1NSGA

The structure of the immunophilin-immunosuppressant fkbp12-rapamycin complex interacting with human frap
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (isomerase/kinase)
molecule keywords FK506-BINDING PROTEIN
publication title Refined structure of the FKBP12-rapamycin-FRB ternary complex at 2.2 A resolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1997-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1nsgA00
2PPNA 4ODMA 4R0XA 1J4RA 2LGOA 2PBCA 2VCDA 4IQ2A 4IPXA 4JFMA 3O5QA 4O2TA 3O5OA 1W26A 2PV1A 3O5LA 4ODRA 4ODLA 3VAWA 4MSPA 4DRHA 1P5QA 1FKRA 4J4OA 5HW6A 3RFWA 3NTPA 1ZK6A 4DIPA 3O5KA 1FKJA 3KAGA 4W9OA 1QZ2A 1EYMA 3ODKA 2KR7A 2RSEA 3NRKA 4J4NA 1D7HA 2XP4A 2LPVA 2IF4A 2ZR4A 2XP8A 2XP9A 2KI3A 1PBKA 4DRPA 2ZQUA 2LJ4A 4DRQA 1JVWA 2MLYA 1YW5A 1NMWA 3UQIA 1C9HA 4DRMA 4JFJA 1Y0OA 3FAPA 1FKBA 5DIVA 1NSGA 1FKKA 2MPHA 5GPGA 2N87A 2MLXA 4QIBA 1NMVA 2PPOA 4MGVA 3UI5A 1J6YA 4ODPA 2Q5AA 2M2AA 5HWCA 4DRNA 3KABA 2F2DA 2XP6A 4TW7A 4U85A 4FAPA 1D7JA 4BF8A 3GPKA 1EQ3A 1FKSA 2LKNA 1B6CA 1FKLA 4ITZA 2KFWA 4GIVA 3UQBA 2XP5A 4ODNA 1L1PA 2DG4A 2RUQA 2F4EA 4DZ2A 3CGNA 2ZR5A 4DROA 2D9FA 1JNTA 4DRKA 3JYJA 3O5RA 4QT3A 1F40A 3IHZA 4TW6A 5I98A 2KE0A 2DG9A 1FKTA 2L2SA 2M1IA 2ZQVA 2KGJA 1D6OA 2F21A 1BKFA 1QPLA 2PV3A 3EY6A 3IKGA 1A7XA 4W9PA 1TCOC 3KACA 4C02B 4N19A 3RGCA 4DZ3A 3O5MA 1KT1A 2RQSA 4IQCA 4DRIA 4JFLA 5D75A 3O5PA 3H9RB 3KAHA 4LAVA 3TDBA 4ODQA 1J4IA 4DH0A 5HW7A 4DRJA 3JYMA 1HXVA 3I6CA 4LAXA 4NNRA 3UF8A 1N1AA 3O5EA 5HT1A 3O5FA 4TX0A 1FD9A 4TW8A 4ODOA 5B8IC 4ODKA 2ZQSA 1FKIA 2PPPA 3O5IA 4QT2A 2MNTA 2MLZA 3TC5A 2MF9A 2ZQTA 3MDYB 1FKDA 5HUAA 2ITKA 2JZVA 1PINA 3LUOA 2Y78A 1KT0A 1Q1CA 4JFIA 3KADA 3UI6A 5DITA 4U86A 1FKGA 3NI6A 1Q6UA 3IK8A 2RUDA 3KAIA 3IKDA 4W9QA 3O5GA 3OOBA 1Q6IA 2AWGA 3PRBA 1R9HA 1ROTA 2OFNA 3JXVA 1FKHA 2RURA 4G2PA 3KCEA 1U79A 4DT4A 1FJDA 2PV2A 4GGQA 3B7XA 5HKGA 1F8AB 3TCZA 2FAPA 3PA7A 1ROUA 2DG3A 3KAFA 1J4HA 4LAYA 1M5YA 1T11A 5HTGA 2XP3A 1FKFA 3PRDA 2XP7A 2FKEA 3O5JA 2XPBA 3WH0A 5J6EA 1ZCNA 2RUCA 3KZ7A 4JFKA 2KO7A 2UZ5A 1BL4A 5HW8A 1FAPA 3O5DA 2ZR6A 4LAWA 1QPFA 3UI4A 5HWBA 4JYSA 4FN2A 1YATA 1D7IA 2VN1A 4G50A 4TYOA 1JNSA 1Q6HA 4TNSA 5DIUA 3CGMA 2XPAA 4U84A 2K8IA 2M08A 5BXJA 3UQAA
chains in the Genus database with same CATH superfamily
2VCDA 3AROA 4PTMA 4DWSC 3O5LA 3QOKA 1P5QA 5DO2A 1FKJA 3CHCA 2KR7A 2F23A 1D7HA 4AY1A 2KI3A 2ZQUA 2ETNA 2DT0A 3UQIA 3RM4A 4ZPTR 1W1PA 1XHGA 2B5UB 4Q22A 3ARPA 4IT6A 2WLYA 5DIVA 1W1TA 4QIBA 2MLXA 2PPOA 1J6YA 4ZS6A 3WD3A 2M2AA 3KABA 2F2DA 4U85A 3GU0A 4HBOA 1FKSA 2LKNA 4ITZA 4ODNA 4S3JA 3CHDA 4DZ2A 4DRKA 3WKZA 3ARZA 3B9EA 2PN0A 1CTNA 1FKTA 2DG9A 3B9DA 2PV3A 3WD1A 1BKFA 1QPLA 3EY6A 4C02B 1TCOC 3KACA 3O5MA 2RQSA 1HKJA 1NWSA 4DH0A 1WNOA 1ITXA 4LAXA 2WM0A 1HKMA 3BXWA 3UF8A 1FD9A 4TW8A 2PPPA 3O5IA 1ZBVA 2ZQTA 1FKDA 1NWRA 1Q1CA 3KADA 4MNJA 1OGGA 1Q6UA 3IK8A 3KAIA 1W9UA 3O5GA 4ZPVR 1Q6IA 2WLZA 1FKHA 2P4VA 2DT3A 3PA7A 3G6MA 1ROUA 2DG3A 1LQ0A 3EIPA 5HTGA 2XP3A 2XP7A 3O5JA 3WH0A 2KO7A 1BL4A 3O5DA 3UI4A 4LAWA 4JYSA 4FN2A 1X6NA 5GPRA 1RD6A 3B9AA 1Q6HA 3FY1A 2DSWA 5BXJA 3UQAA 3ARYA 5HW6A 2LGOA 4O2TA 4IQ2A 4MPKA 1ZU8A 2PV1A 1FKRA 3AS1A 1H0IA 1ZK6A 3ARQA 3O5KA 1HJVA 1EYMA 3ODKA 4J4NA 2RSEA 3WL0A 2DT1A 2IF4A 4P8XA 3WQWA 3FXYA 1YW5A 1W1YA 1C9HA 4DRMA 4JFJA 1E6NA 3FAPA 1OGBA 1NSGA 5JH8A 4MGVA 3UI5A 1FFQA 4L3NA 4LGXA 4BF8A 3OA5A 3GPKA 2AOSA 1LL6A 2DG4A 2RUQA 4DROA 1JNTA 5I98A 3WD2A 1LL4A 2M1IA 2ZQVA 2KGJA 2F21A 3IKGA 3WIJA 1HJXA 3RGCA 4DZ3A 1FFRA 1ZBWA 3PRAA 5D75A 5DF0A 2A3CA 3KAHA 1N1AA 1E9LA 4TX0A 1W9VA 3AS3A 3MDYB 2JZVA 1KT0A 3UI6A 5DITA 4U86A 2IUZA 4HBEA 4IT4A 4S3KA 1R9HA 1ROTA 2OFNA 4NZCA 3JXVA 2B31A 4G2PA 1U79A 2PV2A 4GGQA 1ZBKA 3B7XA 1F8AB 3TCZA 1J4HA 4LAYA 5HBFA 3RMEA 1FKFA 2FKEA 1E44A 2RUCA 4QZVB 3KZ7A 1ZBCA 2OLHA 2UZ5A 1GUVA 4WJXA 1D2KA 5HWBA 1NWTA 5GQBA 4G50A 1JNSA 1ZB5A 4TNSA 1UR9A 2K8IA 2M08A 4MTVA 4WKAA 3W4RA 4R0XA 3ARXA 4ODMA 1J4RA 2PBCA 4W5UA 2PI6A 3O5QA 3PR9A 4ODRA 3VAWA 4Z2GA 1W1VA 4DRHA 1O6IA 3NTPA 3KAGA 1QZ2A 3NRKA 2XP4A 2O92A 2ZR4A 2XP9A 3CH9A 1JVWA 2MLYA 4P8VA 1HJWA 1E6RA 1NMWA 3ARWA 4P8WA 1SR0A 1Y0OA 4DWSD 1WB0A 2MPHA 5GPGA 2O9OA 2Q5AA 4DRNA 1E6ZA 4WKFA 2YBUA 4ZPWR 4DWSB 1B6CA 3UQBA 2KFWA 4GIVA 2ZR5A 3JYJA 3O5RA 1F40A 3WQVA 1K9TA 2KE0A 3ARVA 3B8SA 2L2SA 1D6OA 4XAKA 4N19A 4DRIA 4JFLA 3H9RB 5HW7A 1HXVA 1J4IA 1H0GA 4NNRA 4UDMA 3O5EA 3O5FA 4R5EA 2A3AA 4ODOA 4ODKA 1FKIA 1E15A 2MNTA 2MLZA 3RM8A 3TC5A 4Z2JA 2MF9A 3ARRA 5HUAA 3LUOA 1EIBA 1JNEA 1VF8A 2Y78A 1X6LA 4JFIA 4Z2HA 1FKGA 2DSZA 3IKDA 4W9QA 2DSVA 2FDMA 2QF8A 2G8ZA 3ALGA 4DT4A 1FJDA 5HKGA 3KAFA 1M5YA 1IX5A 1T11A 1XRVA 1EHNA 3PRDA 5J6EA 2DT2A 2ESCA 4JFKA 1ZL1A 1FAPA 3WL1A 1LL7A 1GRJA 4Z2LA 1GPFA 1KFWA 1D7IA 4MNMA 1LJYA 5DIUA 1LG2A 3CGMA 2YBTA 1SYTA 4U84A 2PPNA 5HW8A 4IPXA 4JFMA 3CHEA 3O5OA 1HKIA 1W26A 4ODLA 4MSPA 1WAWA 4J4OA 3RFWA 3CHFA 4DIPA 4W9OA 2G41A 5DEZA 2LPVA 2XP8A 4DRPA 1PBKA 3CZ8A 2LJ4A 4DRQA 4MAVA 4WKHA 1FKBA 2EULA 3WD0A 1FKKA 2N87A 1NMVA 4ODPA 5HWCA 2DSUA 4TW7A 2XP6A 3ALFA 4FAPA 1D7JA 3ARSA 1EQ3A 1FKLA 3ARTA 2XP5A 1L1PA 3AS0A 2F4EA 3CGNA 4MNLA 2D9FA 4KR0B 4QT3A 3IHZA 4TW6A 4WIWA 3GTYX 1JNDA 4ML4A 3ARUA 4W9PA 1A7XA 1JCHB 1GOIA 4Q7NA 1KT1A 2A3BA 4IQCA 2DPEA 3AQUA 3O5PA 4LAVA 3TDBA 4ODQA 4NSBA 3JYMA 4DRJA 3I6CA 4L72B 4HARA 2A3EA 4URIA 4MNKA 5HT1A 5B8IC 2ZQSA 4QT2A 1NWUA 2ITKA 1PINA 1E6PA 3NI6A 3RM9A 2RUDA 3AS2A 3BMBA 1NH6A 1OWQA 3OOBA 2AWGA 3PRBA 2RURA 1TFVA 3KCEA 4P8UA 2FAPA 3G6LA 1LG1A 1HKKA 2WK2A 4KQZA 2XPBA 1UR8A 1ZCNA 4Z2KA 4DWSA 3WD4A 2ZR6A 1QPFA 1EDQA 1W9PA 1YATA 4TYOA 2VN1A 4Z2IA 2XPAA 4WK9A
chains in the Genus database with same CATH topology
2VCDA 3AROA 4PTMA 4DWSC 3O5LA 3QOKA 1P5QA 5DO2A 1FKJA 3CHCA 2KR7A 1D7HA 4AY1A 2KI3A 2ZQUA 2DT0A 3UQIA 3RM4A 4ZPTR 1W1PA 1XHGA 4Q22A 3ARPA 4IT6A 2WLYA 5DIVA 1W1TA 4QIBA 2MLXA 2PPOA 1J6YA 4ZS6A 3WD3A 2M2AA 3KABA 2F2DA 4U85A 4HBOA 1FKSA 2LKNA 4ITZA 4ODNA 4S3JA 3CHDA 4DZ2A 4DRKA 3WKZA 3ARZA 3B9EA 1CTNA 1FKTA 2DG9A 3B9DA 2PV3A 3WD1A 1BKFA 1QPLA 3EY6A 4C02B 1TCOC 3KACA 3O5MA 2RQSA 1HKJA 1NWSA 4DH0A 1WNOA 1ITXA 4LAXA 2WM0A 1HKMA 3BXWA 3UF8A 1FD9A 4TW8A 2PPPA 3O5IA 1ZBVA 2ZQTA 1FKDA 1NWRA 1Q1CA 3KADA 4MNJA 1OGGA 1Q6UA 3IK8A 3KAIA 1W9UA 3O5GA 4ZPVR 1Q6IA 2WLZA 1FKHA 2DT3A 3PA7A 3G6MA 1ROUA 2DG3A 1LQ0A 5HTGA 2XP3A 2XP7A 3O5JA 3WH0A 2KO7A 1BL4A 3O5DA 3UI4A 4LAWA 4JYSA 4FN2A 1X6NA 5GPRA 1RD6A 3B9AA 1Q6HA 3FY1A 2DSWA 5BXJA 3UQAA 3ARYA 5HW6A 2LGOA 4O2TA 4IQ2A 4MPKA 1ZU8A 2PV1A 1FKRA 3AS1A 1H0IA 1ZK6A 3ARQA 3O5KA 1HJVA 1EYMA 3ODKA 4J4NA 2RSEA 3WL0A 2DT1A 2IF4A 4P8XA 3WQWA 3FXYA 1YW5A 1W1YA 1C9HA 4DRMA 4JFJA 1E6NA 3FAPA 1OGBA 1NSGA 5JH8A 4MGVA 3UI5A 1FFQA 4L3NA 4LGXA 4BF8A 3OA5A 3GPKA 2AOSA 1LL6A 2DG4A 2RUQA 4DROA 1JNTA 5I98A 3WD2A 1LL4A 2M1IA 2ZQVA 2KGJA 2F21A 3IKGA 3WIJA 1HJXA 3RGCA 4DZ3A 1FFRA 1ZBWA 3PRAA 5D75A 5DF0A 2A3CA 3KAHA 1N1AA 1E9LA 4TX0A 1W9VA 3AS3A 3MDYB 2JZVA 1KT0A 3UI6A 5DITA 4U86A 2IUZA 4HBEA 4IT4A 4S3KA 1R9HA 1ROTA 2OFNA 4NZCA 3JXVA 2B31A 4G2PA 1U79A 2PV2A 4GGQA 1ZBKA 3B7XA 1F8AB 3TCZA 1J4HA 4LAYA 5HBFA 3RMEA 1FKFA 2FKEA 2RUCA 4QZVB 3KZ7A 1ZBCA 2OLHA 2UZ5A 1GUVA 4WJXA 1D2KA 5HWBA 1NWTA 5GQBA 4G50A 1JNSA 1ZB5A 4TNSA 1UR9A 2K8IA 2M08A 4MTVA 4WKAA 3W4RA 4R0XA 3ARXA 4ODMA 1J4RA 2PBCA 4W5UA 2PI6A 3O5QA 3PR9A 4ODRA 3VAWA 4Z2GA 1W1VA 4DRHA 1O6IA 3NTPA 3KAGA 1QZ2A 3NRKA 2XP4A 2O92A 2ZR4A 2XP9A 3CH9A 1JVWA 2MLYA 4P8VA 1HJWA 1E6RA 1NMWA 3ARWA 4P8WA 1SR0A 1Y0OA 4DWSD 1WB0A 2MPHA 5GPGA 2O9OA 2Q5AA 4DRNA 1E6ZA 4WKFA 2YBUA 4ZPWR 4DWSB 1B6CA 3UQBA 2KFWA 4GIVA 2ZR5A 3JYJA 3O5RA 1F40A 3WQVA 1K9TA 2KE0A 3ARVA 3B8SA 2L2SA 1D6OA 4XAKA 4N19A 4DRIA 4JFLA 3H9RB 5HW7A 1HXVA 1J4IA 1H0GA 4NNRA 3O5EA 3O5FA 4R5EA 2A3AA 4ODOA 4ODKA 1FKIA 1E15A 2MNTA 2MLZA 3RM8A 3TC5A 4Z2JA 2MF9A 3ARRA 5HUAA 3LUOA 1EIBA 1JNEA 1VF8A 2Y78A 1X6LA 4JFIA 4Z2HA 1FKGA 2DSZA 3IKDA 4W9QA 2DSVA 2FDMA 2QF8A 2G8ZA 3ALGA 4DT4A 1FJDA 5HKGA 3KAFA 1M5YA 1IX5A 1T11A 1XRVA 1EHNA 3PRDA 5J6EA 2DT2A 2ESCA 4JFKA 1ZL1A 1FAPA 3WL1A 1LL7A 4Z2LA 1GPFA 1KFWA 1D7IA 4MNMA 1LJYA 5DIUA 1LG2A 3CGMA 2YBTA 1SYTA 4U84A 2PPNA 5HW8A 4IPXA 4JFMA 3CHEA 3O5OA 1HKIA 1W26A 4ODLA 4MSPA 1WAWA 4J4OA 3RFWA 3CHFA 4DIPA 4W9OA 2G41A 5DEZA 2LPVA 2XP8A 4DRPA 1PBKA 3CZ8A 2LJ4A 4DRQA 4MAVA 4WKHA 1FKBA 3WD0A 1FKKA 2N87A 1NMVA 4ODPA 5HWCA 2DSUA 4TW7A 2XP6A 3ALFA 4FAPA 1D7JA 3ARSA 1EQ3A 1FKLA 3ARTA 2XP5A 1L1PA 3AS0A 2F4EA 3CGNA 4MNLA 2D9FA 4KR0B 4QT3A 3IHZA 4TW6A 4WIWA 1JNDA 4ML4A 3ARUA 4W9PA 1A7XA 1GOIA 4Q7NA 1KT1A 2A3BA 4IQCA 2DPEA 3AQUA 3O5PA 4LAVA 3TDBA 4ODQA 4NSBA 3JYMA 4DRJA 3I6CA 4L72B 4HARA 2A3EA 4URIA 4MNKA 5HT1A 5B8IC 2ZQSA 4QT2A 1NWUA 2ITKA 1PINA 1E6PA 3NI6A 3RM9A 2RUDA 3AS2A 1NH6A 1OWQA 3OOBA 2AWGA 3PRBA 2RURA 1TFVA 3KCEA 4P8UA 2FAPA 3G6LA 1LG1A 1HKKA 2WK2A 4KQZA 2XPBA 1UR8A 1ZCNA 4Z2KA 4DWSA 3WD4A 2ZR6A 1QPFA 1EDQA 1W9PA 1YATA 4TYOA 2VN1A 4Z2IA 2XPAA 4WK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PPN A;  4ODM A;  4R0X A;  1J4R A;  2LGO A;  2PBC A;  2VCD A;  4IQ2 A;  4IPX A;  4JFM A;  3O5Q A;  4O2T A;  3O5O A;  1W26 A;  2PV1 A;  3O5L A;  4ODR A;  4ODL A;  3VAW A;  4MSP A;  4DRH A;  1P5Q A;  1FKR A;  4J4O A;  5HW6 A;  3RFW A;  3NTP A;  1ZK6 A;  4DIP A;  3O5K A;  1FKJ A;  3KAG A;  4W9O A;  1QZ2 A;  1EYM A;  3ODK A;  2KR7 A;  2RSE A;  3NRK A;  4J4N A;  1D7H A;  2XP4 A;  2LPV A;  2IF4 A;  2ZR4 A;  2XP8 A;  2XP9 A;  2KI3 A;  1PBK A;  4DRP A;  2ZQU A;  2LJ4 A;  4DRQ A;  1JVW A;  2MLY A;  1YW5 A;  1NMW A;  3UQI A;  1C9H A;  4DRM A;  4JFJ A;  1Y0O A;  3FAP A;  1FKB A;  5DIV A;  1NSG A;  1FKK A;  2MPH A;  5GPG A;  2N87 A;  2MLX A;  4QIB A;  1NMV A;  2PPO A;  4MGV A;  3UI5 A;  1J6Y A;  4ODP A;  2Q5A A;  2M2A A;  5HWC A;  4DRN A;  3KAB A;  2F2D A;  2XP6 A;  4TW7 A;  4U85 A;  4FAP A;  1D7J A;  4BF8 A;  3GPK A;  1EQ3 A;  1FKS A;  2LKN A;  1B6C A;  1FKL A;  4ITZ A;  2KFW A;  4GIV A;  3UQB A;  2XP5 A;  4ODN A;  1L1P A;  2DG4 A;  2RUQ A;  2F4E A;  4DZ2 A;  3CGN A;  2ZR5 A;  4DRO A;  2D9F A;  1JNT A;  4DRK A;  3JYJ A;  3O5R A;  4QT3 A;  1F40 A;  3IHZ A;  4TW6 A;  5I98 A;  2KE0 A;  2DG9 A;  1FKT A;  2L2S A;  2M1I A;  2ZQV A;  2KGJ A;  1D6O A;  2F21 A;  1BKF A;  1QPL A;  2PV3 A;  3EY6 A;  3IKG A;  1A7X A;  4W9P A;  1TCO C;  3KAC A;  4C02 B;  4N19 A;  3RGC A;  4DZ3 A;  3O5M A;  1KT1 A;  2RQS A;  4IQC A;  4DRI A;  4JFL A;  5D75 A;  3O5P A;  3H9R B;  3KAH A;  4LAV A;  3TDB A;  4ODQ A;  1J4I A;  4DH0 A;  5HW7 A;  4DRJ A;  3JYM A;  1HXV A;  3I6C A;  4LAX A;  4NNR A;  3UF8 A;  1N1A A;  3O5E A;  5HT1 A;  3O5F A;  4TX0 A;  1FD9 A;  4TW8 A;  4ODO A;  5B8I C;  4ODK A;  2ZQS A;  1FKI A;  2PPP A;  3O5I A;  4QT2 A;  2MNT A;  2MLZ A;  3TC5 A;  2MF9 A;  2ZQT A;  3MDY B;  1FKD A;  5HUA A;  2ITK A;  2JZV A;  1PIN A;  3LUO A;  2Y78 A;  1KT0 A;  1Q1C A;  4JFI A;  3KAD A;  3UI6 A;  5DIT A;  4U86 A;  1FKG A;  3NI6 A;  1Q6U A;  3IK8 A;  2RUD A;  3KAI A;  3IKD A;  4W9Q A;  3O5G A;  3OOB A;  1Q6I A;  2AWG A;  3PRB A;  1R9H A;  1ROT A;  2OFN A;  3JXV A;  1FKH A;  2RUR A;  4G2P A;  3KCE A;  1U79 A;  4DT4 A;  1FJD A;  2PV2 A;  4GGQ A;  3B7X A;  5HKG A;  1F8A B;  3TCZ A;  2FAP A;  3PA7 A;  1ROU A;  2DG3 A;  3KAF A;  1J4H A;  4LAY A;  1M5Y A;  1T11 A;  5HTG A;  2XP3 A;  1FKF A;  3PRD A;  2XP7 A;  2FKE A;  3O5J A;  2XPB A;  3WH0 A;  5J6E A;  1ZCN A;  2RUC A;  3KZ7 A;  4JFK A;  2KO7 A;  2UZ5 A;  1BL4 A;  5HW8 A;  1FAP A;  3O5D A;  2ZR6 A;  4LAW A;  1QPF A;  3UI4 A;  5HWB A;  4JYS A;  4FN2 A;  1YAT A;  1D7I A;  2VN1 A;  4G50 A;  4TYO A;  1JNS A;  1Q6H A;  4TNS A;  5DIU A;  3CGM A;  2XPA A;  4U84 A;  2K8I A;  2M08 A;  5BXJ A;  3UQA A; 
#chains in the Genus database with same CATH topology
 2VCD A;  3ARO A;  4PTM A;  4DWS C;  3O5L A;  3QOK A;  1P5Q A;  5DO2 A;  1FKJ A;  3CHC A;  2KR7 A;  2F23 A;  1D7H A;  4AY1 A;  2KI3 A;  2ZQU A;  2ETN A;  2DT0 A;  3UQI A;  3RM4 A;  4ZPT R;  1W1P A;  1XHG A;  2B5U B;  4Q22 A;  3ARP A;  4IT6 A;  2WLY A;  5DIV A;  1W1T A;  4QIB A;  2MLX A;  2PPO A;  1J6Y A;  4ZS6 A;  3WD3 A;  2M2A A;  3KAB A;  2F2D A;  4U85 A;  3GU0 A;  4HBO A;  1FKS A;  2LKN A;  4ITZ A;  4ODN A;  4S3J A;  3CHD A;  4DZ2 A;  4DRK A;  3WKZ A;  3ARZ A;  3B9E A;  2PN0 A;  1CTN A;  1FKT A;  2DG9 A;  3B9D A;  2PV3 A;  3WD1 A;  1BKF A;  1QPL A;  3EY6 A;  4C02 B;  1TCO C;  3KAC A;  3O5M A;  2RQS A;  1HKJ A;  1NWS A;  4DH0 A;  1WNO A;  1ITX A;  4LAX A;  2WM0 A;  1HKM A;  3BXW A;  3UF8 A;  1FD9 A;  4TW8 A;  2PPP A;  3O5I A;  1ZBV A;  2ZQT A;  1FKD A;  1NWR A;  1Q1C A;  3KAD A;  4MNJ A;  1OGG A;  1Q6U A;  3IK8 A;  3KAI A;  1W9U A;  3O5G A;  4ZPV R;  1Q6I A;  2WLZ A;  1FKH A;  2P4V A;  2DT3 A;  3PA7 A;  3G6M A;  1ROU A;  2DG3 A;  1LQ0 A;  3EIP A;  5HTG A;  2XP3 A;  2XP7 A;  3O5J A;  3WH0 A;  2KO7 A;  1BL4 A;  3O5D A;  3UI4 A;  4LAW A;  4JYS A;  4FN2 A;  1X6N A;  5GPR A;  1RD6 A;  3B9A A;  1Q6H A;  3FY1 A;  2DSW A;  5BXJ A;  3UQA A;  3ARY A;  5HW6 A;  2LGO A;  4O2T A;  4IQ2 A;  4MPK A;  1ZU8 A;  2PV1 A;  1FKR A;  3AS1 A;  1H0I A;  1ZK6 A;  3ARQ A;  3O5K A;  1HJV A;  1EYM A;  3ODK A;  4J4N A;  2RSE A;  3WL0 A;  2DT1 A;  2IF4 A;  4P8X A;  3WQW A;  3FXY A;  1YW5 A;  1W1Y A;  1C9H A;  4DRM A;  4JFJ A;  1E6N A;  3FAP A;  1OGB A;  1NSG A;  5JH8 A;  4MGV A;  3UI5 A;  1FFQ A;  4L3N A;  4LGX A;  4BF8 A;  3OA5 A;  3GPK A;  2AOS A;  1LL6 A;  2DG4 A;  2RUQ A;  4DRO A;  1JNT A;  5I98 A;  3WD2 A;  1LL4 A;  2M1I A;  2ZQV A;  2KGJ A;  2F21 A;  3IKG A;  3WIJ A;  1HJX A;  3RGC A;  4DZ3 A;  1FFR A;  1ZBW A;  3PRA A;  5D75 A;  5DF0 A;  2A3C A;  3KAH A;  1N1A A;  1E9L A;  4TX0 A;  1W9V A;  3AS3 A;  3MDY B;  2JZV A;  1KT0 A;  3UI6 A;  5DIT A;  4U86 A;  2IUZ A;  4HBE A;  4IT4 A;  4S3K A;  1R9H A;  1ROT A;  2OFN A;  4NZC A;  3JXV A;  2B31 A;  4G2P A;  1U79 A;  2PV2 A;  4GGQ A;  1ZBK A;  3B7X A;  1F8A B;  3TCZ A;  1J4H A;  4LAY A;  5HBF A;  3RME A;  1FKF A;  2FKE A;  1E44 A;  2RUC A;  4QZV B;  3KZ7 A;  1ZBC A;  2OLH A;  2UZ5 A;  1GUV A;  4WJX A;  1D2K A;  5HWB A;  1NWT A;  5GQB A;  4G50 A;  1JNS A;  1ZB5 A;  4TNS A;  1UR9 A;  2K8I A;  2M08 A;  4MTV A;  4WKA A;  3W4R A;  4R0X A;  3ARX A;  4ODM A;  1J4R A;  2PBC A;  4W5U A;  2PI6 A;  3O5Q A;  3PR9 A;  4ODR A;  3VAW A;  4Z2G A;  1W1V A;  4DRH A;  1O6I A;  3NTP A;  3KAG A;  1QZ2 A;  3NRK A;  2XP4 A;  2O92 A;  2ZR4 A;  2XP9 A;  3CH9 A;  1JVW A;  2MLY A;  4P8V A;  1HJW A;  1E6R A;  1NMW A;  3ARW A;  4P8W A;  1SR0 A;  1Y0O A;  4DWS D;  1WB0 A;  2MPH A;  5GPG A;  2O9O A;  2Q5A A;  4DRN A;  1E6Z A;  4WKF A;  2YBU A;  4ZPW R;  4DWS B;  1B6C A;  3UQB A;  2KFW A;  4GIV A;  2ZR5 A;  3JYJ A;  3O5R A;  1F40 A;  3WQV A;  1K9T A;  2KE0 A;  3ARV A;  3B8S A;  2L2S A;  1D6O A;  4XAK A;  4N19 A;  4DRI A;  4JFL A;  3H9R B;  5HW7 A;  1HXV A;  1J4I A;  1H0G A;  4NNR A;  4UDM A;  3O5E A;  3O5F A;  4R5E A;  2A3A A;  4ODO A;  4ODK A;  1FKI A;  1E15 A;  2MNT A;  2MLZ A;  3RM8 A;  3TC5 A;  4Z2J A;  2MF9 A;  3ARR A;  5HUA A;  3LUO A;  1EIB A;  1JNE A;  1VF8 A;  2Y78 A;  1X6L A;  4JFI A;  4Z2H A;  1FKG A;  2DSZ A;  3IKD A;  4W9Q A;  2DSV A;  2FDM A;  2QF8 A;  2G8Z A;  3ALG A;  4DT4 A;  1FJD A;  5HKG A;  3KAF A;  1M5Y A;  1IX5 A;  1T11 A;  1XRV A;  1EHN A;  3PRD A;  5J6E A;  2DT2 A;  2ESC A;  4JFK A;  1ZL1 A;  1FAP A;  3WL1 A;  1LL7 A;  1GRJ A;  4Z2L A;  1GPF A;  1KFW A;  1D7I A;  4MNM A;  1LJY A;  5DIU A;  1LG2 A;  3CGM A;  2YBT A;  1SYT A;  4U84 A;  2PPN A;  5HW8 A;  4IPX A;  4JFM A;  3CHE A;  3O5O A;  1HKI A;  1W26 A;  4ODL A;  4MSP A;  1WAW A;  4J4O A;  3RFW A;  3CHF A;  4DIP A;  4W9O A;  2G41 A;  5DEZ A;  2LPV A;  2XP8 A;  4DRP A;  1PBK A;  3CZ8 A;  2LJ4 A;  4DRQ A;  4MAV A;  4WKH A;  1FKB A;  2EUL A;  3WD0 A;  1FKK A;  2N87 A;  1NMV A;  4ODP A;  5HWC A;  2DSU A;  4TW7 A;  2XP6 A;  3ALF A;  4FAP A;  1D7J A;  3ARS A;  1EQ3 A;  1FKL A;  3ART A;  2XP5 A;  1L1P A;  3AS0 A;  2F4E A;  3CGN A;  4MNL A;  2D9F A;  4KR0 B;  4QT3 A;  3IHZ A;  4TW6 A;  4WIW A;  3GTY X;  1JND A;  4ML4 A;  3ARU A;  4W9P A;  1A7X A;  1JCH B;  1GOI A;  4Q7N A;  1KT1 A;  2A3B A;  4IQC A;  2DPE A;  3AQU A;  3O5P A;  4LAV A;  3TDB A;  4ODQ A;  4NSB A;  3JYM A;  4DRJ A;  3I6C A;  4L72 B;  4HAR A;  2A3E A;  4URI A;  4MNK A;  5HT1 A;  5B8I C;  2ZQS A;  4QT2 A;  1NWU A;  2ITK A;  1PIN A;  1E6P A;  3NI6 A;  3RM9 A;  2RUD A;  3AS2 A;  3BMB A;  1NH6 A;  1OWQ A;  3OOB A;  2AWG A;  3PRB A;  2RUR A;  1TFV A;  3KCE A;  4P8U A;  2FAP A;  3G6L A;  1LG1 A;  1HKK A;  2WK2 A;  4KQZ A;  2XPB A;  1UR8 A;  1ZCN A;  4Z2K A;  4DWS A;  3WD4 A;  2ZR6 A;  1QPF A;  1EDQ A;  1W9P A;  1YAT A;  4TYO A;  2VN1 A;  4Z2I A;  2XPA A;  4WK9 A; 
#chains in the Genus database with same CATH homology
 2VCD A;  3ARO A;  4PTM A;  4DWS C;  3O5L A;  3QOK A;  1P5Q A;  5DO2 A;  1FKJ A;  3CHC A;  2KR7 A;  1D7H A;  4AY1 A;  2KI3 A;  2ZQU A;  2DT0 A;  3UQI A;  3RM4 A;  4ZPT R;  1W1P A;  1XHG A;  4Q22 A;  3ARP A;  4IT6 A;  2WLY A;  5DIV A;  1W1T A;  4QIB A;  2MLX A;  2PPO A;  1J6Y A;  4ZS6 A;  3WD3 A;  2M2A A;  3KAB A;  2F2D A;  4U85 A;  4HBO A;  1FKS A;  2LKN A;  4ITZ A;  4ODN A;  4S3J A;  3CHD A;  4DZ2 A;  4DRK A;  3WKZ A;  3ARZ A;  3B9E A;  1CTN A;  1FKT A;  2DG9 A;  3B9D A;  2PV3 A;  3WD1 A;  1BKF A;  1QPL A;  3EY6 A;  4C02 B;  1TCO C;  3KAC A;  3O5M A;  2RQS A;  1HKJ A;  1NWS A;  4DH0 A;  1WNO A;  1ITX A;  4LAX A;  2WM0 A;  1HKM A;  3BXW A;  3UF8 A;  1FD9 A;  4TW8 A;  2PPP A;  3O5I A;  1ZBV A;  2ZQT A;  1FKD A;  1NWR A;  1Q1C A;  3KAD A;  4MNJ A;  1OGG A;  1Q6U A;  3IK8 A;  3KAI A;  1W9U A;  3O5G A;  4ZPV R;  1Q6I A;  2WLZ A;  1FKH A;  2DT3 A;  3PA7 A;  3G6M A;  1ROU A;  2DG3 A;  1LQ0 A;  5HTG A;  2XP3 A;  2XP7 A;  3O5J A;  3WH0 A;  2KO7 A;  1BL4 A;  3O5D A;  3UI4 A;  4LAW A;  4JYS A;  4FN2 A;  1X6N A;  5GPR A;  1RD6 A;  3B9A A;  1Q6H A;  3FY1 A;  2DSW A;  5BXJ A;  3UQA A;  3ARY A;  5HW6 A;  2LGO A;  4O2T A;  4IQ2 A;  4MPK A;  1ZU8 A;  2PV1 A;  1FKR A;  3AS1 A;  1H0I A;  1ZK6 A;  3ARQ A;  3O5K A;  1HJV A;  1EYM A;  3ODK A;  4J4N A;  2RSE A;  3WL0 A;  2DT1 A;  2IF4 A;  4P8X A;  3WQW A;  3FXY A;  1YW5 A;  1W1Y A;  1C9H A;  4DRM A;  4JFJ A;  1E6N A;  3FAP A;  1OGB A;  1NSG A;  5JH8 A;  4MGV A;  3UI5 A;  1FFQ A;  4L3N A;  4LGX A;  4BF8 A;  3OA5 A;  3GPK A;  2AOS A;  1LL6 A;  2DG4 A;  2RUQ A;  4DRO A;  1JNT A;  5I98 A;  3WD2 A;  1LL4 A;  2M1I A;  2ZQV A;  2KGJ A;  2F21 A;  3IKG A;  3WIJ A;  1HJX A;  3RGC A;  4DZ3 A;  1FFR A;  1ZBW A;  3PRA A;  5D75 A;  5DF0 A;  2A3C A;  3KAH A;  1N1A A;  1E9L A;  4TX0 A;  1W9V A;  3AS3 A;  3MDY B;  2JZV A;  1KT0 A;  3UI6 A;  5DIT A;  4U86 A;  2IUZ A;  4HBE A;  4IT4 A;  4S3K A;  1R9H A;  1ROT A;  2OFN A;  4NZC A;  3JXV A;  2B31 A;  4G2P A;  1U79 A;  2PV2 A;  4GGQ A;  1ZBK A;  3B7X A;  1F8A B;  3TCZ A;  1J4H A;  4LAY A;  5HBF A;  3RME A;  1FKF A;  2FKE A;  2RUC A;  4QZV B;  3KZ7 A;  1ZBC A;  2OLH A;  2UZ5 A;  1GUV A;  4WJX A;  1D2K A;  5HWB A;  1NWT A;  5GQB A;  4G50 A;  1JNS A;  1ZB5 A;  4TNS A;  1UR9 A;  2K8I A;  2M08 A;  4MTV A;  4WKA A;  3W4R A;  4R0X A;  3ARX A;  4ODM A;  1J4R A;  2PBC A;  4W5U A;  2PI6 A;  3O5Q A;  3PR9 A;  4ODR A;  3VAW A;  4Z2G A;  1W1V A;  4DRH A;  1O6I A;  3NTP A;  3KAG A;  1QZ2 A;  3NRK A;  2XP4 A;  2O92 A;  2ZR4 A;  2XP9 A;  3CH9 A;  1JVW A;  2MLY A;  4P8V A;  1HJW A;  1E6R A;  1NMW A;  3ARW A;  4P8W A;  1SR0 A;  1Y0O A;  4DWS D;  1WB0 A;  2MPH A;  5GPG A;  2O9O A;  2Q5A A;  4DRN A;  1E6Z A;  4WKF A;  2YBU A;  4ZPW R;  4DWS B;  1B6C A;  3UQB A;  2KFW A;  4GIV A;  2ZR5 A;  3JYJ A;  3O5R A;  1F40 A;  3WQV A;  1K9T A;  2KE0 A;  3ARV A;  3B8S A;  2L2S A;  1D6O A;  4XAK A;  4N19 A;  4DRI A;  4JFL A;  3H9R B;  5HW7 A;  1HXV A;  1J4I A;  1H0G A;  4NNR A;  3O5E A;  3O5F A;  4R5E A;  2A3A A;  4ODO A;  4ODK A;  1FKI A;  1E15 A;  2MNT A;  2MLZ A;  3RM8 A;  3TC5 A;  4Z2J A;  2MF9 A;  3ARR A;  5HUA A;  3LUO A;  1EIB A;  1JNE A;  1VF8 A;  2Y78 A;  1X6L A;  4JFI A;  4Z2H A;  1FKG A;  2DSZ A;  3IKD A;  4W9Q A;  2DSV A;  2FDM A;  2QF8 A;  2G8Z A;  3ALG A;  4DT4 A;  1FJD A;  5HKG A;  3KAF A;  1M5Y A;  1IX5 A;  1T11 A;  1XRV A;  1EHN A;  3PRD A;  5J6E A;  2DT2 A;  2ESC A;  4JFK A;  1ZL1 A;  1FAP A;  3WL1 A;  1LL7 A;  4Z2L A;  1GPF A;  1KFW A;  1D7I A;  4MNM A;  1LJY A;  5DIU A;  1LG2 A;  3CGM A;  2YBT A;  1SYT A;  4U84 A;  2PPN A;  5HW8 A;  4IPX A;  4JFM A;  3CHE A;  3O5O A;  1HKI A;  1W26 A;  4ODL A;  4MSP A;  1WAW A;  4J4O A;  3RFW A;  3CHF A;  4DIP A;  4W9O A;  2G41 A;  5DEZ A;  2LPV A;  2XP8 A;  4DRP A;  1PBK A;  3CZ8 A;  2LJ4 A;  4DRQ A;  4MAV A;  4WKH A;  1FKB A;  3WD0 A;  1FKK A;  2N87 A;  1NMV A;  4ODP A;  5HWC A;  2DSU A;  4TW7 A;  2XP6 A;  3ALF A;  4FAP A;  1D7J A;  3ARS A;  1EQ3 A;  1FKL A;  3ART A;  2XP5 A;  1L1P A;  3AS0 A;  2F4E A;  3CGN A;  4MNL A;  2D9F A;  4KR0 B;  4QT3 A;  3IHZ A;  4TW6 A;  4WIW A;  1JND A;  4ML4 A;  3ARU A;  4W9P A;  1A7X A;  1GOI A;  4Q7N A;  1KT1 A;  2A3B A;  4IQC A;  2DPE A;  3AQU A;  3O5P A;  4LAV A;  3TDB A;  4ODQ A;  4NSB A;  3JYM A;  4DRJ A;  3I6C A;  4L72 B;  4HAR A;  2A3E A;  4URI A;  4MNK A;  5HT1 A;  5B8I C;  2ZQS A;  4QT2 A;  1NWU A;  2ITK A;  1PIN A;  1E6P A;  3NI6 A;  3RM9 A;  2RUD A;  3AS2 A;  1NH6 A;  1OWQ A;  3OOB A;  2AWG A;  3PRB A;  2RUR A;  1TFV A;  3KCE A;  4P8U A;  2FAP A;  3G6L A;  1LG1 A;  1HKK A;  2WK2 A;  4KQZ A;  2XPB A;  1UR8 A;  1ZCN A;  4Z2K A;  4DWS A;  3WD4 A;  2ZR6 A;  1QPF A;  1EDQ A;  1W9P A;  1YAT A;  4TYO A;  2VN1 A;  4Z2I A;  2XPA A;  4WK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...