3EY6A

Crystal structure of the fk506-binding domain of human fkbp38
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
MREWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVDGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FK506-binding protein 8
publication title A charge-sensitive loop in the FKBP38 catalytic domain modulates Bcl-2 binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 118
sequence length 118
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3ey6A00
2KO7A 2KR7A 2XP6A 2M1IA 4ODOA 5I98A 2VN1A 2ZR4A 3O5EA 3TC5A 4DRMA 1T11A 2IF4A 3O5JA 2F4EA 3KZ7A 2N87A 2XP3A 4JFLA 4R0XA 4TW8A 1F40A 1FKHA 3I6CA 3KAIA 1FAPA 5DIUA 3IK8A 5HUAA 3GPKA 3UF8A 2ZQSA 2XPAA 4GIVA 2XP7A 2PV2A 5HT1A 3FAPA 3O5PA 1FD9A 2XPBA 1FKKA 4TW6A 3VAWA 4DRKA 3UQAA 1EYMA 2KFWA 5HW7A 3MDYB 1J4RA 2MNTA 4ODNA 3O5LA 3O5DA 2ZQUA 5J6EA 4JFIA 2DG9A 3KAGA 1M5YA 2KGJA 1FKBA 3IKDA 3TDBA 3EY6A 4W9OA 4GGQA 1FKRA 1FKSA 3KABA 4J4OA 3IHZA 1D6OA 4FN2A 2PBCA 2XP4A 4U86A 2MF9A 4DZ3A 2PPOA 2MLXA 1BL4A 4JFJA 4DT4A 2Y78A 1FKLA 1QPLA 2ITKA 2LGOA 3PA7A 4TX0A 3UI4A 3UQIA 4C02B 5HTGA 4BF8A 3IKGA 4MGVA 4U84A 1JNSA 2L2SA 4DROA 5D75A 4DRPA 1PBKA 1JNTA 1QZ2A 4O2TA 2XP5A 4ODRA 1JVWA 2KI3A 2AWGA 5DITA 2RUCA 1BKFA 3O5IA 2M08A 2FKEA 3PRBA 1R9HA 2RSEA 3UQBA 1D7JA 3NI6A 2XP8A 4G50A 4LAVA 2VCDA 4W9QA 1ROUA 5HW6A 2PPNA 1ZCNA 4QIBA 2F21A 1FKFA 1C9HA 2MLZA 3WH0A 1Y0OA 1KT0A 2PV3A 4JYSA 1FJDA 2PPPA 1NMWA 4ODPA 4DRIA 3RGCA 3UI6A 2D9FA 1Q1CA 2LPVA 1HXVA 4JFKA 4DH0A 1J6YA 2RUDA 2ZR6A 4W9PA 1J4IA 2Q5AA 5B8IC 5GPGA 2DG3A 1N1AA 3CGMA 3KCEA 3O5RA 3O5MA 3PRDA 2XP9A 4IQ2A 3KAHA 4ODLA 1D7HA 3JYMA 2ZQTA 1J4HA 3UI5A 5HKGA 1Q6UA 4QT2A 3O5KA 4LAXA 2FAPA 1QPFA 4TYOA 2MPHA 1ZK6A 4LAWA 4DZ2A 3O5FA 4G2PA 2LKNA 3KADA 4DRHA 5HWCA 2DG4A 1YW5A 2MLYA 1Q6IA 1Q6HA 2OFNA 1A7XA 1B6CA 5BXJA 4TNSA 1YATA 1P5QA 1W26A 2RQSA 3RFWA 4DRQA 1KT1A 1FKTA 1PINA 3H9RB 1FKIA 2KE0A 4LAYA 2M2AA 2PV1A 3O5QA 4ODMA 1F8AB 3O5OA 3O5GA 2UZ5A 1FKDA 3JYJA 4DIPA 5HWBA 3JXVA 4N19A 1FKJA 5HW8A 1U79A 2F2DA 4U85A 3NTPA 4IPXA 5DIVA 1L1PA 3LUOA 4DRJA 4ODQA 1ROTA 1FKGA 3CGNA 1NMVA 1NSGA 4J4NA 3ODKA 4ITZA 4ODKA 4TW7A 3KACA 4JFMA 3NRKA 1D7IA 2ZR5A 2RUQA 3TCZA 3B7XA 4FAPA 2JZVA 1TCOC 1EQ3A 4MSPA 2LJ4A 3KAFA 4DRNA 2K8IA 4QT3A 4NNRA 3OOBA 2ZQVA 2RURA 4IQCA
chains in the Genus database with same CATH superfamily
3ARXA 3RMEA 4ODOA 2ZR4A 4DRMA 1T11A 4Z2JA 2N87A 1X6LA 1FKHA 3GPKA 4GIVA 3CHFA 3ARZA 4DRKA 1FKKA 3AS0A 5HW7A 3MDYB 1SR0A 4ODNA 3O5DA 1GRJA 4ML4A 3KAGA 3TDBA 4W9OA 4GGQA 4HBEA 4QZVB 1FKRA 3KABA 1IX5A 3IHZA 1LJYA 4DZ3A 2MF9A 4DT4A 1FKLA 2ITKA 2LGOA 2DT0A 4WKFA 3UQIA 5HTGA 4Z2HA 1HKIA 3IKGA 4U84A 2B5UB 5D75A 5DF0A 3WL1A 1JNTA 4O2TA 2FDMA 2KI3A 5DITA 2AWGA 2YBTA 2DSZA 2M08A 4L3NA 2DPEA 2XP8A 2PPNA 2F21A 1OGGA 4ZPWR 2DT3A 1VF8A 4Q22A 1FJDA 1NMWA 3WD1A 3ARPA 4DRIA 3UI6A 4WJXA 2D9FA 4HARA 4AY1A 4Z2LA 4JFKA 1JCHB 4W9PA 2G8ZA 1NWRA 3KAHA 1D7HA 3JYMA 3ARRA 4WK9A 2G41A 1QPFA 1ZK6A 4DZ2A 1LL7A 1ZB5A 1Q6HA 2O92A 1P5QA 3EIPA 1W26A 3RFWA 2ESCA 4ZPTR 4DRQA 4Z2IA 4P8VA 1CTNA 2UZ5A 1FFQA 5HWBA 5HW8A 1U79A 1WB0A 1FKGA 2DSUA 1NMVA 4TW7A 3KACA 4JFMA 3NRKA 2ZR5A 1NH6A 3TCZA 3WQVA 1EQ3A 3FXYA 4QT3A 2YBUA 1O6IA 4MNLA 2RURA 4IQCA 4P8XA 1E6RA 2QF8A 3AROA 3TC5A 3O5EA 2IF4A 3O5JA 2ETNA 4TW8A 1HJWA 3BXWA 5HUAA 2ZQSA 3O5PA 4TW6A 3ARWA 3UQAA 1EYMA 2KFWA 2MNTA 1GUVA 1NWTA 1W9VA 2ZQUA 4IT6A 2DG9A 4MAVA 3EY6A 5JH8A 1FKSA 4J4OA 2WM0A 1D6OA 4FN2A 4DWSC 1NWSA 4JFJA 2Y78A 2A3AA 1JNSA 3WD4A 1E44A 1UR9A 1H0IA 4DROA 4DRPA 1PBKA 2XP5A 4KQZA 2FKEA 3PRBA 4IT4A 4NSBA 1D7JA 3G6LA 2OLHA 4G50A 4LAVA 1ZCNA 2MLZA 1C9HA 1OWQA 2PV3A 4W5UA 4S3JA 1WNOA 2IUZA 3ARYA 1XHGA 5DO2A 3RM4A 4WIWA 4DH0A 1HJVA 2ZR6A 3B8SA 1J4IA 2Q5AA 5B8IC 3WL0A 1ZU8A 2DG3A 3O5MA 3B9DA 4ODLA 4U86A 3UI5A 2ZQTA 1KFWA 3B9EA 4TYOA 1ZBKA 1TFVA 2DG4A 2MLYA 5GPRA 1FFRA 3CHEA 2OFNA 1W1PA 4TNSA 3W4RA 1PINA 1FKTA 4MNKA 4WKAA 3ARUA 1RD6A 4DIPA 4PTMA 3JXVA 1FKJA 4DWSA 2DT1A 4IPXA 4P8UA 2WLZA 1NSGA 4J4NA 4ITZA 4MNMA 1D7IA 4MPKA 2RUQA 2JZVA 4MSPA 4NNRA 3OOBA 5I98A 3B9AA 2DSVA 2XP6A 5DEZA 2A3EA 1LQ0A 3KZ7A 2XP3A 4JFLA 4Q7NA 4R0XA 1F40A 1GOIA 1E6PA 2XP7A 2B31A 5HT1A 3VAWA 1D2KA 3WKZA 1J4RA 3O5LA 2EULA 5J6EA 3WD2A 3AS2A 4JFIA 1M5YA 2KGJA 1FKBA 2A3CA 2PBCA 2XP4A 3ARQA 3CZ8A 4C02B 3UI4A 4BF8A 2WLYA 2L2SA 1QZ2A 4DWSD 1JVWA 1WAWA 3O5IA 1LG2A 1R9HA 2RSEA 4W9QA 1XRVA 3OA5A 1ROUA 1X6NA 2P4VA 1FKFA 3WH0A 3CHCA 1LL6A 4ODPA 1HKMA 3PR9A 4URIA 1Q1CA 3WD3A 4DWSB 2LPVA 1ITXA 1J6YA 2RUDA 1ZL1A 1N1AA 4ZS6A 3PRDA 2XP9A 1J4HA 1GPFA 1Q6UA 4LAXA 2FAPA 2MPHA 1ZBCA 3O5FA 3WD0A 1H0GA 3KADA 1Q6IA 4MTVA 1A7XA 1B6CA 1LL4A 5BXJA 1YATA 3H9RB 1FKIA 4LAYA 2M2AA 2PV1A 3BMBA 3ARVA 3O5QA 4ODMA 3O5OA 1FKDA 2DSWA 4N19A 1HKJA 3NTPA 4ZPVR 4UDMA 3LUOA 3CH9A 4DRJA 3ALGA 3AQUA 4ODQA 4HBOA 1SYTA 4ODKA 3B7XA 1EHNA 1TCOC 4DRNA 1E9LA 1W1VA 2ZQVA 2KO7A 2KR7A 2M1IA 2VN1A 3AS3A 2F4EA 1JNDA 1UR8A 3ARSA 3I6CA 3KAIA 1FAPA 5DIUA 1LG1A 3ARTA 3IK8A 1K9TA 3UF8A 2XPAA 3FY1A 2PV2A 3FAPA 1FD9A 2XPBA 3RM8A 2F23A 5HBFA 3GTYX 3IKDA 4P8WA 1NWUA 1E15A 2PPOA 2MLXA 1BL4A 1E6ZA 1QPLA 3PA7A 2A3BA 4TX0A 4NZCA 4MGVA 1W1YA 1JNEA 3G6MA 1W9UA 4ODRA 1E6NA 1HKKA 2RUCA 1BKFA 4R5EA 3UQBA 4S3KA 4WKHA 3NI6A 2VCDA 1EDQA 5HW6A 2AOSA 4QIBA 2O9OA 3GU0A 1Y0OA 1KT0A 4JYSA 5GQBA 2PPPA 4Z2KA 3RGCA 1HJXA 4KR0B 2PN0A 1HXVA 5GPGA 3O5RA 3CGMA 3KCEA 4IQ2A 4L72B 5HKGA 4QT2A 3O5KA 2WK2A 4LAWA 1W1TA 3CHDA 2LKNA 4G2PA 4DRHA 5HWCA 3WQWA 1YW5A 1W9PA 2RQSA 1KT1A 2KE0A 4LGXA 1ZBVA 1F8AB 4Z2GA 3O5GA 1EIBA 3JYJA 2PI6A 3QOKA 3ALFA 2F2DA 3PRAA 4U85A 5DIVA 1L1PA 4MNJA 1ROTA 3CGNA 3ODKA 4XAKA 3RM9A 4FAPA 2LJ4A 3KAFA 2K8IA 3WIJA 2DT2A 1OGBA 3AS1A 1ZBWA
chains in the Genus database with same CATH topology
3ARXA 3RMEA 4ODOA 2ZR4A 4DRMA 1T11A 4Z2JA 2N87A 1X6LA 1FKHA 3GPKA 4GIVA 3CHFA 3ARZA 4DRKA 1FKKA 3AS0A 5HW7A 3MDYB 1SR0A 4ODNA 3O5DA 4ML4A 3KAGA 3TDBA 4W9OA 4GGQA 4HBEA 4QZVB 1FKRA 3KABA 1IX5A 3IHZA 1LJYA 4DZ3A 2MF9A 4DT4A 1FKLA 2ITKA 2LGOA 2DT0A 4WKFA 3UQIA 5HTGA 4Z2HA 1HKIA 3IKGA 4U84A 5D75A 5DF0A 3WL1A 1JNTA 4O2TA 2FDMA 2KI3A 5DITA 2AWGA 2YBTA 2DSZA 2M08A 4L3NA 2DPEA 2XP8A 2PPNA 2F21A 1OGGA 4ZPWR 2DT3A 1VF8A 4Q22A 1FJDA 1NMWA 3WD1A 3ARPA 4DRIA 3UI6A 4WJXA 2D9FA 4HARA 4AY1A 4Z2LA 4JFKA 4W9PA 2G8ZA 1NWRA 3KAHA 1D7HA 3JYMA 3ARRA 4WK9A 2G41A 1QPFA 1ZK6A 4DZ2A 1LL7A 1ZB5A 1Q6HA 2O92A 1P5QA 1W26A 3RFWA 2ESCA 4ZPTR 4DRQA 4Z2IA 4P8VA 1CTNA 2UZ5A 1FFQA 5HWBA 5HW8A 1U79A 1WB0A 1FKGA 2DSUA 1NMVA 4TW7A 3KACA 4JFMA 3NRKA 2ZR5A 1NH6A 3TCZA 3WQVA 1EQ3A 3FXYA 4QT3A 2YBUA 1O6IA 4MNLA 2RURA 4IQCA 4P8XA 1E6RA 2QF8A 3AROA 3TC5A 3O5EA 2IF4A 3O5JA 4TW8A 1HJWA 3BXWA 5HUAA 2ZQSA 3O5PA 4TW6A 3ARWA 3UQAA 1EYMA 2KFWA 2MNTA 1GUVA 1NWTA 1W9VA 2ZQUA 4IT6A 2DG9A 4MAVA 3EY6A 5JH8A 1FKSA 4J4OA 2WM0A 1D6OA 4FN2A 4DWSC 1NWSA 4JFJA 2Y78A 2A3AA 1JNSA 3WD4A 1UR9A 1H0IA 4DROA 4DRPA 1PBKA 2XP5A 4KQZA 2FKEA 3PRBA 4IT4A 4NSBA 1D7JA 3G6LA 2OLHA 4G50A 4LAVA 1ZCNA 2MLZA 1C9HA 1OWQA 2PV3A 4W5UA 4S3JA 1WNOA 2IUZA 3ARYA 1XHGA 5DO2A 3RM4A 4WIWA 4DH0A 1HJVA 2ZR6A 3B8SA 1J4IA 2Q5AA 5B8IC 3WL0A 1ZU8A 2DG3A 3O5MA 3B9DA 4ODLA 4U86A 3UI5A 2ZQTA 1KFWA 3B9EA 4TYOA 1ZBKA 1TFVA 2DG4A 2MLYA 5GPRA 1FFRA 3CHEA 2OFNA 1W1PA 4TNSA 3W4RA 1PINA 1FKTA 4MNKA 4WKAA 3ARUA 1RD6A 4DIPA 4PTMA 3JXVA 1FKJA 4DWSA 2DT1A 4IPXA 4P8UA 2WLZA 1NSGA 4J4NA 4ITZA 4MNMA 1D7IA 4MPKA 2RUQA 2JZVA 4MSPA 4NNRA 3OOBA 5I98A 3B9AA 2DSVA 2XP6A 5DEZA 2A3EA 1LQ0A 3KZ7A 2XP3A 4JFLA 4Q7NA 4R0XA 1F40A 1GOIA 1E6PA 2XP7A 2B31A 5HT1A 3VAWA 1D2KA 3WKZA 1J4RA 3O5LA 5J6EA 3WD2A 3AS2A 4JFIA 1M5YA 2KGJA 1FKBA 2A3CA 2PBCA 2XP4A 3ARQA 3CZ8A 4C02B 3UI4A 4BF8A 2WLYA 2L2SA 1QZ2A 4DWSD 1JVWA 1WAWA 3O5IA 1LG2A 1R9HA 2RSEA 4W9QA 1XRVA 3OA5A 1ROUA 1X6NA 1FKFA 3WH0A 3CHCA 1LL6A 4ODPA 1HKMA 3PR9A 4URIA 1Q1CA 3WD3A 4DWSB 2LPVA 1ITXA 1J6YA 2RUDA 1ZL1A 1N1AA 4ZS6A 3PRDA 2XP9A 1J4HA 1GPFA 1Q6UA 4LAXA 2FAPA 2MPHA 1ZBCA 3O5FA 3WD0A 1H0GA 3KADA 1Q6IA 4MTVA 1A7XA 1B6CA 1LL4A 5BXJA 1YATA 3H9RB 1FKIA 4LAYA 2M2AA 2PV1A 3ARVA 3O5QA 4ODMA 3O5OA 1FKDA 2DSWA 4N19A 1HKJA 3NTPA 4ZPVR 3LUOA 3CH9A 4DRJA 3ALGA 3AQUA 4ODQA 4HBOA 1SYTA 4ODKA 3B7XA 1EHNA 1TCOC 4DRNA 1E9LA 1W1VA 2ZQVA 2KO7A 2KR7A 2M1IA 2VN1A 3AS3A 2F4EA 1JNDA 1UR8A 3ARSA 3I6CA 3KAIA 1FAPA 5DIUA 1LG1A 3ARTA 3IK8A 1K9TA 3UF8A 2XPAA 3FY1A 2PV2A 3FAPA 1FD9A 2XPBA 3RM8A 5HBFA 3IKDA 4P8WA 1NWUA 1E15A 2PPOA 2MLXA 1BL4A 1E6ZA 1QPLA 3PA7A 2A3BA 4TX0A 4NZCA 4MGVA 1W1YA 1JNEA 3G6MA 1W9UA 4ODRA 1E6NA 1HKKA 2RUCA 1BKFA 4R5EA 3UQBA 4S3KA 4WKHA 3NI6A 2VCDA 1EDQA 5HW6A 2AOSA 4QIBA 2O9OA 1Y0OA 1KT0A 4JYSA 5GQBA 2PPPA 4Z2KA 3RGCA 1HJXA 4KR0B 1HXVA 5GPGA 3O5RA 3CGMA 3KCEA 4IQ2A 4L72B 5HKGA 4QT2A 3O5KA 2WK2A 4LAWA 1W1TA 3CHDA 2LKNA 4G2PA 4DRHA 5HWCA 3WQWA 1YW5A 1W9PA 2RQSA 1KT1A 2KE0A 4LGXA 1ZBVA 1F8AB 4Z2GA 3O5GA 1EIBA 3JYJA 2PI6A 3QOKA 3ALFA 2F2DA 3PRAA 4U85A 5DIVA 1L1PA 4MNJA 1ROTA 3CGNA 3ODKA 4XAKA 3RM9A 4FAPA 2LJ4A 3KAFA 2K8IA 3WIJA 2DT2A 1OGBA 3AS1A 1ZBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KO7 A;  2KR7 A;  2XP6 A;  2M1I A;  4ODO A;  5I98 A;  2VN1 A;  2ZR4 A;  3O5E A;  3TC5 A;  4DRM A;  1T11 A;  2IF4 A;  3O5J A;  2F4E A;  3KZ7 A;  2N87 A;  2XP3 A;  4JFL A;  4R0X A;  4TW8 A;  1F40 A;  1FKH A;  3I6C A;  3KAI A;  1FAP A;  5DIU A;  3IK8 A;  5HUA A;  3GPK A;  3UF8 A;  2ZQS A;  2XPA A;  4GIV A;  2XP7 A;  2PV2 A;  5HT1 A;  3FAP A;  3O5P A;  1FD9 A;  2XPB A;  1FKK A;  4TW6 A;  3VAW A;  4DRK A;  3UQA A;  1EYM A;  2KFW A;  5HW7 A;  3MDY B;  1J4R A;  2MNT A;  4ODN A;  3O5L A;  3O5D A;  2ZQU A;  5J6E A;  4JFI A;  2DG9 A;  3KAG A;  1M5Y A;  2KGJ A;  1FKB A;  3IKD A;  3TDB A;  3EY6 A;  4W9O A;  4GGQ A;  1FKR A;  1FKS A;  3KAB A;  4J4O A;  3IHZ A;  1D6O A;  4FN2 A;  2PBC A;  2XP4 A;  4U86 A;  2MF9 A;  4DZ3 A;  2PPO A;  2MLX A;  1BL4 A;  4JFJ A;  4DT4 A;  2Y78 A;  1FKL A;  1QPL A;  2ITK A;  2LGO A;  3PA7 A;  4TX0 A;  3UI4 A;  3UQI A;  4C02 B;  5HTG A;  4BF8 A;  3IKG A;  4MGV A;  4U84 A;  1JNS A;  2L2S A;  4DRO A;  5D75 A;  4DRP A;  1PBK A;  1JNT A;  1QZ2 A;  4O2T A;  2XP5 A;  4ODR A;  1JVW A;  2KI3 A;  2AWG A;  5DIT A;  2RUC A;  1BKF A;  3O5I A;  2M08 A;  2FKE A;  3PRB A;  1R9H A;  2RSE A;  3UQB A;  1D7J A;  3NI6 A;  2XP8 A;  4G50 A;  4LAV A;  2VCD A;  4W9Q A;  1ROU A;  5HW6 A;  2PPN A;  1ZCN A;  4QIB A;  2F21 A;  1FKF A;  1C9H A;  2MLZ A;  3WH0 A;  1Y0O A;  1KT0 A;  2PV3 A;  4JYS A;  1FJD A;  2PPP A;  1NMW A;  4ODP A;  4DRI A;  3RGC A;  3UI6 A;  2D9F A;  1Q1C A;  2LPV A;  1HXV A;  4JFK A;  4DH0 A;  1J6Y A;  2RUD A;  2ZR6 A;  4W9P A;  1J4I A;  2Q5A A;  5B8I C;  5GPG A;  2DG3 A;  1N1A A;  3CGM A;  3KCE A;  3O5R A;  3O5M A;  3PRD A;  2XP9 A;  4IQ2 A;  3KAH A;  4ODL A;  1D7H A;  3JYM A;  2ZQT A;  1J4H A;  3UI5 A;  5HKG A;  1Q6U A;  4QT2 A;  3O5K A;  4LAX A;  2FAP A;  1QPF A;  4TYO A;  2MPH A;  1ZK6 A;  4LAW A;  4DZ2 A;  3O5F A;  4G2P A;  2LKN A;  3KAD A;  4DRH A;  5HWC A;  2DG4 A;  1YW5 A;  2MLY A;  1Q6I A;  1Q6H A;  2OFN A;  1A7X A;  1B6C A;  5BXJ A;  4TNS A;  1YAT A;  1P5Q A;  1W26 A;  2RQS A;  3RFW A;  4DRQ A;  1KT1 A;  1FKT A;  1PIN A;  3H9R B;  1FKI A;  2KE0 A;  4LAY A;  2M2A A;  2PV1 A;  3O5Q A;  4ODM A;  1F8A B;  3O5O A;  3O5G A;  2UZ5 A;  1FKD A;  3JYJ A;  4DIP A;  5HWB A;  3JXV A;  4N19 A;  1FKJ A;  5HW8 A;  1U79 A;  2F2D A;  4U85 A;  3NTP A;  4IPX A;  5DIV A;  1L1P A;  3LUO A;  4DRJ A;  4ODQ A;  1ROT A;  1FKG A;  3CGN A;  1NMV A;  1NSG A;  4J4N A;  3ODK A;  4ITZ A;  4ODK A;  4TW7 A;  3KAC A;  4JFM A;  3NRK A;  1D7I A;  2ZR5 A;  2RUQ A;  3TCZ A;  3B7X A;  4FAP A;  2JZV A;  1TCO C;  1EQ3 A;  4MSP A;  2LJ4 A;  3KAF A;  4DRN A;  2K8I A;  4QT3 A;  4NNR A;  3OOB A;  2ZQV A;  2RUR A;  4IQC A; 
#chains in the Genus database with same CATH topology
 3ARX A;  3RME A;  4ODO A;  2ZR4 A;  4DRM A;  1T11 A;  4Z2J A;  2N87 A;  1X6L A;  1FKH A;  3GPK A;  4GIV A;  3CHF A;  3ARZ A;  4DRK A;  1FKK A;  3AS0 A;  5HW7 A;  3MDY B;  1SR0 A;  4ODN A;  3O5D A;  1GRJ A;  4ML4 A;  3KAG A;  3TDB A;  4W9O A;  4GGQ A;  4HBE A;  4QZV B;  1FKR A;  3KAB A;  1IX5 A;  3IHZ A;  1LJY A;  4DZ3 A;  2MF9 A;  4DT4 A;  1FKL A;  2ITK A;  2LGO A;  2DT0 A;  4WKF A;  3UQI A;  5HTG A;  4Z2H A;  1HKI A;  3IKG A;  4U84 A;  2B5U B;  5D75 A;  5DF0 A;  3WL1 A;  1JNT A;  4O2T A;  2FDM A;  2KI3 A;  5DIT A;  2AWG A;  2YBT A;  2DSZ A;  2M08 A;  4L3N A;  2DPE A;  2XP8 A;  2PPN A;  2F21 A;  1OGG A;  4ZPW R;  2DT3 A;  1VF8 A;  4Q22 A;  1FJD A;  1NMW A;  3WD1 A;  3ARP A;  4DRI A;  3UI6 A;  4WJX A;  2D9F A;  4HAR A;  4AY1 A;  4Z2L A;  4JFK A;  1JCH B;  4W9P A;  2G8Z A;  1NWR A;  3KAH A;  1D7H A;  3JYM A;  3ARR A;  4WK9 A;  2G41 A;  1QPF A;  1ZK6 A;  4DZ2 A;  1LL7 A;  1ZB5 A;  1Q6H A;  2O92 A;  1P5Q A;  3EIP A;  1W26 A;  3RFW A;  2ESC A;  4ZPT R;  4DRQ A;  4Z2I A;  4P8V A;  1CTN A;  2UZ5 A;  1FFQ A;  5HWB A;  5HW8 A;  1U79 A;  1WB0 A;  1FKG A;  2DSU A;  1NMV A;  4TW7 A;  3KAC A;  4JFM A;  3NRK A;  2ZR5 A;  1NH6 A;  3TCZ A;  3WQV A;  1EQ3 A;  3FXY A;  4QT3 A;  2YBU A;  1O6I A;  4MNL A;  2RUR A;  4IQC A;  4P8X A;  1E6R A;  2QF8 A;  3ARO A;  3TC5 A;  3O5E A;  2IF4 A;  3O5J A;  2ETN A;  4TW8 A;  1HJW A;  3BXW A;  5HUA A;  2ZQS A;  3O5P A;  4TW6 A;  3ARW A;  3UQA A;  1EYM A;  2KFW A;  2MNT A;  1GUV A;  1NWT A;  1W9V A;  2ZQU A;  4IT6 A;  2DG9 A;  4MAV A;  3EY6 A;  5JH8 A;  1FKS A;  4J4O A;  2WM0 A;  1D6O A;  4FN2 A;  4DWS C;  1NWS A;  4JFJ A;  2Y78 A;  2A3A A;  1JNS A;  3WD4 A;  1E44 A;  1UR9 A;  1H0I A;  4DRO A;  4DRP A;  1PBK A;  2XP5 A;  4KQZ A;  2FKE A;  3PRB A;  4IT4 A;  4NSB A;  1D7J A;  3G6L A;  2OLH A;  4G50 A;  4LAV A;  1ZCN A;  2MLZ A;  1C9H A;  1OWQ A;  2PV3 A;  4W5U A;  4S3J A;  1WNO A;  2IUZ A;  3ARY A;  1XHG A;  5DO2 A;  3RM4 A;  4WIW A;  4DH0 A;  1HJV A;  2ZR6 A;  3B8S A;  1J4I A;  2Q5A A;  5B8I C;  3WL0 A;  1ZU8 A;  2DG3 A;  3O5M A;  3B9D A;  4ODL A;  4U86 A;  3UI5 A;  2ZQT A;  1KFW A;  3B9E A;  4TYO A;  1ZBK A;  1TFV A;  2DG4 A;  2MLY A;  5GPR A;  1FFR A;  3CHE A;  2OFN A;  1W1P A;  4TNS A;  3W4R A;  1PIN A;  1FKT A;  4MNK A;  4WKA A;  3ARU A;  1RD6 A;  4DIP A;  4PTM A;  3JXV A;  1FKJ A;  4DWS A;  2DT1 A;  4IPX A;  4P8U A;  2WLZ A;  1NSG A;  4J4N A;  4ITZ A;  4MNM A;  1D7I A;  4MPK A;  2RUQ A;  2JZV A;  4MSP A;  4NNR A;  3OOB A;  5I98 A;  3B9A A;  2DSV A;  2XP6 A;  5DEZ A;  2A3E A;  1LQ0 A;  3KZ7 A;  2XP3 A;  4JFL A;  4Q7N A;  4R0X A;  1F40 A;  1GOI A;  1E6P A;  2XP7 A;  2B31 A;  5HT1 A;  3VAW A;  1D2K A;  3WKZ A;  1J4R A;  3O5L A;  2EUL A;  5J6E A;  3WD2 A;  3AS2 A;  4JFI A;  1M5Y A;  2KGJ A;  1FKB A;  2A3C A;  2PBC A;  2XP4 A;  3ARQ A;  3CZ8 A;  4C02 B;  3UI4 A;  4BF8 A;  2WLY A;  2L2S A;  1QZ2 A;  4DWS D;  1JVW A;  1WAW A;  3O5I A;  1LG2 A;  1R9H A;  2RSE A;  4W9Q A;  1XRV A;  3OA5 A;  1ROU A;  1X6N A;  2P4V A;  1FKF A;  3WH0 A;  3CHC A;  1LL6 A;  4ODP A;  1HKM A;  3PR9 A;  4URI A;  1Q1C A;  3WD3 A;  4DWS B;  2LPV A;  1ITX A;  1J6Y A;  2RUD A;  1ZL1 A;  1N1A A;  4ZS6 A;  3PRD A;  2XP9 A;  1J4H A;  1GPF A;  1Q6U A;  4LAX A;  2FAP A;  2MPH A;  1ZBC A;  3O5F A;  3WD0 A;  1H0G A;  3KAD A;  1Q6I A;  4MTV A;  1A7X A;  1B6C A;  1LL4 A;  5BXJ A;  1YAT A;  3H9R B;  1FKI A;  4LAY A;  2M2A A;  2PV1 A;  3BMB A;  3ARV A;  3O5Q A;  4ODM A;  3O5O A;  1FKD A;  2DSW A;  4N19 A;  1HKJ A;  3NTP A;  4ZPV R;  4UDM A;  3LUO A;  3CH9 A;  4DRJ A;  3ALG A;  3AQU A;  4ODQ A;  4HBO A;  1SYT A;  4ODK A;  3B7X A;  1EHN A;  1TCO C;  4DRN A;  1E9L A;  1W1V A;  2ZQV A;  2KO7 A;  2KR7 A;  2M1I A;  2VN1 A;  3AS3 A;  2F4E A;  1JND A;  1UR8 A;  3ARS A;  3I6C A;  3KAI A;  1FAP A;  5DIU A;  1LG1 A;  3ART A;  3IK8 A;  1K9T A;  3UF8 A;  2XPA A;  3FY1 A;  2PV2 A;  3FAP A;  1FD9 A;  2XPB A;  3RM8 A;  2F23 A;  5HBF A;  3GTY X;  3IKD A;  4P8W A;  1NWU A;  1E15 A;  2PPO A;  2MLX A;  1BL4 A;  1E6Z A;  1QPL A;  3PA7 A;  2A3B A;  4TX0 A;  4NZC A;  4MGV A;  1W1Y A;  1JNE A;  3G6M A;  1W9U A;  4ODR A;  1E6N A;  1HKK A;  2RUC A;  1BKF A;  4R5E A;  3UQB A;  4S3K A;  4WKH A;  3NI6 A;  2VCD A;  1EDQ A;  5HW6 A;  2AOS A;  4QIB A;  2O9O A;  3GU0 A;  1Y0O A;  1KT0 A;  4JYS A;  5GQB A;  2PPP A;  4Z2K A;  3RGC A;  1HJX A;  4KR0 B;  2PN0 A;  1HXV A;  5GPG A;  3O5R A;  3CGM A;  3KCE A;  4IQ2 A;  4L72 B;  5HKG A;  4QT2 A;  3O5K A;  2WK2 A;  4LAW A;  1W1T A;  3CHD A;  2LKN A;  4G2P A;  4DRH A;  5HWC A;  3WQW A;  1YW5 A;  1W9P A;  2RQS A;  1KT1 A;  2KE0 A;  4LGX A;  1ZBV A;  1F8A B;  4Z2G A;  3O5G A;  1EIB A;  3JYJ A;  2PI6 A;  3QOK A;  3ALF A;  2F2D A;  3PRA A;  4U85 A;  5DIV A;  1L1P A;  4MNJ A;  1ROT A;  3CGN A;  3ODK A;  4XAK A;  3RM9 A;  4FAP A;  2LJ4 A;  3KAF A;  2K8I A;  3WIJ A;  2DT2 A;  1OGB A;  3AS1 A;  1ZBW A; 
#chains in the Genus database with same CATH homology
 3ARX A;  3RME A;  4ODO A;  2ZR4 A;  4DRM A;  1T11 A;  4Z2J A;  2N87 A;  1X6L A;  1FKH A;  3GPK A;  4GIV A;  3CHF A;  3ARZ A;  4DRK A;  1FKK A;  3AS0 A;  5HW7 A;  3MDY B;  1SR0 A;  4ODN A;  3O5D A;  4ML4 A;  3KAG A;  3TDB A;  4W9O A;  4GGQ A;  4HBE A;  4QZV B;  1FKR A;  3KAB A;  1IX5 A;  3IHZ A;  1LJY A;  4DZ3 A;  2MF9 A;  4DT4 A;  1FKL A;  2ITK A;  2LGO A;  2DT0 A;  4WKF A;  3UQI A;  5HTG A;  4Z2H A;  1HKI A;  3IKG A;  4U84 A;  5D75 A;  5DF0 A;  3WL1 A;  1JNT A;  4O2T A;  2FDM A;  2KI3 A;  5DIT A;  2AWG A;  2YBT A;  2DSZ A;  2M08 A;  4L3N A;  2DPE A;  2XP8 A;  2PPN A;  2F21 A;  1OGG A;  4ZPW R;  2DT3 A;  1VF8 A;  4Q22 A;  1FJD A;  1NMW A;  3WD1 A;  3ARP A;  4DRI A;  3UI6 A;  4WJX A;  2D9F A;  4HAR A;  4AY1 A;  4Z2L A;  4JFK A;  4W9P A;  2G8Z A;  1NWR A;  3KAH A;  1D7H A;  3JYM A;  3ARR A;  4WK9 A;  2G41 A;  1QPF A;  1ZK6 A;  4DZ2 A;  1LL7 A;  1ZB5 A;  1Q6H A;  2O92 A;  1P5Q A;  1W26 A;  3RFW A;  2ESC A;  4ZPT R;  4DRQ A;  4Z2I A;  4P8V A;  1CTN A;  2UZ5 A;  1FFQ A;  5HWB A;  5HW8 A;  1U79 A;  1WB0 A;  1FKG A;  2DSU A;  1NMV A;  4TW7 A;  3KAC A;  4JFM A;  3NRK A;  2ZR5 A;  1NH6 A;  3TCZ A;  3WQV A;  1EQ3 A;  3FXY A;  4QT3 A;  2YBU A;  1O6I A;  4MNL A;  2RUR A;  4IQC A;  4P8X A;  1E6R A;  2QF8 A;  3ARO A;  3TC5 A;  3O5E A;  2IF4 A;  3O5J A;  4TW8 A;  1HJW A;  3BXW A;  5HUA A;  2ZQS A;  3O5P A;  4TW6 A;  3ARW A;  3UQA A;  1EYM A;  2KFW A;  2MNT A;  1GUV A;  1NWT A;  1W9V A;  2ZQU A;  4IT6 A;  2DG9 A;  4MAV A;  3EY6 A;  5JH8 A;  1FKS A;  4J4O A;  2WM0 A;  1D6O A;  4FN2 A;  4DWS C;  1NWS A;  4JFJ A;  2Y78 A;  2A3A A;  1JNS A;  3WD4 A;  1UR9 A;  1H0I A;  4DRO A;  4DRP A;  1PBK A;  2XP5 A;  4KQZ A;  2FKE A;  3PRB A;  4IT4 A;  4NSB A;  1D7J A;  3G6L A;  2OLH A;  4G50 A;  4LAV A;  1ZCN A;  2MLZ A;  1C9H A;  1OWQ A;  2PV3 A;  4W5U A;  4S3J A;  1WNO A;  2IUZ A;  3ARY A;  1XHG A;  5DO2 A;  3RM4 A;  4WIW A;  4DH0 A;  1HJV A;  2ZR6 A;  3B8S A;  1J4I A;  2Q5A A;  5B8I C;  3WL0 A;  1ZU8 A;  2DG3 A;  3O5M A;  3B9D A;  4ODL A;  4U86 A;  3UI5 A;  2ZQT A;  1KFW A;  3B9E A;  4TYO A;  1ZBK A;  1TFV A;  2DG4 A;  2MLY A;  5GPR A;  1FFR A;  3CHE A;  2OFN A;  1W1P A;  4TNS A;  3W4R A;  1PIN A;  1FKT A;  4MNK A;  4WKA A;  3ARU A;  1RD6 A;  4DIP A;  4PTM A;  3JXV A;  1FKJ A;  4DWS A;  2DT1 A;  4IPX A;  4P8U A;  2WLZ A;  1NSG A;  4J4N A;  4ITZ A;  4MNM A;  1D7I A;  4MPK A;  2RUQ A;  2JZV A;  4MSP A;  4NNR A;  3OOB A;  5I98 A;  3B9A A;  2DSV A;  2XP6 A;  5DEZ A;  2A3E A;  1LQ0 A;  3KZ7 A;  2XP3 A;  4JFL A;  4Q7N A;  4R0X A;  1F40 A;  1GOI A;  1E6P A;  2XP7 A;  2B31 A;  5HT1 A;  3VAW A;  1D2K A;  3WKZ A;  1J4R A;  3O5L A;  5J6E A;  3WD2 A;  3AS2 A;  4JFI A;  1M5Y A;  2KGJ A;  1FKB A;  2A3C A;  2PBC A;  2XP4 A;  3ARQ A;  3CZ8 A;  4C02 B;  3UI4 A;  4BF8 A;  2WLY A;  2L2S A;  1QZ2 A;  4DWS D;  1JVW A;  1WAW A;  3O5I A;  1LG2 A;  1R9H A;  2RSE A;  4W9Q A;  1XRV A;  3OA5 A;  1ROU A;  1X6N A;  1FKF A;  3WH0 A;  3CHC A;  1LL6 A;  4ODP A;  1HKM A;  3PR9 A;  4URI A;  1Q1C A;  3WD3 A;  4DWS B;  2LPV A;  1ITX A;  1J6Y A;  2RUD A;  1ZL1 A;  1N1A A;  4ZS6 A;  3PRD A;  2XP9 A;  1J4H A;  1GPF A;  1Q6U A;  4LAX A;  2FAP A;  2MPH A;  1ZBC A;  3O5F A;  3WD0 A;  1H0G A;  3KAD A;  1Q6I A;  4MTV A;  1A7X A;  1B6C A;  1LL4 A;  5BXJ A;  1YAT A;  3H9R B;  1FKI A;  4LAY A;  2M2A A;  2PV1 A;  3ARV A;  3O5Q A;  4ODM A;  3O5O A;  1FKD A;  2DSW A;  4N19 A;  1HKJ A;  3NTP A;  4ZPV R;  3LUO A;  3CH9 A;  4DRJ A;  3ALG A;  3AQU A;  4ODQ A;  4HBO A;  1SYT A;  4ODK A;  3B7X A;  1EHN A;  1TCO C;  4DRN A;  1E9L A;  1W1V A;  2ZQV A;  2KO7 A;  2KR7 A;  2M1I A;  2VN1 A;  3AS3 A;  2F4E A;  1JND A;  1UR8 A;  3ARS A;  3I6C A;  3KAI A;  1FAP A;  5DIU A;  1LG1 A;  3ART A;  3IK8 A;  1K9T A;  3UF8 A;  2XPA A;  3FY1 A;  2PV2 A;  3FAP A;  1FD9 A;  2XPB A;  3RM8 A;  5HBF A;  3IKD A;  4P8W A;  1NWU A;  1E15 A;  2PPO A;  2MLX A;  1BL4 A;  1E6Z A;  1QPL A;  3PA7 A;  2A3B A;  4TX0 A;  4NZC A;  4MGV A;  1W1Y A;  1JNE A;  3G6M A;  1W9U A;  4ODR A;  1E6N A;  1HKK A;  2RUC A;  1BKF A;  4R5E A;  3UQB A;  4S3K A;  4WKH A;  3NI6 A;  2VCD A;  1EDQ A;  5HW6 A;  2AOS A;  4QIB A;  2O9O A;  1Y0O A;  1KT0 A;  4JYS A;  5GQB A;  2PPP A;  4Z2K A;  3RGC A;  1HJX A;  4KR0 B;  1HXV A;  5GPG A;  3O5R A;  3CGM A;  3KCE A;  4IQ2 A;  4L72 B;  5HKG A;  4QT2 A;  3O5K A;  2WK2 A;  4LAW A;  1W1T A;  3CHD A;  2LKN A;  4G2P A;  4DRH A;  5HWC A;  3WQW A;  1YW5 A;  1W9P A;  2RQS A;  1KT1 A;  2KE0 A;  4LGX A;  1ZBV A;  1F8A B;  4Z2G A;  3O5G A;  1EIB A;  3JYJ A;  2PI6 A;  3QOK A;  3ALF A;  2F2D A;  3PRA A;  4U85 A;  5DIV A;  1L1P A;  4MNJ A;  1ROT A;  3CGN A;  3ODK A;  4XAK A;  3RM9 A;  4FAP A;  2LJ4 A;  3KAF A;  2K8I A;  3WIJ A;  2DT2 A;  1OGB A;  3AS1 A;  1ZBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...