3JYJA

Structure-based design of novel pin1 inhibitors (ii)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
113
structure length
113
Chain Sequence
EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of novel human Pin1 inhibitors (II).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 40
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3jyjA00
2XP3A 3JYMA 2IF4A 2XP7A 4DIPA 4DRPA 3PRDA 2PV2A 4JFJA 4DZ2A 4DRQA 5I98A 3KAHA 3O5LA 1FD9A 4JFMA 2PPPA 4DROA 4ITZA 1F8AB 5D75A 2L2SA 1FJDA 4DRNA 1JNSA 4DRHA 3O5DA 5B8IC 3KAIA 2PV3A 4JFIA 2MNTA 3O5MA 1FKTA 4ODLA 4ODOA 2KGJA 3TC5A 1QPLA 3H9RB 4J4OA 5BXJA 1J4RA 2F2DA 4QT3A 3VAWA 1N1AA 2VN1A 1FKIA 1B6CA 2LJ4A 4N19A 4TNSA 4BF8A 4FN2A 2ZR4A 1P5QA 3KACA 4MSPA 3MDYB 1ROTA 4IPXA 2DG4A 2MPHA 5GPGA 3UQAA 1A7XA 1TCOC 1ZCNA 2ITKA 2KR7A 1EYMA 3KAGA 4C02B 1D7JA 1Q6UA 4ODMA 1U79A 2KO7A 1Y0OA 3O5GA 4LAYA 4IQ2A 3IHZA 2ZR6A 1BKFA 1BL4A 1FKSA 3CGMA 4GGQA 4FAPA 2LKNA 1EQ3A 1FKRA 3PA7A 3TCZA 3IK8A 2MLYA 3KZ7A 1M5YA 3O5FA 5J6EA 2JZVA 3UQIA 4LAWA 1F40A 1QZ2A 1D6OA 1NMWA 1Q6HA 4DRMA 1J4IA 3GPKA 1YW5A 3O5PA 4W9OA 2RUQA 5HWCA 2KI3A 1ROUA 1T11A 1FKBA 2Q5AA 2RSEA 3I6CA 1KT0A 2DG9A 1FKKA 2PPOA 3LUOA 2UZ5A 3NTPA 3O5QA 4LAXA 4TW6A 2PBCA 4JFKA 4O2TA 5DIVA 1FKLA 4TW7A 4DZ3A 2Y78A 4DH0A 2XP8A 5HWBA 1C9HA 2MLXA 2M08A 3O5RA 2DG3A 2N87A 4J4NA 4U84A 4R0XA 1NSGA 2LPVA 5DITA 2RUDA 1KT1A 4W9QA 3UI4A 1YATA 3O5EA 4DRJA 3WH0A 1JNTA 2ZQVA 5HT1A 4G50A 1FKJA 1D7HA 4DT4A 1FKGA 4U85A 2F21A 4W9PA 3IKGA 2ZR5A 3EY6A 5HW7A 1D7IA 1ZK6A 2PV1A 2XP9A 1J4HA 2AWGA 2PPNA 1L1PA 5HW8A 2XP4A 2F4EA 2KE0A 3OOBA 4MGVA 3UI5A 2XP5A 1Q1CA 3O5KA 2RUCA 3JYJA 4ODNA 2RURA 1FKHA 5HTGA 2MLZA 2K8IA 4LAVA 4TYOA 1J6YA 1JVWA 5HW6A 2ZQTA 3O5JA 3PRBA 4GIVA 3B7XA 4NNRA 3FAPA 3UF8A 5HKGA 4ODRA 3KADA 4U86A 4DRIA 3UQBA 3IKDA 1QPFA 1W26A 2MF9A 3KAFA 4ODQA 4TX0A 2ZQUA 4TW8A 1Q6IA 1FAPA 2FKEA 3RFWA 2D9FA 2OFNA 2RQSA 2XPAA 1FKFA 4JFLA 4JYSA 4ODKA 3O5OA 1R9HA 4QIBA 3TDBA 1PINA 1FKDA 3NI6A 2LGOA 2M1IA 3KCEA 3O5IA 5DIUA 3NRKA 2XPBA 3RGCA 4ODPA 5HUAA 4DRKA 3UI6A 3ODKA 3KABA 2VCDA 3JXVA 1NMVA 2FAPA 3CGNA 2M2AA 1PBKA 2KFWA 2ZQSA 4QT2A 1HXVA 4IQCA 2XP6A 4G2PA
chains in the Genus database with same CATH superfamily
1ITXA 5I98A 4HBOA 1H0GA 3KAHA 5D75A 2L2SA 4DRHA 1W9PA 3AS3A 1FKTA 1QPLA 2YBUA 4R5EA 4QT3A 2F2DA 2ETNA 4N19A 4ZS6A 3ARVA 1P5QA 3KACA 3WD4A 4IPXA 5GPGA 5HBFA 3GTYX 3GU0A 4Q7NA 4ODMA 1U79A 3ARWA 3ALFA 4WKFA 4LAYA 4P8WA 2A3BA 1E6NA 3CGMA 2LKNA 1FKRA 3WQWA 3UQIA 4Z2KA 1Q6HA 3ARYA 1JNEA 4W9OA 4ZPWR 3WL0A 1T11A 1FKBA 1W1VA 1E6ZA 2PPOA 2UZ5A 2PBCA 5DIVA 4DZ3A 4URIA 2XP8A 2DT3A 1W9VA 1C9HA 2MLXA 3AQUA 2WLZA 2LPVA 1KT1A 4W9QA 1YATA 1ZBCA 4DRJA 1FFQA 1JNTA 4NSBA 2DPEA 2F23A 5DO2A 2F21A 3ARXA 3IKGA 5HW7A 4UDMA 2G41A 3QOKA 2O92A 1JNDA 4IT4A 4MNMA 1Q1CA 2RURA 1W1PA 4TYOA 1LJYA 2ZQTA 4GIVA 2YBTA 1EDQA 3FAPA 3UF8A 5HKGA 1OGGA 3WD3A 1E44A 1LL6A 3RFWA 3WD0A 4JYSA 3RM9A 1NWUA 4QIBA 4Z2JA 1EIBA 3FY1A 3FXYA 1GOIA 5DIUA 2XPBA 3RGCA 4ODPA 1NMVA 3CGNA 4IQCA 1OWQA 3JYMA 2PV2A 1LQ0A 1HJWA 1WB0A 1F8AB 3B8SA 4PTMA 4DRNA 2DSWA 5B8IC 3KAIA 3O5MA 3BXWA 1GRJA 3TC5A 1W1YA 1W9UA 3CHEA 2VN1A 4MSPA 5DEZA 3MDYB 4WKAA 2MPHA 2ITKA 1TCOC 1ZCNA 2A3EA 5GQBA 4HBEA 3KAGA 2A3CA 2ESCA 1HJVA 1Q6UA 4WKHA 1Y0OA 2DSZA 3IHZA 1BKFA 3ARUA 4LGXA 4GGQA 5J6EA 4NZCA 3IK8A 2MLYA 3KZ7A 4P8XA 4HARA 1F40A 3ARQA 1J4IA 3G6MA 3O5PA 1GPFA 2KI3A 2RSEA 3B9EA 3G6LA 5JH8A 4P8UA 1KT0A 4TW6A 1FKKA 4MTVA 2FDMA 1XRVA 1FKLA 2Y78A 5HWBA 1SR0A 4U84A 1RD6A 4ZPVR 1E9LA 3UI4A 2PN0A 3B9DA 4G50A 1VF8A 4DWSD 1D7HA 1FKGA 3OA5A 4W9PA 3W4RA 3EY6A 3WD2A 2PV1A 2PPNA 5HW8A 2XP4A 3OOBA 3UI5A 2XP5A 3JYJA 4ODNA 1FKHA 5HTGA 2MLZA 2K8IA 3CH9A 1XHGA 3PR9A 3PRBA 4ML4A 3ARTA 1NH6A 4DRIA 3UQBA 2A3AA 1W26A 4Z2GA 3KAFA 4TX0A 1Q6IA 2FKEA 1ZL1A 3ALGA 4WJXA 1K9TA 2XPAA 4ODKA 4S3KA 3NI6A 2M1IA 4Z2LA 1HJXA 3O5IA 3AROA 1ZBVA 4MNKA 4DZ2A 1NWTA 2FAPA 2M2AA 1HKIA 1PBKA 3CHCA 4G2PA 2WM0A 2XP3A 2IF4A 2XP7A 4DIPA 4DRPA 4MAVA 4DRQA 1W1TA 2DT0A 4L72B 4JFMA 4DROA 4ITZA 1FJDA 1HKKA 3ARRA 3O5DA 1ZBWA 1X6LA 4JFIA 1ZB5A 2DT1A 1ZU8A 4ODOA 2KGJA 3AS0A 3CZ8A 1J4RA 2AOSA 1FKIA 1B6CA 2LJ4A 4BF8A 4FN2A 2ZR4A 1ROTA 3UQAA 2KR7A 3RM4A 2WLYA 1EYMA 4C02B 2KO7A 4KQZA 3AS2A 2ZR6A 1FKSA 1GUVA 2B5UB 3TCZA 3O5FA 2DT2A 4LAWA 4W5UA 3WD1A 1D6OA 4XAKA 3GPKA 1YW5A 2Q5AA 2PI6A 3I6CA 4LAXA 3NTPA 4O2TA 4TW7A 4DH0A 3WL1A 2M08A 1WNOA 4R0XA 1LL7A 3O5EA 1E15A 1FKJA 4DT4A 1H0IA 4U85A 2ZR5A 1D7IA 1J4HA 2AWGA 2KE0A 3O5KA 2RUCA 1UR9A 4LAVA 1J6YA 1NWSA 5HW6A 3B7XA 4MNLA 4ODRA 3KADA 4U86A 2G8ZA 2QF8A 3ARPA 3IKDA 2ZQUA 3WKZA 1X6NA 2D9FA 2OFNA 2RQSA 1R9HA 4QZVB 2EULA 1PINA 1CTNA 4WIWA 2O9OA 3PRAA 5HUAA 4DRKA 3ODKA 2VCDA 3JXVA 4QT2A 1EHNA 2KFWA 2ZQSA 3O5LA 3ARSA 4ZPTR 4DWSC 3PRDA 4JFJA 1E6RA 1FD9A 1JCHB 2PPPA 1JNSA 1FFRA 4Q22A 1OGBA 2PV3A 1IX5A 2MNTA 4IT6A 1LG1A 4KR0B 4ODLA 2DSVA 3CHDA 3WQVA 4L3NA 4AY1A 3H9RB 3B9AA 2B31A 1TFVA 4J4OA 5BXJA 4Z2IA 3VAWA 1N1AA 4TNSA 2DG4A 1A7XA 1D7JA 1LL4A 3O5GA 4WK9A 4IQ2A 1BL4A 3CHFA 4FAPA 1EQ3A 3PA7A 1M5YA 2JZVA 4P8VA 1QZ2A 1NMWA 2IUZA 4DRMA 4DWSB 2P4VA 2RUQA 5HWCA 1ROUA 3RM8A 1WAWA 2DG9A 3LUOA 3O5QA 4JFKA 1D2KA 3O5RA 1UR8A 1E6PA 2DG3A 2N87A 4J4NA 1NSGA 5DITA 2RUDA 1HKMA 3RMEA 1SYTA 3WH0A 2ZQVA 5HT1A 4MPKA 1ZK6A 2XP9A 1L1PA 2WK2A 4MGVA 2F4EA 3EIPA 1LG2A 1ZBKA 1HKJA 2DSUA 1JVWA 3O5JA 4NNRA 3AS1A 1QPFA 4MNJA 2MF9A 3ARZA 4ODQA 1O6IA 4TW8A 1FAPA 1FKFA 4JFLA 4S3JA 4Z2HA 3O5OA 5DF0A 3TDBA 1FKDA 2LGOA 3KCEA 3NRKA 1KFWA 3UI6A 3WIJA 4DWSA 5GPRA 3KABA 1HXVA 2OLHA 3BMBA 2XP6A 1NWRA
chains in the Genus database with same CATH topology
1ITXA 5I98A 4HBOA 1H0GA 3KAHA 5D75A 2L2SA 4DRHA 1W9PA 3AS3A 1FKTA 1QPLA 2YBUA 4R5EA 4QT3A 2F2DA 4N19A 4ZS6A 3ARVA 1P5QA 3KACA 3WD4A 4IPXA 5GPGA 5HBFA 4Q7NA 4ODMA 1U79A 3ARWA 3ALFA 4WKFA 4LAYA 4P8WA 2A3BA 1E6NA 3CGMA 2LKNA 1FKRA 3WQWA 3UQIA 4Z2KA 1Q6HA 3ARYA 1JNEA 4W9OA 4ZPWR 3WL0A 1T11A 1FKBA 1W1VA 1E6ZA 2PPOA 2UZ5A 2PBCA 5DIVA 4DZ3A 4URIA 2XP8A 2DT3A 1W9VA 1C9HA 2MLXA 3AQUA 2WLZA 2LPVA 1KT1A 4W9QA 1YATA 1ZBCA 4DRJA 1FFQA 1JNTA 4NSBA 2DPEA 5DO2A 2F21A 3ARXA 3IKGA 5HW7A 2G41A 3QOKA 2O92A 1JNDA 4IT4A 4MNMA 1Q1CA 2RURA 1W1PA 4TYOA 1LJYA 2ZQTA 4GIVA 2YBTA 1EDQA 3FAPA 3UF8A 5HKGA 1OGGA 3WD3A 1LL6A 3RFWA 3WD0A 4JYSA 3RM9A 1NWUA 4QIBA 4Z2JA 1EIBA 3FY1A 3FXYA 1GOIA 5DIUA 2XPBA 3RGCA 4ODPA 1NMVA 3CGNA 4IQCA 1OWQA 3JYMA 2PV2A 1LQ0A 1HJWA 1WB0A 1F8AB 3B8SA 4PTMA 4DRNA 2DSWA 5B8IC 3KAIA 3O5MA 3BXWA 3TC5A 1W1YA 1W9UA 3CHEA 2VN1A 4MSPA 5DEZA 3MDYB 4WKAA 2MPHA 2ITKA 1TCOC 1ZCNA 2A3EA 5GQBA 4HBEA 3KAGA 2A3CA 2ESCA 1HJVA 1Q6UA 4WKHA 1Y0OA 2DSZA 3IHZA 1BKFA 3ARUA 4LGXA 4GGQA 5J6EA 4NZCA 3IK8A 2MLYA 3KZ7A 4P8XA 4HARA 1F40A 3ARQA 1J4IA 3G6MA 3O5PA 1GPFA 2KI3A 2RSEA 3B9EA 3G6LA 5JH8A 4P8UA 1KT0A 4TW6A 1FKKA 4MTVA 2FDMA 1XRVA 1FKLA 2Y78A 5HWBA 1SR0A 4U84A 1RD6A 4ZPVR 1E9LA 3UI4A 3B9DA 4G50A 1VF8A 4DWSD 1D7HA 1FKGA 3OA5A 4W9PA 3W4RA 3EY6A 3WD2A 2PV1A 2PPNA 5HW8A 2XP4A 3OOBA 3UI5A 2XP5A 3JYJA 4ODNA 1FKHA 5HTGA 2MLZA 2K8IA 3CH9A 1XHGA 3PR9A 3PRBA 4ML4A 3ARTA 1NH6A 4DRIA 3UQBA 2A3AA 1W26A 4Z2GA 3KAFA 4TX0A 1Q6IA 2FKEA 1ZL1A 3ALGA 4WJXA 1K9TA 2XPAA 4ODKA 4S3KA 3NI6A 2M1IA 4Z2LA 1HJXA 3O5IA 3AROA 1ZBVA 4MNKA 4DZ2A 1NWTA 2FAPA 2M2AA 1HKIA 1PBKA 3CHCA 4G2PA 2WM0A 2XP3A 2IF4A 2XP7A 4DIPA 4DRPA 4MAVA 4DRQA 1W1TA 2DT0A 4L72B 4JFMA 4DROA 4ITZA 1FJDA 1HKKA 3ARRA 3O5DA 1ZBWA 1X6LA 4JFIA 1ZB5A 2DT1A 1ZU8A 4ODOA 2KGJA 3AS0A 3CZ8A 1J4RA 2AOSA 1FKIA 1B6CA 2LJ4A 4BF8A 4FN2A 2ZR4A 1ROTA 3UQAA 2KR7A 3RM4A 2WLYA 1EYMA 4C02B 2KO7A 4KQZA 3AS2A 2ZR6A 1FKSA 1GUVA 3TCZA 3O5FA 2DT2A 4LAWA 4W5UA 3WD1A 1D6OA 4XAKA 3GPKA 1YW5A 2Q5AA 2PI6A 3I6CA 4LAXA 3NTPA 4O2TA 4TW7A 4DH0A 3WL1A 2M08A 1WNOA 4R0XA 1LL7A 3O5EA 1E15A 1FKJA 4DT4A 1H0IA 4U85A 2ZR5A 1D7IA 1J4HA 2AWGA 2KE0A 3O5KA 2RUCA 1UR9A 4LAVA 1J6YA 1NWSA 5HW6A 3B7XA 4MNLA 4ODRA 3KADA 4U86A 2G8ZA 2QF8A 3ARPA 3IKDA 2ZQUA 3WKZA 1X6NA 2D9FA 2OFNA 2RQSA 1R9HA 4QZVB 1PINA 1CTNA 4WIWA 2O9OA 3PRAA 5HUAA 4DRKA 3ODKA 2VCDA 3JXVA 4QT2A 1EHNA 2KFWA 2ZQSA 3O5LA 3ARSA 4ZPTR 4DWSC 3PRDA 4JFJA 1E6RA 1FD9A 2PPPA 1JNSA 1FFRA 4Q22A 1OGBA 2PV3A 1IX5A 2MNTA 4IT6A 1LG1A 4KR0B 4ODLA 2DSVA 3CHDA 3WQVA 4L3NA 4AY1A 3H9RB 3B9AA 2B31A 1TFVA 4J4OA 5BXJA 4Z2IA 3VAWA 1N1AA 4TNSA 2DG4A 1A7XA 1D7JA 1LL4A 3O5GA 4WK9A 4IQ2A 1BL4A 3CHFA 4FAPA 1EQ3A 3PA7A 1M5YA 2JZVA 4P8VA 1QZ2A 1NMWA 2IUZA 4DRMA 4DWSB 2RUQA 5HWCA 1ROUA 3RM8A 1WAWA 2DG9A 3LUOA 3O5QA 4JFKA 1D2KA 3O5RA 1UR8A 1E6PA 2DG3A 2N87A 4J4NA 1NSGA 5DITA 2RUDA 1HKMA 3RMEA 1SYTA 3WH0A 2ZQVA 5HT1A 4MPKA 1ZK6A 2XP9A 1L1PA 2WK2A 4MGVA 2F4EA 1LG2A 1ZBKA 1HKJA 2DSUA 1JVWA 3O5JA 4NNRA 3AS1A 1QPFA 4MNJA 2MF9A 3ARZA 4ODQA 1O6IA 4TW8A 1FAPA 1FKFA 4JFLA 4S3JA 4Z2HA 3O5OA 5DF0A 3TDBA 1FKDA 2LGOA 3KCEA 3NRKA 1KFWA 3UI6A 3WIJA 4DWSA 5GPRA 3KABA 1HXVA 2OLHA 2XP6A 1NWRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XP3 A;  3JYM A;  2IF4 A;  2XP7 A;  4DIP A;  4DRP A;  3PRD A;  2PV2 A;  4JFJ A;  4DZ2 A;  4DRQ A;  5I98 A;  3KAH A;  3O5L A;  1FD9 A;  4JFM A;  2PPP A;  4DRO A;  4ITZ A;  1F8A B;  5D75 A;  2L2S A;  1FJD A;  4DRN A;  1JNS A;  4DRH A;  3O5D A;  5B8I C;  3KAI A;  2PV3 A;  4JFI A;  2MNT A;  3O5M A;  1FKT A;  4ODL A;  4ODO A;  2KGJ A;  3TC5 A;  1QPL A;  3H9R B;  4J4O A;  5BXJ A;  1J4R A;  2F2D A;  4QT3 A;  3VAW A;  1N1A A;  2VN1 A;  1FKI A;  1B6C A;  2LJ4 A;  4N19 A;  4TNS A;  4BF8 A;  4FN2 A;  2ZR4 A;  1P5Q A;  3KAC A;  4MSP A;  3MDY B;  1ROT A;  4IPX A;  2DG4 A;  2MPH A;  5GPG A;  3UQA A;  1A7X A;  1TCO C;  1ZCN A;  2ITK A;  2KR7 A;  1EYM A;  3KAG A;  4C02 B;  1D7J A;  1Q6U A;  4ODM A;  1U79 A;  2KO7 A;  1Y0O A;  3O5G A;  4LAY A;  4IQ2 A;  3IHZ A;  2ZR6 A;  1BKF A;  1BL4 A;  1FKS A;  3CGM A;  4GGQ A;  4FAP A;  2LKN A;  1EQ3 A;  1FKR A;  3PA7 A;  3TCZ A;  3IK8 A;  2MLY A;  3KZ7 A;  1M5Y A;  3O5F A;  5J6E A;  2JZV A;  3UQI A;  4LAW A;  1F40 A;  1QZ2 A;  1D6O A;  1NMW A;  1Q6H A;  4DRM A;  1J4I A;  3GPK A;  1YW5 A;  3O5P A;  4W9O A;  2RUQ A;  5HWC A;  2KI3 A;  1ROU A;  1T11 A;  1FKB A;  2Q5A A;  2RSE A;  3I6C A;  1KT0 A;  2DG9 A;  1FKK A;  2PPO A;  3LUO A;  2UZ5 A;  3NTP A;  3O5Q A;  4LAX A;  4TW6 A;  2PBC A;  4JFK A;  4O2T A;  5DIV A;  1FKL A;  4TW7 A;  4DZ3 A;  2Y78 A;  4DH0 A;  2XP8 A;  5HWB A;  1C9H A;  2MLX A;  2M08 A;  3O5R A;  2DG3 A;  2N87 A;  4J4N A;  4U84 A;  4R0X A;  1NSG A;  2LPV A;  5DIT A;  2RUD A;  1KT1 A;  4W9Q A;  3UI4 A;  1YAT A;  3O5E A;  4DRJ A;  3WH0 A;  1JNT A;  2ZQV A;  5HT1 A;  4G50 A;  1FKJ A;  1D7H A;  4DT4 A;  1FKG A;  4U85 A;  2F21 A;  4W9P A;  3IKG A;  2ZR5 A;  3EY6 A;  5HW7 A;  1D7I A;  1ZK6 A;  2PV1 A;  2XP9 A;  1J4H A;  2AWG A;  2PPN A;  1L1P A;  5HW8 A;  2XP4 A;  2F4E A;  2KE0 A;  3OOB A;  4MGV A;  3UI5 A;  2XP5 A;  1Q1C A;  3O5K A;  2RUC A;  3JYJ A;  4ODN A;  2RUR A;  1FKH A;  5HTG A;  2MLZ A;  2K8I A;  4LAV A;  4TYO A;  1J6Y A;  1JVW A;  5HW6 A;  2ZQT A;  3O5J A;  3PRB A;  4GIV A;  3B7X A;  4NNR A;  3FAP A;  3UF8 A;  5HKG A;  4ODR A;  3KAD A;  4U86 A;  4DRI A;  3UQB A;  3IKD A;  1QPF A;  1W26 A;  2MF9 A;  3KAF A;  4ODQ A;  4TX0 A;  2ZQU A;  4TW8 A;  1Q6I A;  1FAP A;  2FKE A;  3RFW A;  2D9F A;  2OFN A;  2RQS A;  2XPA A;  1FKF A;  4JFL A;  4JYS A;  4ODK A;  3O5O A;  1R9H A;  4QIB A;  3TDB A;  1PIN A;  1FKD A;  3NI6 A;  2LGO A;  2M1I A;  3KCE A;  3O5I A;  5DIU A;  3NRK A;  2XPB A;  3RGC A;  4ODP A;  5HUA A;  4DRK A;  3UI6 A;  3ODK A;  3KAB A;  2VCD A;  3JXV A;  1NMV A;  2FAP A;  3CGN A;  2M2A A;  1PBK A;  2KFW A;  2ZQS A;  4QT2 A;  1HXV A;  4IQC A;  2XP6 A;  4G2P A; 
#chains in the Genus database with same CATH topology
 1ITX A;  5I98 A;  4HBO A;  1H0G A;  3KAH A;  5D75 A;  2L2S A;  4DRH A;  1W9P A;  3AS3 A;  1FKT A;  1QPL A;  2YBU A;  4R5E A;  4QT3 A;  2F2D A;  2ETN A;  4N19 A;  4ZS6 A;  3ARV A;  1P5Q A;  3KAC A;  3WD4 A;  4IPX A;  5GPG A;  5HBF A;  3GTY X;  3GU0 A;  4Q7N A;  4ODM A;  1U79 A;  3ARW A;  3ALF A;  4WKF A;  4LAY A;  4P8W A;  2A3B A;  1E6N A;  3CGM A;  2LKN A;  1FKR A;  3WQW A;  3UQI A;  4Z2K A;  1Q6H A;  3ARY A;  1JNE A;  4W9O A;  4ZPW R;  3WL0 A;  1T11 A;  1FKB A;  1W1V A;  1E6Z A;  2PPO A;  2UZ5 A;  2PBC A;  5DIV A;  4DZ3 A;  4URI A;  2XP8 A;  2DT3 A;  1W9V A;  1C9H A;  2MLX A;  3AQU A;  2WLZ A;  2LPV A;  1KT1 A;  4W9Q A;  1YAT A;  1ZBC A;  4DRJ A;  1FFQ A;  1JNT A;  4NSB A;  2DPE A;  2F23 A;  5DO2 A;  2F21 A;  3ARX A;  3IKG A;  5HW7 A;  4UDM A;  2G41 A;  3QOK A;  2O92 A;  1JND A;  4IT4 A;  4MNM A;  1Q1C A;  2RUR A;  1W1P A;  4TYO A;  1LJY A;  2ZQT A;  4GIV A;  2YBT A;  1EDQ A;  3FAP A;  3UF8 A;  5HKG A;  1OGG A;  3WD3 A;  1E44 A;  1LL6 A;  3RFW A;  3WD0 A;  4JYS A;  3RM9 A;  1NWU A;  4QIB A;  4Z2J A;  1EIB A;  3FY1 A;  3FXY A;  1GOI A;  5DIU A;  2XPB A;  3RGC A;  4ODP A;  1NMV A;  3CGN A;  4IQC A;  1OWQ A;  3JYM A;  2PV2 A;  1LQ0 A;  1HJW A;  1WB0 A;  1F8A B;  3B8S A;  4PTM A;  4DRN A;  2DSW A;  5B8I C;  3KAI A;  3O5M A;  3BXW A;  1GRJ A;  3TC5 A;  1W1Y A;  1W9U A;  3CHE A;  2VN1 A;  4MSP A;  5DEZ A;  3MDY B;  4WKA A;  2MPH A;  2ITK A;  1TCO C;  1ZCN A;  2A3E A;  5GQB A;  4HBE A;  3KAG A;  2A3C A;  2ESC A;  1HJV A;  1Q6U A;  4WKH A;  1Y0O A;  2DSZ A;  3IHZ A;  1BKF A;  3ARU A;  4LGX A;  4GGQ A;  5J6E A;  4NZC A;  3IK8 A;  2MLY A;  3KZ7 A;  4P8X A;  4HAR A;  1F40 A;  3ARQ A;  1J4I A;  3G6M A;  3O5P A;  1GPF A;  2KI3 A;  2RSE A;  3B9E A;  3G6L A;  5JH8 A;  4P8U A;  1KT0 A;  4TW6 A;  1FKK A;  4MTV A;  2FDM A;  1XRV A;  1FKL A;  2Y78 A;  5HWB A;  1SR0 A;  4U84 A;  1RD6 A;  4ZPV R;  1E9L A;  3UI4 A;  2PN0 A;  3B9D A;  4G50 A;  1VF8 A;  4DWS D;  1D7H A;  1FKG A;  3OA5 A;  4W9P A;  3W4R A;  3EY6 A;  3WD2 A;  2PV1 A;  2PPN A;  5HW8 A;  2XP4 A;  3OOB A;  3UI5 A;  2XP5 A;  3JYJ A;  4ODN A;  1FKH A;  5HTG A;  2MLZ A;  2K8I A;  3CH9 A;  1XHG A;  3PR9 A;  3PRB A;  4ML4 A;  3ART A;  1NH6 A;  4DRI A;  3UQB A;  2A3A A;  1W26 A;  4Z2G A;  3KAF A;  4TX0 A;  1Q6I A;  2FKE A;  1ZL1 A;  3ALG A;  4WJX A;  1K9T A;  2XPA A;  4ODK A;  4S3K A;  3NI6 A;  2M1I A;  4Z2L A;  1HJX A;  3O5I A;  3ARO A;  1ZBV A;  4MNK A;  4DZ2 A;  1NWT A;  2FAP A;  2M2A A;  1HKI A;  1PBK A;  3CHC A;  4G2P A;  2WM0 A;  2XP3 A;  2IF4 A;  2XP7 A;  4DIP A;  4DRP A;  4MAV A;  4DRQ A;  1W1T A;  2DT0 A;  4L72 B;  4JFM A;  4DRO A;  4ITZ A;  1FJD A;  1HKK A;  3ARR A;  3O5D A;  1ZBW A;  1X6L A;  4JFI A;  1ZB5 A;  2DT1 A;  1ZU8 A;  4ODO A;  2KGJ A;  3AS0 A;  3CZ8 A;  1J4R A;  2AOS A;  1FKI A;  1B6C A;  2LJ4 A;  4BF8 A;  4FN2 A;  2ZR4 A;  1ROT A;  3UQA A;  2KR7 A;  3RM4 A;  2WLY A;  1EYM A;  4C02 B;  2KO7 A;  4KQZ A;  3AS2 A;  2ZR6 A;  1FKS A;  1GUV A;  2B5U B;  3TCZ A;  3O5F A;  2DT2 A;  4LAW A;  4W5U A;  3WD1 A;  1D6O A;  4XAK A;  3GPK A;  1YW5 A;  2Q5A A;  2PI6 A;  3I6C A;  4LAX A;  3NTP A;  4O2T A;  4TW7 A;  4DH0 A;  3WL1 A;  2M08 A;  1WNO A;  4R0X A;  1LL7 A;  3O5E A;  1E15 A;  1FKJ A;  4DT4 A;  1H0I A;  4U85 A;  2ZR5 A;  1D7I A;  1J4H A;  2AWG A;  2KE0 A;  3O5K A;  2RUC A;  1UR9 A;  4LAV A;  1J6Y A;  1NWS A;  5HW6 A;  3B7X A;  4MNL A;  4ODR A;  3KAD A;  4U86 A;  2G8Z A;  2QF8 A;  3ARP A;  3IKD A;  2ZQU A;  3WKZ A;  1X6N A;  2D9F A;  2OFN A;  2RQS A;  1R9H A;  4QZV B;  2EUL A;  1PIN A;  1CTN A;  4WIW A;  2O9O A;  3PRA A;  5HUA A;  4DRK A;  3ODK A;  2VCD A;  3JXV A;  4QT2 A;  1EHN A;  2KFW A;  2ZQS A;  3O5L A;  3ARS A;  4ZPT R;  4DWS C;  3PRD A;  4JFJ A;  1E6R A;  1FD9 A;  1JCH B;  2PPP A;  1JNS A;  1FFR A;  4Q22 A;  1OGB A;  2PV3 A;  1IX5 A;  2MNT A;  4IT6 A;  1LG1 A;  4KR0 B;  4ODL A;  2DSV A;  3CHD A;  3WQV A;  4L3N A;  4AY1 A;  3H9R B;  3B9A A;  2B31 A;  1TFV A;  4J4O A;  5BXJ A;  4Z2I A;  3VAW A;  1N1A A;  4TNS A;  2DG4 A;  1A7X A;  1D7J A;  1LL4 A;  3O5G A;  4WK9 A;  4IQ2 A;  1BL4 A;  3CHF A;  4FAP A;  1EQ3 A;  3PA7 A;  1M5Y A;  2JZV A;  4P8V A;  1QZ2 A;  1NMW A;  2IUZ A;  4DRM A;  4DWS B;  2P4V A;  2RUQ A;  5HWC A;  1ROU A;  3RM8 A;  1WAW A;  2DG9 A;  3LUO A;  3O5Q A;  4JFK A;  1D2K A;  3O5R A;  1UR8 A;  1E6P A;  2DG3 A;  2N87 A;  4J4N A;  1NSG A;  5DIT A;  2RUD A;  1HKM A;  3RME A;  1SYT A;  3WH0 A;  2ZQV A;  5HT1 A;  4MPK A;  1ZK6 A;  2XP9 A;  1L1P A;  2WK2 A;  4MGV A;  2F4E A;  3EIP A;  1LG2 A;  1ZBK A;  1HKJ A;  2DSU A;  1JVW A;  3O5J A;  4NNR A;  3AS1 A;  1QPF A;  4MNJ A;  2MF9 A;  3ARZ A;  4ODQ A;  1O6I A;  4TW8 A;  1FAP A;  1FKF A;  4JFL A;  4S3J A;  4Z2H A;  3O5O A;  5DF0 A;  3TDB A;  1FKD A;  2LGO A;  3KCE A;  3NRK A;  1KFW A;  3UI6 A;  3WIJ A;  4DWS A;  5GPR A;  3KAB A;  1HXV A;  2OLH A;  3BMB A;  2XP6 A;  1NWR A; 
#chains in the Genus database with same CATH homology
 1ITX A;  5I98 A;  4HBO A;  1H0G A;  3KAH A;  5D75 A;  2L2S A;  4DRH A;  1W9P A;  3AS3 A;  1FKT A;  1QPL A;  2YBU A;  4R5E A;  4QT3 A;  2F2D A;  4N19 A;  4ZS6 A;  3ARV A;  1P5Q A;  3KAC A;  3WD4 A;  4IPX A;  5GPG A;  5HBF A;  4Q7N A;  4ODM A;  1U79 A;  3ARW A;  3ALF A;  4WKF A;  4LAY A;  4P8W A;  2A3B A;  1E6N A;  3CGM A;  2LKN A;  1FKR A;  3WQW A;  3UQI A;  4Z2K A;  1Q6H A;  3ARY A;  1JNE A;  4W9O A;  4ZPW R;  3WL0 A;  1T11 A;  1FKB A;  1W1V A;  1E6Z A;  2PPO A;  2UZ5 A;  2PBC A;  5DIV A;  4DZ3 A;  4URI A;  2XP8 A;  2DT3 A;  1W9V A;  1C9H A;  2MLX A;  3AQU A;  2WLZ A;  2LPV A;  1KT1 A;  4W9Q A;  1YAT A;  1ZBC A;  4DRJ A;  1FFQ A;  1JNT A;  4NSB A;  2DPE A;  5DO2 A;  2F21 A;  3ARX A;  3IKG A;  5HW7 A;  2G41 A;  3QOK A;  2O92 A;  1JND A;  4IT4 A;  4MNM A;  1Q1C A;  2RUR A;  1W1P A;  4TYO A;  1LJY A;  2ZQT A;  4GIV A;  2YBT A;  1EDQ A;  3FAP A;  3UF8 A;  5HKG A;  1OGG A;  3WD3 A;  1LL6 A;  3RFW A;  3WD0 A;  4JYS A;  3RM9 A;  1NWU A;  4QIB A;  4Z2J A;  1EIB A;  3FY1 A;  3FXY A;  1GOI A;  5DIU A;  2XPB A;  3RGC A;  4ODP A;  1NMV A;  3CGN A;  4IQC A;  1OWQ A;  3JYM A;  2PV2 A;  1LQ0 A;  1HJW A;  1WB0 A;  1F8A B;  3B8S A;  4PTM A;  4DRN A;  2DSW A;  5B8I C;  3KAI A;  3O5M A;  3BXW A;  3TC5 A;  1W1Y A;  1W9U A;  3CHE A;  2VN1 A;  4MSP A;  5DEZ A;  3MDY B;  4WKA A;  2MPH A;  2ITK A;  1TCO C;  1ZCN A;  2A3E A;  5GQB A;  4HBE A;  3KAG A;  2A3C A;  2ESC A;  1HJV A;  1Q6U A;  4WKH A;  1Y0O A;  2DSZ A;  3IHZ A;  1BKF A;  3ARU A;  4LGX A;  4GGQ A;  5J6E A;  4NZC A;  3IK8 A;  2MLY A;  3KZ7 A;  4P8X A;  4HAR A;  1F40 A;  3ARQ A;  1J4I A;  3G6M A;  3O5P A;  1GPF A;  2KI3 A;  2RSE A;  3B9E A;  3G6L A;  5JH8 A;  4P8U A;  1KT0 A;  4TW6 A;  1FKK A;  4MTV A;  2FDM A;  1XRV A;  1FKL A;  2Y78 A;  5HWB A;  1SR0 A;  4U84 A;  1RD6 A;  4ZPV R;  1E9L A;  3UI4 A;  3B9D A;  4G50 A;  1VF8 A;  4DWS D;  1D7H A;  1FKG A;  3OA5 A;  4W9P A;  3W4R A;  3EY6 A;  3WD2 A;  2PV1 A;  2PPN A;  5HW8 A;  2XP4 A;  3OOB A;  3UI5 A;  2XP5 A;  3JYJ A;  4ODN A;  1FKH A;  5HTG A;  2MLZ A;  2K8I A;  3CH9 A;  1XHG A;  3PR9 A;  3PRB A;  4ML4 A;  3ART A;  1NH6 A;  4DRI A;  3UQB A;  2A3A A;  1W26 A;  4Z2G A;  3KAF A;  4TX0 A;  1Q6I A;  2FKE A;  1ZL1 A;  3ALG A;  4WJX A;  1K9T A;  2XPA A;  4ODK A;  4S3K A;  3NI6 A;  2M1I A;  4Z2L A;  1HJX A;  3O5I A;  3ARO A;  1ZBV A;  4MNK A;  4DZ2 A;  1NWT A;  2FAP A;  2M2A A;  1HKI A;  1PBK A;  3CHC A;  4G2P A;  2WM0 A;  2XP3 A;  2IF4 A;  2XP7 A;  4DIP A;  4DRP A;  4MAV A;  4DRQ A;  1W1T A;  2DT0 A;  4L72 B;  4JFM A;  4DRO A;  4ITZ A;  1FJD A;  1HKK A;  3ARR A;  3O5D A;  1ZBW A;  1X6L A;  4JFI A;  1ZB5 A;  2DT1 A;  1ZU8 A;  4ODO A;  2KGJ A;  3AS0 A;  3CZ8 A;  1J4R A;  2AOS A;  1FKI A;  1B6C A;  2LJ4 A;  4BF8 A;  4FN2 A;  2ZR4 A;  1ROT A;  3UQA A;  2KR7 A;  3RM4 A;  2WLY A;  1EYM A;  4C02 B;  2KO7 A;  4KQZ A;  3AS2 A;  2ZR6 A;  1FKS A;  1GUV A;  3TCZ A;  3O5F A;  2DT2 A;  4LAW A;  4W5U A;  3WD1 A;  1D6O A;  4XAK A;  3GPK A;  1YW5 A;  2Q5A A;  2PI6 A;  3I6C A;  4LAX A;  3NTP A;  4O2T A;  4TW7 A;  4DH0 A;  3WL1 A;  2M08 A;  1WNO A;  4R0X A;  1LL7 A;  3O5E A;  1E15 A;  1FKJ A;  4DT4 A;  1H0I A;  4U85 A;  2ZR5 A;  1D7I A;  1J4H A;  2AWG A;  2KE0 A;  3O5K A;  2RUC A;  1UR9 A;  4LAV A;  1J6Y A;  1NWS A;  5HW6 A;  3B7X A;  4MNL A;  4ODR A;  3KAD A;  4U86 A;  2G8Z A;  2QF8 A;  3ARP A;  3IKD A;  2ZQU A;  3WKZ A;  1X6N A;  2D9F A;  2OFN A;  2RQS A;  1R9H A;  4QZV B;  1PIN A;  1CTN A;  4WIW A;  2O9O A;  3PRA A;  5HUA A;  4DRK A;  3ODK A;  2VCD A;  3JXV A;  4QT2 A;  1EHN A;  2KFW A;  2ZQS A;  3O5L A;  3ARS A;  4ZPT R;  4DWS C;  3PRD A;  4JFJ A;  1E6R A;  1FD9 A;  2PPP A;  1JNS A;  1FFR A;  4Q22 A;  1OGB A;  2PV3 A;  1IX5 A;  2MNT A;  4IT6 A;  1LG1 A;  4KR0 B;  4ODL A;  2DSV A;  3CHD A;  3WQV A;  4L3N A;  4AY1 A;  3H9R B;  3B9A A;  2B31 A;  1TFV A;  4J4O A;  5BXJ A;  4Z2I A;  3VAW A;  1N1A A;  4TNS A;  2DG4 A;  1A7X A;  1D7J A;  1LL4 A;  3O5G A;  4WK9 A;  4IQ2 A;  1BL4 A;  3CHF A;  4FAP A;  1EQ3 A;  3PA7 A;  1M5Y A;  2JZV A;  4P8V A;  1QZ2 A;  1NMW A;  2IUZ A;  4DRM A;  4DWS B;  2RUQ A;  5HWC A;  1ROU A;  3RM8 A;  1WAW A;  2DG9 A;  3LUO A;  3O5Q A;  4JFK A;  1D2K A;  3O5R A;  1UR8 A;  1E6P A;  2DG3 A;  2N87 A;  4J4N A;  1NSG A;  5DIT A;  2RUD A;  1HKM A;  3RME A;  1SYT A;  3WH0 A;  2ZQV A;  5HT1 A;  4MPK A;  1ZK6 A;  2XP9 A;  1L1P A;  2WK2 A;  4MGV A;  2F4E A;  1LG2 A;  1ZBK A;  1HKJ A;  2DSU A;  1JVW A;  3O5J A;  4NNR A;  3AS1 A;  1QPF A;  4MNJ A;  2MF9 A;  3ARZ A;  4ODQ A;  1O6I A;  4TW8 A;  1FAP A;  1FKF A;  4JFL A;  4S3J A;  4Z2H A;  3O5O A;  5DF0 A;  3TDB A;  1FKD A;  2LGO A;  3KCE A;  3NRK A;  1KFW A;  3UI6 A;  3WIJ A;  4DWS A;  5GPR A;  3KAB A;  1HXV A;  2OLH A;  2XP6 A;  1NWR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...