4TX0A

The fk1 domain of fkbp51 in complex with (1s,5s,6r)-10-[(3,5-dichlorophenyl)sulfonyl]-5-(2-methoxyethoxy)-3-(2-methoxyethyl)-3,10-diazabicyclo[4.3.1]decan-2-one
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Stereoselective Construction of the 5-Hydroxy Diazabicyclo[4.3.1]decane-2-one Scaffold, a Privileged Motif for FK506-Binding Proteins.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4tx0A00
5GPGA 1PINA 4U86A 1FKIA 4JYSA 2DG9A 3FAPA 1J6YA 4W9PA 3UQIA 2MNTA 2Y78A 1NMVA 2RUQA 1KT0A 3KAFA 3PA7A 3O5KA 1D7IA 4G2PA 4QT3A 1JNSA 3OOBA 2M1IA 2VN1A 3O5GA 4LAXA 3PRDA 3JXVA 4N19A 4NNRA 3UQBA 3B7XA 4JFLA 2K8IA 1J4IA 2MLXA 3IKDA 3EY6A 4JFMA 4ODMA 4C02B 1TCOC 1BKFA 3TC5A 2MLYA 4FAPA 4W9OA 2F4EA 1F8AB 3ODKA 5HTGA 1FKKA 4DRNA 2ZQSA 3MDYB 4JFJA 2FKEA 4DRIA 2XP7A 1L1PA 1R9HA 2LGOA 2ZQUA 1ZK6A 3CGMA 1Q1CA 5DIUA 1FJDA 1Q6IA 2KGJA 4R0XA 1D7JA 4DRQA 1HXVA 4LAWA 2PV2A 5HWBA 3O5QA 4DZ3A 2MLZA 5DIVA 5DITA 1FKRA 1P5QA 1JNTA 4ODPA 5D75A 2XP3A 1FKSA 3H9RB 4BF8A 4MGVA 5I98A 1BL4A 1J4HA 2LJ4A 2KI3A 3UF8A 1PBKA 2RURA 4J4NA 4ODNA 4U85A 2RQSA 4JFIA 5HUAA 2LPVA 3UQAA 2RUCA 2XPBA 4DH0A 3O5JA 2PPNA 3UI5A 3KACA 3KABA 2M2AA 4DT4A 2DG4A 2ZR4A 3WH0A 1D7HA 1N1AA 2XP6A 4LAVA 1EQ3A 4TW7A 2VCDA 1NSGA 2XP9A 3O5IA 4QT2A 3TDBA 3O5RA 1U79A 3TCZA 4DRJA 5J6EA 1YATA 4TW8A 3RFWA 2KR7A 1B6CA 3KADA 4MSPA 4GIVA 2KFWA 1Q6HA 4W9QA 2PV3A 1J4RA 5B8IC 3LUOA 1ROUA 2XP8A 3NI6A 4ODRA 1NMWA 1ZCNA 3O5EA 1JVWA 3O5PA 4ODLA 2RSEA 2LKNA 3VAWA 4DROA 3O5FA 1T11A 2PPPA 4DZ2A 1C9HA 1EYMA 1YW5A 2KO7A 2ZR6A 3KCEA 4DRKA 2KE0A 4TYOA 1D6OA 3O5OA 4G50A 4ITZA 4TW6A 4ODKA 2L2SA 1FKGA 1FKFA 4DRPA 2RUDA 3O5LA 3IHZA 1FKHA 3UI6A 2PBCA 5BXJA 2DG3A 2ZR5A 3O5DA 2F2DA 4DRHA 1F40A 3IK8A 4FN2A 1FAPA 2ZQVA 1FKLA 2M08A 5HW7A 5HT1A 1QPFA 2PV1A 5HW6A 4U84A 3IKGA 4GGQA 2XP5A 1FKTA 4DIPA 1FKBA 1FKDA 1KT1A 2ZQTA 1QPLA 2ITKA 3KZ7A 4IQCA 1FD9A 1A7XA 2MPHA 3RGCA 2IF4A 2OFNA 2Q5AA 2MF9A 5HWCA 4O2TA 1ROTA 5HKGA 3JYMA 1FKJA 1M5YA 2FAPA 4DRMA 3GPKA 4ODOA 1W26A 3NTPA 1Q6UA 2XP4A 4TX0A 3JYJA 2D9FA 1QZ2A 3KAHA 4JFKA 4TNSA 2JZVA 2PPOA 4IQ2A 2F21A 4IPXA 3PRBA 4ODQA 3UI4A 3KAIA 3I6CA 2N87A 2AWGA 3O5MA 3KAGA 3NRKA 4J4OA 2UZ5A 4LAYA 1Y0OA 5HW8A 2XPAA 3CGNA 4QIBA
chains in the Genus database with same CATH superfamily
1PINA 2AOSA 4WJXA 4DRPA 2RUQA 1GRJA 4G2PA 2DSZA 3O5GA 3UQBA 3JXVA 3B7XA 2K8IA 1J4IA 4C02B 3EY6A 1FFQA 3ALGA 1ZL1A 5GPRA 4FAPA 1F8AB 3AROA 3B9EA 2FKEA 2XP7A 2LGOA 5DIUA 1ZK6A 1FJDA 3RM9A 5DITA 4Q7NA 5D75A 1O6IA 1W1VA 4MGVA 1WB0A 2LJ4A 4J4NA 2EULA 3WIJA 1OWQA 1NH6A 2B5UB 5GQBA 2G41A 2YBUA 3KACA 2ZR4A 4Z2KA 1XHGA 3ARSA 3CHDA 4TW7A 1ZBCA 2XP9A 4HARA 4DRJA 1YATA 1E6PA 4DWSB 3ARQA 3LUOA 1ROUA 2XP8A 1WAWA 3PR9A 1ZCNA 4ZPWR 3O5PA 2RSEA 2LKNA 1C9HA 1EYMA 2KE0A 4ML4A 4NZCA 3ARXA 1FKFA 1CTNA 5HBFA 3UI6A 4HBEA 5BXJA 3O5DA 3WL1A 3IK8A 2WK2A 2ZQVA 5HW7A 1LG2A 1HKKA 1JCHB 1FKBA 1KT1A 2ZQTA 2ITKA 3KZ7A 1E15A 2WLYA 1FFRA 4ZPVR 5HKGA 1FKJA 1WNOA 3JYJA 1X6LA 4TNSA 2F21A 1ZB5A 2WLZA 2N87A 1LG1A 3NRKA 2UZ5A 1Y0OA 2XPAA 4KR0B 4U86A 1FKIA 3FAPA 4Z2HA 1J6YA 2FDMA 1NMVA 1KT0A 4QT3A 3O5KA 4L72B 3OOBA 3G6MA 1X6NA 4JFLA 2MLXA 2DT3A 4ODMA 1TCOC 4DRNA 2ZQSA 4JFJA 3WD2A 3WQWA 1R9HA 1GOIA 3CGMA 1EHNA 3RM4A 3ARYA 1OGGA 1D7JA 4LAWA 4DZ3A 1FKRA 1JNTA 4KQZA 2XP3A 1HKIA 3WD3A 1JNEA 4Q22A 1HKMA 1SYTA 4U85A 1LL4A 2A3AA 1NWUA 3WH0A 4MPKA 1LQ0A 1N1AA 4ZPTR 1EQ3A 1ZBVA 2VCDA 4MAVA 1OGBA 3TCZA 3WL0A 1B6CA 5JH8A 2KFWA 1Q6HA 5B8IC 3NI6A 4ODRA 1NMWA 4DROA 4WK9A 4QZVB 2ZR6A 3KCEA 1D6OA 1GUVA 4G50A 4ITZA 4TW6A 4ODKA 1FKGA 2RUDA 1FKHA 2PBCA 3AS2A 2ZR5A 1F40A 4S3JA 4ZS6A 2M08A 2P4VA 5HT1A 4S3KA 1QPFA 5HW6A 3IKGA 4MNMA 4DIPA 1FKDA 4MNKA 3B8SA 1FD9A 3AS1A 2ETNA 3RGCA 2IF4A 2Q5AA 4O2TA 1ROTA 4Z2GA 3JYMA 2O9OA 1M5YA 3ARVA 1Q6UA 2D9FA 3KAHA 3UI4A 3WKZA 3CHCA 2DSVA 3I6CA 3KAGA 4XAKA 5DO2A 3CGNA 4QIBA 1ZBWA 2DG9A 1VF8A 4WIWA 3UQIA 2DT2A 1LJYA 3KAFA 3PA7A 1D7IA 1NWSA 2M1IA 4LAXA 4JFMA 4IT4A 1BKFA 1W1PA 2MLYA 4W9OA 5HTGA 1FKKA 1NWTA 4R5EA 4L3NA 3ARUA 4WKFA 1Q6IA 4R0XA 1ZBKA 2IUZA 5DIVA 1UR8A 4ODPA 4NSBA 1FKSA 2PI6A 3RMEA 3ARRA 5I98A 3FY1A 1BL4A 4WKAA 3UF8A 1PBKA 4ODNA 2RQSA 3PRAA 3BMBA 3UQAA 2RUCA 3O5JA 2PPNA 3UI5A 1IX5A 3KABA 4DT4A 2DG4A 1EIBA 5DF0A 1E44A 1E9LA 2XP6A 4LAVA 4DWSA 4Z2IA 3CZ8A 3GU0A 4MTVA 2KR7A 4UDMA 3KADA 1E6RA 4MSPA 1K9TA 3WD4A 4GIVA 2PV3A 1J4RA 3VAWA 3AS3A 1JVWA 5DEZA 1T11A 2PPPA 2KO7A 1YW5A 4DRKA 4PTMA 4TYOA 3O5OA 3CHEA 3ALFA 3AS0A 1TFVA 2A3BA 2DG3A 1HJXA 2F2DA 4URIA 4Z2JA 4FN2A 1JNDA 1W1TA 2DSUA 4GGQA 2XP5A 1LL7A 1NWRA 3OA5A 1GPFA 1QPLA 4P8VA 2MF9A 1ITXA 2QF8A 2DPEA 4ODOA 1W26A 3NTPA 3GTYX 4JFKA 2JZVA 2PPOA 4IQ2A 2OLHA 3PRBA 1RD6A 2AWGA 4MNLA 1XRVA 4LAYA 2ESCA 1LL6A 1W1YA 5GPGA 4JYSA 4P8WA 2B31A 1W9VA 4W9PA 2MNTA 1E6ZA 2Y78A 4Z2LA 4IT6A 1JNSA 1HJVA 3CH9A 1H0GA 2G8ZA 1HJWA 2VN1A 4N19A 3W4RA 4NNRA 3IKDA 2DSWA 3CHFA 3TC5A 2F4EA 1H0IA 3ODKA 3QOKA 3MDYB 1L1PA 3FXYA 4DRIA 2ZQUA 1Q1CA 2KGJA 4DRQA 2DT0A 1HXVA 1KFWA 2PV2A 5HWBA 3O5QA 2MLZA 1HKJA 1P5QA 2F23A 3H9RB 4BF8A 1J4HA 2PN0A 2KI3A 2RURA 4DWSC 1SR0A 4JFIA 5HUAA 2LPVA 3G6LA 2XPBA 4DH0A 1D2KA 2M2AA 1D7HA 1NSGA 3ARPA 3O5IA 4AY1A 4QT2A 3TDBA 3O5RA 1U79A 5J6EA 4TW8A 3RFWA 3EIPA 3ARZA 4W9QA 2YBTA 3O5EA 4ODLA 3WQVA 4DZ2A 3O5FA 2DT1A 3ARTA 1W9UA 4P8XA 4LGXA 2L2SA 4HBOA 4DWSD 1W9PA 3O5LA 3IHZA 3BXWA 4DRHA 1FAPA 3WD0A 1FKLA 3B9DA 2PV1A 4W5UA 4U84A 1E6NA 1FKTA 3B9AA 1EDQA 4IQCA 1A7XA 2MPHA 3ARWA 2OFNA 1ZU8A 5HWCA 4MNJA 2A3EA 3AQUA 4DRMA 2FAPA 3RM8A 3GPKA 2XP4A 4TX0A 4WKHA 1QZ2A 4IPXA 4ODQA 2A3CA 2WM0A 1UR9A 3KAIA 2O92A 4P8UA 3O5MA 4J4OA 3WD1A 5HW8A 3PRDA
chains in the Genus database with same CATH topology
1PINA 2AOSA 4WJXA 4DRPA 2RUQA 4G2PA 2DSZA 3O5GA 3UQBA 3JXVA 3B7XA 2K8IA 1J4IA 4C02B 3EY6A 1FFQA 3ALGA 1ZL1A 5GPRA 4FAPA 1F8AB 3AROA 3B9EA 2FKEA 2XP7A 2LGOA 5DIUA 1ZK6A 1FJDA 3RM9A 5DITA 4Q7NA 5D75A 1O6IA 1W1VA 4MGVA 1WB0A 2LJ4A 4J4NA 3WIJA 1OWQA 1NH6A 5GQBA 2G41A 2YBUA 3KACA 2ZR4A 4Z2KA 1XHGA 3ARSA 3CHDA 4TW7A 1ZBCA 2XP9A 4HARA 4DRJA 1YATA 1E6PA 4DWSB 3ARQA 3LUOA 1ROUA 2XP8A 1WAWA 3PR9A 1ZCNA 4ZPWR 3O5PA 2RSEA 2LKNA 1C9HA 1EYMA 2KE0A 4ML4A 4NZCA 3ARXA 1FKFA 1CTNA 5HBFA 3UI6A 4HBEA 5BXJA 3O5DA 3WL1A 3IK8A 2WK2A 2ZQVA 5HW7A 1LG2A 1HKKA 1FKBA 1KT1A 2ZQTA 2ITKA 3KZ7A 1E15A 2WLYA 1FFRA 4ZPVR 5HKGA 1FKJA 1WNOA 3JYJA 1X6LA 4TNSA 2F21A 1ZB5A 2WLZA 2N87A 1LG1A 3NRKA 2UZ5A 1Y0OA 2XPAA 4KR0B 4U86A 1FKIA 3FAPA 4Z2HA 1J6YA 2FDMA 1NMVA 1KT0A 4QT3A 3O5KA 4L72B 3OOBA 3G6MA 1X6NA 4JFLA 2MLXA 2DT3A 4ODMA 1TCOC 4DRNA 2ZQSA 4JFJA 3WD2A 3WQWA 1R9HA 1GOIA 3CGMA 1EHNA 3RM4A 3ARYA 1OGGA 1D7JA 4LAWA 4DZ3A 1FKRA 1JNTA 4KQZA 2XP3A 1HKIA 3WD3A 1JNEA 4Q22A 1HKMA 1SYTA 4U85A 1LL4A 2A3AA 1NWUA 3WH0A 4MPKA 1LQ0A 1N1AA 4ZPTR 1EQ3A 1ZBVA 2VCDA 4MAVA 1OGBA 3TCZA 3WL0A 1B6CA 5JH8A 2KFWA 1Q6HA 5B8IC 3NI6A 4ODRA 1NMWA 4DROA 4WK9A 4QZVB 2ZR6A 3KCEA 1D6OA 1GUVA 4G50A 4ITZA 4TW6A 4ODKA 1FKGA 2RUDA 1FKHA 2PBCA 3AS2A 2ZR5A 1F40A 4S3JA 4ZS6A 2M08A 5HT1A 4S3KA 1QPFA 5HW6A 3IKGA 4MNMA 4DIPA 1FKDA 4MNKA 3B8SA 1FD9A 3AS1A 3RGCA 2IF4A 2Q5AA 4O2TA 1ROTA 4Z2GA 3JYMA 2O9OA 1M5YA 3ARVA 1Q6UA 2D9FA 3KAHA 3UI4A 3WKZA 3CHCA 2DSVA 3I6CA 3KAGA 4XAKA 5DO2A 3CGNA 4QIBA 1ZBWA 2DG9A 1VF8A 4WIWA 3UQIA 2DT2A 1LJYA 3KAFA 3PA7A 1D7IA 1NWSA 2M1IA 4LAXA 4JFMA 4IT4A 1BKFA 1W1PA 2MLYA 4W9OA 5HTGA 1FKKA 1NWTA 4R5EA 4L3NA 3ARUA 4WKFA 1Q6IA 4R0XA 1ZBKA 2IUZA 5DIVA 1UR8A 4ODPA 4NSBA 1FKSA 2PI6A 3RMEA 3ARRA 5I98A 3FY1A 1BL4A 4WKAA 3UF8A 1PBKA 4ODNA 2RQSA 3PRAA 3UQAA 2RUCA 3O5JA 2PPNA 3UI5A 1IX5A 3KABA 4DT4A 2DG4A 1EIBA 5DF0A 1E9LA 2XP6A 4LAVA 4DWSA 4Z2IA 3CZ8A 4MTVA 2KR7A 3KADA 1E6RA 4MSPA 1K9TA 3WD4A 4GIVA 2PV3A 1J4RA 3VAWA 3AS3A 1JVWA 5DEZA 1T11A 2PPPA 2KO7A 1YW5A 4DRKA 4PTMA 4TYOA 3O5OA 3CHEA 3ALFA 3AS0A 1TFVA 2A3BA 2DG3A 1HJXA 2F2DA 4URIA 4Z2JA 4FN2A 1JNDA 1W1TA 2DSUA 4GGQA 2XP5A 1LL7A 1NWRA 3OA5A 1GPFA 1QPLA 4P8VA 2MF9A 1ITXA 2QF8A 2DPEA 4ODOA 1W26A 3NTPA 4JFKA 2JZVA 2PPOA 4IQ2A 2OLHA 3PRBA 1RD6A 2AWGA 4MNLA 1XRVA 4LAYA 2ESCA 1LL6A 1W1YA 5GPGA 4JYSA 4P8WA 2B31A 1W9VA 4W9PA 2MNTA 1E6ZA 2Y78A 4Z2LA 4IT6A 1JNSA 1HJVA 3CH9A 1H0GA 2G8ZA 1HJWA 2VN1A 4N19A 3W4RA 4NNRA 3IKDA 2DSWA 3CHFA 3TC5A 2F4EA 1H0IA 3ODKA 3QOKA 3MDYB 1L1PA 3FXYA 4DRIA 2ZQUA 1Q1CA 2KGJA 4DRQA 2DT0A 1HXVA 1KFWA 2PV2A 5HWBA 3O5QA 2MLZA 1HKJA 1P5QA 3H9RB 4BF8A 1J4HA 2KI3A 2RURA 4DWSC 1SR0A 4JFIA 5HUAA 2LPVA 3G6LA 2XPBA 4DH0A 1D2KA 2M2AA 1D7HA 1NSGA 3ARPA 3O5IA 4AY1A 4QT2A 3TDBA 3O5RA 1U79A 5J6EA 4TW8A 3RFWA 3ARZA 4W9QA 2YBTA 3O5EA 4ODLA 3WQVA 4DZ2A 3O5FA 2DT1A 3ARTA 1W9UA 4P8XA 4LGXA 2L2SA 4HBOA 4DWSD 1W9PA 3O5LA 3IHZA 3BXWA 4DRHA 1FAPA 3WD0A 1FKLA 3B9DA 2PV1A 4W5UA 4U84A 1E6NA 1FKTA 3B9AA 1EDQA 4IQCA 1A7XA 2MPHA 3ARWA 2OFNA 1ZU8A 5HWCA 4MNJA 2A3EA 3AQUA 4DRMA 2FAPA 3RM8A 3GPKA 2XP4A 4TX0A 4WKHA 1QZ2A 4IPXA 4ODQA 2A3CA 2WM0A 1UR9A 3KAIA 2O92A 4P8UA 3O5MA 4J4OA 3WD1A 5HW8A 3PRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GPG A;  1PIN A;  4U86 A;  1FKI A;  4JYS A;  2DG9 A;  3FAP A;  1J6Y A;  4W9P A;  3UQI A;  2MNT A;  2Y78 A;  1NMV A;  2RUQ A;  1KT0 A;  3KAF A;  3PA7 A;  3O5K A;  1D7I A;  4G2P A;  4QT3 A;  1JNS A;  3OOB A;  2M1I A;  2VN1 A;  3O5G A;  4LAX A;  3PRD A;  3JXV A;  4N19 A;  4NNR A;  3UQB A;  3B7X A;  4JFL A;  2K8I A;  1J4I A;  2MLX A;  3IKD A;  3EY6 A;  4JFM A;  4ODM A;  4C02 B;  1TCO C;  1BKF A;  3TC5 A;  2MLY A;  4FAP A;  4W9O A;  2F4E A;  1F8A B;  3ODK A;  5HTG A;  1FKK A;  4DRN A;  2ZQS A;  3MDY B;  4JFJ A;  2FKE A;  4DRI A;  2XP7 A;  1L1P A;  1R9H A;  2LGO A;  2ZQU A;  1ZK6 A;  3CGM A;  1Q1C A;  5DIU A;  1FJD A;  1Q6I A;  2KGJ A;  4R0X A;  1D7J A;  4DRQ A;  1HXV A;  4LAW A;  2PV2 A;  5HWB A;  3O5Q A;  4DZ3 A;  2MLZ A;  5DIV A;  5DIT A;  1FKR A;  1P5Q A;  1JNT A;  4ODP A;  5D75 A;  2XP3 A;  1FKS A;  3H9R B;  4BF8 A;  4MGV A;  5I98 A;  1BL4 A;  1J4H A;  2LJ4 A;  2KI3 A;  3UF8 A;  1PBK A;  2RUR A;  4J4N A;  4ODN A;  4U85 A;  2RQS A;  4JFI A;  5HUA A;  2LPV A;  3UQA A;  2RUC A;  2XPB A;  4DH0 A;  3O5J A;  2PPN A;  3UI5 A;  3KAC A;  3KAB A;  2M2A A;  4DT4 A;  2DG4 A;  2ZR4 A;  3WH0 A;  1D7H A;  1N1A A;  2XP6 A;  4LAV A;  1EQ3 A;  4TW7 A;  2VCD A;  1NSG A;  2XP9 A;  3O5I A;  4QT2 A;  3TDB A;  3O5R A;  1U79 A;  3TCZ A;  4DRJ A;  5J6E A;  1YAT A;  4TW8 A;  3RFW A;  2KR7 A;  1B6C A;  3KAD A;  4MSP A;  4GIV A;  2KFW A;  1Q6H A;  4W9Q A;  2PV3 A;  1J4R A;  5B8I C;  3LUO A;  1ROU A;  2XP8 A;  3NI6 A;  4ODR A;  1NMW A;  1ZCN A;  3O5E A;  1JVW A;  3O5P A;  4ODL A;  2RSE A;  2LKN A;  3VAW A;  4DRO A;  3O5F A;  1T11 A;  2PPP A;  4DZ2 A;  1C9H A;  1EYM A;  1YW5 A;  2KO7 A;  2ZR6 A;  3KCE A;  4DRK A;  2KE0 A;  4TYO A;  1D6O A;  3O5O A;  4G50 A;  4ITZ A;  4TW6 A;  4ODK A;  2L2S A;  1FKG A;  1FKF A;  4DRP A;  2RUD A;  3O5L A;  3IHZ A;  1FKH A;  3UI6 A;  2PBC A;  5BXJ A;  2DG3 A;  2ZR5 A;  3O5D A;  2F2D A;  4DRH A;  1F40 A;  3IK8 A;  4FN2 A;  1FAP A;  2ZQV A;  1FKL A;  2M08 A;  5HW7 A;  5HT1 A;  1QPF A;  2PV1 A;  5HW6 A;  4U84 A;  3IKG A;  4GGQ A;  2XP5 A;  1FKT A;  4DIP A;  1FKB A;  1FKD A;  1KT1 A;  2ZQT A;  1QPL A;  2ITK A;  3KZ7 A;  4IQC A;  1FD9 A;  1A7X A;  2MPH A;  3RGC A;  2IF4 A;  2OFN A;  2Q5A A;  2MF9 A;  5HWC A;  4O2T A;  1ROT A;  5HKG A;  3JYM A;  1FKJ A;  1M5Y A;  2FAP A;  4DRM A;  3GPK A;  4ODO A;  1W26 A;  3NTP A;  1Q6U A;  2XP4 A;  4TX0 A;  3JYJ A;  2D9F A;  1QZ2 A;  3KAH A;  4JFK A;  4TNS A;  2JZV A;  2PPO A;  4IQ2 A;  2F21 A;  4IPX A;  3PRB A;  4ODQ A;  3UI4 A;  3KAI A;  3I6C A;  2N87 A;  2AWG A;  3O5M A;  3KAG A;  3NRK A;  4J4O A;  2UZ5 A;  4LAY A;  1Y0O A;  5HW8 A;  2XPA A;  3CGN A;  4QIB A; 
#chains in the Genus database with same CATH topology
 1PIN A;  2AOS A;  4WJX A;  4DRP A;  2RUQ A;  1GRJ A;  4G2P A;  2DSZ A;  3O5G A;  3UQB A;  3JXV A;  3B7X A;  2K8I A;  1J4I A;  4C02 B;  3EY6 A;  1FFQ A;  3ALG A;  1ZL1 A;  5GPR A;  4FAP A;  1F8A B;  3ARO A;  3B9E A;  2FKE A;  2XP7 A;  2LGO A;  5DIU A;  1ZK6 A;  1FJD A;  3RM9 A;  5DIT A;  4Q7N A;  5D75 A;  1O6I A;  1W1V A;  4MGV A;  1WB0 A;  2LJ4 A;  4J4N A;  2EUL A;  3WIJ A;  1OWQ A;  1NH6 A;  2B5U B;  5GQB A;  2G41 A;  2YBU A;  3KAC A;  2ZR4 A;  4Z2K A;  1XHG A;  3ARS A;  3CHD A;  4TW7 A;  1ZBC A;  2XP9 A;  4HAR A;  4DRJ A;  1YAT A;  1E6P A;  4DWS B;  3ARQ A;  3LUO A;  1ROU A;  2XP8 A;  1WAW A;  3PR9 A;  1ZCN A;  4ZPW R;  3O5P A;  2RSE A;  2LKN A;  1C9H A;  1EYM A;  2KE0 A;  4ML4 A;  4NZC A;  3ARX A;  1FKF A;  1CTN A;  5HBF A;  3UI6 A;  4HBE A;  5BXJ A;  3O5D A;  3WL1 A;  3IK8 A;  2WK2 A;  2ZQV A;  5HW7 A;  1LG2 A;  1HKK A;  1JCH B;  1FKB A;  1KT1 A;  2ZQT A;  2ITK A;  3KZ7 A;  1E15 A;  2WLY A;  1FFR A;  4ZPV R;  5HKG A;  1FKJ A;  1WNO A;  3JYJ A;  1X6L A;  4TNS A;  2F21 A;  1ZB5 A;  2WLZ A;  2N87 A;  1LG1 A;  3NRK A;  2UZ5 A;  1Y0O A;  2XPA A;  4KR0 B;  4U86 A;  1FKI A;  3FAP A;  4Z2H A;  1J6Y A;  2FDM A;  1NMV A;  1KT0 A;  4QT3 A;  3O5K A;  4L72 B;  3OOB A;  3G6M A;  1X6N A;  4JFL A;  2MLX A;  2DT3 A;  4ODM A;  1TCO C;  4DRN A;  2ZQS A;  4JFJ A;  3WD2 A;  3WQW A;  1R9H A;  1GOI A;  3CGM A;  1EHN A;  3RM4 A;  3ARY A;  1OGG A;  1D7J A;  4LAW A;  4DZ3 A;  1FKR A;  1JNT A;  4KQZ A;  2XP3 A;  1HKI A;  3WD3 A;  1JNE A;  4Q22 A;  1HKM A;  1SYT A;  4U85 A;  1LL4 A;  2A3A A;  1NWU A;  3WH0 A;  4MPK A;  1LQ0 A;  1N1A A;  4ZPT R;  1EQ3 A;  1ZBV A;  2VCD A;  4MAV A;  1OGB A;  3TCZ A;  3WL0 A;  1B6C A;  5JH8 A;  2KFW A;  1Q6H A;  5B8I C;  3NI6 A;  4ODR A;  1NMW A;  4DRO A;  4WK9 A;  4QZV B;  2ZR6 A;  3KCE A;  1D6O A;  1GUV A;  4G50 A;  4ITZ A;  4TW6 A;  4ODK A;  1FKG A;  2RUD A;  1FKH A;  2PBC A;  3AS2 A;  2ZR5 A;  1F40 A;  4S3J A;  4ZS6 A;  2M08 A;  2P4V A;  5HT1 A;  4S3K A;  1QPF A;  5HW6 A;  3IKG A;  4MNM A;  4DIP A;  1FKD A;  4MNK A;  3B8S A;  1FD9 A;  3AS1 A;  2ETN A;  3RGC A;  2IF4 A;  2Q5A A;  4O2T A;  1ROT A;  4Z2G A;  3JYM A;  2O9O A;  1M5Y A;  3ARV A;  1Q6U A;  2D9F A;  3KAH A;  3UI4 A;  3WKZ A;  3CHC A;  2DSV A;  3I6C A;  3KAG A;  4XAK A;  5DO2 A;  3CGN A;  4QIB A;  1ZBW A;  2DG9 A;  1VF8 A;  4WIW A;  3UQI A;  2DT2 A;  1LJY A;  3KAF A;  3PA7 A;  1D7I A;  1NWS A;  2M1I A;  4LAX A;  4JFM A;  4IT4 A;  1BKF A;  1W1P A;  2MLY A;  4W9O A;  5HTG A;  1FKK A;  1NWT A;  4R5E A;  4L3N A;  3ARU A;  4WKF A;  1Q6I A;  4R0X A;  1ZBK A;  2IUZ A;  5DIV A;  1UR8 A;  4ODP A;  4NSB A;  1FKS A;  2PI6 A;  3RME A;  3ARR A;  5I98 A;  3FY1 A;  1BL4 A;  4WKA A;  3UF8 A;  1PBK A;  4ODN A;  2RQS A;  3PRA A;  3BMB A;  3UQA A;  2RUC A;  3O5J A;  2PPN A;  3UI5 A;  1IX5 A;  3KAB A;  4DT4 A;  2DG4 A;  1EIB A;  5DF0 A;  1E44 A;  1E9L A;  2XP6 A;  4LAV A;  4DWS A;  4Z2I A;  3CZ8 A;  3GU0 A;  4MTV A;  2KR7 A;  4UDM A;  3KAD A;  1E6R A;  4MSP A;  1K9T A;  3WD4 A;  4GIV A;  2PV3 A;  1J4R A;  3VAW A;  3AS3 A;  1JVW A;  5DEZ A;  1T11 A;  2PPP A;  2KO7 A;  1YW5 A;  4DRK A;  4PTM A;  4TYO A;  3O5O A;  3CHE A;  3ALF A;  3AS0 A;  1TFV A;  2A3B A;  2DG3 A;  1HJX A;  2F2D A;  4URI A;  4Z2J A;  4FN2 A;  1JND A;  1W1T A;  2DSU A;  4GGQ A;  2XP5 A;  1LL7 A;  1NWR A;  3OA5 A;  1GPF A;  1QPL A;  4P8V A;  2MF9 A;  1ITX A;  2QF8 A;  2DPE A;  4ODO A;  1W26 A;  3NTP A;  3GTY X;  4JFK A;  2JZV A;  2PPO A;  4IQ2 A;  2OLH A;  3PRB A;  1RD6 A;  2AWG A;  4MNL A;  1XRV A;  4LAY A;  2ESC A;  1LL6 A;  1W1Y A;  5GPG A;  4JYS A;  4P8W A;  2B31 A;  1W9V A;  4W9P A;  2MNT A;  1E6Z A;  2Y78 A;  4Z2L A;  4IT6 A;  1JNS A;  1HJV A;  3CH9 A;  1H0G A;  2G8Z A;  1HJW A;  2VN1 A;  4N19 A;  3W4R A;  4NNR A;  3IKD A;  2DSW A;  3CHF A;  3TC5 A;  2F4E A;  1H0I A;  3ODK A;  3QOK A;  3MDY B;  1L1P A;  3FXY A;  4DRI A;  2ZQU A;  1Q1C A;  2KGJ A;  4DRQ A;  2DT0 A;  1HXV A;  1KFW A;  2PV2 A;  5HWB A;  3O5Q A;  2MLZ A;  1HKJ A;  1P5Q A;  2F23 A;  3H9R B;  4BF8 A;  1J4H A;  2PN0 A;  2KI3 A;  2RUR A;  4DWS C;  1SR0 A;  4JFI A;  5HUA A;  2LPV A;  3G6L A;  2XPB A;  4DH0 A;  1D2K A;  2M2A A;  1D7H A;  1NSG A;  3ARP A;  3O5I A;  4AY1 A;  4QT2 A;  3TDB A;  3O5R A;  1U79 A;  5J6E A;  4TW8 A;  3RFW A;  3EIP A;  3ARZ A;  4W9Q A;  2YBT A;  3O5E A;  4ODL A;  3WQV A;  4DZ2 A;  3O5F A;  2DT1 A;  3ART A;  1W9U A;  4P8X A;  4LGX A;  2L2S A;  4HBO A;  4DWS D;  1W9P A;  3O5L A;  3IHZ A;  3BXW A;  4DRH A;  1FAP A;  3WD0 A;  1FKL A;  3B9D A;  2PV1 A;  4W5U A;  4U84 A;  1E6N A;  1FKT A;  3B9A A;  1EDQ A;  4IQC A;  1A7X A;  2MPH A;  3ARW A;  2OFN A;  1ZU8 A;  5HWC A;  4MNJ A;  2A3E A;  3AQU A;  4DRM A;  2FAP A;  3RM8 A;  3GPK A;  2XP4 A;  4TX0 A;  4WKH A;  1QZ2 A;  4IPX A;  4ODQ A;  2A3C A;  2WM0 A;  1UR9 A;  3KAI A;  2O92 A;  4P8U A;  3O5M A;  4J4O A;  3WD1 A;  5HW8 A;  3PRD A; 
#chains in the Genus database with same CATH homology
 1PIN A;  2AOS A;  4WJX A;  4DRP A;  2RUQ A;  4G2P A;  2DSZ A;  3O5G A;  3UQB A;  3JXV A;  3B7X A;  2K8I A;  1J4I A;  4C02 B;  3EY6 A;  1FFQ A;  3ALG A;  1ZL1 A;  5GPR A;  4FAP A;  1F8A B;  3ARO A;  3B9E A;  2FKE A;  2XP7 A;  2LGO A;  5DIU A;  1ZK6 A;  1FJD A;  3RM9 A;  5DIT A;  4Q7N A;  5D75 A;  1O6I A;  1W1V A;  4MGV A;  1WB0 A;  2LJ4 A;  4J4N A;  3WIJ A;  1OWQ A;  1NH6 A;  5GQB A;  2G41 A;  2YBU A;  3KAC A;  2ZR4 A;  4Z2K A;  1XHG A;  3ARS A;  3CHD A;  4TW7 A;  1ZBC A;  2XP9 A;  4HAR A;  4DRJ A;  1YAT A;  1E6P A;  4DWS B;  3ARQ A;  3LUO A;  1ROU A;  2XP8 A;  1WAW A;  3PR9 A;  1ZCN A;  4ZPW R;  3O5P A;  2RSE A;  2LKN A;  1C9H A;  1EYM A;  2KE0 A;  4ML4 A;  4NZC A;  3ARX A;  1FKF A;  1CTN A;  5HBF A;  3UI6 A;  4HBE A;  5BXJ A;  3O5D A;  3WL1 A;  3IK8 A;  2WK2 A;  2ZQV A;  5HW7 A;  1LG2 A;  1HKK A;  1FKB A;  1KT1 A;  2ZQT A;  2ITK A;  3KZ7 A;  1E15 A;  2WLY A;  1FFR A;  4ZPV R;  5HKG A;  1FKJ A;  1WNO A;  3JYJ A;  1X6L A;  4TNS A;  2F21 A;  1ZB5 A;  2WLZ A;  2N87 A;  1LG1 A;  3NRK A;  2UZ5 A;  1Y0O A;  2XPA A;  4KR0 B;  4U86 A;  1FKI A;  3FAP A;  4Z2H A;  1J6Y A;  2FDM A;  1NMV A;  1KT0 A;  4QT3 A;  3O5K A;  4L72 B;  3OOB A;  3G6M A;  1X6N A;  4JFL A;  2MLX A;  2DT3 A;  4ODM A;  1TCO C;  4DRN A;  2ZQS A;  4JFJ A;  3WD2 A;  3WQW A;  1R9H A;  1GOI A;  3CGM A;  1EHN A;  3RM4 A;  3ARY A;  1OGG A;  1D7J A;  4LAW A;  4DZ3 A;  1FKR A;  1JNT A;  4KQZ A;  2XP3 A;  1HKI A;  3WD3 A;  1JNE A;  4Q22 A;  1HKM A;  1SYT A;  4U85 A;  1LL4 A;  2A3A A;  1NWU A;  3WH0 A;  4MPK A;  1LQ0 A;  1N1A A;  4ZPT R;  1EQ3 A;  1ZBV A;  2VCD A;  4MAV A;  1OGB A;  3TCZ A;  3WL0 A;  1B6C A;  5JH8 A;  2KFW A;  1Q6H A;  5B8I C;  3NI6 A;  4ODR A;  1NMW A;  4DRO A;  4WK9 A;  4QZV B;  2ZR6 A;  3KCE A;  1D6O A;  1GUV A;  4G50 A;  4ITZ A;  4TW6 A;  4ODK A;  1FKG A;  2RUD A;  1FKH A;  2PBC A;  3AS2 A;  2ZR5 A;  1F40 A;  4S3J A;  4ZS6 A;  2M08 A;  5HT1 A;  4S3K A;  1QPF A;  5HW6 A;  3IKG A;  4MNM A;  4DIP A;  1FKD A;  4MNK A;  3B8S A;  1FD9 A;  3AS1 A;  3RGC A;  2IF4 A;  2Q5A A;  4O2T A;  1ROT A;  4Z2G A;  3JYM A;  2O9O A;  1M5Y A;  3ARV A;  1Q6U A;  2D9F A;  3KAH A;  3UI4 A;  3WKZ A;  3CHC A;  2DSV A;  3I6C A;  3KAG A;  4XAK A;  5DO2 A;  3CGN A;  4QIB A;  1ZBW A;  2DG9 A;  1VF8 A;  4WIW A;  3UQI A;  2DT2 A;  1LJY A;  3KAF A;  3PA7 A;  1D7I A;  1NWS A;  2M1I A;  4LAX A;  4JFM A;  4IT4 A;  1BKF A;  1W1P A;  2MLY A;  4W9O A;  5HTG A;  1FKK A;  1NWT A;  4R5E A;  4L3N A;  3ARU A;  4WKF A;  1Q6I A;  4R0X A;  1ZBK A;  2IUZ A;  5DIV A;  1UR8 A;  4ODP A;  4NSB A;  1FKS A;  2PI6 A;  3RME A;  3ARR A;  5I98 A;  3FY1 A;  1BL4 A;  4WKA A;  3UF8 A;  1PBK A;  4ODN A;  2RQS A;  3PRA A;  3UQA A;  2RUC A;  3O5J A;  2PPN A;  3UI5 A;  1IX5 A;  3KAB A;  4DT4 A;  2DG4 A;  1EIB A;  5DF0 A;  1E9L A;  2XP6 A;  4LAV A;  4DWS A;  4Z2I A;  3CZ8 A;  4MTV A;  2KR7 A;  3KAD A;  1E6R A;  4MSP A;  1K9T A;  3WD4 A;  4GIV A;  2PV3 A;  1J4R A;  3VAW A;  3AS3 A;  1JVW A;  5DEZ A;  1T11 A;  2PPP A;  2KO7 A;  1YW5 A;  4DRK A;  4PTM A;  4TYO A;  3O5O A;  3CHE A;  3ALF A;  3AS0 A;  1TFV A;  2A3B A;  2DG3 A;  1HJX A;  2F2D A;  4URI A;  4Z2J A;  4FN2 A;  1JND A;  1W1T A;  2DSU A;  4GGQ A;  2XP5 A;  1LL7 A;  1NWR A;  3OA5 A;  1GPF A;  1QPL A;  4P8V A;  2MF9 A;  1ITX A;  2QF8 A;  2DPE A;  4ODO A;  1W26 A;  3NTP A;  4JFK A;  2JZV A;  2PPO A;  4IQ2 A;  2OLH A;  3PRB A;  1RD6 A;  2AWG A;  4MNL A;  1XRV A;  4LAY A;  2ESC A;  1LL6 A;  1W1Y A;  5GPG A;  4JYS A;  4P8W A;  2B31 A;  1W9V A;  4W9P A;  2MNT A;  1E6Z A;  2Y78 A;  4Z2L A;  4IT6 A;  1JNS A;  1HJV A;  3CH9 A;  1H0G A;  2G8Z A;  1HJW A;  2VN1 A;  4N19 A;  3W4R A;  4NNR A;  3IKD A;  2DSW A;  3CHF A;  3TC5 A;  2F4E A;  1H0I A;  3ODK A;  3QOK A;  3MDY B;  1L1P A;  3FXY A;  4DRI A;  2ZQU A;  1Q1C A;  2KGJ A;  4DRQ A;  2DT0 A;  1HXV A;  1KFW A;  2PV2 A;  5HWB A;  3O5Q A;  2MLZ A;  1HKJ A;  1P5Q A;  3H9R B;  4BF8 A;  1J4H A;  2KI3 A;  2RUR A;  4DWS C;  1SR0 A;  4JFI A;  5HUA A;  2LPV A;  3G6L A;  2XPB A;  4DH0 A;  1D2K A;  2M2A A;  1D7H A;  1NSG A;  3ARP A;  3O5I A;  4AY1 A;  4QT2 A;  3TDB A;  3O5R A;  1U79 A;  5J6E A;  4TW8 A;  3RFW A;  3ARZ A;  4W9Q A;  2YBT A;  3O5E A;  4ODL A;  3WQV A;  4DZ2 A;  3O5F A;  2DT1 A;  3ART A;  1W9U A;  4P8X A;  4LGX A;  2L2S A;  4HBO A;  4DWS D;  1W9P A;  3O5L A;  3IHZ A;  3BXW A;  4DRH A;  1FAP A;  3WD0 A;  1FKL A;  3B9D A;  2PV1 A;  4W5U A;  4U84 A;  1E6N A;  1FKT A;  3B9A A;  1EDQ A;  4IQC A;  1A7X A;  2MPH A;  3ARW A;  2OFN A;  1ZU8 A;  5HWC A;  4MNJ A;  2A3E A;  3AQU A;  4DRM A;  2FAP A;  3RM8 A;  3GPK A;  2XP4 A;  4TX0 A;  4WKH A;  1QZ2 A;  4IPX A;  4ODQ A;  2A3C A;  2WM0 A;  1UR9 A;  3KAI A;  2O92 A;  4P8U A;  3O5M A;  4J4O A;  3WD1 A;  5HW8 A;  3PRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...