3EY6A

Crystal structure of the fk506-binding domain of human fkbp38
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
MREWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVDGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 8
publication title A charge-sensitive loop in the FKBP38 catalytic domain modulates Bcl-2 binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 29
structure length 118
sequence length 118
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3ey6A00
1FKJA 1Q6HA 1KT1A 2KFWA 3I6CA 1D7IA 5DITA 2LGOA 2ZR5A 1FKFA 2KR7A 5HW7A 4W9QA 2PV1A 3KACA 4QT2A 1Q1CA 2KGJA 2OFNA 3O5OA 1FKHA 1JVWA 2ZR4A 3RGCA 3UQBA 3O5IA 1ZCNA 2N87A 3O5GA 4QT3A 2RURA 2LKNA 1B6CA 3B7XA 3GPKA 2VCDA 3UI4A 4C02B 4DRHA 4G2PA 5GPGA 1YATA 3KADA 4U84A 4ODMA 1PINA 4JYSA 2Q5AA 3O5JA 2MNTA 1N1AA 3KAIA 5HWBA 4JFJA 4LAVA 1BL4A 5J6EA 1BKFA 3OOBA 1U79A 5B8IC 1FKDA 2LPVA 4DRPA 3KAFA 3WH0A 1C9HA 2ZQUA 1FKSA 1T11A 4ODRA 4ODKA 3UQAA 2F4EA 2RQSA 1ROTA 2MLZA 4ITZA 1ZK6A 3LUOA 1TCOC 2MF9A 2VN1A 3KZ7A 4JFLA 4TW8A 3UF8A 4DRMA 4DRJA 1J4IA 2MPHA 3O5RA 1D7HA 3EY6A 4W9PA 5HTGA 1YW5A 3NTPA 2FKEA 2UZ5A 1M5YA 3O5QA 4LAYA 4NNRA 2PV2A 1FKIA 3CGMA 1A7XA 4DRIA 5HT1A 4J4NA 4G50A 3O5KA 2MLXA 1JNSA 4JFMA 4U85A 1NMVA 1QPFA 3NRKA 3FAPA 1J6YA 1FD9A 2DG3A 2KE0A 3ODKA 5HW8A 2XP6A 3CGNA 3IKDA 2RUDA 3UI5A 4ODOA 2XP9A 2PV3A 1P5QA 4DH0A 2K8IA 3KCEA 3KAHA 4LAWA 4ODPA 3O5LA 4DT4A 4DZ2A 2PPNA 3MDYB 1FAPA 2M08A 3JYMA 5HWCA 2XP8A 2F2DA 1QZ2A 2XPBA 4W9OA 2ZQVA 2KO7A 2RUQA 3UQIA 3O5DA 4QIBA 1Y0OA 4FAPA 2LJ4A 1Q6IA 4IQ2A 4DROA 1D6OA 2RUCA 3PA7A 4TYOA 4JFKA 5DIVA 1HXVA 2RSEA 4DRKA 2F21A 4DRNA 1FKBA 4R0XA 5HUAA 5BXJA 1FKRA 4J4OA 1FKTA 2L2SA 5HW6A 4GIVA 3TC5A 2JZVA 2XP5A 2ZQTA 1KT0A 4TW6A 4ODLA 4JFIA 1J4RA 3JXVA 4U86A 5HKGA 4ODQA 5I98A 3IHZA 2XP3A 2KI3A 2IF4A 2M1IA 4N19A 4TNSA 1L1PA 2XPAA 2DG4A 1FKGA 2MLYA 3PRDA 4IPXA 2ITKA 1FJDA 3TDBA 5DIUA 4IQCA 3O5PA 3RFWA 1NSGA 4DRQA 2AWGA 3VAWA 2XP4A 3JYJA 4MSPA 3TCZA 3NI6A 2PBCA 1Q6UA 3IK8A 1ROUA 3H9RB 3UI6A 3KABA 1R9HA 3O5MA 1F8AB 5D75A 3O5EA 1NMWA 2PPOA 2XP7A 2Y78A 3PRBA 3IKGA 4BF8A 4DIPA 4DZ3A 1EQ3A 1JNTA 4O2TA 3O5FA 2ZQSA 1FKKA 2D9FA 1PBKA 1J4HA 1QPLA 2FAPA 4FN2A 2DG9A 1W26A 4ODNA 2PPPA 4MGVA 1FKLA 4LAXA 4TX0A 1EYMA 2M2AA 1F40A 4TW7A 3KAGA 1D7JA 2ZR6A 4GGQA
chains in the Genus database with same CATH superfamily
1FKJA 1Q6HA 2KFWA 4WIWA 1D7IA 5DITA 1HKMA 2ZR5A 5HW7A 4NSBA 4Q7NA 1XHGA 2PN0A 4W9QA 1Q1CA 2KGJA 3O5OA 3O5IA 1ZCNA 2DSVA 4QT3A 3PRAA 1B6CA 1UR9A 4WK9A 4C02B 3CHFA 1YATA 1EIBA 4JYSA 2MNTA 1N1AA 1W1PA 3B9EA 3WD4A 1H0IA 3WH0A 3B8SA 2F4EA 2RQSA 2MLZA 4ITZA 3UI5A 1TCOC 2MF9A 3KZ7A 3O5RA 2AOSA 5GQBA 1W9VA 1M5YA 4NNRA 2P4VA 1A7XA 4HARA 4J4NA 1QPFA 2WLZA 1CTNA 3FY1A 2DG3A 2KE0A 3ODKA 2DT2A 5HW8A 1ZL1A 1JCHB 4DZ2A 4ODPA 4DT4A 5B8IC 2M08A 1IX5A 4FAPA 2LJ4A 4DROA 4TYOA 4JFKA 3ALFA 3WD1A 2DSWA 1GRJA 4R0XA 3ARVA 5HUAA 4DWSB 1FKTA 2L2SA 4L72B 2XP5A 4TW6A 4U86A 3JXVA 4TNSA 1E6NA 2IF4A 2MLYA 4IPXA 3ARRA 2QF8A 4Z2LA 3WD3A 1NSGA 2AWGA 4URIA 4MSPA 1E6PA 1Q6UA 1K9TA 4MNLA 5D75A 4ZPTR 2PPOA 4DZ3A 3PRBA 3IKGA 1ZBWA 1JNTA 1FKKA 1PBKA 1WAWA 4MPKA 4P8UA 4Q22A 1W26A 4ODNA 1LL4A 3ARYA 4TW7A 2PV1A 3KACA 2OFNA 1H0GA 1OWQA 1SYTA 3AS2A 2N87A 1OGGA 3AS0A 2F23A 4DRHA 5GPGA 4ODMA 4QZVB 1E6RA 4ZS6A 4DWSA 3BMBA 2PI6A 4Z2HA 1BL4A 4DRPA 2LPVA 4WKHA 4ODRA 1FFRA 1ZK6A 3LUOA 4TW8A 3UF8A 1J4IA 2MPHA 4W9PA 5HTGA 1X6NA 1HJXA 3NTPA 1NWRA 4LGXA 4LAYA 1E9LA 1LL6A 3O5KA 2MLXA 4U85A 4DWSC 3FAPA 2DSZA 3WQWA 1LQ0A 4MNMA 2RUDA 4ODOA 1P5QA 4DH0A 3ARZA 5HWCA 2F2DA 4W9OA 4WKAA 2KO7A 2RUQA 3ARTA 3BXWA 1NWSA 3O5DA 1JNDA 2B31A 2O9OA 1D6OA 5DO2A 4HBOA 4DRKA 1D2KA 2F21A 4DRNA 3GTYX 4NZCA 2WM0A 1EHNA 5HW6A 2JZVA 1KT0A 4JFIA 2A3BA 4N19A 2M1IA 3FXYA 1O6IA 3PRDA 2ITKA 5DIUA 4WKFA 2XP4A 1KFWA 5DEZA 1OGBA 1E15A 2G8ZA 4ZPWR 2ETNA 3WIJA 2FDMA 4P8WA 3KABA 1F8AB 3AROA 4BF8A 4AY1A 2ZQSA 1XRVA 3QOKA 1W1TA 3CHDA 4MGVA 4TX0A 2M2AA 3ARWA 3G6MA 1KT1A 1ZBVA 3I6CA 1FKFA 1FKHA 1JVWA 3UQBA 2WLYA 4L3NA 1UR8A 3GU0A 3O5GA 1TFVA 1RD6A 1X6LA 2A3CA 3AS3A 4G2PA 3KADA 1PINA 2Q5AA 5HWBA 3B9DA 4LAVA 5J6EA 3OOBA 1U79A 1FKDA 3ALGA 3KAFA 3WKZA 5HBFA 3UQAA 1ROTA 2VN1A 4DRMA 2IUZA 3EY6A 1LG1A 1EDQA 2ESCA 1YW5A 2UZ5A 2A3AA 3O5QA 2PV2A 1FKIA 1ZBCA 4MNJA 1GPFA 1NMVA 2YBTA 2B5UB 4KQZA 2XP6A 3CGNA 3IKDA 1GUVA 4WJXA 3CHCA 3WL1A 2PV3A 4PTMA 3KAHA 4LAWA 2PPNA 1WB0A 1FAPA 2XPBA 4S3JA 4Z2KA 2ZQVA 3UQIA 1Y0OA 4ML4A 1Q6IA 1HKJA 1ZBKA 3AQUA 3RM9A 3PA7A 1HXVA 2RSEA 1VF8A 1W9PA 3WD2A 4GIVA 2G41A 4ODLA 3RMEA 1J4RA 5I98A 3IHZA 2XP3A 1L1PA 2DG4A 1FKGA 1FJDA 3TDBA 4UDMA 3OA5A 4IQCA 3O5PA 4MTVA 4KR0B 3VAWA 3ARQA 3JYJA 3TCZA 3AS1A 3NI6A 2PBCA 4P8XA 2O92A 3IK8A 3UI6A 2DPEA 1HJVA 3O5MA 1W1YA 1NMWA 2Y78A 4O2TA 3O5FA 2D9FA 1QPLA 1FFQA 2FAPA 4R5EA 1HJWA 1F40A 1EYMA 3KAGA 2ZR6A 3PR9A 4GGQA 3WD0A 3ARPA 4HBEA 1ZU8A 1HKKA 2DT3A 2LGOA 2KR7A 1E6ZA 4QT2A 3ARXA 2DSUA 2ZR4A 3RGCA 2RURA 1HKIA 2LKNA 3B7XA 3GPKA 2VCDA 3UI4A 3WL0A 1WNOA 4U84A 4S3KA 1GOIA 3O5JA 3EIPA 2DT1A 3KAIA 4JFJA 1BKFA 1C9HA 2ZQUA 1FKSA 1T11A 4ODKA 4JFLA 1NWTA 4DRJA 3CH9A 1D7HA 2FKEA 3CGMA 4DRIA 5HT1A 2A3EA 4G50A 3RM8A 1JNSA 4JFMA 3NRKA 1NH6A 5GPRA 3ARSA 1J6YA 1FD9A 2OLHA 1NWUA 4XAKA 5JH8A 2XP9A 3CZ8A 2K8IA 3KCEA 3O5LA 3MDYB 3JYMA 2EULA 2XP8A 1QZ2A 4Z2GA 4P8VA 4QIBA 4IQ2A 2RUCA 5DF0A 5DIVA 3ARUA 3WQVA 4IT4A 1FKBA 5BXJA 1FKRA 4J4OA 3RM4A 3B9AA 2WK2A 1JNEA 3TC5A 2ZQTA 5HKGA 4ODQA 2KI3A 2XPAA 4DWSD 1ITXA 4Z2JA 3RFWA 4DRQA 1ROUA 3H9RB 1W9UA 1W1VA 4IT6A 1R9HA 3O5EA 2XP7A 4ZPVR 4DIPA 1EQ3A 1SR0A 4Z2IA 1LG2A 2DT0A 2YBUA 3W4RA 1J4HA 3CHEA 1E44A 4MAVA 1ZB5A 3G6LA 4FN2A 2DG9A 2PPPA 1FKLA 4LAXA 1LJYA 1LL7A 4MNKA 4W5UA 1D7JA
chains in the Genus database with same CATH topology
1FKJA 1Q6HA 2KFWA 4WIWA 1D7IA 5DITA 1HKMA 2ZR5A 5HW7A 4NSBA 4Q7NA 1XHGA 4W9QA 1Q1CA 2KGJA 3O5OA 3O5IA 1ZCNA 2DSVA 4QT3A 3PRAA 1B6CA 1UR9A 4WK9A 4C02B 3CHFA 1YATA 1EIBA 4JYSA 2MNTA 1N1AA 1W1PA 3B9EA 3WD4A 1H0IA 3WH0A 3B8SA 2F4EA 2RQSA 2MLZA 4ITZA 3UI5A 1TCOC 2MF9A 3KZ7A 3O5RA 2AOSA 5GQBA 1W9VA 1M5YA 4NNRA 1A7XA 4HARA 4J4NA 1QPFA 2WLZA 1CTNA 3FY1A 2DG3A 2KE0A 3ODKA 2DT2A 5HW8A 1ZL1A 4DZ2A 4ODPA 4DT4A 5B8IC 2M08A 1IX5A 4FAPA 2LJ4A 4DROA 4TYOA 4JFKA 3ALFA 3WD1A 2DSWA 4R0XA 3ARVA 5HUAA 4DWSB 1FKTA 2L2SA 4L72B 2XP5A 4TW6A 4U86A 3JXVA 4TNSA 1E6NA 2IF4A 2MLYA 4IPXA 3ARRA 2QF8A 4Z2LA 3WD3A 1NSGA 2AWGA 4URIA 4MSPA 1E6PA 1Q6UA 1K9TA 4MNLA 5D75A 4ZPTR 2PPOA 4DZ3A 3PRBA 3IKGA 1ZBWA 1JNTA 1FKKA 1PBKA 1WAWA 4MPKA 4P8UA 4Q22A 1W26A 4ODNA 1LL4A 3ARYA 4TW7A 2PV1A 3KACA 2OFNA 1H0GA 1OWQA 1SYTA 3AS2A 2N87A 1OGGA 3AS0A 4DRHA 5GPGA 4ODMA 4QZVB 1E6RA 4ZS6A 4DWSA 2PI6A 4Z2HA 1BL4A 4DRPA 2LPVA 4WKHA 4ODRA 1FFRA 1ZK6A 3LUOA 4TW8A 3UF8A 1J4IA 2MPHA 4W9PA 5HTGA 1X6NA 1HJXA 3NTPA 1NWRA 4LGXA 4LAYA 1E9LA 1LL6A 3O5KA 2MLXA 4U85A 4DWSC 3FAPA 2DSZA 3WQWA 1LQ0A 4MNMA 2RUDA 4ODOA 1P5QA 4DH0A 3ARZA 5HWCA 2F2DA 4W9OA 4WKAA 2KO7A 2RUQA 3ARTA 3BXWA 1NWSA 3O5DA 1JNDA 2B31A 2O9OA 1D6OA 5DO2A 4HBOA 4DRKA 1D2KA 2F21A 4DRNA 4NZCA 2WM0A 1EHNA 5HW6A 2JZVA 1KT0A 4JFIA 2A3BA 4N19A 2M1IA 3FXYA 1O6IA 3PRDA 2ITKA 5DIUA 4WKFA 2XP4A 1KFWA 5DEZA 1OGBA 1E15A 2G8ZA 4ZPWR 3WIJA 2FDMA 4P8WA 3KABA 1F8AB 3AROA 4BF8A 4AY1A 2ZQSA 1XRVA 3QOKA 1W1TA 3CHDA 4MGVA 4TX0A 2M2AA 3ARWA 3G6MA 1KT1A 1ZBVA 3I6CA 1FKFA 1FKHA 1JVWA 3UQBA 2WLYA 4L3NA 1UR8A 3O5GA 1TFVA 1RD6A 1X6LA 2A3CA 3AS3A 4G2PA 3KADA 1PINA 2Q5AA 5HWBA 3B9DA 4LAVA 5J6EA 3OOBA 1U79A 1FKDA 3ALGA 3KAFA 3WKZA 5HBFA 3UQAA 1ROTA 2VN1A 4DRMA 2IUZA 3EY6A 1LG1A 1EDQA 2ESCA 1YW5A 2UZ5A 2A3AA 3O5QA 2PV2A 1FKIA 1ZBCA 4MNJA 1GPFA 1NMVA 2YBTA 4KQZA 2XP6A 3CGNA 3IKDA 1GUVA 4WJXA 3CHCA 3WL1A 2PV3A 4PTMA 3KAHA 4LAWA 2PPNA 1WB0A 1FAPA 2XPBA 4S3JA 4Z2KA 2ZQVA 3UQIA 1Y0OA 4ML4A 1Q6IA 1HKJA 1ZBKA 3AQUA 3RM9A 3PA7A 1HXVA 2RSEA 1VF8A 1W9PA 3WD2A 4GIVA 2G41A 4ODLA 3RMEA 1J4RA 5I98A 3IHZA 2XP3A 1L1PA 2DG4A 1FKGA 1FJDA 3TDBA 3OA5A 4IQCA 3O5PA 4MTVA 4KR0B 3VAWA 3ARQA 3JYJA 3TCZA 3AS1A 3NI6A 2PBCA 4P8XA 2O92A 3IK8A 3UI6A 2DPEA 1HJVA 3O5MA 1W1YA 1NMWA 2Y78A 4O2TA 3O5FA 2D9FA 1QPLA 1FFQA 2FAPA 4R5EA 1HJWA 1F40A 1EYMA 3KAGA 2ZR6A 3PR9A 4GGQA 3WD0A 3ARPA 4HBEA 1ZU8A 1HKKA 2DT3A 2LGOA 2KR7A 1E6ZA 4QT2A 3ARXA 2DSUA 2ZR4A 3RGCA 2RURA 1HKIA 2LKNA 3B7XA 3GPKA 2VCDA 3UI4A 3WL0A 1WNOA 4U84A 4S3KA 1GOIA 3O5JA 2DT1A 3KAIA 4JFJA 1BKFA 1C9HA 2ZQUA 1FKSA 1T11A 4ODKA 4JFLA 1NWTA 4DRJA 3CH9A 1D7HA 2FKEA 3CGMA 4DRIA 5HT1A 2A3EA 4G50A 3RM8A 1JNSA 4JFMA 3NRKA 1NH6A 5GPRA 3ARSA 1J6YA 1FD9A 2OLHA 1NWUA 4XAKA 5JH8A 2XP9A 3CZ8A 2K8IA 3KCEA 3O5LA 3MDYB 3JYMA 2XP8A 1QZ2A 4Z2GA 4P8VA 4QIBA 4IQ2A 2RUCA 5DF0A 5DIVA 3ARUA 3WQVA 4IT4A 1FKBA 5BXJA 1FKRA 4J4OA 3RM4A 3B9AA 2WK2A 1JNEA 3TC5A 2ZQTA 5HKGA 4ODQA 2KI3A 2XPAA 4DWSD 1ITXA 4Z2JA 3RFWA 4DRQA 1ROUA 3H9RB 1W9UA 1W1VA 4IT6A 1R9HA 3O5EA 2XP7A 4ZPVR 4DIPA 1EQ3A 1SR0A 4Z2IA 1LG2A 2DT0A 2YBUA 3W4RA 1J4HA 3CHEA 4MAVA 1ZB5A 3G6LA 4FN2A 2DG9A 2PPPA 1FKLA 4LAXA 1LJYA 1LL7A 4MNKA 4W5UA 1D7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKJ A;  1Q6H A;  1KT1 A;  2KFW A;  3I6C A;  1D7I A;  5DIT A;  2LGO A;  2ZR5 A;  1FKF A;  2KR7 A;  5HW7 A;  4W9Q A;  2PV1 A;  3KAC A;  4QT2 A;  1Q1C A;  2KGJ A;  2OFN A;  3O5O A;  1FKH A;  1JVW A;  2ZR4 A;  3RGC A;  3UQB A;  3O5I A;  1ZCN A;  2N87 A;  3O5G A;  4QT3 A;  2RUR A;  2LKN A;  1B6C A;  3B7X A;  3GPK A;  2VCD A;  3UI4 A;  4C02 B;  4DRH A;  4G2P A;  5GPG A;  1YAT A;  3KAD A;  4U84 A;  4ODM A;  1PIN A;  4JYS A;  2Q5A A;  3O5J A;  2MNT A;  1N1A A;  3KAI A;  5HWB A;  4JFJ A;  4LAV A;  1BL4 A;  5J6E A;  1BKF A;  3OOB A;  1U79 A;  5B8I C;  1FKD A;  2LPV A;  4DRP A;  3KAF A;  3WH0 A;  1C9H A;  2ZQU A;  1FKS A;  1T11 A;  4ODR A;  4ODK A;  3UQA A;  2F4E A;  2RQS A;  1ROT A;  2MLZ A;  4ITZ A;  1ZK6 A;  3LUO A;  1TCO C;  2MF9 A;  2VN1 A;  3KZ7 A;  4JFL A;  4TW8 A;  3UF8 A;  4DRM A;  4DRJ A;  1J4I A;  2MPH A;  3O5R A;  1D7H A;  3EY6 A;  4W9P A;  5HTG A;  1YW5 A;  3NTP A;  2FKE A;  2UZ5 A;  1M5Y A;  3O5Q A;  4LAY A;  4NNR A;  2PV2 A;  1FKI A;  3CGM A;  1A7X A;  4DRI A;  5HT1 A;  4J4N A;  4G50 A;  3O5K A;  2MLX A;  1JNS A;  4JFM A;  4U85 A;  1NMV A;  1QPF A;  3NRK A;  3FAP A;  1J6Y A;  1FD9 A;  2DG3 A;  2KE0 A;  3ODK A;  5HW8 A;  2XP6 A;  3CGN A;  3IKD A;  2RUD A;  3UI5 A;  4ODO A;  2XP9 A;  2PV3 A;  1P5Q A;  4DH0 A;  2K8I A;  3KCE A;  3KAH A;  4LAW A;  4ODP A;  3O5L A;  4DT4 A;  4DZ2 A;  2PPN A;  3MDY B;  1FAP A;  2M08 A;  3JYM A;  5HWC A;  2XP8 A;  2F2D A;  1QZ2 A;  2XPB A;  4W9O A;  2ZQV A;  2KO7 A;  2RUQ A;  3UQI A;  3O5D A;  4QIB A;  1Y0O A;  4FAP A;  2LJ4 A;  1Q6I A;  4IQ2 A;  4DRO A;  1D6O A;  2RUC A;  3PA7 A;  4TYO A;  4JFK A;  5DIV A;  1HXV A;  2RSE A;  4DRK A;  2F21 A;  4DRN A;  1FKB A;  4R0X A;  5HUA A;  5BXJ A;  1FKR A;  4J4O A;  1FKT A;  2L2S A;  5HW6 A;  4GIV A;  3TC5 A;  2JZV A;  2XP5 A;  2ZQT A;  1KT0 A;  4TW6 A;  4ODL A;  4JFI A;  1J4R A;  3JXV A;  4U86 A;  5HKG A;  4ODQ A;  5I98 A;  3IHZ A;  2XP3 A;  2KI3 A;  2IF4 A;  2M1I A;  4N19 A;  4TNS A;  1L1P A;  2XPA A;  2DG4 A;  1FKG A;  2MLY A;  3PRD A;  4IPX A;  2ITK A;  1FJD A;  3TDB A;  5DIU A;  4IQC A;  3O5P A;  3RFW A;  1NSG A;  4DRQ A;  2AWG A;  3VAW A;  2XP4 A;  3JYJ A;  4MSP A;  3TCZ A;  3NI6 A;  2PBC A;  1Q6U A;  3IK8 A;  1ROU A;  3H9R B;  3UI6 A;  3KAB A;  1R9H A;  3O5M A;  1F8A B;  5D75 A;  3O5E A;  1NMW A;  2PPO A;  2XP7 A;  2Y78 A;  3PRB A;  3IKG A;  4BF8 A;  4DIP A;  4DZ3 A;  1EQ3 A;  1JNT A;  4O2T A;  3O5F A;  2ZQS A;  1FKK A;  2D9F A;  1PBK A;  1J4H A;  1QPL A;  2FAP A;  4FN2 A;  2DG9 A;  1W26 A;  4ODN A;  2PPP A;  4MGV A;  1FKL A;  4LAX A;  4TX0 A;  1EYM A;  2M2A A;  1F40 A;  4TW7 A;  3KAG A;  1D7J A;  2ZR6 A;  4GGQ A; 
#chains in the Genus database with same CATH topology
 1FKJ A;  1Q6H A;  2KFW A;  4WIW A;  1D7I A;  5DIT A;  1HKM A;  2ZR5 A;  5HW7 A;  4NSB A;  4Q7N A;  1XHG A;  2PN0 A;  4W9Q A;  1Q1C A;  2KGJ A;  3O5O A;  3O5I A;  1ZCN A;  2DSV A;  4QT3 A;  3PRA A;  1B6C A;  1UR9 A;  4WK9 A;  4C02 B;  3CHF A;  1YAT A;  1EIB A;  4JYS A;  2MNT A;  1N1A A;  1W1P A;  3B9E A;  3WD4 A;  1H0I A;  3WH0 A;  3B8S A;  2F4E A;  2RQS A;  2MLZ A;  4ITZ A;  3UI5 A;  1TCO C;  2MF9 A;  3KZ7 A;  3O5R A;  2AOS A;  5GQB A;  1W9V A;  1M5Y A;  4NNR A;  2P4V A;  1A7X A;  4HAR A;  4J4N A;  1QPF A;  2WLZ A;  1CTN A;  3FY1 A;  2DG3 A;  2KE0 A;  3ODK A;  2DT2 A;  5HW8 A;  1ZL1 A;  1JCH B;  4DZ2 A;  4ODP A;  4DT4 A;  5B8I C;  2M08 A;  1IX5 A;  4FAP A;  2LJ4 A;  4DRO A;  4TYO A;  4JFK A;  3ALF A;  3WD1 A;  2DSW A;  1GRJ A;  4R0X A;  3ARV A;  5HUA A;  4DWS B;  1FKT A;  2L2S A;  4L72 B;  2XP5 A;  4TW6 A;  4U86 A;  3JXV A;  4TNS A;  1E6N A;  2IF4 A;  2MLY A;  4IPX A;  3ARR A;  2QF8 A;  4Z2L A;  3WD3 A;  1NSG A;  2AWG A;  4URI A;  4MSP A;  1E6P A;  1Q6U A;  1K9T A;  4MNL A;  5D75 A;  4ZPT R;  2PPO A;  4DZ3 A;  3PRB A;  3IKG A;  1ZBW A;  1JNT A;  1FKK A;  1PBK A;  1WAW A;  4MPK A;  4P8U A;  4Q22 A;  1W26 A;  4ODN A;  1LL4 A;  3ARY A;  4TW7 A;  2PV1 A;  3KAC A;  2OFN A;  1H0G A;  1OWQ A;  1SYT A;  3AS2 A;  2N87 A;  1OGG A;  3AS0 A;  2F23 A;  4DRH A;  5GPG A;  4ODM A;  4QZV B;  1E6R A;  4ZS6 A;  4DWS A;  3BMB A;  2PI6 A;  4Z2H A;  1BL4 A;  4DRP A;  2LPV A;  4WKH A;  4ODR A;  1FFR A;  1ZK6 A;  3LUO A;  4TW8 A;  3UF8 A;  1J4I A;  2MPH A;  4W9P A;  5HTG A;  1X6N A;  1HJX A;  3NTP A;  1NWR A;  4LGX A;  4LAY A;  1E9L A;  1LL6 A;  3O5K A;  2MLX A;  4U85 A;  4DWS C;  3FAP A;  2DSZ A;  3WQW A;  1LQ0 A;  4MNM A;  2RUD A;  4ODO A;  1P5Q A;  4DH0 A;  3ARZ A;  5HWC A;  2F2D A;  4W9O A;  4WKA A;  2KO7 A;  2RUQ A;  3ART A;  3BXW A;  1NWS A;  3O5D A;  1JND A;  2B31 A;  2O9O A;  1D6O A;  5DO2 A;  4HBO A;  4DRK A;  1D2K A;  2F21 A;  4DRN A;  3GTY X;  4NZC A;  2WM0 A;  1EHN A;  5HW6 A;  2JZV A;  1KT0 A;  4JFI A;  2A3B A;  4N19 A;  2M1I A;  3FXY A;  1O6I A;  3PRD A;  2ITK A;  5DIU A;  4WKF A;  2XP4 A;  1KFW A;  5DEZ A;  1OGB A;  1E15 A;  2G8Z A;  4ZPW R;  2ETN A;  3WIJ A;  2FDM A;  4P8W A;  3KAB A;  1F8A B;  3ARO A;  4BF8 A;  4AY1 A;  2ZQS A;  1XRV A;  3QOK A;  1W1T A;  3CHD A;  4MGV A;  4TX0 A;  2M2A A;  3ARW A;  3G6M A;  1KT1 A;  1ZBV A;  3I6C A;  1FKF A;  1FKH A;  1JVW A;  3UQB A;  2WLY A;  4L3N A;  1UR8 A;  3GU0 A;  3O5G A;  1TFV A;  1RD6 A;  1X6L A;  2A3C A;  3AS3 A;  4G2P A;  3KAD A;  1PIN A;  2Q5A A;  5HWB A;  3B9D A;  4LAV A;  5J6E A;  3OOB A;  1U79 A;  1FKD A;  3ALG A;  3KAF A;  3WKZ A;  5HBF A;  3UQA A;  1ROT A;  2VN1 A;  4DRM A;  2IUZ A;  3EY6 A;  1LG1 A;  1EDQ A;  2ESC A;  1YW5 A;  2UZ5 A;  2A3A A;  3O5Q A;  2PV2 A;  1FKI A;  1ZBC A;  4MNJ A;  1GPF A;  1NMV A;  2YBT A;  2B5U B;  4KQZ A;  2XP6 A;  3CGN A;  3IKD A;  1GUV A;  4WJX A;  3CHC A;  3WL1 A;  2PV3 A;  4PTM A;  3KAH A;  4LAW A;  2PPN A;  1WB0 A;  1FAP A;  2XPB A;  4S3J A;  4Z2K A;  2ZQV A;  3UQI A;  1Y0O A;  4ML4 A;  1Q6I A;  1HKJ A;  1ZBK A;  3AQU A;  3RM9 A;  3PA7 A;  1HXV A;  2RSE A;  1VF8 A;  1W9P A;  3WD2 A;  4GIV A;  2G41 A;  4ODL A;  3RME A;  1J4R A;  5I98 A;  3IHZ A;  2XP3 A;  1L1P A;  2DG4 A;  1FKG A;  1FJD A;  3TDB A;  4UDM A;  3OA5 A;  4IQC A;  3O5P A;  4MTV A;  4KR0 B;  3VAW A;  3ARQ A;  3JYJ A;  3TCZ A;  3AS1 A;  3NI6 A;  2PBC A;  4P8X A;  2O92 A;  3IK8 A;  3UI6 A;  2DPE A;  1HJV A;  3O5M A;  1W1Y A;  1NMW A;  2Y78 A;  4O2T A;  3O5F A;  2D9F A;  1QPL A;  1FFQ A;  2FAP A;  4R5E A;  1HJW A;  1F40 A;  1EYM A;  3KAG A;  2ZR6 A;  3PR9 A;  4GGQ A;  3WD0 A;  3ARP A;  4HBE A;  1ZU8 A;  1HKK A;  2DT3 A;  2LGO A;  2KR7 A;  1E6Z A;  4QT2 A;  3ARX A;  2DSU A;  2ZR4 A;  3RGC A;  2RUR A;  1HKI A;  2LKN A;  3B7X A;  3GPK A;  2VCD A;  3UI4 A;  3WL0 A;  1WNO A;  4U84 A;  4S3K A;  1GOI A;  3O5J A;  3EIP A;  2DT1 A;  3KAI A;  4JFJ A;  1BKF A;  1C9H A;  2ZQU A;  1FKS A;  1T11 A;  4ODK A;  4JFL A;  1NWT A;  4DRJ A;  3CH9 A;  1D7H A;  2FKE A;  3CGM A;  4DRI A;  5HT1 A;  2A3E A;  4G50 A;  3RM8 A;  1JNS A;  4JFM A;  3NRK A;  1NH6 A;  5GPR A;  3ARS A;  1J6Y A;  1FD9 A;  2OLH A;  1NWU A;  4XAK A;  5JH8 A;  2XP9 A;  3CZ8 A;  2K8I A;  3KCE A;  3O5L A;  3MDY B;  3JYM A;  2EUL A;  2XP8 A;  1QZ2 A;  4Z2G A;  4P8V A;  4QIB A;  4IQ2 A;  2RUC A;  5DF0 A;  5DIV A;  3ARU A;  3WQV A;  4IT4 A;  1FKB A;  5BXJ A;  1FKR A;  4J4O A;  3RM4 A;  3B9A A;  2WK2 A;  1JNE A;  3TC5 A;  2ZQT A;  5HKG A;  4ODQ A;  2KI3 A;  2XPA A;  4DWS D;  1ITX A;  4Z2J A;  3RFW A;  4DRQ A;  1ROU A;  3H9R B;  1W9U A;  1W1V A;  4IT6 A;  1R9H A;  3O5E A;  2XP7 A;  4ZPV R;  4DIP A;  1EQ3 A;  1SR0 A;  4Z2I A;  1LG2 A;  2DT0 A;  2YBU A;  3W4R A;  1J4H A;  3CHE A;  1E44 A;  4MAV A;  1ZB5 A;  3G6L A;  4FN2 A;  2DG9 A;  2PPP A;  1FKL A;  4LAX A;  1LJY A;  1LL7 A;  4MNK A;  4W5U A;  1D7J A; 
#chains in the Genus database with same CATH homology
 1FKJ A;  1Q6H A;  2KFW A;  4WIW A;  1D7I A;  5DIT A;  1HKM A;  2ZR5 A;  5HW7 A;  4NSB A;  4Q7N A;  1XHG A;  4W9Q A;  1Q1C A;  2KGJ A;  3O5O A;  3O5I A;  1ZCN A;  2DSV A;  4QT3 A;  3PRA A;  1B6C A;  1UR9 A;  4WK9 A;  4C02 B;  3CHF A;  1YAT A;  1EIB A;  4JYS A;  2MNT A;  1N1A A;  1W1P A;  3B9E A;  3WD4 A;  1H0I A;  3WH0 A;  3B8S A;  2F4E A;  2RQS A;  2MLZ A;  4ITZ A;  3UI5 A;  1TCO C;  2MF9 A;  3KZ7 A;  3O5R A;  2AOS A;  5GQB A;  1W9V A;  1M5Y A;  4NNR A;  1A7X A;  4HAR A;  4J4N A;  1QPF A;  2WLZ A;  1CTN A;  3FY1 A;  2DG3 A;  2KE0 A;  3ODK A;  2DT2 A;  5HW8 A;  1ZL1 A;  4DZ2 A;  4ODP A;  4DT4 A;  5B8I C;  2M08 A;  1IX5 A;  4FAP A;  2LJ4 A;  4DRO A;  4TYO A;  4JFK A;  3ALF A;  3WD1 A;  2DSW A;  4R0X A;  3ARV A;  5HUA A;  4DWS B;  1FKT A;  2L2S A;  4L72 B;  2XP5 A;  4TW6 A;  4U86 A;  3JXV A;  4TNS A;  1E6N A;  2IF4 A;  2MLY A;  4IPX A;  3ARR A;  2QF8 A;  4Z2L A;  3WD3 A;  1NSG A;  2AWG A;  4URI A;  4MSP A;  1E6P A;  1Q6U A;  1K9T A;  4MNL A;  5D75 A;  4ZPT R;  2PPO A;  4DZ3 A;  3PRB A;  3IKG A;  1ZBW A;  1JNT A;  1FKK A;  1PBK A;  1WAW A;  4MPK A;  4P8U A;  4Q22 A;  1W26 A;  4ODN A;  1LL4 A;  3ARY A;  4TW7 A;  2PV1 A;  3KAC A;  2OFN A;  1H0G A;  1OWQ A;  1SYT A;  3AS2 A;  2N87 A;  1OGG A;  3AS0 A;  4DRH A;  5GPG A;  4ODM A;  4QZV B;  1E6R A;  4ZS6 A;  4DWS A;  2PI6 A;  4Z2H A;  1BL4 A;  4DRP A;  2LPV A;  4WKH A;  4ODR A;  1FFR A;  1ZK6 A;  3LUO A;  4TW8 A;  3UF8 A;  1J4I A;  2MPH A;  4W9P A;  5HTG A;  1X6N A;  1HJX A;  3NTP A;  1NWR A;  4LGX A;  4LAY A;  1E9L A;  1LL6 A;  3O5K A;  2MLX A;  4U85 A;  4DWS C;  3FAP A;  2DSZ A;  3WQW A;  1LQ0 A;  4MNM A;  2RUD A;  4ODO A;  1P5Q A;  4DH0 A;  3ARZ A;  5HWC A;  2F2D A;  4W9O A;  4WKA A;  2KO7 A;  2RUQ A;  3ART A;  3BXW A;  1NWS A;  3O5D A;  1JND A;  2B31 A;  2O9O A;  1D6O A;  5DO2 A;  4HBO A;  4DRK A;  1D2K A;  2F21 A;  4DRN A;  4NZC A;  2WM0 A;  1EHN A;  5HW6 A;  2JZV A;  1KT0 A;  4JFI A;  2A3B A;  4N19 A;  2M1I A;  3FXY A;  1O6I A;  3PRD A;  2ITK A;  5DIU A;  4WKF A;  2XP4 A;  1KFW A;  5DEZ A;  1OGB A;  1E15 A;  2G8Z A;  4ZPW R;  3WIJ A;  2FDM A;  4P8W A;  3KAB A;  1F8A B;  3ARO A;  4BF8 A;  4AY1 A;  2ZQS A;  1XRV A;  3QOK A;  1W1T A;  3CHD A;  4MGV A;  4TX0 A;  2M2A A;  3ARW A;  3G6M A;  1KT1 A;  1ZBV A;  3I6C A;  1FKF A;  1FKH A;  1JVW A;  3UQB A;  2WLY A;  4L3N A;  1UR8 A;  3O5G A;  1TFV A;  1RD6 A;  1X6L A;  2A3C A;  3AS3 A;  4G2P A;  3KAD A;  1PIN A;  2Q5A A;  5HWB A;  3B9D A;  4LAV A;  5J6E A;  3OOB A;  1U79 A;  1FKD A;  3ALG A;  3KAF A;  3WKZ A;  5HBF A;  3UQA A;  1ROT A;  2VN1 A;  4DRM A;  2IUZ A;  3EY6 A;  1LG1 A;  1EDQ A;  2ESC A;  1YW5 A;  2UZ5 A;  2A3A A;  3O5Q A;  2PV2 A;  1FKI A;  1ZBC A;  4MNJ A;  1GPF A;  1NMV A;  2YBT A;  4KQZ A;  2XP6 A;  3CGN A;  3IKD A;  1GUV A;  4WJX A;  3CHC A;  3WL1 A;  2PV3 A;  4PTM A;  3KAH A;  4LAW A;  2PPN A;  1WB0 A;  1FAP A;  2XPB A;  4S3J A;  4Z2K A;  2ZQV A;  3UQI A;  1Y0O A;  4ML4 A;  1Q6I A;  1HKJ A;  1ZBK A;  3AQU A;  3RM9 A;  3PA7 A;  1HXV A;  2RSE A;  1VF8 A;  1W9P A;  3WD2 A;  4GIV A;  2G41 A;  4ODL A;  3RME A;  1J4R A;  5I98 A;  3IHZ A;  2XP3 A;  1L1P A;  2DG4 A;  1FKG A;  1FJD A;  3TDB A;  3OA5 A;  4IQC A;  3O5P A;  4MTV A;  4KR0 B;  3VAW A;  3ARQ A;  3JYJ A;  3TCZ A;  3AS1 A;  3NI6 A;  2PBC A;  4P8X A;  2O92 A;  3IK8 A;  3UI6 A;  2DPE A;  1HJV A;  3O5M A;  1W1Y A;  1NMW A;  2Y78 A;  4O2T A;  3O5F A;  2D9F A;  1QPL A;  1FFQ A;  2FAP A;  4R5E A;  1HJW A;  1F40 A;  1EYM A;  3KAG A;  2ZR6 A;  3PR9 A;  4GGQ A;  3WD0 A;  3ARP A;  4HBE A;  1ZU8 A;  1HKK A;  2DT3 A;  2LGO A;  2KR7 A;  1E6Z A;  4QT2 A;  3ARX A;  2DSU A;  2ZR4 A;  3RGC A;  2RUR A;  1HKI A;  2LKN A;  3B7X A;  3GPK A;  2VCD A;  3UI4 A;  3WL0 A;  1WNO A;  4U84 A;  4S3K A;  1GOI A;  3O5J A;  2DT1 A;  3KAI A;  4JFJ A;  1BKF A;  1C9H A;  2ZQU A;  1FKS A;  1T11 A;  4ODK A;  4JFL A;  1NWT A;  4DRJ A;  3CH9 A;  1D7H A;  2FKE A;  3CGM A;  4DRI A;  5HT1 A;  2A3E A;  4G50 A;  3RM8 A;  1JNS A;  4JFM A;  3NRK A;  1NH6 A;  5GPR A;  3ARS A;  1J6Y A;  1FD9 A;  2OLH A;  1NWU A;  4XAK A;  5JH8 A;  2XP9 A;  3CZ8 A;  2K8I A;  3KCE A;  3O5L A;  3MDY B;  3JYM A;  2XP8 A;  1QZ2 A;  4Z2G A;  4P8V A;  4QIB A;  4IQ2 A;  2RUC A;  5DF0 A;  5DIV A;  3ARU A;  3WQV A;  4IT4 A;  1FKB A;  5BXJ A;  1FKR A;  4J4O A;  3RM4 A;  3B9A A;  2WK2 A;  1JNE A;  3TC5 A;  2ZQT A;  5HKG A;  4ODQ A;  2KI3 A;  2XPA A;  4DWS D;  1ITX A;  4Z2J A;  3RFW A;  4DRQ A;  1ROU A;  3H9R B;  1W9U A;  1W1V A;  4IT6 A;  1R9H A;  3O5E A;  2XP7 A;  4ZPV R;  4DIP A;  1EQ3 A;  1SR0 A;  4Z2I A;  1LG2 A;  2DT0 A;  2YBU A;  3W4R A;  1J4H A;  3CHE A;  4MAV A;  1ZB5 A;  3G6L A;  4FN2 A;  2DG9 A;  2PPP A;  1FKL A;  4LAX A;  1LJY A;  1LL7 A;  4MNK A;  4W5U A;  1D7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...