3EY6A

Crystal structure of the fk506-binding domain of human fkbp38
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
b'MREWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVDGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 8
publication title A charge-sensitive loop in the FKBP38 catalytic domain modulates Bcl-2 binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 29
structure length 118
sequence length 118
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3ey6A00
3O5PA 5BXJA 3FAPA 4DRQA 3O5LA 1FKSA 1NMVA 3UI6A 4FAPA 4GIVA 2DG4A 2XPAA 1NMWA 2RURA 2DG9A 2XP4A 3JYJA 4ITZA 1FKTA 3RGCA 4ODRA 1FJDA 3IK8A 1F8AB 1JNTA 4TX0A 5HUAA 2D9FA 4TYOA 2MNTA 2OFNA 2ZR6A 2KI3A 1ZCNA 1QPFA 2XP8A 2ZR5A 2JZVA 2XP6A 4GGQA 4U85A 2DG3A 1FD9A 1Q6IA 1U79A 4U84A 5I98A 2PV3A 1M5YA 2PV2A 4ODOA 1FKJA 2KE0A 1Y0OA 2PV1A 2LJ4A 1J4RA 2IF4A 3KACA 5GPGA 5HTGA 2LPVA 3O5QA 5DIVA 4DRIA 4DT4A 2XP7A 3NRKA 3IHZA 3O5OA 1FKRA 3KABA 3UI5A 5HW7A 1PBKA 4TNSA 4DROA 5DIUA 5DITA 1JNSA 3O5GA 3KAFA 1L1PA 2RUQA 3CGNA 1NSGA 1TCOC 3KAHA 4LAVA 4G2PA 2F21A 4J4NA 2MF9A 4LAXA 4DZ2A 4IQ2A 3B7XA 4LAWA 2LGOA 2F4EA 3O5FA 4DRKA 3RFWA 1J4HA 4R0XA 1YATA 1F40A 3IKDA 2M1IA 2XP5A 1W26A 3WH0A 1P5QA 4DIPA 3KCEA 1FKHA 3NI6A 3O5DA 2VN1A 4JFJA 3TCZA 1D7IA 1B6CA 2RQSA 3UF8A 2ZQTA 3UI4A 1FKDA 3JXVA 2PBCA 4NNRA 4J4OA 1QZ2A 3OOBA 4DRPA 4N19A 4IPXA 1J4IA 4DZ3A 4DRNA 1FKBA 1BL4A 3KZ7A 4ODKA 1T11A 3I6CA 4W9OA 3VAWA 2AWGA 3KAIA 4BF8A 3O5IA 4ODLA 4QT3A 5HW6A 3KADA 2XP3A 4W9QA 4DRMA 3UQBA 3UQAA 2FAPA 1N1AA 3TDBA 2FKEA 2PPPA 2RUDA 2MLZA 2UZ5A 4TW8A 2F2DA 4MGVA 1ROTA 2MPHA 3PA7A 2RSEA 1BKFA 1JVWA 1FKFA 2M08A 1D6OA 2ITKA 2Q5AA 4DH0A 1QPLA 5HWBA 2L2SA 2KFWA 5HWCA 1D7HA 2Y78A 2K8IA 3PRBA 4IQCA 3JYMA 1Q1CA 4ODPA 3KAGA 4DRJA 5HKGA 2ZQUA 4C02B 1YW5A 3TC5A 1C9HA 2ZQSA 2ZR4A 3MDYB 3O5EA 3O5RA 3O5JA 4W9PA 4ODMA 5B8IC 2XP9A 1KT1A 4JFMA 4LAYA 1EQ3A 2KO7A 2LKNA 2PPNA 4JFIA 4MSPA 5HW8A 2KR7A 3IKGA 4JYSA 1J6YA 3GPKA 1EYMA 1Q6HA 2MLXA 2PPOA 3PRDA 4FN2A 3H9RB 1PINA 2M2AA 4TW7A 5HT1A 4DRHA 2KGJA 3CGMA 1A7XA 1FAPA 1FKLA 2VCDA 4ODNA 2MLYA 2XPBA 3EY6A 3NTPA 1ZK6A 4O2TA 2N87A 4JFKA 3O5KA 5J6EA 4G50A 4U86A 1FKGA 4QT2A 3UQIA 1Q6UA 3ODKA 2RUCA 1ROUA 3O5MA 1D7JA 3LUOA 4QIBA 1KT0A 4JFLA 2ZQVA 4TW6A 1FKKA 5D75A 1HXVA 4ODQA 1FKIA 1R9HA
chains in the Genus database with same CATH superfamily
5BXJA 1GOIA 3O5LA 1NMWA 2FDMA 2XP4A 1FKTA 3G6MA 4ODRA 3BMBA 1E44A 4TX0A 1OGBA 3AS0A 1O6IA 3AROA 5DF0A 2ZR5A 4GGQA 2DG3A 1Q6IA 1ZU8A 1CTNA 3WQVA 3W4RA 4AY1A 1LG1A 1OWQA 2DSWA 4Q22A 3RM4A 5JH8A 1FKRA 3RM9A 3WL0A 5DIUA 3O5GA 3CGNA 4LAVA 4G2PA 3ARQA 3WKZA 4J4NA 4IQ2A 3B7XA 4LAWA 2LGOA 1EHNA 3RFWA 1W1TA 4Z2IA 2M1IA 2XP5A 3ARXA 3ARZA 4DIPA 3KCEA 5GQBA 1FKHA 1X6NA 2VN1A 2RQSA 4DWSD 4HARA 2ZQTA 1GUVA 3UI4A 1UR9A 4NNRA 3OOBA 4IPXA 1J4IA 1HKIA 2WLYA 4DRNA 1FKBA 2IUZA 4W9OA 5HWCA 1WAWA 3I6CA 1VF8A 4W9QA 4DRMA 3ARSA 3UQAA 2F2DA 4MGVA 2O92A 3PA7A 3WIJA 2DT0A 1JVWA 1D6OA 2ITKA 4ZPWR 1ZBCA 2AOSA 1E6ZA 4MPKA 2Y78A 5HKGA 4DWSC 2ZQUA 4MTVA 2B31A 1C9HA 3O5RA 3CHEA 4W9PA 4MNKA 1WNOA 2KO7A 4MSPA 5HW8A 1E15A 3PRDA 1Q6HA 4FN2A 3GTYX 1EIBA 3ARWA 1JNDA 2VCDA 1NH6A 3EY6A 3WD1A 1LL6A 1ZK6A 5J6EA 4G50A 4U86A 2RUCA 3LUOA 1R9HA 3O5PA 3FAPA 4Z2KA 1FKSA 4Z2JA 2DG4A 4P8WA 2RURA 3ARPA 1FJDA 4ML4A 1SR0A 4NZCA 2D9FA 3ARTA 2MNTA 1ZCNA 1QPFA 3ARVA 1W9VA 2XP6A 1X6LA 2PV3A 2PV1A 1J4RA 3AS1A 3O5QA 4DT4A 4DRIA 3NRKA 1W9UA 1HJWA 3O5OA 3ARUA 1NWRA 3WQWA 3UI5A 5HW7A 3WD0A 4DROA 1IX5A 3KAHA 2ETNA 3CH9A 4WKAA 3O5FA 1YATA 1F40A 1GPFA 3IKDA 1LL7A 3WH0A 1WB0A 3RMEA 1XRVA 3CHFA 4UDMA 4DRPA 2G8ZA 1E6NA 3KZ7A 4ODKA 1HKJA 3KAIA 5HW6A 4WK9A 2FAPA 2FKEA 2PPPA 2DPEA 2MLZA 4TW8A 2MPHA 4R5EA 4KR0B 4URIA 1UR8A 2L2SA 1ITXA 4HBEA 3B9EA 1D7HA 3JYMA 4DRJA 3KAGA 3TC5A 2ZR4A 3CHCA 3O5EA 5B8IC 4ODMA 1KT1A 2A3AA 1NWSA 2KR7A 4JYSA 3GPKA 4TW7A 3CZ8A 1PINA 2M2AA 3H9RB 4DRHA 2KGJA 4DWSA 2A3BA 4ODNA 2MLYA 2OLHA 1Q6UA 4QIBA 3QOKA 4MAVA 1FKKA 4LAXA 1ZBVA 3IHZA 1FKIA 4KQZA 1W1VA 4GIVA 4ZPTR 2XPAA 1W9PA 4MNJA 2DG9A 2DT3A 4WKHA 1F8AB 1JNTA 3WD2A 5HUAA 3EIPA 2XP8A 2JZVA 1ZBKA 4U84A 5I98A 1SYTA 4ODOA 2KE0A 1Y0OA 1H0IA 3BXWA 3RM8A 2LPVA 3CHDA 4PTMA 5DIVA 5HTGA 3WD4A 1PBKA 1ZL1A 5DITA 1JNSA 3FXYA 3KAFA 2RUQA 1NSGA 1TCOC 2F21A 1FFRA 2DSZA 1JNEA 4MNLA 4DRKA 2F23A 1J4HA 1JCHB 4R0XA 4L72B 1W1YA 1W26A 1W1PA 1FFQA 3ARYA 3NI6A 4JFJA 3WL1A 2O9OA 3JXVA 2PBCA 2EULA 1QZ2A 1BL4A 1RD6A 3VAWA 4BF8A 4FAPA 2G41A 4ODLA 2P4VA 3UQBA 3KADA 2XP3A 1ZB5A 1EDQA 3TDBA 2RUDA 2A3EA 1ROTA 2RSEA 1BKFA 1FKFA 4ZS6A 2M08A 1QPLA 2KFWA 2K8IA 2QF8A 3B9DA 4ODPA 2PN0A 1NWTA 1YW5A 2A3CA 2WK2A 2ZQSA 4C02B 3FY1A 4JFMA 1D2KA 4LAYA 2PI6A 3AS2A 1EQ3A 3AQUA 2PPNA 1J6YA 4P8VA 4HBOA 1LJYA 2PPOA 4Z2HA 5HT1A 3CGMA 1A7XA 1FAPA 3ALGA 1LL4A 2XPBA 4Z2GA 3WD3A 3O5KA 2ESCA 2YBTA 1D7JA 4QZVB 1HJVA 2ZQVA 2DT1A 4DZ3A 4MNMA 4DRQA 3ARRA 1NMVA 3UI6A 4ITZA 4DWSB 3JYJA 4IT6A 3RGCA 3IK8A 3AS3A 4Z2LA 5GPRA 4L3NA 4TYOA 3G6LA 2OFNA 2ZR6A 2KI3A 1LG2A 5DO2A 4U85A 1FD9A 1H0GA 1U79A 4Q7NA 1KFWA 1M5YA 2PV2A 4W5UA 1FKJA 1E6PA 2IF4A 3KACA 5GPGA 2XP7A 1E6RA 1E9LA 1OGGA 1K9TA 3KABA 2WLZA 4TNSA 1HJXA 4ZPVR 1XHGA 1GRJA 2MF9A 4DZ2A 2F4EA 2YBUA 4XAKA 1HKKA 1HKMA 5DEZA 1P5QA 4S3JA 2B5UB 3O5DA 3B9AA 3TCZA 3UF8A 1D7IA 1B6CA 1TFVA 4WJXA 1FKDA 4J4OA 4N19A 1T11A 2AWGA 3O5IA 4QT3A 4WKFA 1N1AA 2WM0A 2UZ5A 3B8SA 4NSBA 2Q5AA 4DH0A 3PRAA 3GU0A 4P8UA 5HWBA 2DT2A 3PRBA 4IQCA 5HBFA 4S3KA 1Q1CA 2DSUA 3MDYB 1L1PA 3O5JA 2XP9A 2DSVA 4WIWA 2LKNA 4JFIA 3IKGA 3PR9A 1EYMA 2MLXA 4LGXA 1ZBWA 1FKLA 1LQ0A 3NTPA 4O2TA 2N87A 4JFKA 3ALFA 1FKGA 4P8XA 4QT2A 3OA5A 3UQIA 3ODKA 1ROUA 3O5MA 1KT0A 4IT4A 4JFLA 4TW6A 1NWUA 5D75A 1HXVA 4ODQA 2LJ4A
chains in the Genus database with same CATH topology
5BXJA 1GOIA 3O5LA 1NMWA 2FDMA 2XP4A 1FKTA 3G6MA 4ODRA 4TX0A 1OGBA 3AS0A 1O6IA 3AROA 5DF0A 2ZR5A 4GGQA 2DG3A 1Q6IA 1ZU8A 1CTNA 3WQVA 3W4RA 4AY1A 1LG1A 1OWQA 2DSWA 4Q22A 3RM4A 5JH8A 1FKRA 3RM9A 3WL0A 5DIUA 3O5GA 3CGNA 4LAVA 4G2PA 3ARQA 3WKZA 4J4NA 4IQ2A 3B7XA 4LAWA 2LGOA 1EHNA 3RFWA 1W1TA 4Z2IA 2M1IA 2XP5A 3ARXA 3ARZA 4DIPA 3KCEA 5GQBA 1FKHA 1X6NA 2VN1A 2RQSA 4DWSD 4HARA 2ZQTA 1GUVA 3UI4A 1UR9A 4NNRA 3OOBA 4IPXA 1J4IA 1HKIA 2WLYA 4DRNA 1FKBA 2IUZA 4W9OA 5HWCA 1WAWA 3I6CA 1VF8A 4W9QA 4DRMA 3ARSA 3UQAA 2F2DA 4MGVA 2O92A 3PA7A 3WIJA 2DT0A 1JVWA 1D6OA 2ITKA 4ZPWR 1ZBCA 2AOSA 1E6ZA 4MPKA 2Y78A 5HKGA 4DWSC 2ZQUA 4MTVA 2B31A 1C9HA 3O5RA 3CHEA 4W9PA 4MNKA 1WNOA 2KO7A 4MSPA 5HW8A 1E15A 3PRDA 1Q6HA 4FN2A 1EIBA 3ARWA 1JNDA 2VCDA 1NH6A 3EY6A 3WD1A 1LL6A 1ZK6A 5J6EA 4G50A 4U86A 2RUCA 3LUOA 1R9HA 3O5PA 3FAPA 4Z2KA 1FKSA 4Z2JA 2DG4A 4P8WA 2RURA 3ARPA 1FJDA 4ML4A 1SR0A 4NZCA 2D9FA 3ARTA 2MNTA 1ZCNA 1QPFA 3ARVA 1W9VA 2XP6A 1X6LA 2PV3A 2PV1A 1J4RA 3AS1A 3O5QA 4DT4A 4DRIA 3NRKA 1W9UA 1HJWA 3O5OA 3ARUA 1NWRA 3WQWA 3UI5A 5HW7A 3WD0A 4DROA 1IX5A 3KAHA 3CH9A 4WKAA 3O5FA 1YATA 1F40A 1GPFA 3IKDA 1LL7A 3WH0A 1WB0A 3RMEA 1XRVA 3CHFA 4DRPA 2G8ZA 1E6NA 3KZ7A 4ODKA 1HKJA 3KAIA 5HW6A 4WK9A 2FAPA 2FKEA 2PPPA 2DPEA 2MLZA 4TW8A 2MPHA 4R5EA 4KR0B 4URIA 1UR8A 2L2SA 1ITXA 4HBEA 3B9EA 1D7HA 3JYMA 4DRJA 3KAGA 3TC5A 2ZR4A 3O5EA 3CHCA 5B8IC 4ODMA 1KT1A 2A3AA 1NWSA 2KR7A 4JYSA 3GPKA 4TW7A 3CZ8A 1PINA 2M2AA 3H9RB 4DRHA 2KGJA 4DWSA 2A3BA 4ODNA 2MLYA 2OLHA 1Q6UA 4QIBA 3QOKA 4MAVA 1FKKA 4LAXA 1ZBVA 3IHZA 1FKIA 4KQZA 1W1VA 4GIVA 4ZPTR 2XPAA 1W9PA 4MNJA 2DG9A 2DT3A 4WKHA 1F8AB 1JNTA 3WD2A 5HUAA 2XP8A 2JZVA 1ZBKA 4U84A 5I98A 1SYTA 4ODOA 2KE0A 1Y0OA 1H0IA 3BXWA 3RM8A 2LPVA 3CHDA 4PTMA 5DIVA 5HTGA 3WD4A 1PBKA 1ZL1A 5DITA 1JNSA 3FXYA 3KAFA 2RUQA 1NSGA 1TCOC 2F21A 1FFRA 2DSZA 1JNEA 4MNLA 4DRKA 1J4HA 4R0XA 4L72B 1W1YA 1W26A 1W1PA 1FFQA 3ARYA 3NI6A 4JFJA 3WL1A 2O9OA 3JXVA 2PBCA 1QZ2A 1BL4A 1RD6A 3VAWA 4BF8A 4FAPA 2G41A 4ODLA 3UQBA 3KADA 2XP3A 1ZB5A 1EDQA 3TDBA 2RUDA 2A3EA 1ROTA 2RSEA 1BKFA 1FKFA 4ZS6A 2M08A 1QPLA 2KFWA 2K8IA 2QF8A 3B9DA 4ODPA 1NWTA 1YW5A 2A3CA 2WK2A 2ZQSA 4C02B 3FY1A 4JFMA 1D2KA 4LAYA 2PI6A 3AS2A 1EQ3A 3AQUA 2PPNA 1J6YA 4P8VA 4HBOA 1LJYA 2PPOA 4Z2HA 5HT1A 3CGMA 1A7XA 1FAPA 3ALGA 1LL4A 2XPBA 4Z2GA 3WD3A 3O5KA 2ESCA 2YBTA 1D7JA 4QZVB 1HJVA 2ZQVA 2DT1A 4DZ3A 4MNMA 4DRQA 3ARRA 1NMVA 3UI6A 4ITZA 4DWSB 3JYJA 4IT6A 3RGCA 3IK8A 3AS3A 4Z2LA 5GPRA 4L3NA 4TYOA 3G6LA 2OFNA 2ZR6A 2KI3A 1LG2A 5DO2A 4U85A 1FD9A 1H0GA 1U79A 4Q7NA 1KFWA 1M5YA 2PV2A 4W5UA 1FKJA 1E6PA 2IF4A 3KACA 5GPGA 2XP7A 1E6RA 1E9LA 1OGGA 1K9TA 3KABA 2WLZA 4TNSA 1HJXA 4ZPVR 1XHGA 2MF9A 4DZ2A 2F4EA 2YBUA 4XAKA 1HKKA 1HKMA 5DEZA 1P5QA 4S3JA 3O5DA 3B9AA 3TCZA 3UF8A 1D7IA 1B6CA 1TFVA 4WJXA 1FKDA 4J4OA 4N19A 1T11A 2AWGA 3O5IA 4QT3A 4WKFA 1N1AA 2WM0A 2UZ5A 3B8SA 4NSBA 2Q5AA 4DH0A 3PRAA 4P8UA 5HWBA 2DT2A 3PRBA 4IQCA 5HBFA 4S3KA 1Q1CA 2DSUA 3MDYB 1L1PA 3O5JA 2XP9A 2DSVA 4WIWA 2LKNA 4JFIA 3IKGA 3PR9A 1EYMA 2MLXA 4LGXA 1ZBWA 1FKLA 1LQ0A 3NTPA 4O2TA 2N87A 4JFKA 3ALFA 1FKGA 4P8XA 4QT2A 3OA5A 3UQIA 3ODKA 1ROUA 3O5MA 1KT0A 4IT4A 4JFLA 4TW6A 1NWUA 5D75A 1HXVA 4ODQA 2LJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5P A;  5BXJ A;  3FAP A;  4DRQ A;  3O5L A;  1FKS A;  1NMV A;  3UI6 A;  4FAP A;  4GIV A;  2DG4 A;  2XPA A;  1NMW A;  2RUR A;  2DG9 A;  2XP4 A;  3JYJ A;  4ITZ A;  1FKT A;  3RGC A;  4ODR A;  1FJD A;  3IK8 A;  1F8A B;  1JNT A;  4TX0 A;  5HUA A;  2D9F A;  4TYO A;  2MNT A;  2OFN A;  2ZR6 A;  2KI3 A;  1ZCN A;  1QPF A;  2XP8 A;  2ZR5 A;  2JZV A;  2XP6 A;  4GGQ A;  4U85 A;  2DG3 A;  1FD9 A;  1Q6I A;  1U79 A;  4U84 A;  5I98 A;  2PV3 A;  1M5Y A;  2PV2 A;  4ODO A;  1FKJ A;  2KE0 A;  1Y0O A;  2PV1 A;  2LJ4 A;  1J4R A;  2IF4 A;  3KAC A;  5GPG A;  5HTG A;  2LPV A;  3O5Q A;  5DIV A;  4DRI A;  4DT4 A;  2XP7 A;  3NRK A;  3IHZ A;  3O5O A;  1FKR A;  3KAB A;  3UI5 A;  5HW7 A;  1PBK A;  4TNS A;  4DRO A;  5DIU A;  5DIT A;  1JNS A;  3O5G A;  3KAF A;  1L1P A;  2RUQ A;  3CGN A;  1NSG A;  1TCO C;  3KAH A;  4LAV A;  4G2P A;  2F21 A;  4J4N A;  2MF9 A;  4LAX A;  4DZ2 A;  4IQ2 A;  3B7X A;  4LAW A;  2LGO A;  2F4E A;  3O5F A;  4DRK A;  3RFW A;  1J4H A;  4R0X A;  1YAT A;  1F40 A;  3IKD A;  2M1I A;  2XP5 A;  1W26 A;  3WH0 A;  1P5Q A;  4DIP A;  3KCE A;  1FKH A;  3NI6 A;  3O5D A;  2VN1 A;  4JFJ A;  3TCZ A;  1D7I A;  1B6C A;  2RQS A;  3UF8 A;  2ZQT A;  3UI4 A;  1FKD A;  3JXV A;  2PBC A;  4NNR A;  4J4O A;  1QZ2 A;  3OOB A;  4DRP A;  4N19 A;  4IPX A;  1J4I A;  4DZ3 A;  4DRN A;  1FKB A;  1BL4 A;  3KZ7 A;  4ODK A;  1T11 A;  3I6C A;  4W9O A;  3VAW A;  2AWG A;  3KAI A;  4BF8 A;  3O5I A;  4ODL A;  4QT3 A;  5HW6 A;  3KAD A;  2XP3 A;  4W9Q A;  4DRM A;  3UQB A;  3UQA A;  2FAP A;  1N1A A;  3TDB A;  2FKE A;  2PPP A;  2RUD A;  2MLZ A;  2UZ5 A;  4TW8 A;  2F2D A;  4MGV A;  1ROT A;  2MPH A;  3PA7 A;  2RSE A;  1BKF A;  1JVW A;  1FKF A;  2M08 A;  1D6O A;  2ITK A;  2Q5A A;  4DH0 A;  1QPL A;  5HWB A;  2L2S A;  2KFW A;  5HWC A;  1D7H A;  2Y78 A;  2K8I A;  3PRB A;  4IQC A;  3JYM A;  1Q1C A;  4ODP A;  3KAG A;  4DRJ A;  5HKG A;  2ZQU A;  4C02 B;  1YW5 A;  3TC5 A;  1C9H A;  2ZQS A;  2ZR4 A;  3MDY B;  3O5E A;  3O5R A;  3O5J A;  4W9P A;  4ODM A;  5B8I C;  2XP9 A;  1KT1 A;  4JFM A;  4LAY A;  1EQ3 A;  2KO7 A;  2LKN A;  2PPN A;  4JFI A;  4MSP A;  5HW8 A;  2KR7 A;  3IKG A;  4JYS A;  1J6Y A;  3GPK A;  1EYM A;  1Q6H A;  2MLX A;  2PPO A;  3PRD A;  4FN2 A;  3H9R B;  1PIN A;  2M2A A;  4TW7 A;  5HT1 A;  4DRH A;  2KGJ A;  3CGM A;  1A7X A;  1FAP A;  1FKL A;  2VCD A;  4ODN A;  2MLY A;  2XPB A;  3EY6 A;  3NTP A;  1ZK6 A;  4O2T A;  2N87 A;  4JFK A;  3O5K A;  5J6E A;  4G50 A;  4U86 A;  1FKG A;  4QT2 A;  3UQI A;  1Q6U A;  3ODK A;  2RUC A;  1ROU A;  3O5M A;  1D7J A;  3LUO A;  4QIB A;  1KT0 A;  4JFL A;  2ZQV A;  4TW6 A;  1FKK A;  5D75 A;  1HXV A;  4ODQ A;  1FKI A;  1R9H A; 
#chains in the Genus database with same CATH topology
 5BXJ A;  1GOI A;  3O5L A;  1NMW A;  2FDM A;  2XP4 A;  1FKT A;  3G6M A;  4ODR A;  3BMB A;  1E44 A;  4TX0 A;  1OGB A;  3AS0 A;  1O6I A;  3ARO A;  5DF0 A;  2ZR5 A;  4GGQ A;  2DG3 A;  1Q6I A;  1ZU8 A;  1CTN A;  3WQV A;  3W4R A;  4AY1 A;  1LG1 A;  1OWQ A;  2DSW A;  4Q22 A;  3RM4 A;  5JH8 A;  1FKR A;  3RM9 A;  3WL0 A;  5DIU A;  3O5G A;  3CGN A;  4LAV A;  4G2P A;  3ARQ A;  3WKZ A;  4J4N A;  4IQ2 A;  3B7X A;  4LAW A;  2LGO A;  1EHN A;  3RFW A;  1W1T A;  4Z2I A;  2M1I A;  2XP5 A;  3ARX A;  3ARZ A;  4DIP A;  3KCE A;  5GQB A;  1FKH A;  1X6N A;  2VN1 A;  2RQS A;  4DWS D;  4HAR A;  2ZQT A;  1GUV A;  3UI4 A;  1UR9 A;  4NNR A;  3OOB A;  4IPX A;  1J4I A;  1HKI A;  2WLY A;  4DRN A;  1FKB A;  2IUZ A;  4W9O A;  5HWC A;  1WAW A;  3I6C A;  1VF8 A;  4W9Q A;  4DRM A;  3ARS A;  3UQA A;  2F2D A;  4MGV A;  2O92 A;  3PA7 A;  3WIJ A;  2DT0 A;  1JVW A;  1D6O A;  2ITK A;  4ZPW R;  1ZBC A;  2AOS A;  1E6Z A;  4MPK A;  2Y78 A;  5HKG A;  4DWS C;  2ZQU A;  4MTV A;  2B31 A;  1C9H A;  3O5R A;  3CHE A;  4W9P A;  4MNK A;  1WNO A;  2KO7 A;  4MSP A;  5HW8 A;  1E15 A;  3PRD A;  1Q6H A;  4FN2 A;  3GTY X;  1EIB A;  3ARW A;  1JND A;  2VCD A;  1NH6 A;  3EY6 A;  3WD1 A;  1LL6 A;  1ZK6 A;  5J6E A;  4G50 A;  4U86 A;  2RUC A;  3LUO A;  1R9H A;  3O5P A;  3FAP A;  4Z2K A;  1FKS A;  4Z2J A;  2DG4 A;  4P8W A;  2RUR A;  3ARP A;  1FJD A;  4ML4 A;  1SR0 A;  4NZC A;  2D9F A;  3ART A;  2MNT A;  1ZCN A;  1QPF A;  3ARV A;  1W9V A;  2XP6 A;  1X6L A;  2PV3 A;  2PV1 A;  1J4R A;  3AS1 A;  3O5Q A;  4DT4 A;  4DRI A;  3NRK A;  1W9U A;  1HJW A;  3O5O A;  3ARU A;  1NWR A;  3WQW A;  3UI5 A;  5HW7 A;  3WD0 A;  4DRO A;  1IX5 A;  3KAH A;  2ETN A;  3CH9 A;  4WKA A;  3O5F A;  1YAT A;  1F40 A;  1GPF A;  3IKD A;  1LL7 A;  3WH0 A;  1WB0 A;  3RME A;  1XRV A;  3CHF A;  4UDM A;  4DRP A;  2G8Z A;  1E6N A;  3KZ7 A;  4ODK A;  1HKJ A;  3KAI A;  5HW6 A;  4WK9 A;  2FAP A;  2FKE A;  2PPP A;  2DPE A;  2MLZ A;  4TW8 A;  2MPH A;  4R5E A;  4KR0 B;  4URI A;  1UR8 A;  2L2S A;  1ITX A;  4HBE A;  3B9E A;  1D7H A;  3JYM A;  4DRJ A;  3KAG A;  3TC5 A;  2ZR4 A;  3CHC A;  3O5E A;  5B8I C;  4ODM A;  1KT1 A;  2A3A A;  1NWS A;  2KR7 A;  4JYS A;  3GPK A;  4TW7 A;  3CZ8 A;  1PIN A;  2M2A A;  3H9R B;  4DRH A;  2KGJ A;  4DWS A;  2A3B A;  4ODN A;  2MLY A;  2OLH A;  1Q6U A;  4QIB A;  3QOK A;  4MAV A;  1FKK A;  4LAX A;  1ZBV A;  3IHZ A;  1FKI A;  4KQZ A;  1W1V A;  4GIV A;  4ZPT R;  2XPA A;  1W9P A;  4MNJ A;  2DG9 A;  2DT3 A;  4WKH A;  1F8A B;  1JNT A;  3WD2 A;  5HUA A;  3EIP A;  2XP8 A;  2JZV A;  1ZBK A;  4U84 A;  5I98 A;  1SYT A;  4ODO A;  2KE0 A;  1Y0O A;  1H0I A;  3BXW A;  3RM8 A;  2LPV A;  3CHD A;  4PTM A;  5DIV A;  5HTG A;  3WD4 A;  1PBK A;  1ZL1 A;  5DIT A;  1JNS A;  3FXY A;  3KAF A;  2RUQ A;  1NSG A;  1TCO C;  2F21 A;  1FFR A;  2DSZ A;  1JNE A;  4MNL A;  4DRK A;  2F23 A;  1J4H A;  1JCH B;  4R0X A;  4L72 B;  1W1Y A;  1W26 A;  1W1P A;  1FFQ A;  3ARY A;  3NI6 A;  4JFJ A;  3WL1 A;  2O9O A;  3JXV A;  2PBC A;  2EUL A;  1QZ2 A;  1BL4 A;  1RD6 A;  3VAW A;  4BF8 A;  4FAP A;  2G41 A;  4ODL A;  2P4V A;  3UQB A;  3KAD A;  2XP3 A;  1ZB5 A;  1EDQ A;  3TDB A;  2RUD A;  2A3E A;  1ROT A;  2RSE A;  1BKF A;  1FKF A;  4ZS6 A;  2M08 A;  1QPL A;  2KFW A;  2K8I A;  2QF8 A;  3B9D A;  4ODP A;  2PN0 A;  1NWT A;  1YW5 A;  2A3C A;  2WK2 A;  2ZQS A;  4C02 B;  3FY1 A;  4JFM A;  1D2K A;  4LAY A;  2PI6 A;  3AS2 A;  1EQ3 A;  3AQU A;  2PPN A;  1J6Y A;  4P8V A;  4HBO A;  1LJY A;  2PPO A;  4Z2H A;  5HT1 A;  3CGM A;  1A7X A;  1FAP A;  3ALG A;  1LL4 A;  2XPB A;  4Z2G A;  3WD3 A;  3O5K A;  2ESC A;  2YBT A;  1D7J A;  4QZV B;  1HJV A;  2ZQV A;  2DT1 A;  4DZ3 A;  4MNM A;  4DRQ A;  3ARR A;  1NMV A;  3UI6 A;  4ITZ A;  4DWS B;  3JYJ A;  4IT6 A;  3RGC A;  3IK8 A;  3AS3 A;  4Z2L A;  5GPR A;  4L3N A;  4TYO A;  3G6L A;  2OFN A;  2ZR6 A;  2KI3 A;  1LG2 A;  5DO2 A;  4U85 A;  1FD9 A;  1H0G A;  1U79 A;  4Q7N A;  1KFW A;  1M5Y A;  2PV2 A;  4W5U A;  1FKJ A;  1E6P A;  2IF4 A;  3KAC A;  5GPG A;  2XP7 A;  1E6R A;  1E9L A;  1OGG A;  1K9T A;  3KAB A;  2WLZ A;  4TNS A;  1HJX A;  4ZPV R;  1XHG A;  1GRJ A;  2MF9 A;  4DZ2 A;  2F4E A;  2YBU A;  4XAK A;  1HKK A;  1HKM A;  5DEZ A;  1P5Q A;  4S3J A;  2B5U B;  3O5D A;  3B9A A;  3TCZ A;  3UF8 A;  1D7I A;  1B6C A;  1TFV A;  4WJX A;  1FKD A;  4J4O A;  4N19 A;  1T11 A;  2AWG A;  3O5I A;  4QT3 A;  4WKF A;  1N1A A;  2WM0 A;  2UZ5 A;  3B8S A;  4NSB A;  2Q5A A;  4DH0 A;  3PRA A;  3GU0 A;  4P8U A;  5HWB A;  2DT2 A;  3PRB A;  4IQC A;  5HBF A;  4S3K A;  1Q1C A;  2DSU A;  3MDY B;  1L1P A;  3O5J A;  2XP9 A;  2DSV A;  4WIW A;  2LKN A;  4JFI A;  3IKG A;  3PR9 A;  1EYM A;  2MLX A;  4LGX A;  1ZBW A;  1FKL A;  1LQ0 A;  3NTP A;  4O2T A;  2N87 A;  4JFK A;  3ALF A;  1FKG A;  4P8X A;  4QT2 A;  3OA5 A;  3UQI A;  3ODK A;  1ROU A;  3O5M A;  1KT0 A;  4IT4 A;  4JFL A;  4TW6 A;  1NWU A;  5D75 A;  1HXV A;  4ODQ A;  2LJ4 A; 
#chains in the Genus database with same CATH homology
 5BXJ A;  1GOI A;  3O5L A;  1NMW A;  2FDM A;  2XP4 A;  1FKT A;  3G6M A;  4ODR A;  4TX0 A;  1OGB A;  3AS0 A;  1O6I A;  3ARO A;  5DF0 A;  2ZR5 A;  4GGQ A;  2DG3 A;  1Q6I A;  1ZU8 A;  1CTN A;  3WQV A;  3W4R A;  4AY1 A;  1LG1 A;  1OWQ A;  2DSW A;  4Q22 A;  3RM4 A;  5JH8 A;  1FKR A;  3RM9 A;  3WL0 A;  5DIU A;  3O5G A;  3CGN A;  4LAV A;  4G2P A;  3ARQ A;  3WKZ A;  4J4N A;  4IQ2 A;  3B7X A;  4LAW A;  2LGO A;  1EHN A;  3RFW A;  1W1T A;  4Z2I A;  2M1I A;  2XP5 A;  3ARX A;  3ARZ A;  4DIP A;  3KCE A;  5GQB A;  1FKH A;  1X6N A;  2VN1 A;  2RQS A;  4DWS D;  4HAR A;  2ZQT A;  1GUV A;  3UI4 A;  1UR9 A;  4NNR A;  3OOB A;  4IPX A;  1J4I A;  1HKI A;  2WLY A;  4DRN A;  1FKB A;  2IUZ A;  4W9O A;  5HWC A;  1WAW A;  3I6C A;  1VF8 A;  4W9Q A;  4DRM A;  3ARS A;  3UQA A;  2F2D A;  4MGV A;  2O92 A;  3PA7 A;  3WIJ A;  2DT0 A;  1JVW A;  1D6O A;  2ITK A;  4ZPW R;  1ZBC A;  2AOS A;  1E6Z A;  4MPK A;  2Y78 A;  5HKG A;  4DWS C;  2ZQU A;  4MTV A;  2B31 A;  1C9H A;  3O5R A;  3CHE A;  4W9P A;  4MNK A;  1WNO A;  2KO7 A;  4MSP A;  5HW8 A;  1E15 A;  3PRD A;  1Q6H A;  4FN2 A;  1EIB A;  3ARW A;  1JND A;  2VCD A;  1NH6 A;  3EY6 A;  3WD1 A;  1LL6 A;  1ZK6 A;  5J6E A;  4G50 A;  4U86 A;  2RUC A;  3LUO A;  1R9H A;  3O5P A;  3FAP A;  4Z2K A;  1FKS A;  4Z2J A;  2DG4 A;  4P8W A;  2RUR A;  3ARP A;  1FJD A;  4ML4 A;  1SR0 A;  4NZC A;  2D9F A;  3ART A;  2MNT A;  1ZCN A;  1QPF A;  3ARV A;  1W9V A;  2XP6 A;  1X6L A;  2PV3 A;  2PV1 A;  1J4R A;  3AS1 A;  3O5Q A;  4DT4 A;  4DRI A;  3NRK A;  1W9U A;  1HJW A;  3O5O A;  3ARU A;  1NWR A;  3WQW A;  3UI5 A;  5HW7 A;  3WD0 A;  4DRO A;  1IX5 A;  3KAH A;  3CH9 A;  4WKA A;  3O5F A;  1YAT A;  1F40 A;  1GPF A;  3IKD A;  1LL7 A;  3WH0 A;  1WB0 A;  3RME A;  1XRV A;  3CHF A;  4DRP A;  2G8Z A;  1E6N A;  3KZ7 A;  4ODK A;  1HKJ A;  3KAI A;  5HW6 A;  4WK9 A;  2FAP A;  2FKE A;  2PPP A;  2DPE A;  2MLZ A;  4TW8 A;  2MPH A;  4R5E A;  4KR0 B;  4URI A;  1UR8 A;  2L2S A;  1ITX A;  4HBE A;  3B9E A;  1D7H A;  3JYM A;  4DRJ A;  3KAG A;  3TC5 A;  2ZR4 A;  3O5E A;  3CHC A;  5B8I C;  4ODM A;  1KT1 A;  2A3A A;  1NWS A;  2KR7 A;  4JYS A;  3GPK A;  4TW7 A;  3CZ8 A;  1PIN A;  2M2A A;  3H9R B;  4DRH A;  2KGJ A;  4DWS A;  2A3B A;  4ODN A;  2MLY A;  2OLH A;  1Q6U A;  4QIB A;  3QOK A;  4MAV A;  1FKK A;  4LAX A;  1ZBV A;  3IHZ A;  1FKI A;  4KQZ A;  1W1V A;  4GIV A;  4ZPT R;  2XPA A;  1W9P A;  4MNJ A;  2DG9 A;  2DT3 A;  4WKH A;  1F8A B;  1JNT A;  3WD2 A;  5HUA A;  2XP8 A;  2JZV A;  1ZBK A;  4U84 A;  5I98 A;  1SYT A;  4ODO A;  2KE0 A;  1Y0O A;  1H0I A;  3BXW A;  3RM8 A;  2LPV A;  3CHD A;  4PTM A;  5DIV A;  5HTG A;  3WD4 A;  1PBK A;  1ZL1 A;  5DIT A;  1JNS A;  3FXY A;  3KAF A;  2RUQ A;  1NSG A;  1TCO C;  2F21 A;  1FFR A;  2DSZ A;  1JNE A;  4MNL A;  4DRK A;  1J4H A;  4R0X A;  4L72 B;  1W1Y A;  1W26 A;  1W1P A;  1FFQ A;  3ARY A;  3NI6 A;  4JFJ A;  3WL1 A;  2O9O A;  3JXV A;  2PBC A;  1QZ2 A;  1BL4 A;  1RD6 A;  3VAW A;  4BF8 A;  4FAP A;  2G41 A;  4ODL A;  3UQB A;  3KAD A;  2XP3 A;  1ZB5 A;  1EDQ A;  3TDB A;  2RUD A;  2A3E A;  1ROT A;  2RSE A;  1BKF A;  1FKF A;  4ZS6 A;  2M08 A;  1QPL A;  2KFW A;  2K8I A;  2QF8 A;  3B9D A;  4ODP A;  1NWT A;  1YW5 A;  2A3C A;  2WK2 A;  2ZQS A;  4C02 B;  3FY1 A;  4JFM A;  1D2K A;  4LAY A;  2PI6 A;  3AS2 A;  1EQ3 A;  3AQU A;  2PPN A;  1J6Y A;  4P8V A;  4HBO A;  1LJY A;  2PPO A;  4Z2H A;  5HT1 A;  3CGM A;  1A7X A;  1FAP A;  3ALG A;  1LL4 A;  2XPB A;  4Z2G A;  3WD3 A;  3O5K A;  2ESC A;  2YBT A;  1D7J A;  4QZV B;  1HJV A;  2ZQV A;  2DT1 A;  4DZ3 A;  4MNM A;  4DRQ A;  3ARR A;  1NMV A;  3UI6 A;  4ITZ A;  4DWS B;  3JYJ A;  4IT6 A;  3RGC A;  3IK8 A;  3AS3 A;  4Z2L A;  5GPR A;  4L3N A;  4TYO A;  3G6L A;  2OFN A;  2ZR6 A;  2KI3 A;  1LG2 A;  5DO2 A;  4U85 A;  1FD9 A;  1H0G A;  1U79 A;  4Q7N A;  1KFW A;  1M5Y A;  2PV2 A;  4W5U A;  1FKJ A;  1E6P A;  2IF4 A;  3KAC A;  5GPG A;  2XP7 A;  1E6R A;  1E9L A;  1OGG A;  1K9T A;  3KAB A;  2WLZ A;  4TNS A;  1HJX A;  4ZPV R;  1XHG A;  2MF9 A;  4DZ2 A;  2F4E A;  2YBU A;  4XAK A;  1HKK A;  1HKM A;  5DEZ A;  1P5Q A;  4S3J A;  3O5D A;  3B9A A;  3TCZ A;  3UF8 A;  1D7I A;  1B6C A;  1TFV A;  4WJX A;  1FKD A;  4J4O A;  4N19 A;  1T11 A;  2AWG A;  3O5I A;  4QT3 A;  4WKF A;  1N1A A;  2WM0 A;  2UZ5 A;  3B8S A;  4NSB A;  2Q5A A;  4DH0 A;  3PRA A;  4P8U A;  5HWB A;  2DT2 A;  3PRB A;  4IQC A;  5HBF A;  4S3K A;  1Q1C A;  2DSU A;  3MDY B;  1L1P A;  3O5J A;  2XP9 A;  2DSV A;  4WIW A;  2LKN A;  4JFI A;  3IKG A;  3PR9 A;  1EYM A;  2MLX A;  4LGX A;  1ZBW A;  1FKL A;  1LQ0 A;  3NTP A;  4O2T A;  2N87 A;  4JFK A;  3ALF A;  1FKG A;  4P8X A;  4QT2 A;  3OA5 A;  3UQI A;  3ODK A;  1ROU A;  3O5M A;  1KT0 A;  4IT4 A;  4JFL A;  4TW6 A;  1NWU A;  5D75 A;  1HXV A;  4ODQ A;  2LJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...