3CGNA

Crystal structure of thermophilic slyd
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
151
structure length
151
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure Determination and Functional Characterization of the Metallochaperone SlyD from Thermus thermophilus
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase
total genus 28
structure length 151
sequence length 151
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3cgnA00
1Y0OA 4NNRA 2M1IA 2PV1A 3KAHA 1D7HA 3O5EA 3PA7A 4DT4A 1FKSA 1BKFA 2XP4A 3O5LA 4TX0A 1FKDA 3O5OA 1T11A 5D75A 3UI5A 4O2TA 3IHZA 3H9RB 5I98A 3CGNA 2XP5A 3JYMA 5B8IC 4IQ2A 1ROTA 4ODOA 2M08A 3PRDA 1PINA 2FKEA 2PBCA 3NRKA 3TCZA 1FJDA 3UI6A 2F2DA 4ODMA 2KFWA 2MPHA 4LAYA 2MLYA 2PPOA 2ZQSA 1A7XA 2ZQUA 3B7XA 1QPLA 3IKDA 1PBKA 1QPFA 4LAWA 3EY6A 4GIVA 4ODNA 1D7JA 2PV3A 3LUOA 1QZ2A 3UQIA 1NMWA 4DH0A 2KR7A 2MLXA 4W9PA 4DRNA 1FKGA 3KACA 3KABA 1EQ3A 4ODPA 4ITZA 3PRBA 3UQAA 5HUAA 2FAPA 2Q5AA 1EYMA 2ZR5A 4IPXA 2RQSA 1BL4A 4DZ2A 1YATA 3IKGA 4ODQA 3WH0A 1FKIA 3O5IA 4DZ3A 1FKRA 1JNSA 5GPGA 1J4IA 3O5PA 4TNSA 5HT1A 4ODKA 1FKJA 4W9QA 4MGVA 4DRIA 4DRMA 2XP9A 2D9FA 2XPAA 2ZQVA 2LJ4A 3KADA 3CGMA 5HWCA 3KAGA 1J4HA 2LGOA 4JFJA 5HW8A 1YW5A 3FAPA 1FKTA 1KT1A 3ODKA 4R0XA 1FD9A 2RUCA 3O5QA 2UZ5A 5DITA 4DROA 1JNTA 2KE0A 3O5FA 4JFMA 1FKKA 1NMVA 2Y78A 5HW7A 4LAXA 3O5GA 1ZCNA 4C02B 4ODLA 3UF8A 1ROUA 4J4NA 3O5MA 4DRQA 2RURA 2XPBA 4QT3A 2KI3A 4DIPA 2DG9A 2IF4A 1TCOC 1R9HA 2VN1A 1N1AA 2DG3A 1Q1CA 4G2PA 2M2AA 2KO7A 3RGCA 4J4OA 4N19A 3KCEA 5HWBA 3O5KA 2PPPA 2JZVA 5J6EA 2PV2A 1NSGA 2VCDA 4FAPA 4G50A 3GPKA 3OOBA 4U84A 2KGJA 1M5YA 1FKBA 2XP6A 4W9OA 3O5RA 4ODRA 1U79A 2L2SA 1KT0A 2XP3A 2LKNA 3RFWA 5HKGA 4JFIA 1F40A 2F4EA 1F8AB 1C9HA 2XP7A 3IK8A 1FKLA 1FKFA 1ZK6A 3UQBA 2MNTA 4JYSA 4TW7A 4JFLA 1W26A 4QT2A 1P5QA 4DRJA 1J4RA 1J6YA 4DRHA 1HXVA 2AWGA 2ZR6A 3KAIA 3NTPA 5HTGA 1L1PA 5DIVA 2MF9A 3O5JA 4U85A 1FAPA 3KZ7A 3KAFA 3O5DA 4FN2A 3MDYB 3TC5A 5BXJA 2ZR4A 1D6OA 2OFNA 2DG4A 1JVWA 4GGQA 2RUQA 4TYOA 2MLZA 4DRPA 4BF8A 3TDBA 4JFKA 1B6CA 4TW8A 4U86A 4QIBA 2RSEA 4TW6A 2ITKA 2LPVA 2XP8A 3VAWA 5DIUA 2RUDA 3JYJA 2F21A 1D7IA 4LAVA 1FKHA 2ZQTA 1Q6UA 3I6CA 3JXVA 4IQCA 3UI4A 5HW6A 3NI6A 2PPNA 4MSPA 2K8IA 4DRKA 1Q6HA 1Q6IA 2N87A
chains in the Genus database with same CATH superfamily
2M1IA 2PV1A 3KAHA 2XP4A 1GOIA 3UI5A 3WD1A 3JYMA 5B8IC 4IQ2A 3TCZA 3NRKA 1FJDA 3UI6A 1E9LA 2PPOA 1NWUA 2ETNA 1ZBVA 1D7JA 3UQIA 2KR7A 1FKGA 3KACA 3KABA 2DSZA 4ODPA 4ITZA 3WL0A 4URIA 2AOSA 1SR0A 1X6NA 5DF0A 2RQSA 1ZL1A 1BL4A 4DZ2A 2YBUA 3IKGA 1CTNA 4DZ3A 1HJVA 5GPGA 1E6ZA 1J4IA 5HT1A 1W1TA 1K9TA 2DSUA 2IUZA 5GPRA 3KAGA 1NWSA 4JFJA 1FFRA 4R0XA 1FKTA 1KT1A 3ODKA 3O5QA 3O5FA 3QOKA 1LG1A 1FKKA 4LAXA 3O5GA 3UF8A 1ROUA 4QT3A 4DIPA 3PRAA 1R9HA 1E6PA 4G2PA 3CHFA 1EDQA 2M2AA 4WKAA 4WJXA 2YBTA 3RGCA 3KCEA 4ZPTR 4Z2GA 1E44A 4U84A 4AY1A 3B9AA 4W9OA 4ODRA 1LL6A 2XP3A 1F40A 4MAVA 4JFIA 5HBFA 1ZK6A 3ARWA 4JFLA 4QT2A 2A3AA 4DRJA 4KR0B 4Z2HA 1EIBA 2MF9A 3RM8A 4U85A 1KFWA 4HBOA 3O5DA 2G8ZA 2OFNA 2DG4A 4TYOA 4GGQA 2RUQA 1JCHB 1B6CA 1GRJA 4QIBA 3WKZA 2ITKA 3ARVA 1NWTA 4Q22A 1FKHA 1OGBA 2WM0A 3B9DA 4HARA 1Q6HA 1HJWA 2WK2A 4DT4A 3PA7A 1BKFA 1FKDA 3O5OA 1T11A 3H9RB 3CGNA 1H0GA 2FKEA 4ODMA 2KFWA 4LAYA 2ZQSA 2ZQUA 1GPFA 2B5UB 3EY6A 4GIVA 4ML4A 4ODNA 2PV3A 3OA5A 4DRNA 1EQ3A 1XHGA 3PRBA 1E6NA 2Q5AA 4ODQA 1FKIA 3WD0A 1FKRA 3O5PA 4TNSA 1UR8A 1FKJA 4DRMA 4MGVA 2ZQVA 2LJ4A 1ZU8A 1ZBKA 1J4HA 4WK9A 1YW5A 3B9EA 2RUCA 1HKKA 4KQZA 3G6LA 4J4NA 2OLHA 2KI3A 1OWQA 2FDMA 2DG9A 2VN1A 1TCOC 2DG3A 1Q1CA 1W1PA 3ARZA 4J4OA 1FFQA 5HWBA 2PPPA 2PV2A 4Z2IA 2XP6A 4QZVB 3IK8A 1LQ0A 5JH8A 1FKLA 1W26A 1P5QA 1J4RA 2ZR6A 3WIJA 3WQVA 5DIVA 3CH9A 4FN2A 3KAFA 3RM4A 1LL4A 3MDYB 2QF8A 2ZR4A 2P4VA 1ZBWA 4S3JA 3ALFA 4JFKA 3TDBA 4TW8A 4L72B 4U86A 2RSEA 1X6LA 4TW6A 2LPVA 2XP8A 3AROA 5DIUA 3ARYA 4R5EA 3CHDA 4NZCA 3UI4A 5HW6A 2DT2A 4C02B 3WQWA 3O5JA 4DWSD 1D7HA 3ALGA 4TX0A 3O5LA 1LJYA 4ZPVR 3IHZA 2O9OA 2DT0A 3PR9A 1WB0A 1ROTA 1ZBCA 4ODOA 2F2DA 1VF8A 2MPHA 3AS2A 3B7XA 2DSVA 3CZ8A 3AS0A 4LAWA 4PTMA 2DT3A 3ARXA 1NMWA 4MTVA 4DWSA 4W9PA 3FXYA 2ZR5A 4IPXA 4UDMA 4XAKA 3ARRA 3WH0A 3O5IA 4DWSB 1JNSA 3AQUA 4ODKA 2XP9A 2XPAA 5HWCA 1HJXA 2LGOA 3GTYX 5DITA 4DROA 3ARSA 1JNTA 4JFMA 5HW7A 2Y78A 4DRQA 3O5MA 2RURA 2A3BA 1N1AA 2B31A 1NWRA 3WD4A 4N19A 1LG2A 2JZVA 4P8VA 5DO2A 5J6EA 1NSGA 2VCDA 4FAPA 3OOBA 4MNMA 4Z2LA 1M5YA 3RFWA 1U79A 2L2SA 5HKGA 4Z2JA 4LGXA 3WD2A 2F4EA 2O92A 1F8AB 1C9HA 3FY1A 1FKFA 3UQBA 2MNTA 4JYSA 4TW7A 3BMBA 2PN0A 2AWGA 3BXWA 2WLYA 1TFVA 4L3NA 4ZS6A 4W5UA 4DWSC 3KZ7A 1ITXA 3TC5A 1RD6A 5BXJA 1D6OA 4DRPA 1D2KA 1W1YA 1O6IA 1NH6A 1WAWA 3ARPA 4MNJA 2F21A 4LAVA 1LL7A 2ZQTA 1WNOA 1Q6UA 3I6CA 3JXVA 5DEZA 1HKMA 4ZPWR 3GU0A 4MSPA 2K8IA 4P8WA 4DRKA 1Q6IA 1Y0OA 4NNRA 3AS1A 1SYTA 3B8SA 3O5EA 1FKSA 2F23A 5D75A 4O2TA 5I98A 2XP5A 3EIPA 3G6MA 2M08A 3PRDA 1PINA 2PBCA 1W9PA 2WLZA 1ZB5A 2MLYA 5GQBA 1A7XA 4IT4A 1QPLA 3IKDA 1PBKA 1QPFA 1HKIA 4P8UA 3LUOA 4DH0A 1QZ2A 3WL1A 2MLXA 3W4RA 3UQAA 5HUAA 2FAPA 3ARUA 1EYMA 1YATA 3ARTA 4DRIA 4W9QA 2D9FA 3KADA 3CGMA 2ESCA 1JNDA 4MNLA 1OGGA 4WKFA 5HW8A 4MNKA 3FAPA 1FD9A 2UZ5A 2KE0A 1NMVA 1ZCNA 4ODLA 2XPBA 1E6RA 2IF4A 4MPKA 3RM9A 3AS3A 2PI6A 2KO7A 3CHEA 1XRVA 3O5KA 1UR9A 4Z2KA 4G50A 3GPKA 2KGJA 1FKBA 3O5RA 3CHCA 1KT0A 2LKNA 2XP7A 1IX5A 1W9VA 1W9UA 4S3KA 1EHNA 1H0IA 4WKHA 1J6YA 4DRHA 1HXVA 3KAIA 3NTPA 4IT6A 5HTGA 2A3CA 1L1PA 3WD3A 3ARQA 1HKJA 2DT1A 1FAPA 1GUVA 4Q7NA 1JVWA 2MLZA 2A3EA 4BF8A 1E15A 1JNEA 3RMEA 3VAWA 2RUDA 3JYJA 1D7IA 4P8XA 2DSWA 2G41A 4IQCA 2DPEA 4WIWA 3NI6A 2PPNA 1W1VA 4HBEA 2EULA 4NSBA 2N87A
chains in the Genus database with same CATH topology
2M1IA 2PV1A 3KAHA 2XP4A 1GOIA 3UI5A 3WD1A 3JYMA 5B8IC 4IQ2A 3TCZA 3NRKA 1FJDA 3UI6A 1E9LA 2PPOA 1NWUA 1ZBVA 1D7JA 3UQIA 2KR7A 1FKGA 3KACA 3KABA 2DSZA 4ODPA 4ITZA 3WL0A 4URIA 2AOSA 1SR0A 1X6NA 5DF0A 2RQSA 1ZL1A 1BL4A 4DZ2A 2YBUA 3IKGA 1CTNA 4DZ3A 1HJVA 5GPGA 1E6ZA 1J4IA 5HT1A 1W1TA 1K9TA 2DSUA 2IUZA 5GPRA 3KAGA 1NWSA 4JFJA 1FFRA 4R0XA 1FKTA 1KT1A 3ODKA 3O5QA 3O5FA 3QOKA 1LG1A 1FKKA 4LAXA 3O5GA 3UF8A 1ROUA 4QT3A 4DIPA 3PRAA 1R9HA 1E6PA 4G2PA 3CHFA 1EDQA 2M2AA 4WKAA 4WJXA 2YBTA 3RGCA 3KCEA 4ZPTR 4Z2GA 4U84A 4AY1A 3B9AA 4W9OA 4ODRA 1LL6A 2XP3A 1F40A 4MAVA 4JFIA 5HBFA 1ZK6A 3ARWA 4JFLA 4QT2A 2A3AA 4DRJA 4KR0B 4Z2HA 1EIBA 2MF9A 3RM8A 4U85A 1KFWA 4HBOA 3O5DA 2G8ZA 2OFNA 2DG4A 4TYOA 4GGQA 2RUQA 1B6CA 4QIBA 3WKZA 2ITKA 3ARVA 1NWTA 4Q22A 1FKHA 1OGBA 2WM0A 3B9DA 4HARA 1Q6HA 1HJWA 2WK2A 4DT4A 3PA7A 1BKFA 1FKDA 3O5OA 1T11A 3H9RB 3CGNA 1H0GA 2FKEA 4ODMA 2KFWA 4LAYA 2ZQSA 2ZQUA 1GPFA 3EY6A 4GIVA 4ML4A 4ODNA 2PV3A 3OA5A 4DRNA 1EQ3A 1XHGA 3PRBA 1E6NA 2Q5AA 4ODQA 1FKIA 3WD0A 1FKRA 3O5PA 4TNSA 1UR8A 1FKJA 4DRMA 4MGVA 2ZQVA 2LJ4A 1ZU8A 1ZBKA 1J4HA 4WK9A 1YW5A 3B9EA 2RUCA 1HKKA 4KQZA 3G6LA 4J4NA 2OLHA 2KI3A 1OWQA 2FDMA 2DG9A 2VN1A 1TCOC 2DG3A 1Q1CA 1W1PA 3ARZA 4J4OA 1FFQA 5HWBA 2PPPA 2PV2A 4Z2IA 2XP6A 4QZVB 3IK8A 1LQ0A 5JH8A 1FKLA 1W26A 1P5QA 1J4RA 2ZR6A 3WIJA 3WQVA 5DIVA 3CH9A 4FN2A 3KAFA 3RM4A 1LL4A 3MDYB 2QF8A 2ZR4A 1ZBWA 4S3JA 3ALFA 4JFKA 3TDBA 4TW8A 4L72B 4U86A 2RSEA 1X6LA 4TW6A 2LPVA 2XP8A 3AROA 5DIUA 3ARYA 4R5EA 3CHDA 4NZCA 3UI4A 5HW6A 2DT2A 4C02B 3WQWA 3O5JA 4DWSD 1D7HA 3ALGA 4TX0A 3O5LA 1LJYA 4ZPVR 3IHZA 2O9OA 2DT0A 3PR9A 1WB0A 1ROTA 1ZBCA 4ODOA 2F2DA 1VF8A 2MPHA 3AS2A 3B7XA 2DSVA 3AS0A 3CZ8A 4LAWA 4PTMA 2DT3A 3ARXA 1NMWA 4MTVA 4DWSA 4W9PA 3FXYA 2ZR5A 4IPXA 4XAKA 3ARRA 3WH0A 3O5IA 4DWSB 1JNSA 3AQUA 4ODKA 2XP9A 2XPAA 5HWCA 1HJXA 2LGOA 5DITA 4DROA 3ARSA 1JNTA 4JFMA 5HW7A 2Y78A 4DRQA 3O5MA 2RURA 2A3BA 1N1AA 2B31A 1NWRA 3WD4A 4N19A 1LG2A 2JZVA 4P8VA 5DO2A 5J6EA 1NSGA 2VCDA 4FAPA 3OOBA 4MNMA 4Z2LA 1M5YA 3RFWA 1U79A 2L2SA 5HKGA 4Z2JA 4LGXA 3WD2A 2F4EA 2O92A 1F8AB 1C9HA 3FY1A 1FKFA 3UQBA 2MNTA 4JYSA 4TW7A 2AWGA 3BXWA 2WLYA 1TFVA 4L3NA 4ZS6A 4W5UA 4DWSC 3KZ7A 1ITXA 3TC5A 1RD6A 5BXJA 1D6OA 4DRPA 1D2KA 1W1YA 1O6IA 1NH6A 1WAWA 3ARPA 4MNJA 2F21A 4LAVA 1LL7A 2ZQTA 1WNOA 1Q6UA 3I6CA 3JXVA 5DEZA 1HKMA 4ZPWR 4MSPA 2K8IA 4P8WA 4DRKA 1Q6IA 1Y0OA 4NNRA 3AS1A 1SYTA 3B8SA 3O5EA 1FKSA 5D75A 4O2TA 5I98A 2XP5A 3G6MA 2M08A 3PRDA 1PINA 2PBCA 1W9PA 2WLZA 1ZB5A 2MLYA 5GQBA 1A7XA 4IT4A 1QPLA 3IKDA 1PBKA 1QPFA 1HKIA 4P8UA 3LUOA 4DH0A 1QZ2A 3WL1A 2MLXA 3W4RA 3UQAA 5HUAA 2FAPA 3ARUA 1EYMA 1YATA 3ARTA 4DRIA 4W9QA 2D9FA 3KADA 3CGMA 2ESCA 1JNDA 4MNLA 1OGGA 4WKFA 5HW8A 4MNKA 3FAPA 1FD9A 2UZ5A 2KE0A 1NMVA 1ZCNA 4ODLA 2XPBA 1E6RA 2IF4A 4MPKA 3RM9A 3AS3A 2PI6A 2KO7A 3CHEA 1XRVA 3O5KA 1UR9A 4Z2KA 4G50A 3GPKA 2KGJA 1FKBA 3O5RA 3CHCA 1KT0A 2LKNA 2XP7A 1IX5A 1W9VA 1W9UA 4S3KA 1EHNA 1H0IA 4WKHA 1J6YA 4DRHA 1HXVA 3KAIA 3NTPA 4IT6A 5HTGA 2A3CA 1L1PA 3WD3A 3ARQA 1HKJA 2DT1A 1FAPA 1GUVA 4Q7NA 1JVWA 2MLZA 2A3EA 4BF8A 1E15A 1JNEA 3RMEA 3VAWA 2RUDA 3JYJA 1D7IA 4P8XA 2DSWA 2G41A 4IQCA 2DPEA 4WIWA 3NI6A 2PPNA 1W1VA 4HBEA 4NSBA 2N87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y0O A;  4NNR A;  2M1I A;  2PV1 A;  3KAH A;  1D7H A;  3O5E A;  3PA7 A;  4DT4 A;  1FKS A;  1BKF A;  2XP4 A;  3O5L A;  4TX0 A;  1FKD A;  3O5O A;  1T11 A;  5D75 A;  3UI5 A;  4O2T A;  3IHZ A;  3H9R B;  5I98 A;  3CGN A;  2XP5 A;  3JYM A;  5B8I C;  4IQ2 A;  1ROT A;  4ODO A;  2M08 A;  3PRD A;  1PIN A;  2FKE A;  2PBC A;  3NRK A;  3TCZ A;  1FJD A;  3UI6 A;  2F2D A;  4ODM A;  2KFW A;  2MPH A;  4LAY A;  2MLY A;  2PPO A;  2ZQS A;  1A7X A;  2ZQU A;  3B7X A;  1QPL A;  3IKD A;  1PBK A;  1QPF A;  4LAW A;  3EY6 A;  4GIV A;  4ODN A;  1D7J A;  2PV3 A;  3LUO A;  1QZ2 A;  3UQI A;  1NMW A;  4DH0 A;  2KR7 A;  2MLX A;  4W9P A;  4DRN A;  1FKG A;  3KAC A;  3KAB A;  1EQ3 A;  4ODP A;  4ITZ A;  3PRB A;  3UQA A;  5HUA A;  2FAP A;  2Q5A A;  1EYM A;  2ZR5 A;  4IPX A;  2RQS A;  1BL4 A;  4DZ2 A;  1YAT A;  3IKG A;  4ODQ A;  3WH0 A;  1FKI A;  3O5I A;  4DZ3 A;  1FKR A;  1JNS A;  5GPG A;  1J4I A;  3O5P A;  4TNS A;  5HT1 A;  4ODK A;  1FKJ A;  4W9Q A;  4MGV A;  4DRI A;  4DRM A;  2XP9 A;  2D9F A;  2XPA A;  2ZQV A;  2LJ4 A;  3KAD A;  3CGM A;  5HWC A;  3KAG A;  1J4H A;  2LGO A;  4JFJ A;  5HW8 A;  1YW5 A;  3FAP A;  1FKT A;  1KT1 A;  3ODK A;  4R0X A;  1FD9 A;  2RUC A;  3O5Q A;  2UZ5 A;  5DIT A;  4DRO A;  1JNT A;  2KE0 A;  3O5F A;  4JFM A;  1FKK A;  1NMV A;  2Y78 A;  5HW7 A;  4LAX A;  3O5G A;  1ZCN A;  4C02 B;  4ODL A;  3UF8 A;  1ROU A;  4J4N A;  3O5M A;  4DRQ A;  2RUR A;  2XPB A;  4QT3 A;  2KI3 A;  4DIP A;  2DG9 A;  2IF4 A;  1TCO C;  1R9H A;  2VN1 A;  1N1A A;  2DG3 A;  1Q1C A;  4G2P A;  2M2A A;  2KO7 A;  3RGC A;  4J4O A;  4N19 A;  3KCE A;  5HWB A;  3O5K A;  2PPP A;  2JZV A;  5J6E A;  2PV2 A;  1NSG A;  2VCD A;  4FAP A;  4G50 A;  3GPK A;  3OOB A;  4U84 A;  2KGJ A;  1M5Y A;  1FKB A;  2XP6 A;  4W9O A;  3O5R A;  4ODR A;  1U79 A;  2L2S A;  1KT0 A;  2XP3 A;  2LKN A;  3RFW A;  5HKG A;  4JFI A;  1F40 A;  2F4E A;  1F8A B;  1C9H A;  2XP7 A;  3IK8 A;  1FKL A;  1FKF A;  1ZK6 A;  3UQB A;  2MNT A;  4JYS A;  4TW7 A;  4JFL A;  1W26 A;  4QT2 A;  1P5Q A;  4DRJ A;  1J4R A;  1J6Y A;  4DRH A;  1HXV A;  2AWG A;  2ZR6 A;  3KAI A;  3NTP A;  5HTG A;  1L1P A;  5DIV A;  2MF9 A;  3O5J A;  4U85 A;  1FAP A;  3KZ7 A;  3KAF A;  3O5D A;  4FN2 A;  3MDY B;  3TC5 A;  5BXJ A;  2ZR4 A;  1D6O A;  2OFN A;  2DG4 A;  1JVW A;  4GGQ A;  2RUQ A;  4TYO A;  2MLZ A;  4DRP A;  4BF8 A;  3TDB A;  4JFK A;  1B6C A;  4TW8 A;  4U86 A;  4QIB A;  2RSE A;  4TW6 A;  2ITK A;  2LPV A;  2XP8 A;  3VAW A;  5DIU A;  2RUD A;  3JYJ A;  2F21 A;  1D7I A;  4LAV A;  1FKH A;  2ZQT A;  1Q6U A;  3I6C A;  3JXV A;  4IQC A;  3UI4 A;  5HW6 A;  3NI6 A;  2PPN A;  4MSP A;  2K8I A;  4DRK A;  1Q6H A;  1Q6I A;  2N87 A; 
#chains in the Genus database with same CATH topology
 2M1I A;  2PV1 A;  3KAH A;  2XP4 A;  1GOI A;  3UI5 A;  3WD1 A;  3JYM A;  5B8I C;  4IQ2 A;  3TCZ A;  3NRK A;  1FJD A;  3UI6 A;  1E9L A;  2PPO A;  1NWU A;  2ETN A;  1ZBV A;  1D7J A;  3UQI A;  2KR7 A;  1FKG A;  3KAC A;  3KAB A;  2DSZ A;  4ODP A;  4ITZ A;  3WL0 A;  4URI A;  2AOS A;  1SR0 A;  1X6N A;  5DF0 A;  2RQS A;  1ZL1 A;  1BL4 A;  4DZ2 A;  2YBU A;  3IKG A;  1CTN A;  4DZ3 A;  1HJV A;  5GPG A;  1E6Z A;  1J4I A;  5HT1 A;  1W1T A;  1K9T A;  2DSU A;  2IUZ A;  5GPR A;  3KAG A;  1NWS A;  4JFJ A;  1FFR A;  4R0X A;  1FKT A;  1KT1 A;  3ODK A;  3O5Q A;  3O5F A;  3QOK A;  1LG1 A;  1FKK A;  4LAX A;  3O5G A;  3UF8 A;  1ROU A;  4QT3 A;  4DIP A;  3PRA A;  1R9H A;  1E6P A;  4G2P A;  3CHF A;  1EDQ A;  2M2A A;  4WKA A;  4WJX A;  2YBT A;  3RGC A;  3KCE A;  4ZPT R;  4Z2G A;  1E44 A;  4U84 A;  4AY1 A;  3B9A A;  4W9O A;  4ODR A;  1LL6 A;  2XP3 A;  1F40 A;  4MAV A;  4JFI A;  5HBF A;  1ZK6 A;  3ARW A;  4JFL A;  4QT2 A;  2A3A A;  4DRJ A;  4KR0 B;  4Z2H A;  1EIB A;  2MF9 A;  3RM8 A;  4U85 A;  1KFW A;  4HBO A;  3O5D A;  2G8Z A;  2OFN A;  2DG4 A;  4TYO A;  4GGQ A;  2RUQ A;  1JCH B;  1B6C A;  1GRJ A;  4QIB A;  3WKZ A;  2ITK A;  3ARV A;  1NWT A;  4Q22 A;  1FKH A;  1OGB A;  2WM0 A;  3B9D A;  4HAR A;  1Q6H A;  1HJW A;  2WK2 A;  4DT4 A;  3PA7 A;  1BKF A;  1FKD A;  3O5O A;  1T11 A;  3H9R B;  3CGN A;  1H0G A;  2FKE A;  4ODM A;  2KFW A;  4LAY A;  2ZQS A;  2ZQU A;  1GPF A;  2B5U B;  3EY6 A;  4GIV A;  4ML4 A;  4ODN A;  2PV3 A;  3OA5 A;  4DRN A;  1EQ3 A;  1XHG A;  3PRB A;  1E6N A;  2Q5A A;  4ODQ A;  1FKI A;  3WD0 A;  1FKR A;  3O5P A;  4TNS A;  1UR8 A;  1FKJ A;  4DRM A;  4MGV A;  2ZQV A;  2LJ4 A;  1ZU8 A;  1ZBK A;  1J4H A;  4WK9 A;  1YW5 A;  3B9E A;  2RUC A;  1HKK A;  4KQZ A;  3G6L A;  4J4N A;  2OLH A;  2KI3 A;  1OWQ A;  2FDM A;  2DG9 A;  2VN1 A;  1TCO C;  2DG3 A;  1Q1C A;  1W1P A;  3ARZ A;  4J4O A;  1FFQ A;  5HWB A;  2PPP A;  2PV2 A;  4Z2I A;  2XP6 A;  4QZV B;  3IK8 A;  1LQ0 A;  5JH8 A;  1FKL A;  1W26 A;  1P5Q A;  1J4R A;  2ZR6 A;  3WIJ A;  3WQV A;  5DIV A;  3CH9 A;  4FN2 A;  3KAF A;  3RM4 A;  1LL4 A;  3MDY B;  2QF8 A;  2ZR4 A;  2P4V A;  1ZBW A;  4S3J A;  3ALF A;  4JFK A;  3TDB A;  4TW8 A;  4L72 B;  4U86 A;  2RSE A;  1X6L A;  4TW6 A;  2LPV A;  2XP8 A;  3ARO A;  5DIU A;  3ARY A;  4R5E A;  3CHD A;  4NZC A;  3UI4 A;  5HW6 A;  2DT2 A;  4C02 B;  3WQW A;  3O5J A;  4DWS D;  1D7H A;  3ALG A;  4TX0 A;  3O5L A;  1LJY A;  4ZPV R;  3IHZ A;  2O9O A;  2DT0 A;  3PR9 A;  1WB0 A;  1ROT A;  1ZBC A;  4ODO A;  2F2D A;  1VF8 A;  2MPH A;  3AS2 A;  3B7X A;  2DSV A;  3CZ8 A;  3AS0 A;  4LAW A;  4PTM A;  2DT3 A;  3ARX A;  1NMW A;  4MTV A;  4DWS A;  4W9P A;  3FXY A;  2ZR5 A;  4IPX A;  4UDM A;  4XAK A;  3ARR A;  3WH0 A;  3O5I A;  4DWS B;  1JNS A;  3AQU A;  4ODK A;  2XP9 A;  2XPA A;  5HWC A;  1HJX A;  2LGO A;  3GTY X;  5DIT A;  4DRO A;  3ARS A;  1JNT A;  4JFM A;  5HW7 A;  2Y78 A;  4DRQ A;  3O5M A;  2RUR A;  2A3B A;  1N1A A;  2B31 A;  1NWR A;  3WD4 A;  4N19 A;  1LG2 A;  2JZV A;  4P8V A;  5DO2 A;  5J6E A;  1NSG A;  2VCD A;  4FAP A;  3OOB A;  4MNM A;  4Z2L A;  1M5Y A;  3RFW A;  1U79 A;  2L2S A;  5HKG A;  4Z2J A;  4LGX A;  3WD2 A;  2F4E A;  2O92 A;  1F8A B;  1C9H A;  3FY1 A;  1FKF A;  3UQB A;  2MNT A;  4JYS A;  4TW7 A;  3BMB A;  2PN0 A;  2AWG A;  3BXW A;  2WLY A;  1TFV A;  4L3N A;  4ZS6 A;  4W5U A;  4DWS C;  3KZ7 A;  1ITX A;  3TC5 A;  1RD6 A;  5BXJ A;  1D6O A;  4DRP A;  1D2K A;  1W1Y A;  1O6I A;  1NH6 A;  1WAW A;  3ARP A;  4MNJ A;  2F21 A;  4LAV A;  1LL7 A;  2ZQT A;  1WNO A;  1Q6U A;  3I6C A;  3JXV A;  5DEZ A;  1HKM A;  4ZPW R;  3GU0 A;  4MSP A;  2K8I A;  4P8W A;  4DRK A;  1Q6I A;  1Y0O A;  4NNR A;  3AS1 A;  1SYT A;  3B8S A;  3O5E A;  1FKS A;  2F23 A;  5D75 A;  4O2T A;  5I98 A;  2XP5 A;  3EIP A;  3G6M A;  2M08 A;  3PRD A;  1PIN A;  2PBC A;  1W9P A;  2WLZ A;  1ZB5 A;  2MLY A;  5GQB A;  1A7X A;  4IT4 A;  1QPL A;  3IKD A;  1PBK A;  1QPF A;  1HKI A;  4P8U A;  3LUO A;  4DH0 A;  1QZ2 A;  3WL1 A;  2MLX A;  3W4R A;  3UQA A;  5HUA A;  2FAP A;  3ARU A;  1EYM A;  1YAT A;  3ART A;  4DRI A;  4W9Q A;  2D9F A;  3KAD A;  3CGM A;  2ESC A;  1JND A;  4MNL A;  1OGG A;  4WKF A;  5HW8 A;  4MNK A;  3FAP A;  1FD9 A;  2UZ5 A;  2KE0 A;  1NMV A;  1ZCN A;  4ODL A;  2XPB A;  1E6R A;  2IF4 A;  4MPK A;  3RM9 A;  3AS3 A;  2PI6 A;  2KO7 A;  3CHE A;  1XRV A;  3O5K A;  1UR9 A;  4Z2K A;  4G50 A;  3GPK A;  2KGJ A;  1FKB A;  3O5R A;  3CHC A;  1KT0 A;  2LKN A;  2XP7 A;  1IX5 A;  1W9V A;  1W9U A;  4S3K A;  1EHN A;  1H0I A;  4WKH A;  1J6Y A;  4DRH A;  1HXV A;  3KAI A;  3NTP A;  4IT6 A;  5HTG A;  2A3C A;  1L1P A;  3WD3 A;  3ARQ A;  1HKJ A;  2DT1 A;  1FAP A;  1GUV A;  4Q7N A;  1JVW A;  2MLZ A;  2A3E A;  4BF8 A;  1E15 A;  1JNE A;  3RME A;  3VAW A;  2RUD A;  3JYJ A;  1D7I A;  4P8X A;  2DSW A;  2G41 A;  4IQC A;  2DPE A;  4WIW A;  3NI6 A;  2PPN A;  1W1V A;  4HBE A;  2EUL A;  4NSB A;  2N87 A; 
#chains in the Genus database with same CATH homology
 2M1I A;  2PV1 A;  3KAH A;  2XP4 A;  1GOI A;  3UI5 A;  3WD1 A;  3JYM A;  5B8I C;  4IQ2 A;  3TCZ A;  3NRK A;  1FJD A;  3UI6 A;  1E9L A;  2PPO A;  1NWU A;  1ZBV A;  1D7J A;  3UQI A;  2KR7 A;  1FKG A;  3KAC A;  3KAB A;  2DSZ A;  4ODP A;  4ITZ A;  3WL0 A;  4URI A;  2AOS A;  1SR0 A;  1X6N A;  5DF0 A;  2RQS A;  1ZL1 A;  1BL4 A;  4DZ2 A;  2YBU A;  3IKG A;  1CTN A;  4DZ3 A;  1HJV A;  5GPG A;  1E6Z A;  1J4I A;  5HT1 A;  1W1T A;  1K9T A;  2DSU A;  2IUZ A;  5GPR A;  3KAG A;  1NWS A;  4JFJ A;  1FFR A;  4R0X A;  1FKT A;  1KT1 A;  3ODK A;  3O5Q A;  3O5F A;  3QOK A;  1LG1 A;  1FKK A;  4LAX A;  3O5G A;  3UF8 A;  1ROU A;  4QT3 A;  4DIP A;  3PRA A;  1R9H A;  1E6P A;  4G2P A;  3CHF A;  1EDQ A;  2M2A A;  4WKA A;  4WJX A;  2YBT A;  3RGC A;  3KCE A;  4ZPT R;  4Z2G A;  4U84 A;  4AY1 A;  3B9A A;  4W9O A;  4ODR A;  1LL6 A;  2XP3 A;  1F40 A;  4MAV A;  4JFI A;  5HBF A;  1ZK6 A;  3ARW A;  4JFL A;  4QT2 A;  2A3A A;  4DRJ A;  4KR0 B;  4Z2H A;  1EIB A;  2MF9 A;  3RM8 A;  4U85 A;  1KFW A;  4HBO A;  3O5D A;  2G8Z A;  2OFN A;  2DG4 A;  4TYO A;  4GGQ A;  2RUQ A;  1B6C A;  4QIB A;  3WKZ A;  2ITK A;  3ARV A;  1NWT A;  4Q22 A;  1FKH A;  1OGB A;  2WM0 A;  3B9D A;  4HAR A;  1Q6H A;  1HJW A;  2WK2 A;  4DT4 A;  3PA7 A;  1BKF A;  1FKD A;  3O5O A;  1T11 A;  3H9R B;  3CGN A;  1H0G A;  2FKE A;  4ODM A;  2KFW A;  4LAY A;  2ZQS A;  2ZQU A;  1GPF A;  3EY6 A;  4GIV A;  4ML4 A;  4ODN A;  2PV3 A;  3OA5 A;  4DRN A;  1EQ3 A;  1XHG A;  3PRB A;  1E6N A;  2Q5A A;  4ODQ A;  1FKI A;  3WD0 A;  1FKR A;  3O5P A;  4TNS A;  1UR8 A;  1FKJ A;  4DRM A;  4MGV A;  2ZQV A;  2LJ4 A;  1ZU8 A;  1ZBK A;  1J4H A;  4WK9 A;  1YW5 A;  3B9E A;  2RUC A;  1HKK A;  4KQZ A;  3G6L A;  4J4N A;  2OLH A;  2KI3 A;  1OWQ A;  2FDM A;  2DG9 A;  2VN1 A;  1TCO C;  2DG3 A;  1Q1C A;  1W1P A;  3ARZ A;  4J4O A;  1FFQ A;  5HWB A;  2PPP A;  2PV2 A;  4Z2I A;  2XP6 A;  4QZV B;  3IK8 A;  1LQ0 A;  5JH8 A;  1FKL A;  1W26 A;  1P5Q A;  1J4R A;  2ZR6 A;  3WIJ A;  3WQV A;  5DIV A;  3CH9 A;  4FN2 A;  3KAF A;  3RM4 A;  1LL4 A;  3MDY B;  2QF8 A;  2ZR4 A;  1ZBW A;  4S3J A;  3ALF A;  4JFK A;  3TDB A;  4TW8 A;  4L72 B;  4U86 A;  2RSE A;  1X6L A;  4TW6 A;  2LPV A;  2XP8 A;  3ARO A;  5DIU A;  3ARY A;  4R5E A;  3CHD A;  4NZC A;  3UI4 A;  5HW6 A;  2DT2 A;  4C02 B;  3WQW A;  3O5J A;  4DWS D;  1D7H A;  3ALG A;  4TX0 A;  3O5L A;  1LJY A;  4ZPV R;  3IHZ A;  2O9O A;  2DT0 A;  3PR9 A;  1WB0 A;  1ROT A;  1ZBC A;  4ODO A;  2F2D A;  1VF8 A;  2MPH A;  3AS2 A;  3B7X A;  2DSV A;  3AS0 A;  3CZ8 A;  4LAW A;  4PTM A;  2DT3 A;  3ARX A;  1NMW A;  4MTV A;  4DWS A;  4W9P A;  3FXY A;  2ZR5 A;  4IPX A;  4XAK A;  3ARR A;  3WH0 A;  3O5I A;  4DWS B;  1JNS A;  3AQU A;  4ODK A;  2XP9 A;  2XPA A;  5HWC A;  1HJX A;  2LGO A;  5DIT A;  4DRO A;  3ARS A;  1JNT A;  4JFM A;  5HW7 A;  2Y78 A;  4DRQ A;  3O5M A;  2RUR A;  2A3B A;  1N1A A;  2B31 A;  1NWR A;  3WD4 A;  4N19 A;  1LG2 A;  2JZV A;  4P8V A;  5DO2 A;  5J6E A;  1NSG A;  2VCD A;  4FAP A;  3OOB A;  4MNM A;  4Z2L A;  1M5Y A;  3RFW A;  1U79 A;  2L2S A;  5HKG A;  4Z2J A;  4LGX A;  3WD2 A;  2F4E A;  2O92 A;  1F8A B;  1C9H A;  3FY1 A;  1FKF A;  3UQB A;  2MNT A;  4JYS A;  4TW7 A;  2AWG A;  3BXW A;  2WLY A;  1TFV A;  4L3N A;  4ZS6 A;  4W5U A;  4DWS C;  3KZ7 A;  1ITX A;  3TC5 A;  1RD6 A;  5BXJ A;  1D6O A;  4DRP A;  1D2K A;  1W1Y A;  1O6I A;  1NH6 A;  1WAW A;  3ARP A;  4MNJ A;  2F21 A;  4LAV A;  1LL7 A;  2ZQT A;  1WNO A;  1Q6U A;  3I6C A;  3JXV A;  5DEZ A;  1HKM A;  4ZPW R;  4MSP A;  2K8I A;  4P8W A;  4DRK A;  1Q6I A;  1Y0O A;  4NNR A;  3AS1 A;  1SYT A;  3B8S A;  3O5E A;  1FKS A;  5D75 A;  4O2T A;  5I98 A;  2XP5 A;  3G6M A;  2M08 A;  3PRD A;  1PIN A;  2PBC A;  1W9P A;  2WLZ A;  1ZB5 A;  2MLY A;  5GQB A;  1A7X A;  4IT4 A;  1QPL A;  3IKD A;  1PBK A;  1QPF A;  1HKI A;  4P8U A;  3LUO A;  4DH0 A;  1QZ2 A;  3WL1 A;  2MLX A;  3W4R A;  3UQA A;  5HUA A;  2FAP A;  3ARU A;  1EYM A;  1YAT A;  3ART A;  4DRI A;  4W9Q A;  2D9F A;  3KAD A;  3CGM A;  2ESC A;  1JND A;  4MNL A;  1OGG A;  4WKF A;  5HW8 A;  4MNK A;  3FAP A;  1FD9 A;  2UZ5 A;  2KE0 A;  1NMV A;  1ZCN A;  4ODL A;  2XPB A;  1E6R A;  2IF4 A;  4MPK A;  3RM9 A;  3AS3 A;  2PI6 A;  2KO7 A;  3CHE A;  1XRV A;  3O5K A;  1UR9 A;  4Z2K A;  4G50 A;  3GPK A;  2KGJ A;  1FKB A;  3O5R A;  3CHC A;  1KT0 A;  2LKN A;  2XP7 A;  1IX5 A;  1W9V A;  1W9U A;  4S3K A;  1EHN A;  1H0I A;  4WKH A;  1J6Y A;  4DRH A;  1HXV A;  3KAI A;  3NTP A;  4IT6 A;  5HTG A;  2A3C A;  1L1P A;  3WD3 A;  3ARQ A;  1HKJ A;  2DT1 A;  1FAP A;  1GUV A;  4Q7N A;  1JVW A;  2MLZ A;  2A3E A;  4BF8 A;  1E15 A;  1JNE A;  3RME A;  3VAW A;  2RUD A;  3JYJ A;  1D7I A;  4P8X A;  2DSW A;  2G41 A;  4IQC A;  2DPE A;  4WIW A;  3NI6 A;  2PPN A;  1W1V A;  4HBE A;  4NSB A;  2N87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...