFNA 3PRAA 4Z2LA 2DSWA 1JNTA 5GPRA 1Q6HA 3ARVA 1ROTA 3O5QA 2VN1A 1GPFA 4LAWA 1TCOC 2KGJA 1H0IA 2DG4A 3O5OA 3ARXA 1L1PA 1NWUA 4QIBA 1JNSA 5D75A 1D7IA 1E15A 1ZB5A 1LG1A 2A3AA 3ARTA 3WD2A 1HXVA 4Q22A 1KT1A 3RM9A 3H9RB 1XRVA 4ZS6A 3NI6A 2Y78A 4P8WA 3CHFA 2DG9A 2B5UB 3AS3A 1B6CA 1FKDA 3CH9A 3EY6A 1FKBA 4J4NA 3TCZA 1HKKA 1F8AB 1ZBCA 1T11A 4QT2A 1W26A 3RFWA 3G6LA 4ODRA 3B9DA 1E6PA 2O9OA 2G41A 5HBFA 4G50A 4L3NA 2IF4A 1SYTA 4TW7A 1ZBKA 3JYMA 2Q5AA 3WL0A 3WH0A 4J4OA 3GPKA 1K9TA 1JCHB 4S3JA 2PV1A 3RGCA 1QPLA 3AS2A 1LL6A 3FAPA 3O5DA 1EIBA 1J6YA 3PA7A 2WM0A 5HKGA 3CGNA 4ZPVR 3O5PA 3OA5A 4W9QA 1WB0A 3B8SA 2AOSA 4DWSD 3CHCA 1LG2A 4TNSA 3ARQA 2KO7A 3O5LA 1FKTA 2LJ4A 4W9PA 1E44A 3IKDA 4HBEA 4DIPA 3CZ8A 3KAGA 4MSPA 4MTVA 5DIUA 1JVWA 2PPPA 1CTNA 1W9VA 4DRPA 3ARUA 3WD0A 2DSVA 4DRKA 3PRDA 2XP3A 4G2PA 2IUZA 4DH0A 5DEZA 2WLYA 2DPEA 1U79A 1W1PA 4ML4A 2XP5A 1H0GA 1VF8A 3WL1A 4DRQA 2RUCA 3PR9A 2B31A 1WAWA 4JFJA 3CHDA 1J4IA 4JFKA 3NTPA 2FDMA 1OGBA 5DF0A 3IHZA 4DROA 4MNLA 3UF8A 3RM4A 2RUDA 1ROUA 1HJWA 3GU0A 3IK8A 3WIJA 4KQZA 5I98A 4LAVA 1FKRA 3WD4A 4P8XA 2ZQVA 1HJXA 2O92A 3KAIA 4Z2GA 2K8IA 5DIVA 4ODOA 4KR0B 3WD1A 2F23A 2KE0A 1JNEA 2MLYA 4QT3A 4DRJA 1IX5A 4IQCA 4DWSB 5BXJA 4IT4A 4HBOA 2XP4A 2LPVA 2RUQA 1SR0A 2OLHA 1FKKA 2DT2A 4L72B 1A7XA 2VCDA 4ITZA 1P5QA 3O5FA 1C9HA 2PPOA 1OWQA 4AY1A 1QZ2A 3O5JA 4Z2JA 3KAFA 1ZK6A 1BL4A 2PI6A 3TDBA 4PTMA 1E9LA 1R9HA 2DT3A 4LAYA 2EULA 1FAPA 1NWTA 1EYMA 1E6ZA 4HARA 3ALFA 4QZVB 3AS1A 1ZU8A 1OGGA 3G6MA 4W5UA 1LJYA 3AROA 2DT0A 4Z2IA 4DRMA 2FAPA 1HJVA 1W1YA 3WQVA 4P8UA 4NNRA 1PINA 3KAHA 3KZ7A 3OOBA 4U86A 3B9AA 2M1IA 1NMVA 1Y0OA 2PV2A 3RMEA 4UDMA 2XPAA 1Q6UA 4DRIA 1HKIA 2LGOA 4NSBA 4JYSA 4ODPA 1EQ3A 2DG3A 2RURA 4DT4A 5HT1A 4NZCA 2F21A 3IKGA 5HWBA 1D2KA 1FKSA
chains in the Genus database with same CATH topology
3KADA 1D7JA 5HTGA 4O2TA 1YATA 1NWRA 2ZR4A 2WK2A 4Z2KA 1ZBWA 1J4RA 2PV3A 5HW8A 2M08A 2XP6A 1TFVA 4ZPWR 2PPNA 2JZVA 1UR9A 3UI5A 1Q6IA 4JFIA 3NRKA 1D7HA 3ARSA 1GUVA 4W9OA 3ARPA 4FN2A 4GIVA 4MGVA 3BXWA 1FD9A 2XPBA 4MNJA 4TYOA 2ZQUA 2DSUA 4IPXA 1ZBVA 3ALGA 1KFWA 3QOKA 1NMWA 4DZ2A 4WK9A 2A3BA 4C02B 1FKGA 5HUAA 5GPGA 4ZPTR 1UR8A 3UQBA 2YBTA 2G8ZA 2MPHA 3I6CA 4R0XA 2ZR5A 2XP7A 1O6IA 2XP9A 3UQAA 3O5GA 1M5YA 5J6EA 2MLZA 1JNDA 3CGMA 4ODLA 2D9FA 1EHNA 4ODKA 1X6LA 1X6NA 4S3KA 2ESCA 5HW7A 3KACA 3KABA 4TX0A 1W1VA 4TW8A 2MF9A 4WJXA 3FY1A 1W9UA 4WKFA 3AS0A 3ODKA 3CHEA 3FXYA 1F40A 4GGQA 1J4HA 1WNOA 2DSZA 4U84A 5DO2A 4R5EA 4U85A 4P8VA 1N1AA 1PBKA 4BF8A 3ARRA 1D6OA 4DWSA 4Q7NA 3UI6A 2M2AA 2DT1A 2ZQTA 2F2DA 4XAKA 1ZL1A 4LGXA 2L2SA 1NH6A 4WIWA 2F4EA 2PBCA 1FFQA 5HWCA 4DZ3A 5HW6A 3ARZA 2FKEA 1E6NA 1Q1CA 3O5RA 1ZCNA 4Z2HA 3B9EA 3O5KA 3AQUA 2LKNA 4JFMA 1RD6A 1LL7A 4URIA 3JYJA 1FKIA 1NSGA 2RSEA 3KCEA 4ODMA 5GQBA 3TC5A 1FKJA 3WKZA 4LAXA 2KFWA 2A3EA 2MNTA 4WKHA 3O5MA 4JFLA 3MDYB 3ARYA 3WD3A 1KT0A 3JXVA 3WQWA 1BKFA 2ZQSA 2ITKA 1EDQA 3PRBA 1FKLA 4MNMA 1W9PA 1XHGA 4IT6A 1YW5A 1ITXA 2A3CA 4DRNA 4WKAA 5B8IC 1W1TA 1FKHA 1QPFA 2N87A 4MPKA 2UZ5A 4N19A 4DRHA 4MAVA 3UQIA 1FKFA 3O5IA 1FJDA 1HKMA 2WLZA 3ARWA 5DITA 3VAWA 2ZR6A 2YBUA 1NWSA 3B7XA 1GOIA 1LL4A 2MLXA 3W4RA 2AWGA 1FFRA 4IQ2A 3UI4A 3O5EA 2XP8A 3LUOA 4FAPA 1HKJA 4MNKA 2KR7A 2RQSA 5JH8A 4ODNA 2QF8A 4ODQA 4DWSC 3RM8A 1LQ0A 1E6RA 4TW6A 2KI3A 2OFNA 3PRAA 4Z2LA 2DSWA 1JNTA 5GPRA 1Q6HA 3ARVA 1ROTA 3O5QA 2VN1A 1GPFA 4LAWA 1TCOC 2KGJA 1H0IA 2DG4A 3O5OA 3ARXA 1L1PA 1NWUA 4QIBA 1JNSA 5D75A 1D7IA 1E15A 1ZB5A 1LG1A 2A3AA 3ARTA 3WD2A 1HXVA 4Q22A 1KT1A 3RM9A 3H9RB 1XRVA 4ZS6A 3NI6A 2Y78A 4P8WA 3CHFA 2DG9A 3AS3A 1B6CA 1FKDA 3CH9A 3EY6A 1FKBA 4J4NA 3TCZA 1HKKA 1F8AB 1ZBCA 1T11A 4QT2A 1W26A 3RFWA 3G6LA 4ODRA 3B9DA 1E6PA 2O9OA 2G41A 5HBFA 4G50A 4L3NA 2IF4A 1SYTA 4TW7A 1ZBKA 3JYMA 2Q5AA 3WL0A 3WH0A 4J4OA 3GPKA 1K9TA 4S3JA 2PV1A 3RGCA 1QPLA 3AS2A 1LL6A 3FAPA 3O5DA 1EIBA 1J6YA 3PA7A 2WM0A 5HKGA 3CGNA 4ZPVR 3O5PA 3OA5A 4W9QA 1WB0A 3B8SA 2AOSA 4DWSD 3CHCA 1LG2A 4TNSA 3ARQA 2KO7A 3O5LA 1FKTA 2LJ4A 4W9PA 3IKDA 4HBEA 4DIPA 3CZ8A 3KAGA 4MSPA 4MTVA 5DIUA 1JVWA 2PPPA 1CTNA 1W9VA 4DRPA 3ARUA 3WD0A 2DSVA 4DRKA 3PRDA 2XP3A 4G2PA 2IUZA 4DH0A 5DEZA 2WLYA 2DPEA 1U79A 1W1PA 4ML4A 2XP5A 1H0GA 1VF8A 3WL1A 4DRQA 2RUCA 3PR9A 2B31A 1WAWA 4JFJA 3CHDA 1J4IA 4JFKA 3NTPA 2FDMA 1OGBA 5DF0A 3IHZA 4DROA 4MNLA 3UF8A 3RM4A 2RUDA 1ROUA 1HJWA 3IK8A 3WIJA 4KQZA 5I98A 4LAVA 1FKRA 3WD4A 4P8XA 2ZQVA 1HJXA 2O92A 3KAIA 4Z2GA 2K8IA 5DIVA 4ODOA 4KR0B 3WD1A 2KE0A 1JNEA 2MLYA 4QT3A 4DRJA 1IX5A 4IQCA 4DWSB 5BXJA 4IT4A 4HBOA 2XP4A 2LPVA 2RUQA 1SR0A 2OLHA 1FKKA 2DT2A 4L72B 1A7XA 2VCDA 4ITZA 1P5QA 3O5FA 1C9HA 2PPOA 1OWQA 4AY1A 1QZ2A 3O5JA 4Z2JA 3KAFA 1ZK6A 1BL4A 2PI6A 3TDBA 4PTMA 1E9LA 1R9HA 2DT3A 4LAYA 1FAPA 1NWTA 1EYMA 1E6ZA 4HARA 3ALFA 4QZVB 3AS1A 1ZU8A 1OGGA 3G6MA 4W5UA 1LJYA 3AROA 2DT0A 4Z2IA 4DRMA 2FAPA 1HJVA 1W1YA 3WQVA 4P8UA 4NNRA 1PINA 3KAHA 3KZ7A 3OOBA 4U86A 3B9AA 2M1IA 1NMVA 1Y0OA 2PV2A 3RMEA 2XPAA 1Q6UA 4DRIA 1HKIA 2LGOA 4NSBA 4JYSA 4ODPA 1EQ3A 2DG3A 2RURA 4DT4A 5HT1A 4NZCA 2F21A 3IKGA 5HWBA 1D2KA 1FKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IHZ A;  4JFM A;  2LKN A;  3KAD A;  4DRO A;  1D7J A;  3UF8 A;  5HTG A;  3JYJ A;  4O2T A;  1FKI A;  1NSG A;  1YAT A;  2RUD A;  2RSE A;  2ZR4 A;  3KCE A;  1ROU A;  4ODM A;  2PV3 A;  1J4R A;  3IK8 A;  5HW8 A;  2M08 A;  2XP6 A;  3TC5 A;  1KT1 A;  1FKJ A;  4LAX A;  4LAV A;  3H9R B;  2KFW A;  5I98 A;  1FKR A;  2MNT A;  3NI6 A;  2Y78 A;  2PPN A;  2JZV A;  2ZQV A;  2DG9 A;  3UI5 A;  1Q6I A;  3KAI A;  3NRK A;  1D7H A;  3O5M A;  4JFI A;  4JFL A;  2K8I A;  3MDY B;  5DIV A;  1B6C A;  4ODO A;  1KT0 A;  3JXV A;  1FKD A;  4FN2 A;  4W9O A;  1BKF A;  2ZQS A;  1FKB A;  3EY6 A;  4GIV A;  2ITK A;  4J4N A;  3TCZ A;  4MGV A;  2KE0 A;  3PRB A;  2MLY A;  1FKL A;  1F8A B;  1T11 A;  1FD9 A;  2XPB A;  1W26 A;  4QT3 A;  4QT2 A;  3RFW A;  4TYO A;  4DRJ A;  1YW5 A;  4IQC A;  2ZQU A;  4ODR A;  4IPX A;  5BXJ A;  4DRN A;  4DZ2 A;  2XP4 A;  5B8I C;  1NMW A;  4C02 B;  1FKG A;  2LPV A;  2RUQ A;  5HUA A;  1FKH A;  5GPG A;  1QPF A;  2N87 A;  1FKK A;  2UZ5 A;  4G50 A;  3UQB A;  2IF4 A;  1A7X A;  4N19 A;  4TW7 A;  3JYM A;  2VCD A;  2MPH A;  4ITZ A;  1P5Q A;  2Q5A A;  3O5F A;  1C9H A;  3I6C A;  4R0X A;  4DRH A;  2ZR5 A;  3WH0 A;  2XP7 A;  2PPO A;  3UQI A;  4J4O A;  2XP9 A;  1QZ2 A;  3GPK A;  1FKF A;  3UQA A;  2PV1 A;  3O5I A;  3RGC A;  1QPL A;  3O5G A;  1M5Y A;  3O5J A;  5J6E A;  1FJD A;  3KAF A;  3FAP A;  1ZK6 A;  2MLZ A;  3O5D A;  1BL4 A;  1J6Y A;  3PA7 A;  1HXV A;  5HKG A;  3CGN A;  3O5P A;  4W9Q A;  3TDB A;  1R9H A;  5DIT A;  3CGM A;  4ODL A;  2D9F A;  3VAW A;  2ZR6 A;  3B7X A;  4LAY A;  1FAP A;  4ODK A;  2MLX A;  2AWG A;  4TNS A;  4IQ2 A;  3UI4 A;  3O5E A;  1EYM A;  5HW7 A;  2KO7 A;  3O5L A;  1FKT A;  2LJ4 A;  4W9P A;  2XP8 A;  3KAC A;  3KAB A;  3LUO A;  3IKD A;  4TX0 A;  4FAP A;  4TW8 A;  2MF9 A;  2KR7 A;  2RQS A;  4DIP A;  3KAG A;  4MSP A;  3ODK A;  4ODN A;  5DIU A;  4ODQ A;  1F40 A;  1JVW A;  2PPP A;  4DRP A;  4GGQ A;  1J4H A;  4DRM A;  2FAP A;  4TW6 A;  4DRK A;  4U84 A;  2KI3 A;  1PIN A;  3PRD A;  2OFN A;  2XP3 A;  4G2P A;  4NNR A;  4U85 A;  3KAH A;  3KZ7 A;  1N1A A;  1PBK A;  3OOB A;  4DH0 A;  1JNT A;  4BF8 A;  1Q6H A;  1D6O A;  1ROT A;  3O5Q A;  1U79 A;  2VN1 A;  4U86 A;  3UI6 A;  2M2A A;  2M1I A;  1NMV A;  2XP5 A;  2F2D A;  1Y0O A;  2ZQT A;  4LAW A;  2PV2 A;  1TCO C;  2KGJ A;  2XPA A;  1Q6U A;  4DRI A;  2DG4 A;  2L2S A;  2LGO A;  2F4E A;  4DRQ A;  2RUC A;  2PBC A;  3O5O A;  4JYS A;  5HWC A;  4ODP A;  4QIB A;  4DZ3 A;  1EQ3 A;  1L1P A;  2DG3 A;  2RUR A;  4DT4 A;  5HW6 A;  5HT1 A;  1JNS A;  2FKE A;  4JFJ A;  2F21 A;  1J4I A;  1Q1C A;  3IKG A;  5D75 A;  4JFK A;  5HWB A;  1D7I A;  3NTP A;  3O5R A;  1ZCN A;  3O5K A;  1FKS A; 
#chains in the Genus database with same CATH topology
 3KAD A;  1D7J A;  5HTG A;  3EIP A;  4O2T A;  1YAT A;  1NWR A;  2ZR4 A;  2WK2 A;  4Z2K A;  1ZBW A;  1J4R A;  2PV3 A;  5HW8 A;  2M08 A;  2XP6 A;  1TFV A;  4ZPW R;  2PPN A;  2JZV A;  1UR9 A;  3UI5 A;  1Q6I A;  4JFI A;  3NRK A;  1D7H A;  3ARS A;  3BMB A;  1GUV A;  4W9O A;  3ARP A;  4FN2 A;  4GIV A;  4MGV A;  3BXW A;  1FD9 A;  2ETN A;  2XPB A;  4MNJ A;  4TYO A;  2ZQU A;  2DSU A;  4IPX A;  1ZBV A;  3ALG A;  1KFW A;  3QOK A;  1NMW A;  4DZ2 A;  4WK9 A;  2A3B A;  4C02 B;  1FKG A;  5HUA A;  5GPG A;  3GTY X;  4ZPT R;  1UR8 A;  3UQB A;  2YBT A;  2G8Z A;  2MPH A;  3I6C A;  4R0X A;  2ZR5 A;  2XP7 A;  1O6I A;  2PN0 A;  2XP9 A;  3UQA A;  3O5G A;  1M5Y A;  5J6E A;  2MLZ A;  1JND A;  3CGM A;  4ODL A;  2D9F A;  1EHN A;  4ODK A;  1X6L A;  1X6N A;  4S3K A;  2ESC A;  5HW7 A;  3KAC A;  3KAB A;  4TX0 A;  1W1V A;  4TW8 A;  2MF9 A;  4WJX A;  3FY1 A;  1W9U A;  4WKF A;  3AS0 A;  3ODK A;  3CHE A;  3FXY A;  1F40 A;  4GGQ A;  1J4H A;  1WNO A;  2DSZ A;  4U84 A;  5DO2 A;  4R5E A;  4U85 A;  4P8V A;  1N1A A;  1PBK A;  4BF8 A;  3ARR A;  1D6O A;  4DWS A;  4Q7N A;  3UI6 A;  2M2A A;  2DT1 A;  2P4V A;  2ZQT A;  2F2D A;  4XAK A;  1ZL1 A;  4LGX A;  2L2S A;  1NH6 A;  4WIW A;  2F4E A;  2PBC A;  1FFQ A;  5HWC A;  4DZ3 A;  5HW6 A;  1GRJ A;  3ARZ A;  2FKE A;  1E6N A;  1Q1C A;  3O5R A;  1ZCN A;  4Z2H A;  3B9E A;  3O5K A;  3AQU A;  2LKN A;  4JFM A;  1RD6 A;  1LL7 A;  4URI A;  3JYJ A;  1FKI A;  1NSG A;  2RSE A;  3KCE A;  4ODM A;  5GQB A;  3TC5 A;  1FKJ A;  3WKZ A;  4LAX A;  2KFW A;  2A3E A;  2MNT A;  4WKH A;  3O5M A;  4JFL A;  3MDY B;  3ARY A;  3WD3 A;  1KT0 A;  3JXV A;  3WQW A;  1BKF A;  2ZQS A;  2ITK A;  1EDQ A;  3PRB A;  1FKL A;  4MNM A;  1W9P A;  1XHG A;  4IT6 A;  1YW5 A;  1ITX A;  2A3C A;  4DRN A;  4WKA A;  5B8I C;  1W1T A;  1FKH A;  1QPF A;  2N87 A;  4MPK A;  2UZ5 A;  4N19 A;  4DRH A;  4MAV A;  3UQI A;  1FKF A;  3O5I A;  1FJD A;  1HKM A;  2WLZ A;  3ARW A;  5DIT A;  3VAW A;  2ZR6 A;  2YBU A;  1NWS A;  3B7X A;  1GOI A;  1LL4 A;  2MLX A;  3W4R A;  2AWG A;  1FFR A;  4IQ2 A;  3UI4 A;  3O5E A;  2XP8 A;  3LUO A;  4FAP A;  1HKJ A;  4MNK A;  2KR7 A;  2RQS A;  5JH8 A;  4ODN A;  2QF8 A;  4ODQ A;  4DWS C;  3RM8 A;  1LQ0 A;  1E6R A;  4TW6 A;  2KI3 A;  2OFN A;  3PRA A;  4Z2L A;  2DSW A;  1JNT A;  5GPR A;  1Q6H A;  3ARV A;  1ROT A;  3O5Q A;  2VN1 A;  1GPF A;  4LAW A;  1TCO C;  2KGJ A;  1H0I A;  2DG4 A;  3O5O A;  3ARX A;  1L1P A;  1NWU A;  4QIB A;  1JNS A;  5D75 A;  1D7I A;  1E15 A;  1ZB5 A;  1LG1 A;  2A3A A;  3ART A;  3WD2 A;  1HXV A;  4Q22 A;  1KT1 A;  3RM9 A;  3H9R B;  1XRV A;  4ZS6 A;  3NI6 A;  2Y78 A;  4P8W A;  3CHF A;  2DG9 A;  2B5U B;  3AS3 A;  1B6C A;  1FKD A;  3CH9 A;  3EY6 A;  1FKB A;  4J4N A;  3TCZ A;  1HKK A;  1F8A B;  1ZBC A;  1T11 A;  4QT2 A;  1W26 A;  3RFW A;  3G6L A;  4ODR A;  3B9D A;  1E6P A;  2O9O A;  2G41 A;  5HBF A;  4G50 A;  4L3N A;  2IF4 A;  1SYT A;  4TW7 A;  1ZBK A;  3JYM A;  2Q5A A;  3WL0 A;  3WH0 A;  4J4O A;  3GPK A;  1K9T A;  1JCH B;  4S3J A;  2PV1 A;  3RGC A;  1QPL A;  3AS2 A;  1LL6 A;  3FAP A;  3O5D A;  1EIB A;  1J6Y A;  3PA7 A;  2WM0 A;  5HKG A;  3CGN A;  4ZPV R;  3O5P A;  3OA5 A;  4W9Q A;  1WB0 A;  3B8S A;  2AOS A;  4DWS D;  3CHC A;  1LG2 A;  4TNS A;  3ARQ A;  2KO7 A;  3O5L A;  1FKT A;  2LJ4 A;  4W9P A;  1E44 A;  3IKD A;  4HBE A;  4DIP A;  3CZ8 A;  3KAG A;  4MSP A;  4MTV A;  5DIU A;  1JVW A;  2PPP A;  1CTN A;  1W9V A;  4DRP A;  3ARU A;  3WD0 A;  2DSV A;  4DRK A;  3PRD A;  2XP3 A;  4G2P A;  2IUZ A;  4DH0 A;  5DEZ A;  2WLY A;  2DPE A;  1U79 A;  1W1P A;  4ML4 A;  2XP5 A;  1H0G A;  1VF8 A;  3WL1 A;  4DRQ A;  2RUC A;  3PR9 A;  2B31 A;  1WAW A;  4JFJ A;  3CHD A;  1J4I A;  4JFK A;  3NTP A;  2FDM A;  1OGB A;  5DF0 A;  3IHZ A;  4DRO A;  4MNL A;  3UF8 A;  3RM4 A;  2RUD A;  1ROU A;  1HJW A;  3GU0 A;  3IK8 A;  3WIJ A;  4KQZ A;  5I98 A;  4LAV A;  1FKR A;  3WD4 A;  4P8X A;  2ZQV A;  1HJX A;  2O92 A;  3KAI A;  4Z2G A;  2K8I A;  5DIV A;  4ODO A;  4KR0 B;  3WD1 A;  2F23 A;  2KE0 A;  1JNE A;  2MLY A;  4QT3 A;  4DRJ A;  1IX5 A;  4IQC A;  4DWS B;  5BXJ A;  4IT4 A;  4HBO A;  2XP4 A;  2LPV A;  2RUQ A;  1SR0 A;  2OLH A;  1FKK A;  2DT2 A;  4L72 B;  1A7X A;  2VCD A;  4ITZ A;  1P5Q A;  3O5F A;  1C9H A;  2PPO A;  1OWQ A;  4AY1 A;  1QZ2 A;  3O5J A;  4Z2J A;  3KAF A;  1ZK6 A;  1BL4 A;  2PI6 A;  3TDB A;  4PTM A;  1E9L A;  1R9H A;  2DT3 A;  4LAY A;  2EUL A;  1FAP A;  1NWT A;  1EYM A;  1E6Z A;  4HAR A;  3ALF A;  4QZV B;  3AS1 A;  1ZU8 A;  1OGG A;  3G6M A;  4W5U A;  1LJY A;  3ARO A;  2DT0 A;  4Z2I A;  4DRM A;  2FAP A;  1HJV A;  1W1Y A;  3WQV A;  4P8U A;  4NNR A;  1PIN A;  3KAH A;  3KZ7 A;  3OOB A;  4U86 A;  3B9A A;  2M1I A;  1NMV A;  1Y0O A;  2PV2 A;  3RME A;  4UDM A;  2XPA A;  1Q6U A;  4DRI A;  1HKI A;  2LGO A;  4NSB A;  4JYS A;  4ODP A;  1EQ3 A;  2DG3 A;  2RUR A;  4DT4 A;  5HT1 A;  4NZC A;  2F21 A;  3IKG A;  5HWB A;  1D2K A;  1FKS A; 
#chains in the Genus database with same CATH homology
 3KAD A;  1D7J A;  5HTG A;  4O2T A;  1YAT A;  1NWR A;  2ZR4 A;  2WK2 A;  4Z2K A;  1ZBW A;  1J4R A;  2PV3 A;  5HW8 A;  2M08 A;  2XP6 A;  1TFV A;  4ZPW R;  2PPN A;  2JZV A;  1UR9 A;  3UI5 A;  1Q6I A;  4JFI A;  3NRK A;  1D7H A;  3ARS A;  1GUV A;  4W9O A;  3ARP A;  4FN2 A;  4GIV A;  4MGV A;  3BXW A;  1FD9 A;  2XPB A;  4MNJ A;  4TYO A;  2ZQU A;  2DSU A;  4IPX A;  1ZBV A;  3ALG A;  1KFW A;  3QOK A;  1NMW A;  4DZ2 A;  4WK9 A;  2A3B A;  4C02 B;  1FKG A;  5HUA A;  5GPG A;  4ZPT R;  1UR8 A;  3UQB A;  2YBT A;  2G8Z A;  2MPH A;  3I6C A;  4R0X A;  2ZR5 A;  2XP7 A;  1O6I A;  2XP9 A;  3UQA A;  3O5G A;  1M5Y A;  5J6E A;  2MLZ A;  1JND A;  3CGM A;  4ODL A;  2D9F A;  1EHN A;  4ODK A;  1X6L A;  1X6N A;  4S3K A;  2ESC A;  5HW7 A;  3KAC A;  3KAB A;  4TX0 A;  1W1V A;  4TW8 A;  2MF9 A;  4WJX A;  3FY1 A;  1W9U A;  4WKF A;  3AS0 A;  3ODK A;  3CHE A;  3FXY A;  1F40 A;  4GGQ A;  1J4H A;  1WNO A;  2DSZ A;  4U84 A;  5DO2 A;  4R5E A;  4U85 A;  4P8V A;  1N1A A;  1PBK A;  4BF8 A;  3ARR A;  1D6O A;  4DWS A;  4Q7N A;  3UI6 A;  2M2A A;  2DT1 A;  2ZQT A;  2F2D A;  4XAK A;  1ZL1 A;  4LGX A;  2L2S A;  1NH6 A;  4WIW A;  2F4E A;  2PBC A;  1FFQ A;  5HWC A;  4DZ3 A;  5HW6 A;  3ARZ A;  2FKE A;  1E6N A;  1Q1C A;  3O5R A;  1ZCN A;  4Z2H A;  3B9E A;  3O5K A;  3AQU A;  2LKN A;  4JFM A;  1RD6 A;  1LL7 A;  4URI A;  3JYJ A;  1FKI A;  1NSG A;  2RSE A;  3KCE A;  4ODM A;  5GQB A;  3TC5 A;  1FKJ A;  3WKZ A;  4LAX A;  2KFW A;  2A3E A;  2MNT A;  4WKH A;  3O5M A;  4JFL A;  3MDY B;  3ARY A;  3WD3 A;  1KT0 A;  3JXV A;  3WQW A;  1BKF A;  2ZQS A;  2ITK A;  1EDQ A;  3PRB A;  1FKL A;  4MNM A;  1W9P A;  1XHG A;  4IT6 A;  1YW5 A;  1ITX A;  2A3C A;  4DRN A;  4WKA A;  5B8I C;  1W1T A;  1FKH A;  1QPF A;  2N87 A;  4MPK A;  2UZ5 A;  4N19 A;  4DRH A;  4MAV A;  3UQI A;  1FKF A;  3O5I A;  1FJD A;  1HKM A;  2WLZ A;  3ARW A;  5DIT A;  3VAW A;  2ZR6 A;  2YBU A;  1NWS A;  3B7X A;  1GOI A;  1LL4 A;  2MLX A;  3W4R A;  2AWG A;  1FFR A;  4IQ2 A;  3UI4 A;  3O5E A;  2XP8 A;  3LUO A;  4FAP A;  1HKJ A;  4MNK A;  2KR7 A;  2RQS A;  5JH8 A;  4ODN A;  2QF8 A;  4ODQ A;  4DWS C;  3RM8 A;  1LQ0 A;  1E6R A;  4TW6 A;  2KI3 A;  2OFN A;  3PRA A;  4Z2L A;  2DSW A;  1JNT A;  5GPR A;  1Q6H A;  3ARV A;  1ROT A;  3O5Q A;  2VN1 A;  1GPF A;  4LAW A;  1TCO C;  2KGJ A;  1H0I A;  2DG4 A;  3O5O A;  3ARX A;  1L1P A;  1NWU A;  4QIB A;  1JNS A;  5D75 A;  1D7I A;  1E15 A;  1ZB5 A;  1LG1 A;  2A3A A;  3ART A;  3WD2 A;  1HXV A;  4Q22 A;  1KT1 A;  3RM9 A;  3H9R B;  1XRV A;  4ZS6 A;  3NI6 A;  2Y78 A;  4P8W A;  3CHF A;  2DG9 A;  3AS3 A;  1B6C A;  1FKD A;  3CH9 A;  3EY6 A;  1FKB A;  4J4N A;  3TCZ A;  1HKK A;  1F8A B;  1ZBC A;  1T11 A;  4QT2 A;  1W26 A;  3RFW A;  3G6L A;  4ODR A;  3B9D A;  1E6P A;  2O9O A;  2G41 A;  5HBF A;  4G50 A;  4L3N A;  2IF4 A;  1SYT A;  4TW7 A;  1ZBK A;  3JYM A;  2Q5A A;  3WL0 A;  3WH0 A;  4J4O A;  3GPK A;  1K9T A;  4S3J A;  2PV1 A;  3RGC A;  1QPL A;  3AS2 A;  1LL6 A;  3FAP A;  3O5D A;  1EIB A;  1J6Y A;  3PA7 A;  2WM0 A;  5HKG A;  3CGN A;  4ZPV R;  3O5P A;  3OA5 A;  4W9Q A;  1WB0 A;  3B8S A;  2AOS A;  4DWS D;  3CHC A;  1LG2 A;  4TNS A;  3ARQ A;  2KO7 A;  3O5L A;  1FKT A;  2LJ4 A;  4W9P A;  3IKD A;  4HBE A;  4DIP A;  3CZ8 A;  3KAG A;  4MSP A;  4MTV A;  5DIU A;  1JVW A;  2PPP A;  1CTN A;  1W9V A;  4DRP A;  3ARU A;  3WD0 A;  2DSV A;  4DRK A;  3PRD A;  2XP3 A;  4G2P A;  2IUZ A;  4DH0 A;  5DEZ A;  2WLY A;  2DPE A;  1U79 A;  1W1P A;  4ML4 A;  2XP5 A;  1H0G A;  1VF8 A;  3WL1 A;  4DRQ A;  2RUC A;  3PR9 A;  2B31 A;  1WAW A;  4JFJ A;  3CHD A;  1J4I A;  4JFK A;  3NTP A;  2FDM A;  1OGB A;  5DF0 A;  3IHZ A;  4DRO A;  4MNL A;  3UF8 A;  3RM4 A;  2RUD A;  1ROU A;  1HJW A;  3IK8 A;  3WIJ A;  4KQZ A;  5I98 A;  4LAV A;  1FKR A;  3WD4 A;  4P8X A;  2ZQV A;  1HJX A;  2O92 A;  3KAI A;  4Z2G A;  2K8I A;  5DIV A;  4ODO A;  4KR0 B;  3WD1 A;  2KE0 A;  1JNE A;  2MLY A;  4QT3 A;  4DRJ A;  1IX5 A;  4IQC A;  4DWS B;  5BXJ A;  4IT4 A;  4HBO A;  2XP4 A;  2LPV A;  2RUQ A;  1SR0 A;  2OLH A;  1FKK A;  2DT2 A;  4L72 B;  1A7X A;  2VCD A;  4ITZ A;  1P5Q A;  3O5F A;  1C9H A;  2PPO A;  1OWQ A;  4AY1 A;  1QZ2 A;  3O5J A;  4Z2J A;  3KAF A;  1ZK6 A;  1BL4 A;  2PI6 A;  3TDB A;  4PTM A;  1E9L A;  1R9H A;  2DT3 A;  4LAY A;  1FAP A;  1NWT A;  1EYM A;  1E6Z A;  4HAR A;  3ALF A;  4QZV B;  3AS1 A;  1ZU8 A;  1OGG A;  3G6M A;  4W5U A;  1LJY A;  3ARO A;  2DT0 A;  4Z2I A;  4DRM A;  2FAP A;  1HJV A;  1W1Y A;  3WQV A;  4P8U A;  4NNR A;  1PIN A;  3KAH A;  3KZ7 A;  3OOB A;  4U86 A;  3B9A A;  2M1I A;  1NMV A;  1Y0O A;  2PV2 A;  3RME A;  2XPA A;  1Q6U A;  4DRI A;  1HKI A;  2LGO A;  4NSB A;  4JYS A;  4ODP A;  1EQ3 A;  2DG3 A;  2RUR A;  4DT4 A;  5HT1 A;  4NZC A;  2F21 A;  3IKG A;  5HWB A;  1D2K A;  1FKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...