4TX0A

The fk1 domain of fkbp51 in complex with (1s,5s,6r)-10-[(3,5-dichlorophenyl)sulfonyl]-5-(2-methoxyethoxy)-3-(2-methoxyethyl)-3,10-diazabicyclo[4.3.1]decan-2-one
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stereoselective Construction of the 5-Hydroxy Diazabicyclo[4.3.1]decane-2-one Scaffold, a Privileged Motif for FK506-Binding Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 36
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4tx0A00
1W26A 1Q6IA 1NMVA 2PPPA 1FKTA 4LAWA 3UQAA 2RQSA 2XP9A 4LAVA 2M1IA 2DG4A 1EYMA 1D7HA 4QIBA 4FAPA 2XP7A 3CGNA 1NSGA 2KGJA 2MLYA 3KABA 4LAXA 3TCZA 5HW7A 5HTGA 3O5FA 5D75A 1FKGA 2KO7A 4LAYA 3VAWA 2LKNA 4TW7A 1B6CA 4DRNA 3MDYB 2FKEA 1Y0OA 3JYMA 2F21A 2MNTA 5HUAA 1Q1CA 4DRKA 3CGMA 3EY6A 2L2SA 4G50A 4ODKA 4DROA 4U86A 4NNRA 1L1PA 4W9QA 2PPOA 1FJDA 3H9RB 4JFJA 1NMWA 2ZR6A 3KAGA 1FKRA 4ODNA 3O5IA 1FKDA 3TC5A 3KAHA 4DZ3A 3O5GA 4C02B 1KT1A 4GGQA 3KAIA 2IF4A 4JFLA 1A7XA 2MF9A 3PRDA 3ODKA 4MSPA 2Y78A 1D7IA 4IQCA 5GPGA 1BKFA 1FKFA 3KZ7A 1PINA 2ZQVA 3UI6A 3O5JA 2RSEA 2KI3A 4JYSA 1C9HA 1R9HA 3NTPA 1BL4A 2JZVA 4DRHA 3JXVA 4DT4A 1F40A 2VN1A 2OFNA 3O5OA 3I6CA 5HWCA 4J4NA 2M08A 4JFIA 4ODRA 3FAPA 4TYOA 4DRPA 3LUOA 5DIUA 2ITKA 2AWGA 3UI4A 2LPVA 4ODMA 1FKJA 2LJ4A 3B7XA 3IK8A 2XP8A 2M2AA 4DRQA 4ODQA 4W9PA 2XP3A 4IQ2A 2PBCA 4GIVA 2ZR5A 1Q6HA 3PRBA 3IHZA 3KADA 3NRKA 2UZ5A 2DG3A 4W9OA 1F8AB 3KACA 5B8IC 1PBKA 1D6OA 1FKBA 2Q5AA 4FN2A 4DRIA 1ROTA 1FKSA 1T11A 2KFWA 4R0XA 2RUDA 2XPAA 2ZQTA 3IKGA 3UQBA 1U79A 4TW6A 4BF8A 2ZQSA 5HWBA 2RUCA 4ITZA 2XPBA 2F2DA 4DRMA 4DZ2A 5I98A 4DRJA 2ZQUA 5BXJA 1J4RA 5DITA 3O5PA 1JNSA 2XP6A 4J4OA 4QT3A 4MGVA 3RFWA 3O5RA 1ZK6A 2KR7A 3O5KA 4N19A 4U85A 5HT1A 4G2PA 4TW8A 3NI6A 4QT2A 1FKLA 3JYJA 3UI5A 1FKIA 1FAPA 2MLXA 3O5LA 5HKGA 4IPXA 4JFMA 2RURA 3O5EA 5DIVA 4U84A 3RGCA 1N1AA 3O5QA 2KE0A 1ROUA 3WH0A 3KCEA 2XP5A 2PPNA 1QZ2A 4DIPA 1J4HA 3TDBA 1JNTA 2FAPA 2MPHA 2LGOA 4TNSA 1KT0A 2F4EA 2VCDA 3KAFA 1YATA 1J4IA 5J6EA 4DH0A 1EQ3A 5HW8A 1HXVA 4TX0A 2D9FA 1J6YA 4ODPA 1JVWA 2DG9A 4JFKA 4ODOA 2K8IA 1P5QA 2MLZA 4ODLA 2ZR4A 2RUQA 3UQIA 5HW6A 1Q6UA 2PV3A 3IKDA 2PV1A 3GPKA 3OOBA 1FD9A 1FKKA 3O5DA 1M5YA 1QPFA 2PV2A 4O2TA 3UF8A 1FKHA 1ZCNA 2XP4A 3PA7A 1TCOC 1YW5A 3O5MA 1D7JA 2N87A 1QPLA
chains in the Genus database with same CATH superfamily
4LAWA 2O92A 3UQAA 3ARUA 1ZBKA 4MNJA 2XP9A 2M1IA 5HW7A 1W9PA 2G41A 4MPKA 4UDMA 2KO7A 4LAYA 3VAWA 2LKNA 4TW7A 1B6CA 3ARSA 3MDYB 2MNTA 1Q1CA 4DRKA 4G50A 4ODKA 1E44A 1ITXA 4WKFA 1E15A 3O5IA 4C02B 3ARYA 3KAIA 2IF4A 2MF9A 3W4RA 2DT1A 4ZPVR 4IQCA 3G6MA 3UI6A 1FFQA 3CH9A 4DRPA 5DIUA 1W1PA 3UI4A 5DO2A 4ODMA 5GQBA 1FKJA 3IK8A 2A3EA 2M2AA 4ODQA 3ARRA 4IT6A 1VF8A 1LL7A 1NH6A 3AS3A 1Q6HA 4HBEA 4P8XA 1F8AB 3KACA 4DRIA 1ROTA 1T11A 2KFWA 2RUDA 3RM8A 1U79A 5HWBA 4DZ2A 2ZQUA 3AS0A 3O5RA 4MNKA 4N19A 3ARXA 4Z2IA 4Z2JA 3JYJA 1E6ZA 3WQWA 5DIVA 1NWRA 4HBOA 1ROUA 2EULA 4W5UA 2MPHA 2LGOA 4TNSA 5DEZA 1YATA 1NWTA 4DH0A 1LJYA 3BMBA 2D9FA 4P8WA 4KQZA 3UQIA 2K8IA 1ZU8A 3GPKA 4Z2GA 2A3AA 1M5YA 2PV2A 2XP4A 3CZ8A 3PA7A 1H0IA 1YW5A 3O5MA 4MNLA 1D7JA 1W26A 1Q6IA 1NMVA 1FKTA 1LL6A 2DPEA 1D7HA 4QIBA 1NSGA 3FXYA 3WD1A 4Z2HA 3B8SA 5D75A 1EHNA 4DRNA 2FKEA 1Y0OA 4HARA 2PI6A 2F21A 4L72B 3EY6A 1EIBA 1W1YA 4NNRA 2DSUA 4DWSA 1L1PA 1FJDA 2QF8A 1ZL1A 4DWSD 4Q7NA 4Z2KA 1FKDA 3WD3A 3KAHA 4GGQA 4P8UA 2DSWA 3ODKA 1HKKA 4MSPA 2Y78A 1D7IA 1BKFA 3ALFA 3B9AA 3KZ7A 2ZQVA 4WIWA 2AOSA 2OLHA 1C9HA 1F40A 1BL4A 3ARZA 4DRHA 3JXVA 5HWCA 3O5OA 2M08A 4ODRA 3WL1A 3FAPA 2ITKA 2P4VA 1E9LA 4NSBA 4DRQA 1KFWA 1EDQA 1FFRA 1UR9A 4GIVA 3WIJA 5HBFA 2PN0A 1NWSA 1OGGA 2UZ5A 1OWQA 4W9OA 4S3KA 3CHDA 1GUVA 2DSZA 4R0XA 3IKGA 4S3JA 4TW6A 1H0GA 4ITZA 3QOKA 2ESCA 3AS2A 3O5PA 4WKAA 1UR8A 4QT3A 2KR7A 4R5EA 5HT1A 4QZVB 2YBTA 1FKLA 3CHFA 4IPXA 1W9VA 4JFMA 1JNDA 2RURA 3CHEA 3O5EA 4U84A 1ZBCA 3RGCA 3AQUA 3WH0A 3KCEA 1HKIA 1JNTA 2FAPA 4MAVA 1KT0A 2F4EA 2VCDA 1NWUA 5J6EA 1EQ3A 5HW8A 1HJXA 1J6YA 4JFKA 4ODOA 1P5QA 2RUQA 1LL4A 1Q6UA 2PV3A 3WL0A 3UF8A 1GPFA 1QPFA 1E6RA 1K9TA 1WB0A 4DRMA 5I98A 1QPLA 1RD6A 2RQSA 3EIPA 1EYMA 4FAPA 2XP7A 3CGNA 2MLYA 4LAXA 1HJWA 4WKHA 2WLZA 4NZCA 1FKGA 3BXWA 2YBUA 1TFVA 2DT2A 3CGMA 2L2SA 1WAWA 2DSVA 4W9QA 2PPOA 3H9RB 2O9OA 1NMWA 2ZR6A 3TC5A 3ARQA 1KT1A 1GRJA 3GTYX 4JFLA 2WLYA 1A7XA 3PRDA 5DF0A 1W1VA 1PINA 1XRVA 2KI3A 4XAKA 3AS1A 3NTPA 4DT4A 2JZVA 3I6CA 4J4NA 4JFIA 2G8ZA 3LUOA 1ZBVA 2AWGA 1X6LA 2XP8A 1JCHB 1LG1A 4W9PA 2XP3A 1E6PA 2PBCA 1GOIA 2ZR5A 3KADA 1CTNA 3NRKA 4L3NA 4ZPTR 2DG3A 5B8IC 4WK9A 1PBKA 4ZPWR 3RM4A 2Q5AA 3UQBA 4BF8A 1IX5A 2ZQSA 1HKJA 1HJVA 2RUCA 2XPBA 4DRJA 4KR0B 1J4RA 5DITA 5BXJA 2XP6A 1W9UA 4DWSC 3RFWA 4MGVA 2A3BA 3WD2A 4G2PA 4QT2A 3UI5A 3WQVA 5HKGA 1FKIA 3O5LA 2MLXA 1SR0A 2XP5A 3RMEA 1QZ2A 4DIPA 1J4HA 1J4IA 4TX0A 4ODPA 2MLZA 2ZR4A 5HW6A 3IKDA 2DT3A 2PV1A 3OOBA 1FKKA 4O2TA 1FKHA 1ZCNA 1TCOC 5HUAA 2N87A 4U86A 2A3CA 2PPPA 4AY1A 4LAVA 2DG4A 2KGJA 3KABA 3TCZA 5HTGA 4Z2LA 3O5FA 5GPRA 3CHCA 1W1TA 1HKMA 3JYMA 2WM0A 1LQ0A 4MNMA 4DROA 3B9EA 3PR9A 1SYTA 1XHGA 4JFJA 3KAGA 1O6IA 1FKRA 4ODNA 3WD0A 2IUZA 4DZ3A 3O5GA 1WNOA 3G6LA 3B9DA 2F23A 3RM9A 1ZB5A 5GPGA 1LG2A 1FKFA 3O5JA 2RSEA 3ARVA 4JYSA 5JH8A 1R9HA 2VN1A 2OFNA 4TYOA 3WKZA 2LPVA 2LJ4A 3B7XA 4DWSB 4IQ2A 4Q22A 2B31A 3GU0A 3IHZA 3PRBA 4ZS6A 3OA5A 4ML4A 4WJXA 1D6OA 1FKBA 4FN2A 1FKSA 4P8VA 2B5UB 2XPAA 2ZQTA 1JNEA 1D2KA 3FY1A 4PTMA 4LGXA 2F2DA 1JNSA 4J4OA 1ZK6A 3O5KA 3PRAA 3ARWA 4U85A 2DT0A 1E6NA 4TW8A 3NI6A 1FAPA 1OGBA 1N1AA 3O5QA 2KE0A 1X6NA 3AROA 2PPNA 3TDBA 4IT4A 3KAFA 2ETNA 3ALGA 3ARPA 3WD4A 1HXVA 4URIA 1JVWA 2DG9A 2WK2A 4ODLA 4MTVA 1FD9A 3O5DA 2FDMA 3ARTA 1ZBWA
chains in the Genus database with same CATH topology
4LAWA 2O92A 3UQAA 3ARUA 1ZBKA 4MNJA 2XP9A 2M1IA 5HW7A 1W9PA 2G41A 4MPKA 2KO7A 4LAYA 3VAWA 2LKNA 4TW7A 1B6CA 3ARSA 3MDYB 2MNTA 1Q1CA 4DRKA 4G50A 4ODKA 1ITXA 4WKFA 1E15A 3O5IA 4C02B 3ARYA 3KAIA 2IF4A 2MF9A 3W4RA 2DT1A 4ZPVR 4IQCA 3G6MA 3UI6A 1FFQA 3CH9A 4DRPA 5DIUA 1W1PA 3UI4A 5DO2A 4ODMA 5GQBA 1FKJA 3IK8A 2A3EA 2M2AA 4ODQA 3ARRA 4IT6A 1VF8A 1LL7A 1NH6A 3AS3A 1Q6HA 4HBEA 4P8XA 1F8AB 3KACA 4DRIA 1ROTA 1T11A 2KFWA 2RUDA 3RM8A 1U79A 5HWBA 4DZ2A 2ZQUA 3AS0A 3O5RA 4MNKA 4N19A 3ARXA 4Z2IA 4Z2JA 3JYJA 1E6ZA 3WQWA 5DIVA 1NWRA 4HBOA 1ROUA 4W5UA 2MPHA 2LGOA 4TNSA 5DEZA 1YATA 1NWTA 4DH0A 1LJYA 2D9FA 4P8WA 4KQZA 3UQIA 2K8IA 1ZU8A 3GPKA 4Z2GA 2A3AA 1M5YA 2PV2A 2XP4A 3CZ8A 3PA7A 1H0IA 1YW5A 3O5MA 4MNLA 1D7JA 1W26A 1Q6IA 1NMVA 1FKTA 1LL6A 2DPEA 1D7HA 4QIBA 1NSGA 3FXYA 3WD1A 4Z2HA 3B8SA 5D75A 1EHNA 4DRNA 2FKEA 1Y0OA 4HARA 2PI6A 2F21A 4L72B 3EY6A 1EIBA 1W1YA 4NNRA 2DSUA 4DWSA 1L1PA 1FJDA 2QF8A 1ZL1A 4DWSD 4Q7NA 4Z2KA 1FKDA 3WD3A 3KAHA 4GGQA 4P8UA 2DSWA 3ODKA 1HKKA 4MSPA 2Y78A 1D7IA 1BKFA 3ALFA 3B9AA 3KZ7A 2ZQVA 4WIWA 2AOSA 2OLHA 1C9HA 1F40A 1BL4A 3ARZA 4DRHA 3JXVA 5HWCA 3O5OA 2M08A 4ODRA 3WL1A 3FAPA 2ITKA 1E9LA 4NSBA 4DRQA 1KFWA 1EDQA 1FFRA 1UR9A 4GIVA 3WIJA 5HBFA 1NWSA 1OGGA 2UZ5A 1OWQA 4W9OA 4S3KA 3CHDA 1GUVA 2DSZA 4R0XA 3IKGA 4S3JA 4TW6A 1H0GA 4ITZA 3QOKA 2ESCA 3AS2A 3O5PA 4WKAA 1UR8A 4QT3A 2KR7A 4R5EA 5HT1A 4QZVB 2YBTA 1FKLA 3CHFA 4IPXA 1W9VA 4JFMA 1JNDA 2RURA 3CHEA 3O5EA 4U84A 1ZBCA 3RGCA 3AQUA 3WH0A 3KCEA 1HKIA 1JNTA 2FAPA 4MAVA 1KT0A 2F4EA 2VCDA 1NWUA 5J6EA 1EQ3A 5HW8A 1HJXA 1J6YA 4JFKA 4ODOA 1P5QA 2RUQA 1LL4A 1Q6UA 2PV3A 3WL0A 3UF8A 1GPFA 1QPFA 1E6RA 1K9TA 1WB0A 4DRMA 5I98A 1QPLA 1RD6A 2RQSA 1EYMA 4FAPA 2XP7A 3CGNA 2MLYA 4LAXA 1HJWA 4WKHA 2WLZA 4NZCA 1FKGA 3BXWA 2YBUA 1TFVA 2DT2A 3CGMA 2L2SA 1WAWA 2DSVA 4W9QA 2PPOA 3H9RB 2O9OA 1NMWA 2ZR6A 3TC5A 3ARQA 1KT1A 4JFLA 2WLYA 1A7XA 3PRDA 5DF0A 1W1VA 1PINA 1XRVA 2KI3A 4XAKA 3AS1A 3NTPA 4DT4A 2JZVA 3I6CA 4J4NA 4JFIA 2G8ZA 3LUOA 1ZBVA 2AWGA 1X6LA 2XP8A 1LG1A 4W9PA 2XP3A 1E6PA 2PBCA 1GOIA 2ZR5A 3KADA 1CTNA 3NRKA 4L3NA 4ZPTR 2DG3A 5B8IC 4WK9A 1PBKA 4ZPWR 3RM4A 2Q5AA 3UQBA 4BF8A 1IX5A 2ZQSA 1HKJA 1HJVA 2RUCA 2XPBA 4DRJA 4KR0B 1J4RA 5DITA 5BXJA 2XP6A 1W9UA 4DWSC 3RFWA 4MGVA 2A3BA 3WD2A 4G2PA 4QT2A 3UI5A 3WQVA 5HKGA 1FKIA 3O5LA 2MLXA 1SR0A 2XP5A 3RMEA 1QZ2A 4DIPA 1J4HA 1J4IA 4TX0A 4ODPA 2MLZA 2ZR4A 5HW6A 3IKDA 2DT3A 2PV1A 3OOBA 1FKKA 4O2TA 1FKHA 1ZCNA 1TCOC 5HUAA 2N87A 4U86A 2A3CA 2PPPA 4AY1A 4LAVA 2DG4A 2KGJA 3KABA 3TCZA 5HTGA 4Z2LA 3O5FA 5GPRA 3CHCA 1W1TA 1HKMA 3JYMA 2WM0A 1LQ0A 4MNMA 4DROA 3B9EA 3PR9A 1SYTA 1XHGA 4JFJA 3KAGA 1O6IA 1FKRA 4ODNA 3WD0A 2IUZA 4DZ3A 3O5GA 1WNOA 3G6LA 3B9DA 3RM9A 1ZB5A 5GPGA 1LG2A 1FKFA 3O5JA 2RSEA 3ARVA 4JYSA 5JH8A 1R9HA 2VN1A 2OFNA 4TYOA 3WKZA 2LPVA 2LJ4A 3B7XA 4DWSB 4IQ2A 4Q22A 2B31A 3PRBA 3IHZA 4ZS6A 3OA5A 4ML4A 4WJXA 1D6OA 1FKBA 4FN2A 1FKSA 4P8VA 2XPAA 2ZQTA 1JNEA 1D2KA 3FY1A 4PTMA 4LGXA 2F2DA 1JNSA 4J4OA 1ZK6A 3O5KA 3PRAA 3ARWA 4U85A 2DT0A 1E6NA 4TW8A 3NI6A 1FAPA 1OGBA 1N1AA 3O5QA 2KE0A 1X6NA 3AROA 2PPNA 3TDBA 4IT4A 3KAFA 3ALGA 3ARPA 3WD4A 1HXVA 4URIA 1JVWA 2DG9A 2WK2A 4ODLA 4MTVA 1FD9A 3O5DA 2FDMA 3ARTA 1ZBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W26 A;  1Q6I A;  1NMV A;  2PPP A;  1FKT A;  4LAW A;  3UQA A;  2RQS A;  2XP9 A;  4LAV A;  2M1I A;  2DG4 A;  1EYM A;  1D7H A;  4QIB A;  4FAP A;  2XP7 A;  3CGN A;  1NSG A;  2KGJ A;  2MLY A;  3KAB A;  4LAX A;  3TCZ A;  5HW7 A;  5HTG A;  3O5F A;  5D75 A;  1FKG A;  2KO7 A;  4LAY A;  3VAW A;  2LKN A;  4TW7 A;  1B6C A;  4DRN A;  3MDY B;  2FKE A;  1Y0O A;  3JYM A;  2F21 A;  2MNT A;  5HUA A;  1Q1C A;  4DRK A;  3CGM A;  3EY6 A;  2L2S A;  4G50 A;  4ODK A;  4DRO A;  4U86 A;  4NNR A;  1L1P A;  4W9Q A;  2PPO A;  1FJD A;  3H9R B;  4JFJ A;  1NMW A;  2ZR6 A;  3KAG A;  1FKR A;  4ODN A;  3O5I A;  1FKD A;  3TC5 A;  3KAH A;  4DZ3 A;  3O5G A;  4C02 B;  1KT1 A;  4GGQ A;  3KAI A;  2IF4 A;  4JFL A;  1A7X A;  2MF9 A;  3PRD A;  3ODK A;  4MSP A;  2Y78 A;  1D7I A;  4IQC A;  5GPG A;  1BKF A;  1FKF A;  3KZ7 A;  1PIN A;  2ZQV A;  3UI6 A;  3O5J A;  2RSE A;  2KI3 A;  4JYS A;  1C9H A;  1R9H A;  3NTP A;  1BL4 A;  2JZV A;  4DRH A;  3JXV A;  4DT4 A;  1F40 A;  2VN1 A;  2OFN A;  3O5O A;  3I6C A;  5HWC A;  4J4N A;  2M08 A;  4JFI A;  4ODR A;  3FAP A;  4TYO A;  4DRP A;  3LUO A;  5DIU A;  2ITK A;  2AWG A;  3UI4 A;  2LPV A;  4ODM A;  1FKJ A;  2LJ4 A;  3B7X A;  3IK8 A;  2XP8 A;  2M2A A;  4DRQ A;  4ODQ A;  4W9P A;  2XP3 A;  4IQ2 A;  2PBC A;  4GIV A;  2ZR5 A;  1Q6H A;  3PRB A;  3IHZ A;  3KAD A;  3NRK A;  2UZ5 A;  2DG3 A;  4W9O A;  1F8A B;  3KAC A;  5B8I C;  1PBK A;  1D6O A;  1FKB A;  2Q5A A;  4FN2 A;  4DRI A;  1ROT A;  1FKS A;  1T11 A;  2KFW A;  4R0X A;  2RUD A;  2XPA A;  2ZQT A;  3IKG A;  3UQB A;  1U79 A;  4TW6 A;  4BF8 A;  2ZQS A;  5HWB A;  2RUC A;  4ITZ A;  2XPB A;  2F2D A;  4DRM A;  4DZ2 A;  5I98 A;  4DRJ A;  2ZQU A;  5BXJ A;  1J4R A;  5DIT A;  3O5P A;  1JNS A;  2XP6 A;  4J4O A;  4QT3 A;  4MGV A;  3RFW A;  3O5R A;  1ZK6 A;  2KR7 A;  3O5K A;  4N19 A;  4U85 A;  5HT1 A;  4G2P A;  4TW8 A;  3NI6 A;  4QT2 A;  1FKL A;  3JYJ A;  3UI5 A;  1FKI A;  1FAP A;  2MLX A;  3O5L A;  5HKG A;  4IPX A;  4JFM A;  2RUR A;  3O5E A;  5DIV A;  4U84 A;  3RGC A;  1N1A A;  3O5Q A;  2KE0 A;  1ROU A;  3WH0 A;  3KCE A;  2XP5 A;  2PPN A;  1QZ2 A;  4DIP A;  1J4H A;  3TDB A;  1JNT A;  2FAP A;  2MPH A;  2LGO A;  4TNS A;  1KT0 A;  2F4E A;  2VCD A;  3KAF A;  1YAT A;  1J4I A;  5J6E A;  4DH0 A;  1EQ3 A;  5HW8 A;  1HXV A;  4TX0 A;  2D9F A;  1J6Y A;  4ODP A;  1JVW A;  2DG9 A;  4JFK A;  4ODO A;  2K8I A;  1P5Q A;  2MLZ A;  4ODL A;  2ZR4 A;  2RUQ A;  3UQI A;  5HW6 A;  1Q6U A;  2PV3 A;  3IKD A;  2PV1 A;  3GPK A;  3OOB A;  1FD9 A;  1FKK A;  3O5D A;  1M5Y A;  1QPF A;  2PV2 A;  4O2T A;  3UF8 A;  1FKH A;  1ZCN A;  2XP4 A;  3PA7 A;  1TCO C;  1YW5 A;  3O5M A;  1D7J A;  2N87 A;  1QPL A; 
#chains in the Genus database with same CATH topology
 4LAW A;  2O92 A;  3UQA A;  3ARU A;  1ZBK A;  4MNJ A;  2XP9 A;  2M1I A;  5HW7 A;  1W9P A;  2G41 A;  4MPK A;  4UDM A;  2KO7 A;  4LAY A;  3VAW A;  2LKN A;  4TW7 A;  1B6C A;  3ARS A;  3MDY B;  2MNT A;  1Q1C A;  4DRK A;  4G50 A;  4ODK A;  1E44 A;  1ITX A;  4WKF A;  1E15 A;  3O5I A;  4C02 B;  3ARY A;  3KAI A;  2IF4 A;  2MF9 A;  3W4R A;  2DT1 A;  4ZPV R;  4IQC A;  3G6M A;  3UI6 A;  1FFQ A;  3CH9 A;  4DRP A;  5DIU A;  1W1P A;  3UI4 A;  5DO2 A;  4ODM A;  5GQB A;  1FKJ A;  3IK8 A;  2A3E A;  2M2A A;  4ODQ A;  3ARR A;  4IT6 A;  1VF8 A;  1LL7 A;  1NH6 A;  3AS3 A;  1Q6H A;  4HBE A;  4P8X A;  1F8A B;  3KAC A;  4DRI A;  1ROT A;  1T11 A;  2KFW A;  2RUD A;  3RM8 A;  1U79 A;  5HWB A;  4DZ2 A;  2ZQU A;  3AS0 A;  3O5R A;  4MNK A;  4N19 A;  3ARX A;  4Z2I A;  4Z2J A;  3JYJ A;  1E6Z A;  3WQW A;  5DIV A;  1NWR A;  4HBO A;  1ROU A;  2EUL A;  4W5U A;  2MPH A;  2LGO A;  4TNS A;  5DEZ A;  1YAT A;  1NWT A;  4DH0 A;  1LJY A;  3BMB A;  2D9F A;  4P8W A;  4KQZ A;  3UQI A;  2K8I A;  1ZU8 A;  3GPK A;  4Z2G A;  2A3A A;  1M5Y A;  2PV2 A;  2XP4 A;  3CZ8 A;  3PA7 A;  1H0I A;  1YW5 A;  3O5M A;  4MNL A;  1D7J A;  1W26 A;  1Q6I A;  1NMV A;  1FKT A;  1LL6 A;  2DPE A;  1D7H A;  4QIB A;  1NSG A;  3FXY A;  3WD1 A;  4Z2H A;  3B8S A;  5D75 A;  1EHN A;  4DRN A;  2FKE A;  1Y0O A;  4HAR A;  2PI6 A;  2F21 A;  4L72 B;  3EY6 A;  1EIB A;  1W1Y A;  4NNR A;  2DSU A;  4DWS A;  1L1P A;  1FJD A;  2QF8 A;  1ZL1 A;  4DWS D;  4Q7N A;  4Z2K A;  1FKD A;  3WD3 A;  3KAH A;  4GGQ A;  4P8U A;  2DSW A;  3ODK A;  1HKK A;  4MSP A;  2Y78 A;  1D7I A;  1BKF A;  3ALF A;  3B9A A;  3KZ7 A;  2ZQV A;  4WIW A;  2AOS A;  2OLH A;  1C9H A;  1F40 A;  1BL4 A;  3ARZ A;  4DRH A;  3JXV A;  5HWC A;  3O5O A;  2M08 A;  4ODR A;  3WL1 A;  3FAP A;  2ITK A;  2P4V A;  1E9L A;  4NSB A;  4DRQ A;  1KFW A;  1EDQ A;  1FFR A;  1UR9 A;  4GIV A;  3WIJ A;  5HBF A;  2PN0 A;  1NWS A;  1OGG A;  2UZ5 A;  1OWQ A;  4W9O A;  4S3K A;  3CHD A;  1GUV A;  2DSZ A;  4R0X A;  3IKG A;  4S3J A;  4TW6 A;  1H0G A;  4ITZ A;  3QOK A;  2ESC A;  3AS2 A;  3O5P A;  4WKA A;  1UR8 A;  4QT3 A;  2KR7 A;  4R5E A;  5HT1 A;  4QZV B;  2YBT A;  1FKL A;  3CHF A;  4IPX A;  1W9V A;  4JFM A;  1JND A;  2RUR A;  3CHE A;  3O5E A;  4U84 A;  1ZBC A;  3RGC A;  3AQU A;  3WH0 A;  3KCE A;  1HKI A;  1JNT A;  2FAP A;  4MAV A;  1KT0 A;  2F4E A;  2VCD A;  1NWU A;  5J6E A;  1EQ3 A;  5HW8 A;  1HJX A;  1J6Y A;  4JFK A;  4ODO A;  1P5Q A;  2RUQ A;  1LL4 A;  1Q6U A;  2PV3 A;  3WL0 A;  3UF8 A;  1GPF A;  1QPF A;  1E6R A;  1K9T A;  1WB0 A;  4DRM A;  5I98 A;  1QPL A;  1RD6 A;  2RQS A;  3EIP A;  1EYM A;  4FAP A;  2XP7 A;  3CGN A;  2MLY A;  4LAX A;  1HJW A;  4WKH A;  2WLZ A;  4NZC A;  1FKG A;  3BXW A;  2YBU A;  1TFV A;  2DT2 A;  3CGM A;  2L2S A;  1WAW A;  2DSV A;  4W9Q A;  2PPO A;  3H9R B;  2O9O A;  1NMW A;  2ZR6 A;  3TC5 A;  3ARQ A;  1KT1 A;  1GRJ A;  3GTY X;  4JFL A;  2WLY A;  1A7X A;  3PRD A;  5DF0 A;  1W1V A;  1PIN A;  1XRV A;  2KI3 A;  4XAK A;  3AS1 A;  3NTP A;  4DT4 A;  2JZV A;  3I6C A;  4J4N A;  4JFI A;  2G8Z A;  3LUO A;  1ZBV A;  2AWG A;  1X6L A;  2XP8 A;  1JCH B;  1LG1 A;  4W9P A;  2XP3 A;  1E6P A;  2PBC A;  1GOI A;  2ZR5 A;  3KAD A;  1CTN A;  3NRK A;  4L3N A;  4ZPT R;  2DG3 A;  5B8I C;  4WK9 A;  1PBK A;  4ZPW R;  3RM4 A;  2Q5A A;  3UQB A;  4BF8 A;  1IX5 A;  2ZQS A;  1HKJ A;  1HJV A;  2RUC A;  2XPB A;  4DRJ A;  4KR0 B;  1J4R A;  5DIT A;  5BXJ A;  2XP6 A;  1W9U A;  4DWS C;  3RFW A;  4MGV A;  2A3B A;  3WD2 A;  4G2P A;  4QT2 A;  3UI5 A;  3WQV A;  5HKG A;  1FKI A;  3O5L A;  2MLX A;  1SR0 A;  2XP5 A;  3RME A;  1QZ2 A;  4DIP A;  1J4H A;  1J4I A;  4TX0 A;  4ODP A;  2MLZ A;  2ZR4 A;  5HW6 A;  3IKD A;  2DT3 A;  2PV1 A;  3OOB A;  1FKK A;  4O2T A;  1FKH A;  1ZCN A;  1TCO C;  5HUA A;  2N87 A;  4U86 A;  2A3C A;  2PPP A;  4AY1 A;  4LAV A;  2DG4 A;  2KGJ A;  3KAB A;  3TCZ A;  5HTG A;  4Z2L A;  3O5F A;  5GPR A;  3CHC A;  1W1T A;  1HKM A;  3JYM A;  2WM0 A;  1LQ0 A;  4MNM A;  4DRO A;  3B9E A;  3PR9 A;  1SYT A;  1XHG A;  4JFJ A;  3KAG A;  1O6I A;  1FKR A;  4ODN A;  3WD0 A;  2IUZ A;  4DZ3 A;  3O5G A;  1WNO A;  3G6L A;  3B9D A;  2F23 A;  3RM9 A;  1ZB5 A;  5GPG A;  1LG2 A;  1FKF A;  3O5J A;  2RSE A;  3ARV A;  4JYS A;  5JH8 A;  1R9H A;  2VN1 A;  2OFN A;  4TYO A;  3WKZ A;  2LPV A;  2LJ4 A;  3B7X A;  4DWS B;  4IQ2 A;  4Q22 A;  2B31 A;  3GU0 A;  3IHZ A;  3PRB A;  4ZS6 A;  3OA5 A;  4ML4 A;  4WJX A;  1D6O A;  1FKB A;  4FN2 A;  1FKS A;  4P8V A;  2B5U B;  2XPA A;  2ZQT A;  1JNE A;  1D2K A;  3FY1 A;  4PTM A;  4LGX A;  2F2D A;  1JNS A;  4J4O A;  1ZK6 A;  3O5K A;  3PRA A;  3ARW A;  4U85 A;  2DT0 A;  1E6N A;  4TW8 A;  3NI6 A;  1FAP A;  1OGB A;  1N1A A;  3O5Q A;  2KE0 A;  1X6N A;  3ARO A;  2PPN A;  3TDB A;  4IT4 A;  3KAF A;  2ETN A;  3ALG A;  3ARP A;  3WD4 A;  1HXV A;  4URI A;  1JVW A;  2DG9 A;  2WK2 A;  4ODL A;  4MTV A;  1FD9 A;  3O5D A;  2FDM A;  3ART A;  1ZBW A; 
#chains in the Genus database with same CATH homology
 4LAW A;  2O92 A;  3UQA A;  3ARU A;  1ZBK A;  4MNJ A;  2XP9 A;  2M1I A;  5HW7 A;  1W9P A;  2G41 A;  4MPK A;  2KO7 A;  4LAY A;  3VAW A;  2LKN A;  4TW7 A;  1B6C A;  3ARS A;  3MDY B;  2MNT A;  1Q1C A;  4DRK A;  4G50 A;  4ODK A;  1ITX A;  4WKF A;  1E15 A;  3O5I A;  4C02 B;  3ARY A;  3KAI A;  2IF4 A;  2MF9 A;  3W4R A;  2DT1 A;  4ZPV R;  4IQC A;  3G6M A;  3UI6 A;  1FFQ A;  3CH9 A;  4DRP A;  5DIU A;  1W1P A;  3UI4 A;  5DO2 A;  4ODM A;  5GQB A;  1FKJ A;  3IK8 A;  2A3E A;  2M2A A;  4ODQ A;  3ARR A;  4IT6 A;  1VF8 A;  1LL7 A;  1NH6 A;  3AS3 A;  1Q6H A;  4HBE A;  4P8X A;  1F8A B;  3KAC A;  4DRI A;  1ROT A;  1T11 A;  2KFW A;  2RUD A;  3RM8 A;  1U79 A;  5HWB A;  4DZ2 A;  2ZQU A;  3AS0 A;  3O5R A;  4MNK A;  4N19 A;  3ARX A;  4Z2I A;  4Z2J A;  3JYJ A;  1E6Z A;  3WQW A;  5DIV A;  1NWR A;  4HBO A;  1ROU A;  4W5U A;  2MPH A;  2LGO A;  4TNS A;  5DEZ A;  1YAT A;  1NWT A;  4DH0 A;  1LJY A;  2D9F A;  4P8W A;  4KQZ A;  3UQI A;  2K8I A;  1ZU8 A;  3GPK A;  4Z2G A;  2A3A A;  1M5Y A;  2PV2 A;  2XP4 A;  3CZ8 A;  3PA7 A;  1H0I A;  1YW5 A;  3O5M A;  4MNL A;  1D7J A;  1W26 A;  1Q6I A;  1NMV A;  1FKT A;  1LL6 A;  2DPE A;  1D7H A;  4QIB A;  1NSG A;  3FXY A;  3WD1 A;  4Z2H A;  3B8S A;  5D75 A;  1EHN A;  4DRN A;  2FKE A;  1Y0O A;  4HAR A;  2PI6 A;  2F21 A;  4L72 B;  3EY6 A;  1EIB A;  1W1Y A;  4NNR A;  2DSU A;  4DWS A;  1L1P A;  1FJD A;  2QF8 A;  1ZL1 A;  4DWS D;  4Q7N A;  4Z2K A;  1FKD A;  3WD3 A;  3KAH A;  4GGQ A;  4P8U A;  2DSW A;  3ODK A;  1HKK A;  4MSP A;  2Y78 A;  1D7I A;  1BKF A;  3ALF A;  3B9A A;  3KZ7 A;  2ZQV A;  4WIW A;  2AOS A;  2OLH A;  1C9H A;  1F40 A;  1BL4 A;  3ARZ A;  4DRH A;  3JXV A;  5HWC A;  3O5O A;  2M08 A;  4ODR A;  3WL1 A;  3FAP A;  2ITK A;  1E9L A;  4NSB A;  4DRQ A;  1KFW A;  1EDQ A;  1FFR A;  1UR9 A;  4GIV A;  3WIJ A;  5HBF A;  1NWS A;  1OGG A;  2UZ5 A;  1OWQ A;  4W9O A;  4S3K A;  3CHD A;  1GUV A;  2DSZ A;  4R0X A;  3IKG A;  4S3J A;  4TW6 A;  1H0G A;  4ITZ A;  3QOK A;  2ESC A;  3AS2 A;  3O5P A;  4WKA A;  1UR8 A;  4QT3 A;  2KR7 A;  4R5E A;  5HT1 A;  4QZV B;  2YBT A;  1FKL A;  3CHF A;  4IPX A;  1W9V A;  4JFM A;  1JND A;  2RUR A;  3CHE A;  3O5E A;  4U84 A;  1ZBC A;  3RGC A;  3AQU A;  3WH0 A;  3KCE A;  1HKI A;  1JNT A;  2FAP A;  4MAV A;  1KT0 A;  2F4E A;  2VCD A;  1NWU A;  5J6E A;  1EQ3 A;  5HW8 A;  1HJX A;  1J6Y A;  4JFK A;  4ODO A;  1P5Q A;  2RUQ A;  1LL4 A;  1Q6U A;  2PV3 A;  3WL0 A;  3UF8 A;  1GPF A;  1QPF A;  1E6R A;  1K9T A;  1WB0 A;  4DRM A;  5I98 A;  1QPL A;  1RD6 A;  2RQS A;  1EYM A;  4FAP A;  2XP7 A;  3CGN A;  2MLY A;  4LAX A;  1HJW A;  4WKH A;  2WLZ A;  4NZC A;  1FKG A;  3BXW A;  2YBU A;  1TFV A;  2DT2 A;  3CGM A;  2L2S A;  1WAW A;  2DSV A;  4W9Q A;  2PPO A;  3H9R B;  2O9O A;  1NMW A;  2ZR6 A;  3TC5 A;  3ARQ A;  1KT1 A;  4JFL A;  2WLY A;  1A7X A;  3PRD A;  5DF0 A;  1W1V A;  1PIN A;  1XRV A;  2KI3 A;  4XAK A;  3AS1 A;  3NTP A;  4DT4 A;  2JZV A;  3I6C A;  4J4N A;  4JFI A;  2G8Z A;  3LUO A;  1ZBV A;  2AWG A;  1X6L A;  2XP8 A;  1LG1 A;  4W9P A;  2XP3 A;  1E6P A;  2PBC A;  1GOI A;  2ZR5 A;  3KAD A;  1CTN A;  3NRK A;  4L3N A;  4ZPT R;  2DG3 A;  5B8I C;  4WK9 A;  1PBK A;  4ZPW R;  3RM4 A;  2Q5A A;  3UQB A;  4BF8 A;  1IX5 A;  2ZQS A;  1HKJ A;  1HJV A;  2RUC A;  2XPB A;  4DRJ A;  4KR0 B;  1J4R A;  5DIT A;  5BXJ A;  2XP6 A;  1W9U A;  4DWS C;  3RFW A;  4MGV A;  2A3B A;  3WD2 A;  4G2P A;  4QT2 A;  3UI5 A;  3WQV A;  5HKG A;  1FKI A;  3O5L A;  2MLX A;  1SR0 A;  2XP5 A;  3RME A;  1QZ2 A;  4DIP A;  1J4H A;  1J4I A;  4TX0 A;  4ODP A;  2MLZ A;  2ZR4 A;  5HW6 A;  3IKD A;  2DT3 A;  2PV1 A;  3OOB A;  1FKK A;  4O2T A;  1FKH A;  1ZCN A;  1TCO C;  5HUA A;  2N87 A;  4U86 A;  2A3C A;  2PPP A;  4AY1 A;  4LAV A;  2DG4 A;  2KGJ A;  3KAB A;  3TCZ A;  5HTG A;  4Z2L A;  3O5F A;  5GPR A;  3CHC A;  1W1T A;  1HKM A;  3JYM A;  2WM0 A;  1LQ0 A;  4MNM A;  4DRO A;  3B9E A;  3PR9 A;  1SYT A;  1XHG A;  4JFJ A;  3KAG A;  1O6I A;  1FKR A;  4ODN A;  3WD0 A;  2IUZ A;  4DZ3 A;  3O5G A;  1WNO A;  3G6L A;  3B9D A;  3RM9 A;  1ZB5 A;  5GPG A;  1LG2 A;  1FKF A;  3O5J A;  2RSE A;  3ARV A;  4JYS A;  5JH8 A;  1R9H A;  2VN1 A;  2OFN A;  4TYO A;  3WKZ A;  2LPV A;  2LJ4 A;  3B7X A;  4DWS B;  4IQ2 A;  4Q22 A;  2B31 A;  3PRB A;  3IHZ A;  4ZS6 A;  3OA5 A;  4ML4 A;  4WJX A;  1D6O A;  1FKB A;  4FN2 A;  1FKS A;  4P8V A;  2XPA A;  2ZQT A;  1JNE A;  1D2K A;  3FY1 A;  4PTM A;  4LGX A;  2F2D A;  1JNS A;  4J4O A;  1ZK6 A;  3O5K A;  3PRA A;  3ARW A;  4U85 A;  2DT0 A;  1E6N A;  4TW8 A;  3NI6 A;  1FAP A;  1OGB A;  1N1A A;  3O5Q A;  2KE0 A;  1X6N A;  3ARO A;  2PPN A;  3TDB A;  4IT4 A;  3KAF A;  3ALG A;  3ARP A;  3WD4 A;  1HXV A;  4URI A;  1JVW A;  2DG9 A;  2WK2 A;  4ODL A;  4MTV A;  1FD9 A;  3O5D A;  2FDM A;  3ART A;  1ZBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...