3EY6A

Crystal structure of the fk506-binding domain of human fkbp38
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
MREWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVDGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A charge-sensitive loop in the FKBP38 catalytic domain modulates Bcl-2 binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords FK506-binding protein 8
total genus 29
structure length 118
sequence length 118
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3ey6A00
1A7XA 4TW7A 1YATA 3CGMA 4DZ3A 4W9PA 1ZCNA 1PINA 1B6CA 2VCDA 1KT0A 3IHZA 3KADA 2XPAA 2PV1A 2FKEA 2K8IA 4DRQA 3KABA 5HUAA 2PPNA 4TNSA 2RQSA 3TDBA 2RUQA 4FAPA 2N87A 4JFKA 1M5YA 3GPKA 2XP7A 3MDYB 2LJ4A 1Q6IA 1KT1A 4U85A 3UI5A 4DIPA 5B8IC 1YW5A 4JFMA 4ODOA 5HWBA 1FJDA 1HXVA 2PV2A 3KAFA 3TC5A 3RGCA 3KCEA 4ODRA 4JYSA 2FAPA 3PRBA 2MLYA 4GIVA 1NSGA 1J4HA 4DRHA 3O5FA 1QPFA 3O5MA 5HW6A 1P5QA 4G50A 4ODMA 2Y78A 4R0XA 1PBKA 3RFWA 3WH0A 2DG3A 1D7JA 3UQAA 4ODKA 2ZQTA 4W9OA 2DG9A 2F21A 2XPBA 4DZ2A 3NTPA 3FAPA 4DRKA 4ITZA 2VN1A 1ROTA 1JVWA 2ZQSA 4QT3A 1C9HA 1QZ2A 1L1PA 2ZR6A 2KI3A 2KR7A 1F8AB 1JNTA 4FN2A 3UF8A 2XP3A 3B7XA 4BF8A 4DH0A 5J6EA 3LUOA 2KE0A 3KACA 5HW8A 2LPVA 2L2SA 3CGNA 2M08A 1QPLA 1D7HA 2DG4A 1Q6UA 2XP6A 4IPXA 4O2TA 4ODQA 1W26A 5DIVA 2MNTA 4LAWA 4ODLA 4IQ2A 1J6YA 4LAXA 3JYMA 4J4NA 3KZ7A 3O5RA 2RUCA 3O5IA 4QIBA 1EQ3A 2PBCA 1BKFA 3UQIA 4TX0A 5D75A 3VAWA 2RURA 3IKDA 1TCOC 1BL4A 2AWGA 1FKHA 2KO7A 1NMWA 2XP9A 4LAVA 2XP4A 4U86A 3O5GA 4W9QA 3NI6A 5GPGA 4DT4A 1F40A 1ZK6A 1Q6HA 2D9FA 4C02B 4MSPA 4DROA 4TW8A 2ZQUA 1FKSA 5I98A 2PPOA 2PPPA 1NMVA 1FKBA 3KAHA 3UI4A 2KFWA 4JFJA 4ODPA 1JNSA 3O5PA 1FKGA 3O5QA 2M2AA 4DRNA 1T11A 3O5EA 2M1IA 2XP5A 3ODKA 1R9HA 1FKLA 2MLZA 1Y0OA 4N19A 3O5JA 3PA7A 4QT2A 1ROUA 4JFLA 2ZQVA 3TCZA 3O5LA 4DRIA 3O5DA 3I6CA 2LGOA 1N1AA 1FKDA 3O5KA 2RUDA 1FKFA 1U79A 1D6OA 1J4IA 3JXVA 1D7IA 1J4RA 2MF9A 3O5OA 4TW6A 5BXJA 2ZR5A 5HT1A 2Q5AA 3KAIA 4DRMA 3PRDA 3EY6A 1EYMA 2UZ5A 2MLXA 4MGVA 4JFIA 2OFNA 4J4OA 1FKRA 4LAYA 2MPHA 2F4EA 1FKIA 5HWCA 2LKNA 2IF4A 2XP8A 1FAPA 4G2PA 4ODNA 3H9RB 5HW7A 3UI6A 3IK8A 3IKGA 1FD9A 4IQCA 1FKKA 2PV3A 3JYJA 3OOBA 5HTGA 2KGJA 2F2DA 2JZVA 4DRJA 4DRPA 1FKTA 4U84A 1Q1CA 5DIUA 4GGQA 4TYOA 5HKGA 3NRKA 2RSEA 4NNRA 5DITA 1FKJA 3KAGA 2ITKA 3UQBA 2ZR4A
chains in the Genus database with same CATH superfamily
1LG1A 1SR0A 1A7XA 3OA5A 4DZ3A 3CGMA 2A3CA 1NWUA 5DEZA 3WD2A 5DO2A 5B8IC 1HXVA 4ODRA 4JYSA 2DT1A 3ARWA 3CHCA 3PRBA 1NSGA 4DRHA 3O5MA 4ODMA 1PBKA 2ZQTA 4DZ2A 3NTPA 1ROTA 4Z2LA 4QT3A 4KQZA 2ZR6A 1JNTA 4FN2A 2XP3A 5J6EA 3LUOA 3ARQA 3CGNA 4WKHA 5DIVA 4MNJA 3JYMA 1ITXA 3KZ7A 3O5RA 4QIBA 1XRVA 1BKFA 4TX0A 2RURA 2XP4A 1JNEA 4WKFA 3NI6A 3BXWA 4C02B 2WLYA 1LL4A 1FKSA 4HBEA 2PI6A 4ODPA 2WM0A 3O5QA 1T11A 4DWSB 2DSVA 2A3AA 3O5JA 1ROUA 3TCZA 2WK2A 3I6CA 4WKAA 1FKFA 4DWSA 2MF9A 1E15A 2O92A 2Q5AA 3KAIA 1W1PA 4MTVA 1GOIA 1EYMA 1H0IA 1LG2A 2OFNA 4J4OA 4LAYA 4HARA 4G2PA 1HJWA 4ODNA 3IKGA 2DSWA 4DWSC 5HTGA 4MAVA 4DRJA 4DRPA 2ESCA 4NNRA 2RSEA 1E9LA 3QOKA 1EIBA 1ZCNA 4WK9A 2FKEA 4DRQA 2G41A 3FY1A 3TDBA 1M5YA 2XP7A 3MDYB 2LJ4A 4DIPA 4U85A 1HJVA 4QZVB 2AOSA 4ODOA 5HWBA 2PV2A 1NWSA 4DWSD 4ZPVR 4GIVA 1UR9A 3B9EA 3GTYX 1CTNA 3O5FA 1LL6A 4IT4A 4S3JA 2DT2A 1EQ3A 2Y78A 3UQAA 4AY1A 2DG3A 1D7JA 4ODKA 1ZU8A 3WKZA 1HKMA 4DRKA 1E6PA 3ARUA 4R5EA 1L1PA 2FDMA 2KI3A 2KR7A 3G6LA 1W1TA 3UF8A 4DH0A 3KACA 1OWQA 2M08A 1QPLA 2DG4A 1Q6UA 2DT0A 4ODQA 2MNTA 1UR8A 4LAWA 3WIJA 1XHGA 1J6YA 4J4NA 3AROA 5HBFA 4MNMA 2P4VA 1HJXA 2YBUA 1TCOC 1BL4A 3WQWA 4LAVA 1NMWA 2XP9A 5GPGA 2A3BA 4DT4A 4HBOA 2EULA 4DROA 1K9TA 4MPKA 3G6MA 1EDQA 4JFJA 1W9PA 1FKGA 1FFQA 4DRNA 2DT3A 4P8UA 2M1IA 1O6IA 3ODKA 1FKLA 2MLZA 3B9AA 3AQUA 4N19A 2O9OA 3B8SA 3WD0A 1GUVA 2DPEA 4DRIA 1E6RA 3AS0A 2LGOA 3ARSA 1W1VA 1ZBKA 3JXVA 4WIWA 3ALFA 4DRMA 4Z2JA 1OGGA 1E44A 2IUZA 2MLXA 4MGVA 4JFIA 1FKRA 5HWCA 2B5UB 3CHFA 3IK8A 4IQCA 2PV3A 3JYJA 3OOBA 2KGJA 4U84A 5DIUA 5DITA 3KAGA 1X6LA 1W1YA 2ZR4A 1YATA 4W9PA 4WJXA 1B6CA 3IHZA 3KADA 2XPAA 2K8IA 3KABA 2PPNA 4TNSA 2RQSA 4FAPA 4MNLA 2N87A 3EIPA 3CH9A 1Q6IA 2B31A 1FJDA 3TC5A 3RGCA 2FAPA 5DF0A 1E6ZA 1J4HA 4NZCA 3AS1A 5HW6A 1LJYA 4R0XA 3GU0A 3RFWA 4S3KA 2DG9A 2F21A 1E6NA 4ZS6A 4ITZA 1KFWA 2VN1A 3ARXA 2ZQSA 3WL0A 1H0GA 1QZ2A 3WD4A 2G8ZA 1VF8A 3B7XA 5HW8A 2KE0A 2LPVA 3RM9A 1D7HA 4P8VA 4IQ2A 4LAXA 3ARVA 3ARRA 2RUCA 3PRAA 2PBCA 3WQVA 3VAWA 3IKDA 5JH8A 2AWGA 1FKHA 3UI4A 3CHEA 4U86A 4W9QA 1ZK6A 1Q6HA 1X6NA 2D9FA 4Z2KA 4L72B 1D2KA 1ZB5A 2PPOA 2PPPA 1NMVA 4P8WA 3CZ8A 1EHNA 3O5PA 1NH6A 2M2AA 1Y0OA 1RD6A 3PA7A 4QT2A 2ZQVA 3O5LA 1N1AA 3O5KA 1TFVA 1D6OA 1U79A 1J4IA 4TW6A 3O5OA 2ZR5A 2PN0A 1ZL1A 5HT1A 3W4RA 1W9UA 3PRDA 1GRJA 2UZ5A 1NWRA 2F4EA 1FKIA 2LKNA 5HW7A 3UI6A 4NSBA 2F2DA 2JZVA 1NWTA 1W9VA 4ML4A 5GQBA 1HKIA 2F23A 5HKGA 3NRKA 4UDMA 3UQBA 5HUAA 3B9DA 4TW7A 1ZBVA 2QF8A 1OGBA 1PINA 2VCDA 1KT0A 3FXYA 2PV1A 3ARYA 2RUQA 4JFKA 3GPKA 1IX5A 1KT1A 3UI5A 3AS2A 1YW5A 4XAKA 4JFMA 3AS3A 3KAFA 3RM8A 3KCEA 1HKKA 2MLYA 2WLZA 1QPFA 1P5QA 4G50A 4P8XA 3WH0A 1FFRA 2A3EA 4W9OA 2XPBA 3FAPA 3WD1A 2ETNA 1JVWA 1ZBWA 1C9HA 1JNDA 3CHDA 1F8AB 4Z2HA 1WAWA 4BF8A 2OLHA 2L2SA 2XP6A 4IPXA 4O2TA 3RMEA 1W26A 4ODLA 3RM4A 3O5IA 2DSZA 4MNKA 1ZBCA 4ZPWR 3UQIA 5D75A 4L3NA 2KO7A 2YBTA 1F40A 3O5GA 4MSPA 4TW8A 2ZQUA 5I98A 1FKBA 3KAHA 5GPRA 2KFWA 3ALGA 1JNSA 4LGXA 3O5EA 2XP5A 1R9HA 3WL1A 3WD3A 3ARPA 4JFLA 4URIA 4Q22A 4Q7NA 4ZPTR 3O5DA 1JCHB 1FKDA 2RUDA 4Z2IA 5BXJA 1D7IA 1J4RA 1WNOA 1LQ0A 4KR0B 3EY6A 1WB0A 1LL7A 4IT6A 3ARZA 3ARTA 2MPHA 2DSUA 2IF4A 2XP8A 3PR9A 1FAPA 3H9RB 4Z2GA 1FD9A 1SYTA 1FKKA 1GPFA 1FKTA 3BMBA 1Q1CA 1HKJA 4GGQA 4TYOA 1FKJA 4PTMA 2ITKA 4W5UA
chains in the Genus database with same CATH topology
1LG1A 1SR0A 1A7XA 3OA5A 4DZ3A 3CGMA 2A3CA 1NWUA 5DEZA 3WD2A 5DO2A 5B8IC 1HXVA 4ODRA 4JYSA 2DT1A 3ARWA 3CHCA 3PRBA 1NSGA 4DRHA 3O5MA 4ODMA 1PBKA 2ZQTA 4DZ2A 3NTPA 1ROTA 4Z2LA 4QT3A 4KQZA 2ZR6A 1JNTA 4FN2A 2XP3A 5J6EA 3LUOA 3ARQA 3CGNA 4WKHA 5DIVA 4MNJA 3JYMA 1ITXA 3KZ7A 3O5RA 4QIBA 1XRVA 1BKFA 4TX0A 2RURA 2XP4A 1JNEA 4WKFA 3NI6A 3BXWA 4C02B 2WLYA 1LL4A 1FKSA 4HBEA 2PI6A 4ODPA 2WM0A 3O5QA 1T11A 4DWSB 2DSVA 2A3AA 3O5JA 1ROUA 3TCZA 2WK2A 3I6CA 4WKAA 1FKFA 4DWSA 2MF9A 1E15A 2O92A 2Q5AA 3KAIA 1W1PA 4MTVA 1GOIA 1EYMA 1H0IA 1LG2A 2OFNA 4J4OA 4LAYA 4HARA 4G2PA 1HJWA 4ODNA 3IKGA 2DSWA 4DWSC 5HTGA 4MAVA 4DRJA 4DRPA 2ESCA 4NNRA 2RSEA 1E9LA 3QOKA 1EIBA 1ZCNA 4WK9A 2FKEA 4DRQA 2G41A 3FY1A 3TDBA 1M5YA 2XP7A 3MDYB 2LJ4A 4DIPA 4U85A 1HJVA 4QZVB 2AOSA 4ODOA 5HWBA 2PV2A 1NWSA 4DWSD 4ZPVR 4GIVA 1UR9A 3B9EA 1CTNA 3O5FA 1LL6A 4IT4A 4S3JA 2DT2A 1EQ3A 2Y78A 3UQAA 4AY1A 2DG3A 1D7JA 4ODKA 1ZU8A 3WKZA 1HKMA 4DRKA 1E6PA 3ARUA 4R5EA 1L1PA 2FDMA 2KI3A 2KR7A 3G6LA 1W1TA 3UF8A 4DH0A 3KACA 1OWQA 2M08A 1QPLA 2DG4A 1Q6UA 2DT0A 4ODQA 2MNTA 1UR8A 4LAWA 3WIJA 1XHGA 1J6YA 4J4NA 3AROA 5HBFA 4MNMA 1HJXA 2YBUA 1TCOC 1BL4A 3WQWA 4LAVA 1NMWA 2XP9A 5GPGA 2A3BA 4DT4A 4HBOA 4DROA 1K9TA 4MPKA 3G6MA 1EDQA 4JFJA 1W9PA 1FKGA 1FFQA 4DRNA 2DT3A 4P8UA 2M1IA 1O6IA 3ODKA 1FKLA 2MLZA 3B9AA 3AQUA 4N19A 2O9OA 3B8SA 3WD0A 1GUVA 2DPEA 4DRIA 1E6RA 3AS0A 2LGOA 3ARSA 1W1VA 1ZBKA 3JXVA 4WIWA 3ALFA 4DRMA 4Z2JA 1OGGA 2IUZA 2MLXA 4MGVA 4JFIA 1FKRA 5HWCA 3CHFA 3IK8A 4IQCA 2PV3A 3JYJA 3OOBA 2KGJA 4U84A 5DIUA 5DITA 3KAGA 1X6LA 1W1YA 2ZR4A 1YATA 4W9PA 4WJXA 1B6CA 3IHZA 3KADA 2XPAA 2K8IA 3KABA 2PPNA 4TNSA 2RQSA 4FAPA 4MNLA 2N87A 3CH9A 1Q6IA 2B31A 1FJDA 3TC5A 3RGCA 2FAPA 5DF0A 1E6ZA 1J4HA 4NZCA 3AS1A 5HW6A 1LJYA 4R0XA 3RFWA 4S3KA 2DG9A 2F21A 1E6NA 4ZS6A 4ITZA 1KFWA 2VN1A 3ARXA 2ZQSA 3WL0A 1H0GA 1QZ2A 3WD4A 2G8ZA 1VF8A 3B7XA 5HW8A 2KE0A 2LPVA 3RM9A 1D7HA 4P8VA 4IQ2A 4LAXA 3ARVA 3ARRA 2RUCA 3PRAA 2PBCA 3WQVA 3VAWA 3IKDA 5JH8A 2AWGA 1FKHA 3UI4A 3CHEA 4U86A 4W9QA 1ZK6A 1Q6HA 1X6NA 2D9FA 4Z2KA 4L72B 1D2KA 1ZB5A 2PPOA 2PPPA 1NMVA 4P8WA 3CZ8A 1EHNA 3O5PA 1NH6A 2M2AA 1Y0OA 1RD6A 3PA7A 4QT2A 2ZQVA 3O5LA 1N1AA 3O5KA 1TFVA 1D6OA 1U79A 1J4IA 4TW6A 3O5OA 2ZR5A 3W4RA 1ZL1A 5HT1A 1W9UA 3PRDA 2UZ5A 1NWRA 2F4EA 1FKIA 2LKNA 5HW7A 3UI6A 4NSBA 2F2DA 2JZVA 1NWTA 1W9VA 4ML4A 5GQBA 1HKIA 5HKGA 3NRKA 3UQBA 5HUAA 3B9DA 4TW7A 1ZBVA 2QF8A 1OGBA 1PINA 2VCDA 1KT0A 3FXYA 2PV1A 3ARYA 2RUQA 4JFKA 3GPKA 1IX5A 1KT1A 3UI5A 3AS2A 1YW5A 4XAKA 4JFMA 3AS3A 3KAFA 3RM8A 3KCEA 1HKKA 2MLYA 2WLZA 1QPFA 1P5QA 4G50A 4P8XA 3WH0A 1FFRA 2A3EA 4W9OA 2XPBA 3FAPA 3WD1A 1JVWA 1ZBWA 1C9HA 1JNDA 3CHDA 1F8AB 4Z2HA 1WAWA 4BF8A 2OLHA 2L2SA 2XP6A 4IPXA 4O2TA 3RMEA 1W26A 4ODLA 3RM4A 3O5IA 2DSZA 4MNKA 1ZBCA 4ZPWR 3UQIA 5D75A 4L3NA 2KO7A 2YBTA 1F40A 3O5GA 4MSPA 4TW8A 2ZQUA 5I98A 1FKBA 3KAHA 5GPRA 2KFWA 3ALGA 1JNSA 4LGXA 3O5EA 2XP5A 1R9HA 3WL1A 3WD3A 3ARPA 4JFLA 4URIA 4Q22A 4Q7NA 4ZPTR 3O5DA 1FKDA 2RUDA 4Z2IA 5BXJA 1D7IA 1J4RA 1WNOA 1LQ0A 4KR0B 3EY6A 1WB0A 1LL7A 4IT6A 3ARZA 3ARTA 2MPHA 2DSUA 2IF4A 2XP8A 3PR9A 1FAPA 3H9RB 4Z2GA 1FD9A 1SYTA 1FKKA 1GPFA 1FKTA 1Q1CA 1HKJA 4GGQA 4TYOA 1FKJA 4PTMA 2ITKA 4W5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A7X A;  4TW7 A;  1YAT A;  3CGM A;  4DZ3 A;  4W9P A;  1ZCN A;  1PIN A;  1B6C A;  2VCD A;  1KT0 A;  3IHZ A;  3KAD A;  2XPA A;  2PV1 A;  2FKE A;  2K8I A;  4DRQ A;  3KAB A;  5HUA A;  2PPN A;  4TNS A;  2RQS A;  3TDB A;  2RUQ A;  4FAP A;  2N87 A;  4JFK A;  1M5Y A;  3GPK A;  2XP7 A;  3MDY B;  2LJ4 A;  1Q6I A;  1KT1 A;  4U85 A;  3UI5 A;  4DIP A;  5B8I C;  1YW5 A;  4JFM A;  4ODO A;  5HWB A;  1FJD A;  1HXV A;  2PV2 A;  3KAF A;  3TC5 A;  3RGC A;  3KCE A;  4ODR A;  4JYS A;  2FAP A;  3PRB A;  2MLY A;  4GIV A;  1NSG A;  1J4H A;  4DRH A;  3O5F A;  1QPF A;  3O5M A;  5HW6 A;  1P5Q A;  4G50 A;  4ODM A;  2Y78 A;  4R0X A;  1PBK A;  3RFW A;  3WH0 A;  2DG3 A;  1D7J A;  3UQA A;  4ODK A;  2ZQT A;  4W9O A;  2DG9 A;  2F21 A;  2XPB A;  4DZ2 A;  3NTP A;  3FAP A;  4DRK A;  4ITZ A;  2VN1 A;  1ROT A;  1JVW A;  2ZQS A;  4QT3 A;  1C9H A;  1QZ2 A;  1L1P A;  2ZR6 A;  2KI3 A;  2KR7 A;  1F8A B;  1JNT A;  4FN2 A;  3UF8 A;  2XP3 A;  3B7X A;  4BF8 A;  4DH0 A;  5J6E A;  3LUO A;  2KE0 A;  3KAC A;  5HW8 A;  2LPV A;  2L2S A;  3CGN A;  2M08 A;  1QPL A;  1D7H A;  2DG4 A;  1Q6U A;  2XP6 A;  4IPX A;  4O2T A;  4ODQ A;  1W26 A;  5DIV A;  2MNT A;  4LAW A;  4ODL A;  4IQ2 A;  1J6Y A;  4LAX A;  3JYM A;  4J4N A;  3KZ7 A;  3O5R A;  2RUC A;  3O5I A;  4QIB A;  1EQ3 A;  2PBC A;  1BKF A;  3UQI A;  4TX0 A;  5D75 A;  3VAW A;  2RUR A;  3IKD A;  1TCO C;  1BL4 A;  2AWG A;  1FKH A;  2KO7 A;  1NMW A;  2XP9 A;  4LAV A;  2XP4 A;  4U86 A;  3O5G A;  4W9Q A;  3NI6 A;  5GPG A;  4DT4 A;  1F40 A;  1ZK6 A;  1Q6H A;  2D9F A;  4C02 B;  4MSP A;  4DRO A;  4TW8 A;  2ZQU A;  1FKS A;  5I98 A;  2PPO A;  2PPP A;  1NMV A;  1FKB A;  3KAH A;  3UI4 A;  2KFW A;  4JFJ A;  4ODP A;  1JNS A;  3O5P A;  1FKG A;  3O5Q A;  2M2A A;  4DRN A;  1T11 A;  3O5E A;  2M1I A;  2XP5 A;  3ODK A;  1R9H A;  1FKL A;  2MLZ A;  1Y0O A;  4N19 A;  3O5J A;  3PA7 A;  4QT2 A;  1ROU A;  4JFL A;  2ZQV A;  3TCZ A;  3O5L A;  4DRI A;  3O5D A;  3I6C A;  2LGO A;  1N1A A;  1FKD A;  3O5K A;  2RUD A;  1FKF A;  1U79 A;  1D6O A;  1J4I A;  3JXV A;  1D7I A;  1J4R A;  2MF9 A;  3O5O A;  4TW6 A;  5BXJ A;  2ZR5 A;  5HT1 A;  2Q5A A;  3KAI A;  4DRM A;  3PRD A;  3EY6 A;  1EYM A;  2UZ5 A;  2MLX A;  4MGV A;  4JFI A;  2OFN A;  4J4O A;  1FKR A;  4LAY A;  2MPH A;  2F4E A;  1FKI A;  5HWC A;  2LKN A;  2IF4 A;  2XP8 A;  1FAP A;  4G2P A;  4ODN A;  3H9R B;  5HW7 A;  3UI6 A;  3IK8 A;  3IKG A;  1FD9 A;  4IQC A;  1FKK A;  2PV3 A;  3JYJ A;  3OOB A;  5HTG A;  2KGJ A;  2F2D A;  2JZV A;  4DRJ A;  4DRP A;  1FKT A;  4U84 A;  1Q1C A;  5DIU A;  4GGQ A;  4TYO A;  5HKG A;  3NRK A;  2RSE A;  4NNR A;  5DIT A;  1FKJ A;  3KAG A;  2ITK A;  3UQB A;  2ZR4 A; 
#chains in the Genus database with same CATH topology
 1LG1 A;  1SR0 A;  1A7X A;  3OA5 A;  4DZ3 A;  3CGM A;  2A3C A;  1NWU A;  5DEZ A;  3WD2 A;  5DO2 A;  5B8I C;  1HXV A;  4ODR A;  4JYS A;  2DT1 A;  3ARW A;  3CHC A;  3PRB A;  1NSG A;  4DRH A;  3O5M A;  4ODM A;  1PBK A;  2ZQT A;  4DZ2 A;  3NTP A;  1ROT A;  4Z2L A;  4QT3 A;  4KQZ A;  2ZR6 A;  1JNT A;  4FN2 A;  2XP3 A;  5J6E A;  3LUO A;  3ARQ A;  3CGN A;  4WKH A;  5DIV A;  4MNJ A;  3JYM A;  1ITX A;  3KZ7 A;  3O5R A;  4QIB A;  1XRV A;  1BKF A;  4TX0 A;  2RUR A;  2XP4 A;  1JNE A;  4WKF A;  3NI6 A;  3BXW A;  4C02 B;  2WLY A;  1LL4 A;  1FKS A;  4HBE A;  2PI6 A;  4ODP A;  2WM0 A;  3O5Q A;  1T11 A;  4DWS B;  2DSV A;  2A3A A;  3O5J A;  1ROU A;  3TCZ A;  2WK2 A;  3I6C A;  4WKA A;  1FKF A;  4DWS A;  2MF9 A;  1E15 A;  2O92 A;  2Q5A A;  3KAI A;  1W1P A;  4MTV A;  1GOI A;  1EYM A;  1H0I A;  1LG2 A;  2OFN A;  4J4O A;  4LAY A;  4HAR A;  4G2P A;  1HJW A;  4ODN A;  3IKG A;  2DSW A;  4DWS C;  5HTG A;  4MAV A;  4DRJ A;  4DRP A;  2ESC A;  4NNR A;  2RSE A;  1E9L A;  3QOK A;  1EIB A;  1ZCN A;  4WK9 A;  2FKE A;  4DRQ A;  2G41 A;  3FY1 A;  3TDB A;  1M5Y A;  2XP7 A;  3MDY B;  2LJ4 A;  4DIP A;  4U85 A;  1HJV A;  4QZV B;  2AOS A;  4ODO A;  5HWB A;  2PV2 A;  1NWS A;  4DWS D;  4ZPV R;  4GIV A;  1UR9 A;  3B9E A;  3GTY X;  1CTN A;  3O5F A;  1LL6 A;  4IT4 A;  4S3J A;  2DT2 A;  1EQ3 A;  2Y78 A;  3UQA A;  4AY1 A;  2DG3 A;  1D7J A;  4ODK A;  1ZU8 A;  3WKZ A;  1HKM A;  4DRK A;  1E6P A;  3ARU A;  4R5E A;  1L1P A;  2FDM A;  2KI3 A;  2KR7 A;  3G6L A;  1W1T A;  3UF8 A;  4DH0 A;  3KAC A;  1OWQ A;  2M08 A;  1QPL A;  2DG4 A;  1Q6U A;  2DT0 A;  4ODQ A;  2MNT A;  1UR8 A;  4LAW A;  3WIJ A;  1XHG A;  1J6Y A;  4J4N A;  3ARO A;  5HBF A;  4MNM A;  2P4V A;  1HJX A;  2YBU A;  1TCO C;  1BL4 A;  3WQW A;  4LAV A;  1NMW A;  2XP9 A;  5GPG A;  2A3B A;  4DT4 A;  4HBO A;  2EUL A;  4DRO A;  1K9T A;  4MPK A;  3G6M A;  1EDQ A;  4JFJ A;  1W9P A;  1FKG A;  1FFQ A;  4DRN A;  2DT3 A;  4P8U A;  2M1I A;  1O6I A;  3ODK A;  1FKL A;  2MLZ A;  3B9A A;  3AQU A;  4N19 A;  2O9O A;  3B8S A;  3WD0 A;  1GUV A;  2DPE A;  4DRI A;  1E6R A;  3AS0 A;  2LGO A;  3ARS A;  1W1V A;  1ZBK A;  3JXV A;  4WIW A;  3ALF A;  4DRM A;  4Z2J A;  1OGG A;  1E44 A;  2IUZ A;  2MLX A;  4MGV A;  4JFI A;  1FKR A;  5HWC A;  2B5U B;  3CHF A;  3IK8 A;  4IQC A;  2PV3 A;  3JYJ A;  3OOB A;  2KGJ A;  4U84 A;  5DIU A;  5DIT A;  3KAG A;  1X6L A;  1W1Y A;  2ZR4 A;  1YAT A;  4W9P A;  4WJX A;  1B6C A;  3IHZ A;  3KAD A;  2XPA A;  2K8I A;  3KAB A;  2PPN A;  4TNS A;  2RQS A;  4FAP A;  4MNL A;  2N87 A;  3EIP A;  3CH9 A;  1Q6I A;  2B31 A;  1FJD A;  3TC5 A;  3RGC A;  2FAP A;  5DF0 A;  1E6Z A;  1J4H A;  4NZC A;  3AS1 A;  5HW6 A;  1LJY A;  4R0X A;  3GU0 A;  3RFW A;  4S3K A;  2DG9 A;  2F21 A;  1E6N A;  4ZS6 A;  4ITZ A;  1KFW A;  2VN1 A;  3ARX A;  2ZQS A;  3WL0 A;  1H0G A;  1QZ2 A;  3WD4 A;  2G8Z A;  1VF8 A;  3B7X A;  5HW8 A;  2KE0 A;  2LPV A;  3RM9 A;  1D7H A;  4P8V A;  4IQ2 A;  4LAX A;  3ARV A;  3ARR A;  2RUC A;  3PRA A;  2PBC A;  3WQV A;  3VAW A;  3IKD A;  5JH8 A;  2AWG A;  1FKH A;  3UI4 A;  3CHE A;  4U86 A;  4W9Q A;  1ZK6 A;  1Q6H A;  1X6N A;  2D9F A;  4Z2K A;  4L72 B;  1D2K A;  1ZB5 A;  2PPO A;  2PPP A;  1NMV A;  4P8W A;  3CZ8 A;  1EHN A;  3O5P A;  1NH6 A;  2M2A A;  1Y0O A;  1RD6 A;  3PA7 A;  4QT2 A;  2ZQV A;  3O5L A;  1N1A A;  3O5K A;  1TFV A;  1D6O A;  1U79 A;  1J4I A;  4TW6 A;  3O5O A;  2ZR5 A;  2PN0 A;  1ZL1 A;  5HT1 A;  3W4R A;  1W9U A;  3PRD A;  1GRJ A;  2UZ5 A;  1NWR A;  2F4E A;  1FKI A;  2LKN A;  5HW7 A;  3UI6 A;  4NSB A;  2F2D A;  2JZV A;  1NWT A;  1W9V A;  4ML4 A;  5GQB A;  1HKI A;  2F23 A;  5HKG A;  3NRK A;  4UDM A;  3UQB A;  5HUA A;  3B9D A;  4TW7 A;  1ZBV A;  2QF8 A;  1OGB A;  1PIN A;  2VCD A;  1KT0 A;  3FXY A;  2PV1 A;  3ARY A;  2RUQ A;  4JFK A;  3GPK A;  1IX5 A;  1KT1 A;  3UI5 A;  3AS2 A;  1YW5 A;  4XAK A;  4JFM A;  3AS3 A;  3KAF A;  3RM8 A;  3KCE A;  1HKK A;  2MLY A;  2WLZ A;  1QPF A;  1P5Q A;  4G50 A;  4P8X A;  3WH0 A;  1FFR A;  2A3E A;  4W9O A;  2XPB A;  3FAP A;  3WD1 A;  2ETN A;  1JVW A;  1ZBW A;  1C9H A;  1JND A;  3CHD A;  1F8A B;  4Z2H A;  1WAW A;  4BF8 A;  2OLH A;  2L2S A;  2XP6 A;  4IPX A;  4O2T A;  3RME A;  1W26 A;  4ODL A;  3RM4 A;  3O5I A;  2DSZ A;  4MNK A;  1ZBC A;  4ZPW R;  3UQI A;  5D75 A;  4L3N A;  2KO7 A;  2YBT A;  1F40 A;  3O5G A;  4MSP A;  4TW8 A;  2ZQU A;  5I98 A;  1FKB A;  3KAH A;  5GPR A;  2KFW A;  3ALG A;  1JNS A;  4LGX A;  3O5E A;  2XP5 A;  1R9H A;  3WL1 A;  3WD3 A;  3ARP A;  4JFL A;  4URI A;  4Q22 A;  4Q7N A;  4ZPT R;  3O5D A;  1JCH B;  1FKD A;  2RUD A;  4Z2I A;  5BXJ A;  1D7I A;  1J4R A;  1WNO A;  1LQ0 A;  4KR0 B;  3EY6 A;  1WB0 A;  1LL7 A;  4IT6 A;  3ARZ A;  3ART A;  2MPH A;  2DSU A;  2IF4 A;  2XP8 A;  3PR9 A;  1FAP A;  3H9R B;  4Z2G A;  1FD9 A;  1SYT A;  1FKK A;  1GPF A;  1FKT A;  3BMB A;  1Q1C A;  1HKJ A;  4GGQ A;  4TYO A;  1FKJ A;  4PTM A;  2ITK A;  4W5U A; 
#chains in the Genus database with same CATH homology
 1LG1 A;  1SR0 A;  1A7X A;  3OA5 A;  4DZ3 A;  3CGM A;  2A3C A;  1NWU A;  5DEZ A;  3WD2 A;  5DO2 A;  5B8I C;  1HXV A;  4ODR A;  4JYS A;  2DT1 A;  3ARW A;  3CHC A;  3PRB A;  1NSG A;  4DRH A;  3O5M A;  4ODM A;  1PBK A;  2ZQT A;  4DZ2 A;  3NTP A;  1ROT A;  4Z2L A;  4QT3 A;  4KQZ A;  2ZR6 A;  1JNT A;  4FN2 A;  2XP3 A;  5J6E A;  3LUO A;  3ARQ A;  3CGN A;  4WKH A;  5DIV A;  4MNJ A;  3JYM A;  1ITX A;  3KZ7 A;  3O5R A;  4QIB A;  1XRV A;  1BKF A;  4TX0 A;  2RUR A;  2XP4 A;  1JNE A;  4WKF A;  3NI6 A;  3BXW A;  4C02 B;  2WLY A;  1LL4 A;  1FKS A;  4HBE A;  2PI6 A;  4ODP A;  2WM0 A;  3O5Q A;  1T11 A;  4DWS B;  2DSV A;  2A3A A;  3O5J A;  1ROU A;  3TCZ A;  2WK2 A;  3I6C A;  4WKA A;  1FKF A;  4DWS A;  2MF9 A;  1E15 A;  2O92 A;  2Q5A A;  3KAI A;  1W1P A;  4MTV A;  1GOI A;  1EYM A;  1H0I A;  1LG2 A;  2OFN A;  4J4O A;  4LAY A;  4HAR A;  4G2P A;  1HJW A;  4ODN A;  3IKG A;  2DSW A;  4DWS C;  5HTG A;  4MAV A;  4DRJ A;  4DRP A;  2ESC A;  4NNR A;  2RSE A;  1E9L A;  3QOK A;  1EIB A;  1ZCN A;  4WK9 A;  2FKE A;  4DRQ A;  2G41 A;  3FY1 A;  3TDB A;  1M5Y A;  2XP7 A;  3MDY B;  2LJ4 A;  4DIP A;  4U85 A;  1HJV A;  4QZV B;  2AOS A;  4ODO A;  5HWB A;  2PV2 A;  1NWS A;  4DWS D;  4ZPV R;  4GIV A;  1UR9 A;  3B9E A;  1CTN A;  3O5F A;  1LL6 A;  4IT4 A;  4S3J A;  2DT2 A;  1EQ3 A;  2Y78 A;  3UQA A;  4AY1 A;  2DG3 A;  1D7J A;  4ODK A;  1ZU8 A;  3WKZ A;  1HKM A;  4DRK A;  1E6P A;  3ARU A;  4R5E A;  1L1P A;  2FDM A;  2KI3 A;  2KR7 A;  3G6L A;  1W1T A;  3UF8 A;  4DH0 A;  3KAC A;  1OWQ A;  2M08 A;  1QPL A;  2DG4 A;  1Q6U A;  2DT0 A;  4ODQ A;  2MNT A;  1UR8 A;  4LAW A;  3WIJ A;  1XHG A;  1J6Y A;  4J4N A;  3ARO A;  5HBF A;  4MNM A;  1HJX A;  2YBU A;  1TCO C;  1BL4 A;  3WQW A;  4LAV A;  1NMW A;  2XP9 A;  5GPG A;  2A3B A;  4DT4 A;  4HBO A;  4DRO A;  1K9T A;  4MPK A;  3G6M A;  1EDQ A;  4JFJ A;  1W9P A;  1FKG A;  1FFQ A;  4DRN A;  2DT3 A;  4P8U A;  2M1I A;  1O6I A;  3ODK A;  1FKL A;  2MLZ A;  3B9A A;  3AQU A;  4N19 A;  2O9O A;  3B8S A;  3WD0 A;  1GUV A;  2DPE A;  4DRI A;  1E6R A;  3AS0 A;  2LGO A;  3ARS A;  1W1V A;  1ZBK A;  3JXV A;  4WIW A;  3ALF A;  4DRM A;  4Z2J A;  1OGG A;  2IUZ A;  2MLX A;  4MGV A;  4JFI A;  1FKR A;  5HWC A;  3CHF A;  3IK8 A;  4IQC A;  2PV3 A;  3JYJ A;  3OOB A;  2KGJ A;  4U84 A;  5DIU A;  5DIT A;  3KAG A;  1X6L A;  1W1Y A;  2ZR4 A;  1YAT A;  4W9P A;  4WJX A;  1B6C A;  3IHZ A;  3KAD A;  2XPA A;  2K8I A;  3KAB A;  2PPN A;  4TNS A;  2RQS A;  4FAP A;  4MNL A;  2N87 A;  3CH9 A;  1Q6I A;  2B31 A;  1FJD A;  3TC5 A;  3RGC A;  2FAP A;  5DF0 A;  1E6Z A;  1J4H A;  4NZC A;  3AS1 A;  5HW6 A;  1LJY A;  4R0X A;  3RFW A;  4S3K A;  2DG9 A;  2F21 A;  1E6N A;  4ZS6 A;  4ITZ A;  1KFW A;  2VN1 A;  3ARX A;  2ZQS A;  3WL0 A;  1H0G A;  1QZ2 A;  3WD4 A;  2G8Z A;  1VF8 A;  3B7X A;  5HW8 A;  2KE0 A;  2LPV A;  3RM9 A;  1D7H A;  4P8V A;  4IQ2 A;  4LAX A;  3ARV A;  3ARR A;  2RUC A;  3PRA A;  2PBC A;  3WQV A;  3VAW A;  3IKD A;  5JH8 A;  2AWG A;  1FKH A;  3UI4 A;  3CHE A;  4U86 A;  4W9Q A;  1ZK6 A;  1Q6H A;  1X6N A;  2D9F A;  4Z2K A;  4L72 B;  1D2K A;  1ZB5 A;  2PPO A;  2PPP A;  1NMV A;  4P8W A;  3CZ8 A;  1EHN A;  3O5P A;  1NH6 A;  2M2A A;  1Y0O A;  1RD6 A;  3PA7 A;  4QT2 A;  2ZQV A;  3O5L A;  1N1A A;  3O5K A;  1TFV A;  1D6O A;  1U79 A;  1J4I A;  4TW6 A;  3O5O A;  2ZR5 A;  3W4R A;  1ZL1 A;  5HT1 A;  1W9U A;  3PRD A;  2UZ5 A;  1NWR A;  2F4E A;  1FKI A;  2LKN A;  5HW7 A;  3UI6 A;  4NSB A;  2F2D A;  2JZV A;  1NWT A;  1W9V A;  4ML4 A;  5GQB A;  1HKI A;  5HKG A;  3NRK A;  3UQB A;  5HUA A;  3B9D A;  4TW7 A;  1ZBV A;  2QF8 A;  1OGB A;  1PIN A;  2VCD A;  1KT0 A;  3FXY A;  2PV1 A;  3ARY A;  2RUQ A;  4JFK A;  3GPK A;  1IX5 A;  1KT1 A;  3UI5 A;  3AS2 A;  1YW5 A;  4XAK A;  4JFM A;  3AS3 A;  3KAF A;  3RM8 A;  3KCE A;  1HKK A;  2MLY A;  2WLZ A;  1QPF A;  1P5Q A;  4G50 A;  4P8X A;  3WH0 A;  1FFR A;  2A3E A;  4W9O A;  2XPB A;  3FAP A;  3WD1 A;  1JVW A;  1ZBW A;  1C9H A;  1JND A;  3CHD A;  1F8A B;  4Z2H A;  1WAW A;  4BF8 A;  2OLH A;  2L2S A;  2XP6 A;  4IPX A;  4O2T A;  3RME A;  1W26 A;  4ODL A;  3RM4 A;  3O5I A;  2DSZ A;  4MNK A;  1ZBC A;  4ZPW R;  3UQI A;  5D75 A;  4L3N A;  2KO7 A;  2YBT A;  1F40 A;  3O5G A;  4MSP A;  4TW8 A;  2ZQU A;  5I98 A;  1FKB A;  3KAH A;  5GPR A;  2KFW A;  3ALG A;  1JNS A;  4LGX A;  3O5E A;  2XP5 A;  1R9H A;  3WL1 A;  3WD3 A;  3ARP A;  4JFL A;  4URI A;  4Q22 A;  4Q7N A;  4ZPT R;  3O5D A;  1FKD A;  2RUD A;  4Z2I A;  5BXJ A;  1D7I A;  1J4R A;  1WNO A;  1LQ0 A;  4KR0 B;  3EY6 A;  1WB0 A;  1LL7 A;  4IT6 A;  3ARZ A;  3ART A;  2MPH A;  2DSU A;  2IF4 A;  2XP8 A;  3PR9 A;  1FAP A;  3H9R B;  4Z2G A;  1FD9 A;  1SYT A;  1FKK A;  1GPF A;  1FKT A;  1Q1C A;  1HKJ A;  4GGQ A;  4TYO A;  1FKJ A;  4PTM A;  2ITK A;  4W5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...