1NSGA

The structure of the immunophilin-immunosuppressant fkbp12-rapamycin complex interacting with human frap
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined structure of the FKBP12-rapamycin-FRB ternary complex at 2.2 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (isomerase/kinase)
molecule keywords FK506-BINDING PROTEIN
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1997-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1nsgA00
1J4RA 2F2DA 2PV3A 3O5MA 3FAPA 4U86A 2ZR6A 2DG4A 2PBCA 2VCDA 4QT2A 3WH0A 1ROTA 2F21A 1FKHA 2PV2A 4ODNA 3CGMA 1KT1A 1W26A 1FKRA 3NI6A 3IKDA 4DRIA 1NMWA 4DRPA 5HWCA 2MPHA 2KR7A 1FKFA 1FKSA 4R0XA 1P5QA 1Q1CA 4ODOA 4DT4A 4MSPA 3O5PA 2M08A 4TW8A 2MF9A 3EY6A 5DIVA 4JYSA 1D6OA 3IHZA 1BL4A 1D7HA 2LPVA 1M5YA 3IK8A 4U84A 2DG3A 2XP4A 3UQBA 1F8AB 2RURA 3KABA 5DIUA 2VN1A 3B7XA 1FAPA 4N19A 3I6CA 4DH0A 2MLYA 2RQSA 4FN2A 1PBKA 3O5FA 2DG9A 1FKKA 1FKLA 4TNSA 1U79A 3OOBA 4G2PA 3MDYB 1FKIA 2XP8A 2XP6A 3O5QA 3ODKA 2FAPA 3RGCA 4J4NA 3TC5A 2RUCA 3KAGA 2MNTA 3O5LA 1Q6UA 4DRMA 1JNTA 1KT0A 5HT1A 4DZ3A 2LJ4A 2OFNA 2XP3A 5HWBA 2K8IA 2ZQSA 4ODPA 2F4EA 4TW6A 3UI6A 4DRJA 4DRQA 4IQ2A 1NMVA 5I98A 1J4IA 2ZR5A 3O5DA 4ODMA 3JYMA 1D7IA 2IF4A 3UI5A 2UZ5A 1TCOC 1B6CA 4NNRA 1PINA 4IQCA 4DIPA 3O5OA 4J4OA 4LAVA 4IPXA 4JFLA 4FAPA 1FKTA 2LGOA 2RUQA 2XPAA 3O5JA 5HW6A 5HW8A 4W9PA 4ODLA 2KFWA 1FJDA 3KZ7A 4ITZA 1ZCNA 4DZ2A 2XP9A 3JYJA 2D9FA 2LKNA 4QT3A 3CGNA 3PRDA 2JZVA 5D75A 2M2AA 1ZK6A 3KCEA 1C9HA 3O5KA 4G50A 2XP7A 4TYOA 5BXJA 3TCZA 1NSGA 1EQ3A 4W9OA 2RUDA 2PV1A 4U85A 4LAXA 4DROA 4DRHA 4MGVA 3UI4A 4ODQA 3KADA 3IKGA 4TW7A 1YATA 1F40A 3KAFA 2AWGA 3UQIA 3O5EA 3KACA 4JFJA 4C02B 2ITKA 2PPPA 2ZR4A 2RSEA 1J6YA 1FKDA 5DITA 3O5GA 1ROUA 3PRBA 3VAWA 2PPNA 3TDBA 2ZQUA 2MLZA 1QPLA 3JXVA 4ODRA 3RFWA 3UF8A 4DRKA 4TX0A 5J6EA 3UQAA 5HTGA 3LUOA 4ODKA 3H9RB 4O2TA 1A7XA 3GPKA 1FKJA 1FKGA 4BF8A 1R9HA 3NRKA 2KGJA 4LAWA 1QZ2A 1J4HA 4W9QA 2M1IA 4GGQA 4LAYA 4DRNA 5GPGA 2ZQTA 1FD9A 4JFMA 5HW7A 1N1AA 1QPFA 2ZQVA 1Y0OA 3O5RA 2KI3A 5HUAA 3KAHA 3PA7A 2Y78A 1FKBA 1T11A 5HKGA 2KE0A 2XP5A 2N87A 4GIVA 5B8IC 1JVWA 2PPOA 1EYMA 1YW5A 1Q6HA 2KO7A 3O5IA 4JFKA 3KAIA 2L2SA 1D7JA 2XPBA 4QIBA 4JFIA 3NTPA 1Q6IA 2MLXA 2Q5AA 1BKFA 1JNSA 2FKEA 1HXVA 1L1PA
chains in the Genus database with same CATH superfamily
1J4RA 2F2DA 3O5MA 5DO2A 2DG4A 3ARRA 4DWSC 2PV2A 2DT0A 2MPHA 1FKSA 4R0XA 4ODOA 4ZPWR 4TW8A 5DIVA 3ARQA 3IHZA 1LL4A 2LPVA 4Z2IA 1FAPA 1OGBA 4N19A 3I6CA 3GTYX 2RQSA 1VF8A 3OA5A 1K9TA 1WNOA 3OOBA 2O9OA 3AS0A 3PR9A 3TC5A 2RUCA 2MNTA 1KT0A 2LJ4A 4W5UA 2ZQSA 4TW6A 5I98A 1LG1A 2ZR5A 2OLHA 2P4VA 3JYMA 1SR0A 2UZ5A 1TCOC 1GOIA 1PINA 4IPXA 3O5JA 3WD0A 3W4RA 3KZ7A 4ITZA 3WD3A 4DZ2A 3CGNA 4XAKA 1W1YA 2XP7A 4TYOA 2IUZA 1EQ3A 2RUDA 4Q22A 4MGVA 3UI4A 3IKGA 4TW7A 1YATA 3KAFA 1JNEA 3UQIA 1OGGA 1NWRA 3ARUA 3FXYA 1FKDA 4P8UA 3GU0A 3PRBA 4IT4A 3TDBA 2ZQUA 1QPLA 1EIBA 4Z2GA 3H9RB 1FKGA 3NRKA 1J4HA 1JNDA 3AS1A 3B8SA 3RMEA 4JFMA 2QF8A 1E44A 2AOSA 2KI3A 3O5RA 3KAHA 1E6ZA 1FKBA 1T11A 2KE0A 1HJWA 2XP5A 5B8IC 2PPOA 3O5IA 4JFKA 5GPRA 4DWSD 2XPBA 3NTPA 1W9UA 1JNSA 1EHNA 5JH8A 4U86A 2ZR6A 2F21A 1FKRA 1LG2A 4DRIA 5HWCA 4Z2JA 3B9DA 1FFRA 2KR7A 3WL1A 1FKFA 1XRVA 1Q1CA 4DT4A 3O5PA 1BL4A 3IK8A 4Q7NA 1ZB5A 3KABA 2RURA 1X6NA 5DIUA 5GQBA 3B7XA 4L3NA 4WK9A 2MLYA 3WL0A 4HBOA 1U79A 4G2PA 3MDYB 3ODKA 1HKIA 4ZPTR 3KAGA 5HWBA 4DRJA 2IF4A 4S3JA 3UI5A 1ZBKA 4R5EA 2B5UB 3O5OA 3ALFA 4J4OA 2DSVA 1FKTA 2RUQA 3WD2A 5HW8A 1W9VA 4ODLA 1FJDA 2WK2A 2XP9A 4UDMA 2YBTA 2JZVA 2M2AA 3KCEA 1JCHB 3TCZA 4QZVB 4HARA 4U85A 1W1TA 1ZBVA 3CHEA 3KADA 2AWGA 4JFJA 2ESCA 4C02B 2ZR4A 4LGXA 2G8ZA 2RSEA 1XHGA 3O5GA 1ROUA 2DSUA 3UF8A 5J6EA 4DWSA 4ZPVR 1A7XA 3GPKA 1FKJA 1R9HA 4LAWA 4DRNA 3ARZA 4AY1A 1FD9A 1N1AA 1Y0OA 1E9LA 2ETNA 5HUAA 2Y78A 1LL6A 3FY1A 2N87A 1JVWA 1EYMA 1Q6HA 2KO7A 3KAIA 2L2SA 4P8XA 4QIBA 4JFIA 1Q6IA 1EDQA 4Z2LA 2O92A 2WM0A 1O6IA 2PV3A 2A3EA 2PBCA 2VCDA 3WH0A 1HKJA 1KFWA 1GUVA 1X6LA 4MNKA 1FKHA 4ODNA 4DWSB 3CGMA 3NI6A 3IKDA 4DRPA 1NMWA 1LQ0A 3QOKA 4HBEA 2A3BA 5HBFA 2DPEA 4U84A 2DG3A 2XP4A 4KQZA 2VN1A 4DH0A 4FN2A 3O5FA 2DG9A 1HJVA 2XP8A 2XP6A 3RGCA 3CH9A 2PI6A 4J4NA 1WB0A 3O5LA 4DRMA 5HT1A 4DZ3A 2PN0A 1W1PA 4Z2KA 4L72B 4DRQA 1NMVA 1J4IA 3O5DA 1D7IA 4MAVA 1NWTA 4NNRA 4IQCA 4DIPA 4P8VA 4JFLA 4FAPA 2LGOA 5HW6A 1H0GA 2KFWA 3CHCA 4Z2HA 1FFQA 1ZK6A 3RM8A 1C9HA 3WKZA 4W9OA 4DROA 4ODQA 1F40A 3O5EA 3B9AA 3BXWA 2ITKA 3ARXA 1D2KA 2A3AA 1UR8A 5DF0A 5DITA 4MTVA 3VAWA 2PPNA 2MLZA 1SYTA 4ML4A 4DRKA 4TX0A 3UQAA 3LUOA 4ODKA 3ARPA 2DT1A 2KGJA 4W9QA 3WIJA 3G6MA 4GGQA 3AROA 1ZU8A 3ARTA 3B9EA 1QPFA 2YBUA 2ZQVA 3G6LA 1ZBWA 2F23A 3ALGA 4GIVA 1YW5A 1HKMA 2DSWA 4S3KA 2MLXA 4WIWA 1BKFA 2FKEA 2A3CA 4NZCA 2WLYA 1L1PA 4MNMA 3FAPA 4QT2A 1ITXA 1E6PA 1ROTA 1W9PA 3ARSA 1KT1A 1W26A 1GPFA 1W1VA 1ZBCA 3WQVA 1P5QA 1NH6A 4MSPA 1NWSA 2M08A 2MF9A 3EY6A 4JYSA 4PTMA 1D6OA 1D7HA 1M5YA 3UQBA 3ARWA 1F8AB 1LL7A 2EULA 1PBKA 1E6NA 1FKLA 1FKKA 3PRAA 4TNSA 3WQWA 1FKIA 2B31A 3O5QA 2FAPA 3EIPA 1Q6UA 1JNTA 4URIA 2OFNA 2XP3A 2K8IA 4ODPA 2FDMA 2F4EA 3WD4A 3CHDA 3UI6A 1GRJA 4IQ2A 4ODMA 3AS3A 1B6CA 1IX5A 4LAVA 4WJXA 1HJXA 1CTNA 2XPAA 3AS2A 4WKFA 4W9PA 5DEZA 3CZ8A 4MPKA 1H0IA 1ZCNA 3JYJA 2D9FA 2LKNA 4QT3A 3PRDA 5D75A 3O5KA 4G50A 5BXJA 4MNJA 1NSGA 4P8WA 4ZS6A 2PV1A 1HKKA 4LAXA 4DRHA 4WKAA 4WKHA 3RM4A 3KACA 2DT2A 2WLZA 3AQUA 3WD1A 2PPPA 1RD6A 1J6YA 1OWQA 1UR9A 1E6RA 3CHFA 2DT3A 3JXVA 1LJYA 4ODRA 3RFWA 3ARYA 1ZL1A 1E15A 5HTGA 4IT6A 4KR0B 4O2TA 1NWUA 4BF8A 4NSBA 1QZ2A 2DSZA 1WAWA 2M1IA 4LAYA 5GPGA 2ZQTA 5HW7A 3PA7A 5HKGA 3ARVA 3BMBA 4MNLA 1D7JA 3RM9A 2G41A 1TFVA 2Q5AA 1HXVA
chains in the Genus database with same CATH topology
1J4RA 2F2DA 3O5MA 5DO2A 2DG4A 3ARRA 4DWSC 2PV2A 2DT0A 2MPHA 1FKSA 4R0XA 4ODOA 4ZPWR 4TW8A 5DIVA 3ARQA 3IHZA 1LL4A 2LPVA 4Z2IA 1FAPA 1OGBA 4N19A 3I6CA 2RQSA 1VF8A 3OA5A 1K9TA 1WNOA 3OOBA 2O9OA 3AS0A 3PR9A 3TC5A 2RUCA 2MNTA 1KT0A 2LJ4A 4W5UA 2ZQSA 4TW6A 5I98A 1LG1A 2ZR5A 2OLHA 3JYMA 1SR0A 2UZ5A 1TCOC 1GOIA 1PINA 4IPXA 3O5JA 3WD0A 3W4RA 3KZ7A 4ITZA 3WD3A 4DZ2A 3CGNA 4XAKA 1W1YA 2XP7A 4TYOA 2IUZA 1EQ3A 2RUDA 4Q22A 4MGVA 3UI4A 3IKGA 4TW7A 1YATA 3KAFA 1JNEA 3UQIA 1OGGA 1NWRA 3ARUA 3FXYA 1FKDA 4P8UA 3PRBA 4IT4A 3TDBA 2ZQUA 1QPLA 1EIBA 4Z2GA 3H9RB 1FKGA 3NRKA 1J4HA 1JNDA 3AS1A 3B8SA 3RMEA 4JFMA 2QF8A 2AOSA 2KI3A 3O5RA 3KAHA 1E6ZA 1FKBA 1T11A 2KE0A 1HJWA 2XP5A 5B8IC 2PPOA 3O5IA 4JFKA 5GPRA 4DWSD 2XPBA 3NTPA 1W9UA 1JNSA 1EHNA 5JH8A 4U86A 2ZR6A 2F21A 1FKRA 1LG2A 4DRIA 5HWCA 4Z2JA 3B9DA 1FFRA 2KR7A 3WL1A 1FKFA 1XRVA 1Q1CA 4DT4A 3O5PA 1BL4A 3IK8A 4Q7NA 1ZB5A 3KABA 2RURA 1X6NA 5DIUA 5GQBA 3B7XA 4L3NA 4WK9A 2MLYA 3WL0A 4HBOA 1U79A 4G2PA 3MDYB 3ODKA 1HKIA 4ZPTR 3KAGA 5HWBA 4DRJA 2IF4A 4S3JA 3UI5A 1ZBKA 4R5EA 3O5OA 3ALFA 4J4OA 2DSVA 1FKTA 2RUQA 3WD2A 5HW8A 1W9VA 4ODLA 1FJDA 2WK2A 2XP9A 2YBTA 2JZVA 2M2AA 3KCEA 3TCZA 4QZVB 4HARA 4U85A 1W1TA 1ZBVA 3CHEA 3KADA 2AWGA 4JFJA 2ESCA 4C02B 2ZR4A 4LGXA 2G8ZA 2RSEA 1XHGA 3O5GA 1ROUA 2DSUA 3UF8A 5J6EA 4DWSA 4ZPVR 1A7XA 3GPKA 1FKJA 1R9HA 4LAWA 4DRNA 3ARZA 4AY1A 1FD9A 1N1AA 1Y0OA 1E9LA 5HUAA 2Y78A 1LL6A 3FY1A 2N87A 1JVWA 1EYMA 1Q6HA 2KO7A 3KAIA 2L2SA 4P8XA 4QIBA 4JFIA 1Q6IA 1EDQA 4Z2LA 2O92A 2WM0A 1O6IA 2PV3A 2A3EA 2PBCA 2VCDA 3WH0A 1HKJA 1KFWA 1GUVA 1X6LA 4MNKA 1FKHA 4ODNA 4DWSB 3CGMA 3NI6A 3IKDA 4DRPA 1NMWA 1LQ0A 3QOKA 4HBEA 2A3BA 5HBFA 2DPEA 4U84A 2DG3A 2XP4A 4KQZA 2VN1A 4DH0A 4FN2A 3O5FA 2DG9A 1HJVA 2XP8A 2XP6A 3RGCA 3CH9A 2PI6A 4J4NA 1WB0A 3O5LA 4DRMA 5HT1A 4DZ3A 1W1PA 4Z2KA 4L72B 4DRQA 1NMVA 1J4IA 3O5DA 1D7IA 4MAVA 1NWTA 4NNRA 4IQCA 4DIPA 4P8VA 4JFLA 4FAPA 2LGOA 5HW6A 1H0GA 2KFWA 3CHCA 4Z2HA 1FFQA 1ZK6A 3RM8A 1C9HA 3WKZA 4W9OA 4DROA 4ODQA 1F40A 3O5EA 3B9AA 3BXWA 2ITKA 3ARXA 1D2KA 2A3AA 1UR8A 5DF0A 5DITA 4MTVA 3VAWA 2PPNA 2MLZA 1SYTA 4ML4A 4DRKA 4TX0A 3UQAA 3LUOA 4ODKA 3ARPA 2DT1A 2KGJA 4W9QA 3WIJA 3G6MA 4GGQA 3AROA 1ZU8A 3ARTA 3B9EA 1QPFA 2YBUA 2ZQVA 3G6LA 1ZBWA 3ALGA 4GIVA 1YW5A 1HKMA 2DSWA 4S3KA 2MLXA 4WIWA 1BKFA 2FKEA 2A3CA 4NZCA 2WLYA 1L1PA 4MNMA 3FAPA 4QT2A 1ITXA 1E6PA 1ROTA 1W9PA 3ARSA 1KT1A 1W26A 1GPFA 1W1VA 1ZBCA 3WQVA 1P5QA 1NH6A 4MSPA 1NWSA 2M08A 2MF9A 3EY6A 4JYSA 4PTMA 1D6OA 1D7HA 1M5YA 3UQBA 3ARWA 1F8AB 1LL7A 1PBKA 1E6NA 1FKLA 1FKKA 3PRAA 4TNSA 3WQWA 1FKIA 2B31A 3O5QA 2FAPA 1Q6UA 1JNTA 4URIA 2OFNA 2XP3A 2K8IA 4ODPA 2FDMA 2F4EA 3WD4A 3CHDA 3UI6A 4IQ2A 4ODMA 3AS3A 1B6CA 1IX5A 4LAVA 4WJXA 1HJXA 1CTNA 2XPAA 3AS2A 4WKFA 4W9PA 5DEZA 3CZ8A 4MPKA 1H0IA 1ZCNA 3JYJA 2D9FA 2LKNA 4QT3A 3PRDA 5D75A 3O5KA 4G50A 5BXJA 4MNJA 1NSGA 4P8WA 4ZS6A 2PV1A 1HKKA 4LAXA 4DRHA 4WKAA 4WKHA 3RM4A 3KACA 2DT2A 2WLZA 3AQUA 3WD1A 2PPPA 1RD6A 1J6YA 1OWQA 1UR9A 1E6RA 3CHFA 2DT3A 3JXVA 1LJYA 4ODRA 3RFWA 3ARYA 1ZL1A 1E15A 5HTGA 4IT6A 4KR0B 4O2TA 1NWUA 4BF8A 4NSBA 1QZ2A 2DSZA 1WAWA 2M1IA 4LAYA 5GPGA 2ZQTA 5HW7A 3PA7A 5HKGA 3ARVA 4MNLA 1D7JA 3RM9A 2G41A 1TFVA 2Q5AA 1HXVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J4R A;  2F2D A;  2PV3 A;  3O5M A;  3FAP A;  4U86 A;  2ZR6 A;  2DG4 A;  2PBC A;  2VCD A;  4QT2 A;  3WH0 A;  1ROT A;  2F21 A;  1FKH A;  2PV2 A;  4ODN A;  3CGM A;  1KT1 A;  1W26 A;  1FKR A;  3NI6 A;  3IKD A;  4DRI A;  1NMW A;  4DRP A;  5HWC A;  2MPH A;  2KR7 A;  1FKF A;  1FKS A;  4R0X A;  1P5Q A;  1Q1C A;  4ODO A;  4DT4 A;  4MSP A;  3O5P A;  2M08 A;  4TW8 A;  2MF9 A;  3EY6 A;  5DIV A;  4JYS A;  1D6O A;  3IHZ A;  1BL4 A;  1D7H A;  2LPV A;  1M5Y A;  3IK8 A;  4U84 A;  2DG3 A;  2XP4 A;  3UQB A;  1F8A B;  2RUR A;  3KAB A;  5DIU A;  2VN1 A;  3B7X A;  1FAP A;  4N19 A;  3I6C A;  4DH0 A;  2MLY A;  2RQS A;  4FN2 A;  1PBK A;  3O5F A;  2DG9 A;  1FKK A;  1FKL A;  4TNS A;  1U79 A;  3OOB A;  4G2P A;  3MDY B;  1FKI A;  2XP8 A;  2XP6 A;  3O5Q A;  3ODK A;  2FAP A;  3RGC A;  4J4N A;  3TC5 A;  2RUC A;  3KAG A;  2MNT A;  3O5L A;  1Q6U A;  4DRM A;  1JNT A;  1KT0 A;  5HT1 A;  4DZ3 A;  2LJ4 A;  2OFN A;  2XP3 A;  5HWB A;  2K8I A;  2ZQS A;  4ODP A;  2F4E A;  4TW6 A;  3UI6 A;  4DRJ A;  4DRQ A;  4IQ2 A;  1NMV A;  5I98 A;  1J4I A;  2ZR5 A;  3O5D A;  4ODM A;  3JYM A;  1D7I A;  2IF4 A;  3UI5 A;  2UZ5 A;  1TCO C;  1B6C A;  4NNR A;  1PIN A;  4IQC A;  4DIP A;  3O5O A;  4J4O A;  4LAV A;  4IPX A;  4JFL A;  4FAP A;  1FKT A;  2LGO A;  2RUQ A;  2XPA A;  3O5J A;  5HW6 A;  5HW8 A;  4W9P A;  4ODL A;  2KFW A;  1FJD A;  3KZ7 A;  4ITZ A;  1ZCN A;  4DZ2 A;  2XP9 A;  3JYJ A;  2D9F A;  2LKN A;  4QT3 A;  3CGN A;  3PRD A;  2JZV A;  5D75 A;  2M2A A;  1ZK6 A;  3KCE A;  1C9H A;  3O5K A;  4G50 A;  2XP7 A;  4TYO A;  5BXJ A;  3TCZ A;  1NSG A;  1EQ3 A;  4W9O A;  2RUD A;  2PV1 A;  4U85 A;  4LAX A;  4DRO A;  4DRH A;  4MGV A;  3UI4 A;  4ODQ A;  3KAD A;  3IKG A;  4TW7 A;  1YAT A;  1F40 A;  3KAF A;  2AWG A;  3UQI A;  3O5E A;  3KAC A;  4JFJ A;  4C02 B;  2ITK A;  2PPP A;  2ZR4 A;  2RSE A;  1J6Y A;  1FKD A;  5DIT A;  3O5G A;  1ROU A;  3PRB A;  3VAW A;  2PPN A;  3TDB A;  2ZQU A;  2MLZ A;  1QPL A;  3JXV A;  4ODR A;  3RFW A;  3UF8 A;  4DRK A;  4TX0 A;  5J6E A;  3UQA A;  5HTG A;  3LUO A;  4ODK A;  3H9R B;  4O2T A;  1A7X A;  3GPK A;  1FKJ A;  1FKG A;  4BF8 A;  1R9H A;  3NRK A;  2KGJ A;  4LAW A;  1QZ2 A;  1J4H A;  4W9Q A;  2M1I A;  4GGQ A;  4LAY A;  4DRN A;  5GPG A;  2ZQT A;  1FD9 A;  4JFM A;  5HW7 A;  1N1A A;  1QPF A;  2ZQV A;  1Y0O A;  3O5R A;  2KI3 A;  5HUA A;  3KAH A;  3PA7 A;  2Y78 A;  1FKB A;  1T11 A;  5HKG A;  2KE0 A;  2XP5 A;  2N87 A;  4GIV A;  5B8I C;  1JVW A;  2PPO A;  1EYM A;  1YW5 A;  1Q6H A;  2KO7 A;  3O5I A;  4JFK A;  3KAI A;  2L2S A;  1D7J A;  2XPB A;  4QIB A;  4JFI A;  3NTP A;  1Q6I A;  2MLX A;  2Q5A A;  1BKF A;  1JNS A;  2FKE A;  1HXV A;  1L1P A; 
#chains in the Genus database with same CATH topology
 1J4R A;  2F2D A;  3O5M A;  5DO2 A;  2DG4 A;  3ARR A;  4DWS C;  2PV2 A;  2DT0 A;  2MPH A;  1FKS A;  4R0X A;  4ODO A;  4ZPW R;  4TW8 A;  5DIV A;  3ARQ A;  3IHZ A;  1LL4 A;  2LPV A;  4Z2I A;  1FAP A;  1OGB A;  4N19 A;  3I6C A;  3GTY X;  2RQS A;  1VF8 A;  3OA5 A;  1K9T A;  1WNO A;  3OOB A;  2O9O A;  3AS0 A;  3PR9 A;  3TC5 A;  2RUC A;  2MNT A;  1KT0 A;  2LJ4 A;  4W5U A;  2ZQS A;  4TW6 A;  5I98 A;  1LG1 A;  2ZR5 A;  2OLH A;  2P4V A;  3JYM A;  1SR0 A;  2UZ5 A;  1TCO C;  1GOI A;  1PIN A;  4IPX A;  3O5J A;  3WD0 A;  3W4R A;  3KZ7 A;  4ITZ A;  3WD3 A;  4DZ2 A;  3CGN A;  4XAK A;  1W1Y A;  2XP7 A;  4TYO A;  2IUZ A;  1EQ3 A;  2RUD A;  4Q22 A;  4MGV A;  3UI4 A;  3IKG A;  4TW7 A;  1YAT A;  3KAF A;  1JNE A;  3UQI A;  1OGG A;  1NWR A;  3ARU A;  3FXY A;  1FKD A;  4P8U A;  3GU0 A;  3PRB A;  4IT4 A;  3TDB A;  2ZQU A;  1QPL A;  1EIB A;  4Z2G A;  3H9R B;  1FKG A;  3NRK A;  1J4H A;  1JND A;  3AS1 A;  3B8S A;  3RME A;  4JFM A;  2QF8 A;  1E44 A;  2AOS A;  2KI3 A;  3O5R A;  3KAH A;  1E6Z A;  1FKB A;  1T11 A;  2KE0 A;  1HJW A;  2XP5 A;  5B8I C;  2PPO A;  3O5I A;  4JFK A;  5GPR A;  4DWS D;  2XPB A;  3NTP A;  1W9U A;  1JNS A;  1EHN A;  5JH8 A;  4U86 A;  2ZR6 A;  2F21 A;  1FKR A;  1LG2 A;  4DRI A;  5HWC A;  4Z2J A;  3B9D A;  1FFR A;  2KR7 A;  3WL1 A;  1FKF A;  1XRV A;  1Q1C A;  4DT4 A;  3O5P A;  1BL4 A;  3IK8 A;  4Q7N A;  1ZB5 A;  3KAB A;  2RUR A;  1X6N A;  5DIU A;  5GQB A;  3B7X A;  4L3N A;  4WK9 A;  2MLY A;  3WL0 A;  4HBO A;  1U79 A;  4G2P A;  3MDY B;  3ODK A;  1HKI A;  4ZPT R;  3KAG A;  5HWB A;  4DRJ A;  2IF4 A;  4S3J A;  3UI5 A;  1ZBK A;  4R5E A;  2B5U B;  3O5O A;  3ALF A;  4J4O A;  2DSV A;  1FKT A;  2RUQ A;  3WD2 A;  5HW8 A;  1W9V A;  4ODL A;  1FJD A;  2WK2 A;  2XP9 A;  4UDM A;  2YBT A;  2JZV A;  2M2A A;  3KCE A;  1JCH B;  3TCZ A;  4QZV B;  4HAR A;  4U85 A;  1W1T A;  1ZBV A;  3CHE A;  3KAD A;  2AWG A;  4JFJ A;  2ESC A;  4C02 B;  2ZR4 A;  4LGX A;  2G8Z A;  2RSE A;  1XHG A;  3O5G A;  1ROU A;  2DSU A;  3UF8 A;  5J6E A;  4DWS A;  4ZPV R;  1A7X A;  3GPK A;  1FKJ A;  1R9H A;  4LAW A;  4DRN A;  3ARZ A;  4AY1 A;  1FD9 A;  1N1A A;  1Y0O A;  1E9L A;  2ETN A;  5HUA A;  2Y78 A;  1LL6 A;  3FY1 A;  2N87 A;  1JVW A;  1EYM A;  1Q6H A;  2KO7 A;  3KAI A;  2L2S A;  4P8X A;  4QIB A;  4JFI A;  1Q6I A;  1EDQ A;  4Z2L A;  2O92 A;  2WM0 A;  1O6I A;  2PV3 A;  2A3E A;  2PBC A;  2VCD A;  3WH0 A;  1HKJ A;  1KFW A;  1GUV A;  1X6L A;  4MNK A;  1FKH A;  4ODN A;  4DWS B;  3CGM A;  3NI6 A;  3IKD A;  4DRP A;  1NMW A;  1LQ0 A;  3QOK A;  4HBE A;  2A3B A;  5HBF A;  2DPE A;  4U84 A;  2DG3 A;  2XP4 A;  4KQZ A;  2VN1 A;  4DH0 A;  4FN2 A;  3O5F A;  2DG9 A;  1HJV A;  2XP8 A;  2XP6 A;  3RGC A;  3CH9 A;  2PI6 A;  4J4N A;  1WB0 A;  3O5L A;  4DRM A;  5HT1 A;  4DZ3 A;  2PN0 A;  1W1P A;  4Z2K A;  4L72 B;  4DRQ A;  1NMV A;  1J4I A;  3O5D A;  1D7I A;  4MAV A;  1NWT A;  4NNR A;  4IQC A;  4DIP A;  4P8V A;  4JFL A;  4FAP A;  2LGO A;  5HW6 A;  1H0G A;  2KFW A;  3CHC A;  4Z2H A;  1FFQ A;  1ZK6 A;  3RM8 A;  1C9H A;  3WKZ A;  4W9O A;  4DRO A;  4ODQ A;  1F40 A;  3O5E A;  3B9A A;  3BXW A;  2ITK A;  3ARX A;  1D2K A;  2A3A A;  1UR8 A;  5DF0 A;  5DIT A;  4MTV A;  3VAW A;  2PPN A;  2MLZ A;  1SYT A;  4ML4 A;  4DRK A;  4TX0 A;  3UQA A;  3LUO A;  4ODK A;  3ARP A;  2DT1 A;  2KGJ A;  4W9Q A;  3WIJ A;  3G6M A;  4GGQ A;  3ARO A;  1ZU8 A;  3ART A;  3B9E A;  1QPF A;  2YBU A;  2ZQV A;  3G6L A;  1ZBW A;  2F23 A;  3ALG A;  4GIV A;  1YW5 A;  1HKM A;  2DSW A;  4S3K A;  2MLX A;  4WIW A;  1BKF A;  2FKE A;  2A3C A;  4NZC A;  2WLY A;  1L1P A;  4MNM A;  3FAP A;  4QT2 A;  1ITX A;  1E6P A;  1ROT A;  1W9P A;  3ARS A;  1KT1 A;  1W26 A;  1GPF A;  1W1V A;  1ZBC A;  3WQV A;  1P5Q A;  1NH6 A;  4MSP A;  1NWS A;  2M08 A;  2MF9 A;  3EY6 A;  4JYS A;  4PTM A;  1D6O A;  1D7H A;  1M5Y A;  3UQB A;  3ARW A;  1F8A B;  1LL7 A;  2EUL A;  1PBK A;  1E6N A;  1FKL A;  1FKK A;  3PRA A;  4TNS A;  3WQW A;  1FKI A;  2B31 A;  3O5Q A;  2FAP A;  3EIP A;  1Q6U A;  1JNT A;  4URI A;  2OFN A;  2XP3 A;  2K8I A;  4ODP A;  2FDM A;  2F4E A;  3WD4 A;  3CHD A;  3UI6 A;  1GRJ A;  4IQ2 A;  4ODM A;  3AS3 A;  1B6C A;  1IX5 A;  4LAV A;  4WJX A;  1HJX A;  1CTN A;  2XPA A;  3AS2 A;  4WKF A;  4W9P A;  5DEZ A;  3CZ8 A;  4MPK A;  1H0I A;  1ZCN A;  3JYJ A;  2D9F A;  2LKN A;  4QT3 A;  3PRD A;  5D75 A;  3O5K A;  4G50 A;  5BXJ A;  4MNJ A;  1NSG A;  4P8W A;  4ZS6 A;  2PV1 A;  1HKK A;  4LAX A;  4DRH A;  4WKA A;  4WKH A;  3RM4 A;  3KAC A;  2DT2 A;  2WLZ A;  3AQU A;  3WD1 A;  2PPP A;  1RD6 A;  1J6Y A;  1OWQ A;  1UR9 A;  1E6R A;  3CHF A;  2DT3 A;  3JXV A;  1LJY A;  4ODR A;  3RFW A;  3ARY A;  1ZL1 A;  1E15 A;  5HTG A;  4IT6 A;  4KR0 B;  4O2T A;  1NWU A;  4BF8 A;  4NSB A;  1QZ2 A;  2DSZ A;  1WAW A;  2M1I A;  4LAY A;  5GPG A;  2ZQT A;  5HW7 A;  3PA7 A;  5HKG A;  3ARV A;  3BMB A;  4MNL A;  1D7J A;  3RM9 A;  2G41 A;  1TFV A;  2Q5A A;  1HXV A; 
#chains in the Genus database with same CATH homology
 1J4R A;  2F2D A;  3O5M A;  5DO2 A;  2DG4 A;  3ARR A;  4DWS C;  2PV2 A;  2DT0 A;  2MPH A;  1FKS A;  4R0X A;  4ODO A;  4ZPW R;  4TW8 A;  5DIV A;  3ARQ A;  3IHZ A;  1LL4 A;  2LPV A;  4Z2I A;  1FAP A;  1OGB A;  4N19 A;  3I6C A;  2RQS A;  1VF8 A;  3OA5 A;  1K9T A;  1WNO A;  3OOB A;  2O9O A;  3AS0 A;  3PR9 A;  3TC5 A;  2RUC A;  2MNT A;  1KT0 A;  2LJ4 A;  4W5U A;  2ZQS A;  4TW6 A;  5I98 A;  1LG1 A;  2ZR5 A;  2OLH A;  3JYM A;  1SR0 A;  2UZ5 A;  1TCO C;  1GOI A;  1PIN A;  4IPX A;  3O5J A;  3WD0 A;  3W4R A;  3KZ7 A;  4ITZ A;  3WD3 A;  4DZ2 A;  3CGN A;  4XAK A;  1W1Y A;  2XP7 A;  4TYO A;  2IUZ A;  1EQ3 A;  2RUD A;  4Q22 A;  4MGV A;  3UI4 A;  3IKG A;  4TW7 A;  1YAT A;  3KAF A;  1JNE A;  3UQI A;  1OGG A;  1NWR A;  3ARU A;  3FXY A;  1FKD A;  4P8U A;  3PRB A;  4IT4 A;  3TDB A;  2ZQU A;  1QPL A;  1EIB A;  4Z2G A;  3H9R B;  1FKG A;  3NRK A;  1J4H A;  1JND A;  3AS1 A;  3B8S A;  3RME A;  4JFM A;  2QF8 A;  2AOS A;  2KI3 A;  3O5R A;  3KAH A;  1E6Z A;  1FKB A;  1T11 A;  2KE0 A;  1HJW A;  2XP5 A;  5B8I C;  2PPO A;  3O5I A;  4JFK A;  5GPR A;  4DWS D;  2XPB A;  3NTP A;  1W9U A;  1JNS A;  1EHN A;  5JH8 A;  4U86 A;  2ZR6 A;  2F21 A;  1FKR A;  1LG2 A;  4DRI A;  5HWC A;  4Z2J A;  3B9D A;  1FFR A;  2KR7 A;  3WL1 A;  1FKF A;  1XRV A;  1Q1C A;  4DT4 A;  3O5P A;  1BL4 A;  3IK8 A;  4Q7N A;  1ZB5 A;  3KAB A;  2RUR A;  1X6N A;  5DIU A;  5GQB A;  3B7X A;  4L3N A;  4WK9 A;  2MLY A;  3WL0 A;  4HBO A;  1U79 A;  4G2P A;  3MDY B;  3ODK A;  1HKI A;  4ZPT R;  3KAG A;  5HWB A;  4DRJ A;  2IF4 A;  4S3J A;  3UI5 A;  1ZBK A;  4R5E A;  3O5O A;  3ALF A;  4J4O A;  2DSV A;  1FKT A;  2RUQ A;  3WD2 A;  5HW8 A;  1W9V A;  4ODL A;  1FJD A;  2WK2 A;  2XP9 A;  2YBT A;  2JZV A;  2M2A A;  3KCE A;  3TCZ A;  4QZV B;  4HAR A;  4U85 A;  1W1T A;  1ZBV A;  3CHE A;  3KAD A;  2AWG A;  4JFJ A;  2ESC A;  4C02 B;  2ZR4 A;  4LGX A;  2G8Z A;  2RSE A;  1XHG A;  3O5G A;  1ROU A;  2DSU A;  3UF8 A;  5J6E A;  4DWS A;  4ZPV R;  1A7X A;  3GPK A;  1FKJ A;  1R9H A;  4LAW A;  4DRN A;  3ARZ A;  4AY1 A;  1FD9 A;  1N1A A;  1Y0O A;  1E9L A;  5HUA A;  2Y78 A;  1LL6 A;  3FY1 A;  2N87 A;  1JVW A;  1EYM A;  1Q6H A;  2KO7 A;  3KAI A;  2L2S A;  4P8X A;  4QIB A;  4JFI A;  1Q6I A;  1EDQ A;  4Z2L A;  2O92 A;  2WM0 A;  1O6I A;  2PV3 A;  2A3E A;  2PBC A;  2VCD A;  3WH0 A;  1HKJ A;  1KFW A;  1GUV A;  1X6L A;  4MNK A;  1FKH A;  4ODN A;  4DWS B;  3CGM A;  3NI6 A;  3IKD A;  4DRP A;  1NMW A;  1LQ0 A;  3QOK A;  4HBE A;  2A3B A;  5HBF A;  2DPE A;  4U84 A;  2DG3 A;  2XP4 A;  4KQZ A;  2VN1 A;  4DH0 A;  4FN2 A;  3O5F A;  2DG9 A;  1HJV A;  2XP8 A;  2XP6 A;  3RGC A;  3CH9 A;  2PI6 A;  4J4N A;  1WB0 A;  3O5L A;  4DRM A;  5HT1 A;  4DZ3 A;  1W1P A;  4Z2K A;  4L72 B;  4DRQ A;  1NMV A;  1J4I A;  3O5D A;  1D7I A;  4MAV A;  1NWT A;  4NNR A;  4IQC A;  4DIP A;  4P8V A;  4JFL A;  4FAP A;  2LGO A;  5HW6 A;  1H0G A;  2KFW A;  3CHC A;  4Z2H A;  1FFQ A;  1ZK6 A;  3RM8 A;  1C9H A;  3WKZ A;  4W9O A;  4DRO A;  4ODQ A;  1F40 A;  3O5E A;  3B9A A;  3BXW A;  2ITK A;  3ARX A;  1D2K A;  2A3A A;  1UR8 A;  5DF0 A;  5DIT A;  4MTV A;  3VAW A;  2PPN A;  2MLZ A;  1SYT A;  4ML4 A;  4DRK A;  4TX0 A;  3UQA A;  3LUO A;  4ODK A;  3ARP A;  2DT1 A;  2KGJ A;  4W9Q A;  3WIJ A;  3G6M A;  4GGQ A;  3ARO A;  1ZU8 A;  3ART A;  3B9E A;  1QPF A;  2YBU A;  2ZQV A;  3G6L A;  1ZBW A;  3ALG A;  4GIV A;  1YW5 A;  1HKM A;  2DSW A;  4S3K A;  2MLX A;  4WIW A;  1BKF A;  2FKE A;  2A3C A;  4NZC A;  2WLY A;  1L1P A;  4MNM A;  3FAP A;  4QT2 A;  1ITX A;  1E6P A;  1ROT A;  1W9P A;  3ARS A;  1KT1 A;  1W26 A;  1GPF A;  1W1V A;  1ZBC A;  3WQV A;  1P5Q A;  1NH6 A;  4MSP A;  1NWS A;  2M08 A;  2MF9 A;  3EY6 A;  4JYS A;  4PTM A;  1D6O A;  1D7H A;  1M5Y A;  3UQB A;  3ARW A;  1F8A B;  1LL7 A;  1PBK A;  1E6N A;  1FKL A;  1FKK A;  3PRA A;  4TNS A;  3WQW A;  1FKI A;  2B31 A;  3O5Q A;  2FAP A;  1Q6U A;  1JNT A;  4URI A;  2OFN A;  2XP3 A;  2K8I A;  4ODP A;  2FDM A;  2F4E A;  3WD4 A;  3CHD A;  3UI6 A;  4IQ2 A;  4ODM A;  3AS3 A;  1B6C A;  1IX5 A;  4LAV A;  4WJX A;  1HJX A;  1CTN A;  2XPA A;  3AS2 A;  4WKF A;  4W9P A;  5DEZ A;  3CZ8 A;  4MPK A;  1H0I A;  1ZCN A;  3JYJ A;  2D9F A;  2LKN A;  4QT3 A;  3PRD A;  5D75 A;  3O5K A;  4G50 A;  5BXJ A;  4MNJ A;  1NSG A;  4P8W A;  4ZS6 A;  2PV1 A;  1HKK A;  4LAX A;  4DRH A;  4WKA A;  4WKH A;  3RM4 A;  3KAC A;  2DT2 A;  2WLZ A;  3AQU A;  3WD1 A;  2PPP A;  1RD6 A;  1J6Y A;  1OWQ A;  1UR9 A;  1E6R A;  3CHF A;  2DT3 A;  3JXV A;  1LJY A;  4ODR A;  3RFW A;  3ARY A;  1ZL1 A;  1E15 A;  5HTG A;  4IT6 A;  4KR0 B;  4O2T A;  1NWU A;  4BF8 A;  4NSB A;  1QZ2 A;  2DSZ A;  1WAW A;  2M1I A;  4LAY A;  5GPG A;  2ZQT A;  5HW7 A;  3PA7 A;  5HKG A;  3ARV A;  4MNL A;  1D7J A;  3RM9 A;  2G41 A;  1TFV A;  2Q5A A;  1HXV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...