1NSGA

The structure of the immunophilin-immunosuppressant fkbp12-rapamycin complex interacting with human frap
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined structure of the FKBP12-rapamycin-FRB ternary complex at 2.2 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (isomerase/kinase)
molecule keywords FK506-BINDING PROTEIN
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1997-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1nsgA00
1QZ2A 2F21A 4U84A 1BL4A 1FKDA 4TW8A 3NRKA 1B6CA 2XP9A 1F40A 3IK8A 4ODQA 1YW5A 1FKKA 4ODRA 2M1IA 3KAIA 3PRBA 5I98A 3O5QA 2ZR5A 5DIUA 2LKNA 4TX0A 4GIVA 1FJDA 1QPLA 2M08A 1JNTA 3OOBA 4W9QA 3UF8A 1M5YA 3PRDA 1N1AA 3UQBA 4DRPA 1QPFA 2XPAA 1D6OA 4N19A 4DRJA 1L1PA 2PPPA 3KZ7A 4BF8A 1FKIA 2DG3A 5HT1A 4DT4A 2MNTA 3IKDA 4G50A 2RUCA 3KACA 1BKFA 1FKLA 1W26A 2ZQUA 4JFKA 3I6CA 4ODLA 4DRMA 5BXJA 4ODMA 4LAXA 2ZR4A 3O5IA 4GGQA 3TDBA 5HKGA 4ODNA 1YATA 2XP7A 1R9HA 2Y78A 3JYJA 5J6EA 4QIBA 3UI5A 3FAPA 2ITKA 1P5QA 2L2SA 1FD9A 3O5EA 3KAGA 2PV1A 4J4NA 2KI3A 1C9HA 1Q6IA 2ZR6A 1EYMA 1J4IA 2PPNA 1KT0A 3O5PA 2VN1A 2MPHA 2Q5AA 1D7HA 4FAPA 2N87A 3IKGA 1FKSA 2PPOA 4LAYA 1ZK6A 2XP6A 3ODKA 3UQIA 4DZ2A 5HW7A 2JZVA 1Q1CA 3O5DA 2XPBA 1FKHA 2VCDA 4JFMA 4ODPA 2FAPA 1KT1A 3O5RA 4DRHA 2XP4A 2ZQVA 4DROA 2KO7A 3JXVA 3KABA 2LJ4A 4JFJA 3GPKA 5DIVA 1D7JA 2LPVA 2KGJA 3CGMA 1FKFA 1U79A 3O5MA 2MLYA 3UI4A 4O2TA 4U86A 1FKGA 3O5LA 2M2AA 3KADA 2KE0A 4TNSA 4TYOA 4W9OA 2ZQTA 2K8IA 3O5GA 4QT2A 1TCOC 3KCEA 3O5JA 1HXVA 1PINA 5HWBA 4W9PA 3TC5A 4TW7A 3EY6A 4DRNA 2RURA 4IQ2A 1D7IA 4J4OA 2DG9A 1ZCNA 2RSEA 2RUDA 4QT3A 5HWCA 2RUQA 3CGNA 2D9FA 5DITA 1FKJA 1JVWA 1FAPA 2PV2A 2XP8A 2LGOA 3PA7A 3MDYB 1NSGA 1NMWA 4IQCA 3TCZA 2IF4A 1ROTA 5HTGA 4C02B 5B8IC 1FKBA 4G2PA 3RGCA 2FKEA 3O5FA 1JNSA 2MF9A 3B7XA 5HUAA 2MLXA 4DRQA 5HW8A 4ODKA 4TW6A 2ZQSA 3IHZA 2OFNA 3LUOA 2KFWA 4DZ3A 1PBKA 4JFIA 1FKTA 2PV3A 1J4HA 4JYSA 4ODOA 3UQAA 1T11A 3H9RB 4MSPA 3KAHA 2MLZA 2XP3A 2PBCA 3KAFA 3WH0A 3O5KA 4NNRA 4LAVA 4LAWA 4R0XA 2RQSA 4JFLA 5GPGA 1NMVA 3NTPA 1ROUA 4FN2A 1Y0OA 3RFWA 1J6YA 1A7XA 4DH0A 1Q6UA 4IPXA 4DRIA 1FKRA 2F2DA 2AWGA 3UI6A 4U85A 2XP5A 4DRKA 1EQ3A 1F8AB 5HW6A 2UZ5A 2F4EA 1J4RA 4ITZA 3O5OA 3NI6A 5D75A 4DIPA 1Q6HA 3VAWA 2DG4A 2KR7A 3JYMA 4MGVA
chains in the Genus database with same CATH superfamily
1W9VA 3FY1A 1FKDA 1B6CA 2OLHA 2WM0A 3IK8A 1YW5A 2M1IA 1HKIA 4Z2GA 5I98A 3G6MA 2DSZA 2M08A 3OOBA 1K9TA 4W9QA 3WD1A 1ZB5A 1E6NA 1M5YA 2DT3A 4DRJA 3WL0A 4BF8A 3G6LA 5HT1A 3IKDA 4G50A 3KACA 1FKLA 1W26A 4WKHA 4DRMA 4ODMA 2ZR4A 3ARRA 1W9PA 4ODNA 2XP7A 2Y78A 5J6EA 3UI5A 1P5QA 1GPFA 1EDQA 2L2SA 3O5PA 2DT0A 1FKSA 4IT4A 3UQIA 1ZBKA 1LQ0A 1HJXA 2ZQVA 2LJ4A 4JFJA 3GPKA 1E9LA 3EIPA 1D7JA 2KGJA 3CGMA 1SR0A 3UI4A 1FKGA 2M2AA 1FFQA 3KADA 4TYOA 2ZQTA 3BMBA 4XAKA 4QT2A 3KCEA 2WLZA 5HWBA 4W9PA 4DRNA 2RURA 4P8WA 2A3EA 2O92A 2RUQA 1X6NA 1FAPA 3MDYB 1H0GA 3B9AA 4KR0B 4G2PA 4ZPWR 1JNSA 2MLXA 4MAVA 4P8UA 4TW6A 3ARSA 3ARTA 3ARQA 4DWSB 4MSPA 2MLZA 2XP3A 3WH0A 3O5KA 5GPRA 3PR9A 4LAVA 1E6PA 3WIJA 3RFWA 1ROUA 4WIWA 1J6YA 1NH6A 4DRIA 1W1PA 3UI6A 4DRKA 2XP5A 1LG2A 5HW6A 4Q22A 3O5OA 4MTVA 3ALGA 1WNOA 4MGVA 5HKGA 1BL4A 4TW8A 3NRKA 1GOIA 4ODRA 1CTNA 1FKKA 3PRBA 1JCHB 3O5QA 5DIUA 4LGXA 3ARZA 4TX0A 3QOKA 4GIVA 1FJDA 1HKJA 4HBEA 1QPLA 4NZCA 1JNTA 2PN0A 3WD4A 4DWSD 1GRJA 1ZBVA 1EHNA 2XPAA 5DO2A 4N19A 3KZ7A 2DG3A 2G41A 4IT6A 1BKFA 4ODLA 4LAXA 1XHGA 3B9DA 1FD9A 2KI3A 2PPNA 1KT0A 3B8SA 2MPHA 4FAPA 2N87A 4LAYA 4DWSA 1ZK6A 3ALFA 3ODKA 5HW7A 2JZVA 4JFMA 2VCDA 1JNEA 4DROA 3JXVA 5DIVA 2LPVA 4Z2LA 1E6RA 4WJXA 3GTYX 2MLYA 3BXWA 1EIBA 4TNSA 4W9OA 3O5GA 2G8ZA 4IQ2A 4J4OA 1LG1A 1E6ZA 4HARA 3CGNA 4ZPTR 5DITA 4IQCA 2XP8A 3TCZA 1NMWA 1ROTA 4ML4A 4C02B 3RGCA 3O5FA 2MF9A 2IUZA 4NSBA 2P4VA 5HUAA 1FFRA 2DT1A 2F23A 2OFNA 2KFWA 1FKTA 2A3AA 1X6LA 3UQAA 4W5UA 3KAHA 2PBCA 1H0IA 4NNRA 1W1TA 4R0XA 2RQSA 2QF8A 2B31A 1NMVA 1VF8A 4FN2A 3CHCA 1D2KA 1A7XA 1FKRA 4IPXA 2F2DA 1HJVA 3CHDA 4DWSC 1J4RA 3VAWA 2ETNA 1QZ2A 1W1YA 2DPEA 2XP9A 4ZS6A 1F40A 3RMEA 1OGGA 1NWSA 1W1VA 4HBOA 3AQUA 3ARYA 4URIA 3UF8A 1ITXA 1ZU8A 1QPFA 4DRPA 1L1PA 3FXYA 4DT4A 2DT2A 1NWUA 4MNLA 2ZQUA 5BXJA 4S3KA 4GGQA 4UDMA 2ITKA 3KAGA 4MNKA 2ZR6A 1J4IA 1D7HA 3ARUA 2PPOA 2XP6A 3O5DA 1FKHA 1HKMA 4ODPA 4DRHA 3OA5A 2XP4A 2KO7A 1FKFA 1U79A 1E44A 3O5MA 4O2TA 2PI6A 1ZL1A 2KE0A 1RD6A 3CHFA 1TCOC 3WD0A 3O5JA 1WAWA 3TC5A 1ZBCA 3EY6A 1IX5A 3ARXA 4Q7NA 1D7IA 2DSWA 2DG9A 4QT3A 2RSEA 2AOSA 3WL1A 3WKZA 4WKAA 2D9FA 2PV2A 1UR9A 3PA7A 1NSGA 3RM8A 5B8IC 4KQZA 3RM4A 2A3CA 2FKEA 5HW8A 2O9OA 2ZQSA 3IHZA 3LUOA 4PTMA 1PBKA 4P8VA 2PV3A 4ODOA 1T11A 3H9RB 2ESCA 2YBTA 3KAFA 4LAWA 4JFLA 3W4RA 3NTPA 1Y0OA 2FDMA 4AY1A 1Q6UA 1WB0A 2UZ5A 5D75A 4ITZA 1ZBWA 4DIPA 1Q6HA 2A3BA 2DG4A 1TFVA 3WD2A 2KR7A 1ZCNA 3JYMA 2F21A 4U84A 2WLYA 4ODQA 1JNDA 3KAIA 2ZR5A 3GU0A 2LKNA 3PRDA 1N1AA 3UQBA 1OGBA 1D6OA 1LL6A 2PPPA 1FKIA 3ARWA 4MPKA 2MNTA 3ARVA 2RUCA 1W9UA 5DEZA 4JFKA 3I6CA 4Z2HA 3O5IA 3TDBA 2DSUA 1YATA 3JYJA 1R9HA 4QIBA 3FAPA 3RM9A 1LL4A 3O5EA 2PV1A 4J4NA 4ZPVR 1SYTA 1C9HA 1Q6IA 1EYMA 3CHEA 2VN1A 1O6IA 2DSVA 3ARPA 3AROA 3AS2A 2Q5AA 3CH9A 3WQVA 3IKGA 4S3JA 2WK2A 3WD3A 4Z2JA 4Z2KA 5GQBA 5JH8A 4DZ2A 1Q1CA 3AS0A 2XPBA 4R5EA 2FAPA 1KT1A 3O5RA 4Z2IA 3KABA 3CZ8A 1GUVA 1HJWA 1XRVA 4WK9A 4U86A 3O5LA 4QZVB 4P8XA 5DF0A 2K8IA 1HXVA 1PINA 4TW7A 4WKFA 2EULA 3AS3A 1LL7A 2RUDA 5HBFA 5HWCA 1FKJA 1JVWA 2LGOA 2YBUA 1HKKA 2IF4A 5HTGA 1FKBA 3WQWA 3B7XA 4L3NA 1NWRA 1LJYA 4DRQA 4ODKA 2B5UB 4L72B 1NWTA 4DZ3A 4JFIA 1J4HA 4JYSA 3AS1A 4MNJA 3PRAA 5GPGA 4DH0A 4MNMA 2AWGA 4U85A 1EQ3A 1F8AB 2F4EA 1OWQA 3B9EA 3NI6A 1KFWA 1UR8A 1E15A
chains in the Genus database with same CATH topology
1W9VA 3FY1A 1FKDA 1B6CA 2OLHA 2WM0A 3IK8A 1YW5A 2M1IA 1HKIA 4Z2GA 5I98A 3G6MA 2DSZA 2M08A 3OOBA 1K9TA 4W9QA 3WD1A 1ZB5A 1E6NA 1M5YA 2DT3A 4DRJA 3WL0A 4BF8A 3G6LA 5HT1A 3IKDA 4G50A 3KACA 1FKLA 1W26A 4WKHA 4DRMA 4ODMA 2ZR4A 3ARRA 1W9PA 4ODNA 2XP7A 2Y78A 5J6EA 3UI5A 1P5QA 1GPFA 1EDQA 2L2SA 3O5PA 2DT0A 1FKSA 4IT4A 3UQIA 1ZBKA 1LQ0A 1HJXA 2ZQVA 2LJ4A 4JFJA 3GPKA 1E9LA 1D7JA 2KGJA 3CGMA 1SR0A 3UI4A 1FKGA 2M2AA 1FFQA 3KADA 4TYOA 2ZQTA 4XAKA 4QT2A 3KCEA 2WLZA 5HWBA 4W9PA 4DRNA 2RURA 4P8WA 2A3EA 2O92A 2RUQA 1X6NA 1FAPA 3MDYB 1H0GA 3B9AA 4KR0B 4G2PA 4ZPWR 1JNSA 2MLXA 4MAVA 4P8UA 4TW6A 3ARSA 3ARTA 3ARQA 4DWSB 4MSPA 2MLZA 2XP3A 3WH0A 3O5KA 5GPRA 3PR9A 4LAVA 1E6PA 3WIJA 3RFWA 1ROUA 4WIWA 1J6YA 1NH6A 4DRIA 1W1PA 3UI6A 4DRKA 2XP5A 1LG2A 5HW6A 4Q22A 3O5OA 4MTVA 3ALGA 1WNOA 4MGVA 5HKGA 1BL4A 4TW8A 3NRKA 1GOIA 4ODRA 1CTNA 1FKKA 3PRBA 3O5QA 5DIUA 4LGXA 3ARZA 4TX0A 3QOKA 4GIVA 1FJDA 1HKJA 4HBEA 1QPLA 4NZCA 1JNTA 3WD4A 4DWSD 1ZBVA 1EHNA 2XPAA 5DO2A 4N19A 3KZ7A 2DG3A 2G41A 4IT6A 1BKFA 4ODLA 4LAXA 1XHGA 3B9DA 1FD9A 2KI3A 2PPNA 1KT0A 3B8SA 2MPHA 4FAPA 2N87A 4LAYA 4DWSA 1ZK6A 3ALFA 3ODKA 5HW7A 2JZVA 4JFMA 2VCDA 1JNEA 4DROA 3JXVA 5DIVA 2LPVA 4Z2LA 1E6RA 4WJXA 2MLYA 3BXWA 1EIBA 4TNSA 4W9OA 3O5GA 2G8ZA 4IQ2A 4J4OA 1LG1A 1E6ZA 4HARA 3CGNA 4ZPTR 5DITA 4IQCA 2XP8A 3TCZA 1NMWA 1ROTA 4ML4A 4C02B 3RGCA 3O5FA 2MF9A 2IUZA 4NSBA 5HUAA 1FFRA 2DT1A 2OFNA 2KFWA 1FKTA 2A3AA 1X6LA 3UQAA 4W5UA 3KAHA 2PBCA 1H0IA 4NNRA 1W1TA 4R0XA 2RQSA 2QF8A 2B31A 1NMVA 1VF8A 4FN2A 3CHCA 1D2KA 1A7XA 1FKRA 4IPXA 2F2DA 1HJVA 3CHDA 4DWSC 1J4RA 3VAWA 1QZ2A 1W1YA 2DPEA 2XP9A 4ZS6A 1F40A 3RMEA 1OGGA 1NWSA 1W1VA 4HBOA 3AQUA 3ARYA 4URIA 3UF8A 1ITXA 1ZU8A 1QPFA 4DRPA 1L1PA 3FXYA 4DT4A 2DT2A 1NWUA 4MNLA 2ZQUA 5BXJA 4S3KA 4GGQA 2ITKA 3KAGA 4MNKA 2ZR6A 1J4IA 1D7HA 3ARUA 2PPOA 2XP6A 3O5DA 1FKHA 1HKMA 4ODPA 4DRHA 3OA5A 2XP4A 2KO7A 1FKFA 1U79A 3O5MA 4O2TA 2PI6A 1ZL1A 2KE0A 1RD6A 3CHFA 1TCOC 3WD0A 3O5JA 1WAWA 3TC5A 1ZBCA 3EY6A 1IX5A 3ARXA 4Q7NA 1D7IA 2DSWA 2DG9A 4QT3A 2RSEA 2AOSA 3WL1A 3WKZA 4WKAA 2D9FA 2PV2A 1UR9A 3PA7A 1NSGA 3RM8A 5B8IC 4KQZA 3RM4A 2A3CA 2FKEA 5HW8A 2O9OA 2ZQSA 3IHZA 3LUOA 4PTMA 1PBKA 4P8VA 2PV3A 4ODOA 1T11A 3H9RB 2ESCA 2YBTA 3KAFA 4LAWA 4JFLA 3W4RA 3NTPA 1Y0OA 2FDMA 4AY1A 1Q6UA 1WB0A 2UZ5A 5D75A 4ITZA 1ZBWA 4DIPA 1Q6HA 2A3BA 2DG4A 1TFVA 3WD2A 2KR7A 1ZCNA 3JYMA 2F21A 4U84A 2WLYA 4ODQA 1JNDA 3KAIA 2ZR5A 2LKNA 3PRDA 1N1AA 3UQBA 1OGBA 1D6OA 1LL6A 2PPPA 1FKIA 3ARWA 4MPKA 2MNTA 3ARVA 2RUCA 1W9UA 5DEZA 4JFKA 3I6CA 4Z2HA 3O5IA 3TDBA 2DSUA 1YATA 3JYJA 1R9HA 4QIBA 3FAPA 3RM9A 1LL4A 3O5EA 2PV1A 4J4NA 4ZPVR 1SYTA 1C9HA 1Q6IA 1EYMA 3CHEA 2VN1A 1O6IA 2DSVA 3ARPA 3AROA 3AS2A 2Q5AA 3CH9A 3WQVA 3IKGA 4S3JA 2WK2A 3WD3A 4Z2JA 4Z2KA 5GQBA 5JH8A 4DZ2A 1Q1CA 3AS0A 2XPBA 4R5EA 2FAPA 1KT1A 3O5RA 4Z2IA 3KABA 3CZ8A 1GUVA 1HJWA 1XRVA 4WK9A 4U86A 3O5LA 4QZVB 4P8XA 5DF0A 2K8IA 1HXVA 1PINA 4TW7A 4WKFA 3AS3A 1LL7A 2RUDA 5HBFA 5HWCA 1FKJA 1JVWA 2LGOA 2YBUA 1HKKA 2IF4A 5HTGA 1FKBA 3WQWA 3B7XA 4L3NA 1NWRA 1LJYA 4DRQA 4ODKA 4L72B 1NWTA 4DZ3A 4JFIA 1J4HA 4JYSA 3AS1A 4MNJA 3PRAA 5GPGA 4DH0A 4MNMA 2AWGA 4U85A 1EQ3A 1F8AB 2F4EA 1OWQA 3B9EA 3NI6A 1KFWA 1UR8A 1E15A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZ2 A;  2F21 A;  4U84 A;  1BL4 A;  1FKD A;  4TW8 A;  3NRK A;  1B6C A;  2XP9 A;  1F40 A;  3IK8 A;  4ODQ A;  1YW5 A;  1FKK A;  4ODR A;  2M1I A;  3KAI A;  3PRB A;  5I98 A;  3O5Q A;  2ZR5 A;  5DIU A;  2LKN A;  4TX0 A;  4GIV A;  1FJD A;  1QPL A;  2M08 A;  1JNT A;  3OOB A;  4W9Q A;  3UF8 A;  1M5Y A;  3PRD A;  1N1A A;  3UQB A;  4DRP A;  1QPF A;  2XPA A;  1D6O A;  4N19 A;  4DRJ A;  1L1P A;  2PPP A;  3KZ7 A;  4BF8 A;  1FKI A;  2DG3 A;  5HT1 A;  4DT4 A;  2MNT A;  3IKD A;  4G50 A;  2RUC A;  3KAC A;  1BKF A;  1FKL A;  1W26 A;  2ZQU A;  4JFK A;  3I6C A;  4ODL A;  4DRM A;  5BXJ A;  4ODM A;  4LAX A;  2ZR4 A;  3O5I A;  4GGQ A;  3TDB A;  5HKG A;  4ODN A;  1YAT A;  2XP7 A;  1R9H A;  2Y78 A;  3JYJ A;  5J6E A;  4QIB A;  3UI5 A;  3FAP A;  2ITK A;  1P5Q A;  2L2S A;  1FD9 A;  3O5E A;  3KAG A;  2PV1 A;  4J4N A;  2KI3 A;  1C9H A;  1Q6I A;  2ZR6 A;  1EYM A;  1J4I A;  2PPN A;  1KT0 A;  3O5P A;  2VN1 A;  2MPH A;  2Q5A A;  1D7H A;  4FAP A;  2N87 A;  3IKG A;  1FKS A;  2PPO A;  4LAY A;  1ZK6 A;  2XP6 A;  3ODK A;  3UQI A;  4DZ2 A;  5HW7 A;  2JZV A;  1Q1C A;  3O5D A;  2XPB A;  1FKH A;  2VCD A;  4JFM A;  4ODP A;  2FAP A;  1KT1 A;  3O5R A;  4DRH A;  2XP4 A;  2ZQV A;  4DRO A;  2KO7 A;  3JXV A;  3KAB A;  2LJ4 A;  4JFJ A;  3GPK A;  5DIV A;  1D7J A;  2LPV A;  2KGJ A;  3CGM A;  1FKF A;  1U79 A;  3O5M A;  2MLY A;  3UI4 A;  4O2T A;  4U86 A;  1FKG A;  3O5L A;  2M2A A;  3KAD A;  2KE0 A;  4TNS A;  4TYO A;  4W9O A;  2ZQT A;  2K8I A;  3O5G A;  4QT2 A;  1TCO C;  3KCE A;  3O5J A;  1HXV A;  1PIN A;  5HWB A;  4W9P A;  3TC5 A;  4TW7 A;  3EY6 A;  4DRN A;  2RUR A;  4IQ2 A;  1D7I A;  4J4O A;  2DG9 A;  1ZCN A;  2RSE A;  2RUD A;  4QT3 A;  5HWC A;  2RUQ A;  3CGN A;  2D9F A;  5DIT A;  1FKJ A;  1JVW A;  1FAP A;  2PV2 A;  2XP8 A;  2LGO A;  3PA7 A;  3MDY B;  1NSG A;  1NMW A;  4IQC A;  3TCZ A;  2IF4 A;  1ROT A;  5HTG A;  4C02 B;  5B8I C;  1FKB A;  4G2P A;  3RGC A;  2FKE A;  3O5F A;  1JNS A;  2MF9 A;  3B7X A;  5HUA A;  2MLX A;  4DRQ A;  5HW8 A;  4ODK A;  4TW6 A;  2ZQS A;  3IHZ A;  2OFN A;  3LUO A;  2KFW A;  4DZ3 A;  1PBK A;  4JFI A;  1FKT A;  2PV3 A;  1J4H A;  4JYS A;  4ODO A;  3UQA A;  1T11 A;  3H9R B;  4MSP A;  3KAH A;  2MLZ A;  2XP3 A;  2PBC A;  3KAF A;  3WH0 A;  3O5K A;  4NNR A;  4LAV A;  4LAW A;  4R0X A;  2RQS A;  4JFL A;  5GPG A;  1NMV A;  3NTP A;  1ROU A;  4FN2 A;  1Y0O A;  3RFW A;  1J6Y A;  1A7X A;  4DH0 A;  1Q6U A;  4IPX A;  4DRI A;  1FKR A;  2F2D A;  2AWG A;  3UI6 A;  4U85 A;  2XP5 A;  4DRK A;  1EQ3 A;  1F8A B;  5HW6 A;  2UZ5 A;  2F4E A;  1J4R A;  4ITZ A;  3O5O A;  3NI6 A;  5D75 A;  4DIP A;  1Q6H A;  3VAW A;  2DG4 A;  2KR7 A;  3JYM A;  4MGV A; 
#chains in the Genus database with same CATH topology
 1W9V A;  3FY1 A;  1FKD A;  1B6C A;  2OLH A;  2WM0 A;  3IK8 A;  1YW5 A;  2M1I A;  1HKI A;  4Z2G A;  5I98 A;  3G6M A;  2DSZ A;  2M08 A;  3OOB A;  1K9T A;  4W9Q A;  3WD1 A;  1ZB5 A;  1E6N A;  1M5Y A;  2DT3 A;  4DRJ A;  3WL0 A;  4BF8 A;  3G6L A;  5HT1 A;  3IKD A;  4G50 A;  3KAC A;  1FKL A;  1W26 A;  4WKH A;  4DRM A;  4ODM A;  2ZR4 A;  3ARR A;  1W9P A;  4ODN A;  2XP7 A;  2Y78 A;  5J6E A;  3UI5 A;  1P5Q A;  1GPF A;  1EDQ A;  2L2S A;  3O5P A;  2DT0 A;  1FKS A;  4IT4 A;  3UQI A;  1ZBK A;  1LQ0 A;  1HJX A;  2ZQV A;  2LJ4 A;  4JFJ A;  3GPK A;  1E9L A;  3EIP A;  1D7J A;  2KGJ A;  3CGM A;  1SR0 A;  3UI4 A;  1FKG A;  2M2A A;  1FFQ A;  3KAD A;  4TYO A;  2ZQT A;  3BMB A;  4XAK A;  4QT2 A;  3KCE A;  2WLZ A;  5HWB A;  4W9P A;  4DRN A;  2RUR A;  4P8W A;  2A3E A;  2O92 A;  2RUQ A;  1X6N A;  1FAP A;  3MDY B;  1H0G A;  3B9A A;  4KR0 B;  4G2P A;  4ZPW R;  1JNS A;  2MLX A;  4MAV A;  4P8U A;  4TW6 A;  3ARS A;  3ART A;  3ARQ A;  4DWS B;  4MSP A;  2MLZ A;  2XP3 A;  3WH0 A;  3O5K A;  5GPR A;  3PR9 A;  4LAV A;  1E6P A;  3WIJ A;  3RFW A;  1ROU A;  4WIW A;  1J6Y A;  1NH6 A;  4DRI A;  1W1P A;  3UI6 A;  4DRK A;  2XP5 A;  1LG2 A;  5HW6 A;  4Q22 A;  3O5O A;  4MTV A;  3ALG A;  1WNO A;  4MGV A;  5HKG A;  1BL4 A;  4TW8 A;  3NRK A;  1GOI A;  4ODR A;  1CTN A;  1FKK A;  3PRB A;  1JCH B;  3O5Q A;  5DIU A;  4LGX A;  3ARZ A;  4TX0 A;  3QOK A;  4GIV A;  1FJD A;  1HKJ A;  4HBE A;  1QPL A;  4NZC A;  1JNT A;  2PN0 A;  3WD4 A;  4DWS D;  1GRJ A;  1ZBV A;  1EHN A;  2XPA A;  5DO2 A;  4N19 A;  3KZ7 A;  2DG3 A;  2G41 A;  4IT6 A;  1BKF A;  4ODL A;  4LAX A;  1XHG A;  3B9D A;  1FD9 A;  2KI3 A;  2PPN A;  1KT0 A;  3B8S A;  2MPH A;  4FAP A;  2N87 A;  4LAY A;  4DWS A;  1ZK6 A;  3ALF A;  3ODK A;  5HW7 A;  2JZV A;  4JFM A;  2VCD A;  1JNE A;  4DRO A;  3JXV A;  5DIV A;  2LPV A;  4Z2L A;  1E6R A;  4WJX A;  3GTY X;  2MLY A;  3BXW A;  1EIB A;  4TNS A;  4W9O A;  3O5G A;  2G8Z A;  4IQ2 A;  4J4O A;  1LG1 A;  1E6Z A;  4HAR A;  3CGN A;  4ZPT R;  5DIT A;  4IQC A;  2XP8 A;  3TCZ A;  1NMW A;  1ROT A;  4ML4 A;  4C02 B;  3RGC A;  3O5F A;  2MF9 A;  2IUZ A;  4NSB A;  2P4V A;  5HUA A;  1FFR A;  2DT1 A;  2F23 A;  2OFN A;  2KFW A;  1FKT A;  2A3A A;  1X6L A;  3UQA A;  4W5U A;  3KAH A;  2PBC A;  1H0I A;  4NNR A;  1W1T A;  4R0X A;  2RQS A;  2QF8 A;  2B31 A;  1NMV A;  1VF8 A;  4FN2 A;  3CHC A;  1D2K A;  1A7X A;  1FKR A;  4IPX A;  2F2D A;  1HJV A;  3CHD A;  4DWS C;  1J4R A;  3VAW A;  2ETN A;  1QZ2 A;  1W1Y A;  2DPE A;  2XP9 A;  4ZS6 A;  1F40 A;  3RME A;  1OGG A;  1NWS A;  1W1V A;  4HBO A;  3AQU A;  3ARY A;  4URI A;  3UF8 A;  1ITX A;  1ZU8 A;  1QPF A;  4DRP A;  1L1P A;  3FXY A;  4DT4 A;  2DT2 A;  1NWU A;  4MNL A;  2ZQU A;  5BXJ A;  4S3K A;  4GGQ A;  4UDM A;  2ITK A;  3KAG A;  4MNK A;  2ZR6 A;  1J4I A;  1D7H A;  3ARU A;  2PPO A;  2XP6 A;  3O5D A;  1FKH A;  1HKM A;  4ODP A;  4DRH A;  3OA5 A;  2XP4 A;  2KO7 A;  1FKF A;  1U79 A;  1E44 A;  3O5M A;  4O2T A;  2PI6 A;  1ZL1 A;  2KE0 A;  1RD6 A;  3CHF A;  1TCO C;  3WD0 A;  3O5J A;  1WAW A;  3TC5 A;  1ZBC A;  3EY6 A;  1IX5 A;  3ARX A;  4Q7N A;  1D7I A;  2DSW A;  2DG9 A;  4QT3 A;  2RSE A;  2AOS A;  3WL1 A;  3WKZ A;  4WKA A;  2D9F A;  2PV2 A;  1UR9 A;  3PA7 A;  1NSG A;  3RM8 A;  5B8I C;  4KQZ A;  3RM4 A;  2A3C A;  2FKE A;  5HW8 A;  2O9O A;  2ZQS A;  3IHZ A;  3LUO A;  4PTM A;  1PBK A;  4P8V A;  2PV3 A;  4ODO A;  1T11 A;  3H9R B;  2ESC A;  2YBT A;  3KAF A;  4LAW A;  4JFL A;  3W4R A;  3NTP A;  1Y0O A;  2FDM A;  4AY1 A;  1Q6U A;  1WB0 A;  2UZ5 A;  5D75 A;  4ITZ A;  1ZBW A;  4DIP A;  1Q6H A;  2A3B A;  2DG4 A;  1TFV A;  3WD2 A;  2KR7 A;  1ZCN A;  3JYM A;  2F21 A;  4U84 A;  2WLY A;  4ODQ A;  1JND A;  3KAI A;  2ZR5 A;  3GU0 A;  2LKN A;  3PRD A;  1N1A A;  3UQB A;  1OGB A;  1D6O A;  1LL6 A;  2PPP A;  1FKI A;  3ARW A;  4MPK A;  2MNT A;  3ARV A;  2RUC A;  1W9U A;  5DEZ A;  4JFK A;  3I6C A;  4Z2H A;  3O5I A;  3TDB A;  2DSU A;  1YAT A;  3JYJ A;  1R9H A;  4QIB A;  3FAP A;  3RM9 A;  1LL4 A;  3O5E A;  2PV1 A;  4J4N A;  4ZPV R;  1SYT A;  1C9H A;  1Q6I A;  1EYM A;  3CHE A;  2VN1 A;  1O6I A;  2DSV A;  3ARP A;  3ARO A;  3AS2 A;  2Q5A A;  3CH9 A;  3WQV A;  3IKG A;  4S3J A;  2WK2 A;  3WD3 A;  4Z2J A;  4Z2K A;  5GQB A;  5JH8 A;  4DZ2 A;  1Q1C A;  3AS0 A;  2XPB A;  4R5E A;  2FAP A;  1KT1 A;  3O5R A;  4Z2I A;  3KAB A;  3CZ8 A;  1GUV A;  1HJW A;  1XRV A;  4WK9 A;  4U86 A;  3O5L A;  4QZV B;  4P8X A;  5DF0 A;  2K8I A;  1HXV A;  1PIN A;  4TW7 A;  4WKF A;  2EUL A;  3AS3 A;  1LL7 A;  2RUD A;  5HBF A;  5HWC A;  1FKJ A;  1JVW A;  2LGO A;  2YBU A;  1HKK A;  2IF4 A;  5HTG A;  1FKB A;  3WQW A;  3B7X A;  4L3N A;  1NWR A;  1LJY A;  4DRQ A;  4ODK A;  2B5U B;  4L72 B;  1NWT A;  4DZ3 A;  4JFI A;  1J4H A;  4JYS A;  3AS1 A;  4MNJ A;  3PRA A;  5GPG A;  4DH0 A;  4MNM A;  2AWG A;  4U85 A;  1EQ3 A;  1F8A B;  2F4E A;  1OWQ A;  3B9E A;  3NI6 A;  1KFW A;  1UR8 A;  1E15 A; 
#chains in the Genus database with same CATH homology
 1W9V A;  3FY1 A;  1FKD A;  1B6C A;  2OLH A;  2WM0 A;  3IK8 A;  1YW5 A;  2M1I A;  1HKI A;  4Z2G A;  5I98 A;  3G6M A;  2DSZ A;  2M08 A;  3OOB A;  1K9T A;  4W9Q A;  3WD1 A;  1ZB5 A;  1E6N A;  1M5Y A;  2DT3 A;  4DRJ A;  3WL0 A;  4BF8 A;  3G6L A;  5HT1 A;  3IKD A;  4G50 A;  3KAC A;  1FKL A;  1W26 A;  4WKH A;  4DRM A;  4ODM A;  2ZR4 A;  3ARR A;  1W9P A;  4ODN A;  2XP7 A;  2Y78 A;  5J6E A;  3UI5 A;  1P5Q A;  1GPF A;  1EDQ A;  2L2S A;  3O5P A;  2DT0 A;  1FKS A;  4IT4 A;  3UQI A;  1ZBK A;  1LQ0 A;  1HJX A;  2ZQV A;  2LJ4 A;  4JFJ A;  3GPK A;  1E9L A;  1D7J A;  2KGJ A;  3CGM A;  1SR0 A;  3UI4 A;  1FKG A;  2M2A A;  1FFQ A;  3KAD A;  4TYO A;  2ZQT A;  4XAK A;  4QT2 A;  3KCE A;  2WLZ A;  5HWB A;  4W9P A;  4DRN A;  2RUR A;  4P8W A;  2A3E A;  2O92 A;  2RUQ A;  1X6N A;  1FAP A;  3MDY B;  1H0G A;  3B9A A;  4KR0 B;  4G2P A;  4ZPW R;  1JNS A;  2MLX A;  4MAV A;  4P8U A;  4TW6 A;  3ARS A;  3ART A;  3ARQ A;  4DWS B;  4MSP A;  2MLZ A;  2XP3 A;  3WH0 A;  3O5K A;  5GPR A;  3PR9 A;  4LAV A;  1E6P A;  3WIJ A;  3RFW A;  1ROU A;  4WIW A;  1J6Y A;  1NH6 A;  4DRI A;  1W1P A;  3UI6 A;  4DRK A;  2XP5 A;  1LG2 A;  5HW6 A;  4Q22 A;  3O5O A;  4MTV A;  3ALG A;  1WNO A;  4MGV A;  5HKG A;  1BL4 A;  4TW8 A;  3NRK A;  1GOI A;  4ODR A;  1CTN A;  1FKK A;  3PRB A;  3O5Q A;  5DIU A;  4LGX A;  3ARZ A;  4TX0 A;  3QOK A;  4GIV A;  1FJD A;  1HKJ A;  4HBE A;  1QPL A;  4NZC A;  1JNT A;  3WD4 A;  4DWS D;  1ZBV A;  1EHN A;  2XPA A;  5DO2 A;  4N19 A;  3KZ7 A;  2DG3 A;  2G41 A;  4IT6 A;  1BKF A;  4ODL A;  4LAX A;  1XHG A;  3B9D A;  1FD9 A;  2KI3 A;  2PPN A;  1KT0 A;  3B8S A;  2MPH A;  4FAP A;  2N87 A;  4LAY A;  4DWS A;  1ZK6 A;  3ALF A;  3ODK A;  5HW7 A;  2JZV A;  4JFM A;  2VCD A;  1JNE A;  4DRO A;  3JXV A;  5DIV A;  2LPV A;  4Z2L A;  1E6R A;  4WJX A;  2MLY A;  3BXW A;  1EIB A;  4TNS A;  4W9O A;  3O5G A;  2G8Z A;  4IQ2 A;  4J4O A;  1LG1 A;  1E6Z A;  4HAR A;  3CGN A;  4ZPT R;  5DIT A;  4IQC A;  2XP8 A;  3TCZ A;  1NMW A;  1ROT A;  4ML4 A;  4C02 B;  3RGC A;  3O5F A;  2MF9 A;  2IUZ A;  4NSB A;  5HUA A;  1FFR A;  2DT1 A;  2OFN A;  2KFW A;  1FKT A;  2A3A A;  1X6L A;  3UQA A;  4W5U A;  3KAH A;  2PBC A;  1H0I A;  4NNR A;  1W1T A;  4R0X A;  2RQS A;  2QF8 A;  2B31 A;  1NMV A;  1VF8 A;  4FN2 A;  3CHC A;  1D2K A;  1A7X A;  1FKR A;  4IPX A;  2F2D A;  1HJV A;  3CHD A;  4DWS C;  1J4R A;  3VAW A;  1QZ2 A;  1W1Y A;  2DPE A;  2XP9 A;  4ZS6 A;  1F40 A;  3RME A;  1OGG A;  1NWS A;  1W1V A;  4HBO A;  3AQU A;  3ARY A;  4URI A;  3UF8 A;  1ITX A;  1ZU8 A;  1QPF A;  4DRP A;  1L1P A;  3FXY A;  4DT4 A;  2DT2 A;  1NWU A;  4MNL A;  2ZQU A;  5BXJ A;  4S3K A;  4GGQ A;  2ITK A;  3KAG A;  4MNK A;  2ZR6 A;  1J4I A;  1D7H A;  3ARU A;  2PPO A;  2XP6 A;  3O5D A;  1FKH A;  1HKM A;  4ODP A;  4DRH A;  3OA5 A;  2XP4 A;  2KO7 A;  1FKF A;  1U79 A;  3O5M A;  4O2T A;  2PI6 A;  1ZL1 A;  2KE0 A;  1RD6 A;  3CHF A;  1TCO C;  3WD0 A;  3O5J A;  1WAW A;  3TC5 A;  1ZBC A;  3EY6 A;  1IX5 A;  3ARX A;  4Q7N A;  1D7I A;  2DSW A;  2DG9 A;  4QT3 A;  2RSE A;  2AOS A;  3WL1 A;  3WKZ A;  4WKA A;  2D9F A;  2PV2 A;  1UR9 A;  3PA7 A;  1NSG A;  3RM8 A;  5B8I C;  4KQZ A;  3RM4 A;  2A3C A;  2FKE A;  5HW8 A;  2O9O A;  2ZQS A;  3IHZ A;  3LUO A;  4PTM A;  1PBK A;  4P8V A;  2PV3 A;  4ODO A;  1T11 A;  3H9R B;  2ESC A;  2YBT A;  3KAF A;  4LAW A;  4JFL A;  3W4R A;  3NTP A;  1Y0O A;  2FDM A;  4AY1 A;  1Q6U A;  1WB0 A;  2UZ5 A;  5D75 A;  4ITZ A;  1ZBW A;  4DIP A;  1Q6H A;  2A3B A;  2DG4 A;  1TFV A;  3WD2 A;  2KR7 A;  1ZCN A;  3JYM A;  2F21 A;  4U84 A;  2WLY A;  4ODQ A;  1JND A;  3KAI A;  2ZR5 A;  2LKN A;  3PRD A;  1N1A A;  3UQB A;  1OGB A;  1D6O A;  1LL6 A;  2PPP A;  1FKI A;  3ARW A;  4MPK A;  2MNT A;  3ARV A;  2RUC A;  1W9U A;  5DEZ A;  4JFK A;  3I6C A;  4Z2H A;  3O5I A;  3TDB A;  2DSU A;  1YAT A;  3JYJ A;  1R9H A;  4QIB A;  3FAP A;  3RM9 A;  1LL4 A;  3O5E A;  2PV1 A;  4J4N A;  4ZPV R;  1SYT A;  1C9H A;  1Q6I A;  1EYM A;  3CHE A;  2VN1 A;  1O6I A;  2DSV A;  3ARP A;  3ARO A;  3AS2 A;  2Q5A A;  3CH9 A;  3WQV A;  3IKG A;  4S3J A;  2WK2 A;  3WD3 A;  4Z2J A;  4Z2K A;  5GQB A;  5JH8 A;  4DZ2 A;  1Q1C A;  3AS0 A;  2XPB A;  4R5E A;  2FAP A;  1KT1 A;  3O5R A;  4Z2I A;  3KAB A;  3CZ8 A;  1GUV A;  1HJW A;  1XRV A;  4WK9 A;  4U86 A;  3O5L A;  4QZV B;  4P8X A;  5DF0 A;  2K8I A;  1HXV A;  1PIN A;  4TW7 A;  4WKF A;  3AS3 A;  1LL7 A;  2RUD A;  5HBF A;  5HWC A;  1FKJ A;  1JVW A;  2LGO A;  2YBU A;  1HKK A;  2IF4 A;  5HTG A;  1FKB A;  3WQW A;  3B7X A;  4L3N A;  1NWR A;  1LJY A;  4DRQ A;  4ODK A;  4L72 B;  1NWT A;  4DZ3 A;  4JFI A;  1J4H A;  4JYS A;  3AS1 A;  4MNJ A;  3PRA A;  5GPG A;  4DH0 A;  4MNM A;  2AWG A;  4U85 A;  1EQ3 A;  1F8A B;  2F4E A;  1OWQ A;  3B9E A;  3NI6 A;  1KFW A;  1UR8 A;  1E15 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...