1NSGA

The structure of the immunophilin-immunosuppressant fkbp12-rapamycin complex interacting with human frap
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-BINDING PROTEIN
publication title Refined structure of the FKBP12-rapamycin-FRB ternary complex at 2.2 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (isomerase/kinase)
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1997-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1nsgA00
4U86A 2KE0A 3PRDA 3UI4A 1J4RA 4J4OA 1NMVA 3LUOA 1Q1CA 4GIVA 4FAPA 4DRMA 5HW8A 5D75A 4O2TA 1KT0A 5HTGA 2ZR4A 1PBKA 3NTPA 3WH0A 1F40A 1FKJA 1FKGA 3B7XA 2ZQUA 3TCZA 4TW8A 3UI6A 5J6EA 1M5YA 1A7XA 4ODPA 1P5QA 2RURA 3O5IA 3KCEA 4TYOA 4DIPA 1FD9A 3CGNA 5HUAA 2KO7A 3O5LA 2PBCA 3IK8A 2FKEA 4W9PA 3UQBA 1YATA 1W26A 3O5OA 4U85A 4TW6A 4DH0A 4JFKA 3VAWA 1JNSA 1EYMA 4ODQA 5HT1A 1D7JA 1FKDA 1T11A 2XPAA 2F4EA 3KACA 2LPVA 1C9HA 1FKKA 4G50A 4LAXA 2JZVA 4NNRA 5HW7A 5HWBA 3JYMA 1QPFA 1FAPA 3GPKA 5GPGA 3O5DA 4DRNA 4ODRA 1BKFA 1FKFA 3O5MA 3KAIA 1D7IA 1ROTA 2ZQTA 3O5FA 4ODNA 2MPHA 3TC5A 2MF9A 2M08A 4QIBA 4TX0A 4JFIA 3TDBA 4DZ3A 3NRKA 1Y0OA 1J6YA 2KI3A 5B8IC 1J4IA 3RFWA 4W9OA 1EQ3A 2Y78A 5HW6A 1D7HA 3O5RA 4MGVA 4DRQA 3O5GA 4DRJA 3IKDA 3NI6A 2KGJA 4LAVA 5BXJA 1D6OA 5HKGA 3UF8A 5DITA 5DIVA 3KAGA 4ITZA 2ZQSA 4JFMA 3PA7A 3EY6A 4QT2A 3KABA 3PRBA 2K8IA 4JFJA 2PPOA 3KADA 4W9QA 2F21A 1NMWA 3CGMA 3JXVA 2FAPA 3KZ7A 4IPXA 1JNTA 3UI5A 1FKBA 1QZ2A 2F2DA 2ZQVA 2D9FA 2LGOA 2PPPA 1F8AB 2ZR6A 2DG4A 2XP7A 4TW7A 4BF8A 4LAYA 1KT1A 2XP4A 2Q5AA 4ODMA 5I98A 3O5PA 3JYJA 4JYSA 2LJ4A 2XP9A 1ZCNA 1Q6HA 2MLZA 4U84A 1FKTA 4ODLA 2PV1A 3UQAA 4LAWA 1YW5A 4QT3A 4TNSA 2MLYA 4G2PA 1FKHA 2M1IA 3IKGA 4IQCA 2XP5A 2ITKA 2DG3A 2OFNA 3I6CA 4MSPA 3RGCA 1FJDA 1FKRA 2LKNA 1N1AA 2PV3A 1FKLA 2N87A 3O5JA 1ROUA 3H9RB 2AWGA 1PINA 2DG9A 3O5KA 1Q6IA 2PV2A 3O5EA 3ODKA 2MLXA 3MDYB 4DROA 4DZ2A 3IHZA 2KR7A 2VN1A 1B6CA 3O5QA 4JFLA 4C02B 2M2AA 2RQSA 2RSEA 3FAPA 1BL4A 2L2SA 3KAHA 1ZK6A 3UQIA 2XP6A 1L1PA 4IQ2A 3KAFA 2KFWA 4GGQA 1FKIA 2RUQA 2XP8A 2MNTA 4N19A 2PPNA 1J4HA 5HWCA 4ODKA 1QPLA 4DRHA 4DT4A 4ODOA 1Q6UA 4R0XA 2XP3A 1TCOC 1HXVA 4J4NA 2IF4A 3OOBA 2ZR5A 2VCDA 5DIUA 1NSGA 2UZ5A 1FKSA 4DRIA 4DRKA 4DRPA 2XPBA 2RUCA 4FN2A 1R9HA 1JVWA 1U79A 2RUDA
chains in the Genus database with same CATH superfamily
1WAWA 4U86A 2KE0A 3UI4A 1LG1A 4FAPA 2YBTA 1KT0A 4O2TA 1PBKA 3BMBA 1F40A 3ARYA 4IT6A 3WD0A 1FKGA 4HBEA 3B7XA 3TCZA 5J6EA 1M5YA 1A7XA 1P5QA 1SR0A 4MPKA 2PBCA 4MNJA 4U85A 1LG2A 4DH0A 4JFKA 3VAWA 4ODQA 5HT1A 2IUZA 3B8SA 1FKDA 4LAXA 1FKKA 4G50A 5HW7A 5DO2A 4DRNA 1FAPA 2OLHA 3B9EA 4ODRA 1NWTA 3KAIA 2DPEA 2MF9A 1J6YA 1W9UA 5B8IC 1RD6A 2Y78A 4HBOA 3O5RA 4MGVA 4DWSC 2FDMA 3GU0A 4Z2JA 3B9AA 4JFMA 4ITZA 2ZQSA 3PA7A 4P8WA 3PRBA 4W9QA 2PPOA 3KADA 2F21A 3UI5A 1FKBA 1HJWA 1QZ2A 2PPPA 1ZB5A 2ZR6A 2Q5AA 5I98A 3O5PA 2LJ4A 3AROA 4ZS6A 1E6RA 1GRJA 1ZCNA 1Q6HA 2MLZA 4U84A 2PV1A 5GQBA 1E6PA 5DF0A 1FKRA 2DG3A 2LKNA 2PV3A 3ARVA 1FKLA 2QF8A 3G6LA 3O5JA 1ROUA 2AWGA 4Q7NA 3O5KA 3O5EA 2MLXA 4MNLA 3KAHA 4ZPTR 2DSVA 1L1PA 1OGBA 4Z2GA 2XP8A 4N19A 5HWCA 1ITXA 1TCOC 3ARTA 1IX5A 5DIUA 1W1VA 1LL7A 1KFWA 2RUCA 2YBUA 3RM8A 1U79A 1VF8A 3WD3A 2DT3A 4MTVA 3WIJA 1J4RA 3LUOA 4GIVA 1X6NA 1W9VA 4ZPWR 1SYTA 2WLZA 5HTGA 3NTPA 2EULA 1FFRA 4KQZA 4UDMA 4DIPA 3KCEA 5HUAA 1WNOA 3IK8A 5DEZA 1HKKA 1YATA 1W26A 2F23A 3O5OA 4TW6A 1JCHB 3WL1A 2XPAA 4NNRA 1X6LA 2DT1A 5HWBA 1QPFA 3O5MA 3O5FA 4QZVB 4R5EA 4S3JA 4Z2KA 3RFWA 4W9OA 4LGXA 5HW6A 1D7HA 2A3AA 4P8VA 3UF8A 5DIVA 2WLYA 2K8IA 4JFJA 3KZ7A 1NMWA 3CGMA 4IPXA 3WD4A 1JNTA 2F2DA 4NSBA 2D9FA 2XP7A 3W4RA 1KT1A 3ARRA 4ODMA 4JYSA 3JYJA 1H0IA 3PRAA 3BXWA 3CZ8A 3UQAA 1ZBVA 4QT3A 4TNSA 3IKGA 4S3KA 3ARPA 2XP5A 3I6CA 1W1TA 4MSPA 4Z2IA 3WD1A 3WD2A 3CHEA 3WKZA 3QOKA 1Q6IA 3ODKA 1E6ZA 1LJYA 1CTNA 2RSEA 1HJXA 2KFWA 2RUQA 4DWSA 1NWRA 3FY1A 4ODOA 3AS3A 1ZU8A 4Z2LA 2ZR5A 2AOSA 2G8ZA 4KR0B 4DRKA 2DSUA 3CHFA 1HJVA 2XPBA 4WKAA 3PRDA 4J4OA 1ZL1A 1OGGA 5HW8A 1LL4A 5D75A 2A3CA 1FKJA 4TW8A 3AS0A 2RURA 4TYOA 5JH8A 4XAKA 4W9PA 2FKEA 3UQBA 1ZBKA 1JNSA 1EYMA 3GTYX 2PI6A 1D7JA 1XRVA 2F4EA 3KACA 2LPVA 4AY1A 1HKIA 1C9HA 2A3BA 2JZVA 1HKMA 5GPGA 3GPKA 1FKFA 1JNDA 1ROTA 2ZQTA 2DSZA 1K9TA 2MPHA 2G41A 2M08A 4QIBA 4TX0A 4JFIA 1Y0OA 1J4IA 1EQ3A 4IT4A 4DRQA 3O5GA 4DRJA 3NI6A 1EDQA 4LAVA 5BXJA 5HKGA 3CHCA 1UR8A 3ARQA 3FXYA 3KAGA 3EY6A 3KABA 2WK2A 2FAPA 2ZQVA 3RM9A 1W9PA 2DG4A 4BF8A 1EHNA 3ARZA 4DWSB 2XP9A 2DT0A 4W5UA 2B5UB 1FKTA 4WK9A 4MAVA 3ARWA 2MLYA 2O9OA 4PTMA 1FKHA 1ZBCA 2M1IA 3ALGA 4IQCA 1D2KA 3CH9A 3H9RB 1HKJA 4DROA 2PV2A 4NZCA 1O6IA 3MDYB 2VN1A 2A3EA 4JFLA 4C02B 2M2AA 3G6MA 4ML4A 2B31A 2L2SA 1ZK6A 4IQ2A 1WB0A 3PR9A 3KAFA 4Z2HA 4GGQA 3AS2A 2PPNA 4ODKA 1QPLA 1FFQA 3RM4A 4MNKA 4R0XA 4MNMA 1HXVA 3AQUA 1LQ0A 2UZ5A 1FKSA 4P8UA 4DRPA 4DZ3A 4FN2A 1R9HA 1JVWA 1W1PA 2RUDA 1NWSA 3OA5A 5GPRA 1E9LA 1ZBWA 1NMVA 1Q1CA 4ZPVR 3ARSA 4DRMA 1GOIA 2ZR4A 3WH0A 4WIWA 3WL0A 1XHGA 2ZQUA 3CHDA 3UI6A 4URIA 4ODPA 3O5IA 3RMEA 1FD9A 3CGNA 1TFVA 2KO7A 3ARUA 3O5LA 1UR9A 1LL6A 4WKFA 4L72B 3ALFA 1T11A 4P8XA 3JYMA 3O5DA 1BKFA 2P4VA 4ODNA 1D7IA 3TC5A 4WKHA 3TDBA 4WJXA 4DWSD 3NRKA 2KI3A 3IKDA 2KGJA 1NH6A 1D6OA 5DITA 2PN0A 3B9DA 4QT2A 3EIPA 1E44A 3JXVA 3AS1A 3WQVA 4L3NA 2LGOA 1F8AB 1EIBA 4HARA 4TW7A 2DT2A 4LAYA 2XP4A 1JNEA 1W1YA 4ODLA 1E6NA 2WM0A 4LAWA 1YW5A 4G2PA 2ESCA 2ITKA 2OFNA 3RGCA 1FJDA 1N1AA 2N87A 3WQWA 1PINA 2DG9A 2O92A 4DZ2A 3ARXA 2ETNA 3IHZA 2KR7A 1B6CA 3O5QA 4Q22A 2RQSA 3FAPA 1BL4A 3UQIA 2XP6A 1GPFA 2DSWA 1NWUA 1FKIA 2MNTA 1H0GA 1J4HA 4DRHA 4DT4A 1E15A 1GUVA 1Q6UA 2XP3A 4J4NA 2IF4A 3OOBA 1OWQA 2VCDA 1NSGA 5HBFA 4DRIA
chains in the Genus database with same CATH topology
1WAWA 4U86A 2KE0A 3UI4A 1LG1A 4FAPA 2YBTA 1KT0A 4O2TA 1PBKA 1F40A 3ARYA 4IT6A 3WD0A 1FKGA 4HBEA 3B7XA 3TCZA 5J6EA 1M5YA 1A7XA 1P5QA 1SR0A 4MPKA 2PBCA 4MNJA 4U85A 1LG2A 4DH0A 4JFKA 3VAWA 4ODQA 5HT1A 2IUZA 3B8SA 1FKDA 4LAXA 1FKKA 4G50A 5HW7A 5DO2A 4DRNA 1FAPA 2OLHA 3B9EA 4ODRA 1NWTA 3KAIA 2DPEA 2MF9A 1J6YA 1W9UA 5B8IC 1RD6A 2Y78A 4HBOA 3O5RA 4MGVA 4DWSC 2FDMA 4Z2JA 3B9AA 4JFMA 4ITZA 2ZQSA 3PA7A 4P8WA 3PRBA 4W9QA 2PPOA 3KADA 2F21A 3UI5A 1FKBA 1HJWA 1QZ2A 2PPPA 1ZB5A 2ZR6A 2Q5AA 5I98A 3O5PA 2LJ4A 3AROA 4ZS6A 1E6RA 1ZCNA 1Q6HA 2MLZA 4U84A 2PV1A 5GQBA 1E6PA 5DF0A 1FKRA 2DG3A 2LKNA 2PV3A 3ARVA 1FKLA 2QF8A 3G6LA 3O5JA 1ROUA 2AWGA 4Q7NA 3O5KA 3O5EA 2MLXA 4MNLA 3KAHA 4ZPTR 2DSVA 1L1PA 1OGBA 4Z2GA 2XP8A 4N19A 5HWCA 1ITXA 1TCOC 3ARTA 1IX5A 5DIUA 1W1VA 1LL7A 1KFWA 2RUCA 2YBUA 3RM8A 1U79A 1VF8A 3WD3A 2DT3A 4MTVA 3WIJA 1J4RA 3LUOA 4GIVA 1X6NA 1W9VA 4ZPWR 1SYTA 2WLZA 5HTGA 3NTPA 1FFRA 4KQZA 4DIPA 3KCEA 5HUAA 1WNOA 3IK8A 5DEZA 1HKKA 1YATA 1W26A 3O5OA 4TW6A 3WL1A 2XPAA 4NNRA 1X6LA 2DT1A 5HWBA 1QPFA 3O5MA 3O5FA 4QZVB 4R5EA 4S3JA 4Z2KA 3RFWA 4W9OA 4LGXA 5HW6A 1D7HA 2A3AA 4P8VA 3UF8A 5DIVA 2WLYA 2K8IA 4JFJA 3KZ7A 1NMWA 3CGMA 4IPXA 3WD4A 1JNTA 2F2DA 4NSBA 2D9FA 2XP7A 3W4RA 1KT1A 3ARRA 4ODMA 4JYSA 3JYJA 1H0IA 3PRAA 3BXWA 3CZ8A 3UQAA 1ZBVA 4QT3A 4TNSA 3IKGA 4S3KA 3ARPA 2XP5A 3I6CA 1W1TA 4MSPA 4Z2IA 3WD1A 3WD2A 3CHEA 3WKZA 3QOKA 1Q6IA 3ODKA 1E6ZA 1LJYA 1CTNA 2RSEA 1HJXA 2KFWA 2RUQA 4DWSA 1NWRA 3FY1A 4ODOA 3AS3A 1ZU8A 4Z2LA 2ZR5A 2AOSA 2G8ZA 4KR0B 4DRKA 2DSUA 3CHFA 1HJVA 2XPBA 4WKAA 3PRDA 4J4OA 1ZL1A 1OGGA 5HW8A 1LL4A 5D75A 2A3CA 1FKJA 4TW8A 3AS0A 2RURA 4TYOA 5JH8A 4XAKA 4W9PA 2FKEA 3UQBA 1ZBKA 1JNSA 1EYMA 2PI6A 1D7JA 1XRVA 2F4EA 3KACA 2LPVA 4AY1A 1HKIA 1C9HA 2A3BA 2JZVA 1HKMA 5GPGA 3GPKA 1FKFA 1JNDA 1ROTA 2ZQTA 2DSZA 1K9TA 2MPHA 2G41A 2M08A 4QIBA 4TX0A 4JFIA 1Y0OA 1J4IA 1EQ3A 4IT4A 4DRQA 3O5GA 4DRJA 3NI6A 1EDQA 4LAVA 5BXJA 5HKGA 3CHCA 1UR8A 3ARQA 3FXYA 3KAGA 3EY6A 3KABA 2WK2A 2FAPA 2ZQVA 3RM9A 1W9PA 2DG4A 4BF8A 1EHNA 3ARZA 4DWSB 2XP9A 2DT0A 4W5UA 1FKTA 4WK9A 4MAVA 3ARWA 2MLYA 2O9OA 4PTMA 1FKHA 1ZBCA 2M1IA 3ALGA 4IQCA 1D2KA 3CH9A 3H9RB 1HKJA 4DROA 2PV2A 4NZCA 1O6IA 3MDYB 2VN1A 2A3EA 4JFLA 4C02B 2M2AA 3G6MA 4ML4A 2B31A 2L2SA 1ZK6A 4IQ2A 1WB0A 3PR9A 3KAFA 4Z2HA 4GGQA 3AS2A 2PPNA 4ODKA 1QPLA 1FFQA 3RM4A 4MNKA 4R0XA 4MNMA 1HXVA 3AQUA 1LQ0A 2UZ5A 1FKSA 4P8UA 4DRPA 4DZ3A 4FN2A 1R9HA 1JVWA 1W1PA 2RUDA 1NWSA 3OA5A 5GPRA 1E9LA 1ZBWA 1NMVA 1Q1CA 4ZPVR 3ARSA 4DRMA 1GOIA 2ZR4A 3WH0A 4WIWA 3WL0A 1XHGA 2ZQUA 3CHDA 3UI6A 4URIA 4ODPA 3O5IA 3RMEA 1FD9A 3CGNA 1TFVA 2KO7A 3ARUA 3O5LA 1UR9A 1LL6A 4WKFA 4L72B 3ALFA 1T11A 4P8XA 3JYMA 3O5DA 1BKFA 4ODNA 1D7IA 3TC5A 4WKHA 3TDBA 4WJXA 4DWSD 3NRKA 2KI3A 3IKDA 2KGJA 1NH6A 1D6OA 5DITA 4QT2A 3B9DA 3JXVA 3AS1A 3WQVA 4L3NA 2LGOA 1F8AB 1EIBA 4HARA 4TW7A 2DT2A 4LAYA 2XP4A 1JNEA 1W1YA 4ODLA 1E6NA 2WM0A 4LAWA 1YW5A 4G2PA 2ESCA 2ITKA 2OFNA 3RGCA 1FJDA 1N1AA 2N87A 3WQWA 1PINA 2DG9A 2O92A 4DZ2A 3ARXA 3IHZA 2KR7A 1B6CA 3O5QA 4Q22A 2RQSA 3FAPA 1BL4A 3UQIA 2XP6A 1GPFA 2DSWA 1NWUA 1FKIA 2MNTA 1H0GA 1J4HA 4DRHA 4DT4A 1E15A 1GUVA 1Q6UA 2XP3A 4J4NA 2IF4A 3OOBA 1OWQA 2VCDA 1NSGA 5HBFA 4DRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U86 A;  2KE0 A;  3PRD A;  3UI4 A;  1J4R A;  4J4O A;  1NMV A;  3LUO A;  1Q1C A;  4GIV A;  4FAP A;  4DRM A;  5HW8 A;  5D75 A;  4O2T A;  1KT0 A;  5HTG A;  2ZR4 A;  1PBK A;  3NTP A;  3WH0 A;  1F40 A;  1FKJ A;  1FKG A;  3B7X A;  2ZQU A;  3TCZ A;  4TW8 A;  3UI6 A;  5J6E A;  1M5Y A;  1A7X A;  4ODP A;  1P5Q A;  2RUR A;  3O5I A;  3KCE A;  4TYO A;  4DIP A;  1FD9 A;  3CGN A;  5HUA A;  2KO7 A;  3O5L A;  2PBC A;  3IK8 A;  2FKE A;  4W9P A;  3UQB A;  1YAT A;  1W26 A;  3O5O A;  4U85 A;  4TW6 A;  4DH0 A;  4JFK A;  3VAW A;  1JNS A;  1EYM A;  4ODQ A;  5HT1 A;  1D7J A;  1FKD A;  1T11 A;  2XPA A;  2F4E A;  3KAC A;  2LPV A;  1C9H A;  1FKK A;  4G50 A;  4LAX A;  2JZV A;  4NNR A;  5HW7 A;  5HWB A;  3JYM A;  1QPF A;  1FAP A;  3GPK A;  5GPG A;  3O5D A;  4DRN A;  4ODR A;  1BKF A;  1FKF A;  3O5M A;  3KAI A;  1D7I A;  1ROT A;  2ZQT A;  3O5F A;  4ODN A;  2MPH A;  3TC5 A;  2MF9 A;  2M08 A;  4QIB A;  4TX0 A;  4JFI A;  3TDB A;  4DZ3 A;  3NRK A;  1Y0O A;  1J6Y A;  2KI3 A;  5B8I C;  1J4I A;  3RFW A;  4W9O A;  1EQ3 A;  2Y78 A;  5HW6 A;  1D7H A;  3O5R A;  4MGV A;  4DRQ A;  3O5G A;  4DRJ A;  3IKD A;  3NI6 A;  2KGJ A;  4LAV A;  5BXJ A;  1D6O A;  5HKG A;  3UF8 A;  5DIT A;  5DIV A;  3KAG A;  4ITZ A;  2ZQS A;  4JFM A;  3PA7 A;  3EY6 A;  4QT2 A;  3KAB A;  3PRB A;  2K8I A;  4JFJ A;  2PPO A;  3KAD A;  4W9Q A;  2F21 A;  1NMW A;  3CGM A;  3JXV A;  2FAP A;  3KZ7 A;  4IPX A;  1JNT A;  3UI5 A;  1FKB A;  1QZ2 A;  2F2D A;  2ZQV A;  2D9F A;  2LGO A;  2PPP A;  1F8A B;  2ZR6 A;  2DG4 A;  2XP7 A;  4TW7 A;  4BF8 A;  4LAY A;  1KT1 A;  2XP4 A;  2Q5A A;  4ODM A;  5I98 A;  3O5P A;  3JYJ A;  4JYS A;  2LJ4 A;  2XP9 A;  1ZCN A;  1Q6H A;  2MLZ A;  4U84 A;  1FKT A;  4ODL A;  2PV1 A;  3UQA A;  4LAW A;  1YW5 A;  4QT3 A;  4TNS A;  2MLY A;  4G2P A;  1FKH A;  2M1I A;  3IKG A;  4IQC A;  2XP5 A;  2ITK A;  2DG3 A;  2OFN A;  3I6C A;  4MSP A;  3RGC A;  1FJD A;  1FKR A;  2LKN A;  1N1A A;  2PV3 A;  1FKL A;  2N87 A;  3O5J A;  1ROU A;  3H9R B;  2AWG A;  1PIN A;  2DG9 A;  3O5K A;  1Q6I A;  2PV2 A;  3O5E A;  3ODK A;  2MLX A;  3MDY B;  4DRO A;  4DZ2 A;  3IHZ A;  2KR7 A;  2VN1 A;  1B6C A;  3O5Q A;  4JFL A;  4C02 B;  2M2A A;  2RQS A;  2RSE A;  3FAP A;  1BL4 A;  2L2S A;  3KAH A;  1ZK6 A;  3UQI A;  2XP6 A;  1L1P A;  4IQ2 A;  3KAF A;  2KFW A;  4GGQ A;  1FKI A;  2RUQ A;  2XP8 A;  2MNT A;  4N19 A;  2PPN A;  1J4H A;  5HWC A;  4ODK A;  1QPL A;  4DRH A;  4DT4 A;  4ODO A;  1Q6U A;  4R0X A;  2XP3 A;  1TCO C;  1HXV A;  4J4N A;  2IF4 A;  3OOB A;  2ZR5 A;  2VCD A;  5DIU A;  1NSG A;  2UZ5 A;  1FKS A;  4DRI A;  4DRK A;  4DRP A;  2XPB A;  2RUC A;  4FN2 A;  1R9H A;  1JVW A;  1U79 A;  2RUD A; 
#chains in the Genus database with same CATH topology
 1WAW A;  4U86 A;  2KE0 A;  3UI4 A;  1LG1 A;  4FAP A;  2YBT A;  1KT0 A;  4O2T A;  1PBK A;  3BMB A;  1F40 A;  3ARY A;  4IT6 A;  3WD0 A;  1FKG A;  4HBE A;  3B7X A;  3TCZ A;  5J6E A;  1M5Y A;  1A7X A;  1P5Q A;  1SR0 A;  4MPK A;  2PBC A;  4MNJ A;  4U85 A;  1LG2 A;  4DH0 A;  4JFK A;  3VAW A;  4ODQ A;  5HT1 A;  2IUZ A;  3B8S A;  1FKD A;  4LAX A;  1FKK A;  4G50 A;  5HW7 A;  5DO2 A;  4DRN A;  1FAP A;  2OLH A;  3B9E A;  4ODR A;  1NWT A;  3KAI A;  2DPE A;  2MF9 A;  1J6Y A;  1W9U A;  5B8I C;  1RD6 A;  2Y78 A;  4HBO A;  3O5R A;  4MGV A;  4DWS C;  2FDM A;  3GU0 A;  4Z2J A;  3B9A A;  4JFM A;  4ITZ A;  2ZQS A;  3PA7 A;  4P8W A;  3PRB A;  4W9Q A;  2PPO A;  3KAD A;  2F21 A;  3UI5 A;  1FKB A;  1HJW A;  1QZ2 A;  2PPP A;  1ZB5 A;  2ZR6 A;  2Q5A A;  5I98 A;  3O5P A;  2LJ4 A;  3ARO A;  4ZS6 A;  1E6R A;  1GRJ A;  1ZCN A;  1Q6H A;  2MLZ A;  4U84 A;  2PV1 A;  5GQB A;  1E6P A;  5DF0 A;  1FKR A;  2DG3 A;  2LKN A;  2PV3 A;  3ARV A;  1FKL A;  2QF8 A;  3G6L A;  3O5J A;  1ROU A;  2AWG A;  4Q7N A;  3O5K A;  3O5E A;  2MLX A;  4MNL A;  3KAH A;  4ZPT R;  2DSV A;  1L1P A;  1OGB A;  4Z2G A;  2XP8 A;  4N19 A;  5HWC A;  1ITX A;  1TCO C;  3ART A;  1IX5 A;  5DIU A;  1W1V A;  1LL7 A;  1KFW A;  2RUC A;  2YBU A;  3RM8 A;  1U79 A;  1VF8 A;  3WD3 A;  2DT3 A;  4MTV A;  3WIJ A;  1J4R A;  3LUO A;  4GIV A;  1X6N A;  1W9V A;  4ZPW R;  1SYT A;  2WLZ A;  5HTG A;  3NTP A;  2EUL A;  1FFR A;  4KQZ A;  4UDM A;  4DIP A;  3KCE A;  5HUA A;  1WNO A;  3IK8 A;  5DEZ A;  1HKK A;  1YAT A;  1W26 A;  2F23 A;  3O5O A;  4TW6 A;  1JCH B;  3WL1 A;  2XPA A;  4NNR A;  1X6L A;  2DT1 A;  5HWB A;  1QPF A;  3O5M A;  3O5F A;  4QZV B;  4R5E A;  4S3J A;  4Z2K A;  3RFW A;  4W9O A;  4LGX A;  5HW6 A;  1D7H A;  2A3A A;  4P8V A;  3UF8 A;  5DIV A;  2WLY A;  2K8I A;  4JFJ A;  3KZ7 A;  1NMW A;  3CGM A;  4IPX A;  3WD4 A;  1JNT A;  2F2D A;  4NSB A;  2D9F A;  2XP7 A;  3W4R A;  1KT1 A;  3ARR A;  4ODM A;  4JYS A;  3JYJ A;  1H0I A;  3PRA A;  3BXW A;  3CZ8 A;  3UQA A;  1ZBV A;  4QT3 A;  4TNS A;  3IKG A;  4S3K A;  3ARP A;  2XP5 A;  3I6C A;  1W1T A;  4MSP A;  4Z2I A;  3WD1 A;  3WD2 A;  3CHE A;  3WKZ A;  3QOK A;  1Q6I A;  3ODK A;  1E6Z A;  1LJY A;  1CTN A;  2RSE A;  1HJX A;  2KFW A;  2RUQ A;  4DWS A;  1NWR A;  3FY1 A;  4ODO A;  3AS3 A;  1ZU8 A;  4Z2L A;  2ZR5 A;  2AOS A;  2G8Z A;  4KR0 B;  4DRK A;  2DSU A;  3CHF A;  1HJV A;  2XPB A;  4WKA A;  3PRD A;  4J4O A;  1ZL1 A;  1OGG A;  5HW8 A;  1LL4 A;  5D75 A;  2A3C A;  1FKJ A;  4TW8 A;  3AS0 A;  2RUR A;  4TYO A;  5JH8 A;  4XAK A;  4W9P A;  2FKE A;  3UQB A;  1ZBK A;  1JNS A;  1EYM A;  3GTY X;  2PI6 A;  1D7J A;  1XRV A;  2F4E A;  3KAC A;  2LPV A;  4AY1 A;  1HKI A;  1C9H A;  2A3B A;  2JZV A;  1HKM A;  5GPG A;  3GPK A;  1FKF A;  1JND A;  1ROT A;  2ZQT A;  2DSZ A;  1K9T A;  2MPH A;  2G41 A;  2M08 A;  4QIB A;  4TX0 A;  4JFI A;  1Y0O A;  1J4I A;  1EQ3 A;  4IT4 A;  4DRQ A;  3O5G A;  4DRJ A;  3NI6 A;  1EDQ A;  4LAV A;  5BXJ A;  5HKG A;  3CHC A;  1UR8 A;  3ARQ A;  3FXY A;  3KAG A;  3EY6 A;  3KAB A;  2WK2 A;  2FAP A;  2ZQV A;  3RM9 A;  1W9P A;  2DG4 A;  4BF8 A;  1EHN A;  3ARZ A;  4DWS B;  2XP9 A;  2DT0 A;  4W5U A;  2B5U B;  1FKT A;  4WK9 A;  4MAV A;  3ARW A;  2MLY A;  2O9O A;  4PTM A;  1FKH A;  1ZBC A;  2M1I A;  3ALG A;  4IQC A;  1D2K A;  3CH9 A;  3H9R B;  1HKJ A;  4DRO A;  2PV2 A;  4NZC A;  1O6I A;  3MDY B;  2VN1 A;  2A3E A;  4JFL A;  4C02 B;  2M2A A;  3G6M A;  4ML4 A;  2B31 A;  2L2S A;  1ZK6 A;  4IQ2 A;  1WB0 A;  3PR9 A;  3KAF A;  4Z2H A;  4GGQ A;  3AS2 A;  2PPN A;  4ODK A;  1QPL A;  1FFQ A;  3RM4 A;  4MNK A;  4R0X A;  4MNM A;  1HXV A;  3AQU A;  1LQ0 A;  2UZ5 A;  1FKS A;  4P8U A;  4DRP A;  4DZ3 A;  4FN2 A;  1R9H A;  1JVW A;  1W1P A;  2RUD A;  1NWS A;  3OA5 A;  5GPR A;  1E9L A;  1ZBW A;  1NMV A;  1Q1C A;  4ZPV R;  3ARS A;  4DRM A;  1GOI A;  2ZR4 A;  3WH0 A;  4WIW A;  3WL0 A;  1XHG A;  2ZQU A;  3CHD A;  3UI6 A;  4URI A;  4ODP A;  3O5I A;  3RME A;  1FD9 A;  3CGN A;  1TFV A;  2KO7 A;  3ARU A;  3O5L A;  1UR9 A;  1LL6 A;  4WKF A;  4L72 B;  3ALF A;  1T11 A;  4P8X A;  3JYM A;  3O5D A;  1BKF A;  2P4V A;  4ODN A;  1D7I A;  3TC5 A;  4WKH A;  3TDB A;  4WJX A;  4DWS D;  3NRK A;  2KI3 A;  3IKD A;  2KGJ A;  1NH6 A;  1D6O A;  5DIT A;  2PN0 A;  3B9D A;  4QT2 A;  3EIP A;  1E44 A;  3JXV A;  3AS1 A;  3WQV A;  4L3N A;  2LGO A;  1F8A B;  1EIB A;  4HAR A;  4TW7 A;  2DT2 A;  4LAY A;  2XP4 A;  1JNE A;  1W1Y A;  4ODL A;  1E6N A;  2WM0 A;  4LAW A;  1YW5 A;  4G2P A;  2ESC A;  2ITK A;  2OFN A;  3RGC A;  1FJD A;  1N1A A;  2N87 A;  3WQW A;  1PIN A;  2DG9 A;  2O92 A;  4DZ2 A;  3ARX A;  2ETN A;  3IHZ A;  2KR7 A;  1B6C A;  3O5Q A;  4Q22 A;  2RQS A;  3FAP A;  1BL4 A;  3UQI A;  2XP6 A;  1GPF A;  2DSW A;  1NWU A;  1FKI A;  2MNT A;  1H0G A;  1J4H A;  4DRH A;  4DT4 A;  1E15 A;  1GUV A;  1Q6U A;  2XP3 A;  4J4N A;  2IF4 A;  3OOB A;  1OWQ A;  2VCD A;  1NSG A;  5HBF A;  4DRI A; 
#chains in the Genus database with same CATH homology
 1WAW A;  4U86 A;  2KE0 A;  3UI4 A;  1LG1 A;  4FAP A;  2YBT A;  1KT0 A;  4O2T A;  1PBK A;  1F40 A;  3ARY A;  4IT6 A;  3WD0 A;  1FKG A;  4HBE A;  3B7X A;  3TCZ A;  5J6E A;  1M5Y A;  1A7X A;  1P5Q A;  1SR0 A;  4MPK A;  2PBC A;  4MNJ A;  4U85 A;  1LG2 A;  4DH0 A;  4JFK A;  3VAW A;  4ODQ A;  5HT1 A;  2IUZ A;  3B8S A;  1FKD A;  4LAX A;  1FKK A;  4G50 A;  5HW7 A;  5DO2 A;  4DRN A;  1FAP A;  2OLH A;  3B9E A;  4ODR A;  1NWT A;  3KAI A;  2DPE A;  2MF9 A;  1J6Y A;  1W9U A;  5B8I C;  1RD6 A;  2Y78 A;  4HBO A;  3O5R A;  4MGV A;  4DWS C;  2FDM A;  4Z2J A;  3B9A A;  4JFM A;  4ITZ A;  2ZQS A;  3PA7 A;  4P8W A;  3PRB A;  4W9Q A;  2PPO A;  3KAD A;  2F21 A;  3UI5 A;  1FKB A;  1HJW A;  1QZ2 A;  2PPP A;  1ZB5 A;  2ZR6 A;  2Q5A A;  5I98 A;  3O5P A;  2LJ4 A;  3ARO A;  4ZS6 A;  1E6R A;  1ZCN A;  1Q6H A;  2MLZ A;  4U84 A;  2PV1 A;  5GQB A;  1E6P A;  5DF0 A;  1FKR A;  2DG3 A;  2LKN A;  2PV3 A;  3ARV A;  1FKL A;  2QF8 A;  3G6L A;  3O5J A;  1ROU A;  2AWG A;  4Q7N A;  3O5K A;  3O5E A;  2MLX A;  4MNL A;  3KAH A;  4ZPT R;  2DSV A;  1L1P A;  1OGB A;  4Z2G A;  2XP8 A;  4N19 A;  5HWC A;  1ITX A;  1TCO C;  3ART A;  1IX5 A;  5DIU A;  1W1V A;  1LL7 A;  1KFW A;  2RUC A;  2YBU A;  3RM8 A;  1U79 A;  1VF8 A;  3WD3 A;  2DT3 A;  4MTV A;  3WIJ A;  1J4R A;  3LUO A;  4GIV A;  1X6N A;  1W9V A;  4ZPW R;  1SYT A;  2WLZ A;  5HTG A;  3NTP A;  1FFR A;  4KQZ A;  4DIP A;  3KCE A;  5HUA A;  1WNO A;  3IK8 A;  5DEZ A;  1HKK A;  1YAT A;  1W26 A;  3O5O A;  4TW6 A;  3WL1 A;  2XPA A;  4NNR A;  1X6L A;  2DT1 A;  5HWB A;  1QPF A;  3O5M A;  3O5F A;  4QZV B;  4R5E A;  4S3J A;  4Z2K A;  3RFW A;  4W9O A;  4LGX A;  5HW6 A;  1D7H A;  2A3A A;  4P8V A;  3UF8 A;  5DIV A;  2WLY A;  2K8I A;  4JFJ A;  3KZ7 A;  1NMW A;  3CGM A;  4IPX A;  3WD4 A;  1JNT A;  2F2D A;  4NSB A;  2D9F A;  2XP7 A;  3W4R A;  1KT1 A;  3ARR A;  4ODM A;  4JYS A;  3JYJ A;  1H0I A;  3PRA A;  3BXW A;  3CZ8 A;  3UQA A;  1ZBV A;  4QT3 A;  4TNS A;  3IKG A;  4S3K A;  3ARP A;  2XP5 A;  3I6C A;  1W1T A;  4MSP A;  4Z2I A;  3WD1 A;  3WD2 A;  3CHE A;  3WKZ A;  3QOK A;  1Q6I A;  3ODK A;  1E6Z A;  1LJY A;  1CTN A;  2RSE A;  1HJX A;  2KFW A;  2RUQ A;  4DWS A;  1NWR A;  3FY1 A;  4ODO A;  3AS3 A;  1ZU8 A;  4Z2L A;  2ZR5 A;  2AOS A;  2G8Z A;  4KR0 B;  4DRK A;  2DSU A;  3CHF A;  1HJV A;  2XPB A;  4WKA A;  3PRD A;  4J4O A;  1ZL1 A;  1OGG A;  5HW8 A;  1LL4 A;  5D75 A;  2A3C A;  1FKJ A;  4TW8 A;  3AS0 A;  2RUR A;  4TYO A;  5JH8 A;  4XAK A;  4W9P A;  2FKE A;  3UQB A;  1ZBK A;  1JNS A;  1EYM A;  2PI6 A;  1D7J A;  1XRV A;  2F4E A;  3KAC A;  2LPV A;  4AY1 A;  1HKI A;  1C9H A;  2A3B A;  2JZV A;  1HKM A;  5GPG A;  3GPK A;  1FKF A;  1JND A;  1ROT A;  2ZQT A;  2DSZ A;  1K9T A;  2MPH A;  2G41 A;  2M08 A;  4QIB A;  4TX0 A;  4JFI A;  1Y0O A;  1J4I A;  1EQ3 A;  4IT4 A;  4DRQ A;  3O5G A;  4DRJ A;  3NI6 A;  1EDQ A;  4LAV A;  5BXJ A;  5HKG A;  3CHC A;  1UR8 A;  3ARQ A;  3FXY A;  3KAG A;  3EY6 A;  3KAB A;  2WK2 A;  2FAP A;  2ZQV A;  3RM9 A;  1W9P A;  2DG4 A;  4BF8 A;  1EHN A;  3ARZ A;  4DWS B;  2XP9 A;  2DT0 A;  4W5U A;  1FKT A;  4WK9 A;  4MAV A;  3ARW A;  2MLY A;  2O9O A;  4PTM A;  1FKH A;  1ZBC A;  2M1I A;  3ALG A;  4IQC A;  1D2K A;  3CH9 A;  3H9R B;  1HKJ A;  4DRO A;  2PV2 A;  4NZC A;  1O6I A;  3MDY B;  2VN1 A;  2A3E A;  4JFL A;  4C02 B;  2M2A A;  3G6M A;  4ML4 A;  2B31 A;  2L2S A;  1ZK6 A;  4IQ2 A;  1WB0 A;  3PR9 A;  3KAF A;  4Z2H A;  4GGQ A;  3AS2 A;  2PPN A;  4ODK A;  1QPL A;  1FFQ A;  3RM4 A;  4MNK A;  4R0X A;  4MNM A;  1HXV A;  3AQU A;  1LQ0 A;  2UZ5 A;  1FKS A;  4P8U A;  4DRP A;  4DZ3 A;  4FN2 A;  1R9H A;  1JVW A;  1W1P A;  2RUD A;  1NWS A;  3OA5 A;  5GPR A;  1E9L A;  1ZBW A;  1NMV A;  1Q1C A;  4ZPV R;  3ARS A;  4DRM A;  1GOI A;  2ZR4 A;  3WH0 A;  4WIW A;  3WL0 A;  1XHG A;  2ZQU A;  3CHD A;  3UI6 A;  4URI A;  4ODP A;  3O5I A;  3RME A;  1FD9 A;  3CGN A;  1TFV A;  2KO7 A;  3ARU A;  3O5L A;  1UR9 A;  1LL6 A;  4WKF A;  4L72 B;  3ALF A;  1T11 A;  4P8X A;  3JYM A;  3O5D A;  1BKF A;  4ODN A;  1D7I A;  3TC5 A;  4WKH A;  3TDB A;  4WJX A;  4DWS D;  3NRK A;  2KI3 A;  3IKD A;  2KGJ A;  1NH6 A;  1D6O A;  5DIT A;  4QT2 A;  3B9D A;  3JXV A;  3AS1 A;  3WQV A;  4L3N A;  2LGO A;  1F8A B;  1EIB A;  4HAR A;  4TW7 A;  2DT2 A;  4LAY A;  2XP4 A;  1JNE A;  1W1Y A;  4ODL A;  1E6N A;  2WM0 A;  4LAW A;  1YW5 A;  4G2P A;  2ESC A;  2ITK A;  2OFN A;  3RGC A;  1FJD A;  1N1A A;  2N87 A;  3WQW A;  1PIN A;  2DG9 A;  2O92 A;  4DZ2 A;  3ARX A;  3IHZ A;  2KR7 A;  1B6C A;  3O5Q A;  4Q22 A;  2RQS A;  3FAP A;  1BL4 A;  3UQI A;  2XP6 A;  1GPF A;  2DSW A;  1NWU A;  1FKI A;  2MNT A;  1H0G A;  1J4H A;  4DRH A;  4DT4 A;  1E15 A;  1GUV A;  1Q6U A;  2XP3 A;  4J4N A;  2IF4 A;  3OOB A;  1OWQ A;  2VCD A;  1NSG A;  5HBF A;  4DRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...