4TX0A

The fk1 domain of fkbp51 in complex with (1s,5s,6r)-10-[(3,5-dichlorophenyl)sulfonyl]-5-(2-methoxyethoxy)-3-(2-methoxyethyl)-3,10-diazabicyclo[4.3.1]decan-2-one
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stereoselective Construction of the 5-Hydroxy Diazabicyclo[4.3.1]decane-2-one Scaffold, a Privileged Motif for FK506-Binding Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 36
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4tx0A00
1FKGA 1NMWA 3TCZA 4DRJA 3JXVA 3VAWA 1JNTA 2LKNA 3O5MA 1D7IA 2PPOA 1FKJA 2RURA 5DIUA 2F21A 1FKFA 4IQ2A 1C9HA 4IQCA 2DG9A 2KI3A 1FKSA 2MF9A 2D9FA 2Q5AA 1QZ2A 3O5DA 3PA7A 4G50A 3UF8A 4DRNA 3UQBA 5DITA 4QIBA 3FAPA 4NNRA 2ZQTA 4U84A 1TCOC 3JYJA 5HW8A 3WH0A 1U79A 4BF8A 3O5FA 2UZ5A 4LAXA 3NI6A 3O5IA 1T11A 1D6OA 1NMVA 3IHZA 4G2PA 4LAYA 5B8IC 2PV2A 3KAHA 3IK8A 1EQ3A 2IF4A 1FKDA 2KE0A 1KT0A 1ROTA 4JFJA 1ROUA 2ZR4A 4N19A 4W9OA 3IKGA 3CGMA 5D75A 3UI5A 1M5YA 1ZCNA 3O5KA 2KR7A 2KGJA 5HUAA 4J4NA 4ODMA 3RGCA 4R0XA 1BKFA 4DRMA 4DRIA 5HW6A 3OOBA 3UQIA 1N1AA 3UI6A 3NRKA 4MGVA 2ITKA 2LJ4A 2OFNA 3JYMA 4TYOA 1FJDA 4DT4A 1J4HA 3KABA 3O5LA 3KADA 1QPFA 2ZQSA 5HTGA 2K8IA 3H9RB 2RQSA 4IPXA 4ODRA 1Q6UA 4W9QA 5BXJA 1A7XA 2ZR5A 2RUCA 1KT1A 1FKKA 2FAPA 4ODOA 1ZK6A 5GPGA 1Q1CA 3NTPA 1F8AB 2XP8A 2LGOA 5HW7A 1JVWA 5I98A 2N87A 2MNTA 4DIPA 4U85A 1J4RA 3KACA 1J6YA 4ODLA 4JFLA 1FKBA 2RUDA 4J4OA 2ZR6A 1R9HA 2FKEA 3O5OA 1FKLA 2XP7A 2JZVA 1FKIA 2M2AA 3O5RA 3PRBA 1Q6IA 4C02B 3O5PA 2VN1A 3GPKA 2PV3A 2MLXA 4GIVA 3KZ7A 4FAPA 2MLZA 4JYSA 2ZQVA 2XP5A 4DH0A 2VCDA 3KCEA 4LAVA 4QT3A 2RUQA 2XP4A 4W9PA 4JFKA 3O5EA 4FN2A 3TDBA 2XPAA 2M1IA 2XP6A 4MSPA 4DRKA 5HWCA 2XP3A 4O2TA 1L1PA 3UQAA 1Y0OA 3EY6A 4TW6A 5J6EA 2ZQUA 3B7XA 4ITZA 1JNSA 1FD9A 3KAGA 1YW5A 1EYMA 2Y78A 4ODKA 2DG4A 1F40A 3ODKA 2F4EA 3KAIA 2PV1A 3CGNA 4ODNA 4U86A 5HT1A 3RFWA 2PBCA 3O5JA 4TW8A 3KAFA 3O5GA 2RSEA 3TC5A 3MDYB 3PRDA 4JFIA 4DZ2A 5HKGA 1D7JA 1B6CA 5HWBA 2KFWA 1NSGA 3IKDA 1PBKA 2DG3A 4JFMA 1Q6HA 1FKTA 5DIVA 4ODQA 3UI4A 4LAWA 4TNSA 2M08A 4DRQA 4DRPA 3I6CA 1FKRA 4DROA 2L2SA 4DRHA 2AWGA 1FKHA 2PPNA 1W26A 2MLYA 1YATA 2KO7A 2XP9A 4ODPA 1QPLA 1PINA 1P5QA 4TW7A 4TX0A 1BL4A 1J4IA 1D7HA 3LUOA 1FAPA 2MPHA 2LPVA 2PPPA 2XPBA 3O5QA 1HXVA 4DZ3A 4QT2A 2F2DA 4GGQA
chains in the Genus database with same CATH superfamily
3JXVA 5DIUA 2F21A 3W4RA 2DG9A 3AS2A 1FKSA 4P8XA 5DEZA 2D9FA 2Q5AA 4DRNA 1HKIA 1LL6A 3UQBA 3FAPA 4NNRA 4U84A 3WD2A 3JYJA 1E15A 1EIBA 1LQ0A 1NMVA 4G2PA 5B8IC 2YBTA 2IUZA 1KT0A 4W9OA 4JFJA 3IKGA 1ZU8A 1GOIA 2KR7A 4J4NA 4ODMA 4WIWA 4R0XA 1BKFA 4DRIA 1SR0A 5HW6A 1N1AA 1X6NA 1JCHB 2OFNA 1WB0A 1J4HA 1SYTA 3KADA 2OLHA 3H9RB 5BXJA 3GU0A 1W1YA 2RUCA 3RMEA 4ODOA 5I98A 3PRAA 1E6PA 2FDMA 3ARTA 3CHDA 3B9AA 1NH6A 1W9UA 4S3KA 5DF0A 1GPFA 2ZR6A 1LJYA 1R9HA 3O5RA 1NWTA 2XP7A 4JFIA 1FKIA 3PRBA 3UI5A 3KZ7A 4DWSA 2MLZA 2DSVA 1NWRA 4W9PA 4WK9A 2M1IA 2XP6A 4WKFA 3G6LA 2P4VA 4Z2IA 1L1PA 3EY6A 3ARYA 3B7XA 1JNSA 3RM8A 3KAGA 2DG4A 3ODKA 4Q22A 3CGNA 4U86A 3KAFA 1TFVA 3TC5A 1D7JA 3WD3A 1B6CA 5HWBA 1HJXA 2KFWA 1NSGA 2DT0A 4JFMA 4ODQA 3EIPA 4TNSA 2M08A 1ZL1A 3WKZA 2AWGA 2ETNA 2KO7A 1HJVA 1H0IA 1P5QA 1QPLA 1WAWA 1BL4A 1D7HA 1FAPA 5DO2A 2MPHA 2PI6A 2XPBA 2F2DA 4GGQA 1W1TA 1FKGA 1NMWA 4DRJA 4QZVB 1JNTA 2LKNA 1D7IA 2RURA 1CTNA 2MF9A 1E9LA 4ZS6A 1QZ2A 3UF8A 2ZQTA 3WIJA 1H0GA 3WH0A 2QF8A 3CH9A 2DSWA 3IK8A 1HKMA 1ROTA 2KE0A 1ROUA 3ARQA 5D75A 3CGMA 4IT4A 2KGJA 5JH8A 1HKKA 5GPRA 3OOBA 4Z2HA 2DPEA 3NRKA 3ARUA 2ITKA 4WKHA 4TYOA 4DT4A 4P8UA 1QPFA 4ODRA 2RQSA 2YBUA 2EULA 1IX5A 1KT1A 4DWSD 4Z2KA 5GPGA 1Q1CA 1F8AB 2XP8A 3FY1A 3QOKA 2N87A 3CHCA 3KACA 1J6YA 3AS3A 4MNJA 4JFLA 1ZBCA 2RUDA 4J4OA 1XHGA 3O5OA 2M2AA 4Z2GA 4C02B 1ZBKA 2PV3A 4FAPA 1W1PA 4JYSA 2ZQVA 4DH0A 2VCDA 2DT2A 2RUQA 3B9DA 4Z2JA 4JFKA 2AOSA 4FN2A 4DRKA 4MSPA 2B5UB 3G6MA 1Y0OA 3WD0A 4WJXA 4TW6A 4ZPTR 5GQBA 5J6EA 4ITZA 5HBFA 1YW5A 1EYMA 2Y78A 2A3CA 3RM4A 4ODNA 5HT1A 1W1VA 2PBCA 1OGGA 4TW8A 3O5GA 4MNMA 5HKGA 1KFWA 3IKDA 4MNKA 1OWQA 4MAVA 1Q6HA 1W9VA 4LAWA 4MTVA 4Q7NA 4DROA 1EDQA 1FKHA 1W26A 2MLYA 1YATA 2XP9A 4MNLA 3O5QA 4DZ3A 3TCZA 1X6LA 4KQZA 2PPOA 4WKAA 1FKJA 4IQCA 2WM0A 1O6IA 1UR9A 4P8VA 3ARXA 2O9OA 2WLZA 1TCOC 2PN0A 4HBEA 5HW8A 4UDMA 4BF8A 1JNEA 3O5IA 1D6OA 2A3BA 1GUVA 3IHZA 2O92A 1EQ3A 3AROA 1ZCNA 3O5KA 3AS0A 3RGCA 3AS1A 4NSBA 4DRMA 4KR0B 3ARZA 3UI6A 4MGVA 3RM9A 2LJ4A 1FJDA 3KABA 5HTGA 2A3EA 2ESCA 4IPXA 2G8ZA 1XRVA 4R5EA 4URIA 4P8WA 1FFRA 3WD1A 2FAPA 1ZK6A 3NTPA 4NZCA 2LGOA 2MNTA 4DIPA 1J4RA 4L72B 3AQUA 2FKEA 3RFWA 1VF8A 3ARPA 2JZVA 1Q6IA 3O5PA 2MLXA 4GIVA 2DT3A 4DWSC 1JNDA 4LGXA 1E6ZA 4LAVA 4QT3A 3ARSA 2WK2A 3O5EA 3TDBA 3BMBA 4O2TA 4XAKA 1ZBWA 1NWUA 3WD4A 1FD9A 4ODKA 4HBOA 2F4EA 3KAIA 4Z2LA 1LG1A 3MDYB 4S3JA 1RD6A 2A3AA 1PBKA 1K9TA 5DIVA 1FKTA 1E6RA 4DRPA 1GRJA 3B9EA 2L2SA 1FFQA 4ODPA 1J4IA 3WQWA 2PPPA 1LL4A 4PTMA 4DRQA 3KAHA 2RSEA 3CZ8A 1W9PA 3ARWA 3VAWA 3O5MA 4IQ2A 1FKFA 1C9HA 2KI3A 1E6NA 3ARRA 3O5DA 3PA7A 4G50A 5DITA 1LL7A 4QIBA 1U79A 3O5FA 1ZB5A 2UZ5A 4LAXA 3NI6A 3WL0A 1T11A 4LAYA 2PV2A 1EHNA 1FKDA 2IF4A 2ZR4A 4N19A 4DWSB 1M5YA 2DSZA 5HUAA 3UQIA 1ZBVA 3OA5A 3CHFA 3JYMA 3O5LA 2B31A 2ZQSA 2K8IA 1Q6UA 1NWSA 4W9QA 1A7XA 2ZR5A 1LG2A 3GTYX 2G41A 1FKKA 3WL1A 1HKJA 4W5UA 3FXYA 4HARA 3ARVA 4ZPVR 5HW7A 1JVWA 3ALFA 1E44A 4U85A 4ODLA 3BXWA 1FKBA 1FKLA 2VN1A 3GPKA 3PR9A 3WQVA 3B8SA 1D2KA 4IT6A 2XP5A 3KCEA 2XP4A 2XPAA 4ML4A 5HWCA 2XP3A 1UR8A 2ZQUA 1OGBA 3CHEA 1WNOA 1F40A 1ITXA 2DSUA 2PV1A 3O5JA 3ALGA 4DZ2A 3PRDA 2WLYA 2DG3A 2DT1A 4MPKA 3UI4A 4AY1A 3I6CA 4DRHA 1HJWA 2PPNA 1FKRA 4ZPWR 4TX0A 4TW7A 1PINA 3UQAA 4L3NA 3LUOA 2LPVA 1HXVA 2F23A 4QT2A
chains in the Genus database with same CATH topology
3JXVA 5DIUA 2F21A 3W4RA 2DG9A 3AS2A 1FKSA 4P8XA 5DEZA 2D9FA 2Q5AA 4DRNA 1HKIA 1LL6A 3UQBA 3FAPA 4NNRA 4U84A 3WD2A 3JYJA 1E15A 1EIBA 1LQ0A 1NMVA 4G2PA 5B8IC 2YBTA 2IUZA 1KT0A 4W9OA 4JFJA 3IKGA 1ZU8A 1GOIA 2KR7A 4J4NA 4ODMA 4WIWA 4R0XA 1BKFA 4DRIA 1SR0A 5HW6A 1N1AA 1X6NA 2OFNA 1WB0A 1J4HA 1SYTA 3KADA 2OLHA 3H9RB 5BXJA 1W1YA 2RUCA 3RMEA 4ODOA 5I98A 3PRAA 1E6PA 2FDMA 3ARTA 3CHDA 3B9AA 1NH6A 1W9UA 4S3KA 5DF0A 1GPFA 2ZR6A 1LJYA 1R9HA 3O5RA 1NWTA 2XP7A 4JFIA 1FKIA 3PRBA 3UI5A 3KZ7A 4DWSA 2MLZA 2DSVA 1NWRA 4W9PA 4WK9A 2M1IA 2XP6A 4WKFA 3G6LA 4Z2IA 1L1PA 3EY6A 3ARYA 3B7XA 1JNSA 3RM8A 3KAGA 2DG4A 3ODKA 4Q22A 3CGNA 4U86A 3KAFA 1TFVA 3TC5A 1D7JA 3WD3A 1B6CA 5HWBA 1HJXA 2KFWA 1NSGA 2DT0A 4JFMA 4ODQA 4TNSA 2M08A 1ZL1A 3WKZA 2AWGA 2KO7A 1HJVA 1H0IA 1P5QA 1QPLA 1WAWA 1BL4A 1D7HA 1FAPA 5DO2A 2MPHA 2PI6A 2XPBA 2F2DA 4GGQA 1W1TA 1FKGA 1NMWA 4DRJA 4QZVB 1JNTA 2LKNA 1D7IA 2RURA 1CTNA 2MF9A 1E9LA 4ZS6A 1QZ2A 3UF8A 2ZQTA 3WIJA 1H0GA 3WH0A 2QF8A 3CH9A 2DSWA 3IK8A 1HKMA 1ROTA 2KE0A 1ROUA 3ARQA 5D75A 3CGMA 4IT4A 2KGJA 5JH8A 1HKKA 5GPRA 3OOBA 4Z2HA 2DPEA 3NRKA 3ARUA 2ITKA 4WKHA 4TYOA 4DT4A 4P8UA 1QPFA 4ODRA 2RQSA 2YBUA 1IX5A 1KT1A 4DWSD 4Z2KA 5GPGA 1Q1CA 1F8AB 2XP8A 3FY1A 3QOKA 2N87A 3CHCA 3KACA 1J6YA 3AS3A 4MNJA 4JFLA 1ZBCA 2RUDA 4J4OA 1XHGA 3O5OA 2M2AA 4Z2GA 4C02B 1ZBKA 2PV3A 4FAPA 4JYSA 1W1PA 2ZQVA 4DH0A 2VCDA 2DT2A 2RUQA 3B9DA 4Z2JA 4JFKA 2AOSA 4FN2A 4DRKA 4MSPA 3G6MA 1Y0OA 3WD0A 4WJXA 4TW6A 4ZPTR 5GQBA 5J6EA 4ITZA 5HBFA 1YW5A 1EYMA 2Y78A 2A3CA 3RM4A 4ODNA 5HT1A 1W1VA 2PBCA 1OGGA 4TW8A 3O5GA 4MNMA 5HKGA 1KFWA 3IKDA 4MNKA 1OWQA 4MAVA 1Q6HA 1W9VA 4LAWA 4MTVA 4Q7NA 4DROA 1EDQA 1FKHA 1W26A 2MLYA 1YATA 2XP9A 4MNLA 3O5QA 4DZ3A 3TCZA 1X6LA 4KQZA 2PPOA 4WKAA 1FKJA 4IQCA 2WM0A 1O6IA 1UR9A 4P8VA 3ARXA 2O9OA 2WLZA 1TCOC 5HW8A 4HBEA 4BF8A 1JNEA 3O5IA 1D6OA 2A3BA 1GUVA 3IHZA 2O92A 1EQ3A 3AROA 1ZCNA 3O5KA 3AS0A 3RGCA 3AS1A 4NSBA 4DRMA 4KR0B 3ARZA 3UI6A 4MGVA 3RM9A 2LJ4A 1FJDA 3KABA 5HTGA 2A3EA 2ESCA 4IPXA 2G8ZA 1XRVA 4R5EA 4URIA 4P8WA 1FFRA 3WD1A 2FAPA 1ZK6A 3NTPA 4NZCA 2LGOA 2MNTA 4DIPA 1J4RA 4L72B 3AQUA 2FKEA 3RFWA 1VF8A 3ARPA 2JZVA 1Q6IA 3O5PA 2MLXA 4GIVA 2DT3A 4DWSC 1JNDA 4LGXA 1E6ZA 4LAVA 4QT3A 3ARSA 2WK2A 3O5EA 3TDBA 4XAKA 4O2TA 1ZBWA 1NWUA 3WD4A 1FD9A 4ODKA 4HBOA 2F4EA 3KAIA 4Z2LA 1LG1A 3MDYB 4S3JA 1RD6A 2A3AA 1PBKA 1K9TA 5DIVA 1FKTA 1E6RA 4DRPA 3B9EA 2L2SA 1FFQA 4ODPA 1J4IA 3WQWA 2PPPA 1LL4A 4PTMA 4DRQA 3KAHA 2RSEA 3CZ8A 1W9PA 3ARWA 3VAWA 3O5MA 4IQ2A 1FKFA 1C9HA 2KI3A 1E6NA 3ARRA 3O5DA 3PA7A 4G50A 5DITA 1LL7A 4QIBA 1U79A 3O5FA 1ZB5A 2UZ5A 4LAXA 3NI6A 3WL0A 1T11A 4LAYA 2PV2A 1EHNA 1FKDA 2IF4A 2ZR4A 4N19A 4DWSB 1M5YA 2DSZA 5HUAA 3UQIA 1ZBVA 3OA5A 3CHFA 3JYMA 3O5LA 2B31A 2ZQSA 2K8IA 1Q6UA 1NWSA 4W9QA 1A7XA 2ZR5A 1LG2A 2G41A 1FKKA 3WL1A 1HKJA 4W5UA 3FXYA 4HARA 3ARVA 4ZPVR 5HW7A 1JVWA 3ALFA 4U85A 4ODLA 3BXWA 1FKBA 1FKLA 2VN1A 3GPKA 3PR9A 3WQVA 3B8SA 1D2KA 4IT6A 2XP5A 3KCEA 2XP4A 2XPAA 4ML4A 5HWCA 2XP3A 1UR8A 2ZQUA 1OGBA 3CHEA 1WNOA 1F40A 1ITXA 2DSUA 2PV1A 3O5JA 3ALGA 4DZ2A 3PRDA 2WLYA 2DG3A 2DT1A 4MPKA 3UI4A 4AY1A 3I6CA 4DRHA 1HJWA 2PPNA 1FKRA 4ZPWR 4TX0A 4TW7A 1PINA 3UQAA 4L3NA 3LUOA 2LPVA 1HXVA 4QT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKG A;  1NMW A;  3TCZ A;  4DRJ A;  3JXV A;  3VAW A;  1JNT A;  2LKN A;  3O5M A;  1D7I A;  2PPO A;  1FKJ A;  2RUR A;  5DIU A;  2F21 A;  1FKF A;  4IQ2 A;  1C9H A;  4IQC A;  2DG9 A;  2KI3 A;  1FKS A;  2MF9 A;  2D9F A;  2Q5A A;  1QZ2 A;  3O5D A;  3PA7 A;  4G50 A;  3UF8 A;  4DRN A;  3UQB A;  5DIT A;  4QIB A;  3FAP A;  4NNR A;  2ZQT A;  4U84 A;  1TCO C;  3JYJ A;  5HW8 A;  3WH0 A;  1U79 A;  4BF8 A;  3O5F A;  2UZ5 A;  4LAX A;  3NI6 A;  3O5I A;  1T11 A;  1D6O A;  1NMV A;  3IHZ A;  4G2P A;  4LAY A;  5B8I C;  2PV2 A;  3KAH A;  3IK8 A;  1EQ3 A;  2IF4 A;  1FKD A;  2KE0 A;  1KT0 A;  1ROT A;  4JFJ A;  1ROU A;  2ZR4 A;  4N19 A;  4W9O A;  3IKG A;  3CGM A;  5D75 A;  3UI5 A;  1M5Y A;  1ZCN A;  3O5K A;  2KR7 A;  2KGJ A;  5HUA A;  4J4N A;  4ODM A;  3RGC A;  4R0X A;  1BKF A;  4DRM A;  4DRI A;  5HW6 A;  3OOB A;  3UQI A;  1N1A A;  3UI6 A;  3NRK A;  4MGV A;  2ITK A;  2LJ4 A;  2OFN A;  3JYM A;  4TYO A;  1FJD A;  4DT4 A;  1J4H A;  3KAB A;  3O5L A;  3KAD A;  1QPF A;  2ZQS A;  5HTG A;  2K8I A;  3H9R B;  2RQS A;  4IPX A;  4ODR A;  1Q6U A;  4W9Q A;  5BXJ A;  1A7X A;  2ZR5 A;  2RUC A;  1KT1 A;  1FKK A;  2FAP A;  4ODO A;  1ZK6 A;  5GPG A;  1Q1C A;  3NTP A;  1F8A B;  2XP8 A;  2LGO A;  5HW7 A;  1JVW A;  5I98 A;  2N87 A;  2MNT A;  4DIP A;  4U85 A;  1J4R A;  3KAC A;  1J6Y A;  4ODL A;  4JFL A;  1FKB A;  2RUD A;  4J4O A;  2ZR6 A;  1R9H A;  2FKE A;  3O5O A;  1FKL A;  2XP7 A;  2JZV A;  1FKI A;  2M2A A;  3O5R A;  3PRB A;  1Q6I A;  4C02 B;  3O5P A;  2VN1 A;  3GPK A;  2PV3 A;  2MLX A;  4GIV A;  3KZ7 A;  4FAP A;  2MLZ A;  4JYS A;  2ZQV A;  2XP5 A;  4DH0 A;  2VCD A;  3KCE A;  4LAV A;  4QT3 A;  2RUQ A;  2XP4 A;  4W9P A;  4JFK A;  3O5E A;  4FN2 A;  3TDB A;  2XPA A;  2M1I A;  2XP6 A;  4MSP A;  4DRK A;  5HWC A;  2XP3 A;  4O2T A;  1L1P A;  3UQA A;  1Y0O A;  3EY6 A;  4TW6 A;  5J6E A;  2ZQU A;  3B7X A;  4ITZ A;  1JNS A;  1FD9 A;  3KAG A;  1YW5 A;  1EYM A;  2Y78 A;  4ODK A;  2DG4 A;  1F40 A;  3ODK A;  2F4E A;  3KAI A;  2PV1 A;  3CGN A;  4ODN A;  4U86 A;  5HT1 A;  3RFW A;  2PBC A;  3O5J A;  4TW8 A;  3KAF A;  3O5G A;  2RSE A;  3TC5 A;  3MDY B;  3PRD A;  4JFI A;  4DZ2 A;  5HKG A;  1D7J A;  1B6C A;  5HWB A;  2KFW A;  1NSG A;  3IKD A;  1PBK A;  2DG3 A;  4JFM A;  1Q6H A;  1FKT A;  5DIV A;  4ODQ A;  3UI4 A;  4LAW A;  4TNS A;  2M08 A;  4DRQ A;  4DRP A;  3I6C A;  1FKR A;  4DRO A;  2L2S A;  4DRH A;  2AWG A;  1FKH A;  2PPN A;  1W26 A;  2MLY A;  1YAT A;  2KO7 A;  2XP9 A;  4ODP A;  1QPL A;  1PIN A;  1P5Q A;  4TW7 A;  4TX0 A;  1BL4 A;  1J4I A;  1D7H A;  3LUO A;  1FAP A;  2MPH A;  2LPV A;  2PPP A;  2XPB A;  3O5Q A;  1HXV A;  4DZ3 A;  4QT2 A;  2F2D A;  4GGQ A; 
#chains in the Genus database with same CATH topology
 3JXV A;  5DIU A;  2F21 A;  3W4R A;  2DG9 A;  3AS2 A;  1FKS A;  4P8X A;  5DEZ A;  2D9F A;  2Q5A A;  4DRN A;  1HKI A;  1LL6 A;  3UQB A;  3FAP A;  4NNR A;  4U84 A;  3WD2 A;  3JYJ A;  1E15 A;  1EIB A;  1LQ0 A;  1NMV A;  4G2P A;  5B8I C;  2YBT A;  2IUZ A;  1KT0 A;  4W9O A;  4JFJ A;  3IKG A;  1ZU8 A;  1GOI A;  2KR7 A;  4J4N A;  4ODM A;  4WIW A;  4R0X A;  1BKF A;  4DRI A;  1SR0 A;  5HW6 A;  1N1A A;  1X6N A;  1JCH B;  2OFN A;  1WB0 A;  1J4H A;  1SYT A;  3KAD A;  2OLH A;  3H9R B;  5BXJ A;  3GU0 A;  1W1Y A;  2RUC A;  3RME A;  4ODO A;  5I98 A;  3PRA A;  1E6P A;  2FDM A;  3ART A;  3CHD A;  3B9A A;  1NH6 A;  1W9U A;  4S3K A;  5DF0 A;  1GPF A;  2ZR6 A;  1LJY A;  1R9H A;  3O5R A;  1NWT A;  2XP7 A;  4JFI A;  1FKI A;  3PRB A;  3UI5 A;  3KZ7 A;  4DWS A;  2MLZ A;  2DSV A;  1NWR A;  4W9P A;  4WK9 A;  2M1I A;  2XP6 A;  4WKF A;  3G6L A;  2P4V A;  4Z2I A;  1L1P A;  3EY6 A;  3ARY A;  3B7X A;  1JNS A;  3RM8 A;  3KAG A;  2DG4 A;  3ODK A;  4Q22 A;  3CGN A;  4U86 A;  3KAF A;  1TFV A;  3TC5 A;  1D7J A;  3WD3 A;  1B6C A;  5HWB A;  1HJX A;  2KFW A;  1NSG A;  2DT0 A;  4JFM A;  4ODQ A;  3EIP A;  4TNS A;  2M08 A;  1ZL1 A;  3WKZ A;  2AWG A;  2ETN A;  2KO7 A;  1HJV A;  1H0I A;  1P5Q A;  1QPL A;  1WAW A;  1BL4 A;  1D7H A;  1FAP A;  5DO2 A;  2MPH A;  2PI6 A;  2XPB A;  2F2D A;  4GGQ A;  1W1T A;  1FKG A;  1NMW A;  4DRJ A;  4QZV B;  1JNT A;  2LKN A;  1D7I A;  2RUR A;  1CTN A;  2MF9 A;  1E9L A;  4ZS6 A;  1QZ2 A;  3UF8 A;  2ZQT A;  3WIJ A;  1H0G A;  3WH0 A;  2QF8 A;  3CH9 A;  2DSW A;  3IK8 A;  1HKM A;  1ROT A;  2KE0 A;  1ROU A;  3ARQ A;  5D75 A;  3CGM A;  4IT4 A;  2KGJ A;  5JH8 A;  1HKK A;  5GPR A;  3OOB A;  4Z2H A;  2DPE A;  3NRK A;  3ARU A;  2ITK A;  4WKH A;  4TYO A;  4DT4 A;  4P8U A;  1QPF A;  4ODR A;  2RQS A;  2YBU A;  2EUL A;  1IX5 A;  1KT1 A;  4DWS D;  4Z2K A;  5GPG A;  1Q1C A;  1F8A B;  2XP8 A;  3FY1 A;  3QOK A;  2N87 A;  3CHC A;  3KAC A;  1J6Y A;  3AS3 A;  4MNJ A;  4JFL A;  1ZBC A;  2RUD A;  4J4O A;  1XHG A;  3O5O A;  2M2A A;  4Z2G A;  4C02 B;  1ZBK A;  2PV3 A;  4FAP A;  1W1P A;  4JYS A;  2ZQV A;  4DH0 A;  2VCD A;  2DT2 A;  2RUQ A;  3B9D A;  4Z2J A;  4JFK A;  2AOS A;  4FN2 A;  4DRK A;  4MSP A;  2B5U B;  3G6M A;  1Y0O A;  3WD0 A;  4WJX A;  4TW6 A;  4ZPT R;  5GQB A;  5J6E A;  4ITZ A;  5HBF A;  1YW5 A;  1EYM A;  2Y78 A;  2A3C A;  3RM4 A;  4ODN A;  5HT1 A;  1W1V A;  2PBC A;  1OGG A;  4TW8 A;  3O5G A;  4MNM A;  5HKG A;  1KFW A;  3IKD A;  4MNK A;  1OWQ A;  4MAV A;  1Q6H A;  1W9V A;  4LAW A;  4MTV A;  4Q7N A;  4DRO A;  1EDQ A;  1FKH A;  1W26 A;  2MLY A;  1YAT A;  2XP9 A;  4MNL A;  3O5Q A;  4DZ3 A;  3TCZ A;  1X6L A;  4KQZ A;  2PPO A;  4WKA A;  1FKJ A;  4IQC A;  2WM0 A;  1O6I A;  1UR9 A;  4P8V A;  3ARX A;  2O9O A;  2WLZ A;  1TCO C;  2PN0 A;  4HBE A;  5HW8 A;  4UDM A;  4BF8 A;  1JNE A;  3O5I A;  1D6O A;  2A3B A;  1GUV A;  3IHZ A;  2O92 A;  1EQ3 A;  3ARO A;  1ZCN A;  3O5K A;  3AS0 A;  3RGC A;  3AS1 A;  4NSB A;  4DRM A;  4KR0 B;  3ARZ A;  3UI6 A;  4MGV A;  3RM9 A;  2LJ4 A;  1FJD A;  3KAB A;  5HTG A;  2A3E A;  2ESC A;  4IPX A;  2G8Z A;  1XRV A;  4R5E A;  4URI A;  4P8W A;  1FFR A;  3WD1 A;  2FAP A;  1ZK6 A;  3NTP A;  4NZC A;  2LGO A;  2MNT A;  4DIP A;  1J4R A;  4L72 B;  3AQU A;  2FKE A;  3RFW A;  1VF8 A;  3ARP A;  2JZV A;  1Q6I A;  3O5P A;  2MLX A;  4GIV A;  2DT3 A;  4DWS C;  1JND A;  4LGX A;  1E6Z A;  4LAV A;  4QT3 A;  3ARS A;  2WK2 A;  3O5E A;  3TDB A;  3BMB A;  4O2T A;  4XAK A;  1ZBW A;  1NWU A;  3WD4 A;  1FD9 A;  4ODK A;  4HBO A;  2F4E A;  3KAI A;  4Z2L A;  1LG1 A;  3MDY B;  4S3J A;  1RD6 A;  2A3A A;  1PBK A;  1K9T A;  5DIV A;  1FKT A;  1E6R A;  4DRP A;  1GRJ A;  3B9E A;  2L2S A;  1FFQ A;  4ODP A;  1J4I A;  3WQW A;  2PPP A;  1LL4 A;  4PTM A;  4DRQ A;  3KAH A;  2RSE A;  3CZ8 A;  1W9P A;  3ARW A;  3VAW A;  3O5M A;  4IQ2 A;  1FKF A;  1C9H A;  2KI3 A;  1E6N A;  3ARR A;  3O5D A;  3PA7 A;  4G50 A;  5DIT A;  1LL7 A;  4QIB A;  1U79 A;  3O5F A;  1ZB5 A;  2UZ5 A;  4LAX A;  3NI6 A;  3WL0 A;  1T11 A;  4LAY A;  2PV2 A;  1EHN A;  1FKD A;  2IF4 A;  2ZR4 A;  4N19 A;  4DWS B;  1M5Y A;  2DSZ A;  5HUA A;  3UQI A;  1ZBV A;  3OA5 A;  3CHF A;  3JYM A;  3O5L A;  2B31 A;  2ZQS A;  2K8I A;  1Q6U A;  1NWS A;  4W9Q A;  1A7X A;  2ZR5 A;  1LG2 A;  3GTY X;  2G41 A;  1FKK A;  3WL1 A;  1HKJ A;  4W5U A;  3FXY A;  4HAR A;  3ARV A;  4ZPV R;  5HW7 A;  1JVW A;  3ALF A;  1E44 A;  4U85 A;  4ODL A;  3BXW A;  1FKB A;  1FKL A;  2VN1 A;  3GPK A;  3PR9 A;  3WQV A;  3B8S A;  1D2K A;  4IT6 A;  2XP5 A;  3KCE A;  2XP4 A;  2XPA A;  4ML4 A;  5HWC A;  2XP3 A;  1UR8 A;  2ZQU A;  1OGB A;  3CHE A;  1WNO A;  1F40 A;  1ITX A;  2DSU A;  2PV1 A;  3O5J A;  3ALG A;  4DZ2 A;  3PRD A;  2WLY A;  2DG3 A;  2DT1 A;  4MPK A;  3UI4 A;  4AY1 A;  3I6C A;  4DRH A;  1HJW A;  2PPN A;  1FKR A;  4ZPW R;  4TX0 A;  4TW7 A;  1PIN A;  3UQA A;  4L3N A;  3LUO A;  2LPV A;  1HXV A;  2F23 A;  4QT2 A; 
#chains in the Genus database with same CATH homology
 3JXV A;  5DIU A;  2F21 A;  3W4R A;  2DG9 A;  3AS2 A;  1FKS A;  4P8X A;  5DEZ A;  2D9F A;  2Q5A A;  4DRN A;  1HKI A;  1LL6 A;  3UQB A;  3FAP A;  4NNR A;  4U84 A;  3WD2 A;  3JYJ A;  1E15 A;  1EIB A;  1LQ0 A;  1NMV A;  4G2P A;  5B8I C;  2YBT A;  2IUZ A;  1KT0 A;  4W9O A;  4JFJ A;  3IKG A;  1ZU8 A;  1GOI A;  2KR7 A;  4J4N A;  4ODM A;  4WIW A;  4R0X A;  1BKF A;  4DRI A;  1SR0 A;  5HW6 A;  1N1A A;  1X6N A;  2OFN A;  1WB0 A;  1J4H A;  1SYT A;  3KAD A;  2OLH A;  3H9R B;  5BXJ A;  1W1Y A;  2RUC A;  3RME A;  4ODO A;  5I98 A;  3PRA A;  1E6P A;  2FDM A;  3ART A;  3CHD A;  3B9A A;  1NH6 A;  1W9U A;  4S3K A;  5DF0 A;  1GPF A;  2ZR6 A;  1LJY A;  1R9H A;  3O5R A;  1NWT A;  2XP7 A;  4JFI A;  1FKI A;  3PRB A;  3UI5 A;  3KZ7 A;  4DWS A;  2MLZ A;  2DSV A;  1NWR A;  4W9P A;  4WK9 A;  2M1I A;  2XP6 A;  4WKF A;  3G6L A;  4Z2I A;  1L1P A;  3EY6 A;  3ARY A;  3B7X A;  1JNS A;  3RM8 A;  3KAG A;  2DG4 A;  3ODK A;  4Q22 A;  3CGN A;  4U86 A;  3KAF A;  1TFV A;  3TC5 A;  1D7J A;  3WD3 A;  1B6C A;  5HWB A;  1HJX A;  2KFW A;  1NSG A;  2DT0 A;  4JFM A;  4ODQ A;  4TNS A;  2M08 A;  1ZL1 A;  3WKZ A;  2AWG A;  2KO7 A;  1HJV A;  1H0I A;  1P5Q A;  1QPL A;  1WAW A;  1BL4 A;  1D7H A;  1FAP A;  5DO2 A;  2MPH A;  2PI6 A;  2XPB A;  2F2D A;  4GGQ A;  1W1T A;  1FKG A;  1NMW A;  4DRJ A;  4QZV B;  1JNT A;  2LKN A;  1D7I A;  2RUR A;  1CTN A;  2MF9 A;  1E9L A;  4ZS6 A;  1QZ2 A;  3UF8 A;  2ZQT A;  3WIJ A;  1H0G A;  3WH0 A;  2QF8 A;  3CH9 A;  2DSW A;  3IK8 A;  1HKM A;  1ROT A;  2KE0 A;  1ROU A;  3ARQ A;  5D75 A;  3CGM A;  4IT4 A;  2KGJ A;  5JH8 A;  1HKK A;  5GPR A;  3OOB A;  4Z2H A;  2DPE A;  3NRK A;  3ARU A;  2ITK A;  4WKH A;  4TYO A;  4DT4 A;  4P8U A;  1QPF A;  4ODR A;  2RQS A;  2YBU A;  1IX5 A;  1KT1 A;  4DWS D;  4Z2K A;  5GPG A;  1Q1C A;  1F8A B;  2XP8 A;  3FY1 A;  3QOK A;  2N87 A;  3CHC A;  3KAC A;  1J6Y A;  3AS3 A;  4MNJ A;  4JFL A;  1ZBC A;  2RUD A;  4J4O A;  1XHG A;  3O5O A;  2M2A A;  4Z2G A;  4C02 B;  1ZBK A;  2PV3 A;  4FAP A;  4JYS A;  1W1P A;  2ZQV A;  4DH0 A;  2VCD A;  2DT2 A;  2RUQ A;  3B9D A;  4Z2J A;  4JFK A;  2AOS A;  4FN2 A;  4DRK A;  4MSP A;  3G6M A;  1Y0O A;  3WD0 A;  4WJX A;  4TW6 A;  4ZPT R;  5GQB A;  5J6E A;  4ITZ A;  5HBF A;  1YW5 A;  1EYM A;  2Y78 A;  2A3C A;  3RM4 A;  4ODN A;  5HT1 A;  1W1V A;  2PBC A;  1OGG A;  4TW8 A;  3O5G A;  4MNM A;  5HKG A;  1KFW A;  3IKD A;  4MNK A;  1OWQ A;  4MAV A;  1Q6H A;  1W9V A;  4LAW A;  4MTV A;  4Q7N A;  4DRO A;  1EDQ A;  1FKH A;  1W26 A;  2MLY A;  1YAT A;  2XP9 A;  4MNL A;  3O5Q A;  4DZ3 A;  3TCZ A;  1X6L A;  4KQZ A;  2PPO A;  4WKA A;  1FKJ A;  4IQC A;  2WM0 A;  1O6I A;  1UR9 A;  4P8V A;  3ARX A;  2O9O A;  2WLZ A;  1TCO C;  5HW8 A;  4HBE A;  4BF8 A;  1JNE A;  3O5I A;  1D6O A;  2A3B A;  1GUV A;  3IHZ A;  2O92 A;  1EQ3 A;  3ARO A;  1ZCN A;  3O5K A;  3AS0 A;  3RGC A;  3AS1 A;  4NSB A;  4DRM A;  4KR0 B;  3ARZ A;  3UI6 A;  4MGV A;  3RM9 A;  2LJ4 A;  1FJD A;  3KAB A;  5HTG A;  2A3E A;  2ESC A;  4IPX A;  2G8Z A;  1XRV A;  4R5E A;  4URI A;  4P8W A;  1FFR A;  3WD1 A;  2FAP A;  1ZK6 A;  3NTP A;  4NZC A;  2LGO A;  2MNT A;  4DIP A;  1J4R A;  4L72 B;  3AQU A;  2FKE A;  3RFW A;  1VF8 A;  3ARP A;  2JZV A;  1Q6I A;  3O5P A;  2MLX A;  4GIV A;  2DT3 A;  4DWS C;  1JND A;  4LGX A;  1E6Z A;  4LAV A;  4QT3 A;  3ARS A;  2WK2 A;  3O5E A;  3TDB A;  4XAK A;  4O2T A;  1ZBW A;  1NWU A;  3WD4 A;  1FD9 A;  4ODK A;  4HBO A;  2F4E A;  3KAI A;  4Z2L A;  1LG1 A;  3MDY B;  4S3J A;  1RD6 A;  2A3A A;  1PBK A;  1K9T A;  5DIV A;  1FKT A;  1E6R A;  4DRP A;  3B9E A;  2L2S A;  1FFQ A;  4ODP A;  1J4I A;  3WQW A;  2PPP A;  1LL4 A;  4PTM A;  4DRQ A;  3KAH A;  2RSE A;  3CZ8 A;  1W9P A;  3ARW A;  3VAW A;  3O5M A;  4IQ2 A;  1FKF A;  1C9H A;  2KI3 A;  1E6N A;  3ARR A;  3O5D A;  3PA7 A;  4G50 A;  5DIT A;  1LL7 A;  4QIB A;  1U79 A;  3O5F A;  1ZB5 A;  2UZ5 A;  4LAX A;  3NI6 A;  3WL0 A;  1T11 A;  4LAY A;  2PV2 A;  1EHN A;  1FKD A;  2IF4 A;  2ZR4 A;  4N19 A;  4DWS B;  1M5Y A;  2DSZ A;  5HUA A;  3UQI A;  1ZBV A;  3OA5 A;  3CHF A;  3JYM A;  3O5L A;  2B31 A;  2ZQS A;  2K8I A;  1Q6U A;  1NWS A;  4W9Q A;  1A7X A;  2ZR5 A;  1LG2 A;  2G41 A;  1FKK A;  3WL1 A;  1HKJ A;  4W5U A;  3FXY A;  4HAR A;  3ARV A;  4ZPV R;  5HW7 A;  1JVW A;  3ALF A;  4U85 A;  4ODL A;  3BXW A;  1FKB A;  1FKL A;  2VN1 A;  3GPK A;  3PR9 A;  3WQV A;  3B8S A;  1D2K A;  4IT6 A;  2XP5 A;  3KCE A;  2XP4 A;  2XPA A;  4ML4 A;  5HWC A;  2XP3 A;  1UR8 A;  2ZQU A;  1OGB A;  3CHE A;  1WNO A;  1F40 A;  1ITX A;  2DSU A;  2PV1 A;  3O5J A;  3ALG A;  4DZ2 A;  3PRD A;  2WLY A;  2DG3 A;  2DT1 A;  4MPK A;  3UI4 A;  4AY1 A;  3I6C A;  4DRH A;  1HJW A;  2PPN A;  1FKR A;  4ZPW R;  4TX0 A;  4TW7 A;  1PIN A;  3UQA A;  4L3N A;  3LUO A;  2LPV A;  1HXV A;  4QT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...