4TX0A

The fk1 domain of fkbp51 in complex with (1s,5s,6r)-10-[(3,5-dichlorophenyl)sulfonyl]-5-(2-methoxyethoxy)-3-(2-methoxyethyl)-3,10-diazabicyclo[4.3.1]decan-2-one
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Stereoselective Construction of the 5-Hydroxy Diazabicyclo[4.3.1]decane-2-one Scaffold, a Privileged Motif for FK506-Binding Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 36
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4tx0A00
1EYMA 4GIVA 1P5QA 4TW7A 1F8AB 3MDYB 2MLYA 1D7HA 3NI6A 2RUQA 3FAPA 3O5PA 2RSEA 4TW8A 2ZR4A 1A7XA 4JFMA 2KR7A 4W9PA 1Q6HA 2Y78A 2KI3A 1KT1A 1QPLA 1J4RA 5HW8A 3O5JA 4IQ2A 3JYJA 2MF9A 4FN2A 4LAYA 3KZ7A 4W9OA 4DRHA 1BKFA 5HW7A 3O5GA 4ODPA 2DG3A 2KE0A 3JYMA 4JFKA 3TDBA 5HKGA 2F2DA 2LGOA 1B6CA 1FAPA 3KACA 3CGMA 4JYSA 4QIBA 1ROTA 2XP6A 2IF4A 1FJDA 3H9RB 2XPAA 5HW6A 2MPHA 1QZ2A 2RUCA 4G50A 3UQIA 1ZK6A 1FKJA 2ZR6A 3GPKA 2ZR5A 3IKDA 1R9HA 4U84A 3UI5A 4FAPA 4IPXA 1ZCNA 4DH0A 2RQSA 3UQBA 2PPOA 3O5QA 1NMWA 5D75A 4QT2A 2XP5A 5GPGA 2ZQSA 3O5KA 1FKHA 1FKBA 2Q5AA 2ZQVA 4MSPA 1Q1CA 3JXVA 4JFLA 2UZ5A 4J4NA 2AWGA 2FAPA 3VAWA 2KO7A 3OOBA 4DZ2A 1D6OA 3TCZA 3UI6A 2LJ4A 5DIVA 2DG4A 2MLXA 4NNRA 3O5FA 4DIPA 3KCEA 4DRKA 2XP9A 2PV2A 1ROUA 2KFWA 2K8IA 3CGNA 3O5DA 2N87A 4U85A 4DROA 4DRMA 4DRIA 2D9FA 2ITKA 2RUDA 4LAWA 2M2AA 4JFIA 1FKLA 3PRBA 5DIUA 3O5OA 4ODRA 4G2PA 1F40A 2DG9A 1Q6UA 1JNTA 2LPVA 4DRPA 5DITA 1Y0OA 5HTGA 1NMVA 1EQ3A 1FKGA 4DZ3A 4IQCA 5HWCA 1D7JA 3O5LA 3UI4A 4W9QA 5HWBA 1W26A 4TX0A 3UF8A 3PA7A 3KAGA 3PRDA 1PINA 3KAHA 2M08A 2ZQTA 1FKRA 3UQAA 2PPPA 2M1IA 3I6CA 2VN1A 3IKGA 4J4OA 5HT1A 4MGVA 4C02B 2PPNA 3RGCA 1FKKA 3TC5A 3IHZA 5I98A 1J4HA 3NTPA 1KT0A 3WH0A 4ITZA 2FKEA 2F21A 3LUOA 4ODOA 4DRJA 5BXJA 2F4EA 5J6EA 1J6YA 2MNTA 3ODKA 3IK8A 3RFWA 2XP3A 3O5MA 3O5IA 5HUAA 1M5YA 4O2TA 4JFJA 3O5EA 1TCOC 2KGJA 1NSGA 1D7IA 1JNSA 4ODNA 4ODLA 4N19A 1U79A 1YW5A 2PV1A 4TYOA 3NRKA 3KABA 2VCDA 1HXVA 1FKTA 2MLZA 1J4IA 1N1AA 3O5RA 3KAIA 2XP7A 1Q6IA 2XP4A 1L1PA 1C9HA 2XPBA 4U86A 3EY6A 4ODQA 4GGQA 4DRQA 1FKFA 1FKDA 4TW6A 1JVWA 4QT3A 1QPFA 4DRNA 1FKSA 4TNSA 1PBKA 4DT4A 3KAFA 4LAXA 1T11A 1FKIA 1BL4A 2PBCA 4R0XA 1FD9A 2RURA 3B7XA 1YATA 5B8IC 2LKNA 2PV3A 3KADA 4ODKA 2ZQUA 4LAVA 2OFNA 2XP8A 4BF8A 4ODMA 2L2SA 2JZVA
chains in the Genus database with same CATH superfamily
5HBFA 4KQZA 4TW7A 3MDYB 3NI6A 4TW8A 2RSEA 2ZR4A 1Q6HA 4MNKA 2Y78A 4HBEA 1J4RA 1JCHB 3BMBA 3O5JA 3ARWA 3JYJA 4DRHA 1BKFA 4Q7NA 5HKGA 2FDMA 3G6MA 2A3EA 1FJDA 3CGMA 4JYSA 1ROTA 3H9RB 2MPHA 2ZR6A 1FKJA 3UI5A 3IKDA 1R9HA 1VF8A 3WD4A 4IPXA 1E6ZA 3UQBA 4MNMA 2F23A 2O9OA 2ZQVA 4DWSD 1JNEA 4J4NA 1GOIA 4MNJA 4R5EA 1W9PA 3B8SA 2MLXA 4NNRA 2ESCA 3KCEA 1SR0A 2KFWA 4U85A 1E6PA 4DRIA 2RUDA 3GU0A 1LL6A 4G2PA 2EULA 2LPVA 4DRPA 1NMVA 1EQ3A 3RM4A 3ALFA 2ZQTA 2PPPA 4J4OA 4C02B 2VN1A 3WD3A 2PPNA 1J4HA 3WH0A 4ITZA 3LUOA 1KFWA 2F4EA 1HKJA 3ARQA 5HUAA 1GPFA 2WM0A 3O5EA 1TCOC 1CTNA 1NSGA 4XAKA 3WL0A 1U79A 1W1YA 3BXWA 4QZVB 4URIA 2IUZA 2MLZA 1N1AA 1GUVA 1WAWA 1HJVA 1Q6IA 4MTVA 2XPBA 1IX5A 4U86A 3WKZA 1JVWA 3KAFA 1W9UA 3ARSA 4MPKA 3WQWA 4LAVA 1EIBA 4BF8A 4MNLA 1EYMA 3FXYA 4P8UA 2DSZA 1W1TA 2KR7A 4IQ2A 3WL1A 2MF9A 1H0GA 3ALGA 4Z2LA 3QOKA 2QF8A 3JYMA 1ZB5A 4JFKA 3WQVA 1LQ0A 3TDBA 2LGOA 1B6CA 2ETNA 3CHEA 4QIBA 3RMEA 5HW6A 1QZ2A 2O92A 3UQIA 1ZK6A 2YBUA 3GPKA 1X6LA 1ZL1A 2PPOA 4QT2A 5GPGA 2ZQSA 1ZBCA 4MSPA 1X6NA 1Q1CA 1E9LA 3VAWA 3AQUA 5DIVA 3ARXA 3O5FA 4DIPA 2PV2A 3O5DA 2N87A 1HKMA 3ARVA 3AS2A 3GTYX 4DRMA 2M2AA 4JFIA 1LG1A 3PRBA 4ODRA 2DG9A 4DZ3A 1D7JA 3UI4A 1LL7A 2DT2A 4W9QA 5HWBA 3UF8A 1PINA 3OA5A 3CH9A 2M08A 3IKGA 2M1IA 5HT1A 1LL4A 3TC5A 4NSBA 5I98A 3NTPA 3ARUA 1NWRA 4DRJA 2B31A 4Z2HA 1ITXA 4DWSA 3ODKA 3RFWA 2XP3A 3O5MA 2WK2A 4JFJA 3AROA 1D7IA 4ODLA 4N19A 1YW5A 4WKFA 3NRKA 3KABA 4W5UA 1J4IA 2PI6A 1TFVA 1HKKA 2XP7A 2XP4A 1L1PA 1WNOA 4ODQA 1FKDA 4TW6A 1QPFA 1K9TA 1W9VA 1FKIA 4R0XA 3B9EA 1FD9A 2RURA 4ODKA 2XP8A 1JNDA 4PTMA 4TYOA 4Z2KA 1ZBKA 3WD2A 4GIVA 4WIWA 1P5QA 3B9DA 1F8AB 3PRAA 1O6IA 1WB0A 1D7HA 2RUQA 3FAPA 3O5PA 1ZBVA 1E6RA 1A7XA 4IT6A 4WKHA 2KI3A 1KT1A 2G8ZA 1QPLA 1FFRA 3WD0A 4L3NA 4MAVA 3KZ7A 4W9OA 5HW7A 4ODPA 4DWSC 2DG3A 3FY1A 3ARPA 3ARYA 1FAPA 3KACA 2XP6A 4ZS6A 4Z2IA 2XPAA 2RUCA 4G50A 4U84A 5DEZA 4FAPA 4DH0A 1NWUA 2RQSA 1NMWA 5D75A 4WK9A 3O5KA 1FKBA 3JXVA 2AWGA 1D6OA 1UR8A 2XP9A 4P8WA 3CGNA 4Z2GA 2ITKA 4LAWA 1GRJA 1FKLA 1OWQA 1F40A 2DSWA 1Q6UA 1JNTA 1RD6A 5HTGA 5DITA 5HWCA 3O5LA 4ZPTR 1W26A 1LJYA 3PRDA 1OGGA 3CZ8A 1EHNA 3RGCA 1FKKA 1KT0A 2WLYA 2FKEA 4ODOA 3ARRA 5J6EA 1XRVA 2MNTA 2PN0A 1LG2A 3IK8A 3O5IA 1M5YA 2KGJA 4IT4A 1E44A 3PR9A 4ODNA 2PV1A 1EDQA 2VCDA 1FKTA 3O5RA 1OGBA 4HARA 4DWSB 1C9HA 3CHCA 3WIJA 4GGQA 4NZCA 1FKFA 4QT3A 2DT3A 4TNSA 5DF0A 4AY1A 4LAXA 1T11A 2G41A 5GQBA 2A3CA 1D2KA 4Z2JA 5B8IC 2PV3A 4HBOA 3KADA 2ZQUA 2OFNA 2WLZA 2L2SA 2JZVA 3EIPA 1H0IA 2MLYA 4ML4A 2OLHA 4JFMA 4W9PA 5GPRA 2P4VA 3AS3A 1SYTA 5HW8A 1E6NA 4FN2A 1HJWA 4LAYA 2DSVA 3O5GA 2KE0A 2AOSA 2B5UB 3RM8A 2F2DA 1W1PA 2DSUA 2IF4A 3CHFA 3AS0A 1HKIA 2YBTA 4DRQA 3ARZA 2ZR5A 3WD1A 2A3AA 1ZCNA 3O5QA 2XP5A 1FKHA 2Q5AA 4JFLA 2UZ5A 2FAPA 2KO7A 3OOBA 4DZ2A 3TCZA 3UI6A 2LJ4A 2DPEA 2DG4A 1ZU8A 3CHDA 4S3JA 4S3KA 4DRKA 1ROUA 2K8IA 4DROA 2D9FA 5DIUA 3O5OA 4UDMA 1NWSA 1Y0OA 1NH6A 1FKGA 4L72B 4IQCA 1NWTA 4TX0A 3PA7A 3KAGA 3KAHA 1FKRA 2DT1A 3UQAA 3I6CA 1JNSA 4MGVA 3IHZA 2F21A 1XHGA 5BXJA 1J6YA 4WJXA 4KR0B 4P8VA 4WKAA 1FFQA 4O2TA 2A3BA 3W4RA 1HJXA 3B9AA 3AS1A 4Q22A 4ZPVR 1HXVA 1ZBWA 1UR9A 3KAIA 4ZPWR 4LGXA 3ARTA 3EY6A 1W1VA 2DT0A 4DRNA 1FKSA 5DO2A 1PBKA 4DT4A 1E15A 1BL4A 2PBCA 3B7XA 1YATA 5JH8A 2LKNA 3G6LA 3RM9A 4P8XA 4ODMA
chains in the Genus database with same CATH topology
5HBFA 4KQZA 4TW7A 3MDYB 3NI6A 4TW8A 2RSEA 2ZR4A 1Q6HA 4MNKA 2Y78A 4HBEA 1J4RA 3O5JA 3ARWA 3JYJA 4DRHA 1BKFA 4Q7NA 5HKGA 2FDMA 3G6MA 2A3EA 1FJDA 3CGMA 4JYSA 1ROTA 3H9RB 2MPHA 2ZR6A 1FKJA 3UI5A 3IKDA 1R9HA 1VF8A 3WD4A 4IPXA 1E6ZA 3UQBA 4MNMA 2O9OA 2ZQVA 4DWSD 1JNEA 4J4NA 1GOIA 4MNJA 4R5EA 1W9PA 3B8SA 2MLXA 4NNRA 2ESCA 3KCEA 1SR0A 2KFWA 4U85A 1E6PA 4DRIA 2RUDA 1LL6A 4G2PA 2LPVA 4DRPA 1NMVA 1EQ3A 3RM4A 3ALFA 2ZQTA 2PPPA 4J4OA 4C02B 2VN1A 3WD3A 2PPNA 1J4HA 3WH0A 4ITZA 3LUOA 1KFWA 2F4EA 1HKJA 3ARQA 5HUAA 1GPFA 2WM0A 3O5EA 1TCOC 1CTNA 1NSGA 4XAKA 3WL0A 1U79A 1W1YA 3BXWA 4QZVB 4URIA 2IUZA 2MLZA 1N1AA 1GUVA 1WAWA 1HJVA 1Q6IA 4MTVA 2XPBA 1IX5A 4U86A 3WKZA 1JVWA 3KAFA 1W9UA 3ARSA 4MPKA 3WQWA 4LAVA 1EIBA 4BF8A 4MNLA 1EYMA 3FXYA 4P8UA 2DSZA 1W1TA 2KR7A 4IQ2A 3WL1A 2MF9A 1H0GA 3ALGA 4Z2LA 3QOKA 2QF8A 3JYMA 1ZB5A 4JFKA 3WQVA 1LQ0A 3TDBA 2LGOA 1B6CA 3CHEA 4QIBA 3RMEA 5HW6A 1QZ2A 2O92A 3UQIA 1ZK6A 2YBUA 3GPKA 1X6LA 1ZL1A 2PPOA 4QT2A 5GPGA 2ZQSA 1ZBCA 4MSPA 1X6NA 1Q1CA 1E9LA 3VAWA 3AQUA 5DIVA 3ARXA 3O5FA 4DIPA 2PV2A 3O5DA 2N87A 1HKMA 3ARVA 3AS2A 4DRMA 2M2AA 4JFIA 1LG1A 3PRBA 4ODRA 2DG9A 4DZ3A 1D7JA 3UI4A 1LL7A 2DT2A 4W9QA 5HWBA 3UF8A 1PINA 3OA5A 3CH9A 2M08A 3IKGA 2M1IA 5HT1A 1LL4A 3TC5A 4NSBA 5I98A 3NTPA 3ARUA 1NWRA 4DRJA 2B31A 4Z2HA 1ITXA 4DWSA 3ODKA 3RFWA 2XP3A 3O5MA 2WK2A 4JFJA 3AROA 1D7IA 4ODLA 4N19A 1YW5A 4WKFA 3NRKA 3KABA 4W5UA 1J4IA 2PI6A 1TFVA 1HKKA 2XP7A 2XP4A 1L1PA 1WNOA 4ODQA 1FKDA 4TW6A 1QPFA 1K9TA 1W9VA 1FKIA 4R0XA 3B9EA 1FD9A 2RURA 4ODKA 2XP8A 1JNDA 4PTMA 4TYOA 4Z2KA 1ZBKA 3WD2A 4GIVA 4WIWA 1P5QA 3B9DA 1F8AB 3PRAA 1O6IA 1WB0A 1D7HA 2RUQA 3FAPA 3O5PA 1ZBVA 1E6RA 1A7XA 4IT6A 4WKHA 2KI3A 1KT1A 2G8ZA 1QPLA 1FFRA 3WD0A 4L3NA 4MAVA 3KZ7A 4W9OA 5HW7A 4ODPA 4DWSC 2DG3A 3FY1A 3ARPA 3ARYA 1FAPA 3KACA 2XP6A 4ZS6A 4Z2IA 2XPAA 2RUCA 4G50A 4U84A 5DEZA 4FAPA 4DH0A 1NWUA 2RQSA 1NMWA 5D75A 4WK9A 3O5KA 1FKBA 3JXVA 2AWGA 1D6OA 1UR8A 2XP9A 4P8WA 3CGNA 4Z2GA 2ITKA 4LAWA 1OWQA 1FKLA 1F40A 2DSWA 1Q6UA 1JNTA 1RD6A 5HTGA 5DITA 5HWCA 3O5LA 4ZPTR 1W26A 1LJYA 3PRDA 1OGGA 3CZ8A 1EHNA 3RGCA 1FKKA 1KT0A 2WLYA 2FKEA 4ODOA 3ARRA 5J6EA 1XRVA 2MNTA 3IK8A 1LG2A 3O5IA 1M5YA 2KGJA 4IT4A 3PR9A 4ODNA 2PV1A 1EDQA 2VCDA 1FKTA 3O5RA 1OGBA 4HARA 4DWSB 1C9HA 3CHCA 3WIJA 4GGQA 4NZCA 1FKFA 4QT3A 2DT3A 4TNSA 5DF0A 4AY1A 4LAXA 1T11A 2G41A 5GQBA 2A3CA 1D2KA 4Z2JA 5B8IC 2PV3A 4HBOA 3KADA 2ZQUA 2OFNA 2WLZA 2L2SA 2JZVA 1H0IA 2MLYA 4ML4A 2OLHA 4JFMA 4W9PA 5GPRA 3AS3A 1SYTA 5HW8A 1E6NA 4FN2A 1HJWA 4LAYA 2DSVA 3O5GA 2KE0A 2AOSA 3RM8A 2F2DA 1W1PA 2DSUA 2IF4A 3CHFA 3AS0A 1HKIA 2YBTA 4DRQA 3ARZA 2ZR5A 3WD1A 2A3AA 1ZCNA 3O5QA 2XP5A 1FKHA 2Q5AA 4JFLA 2UZ5A 2FAPA 2KO7A 3OOBA 4DZ2A 3TCZA 3UI6A 2LJ4A 2DPEA 2DG4A 1ZU8A 3CHDA 4S3JA 4S3KA 4DRKA 1ROUA 2K8IA 4DROA 2D9FA 5DIUA 3O5OA 1NWSA 1Y0OA 1NH6A 1FKGA 4L72B 4IQCA 1NWTA 4TX0A 3PA7A 3KAGA 3KAHA 1FKRA 2DT1A 3UQAA 3I6CA 1JNSA 4MGVA 3IHZA 2F21A 1XHGA 5BXJA 1J6YA 4WJXA 4KR0B 4P8VA 4WKAA 1FFQA 4O2TA 2A3BA 3W4RA 1HJXA 3B9AA 3AS1A 4Q22A 4ZPVR 1HXVA 1ZBWA 1UR9A 3KAIA 4ZPWR 4LGXA 3ARTA 3EY6A 1W1VA 2DT0A 4DRNA 1FKSA 5DO2A 1PBKA 4DT4A 1E15A 1BL4A 2PBCA 3B7XA 1YATA 5JH8A 2LKNA 3G6LA 3RM9A 4P8XA 4ODMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EYM A;  4GIV A;  1P5Q A;  4TW7 A;  1F8A B;  3MDY B;  2MLY A;  1D7H A;  3NI6 A;  2RUQ A;  3FAP A;  3O5P A;  2RSE A;  4TW8 A;  2ZR4 A;  1A7X A;  4JFM A;  2KR7 A;  4W9P A;  1Q6H A;  2Y78 A;  2KI3 A;  1KT1 A;  1QPL A;  1J4R A;  5HW8 A;  3O5J A;  4IQ2 A;  3JYJ A;  2MF9 A;  4FN2 A;  4LAY A;  3KZ7 A;  4W9O A;  4DRH A;  1BKF A;  5HW7 A;  3O5G A;  4ODP A;  2DG3 A;  2KE0 A;  3JYM A;  4JFK A;  3TDB A;  5HKG A;  2F2D A;  2LGO A;  1B6C A;  1FAP A;  3KAC A;  3CGM A;  4JYS A;  4QIB A;  1ROT A;  2XP6 A;  2IF4 A;  1FJD A;  3H9R B;  2XPA A;  5HW6 A;  2MPH A;  1QZ2 A;  2RUC A;  4G50 A;  3UQI A;  1ZK6 A;  1FKJ A;  2ZR6 A;  3GPK A;  2ZR5 A;  3IKD A;  1R9H A;  4U84 A;  3UI5 A;  4FAP A;  4IPX A;  1ZCN A;  4DH0 A;  2RQS A;  3UQB A;  2PPO A;  3O5Q A;  1NMW A;  5D75 A;  4QT2 A;  2XP5 A;  5GPG A;  2ZQS A;  3O5K A;  1FKH A;  1FKB A;  2Q5A A;  2ZQV A;  4MSP A;  1Q1C A;  3JXV A;  4JFL A;  2UZ5 A;  4J4N A;  2AWG A;  2FAP A;  3VAW A;  2KO7 A;  3OOB A;  4DZ2 A;  1D6O A;  3TCZ A;  3UI6 A;  2LJ4 A;  5DIV A;  2DG4 A;  2MLX A;  4NNR A;  3O5F A;  4DIP A;  3KCE A;  4DRK A;  2XP9 A;  2PV2 A;  1ROU A;  2KFW A;  2K8I A;  3CGN A;  3O5D A;  2N87 A;  4U85 A;  4DRO A;  4DRM A;  4DRI A;  2D9F A;  2ITK A;  2RUD A;  4LAW A;  2M2A A;  4JFI A;  1FKL A;  3PRB A;  5DIU A;  3O5O A;  4ODR A;  4G2P A;  1F40 A;  2DG9 A;  1Q6U A;  1JNT A;  2LPV A;  4DRP A;  5DIT A;  1Y0O A;  5HTG A;  1NMV A;  1EQ3 A;  1FKG A;  4DZ3 A;  4IQC A;  5HWC A;  1D7J A;  3O5L A;  3UI4 A;  4W9Q A;  5HWB A;  1W26 A;  4TX0 A;  3UF8 A;  3PA7 A;  3KAG A;  3PRD A;  1PIN A;  3KAH A;  2M08 A;  2ZQT A;  1FKR A;  3UQA A;  2PPP A;  2M1I A;  3I6C A;  2VN1 A;  3IKG A;  4J4O A;  5HT1 A;  4MGV A;  4C02 B;  2PPN A;  3RGC A;  1FKK A;  3TC5 A;  3IHZ A;  5I98 A;  1J4H A;  3NTP A;  1KT0 A;  3WH0 A;  4ITZ A;  2FKE A;  2F21 A;  3LUO A;  4ODO A;  4DRJ A;  5BXJ A;  2F4E A;  5J6E A;  1J6Y A;  2MNT A;  3ODK A;  3IK8 A;  3RFW A;  2XP3 A;  3O5M A;  3O5I A;  5HUA A;  1M5Y A;  4O2T A;  4JFJ A;  3O5E A;  1TCO C;  2KGJ A;  1NSG A;  1D7I A;  1JNS A;  4ODN A;  4ODL A;  4N19 A;  1U79 A;  1YW5 A;  2PV1 A;  4TYO A;  3NRK A;  3KAB A;  2VCD A;  1HXV A;  1FKT A;  2MLZ A;  1J4I A;  1N1A A;  3O5R A;  3KAI A;  2XP7 A;  1Q6I A;  2XP4 A;  1L1P A;  1C9H A;  2XPB A;  4U86 A;  3EY6 A;  4ODQ A;  4GGQ A;  4DRQ A;  1FKF A;  1FKD A;  4TW6 A;  1JVW A;  4QT3 A;  1QPF A;  4DRN A;  1FKS A;  4TNS A;  1PBK A;  4DT4 A;  3KAF A;  4LAX A;  1T11 A;  1FKI A;  1BL4 A;  2PBC A;  4R0X A;  1FD9 A;  2RUR A;  3B7X A;  1YAT A;  5B8I C;  2LKN A;  2PV3 A;  3KAD A;  4ODK A;  2ZQU A;  4LAV A;  2OFN A;  2XP8 A;  4BF8 A;  4ODM A;  2L2S A;  2JZV A; 
#chains in the Genus database with same CATH topology
 5HBF A;  4KQZ A;  4TW7 A;  3MDY B;  3NI6 A;  4TW8 A;  2RSE A;  2ZR4 A;  1Q6H A;  4MNK A;  2Y78 A;  4HBE A;  1J4R A;  1JCH B;  3BMB A;  3O5J A;  3ARW A;  3JYJ A;  4DRH A;  1BKF A;  4Q7N A;  5HKG A;  2FDM A;  3G6M A;  2A3E A;  1FJD A;  3CGM A;  4JYS A;  1ROT A;  3H9R B;  2MPH A;  2ZR6 A;  1FKJ A;  3UI5 A;  3IKD A;  1R9H A;  1VF8 A;  3WD4 A;  4IPX A;  1E6Z A;  3UQB A;  4MNM A;  2F23 A;  2O9O A;  2ZQV A;  4DWS D;  1JNE A;  4J4N A;  1GOI A;  4MNJ A;  4R5E A;  1W9P A;  3B8S A;  2MLX A;  4NNR A;  2ESC A;  3KCE A;  1SR0 A;  2KFW A;  4U85 A;  1E6P A;  4DRI A;  2RUD A;  3GU0 A;  1LL6 A;  4G2P A;  2EUL A;  2LPV A;  4DRP A;  1NMV A;  1EQ3 A;  3RM4 A;  3ALF A;  2ZQT A;  2PPP A;  4J4O A;  4C02 B;  2VN1 A;  3WD3 A;  2PPN A;  1J4H A;  3WH0 A;  4ITZ A;  3LUO A;  1KFW A;  2F4E A;  1HKJ A;  3ARQ A;  5HUA A;  1GPF A;  2WM0 A;  3O5E A;  1TCO C;  1CTN A;  1NSG A;  4XAK A;  3WL0 A;  1U79 A;  1W1Y A;  3BXW A;  4QZV B;  4URI A;  2IUZ A;  2MLZ A;  1N1A A;  1GUV A;  1WAW A;  1HJV A;  1Q6I A;  4MTV A;  2XPB A;  1IX5 A;  4U86 A;  3WKZ A;  1JVW A;  3KAF A;  1W9U A;  3ARS A;  4MPK A;  3WQW A;  4LAV A;  1EIB A;  4BF8 A;  4MNL A;  1EYM A;  3FXY A;  4P8U A;  2DSZ A;  1W1T A;  2KR7 A;  4IQ2 A;  3WL1 A;  2MF9 A;  1H0G A;  3ALG A;  4Z2L A;  3QOK A;  2QF8 A;  3JYM A;  1ZB5 A;  4JFK A;  3WQV A;  1LQ0 A;  3TDB A;  2LGO A;  1B6C A;  2ETN A;  3CHE A;  4QIB A;  3RME A;  5HW6 A;  1QZ2 A;  2O92 A;  3UQI A;  1ZK6 A;  2YBU A;  3GPK A;  1X6L A;  1ZL1 A;  2PPO A;  4QT2 A;  5GPG A;  2ZQS A;  1ZBC A;  4MSP A;  1X6N A;  1Q1C A;  1E9L A;  3VAW A;  3AQU A;  5DIV A;  3ARX A;  3O5F A;  4DIP A;  2PV2 A;  3O5D A;  2N87 A;  1HKM A;  3ARV A;  3AS2 A;  3GTY X;  4DRM A;  2M2A A;  4JFI A;  1LG1 A;  3PRB A;  4ODR A;  2DG9 A;  4DZ3 A;  1D7J A;  3UI4 A;  1LL7 A;  2DT2 A;  4W9Q A;  5HWB A;  3UF8 A;  1PIN A;  3OA5 A;  3CH9 A;  2M08 A;  3IKG A;  2M1I A;  5HT1 A;  1LL4 A;  3TC5 A;  4NSB A;  5I98 A;  3NTP A;  3ARU A;  1NWR A;  4DRJ A;  2B31 A;  4Z2H A;  1ITX A;  4DWS A;  3ODK A;  3RFW A;  2XP3 A;  3O5M A;  2WK2 A;  4JFJ A;  3ARO A;  1D7I A;  4ODL A;  4N19 A;  1YW5 A;  4WKF A;  3NRK A;  3KAB A;  4W5U A;  1J4I A;  2PI6 A;  1TFV A;  1HKK A;  2XP7 A;  2XP4 A;  1L1P A;  1WNO A;  4ODQ A;  1FKD A;  4TW6 A;  1QPF A;  1K9T A;  1W9V A;  1FKI A;  4R0X A;  3B9E A;  1FD9 A;  2RUR A;  4ODK A;  2XP8 A;  1JND A;  4PTM A;  4TYO A;  4Z2K A;  1ZBK A;  3WD2 A;  4GIV A;  4WIW A;  1P5Q A;  3B9D A;  1F8A B;  3PRA A;  1O6I A;  1WB0 A;  1D7H A;  2RUQ A;  3FAP A;  3O5P A;  1ZBV A;  1E6R A;  1A7X A;  4IT6 A;  4WKH A;  2KI3 A;  1KT1 A;  2G8Z A;  1QPL A;  1FFR A;  3WD0 A;  4L3N A;  4MAV A;  3KZ7 A;  4W9O A;  5HW7 A;  4ODP A;  4DWS C;  2DG3 A;  3FY1 A;  3ARP A;  3ARY A;  1FAP A;  3KAC A;  2XP6 A;  4ZS6 A;  4Z2I A;  2XPA A;  2RUC A;  4G50 A;  4U84 A;  5DEZ A;  4FAP A;  4DH0 A;  1NWU A;  2RQS A;  1NMW A;  5D75 A;  4WK9 A;  3O5K A;  1FKB A;  3JXV A;  2AWG A;  1D6O A;  1UR8 A;  2XP9 A;  4P8W A;  3CGN A;  4Z2G A;  2ITK A;  4LAW A;  1GRJ A;  1FKL A;  1OWQ A;  1F40 A;  2DSW A;  1Q6U A;  1JNT A;  1RD6 A;  5HTG A;  5DIT A;  5HWC A;  3O5L A;  4ZPT R;  1W26 A;  1LJY A;  3PRD A;  1OGG A;  3CZ8 A;  1EHN A;  3RGC A;  1FKK A;  1KT0 A;  2WLY A;  2FKE A;  4ODO A;  3ARR A;  5J6E A;  1XRV A;  2MNT A;  2PN0 A;  1LG2 A;  3IK8 A;  3O5I A;  1M5Y A;  2KGJ A;  4IT4 A;  1E44 A;  3PR9 A;  4ODN A;  2PV1 A;  1EDQ A;  2VCD A;  1FKT A;  3O5R A;  1OGB A;  4HAR A;  4DWS B;  1C9H A;  3CHC A;  3WIJ A;  4GGQ A;  4NZC A;  1FKF A;  4QT3 A;  2DT3 A;  4TNS A;  5DF0 A;  4AY1 A;  4LAX A;  1T11 A;  2G41 A;  5GQB A;  2A3C A;  1D2K A;  4Z2J A;  5B8I C;  2PV3 A;  4HBO A;  3KAD A;  2ZQU A;  2OFN A;  2WLZ A;  2L2S A;  2JZV A;  3EIP A;  1H0I A;  2MLY A;  4ML4 A;  2OLH A;  4JFM A;  4W9P A;  5GPR A;  2P4V A;  3AS3 A;  1SYT A;  5HW8 A;  1E6N A;  4FN2 A;  1HJW A;  4LAY A;  2DSV A;  3O5G A;  2KE0 A;  2AOS A;  2B5U B;  3RM8 A;  2F2D A;  1W1P A;  2DSU A;  2IF4 A;  3CHF A;  3AS0 A;  1HKI A;  2YBT A;  4DRQ A;  3ARZ A;  2ZR5 A;  3WD1 A;  2A3A A;  1ZCN A;  3O5Q A;  2XP5 A;  1FKH A;  2Q5A A;  4JFL A;  2UZ5 A;  2FAP A;  2KO7 A;  3OOB A;  4DZ2 A;  3TCZ A;  3UI6 A;  2LJ4 A;  2DPE A;  2DG4 A;  1ZU8 A;  3CHD A;  4S3J A;  4S3K A;  4DRK A;  1ROU A;  2K8I A;  4DRO A;  2D9F A;  5DIU A;  3O5O A;  4UDM A;  1NWS A;  1Y0O A;  1NH6 A;  1FKG A;  4L72 B;  4IQC A;  1NWT A;  4TX0 A;  3PA7 A;  3KAG A;  3KAH A;  1FKR A;  2DT1 A;  3UQA A;  3I6C A;  1JNS A;  4MGV A;  3IHZ A;  2F21 A;  1XHG A;  5BXJ A;  1J6Y A;  4WJX A;  4KR0 B;  4P8V A;  4WKA A;  1FFQ A;  4O2T A;  2A3B A;  3W4R A;  1HJX A;  3B9A A;  3AS1 A;  4Q22 A;  4ZPV R;  1HXV A;  1ZBW A;  1UR9 A;  3KAI A;  4ZPW R;  4LGX A;  3ART A;  3EY6 A;  1W1V A;  2DT0 A;  4DRN A;  1FKS A;  5DO2 A;  1PBK A;  4DT4 A;  1E15 A;  1BL4 A;  2PBC A;  3B7X A;  1YAT A;  5JH8 A;  2LKN A;  3G6L A;  3RM9 A;  4P8X A;  4ODM A; 
#chains in the Genus database with same CATH homology
 5HBF A;  4KQZ A;  4TW7 A;  3MDY B;  3NI6 A;  4TW8 A;  2RSE A;  2ZR4 A;  1Q6H A;  4MNK A;  2Y78 A;  4HBE A;  1J4R A;  3O5J A;  3ARW A;  3JYJ A;  4DRH A;  1BKF A;  4Q7N A;  5HKG A;  2FDM A;  3G6M A;  2A3E A;  1FJD A;  3CGM A;  4JYS A;  1ROT A;  3H9R B;  2MPH A;  2ZR6 A;  1FKJ A;  3UI5 A;  3IKD A;  1R9H A;  1VF8 A;  3WD4 A;  4IPX A;  1E6Z A;  3UQB A;  4MNM A;  2O9O A;  2ZQV A;  4DWS D;  1JNE A;  4J4N A;  1GOI A;  4MNJ A;  4R5E A;  1W9P A;  3B8S A;  2MLX A;  4NNR A;  2ESC A;  3KCE A;  1SR0 A;  2KFW A;  4U85 A;  1E6P A;  4DRI A;  2RUD A;  1LL6 A;  4G2P A;  2LPV A;  4DRP A;  1NMV A;  1EQ3 A;  3RM4 A;  3ALF A;  2ZQT A;  2PPP A;  4J4O A;  4C02 B;  2VN1 A;  3WD3 A;  2PPN A;  1J4H A;  3WH0 A;  4ITZ A;  3LUO A;  1KFW A;  2F4E A;  1HKJ A;  3ARQ A;  5HUA A;  1GPF A;  2WM0 A;  3O5E A;  1TCO C;  1CTN A;  1NSG A;  4XAK A;  3WL0 A;  1U79 A;  1W1Y A;  3BXW A;  4QZV B;  4URI A;  2IUZ A;  2MLZ A;  1N1A A;  1GUV A;  1WAW A;  1HJV A;  1Q6I A;  4MTV A;  2XPB A;  1IX5 A;  4U86 A;  3WKZ A;  1JVW A;  3KAF A;  1W9U A;  3ARS A;  4MPK A;  3WQW A;  4LAV A;  1EIB A;  4BF8 A;  4MNL A;  1EYM A;  3FXY A;  4P8U A;  2DSZ A;  1W1T A;  2KR7 A;  4IQ2 A;  3WL1 A;  2MF9 A;  1H0G A;  3ALG A;  4Z2L A;  3QOK A;  2QF8 A;  3JYM A;  1ZB5 A;  4JFK A;  3WQV A;  1LQ0 A;  3TDB A;  2LGO A;  1B6C A;  3CHE A;  4QIB A;  3RME A;  5HW6 A;  1QZ2 A;  2O92 A;  3UQI A;  1ZK6 A;  2YBU A;  3GPK A;  1X6L A;  1ZL1 A;  2PPO A;  4QT2 A;  5GPG A;  2ZQS A;  1ZBC A;  4MSP A;  1X6N A;  1Q1C A;  1E9L A;  3VAW A;  3AQU A;  5DIV A;  3ARX A;  3O5F A;  4DIP A;  2PV2 A;  3O5D A;  2N87 A;  1HKM A;  3ARV A;  3AS2 A;  4DRM A;  2M2A A;  4JFI A;  1LG1 A;  3PRB A;  4ODR A;  2DG9 A;  4DZ3 A;  1D7J A;  3UI4 A;  1LL7 A;  2DT2 A;  4W9Q A;  5HWB A;  3UF8 A;  1PIN A;  3OA5 A;  3CH9 A;  2M08 A;  3IKG A;  2M1I A;  5HT1 A;  1LL4 A;  3TC5 A;  4NSB A;  5I98 A;  3NTP A;  3ARU A;  1NWR A;  4DRJ A;  2B31 A;  4Z2H A;  1ITX A;  4DWS A;  3ODK A;  3RFW A;  2XP3 A;  3O5M A;  2WK2 A;  4JFJ A;  3ARO A;  1D7I A;  4ODL A;  4N19 A;  1YW5 A;  4WKF A;  3NRK A;  3KAB A;  4W5U A;  1J4I A;  2PI6 A;  1TFV A;  1HKK A;  2XP7 A;  2XP4 A;  1L1P A;  1WNO A;  4ODQ A;  1FKD A;  4TW6 A;  1QPF A;  1K9T A;  1W9V A;  1FKI A;  4R0X A;  3B9E A;  1FD9 A;  2RUR A;  4ODK A;  2XP8 A;  1JND A;  4PTM A;  4TYO A;  4Z2K A;  1ZBK A;  3WD2 A;  4GIV A;  4WIW A;  1P5Q A;  3B9D A;  1F8A B;  3PRA A;  1O6I A;  1WB0 A;  1D7H A;  2RUQ A;  3FAP A;  3O5P A;  1ZBV A;  1E6R A;  1A7X A;  4IT6 A;  4WKH A;  2KI3 A;  1KT1 A;  2G8Z A;  1QPL A;  1FFR A;  3WD0 A;  4L3N A;  4MAV A;  3KZ7 A;  4W9O A;  5HW7 A;  4ODP A;  4DWS C;  2DG3 A;  3FY1 A;  3ARP A;  3ARY A;  1FAP A;  3KAC A;  2XP6 A;  4ZS6 A;  4Z2I A;  2XPA A;  2RUC A;  4G50 A;  4U84 A;  5DEZ A;  4FAP A;  4DH0 A;  1NWU A;  2RQS A;  1NMW A;  5D75 A;  4WK9 A;  3O5K A;  1FKB A;  3JXV A;  2AWG A;  1D6O A;  1UR8 A;  2XP9 A;  4P8W A;  3CGN A;  4Z2G A;  2ITK A;  4LAW A;  1OWQ A;  1FKL A;  1F40 A;  2DSW A;  1Q6U A;  1JNT A;  1RD6 A;  5HTG A;  5DIT A;  5HWC A;  3O5L A;  4ZPT R;  1W26 A;  1LJY A;  3PRD A;  1OGG A;  3CZ8 A;  1EHN A;  3RGC A;  1FKK A;  1KT0 A;  2WLY A;  2FKE A;  4ODO A;  3ARR A;  5J6E A;  1XRV A;  2MNT A;  3IK8 A;  1LG2 A;  3O5I A;  1M5Y A;  2KGJ A;  4IT4 A;  3PR9 A;  4ODN A;  2PV1 A;  1EDQ A;  2VCD A;  1FKT A;  3O5R A;  1OGB A;  4HAR A;  4DWS B;  1C9H A;  3CHC A;  3WIJ A;  4GGQ A;  4NZC A;  1FKF A;  4QT3 A;  2DT3 A;  4TNS A;  5DF0 A;  4AY1 A;  4LAX A;  1T11 A;  2G41 A;  5GQB A;  2A3C A;  1D2K A;  4Z2J A;  5B8I C;  2PV3 A;  4HBO A;  3KAD A;  2ZQU A;  2OFN A;  2WLZ A;  2L2S A;  2JZV A;  1H0I A;  2MLY A;  4ML4 A;  2OLH A;  4JFM A;  4W9P A;  5GPR A;  3AS3 A;  1SYT A;  5HW8 A;  1E6N A;  4FN2 A;  1HJW A;  4LAY A;  2DSV A;  3O5G A;  2KE0 A;  2AOS A;  3RM8 A;  2F2D A;  1W1P A;  2DSU A;  2IF4 A;  3CHF A;  3AS0 A;  1HKI A;  2YBT A;  4DRQ A;  3ARZ A;  2ZR5 A;  3WD1 A;  2A3A A;  1ZCN A;  3O5Q A;  2XP5 A;  1FKH A;  2Q5A A;  4JFL A;  2UZ5 A;  2FAP A;  2KO7 A;  3OOB A;  4DZ2 A;  3TCZ A;  3UI6 A;  2LJ4 A;  2DPE A;  2DG4 A;  1ZU8 A;  3CHD A;  4S3J A;  4S3K A;  4DRK A;  1ROU A;  2K8I A;  4DRO A;  2D9F A;  5DIU A;  3O5O A;  1NWS A;  1Y0O A;  1NH6 A;  1FKG A;  4L72 B;  4IQC A;  1NWT A;  4TX0 A;  3PA7 A;  3KAG A;  3KAH A;  1FKR A;  2DT1 A;  3UQA A;  3I6C A;  1JNS A;  4MGV A;  3IHZ A;  2F21 A;  1XHG A;  5BXJ A;  1J6Y A;  4WJX A;  4KR0 B;  4P8V A;  4WKA A;  1FFQ A;  4O2T A;  2A3B A;  3W4R A;  1HJX A;  3B9A A;  3AS1 A;  4Q22 A;  4ZPV R;  1HXV A;  1ZBW A;  1UR9 A;  3KAI A;  4ZPW R;  4LGX A;  3ART A;  3EY6 A;  1W1V A;  2DT0 A;  4DRN A;  1FKS A;  5DO2 A;  1PBK A;  4DT4 A;  1E15 A;  1BL4 A;  2PBC A;  3B7X A;  1YAT A;  5JH8 A;  2LKN A;  3G6L A;  3RM9 A;  4P8X A;  4ODM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...