3JYJA

Structure-based design of novel pin1 inhibitors (ii)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
113
structure length
113
Chain Sequence
EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-based design of novel human Pin1 inhibitors (II).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 40
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3jyjA00
4O2TA 4LAXA 1P5QA 3O5EA 1ZK6A 4LAVA 2XP6A 4DRHA 3UI6A 4TW8A 4C02B 2PV2A 4W9OA 5HUAA 1Q1CA 4W9QA 2PV1A 5HWCA 1W26A 2PPOA 2Y78A 4DROA 2KFWA 3UI4A 3PRBA 4GIVA 2MPHA 2KE0A 4DH0A 2L2SA 4TW6A 5B8IC 3UQIA 1U79A 2D9FA 3NRKA 2RURA 1FKHA 4ODNA 2VN1A 1BL4A 1JVWA 1YW5A 3IKGA 3O5IA 2LGOA 3VAWA 4ODOA 4NNRA 2XP4A 3O5KA 2ZQVA 1J4HA 4QT2A 4N19A 4ODPA 1Y0OA 5DIVA 2M08A 3JYJA 1JNTA 1J4RA 1FKGA 1QPLA 4J4OA 3OOBA 3UI5A 3CGNA 1J6YA 1F40A 3KCEA 4GGQA 2XP7A 1A7XA 2MLYA 4TNSA 1PBKA 1F8AB 1FJDA 1FKBA 4DRJA 1NMWA 1D7JA 1Q6HA 3O5GA 3ODKA 4JFJA 4JYSA 2UZ5A 2RSEA 3O5OA 2Q5AA 1FKLA 1D7IA 3FAPA 3LUOA 3GPKA 4FN2A 2LPVA 2XP3A 3KAGA 3CGMA 1FD9A 3IKDA 3KAHA 4ITZA 3O5QA 4ODRA 4DT4A 4ODLA 5D75A 1HXVA 2ITKA 4J4NA 2F4EA 4ODKA 4FAPA 4MGVA 1NSGA 1QZ2A 4DRKA 4DZ3A 3O5PA 5BXJA 2M2AA 3O5FA 5HT1A 2RUQA 3KAFA 1M5YA 2XP5A 4JFKA 4QT3A 5DITA 4TX0A 2LJ4A 4DRNA 1FKRA 2AWGA 2IF4A 4BF8A 3RGCA 5HKGA 3UQAA 3H9RB 4ODMA 1FKSA 1NMVA 2RUCA 1C9HA 3JXVA 1Q6IA 1EYMA 1FKIA 3MDYB 1FKKA 2ZR4A 1L1PA 2RQSA 4LAWA 1BKFA 1J4IA 1ROUA 3RFWA 3TC5A 4DZ2A 3O5LA 4QIBA 3KACA 3EY6A 4IQCA 3UF8A 4DRMA 1JNSA 2FAPA 2MLXA 4DRIA 1D7HA 5J6EA 1FKJA 1D6OA 1ZCNA 3O5MA 3PRDA 4R0XA 2KO7A 2OFNA 3IK8A 2DG9A 2PV3A 4IQ2A 2XPBA 4TW7A 2KR7A 2N87A 3NI6A 5DIUA 2MF9A 5GPGA 4G2PA 1KT0A 1PINA 1FKFA 3I6CA 4LAYA 2ZQSA 1T11A 2M1IA 4JFMA 4TYOA 3TCZA 5HW7A 2ZQTA 2KI3A 2XPAA 2XP8A 2ZR6A 3IHZA 2F2DA 2DG4A 2DG3A 2PPNA 2JZVA 1FAPA 3KAIA 1KT1A 2KGJA 3PA7A 4DIPA 2MLZA 4JFIA 2MNTA 3KZ7A 3WH0A 2ZQUA 3JYMA 1YATA 4G50A 1B6CA 1N1AA 3KABA 4IPXA 5HTGA 2ZR5A 2PPPA 5HWBA 2XP9A 3KADA 3O5RA 4DRQA 4U86A 4ODQA 5HW6A 2FKEA 1R9HA 2LKNA 1FKTA 4U84A 4W9PA 1ROTA 2RUDA 3UQBA 2PBCA 2F21A 2K8IA 2VCDA 4MSPA 3O5JA 4DRPA 1EQ3A 4JFLA 1FKDA 1Q6UA 3NTPA 3O5DA 3TDBA 4U85A 5I98A 1TCOC 3B7XA 1QPFA 5HW8A
chains in the Genus database with same CATH superfamily
3OA5A 2PN0A 4LAVA 2WLYA 2B31A 2DT1A 4URIA 1JNEA 5HBFA 4W9OA 5HUAA 1Q1CA 5HWCA 4UDMA 3WD3A 1X6NA 2KE0A 4DH0A 2RURA 1YW5A 3ARQA 2P4VA 4ODOA 2XP4A 3GU0A 1FKGA 4J4OA 3WIJA 3ARVA 3ARWA 1FKBA 3ARUA 1Q6HA 5GQBA 4JFJA 2UZ5A 3LUOA 3GPKA 2XP3A 3IKDA 1FD9A 3ALGA 2ESCA 4ODLA 4S3KA 5D75A 4ODKA 4XAKA 1E6RA 3AS3A 4QT3A 1LL6A 4DRNA 2AWGA 3UQAA 1LL7A 2RUCA 1FKIA 1K9TA 4S3JA 4MNMA 4LAWA 1BKFA 3BXWA 3EY6A 3UF8A 1JNSA 1WAWA 2YBUA 4NSBA 1FKJA 1D6OA 1ZCNA 3O5MA 2KO7A 4IQ2A 2PV3A 2G41A 2WLZA 3I6CA 2M1IA 1KFWA 3G6MA 1H0IA 3IHZA 2WK2A 2DT3A 4DWSB 2DG4A 2PPNA 2JZVA 1OGBA 1X6LA 2MLZA 4NZCA 2DSUA 3KZ7A 2ZQUA 3JYMA 1YATA 1HKKA 1B6CA 4Z2LA 2PPPA 2EULA 1FKTA 4W9PA 3UQBA 4MPKA 2PBCA 2K8IA 2OLHA 4MSPA 4DRPA 1EQ3A 1Q6UA 3NTPA 5I98A 3B7XA 4DRHA 3ARXA 3UI6A 4QZVB 1WB0A 2Y78A 4L3NA 3UI4A 4GIVA 5B8IC 3UQIA 1E9LA 3IKGA 4DWSA 1EIBA 3VAWA 5DF0A 1CTNA 1Y0OA 5DIVA 3WL0A 3JYJA 1J4RA 1HKMA 3OOBA 3UI5A 3CGNA 1J6YA 1OGGA 4GGQA 3PR9A 1A7XA 3AQUA 1F8AB 1FJDA 4DRJA 3B9EA 2IUZA 1UR8A 1XHGA 1HKJA 1ZBCA 1LQ0A 3KAHA 1VF8A 3B9AA 4ODRA 1O6IA 4PTMA 1HXVA 4J4NA 2F4EA 4WKHA 3O5FA 2RUQA 3KAFA 1M5YA 4JFKA 1LG2A 3WKZA 4Z2HA 4BF8A 3H9RB 1FKSA 3ARPA 1EYMA 3MDYB 1L1PA 3CHCA 1ROUA 1J4IA 1ZB5A 3RFWA 2O9OA 5GPRA 3KACA 4IQCA 3CZ8A 2MLXA 1D7HA 5J6EA 2OFNA 4MTVA 2QF8A 3NI6A 2MF9A 1FFRA 4Z2GA 1KT0A 1FKFA 1T11A 4P8UA 4TYOA 1E6NA 2KI3A 1HKIA 4WK9A 2XP8A 4Z2JA 2ZR6A 2F2DA 3PRAA 1W1PA 3PA7A 4DIPA 1NWRA 3ARZA 4IPXA 4MAVA 2ZR5A 2DSWA 2XP9A 3KADA 4U86A 4ODQA 3ARTA 1R9HA 1ROTA 1HJWA 4MNKA 3O5JA 4P8WA 4ZPTR 4AY1A 4O2TA 1HJXA 1UR9A 2DSVA 2FDMA 4TW8A 2PV2A 2KFWA 3PRBA 3B9DA 1IX5A 2DT0A 2L2SA 1U79A 4ZPWR 3WH0A 4ODNA 5HTGA 2LGOA 1NH6A 4Q7NA 3O5KA 2ZQVA 3QOKA 4KQZA 4QT2A 3AROA 3RM4A 4N19A 4ODPA 2A3BA 2WM0A 2A3EA 1QPLA 4LGXA 1F40A 1OWQA 2XP7A 2O92A 1PBKA 3ARRA 1GPFA 3ODKA 1SYTA 1NWTA 3WD4A 2DPEA 3FAPA 4FN2A 4W5UA 3RMEA 2LPVA 4WIWA 2ITKA 4MGVA 1NSGA 1QZ2A 4DZ3A 3O5PA 2M2AA 2DSZA 3GTYX 1WNOA 1LG1A 4TX0A 2LJ4A 1FKRA 2IF4A 5DEZA 1GRJA 3RGCA 5HKGA 4WKFA 4IT6A 1NMVA 1FFQA 1W9PA 1C9HA 4P8XA 4Z2KA 1FKKA 2ZR4A 3WD1A 3O5LA 4DRIA 4DWSD 3EIPA 4HBEA 4R0XA 3ALFA 3PRDA 3IK8A 5DIUA 2XPBA 4TW7A 3AS1A 4LAYA 3RM9A 3TCZA 1W9VA 1HJVA 1JNDA 4ZPVR 1E6ZA 3RM8A 4WJXA 5JH8A 3W4RA 3WD2A 1KT1A 2KGJA 4HARA 1H0GA 2F23A 1LJYA 2MNTA 4Z2IA 2ETNA 3CH9A 1N1AA 3BMBA 5HWBA 4DRQA 1E6PA 5HW6A 3CHEA 2FKEA 2RUDA 1ITXA 1EHNA 4JFLA 3O5DA 4U85A 1TCOC 1ZBWA 5HW8A 4LAXA 1P5QA 3O5EA 1ZK6A 1ZU8A 1W1TA 2XP6A 4MNJA 4R5EA 4C02B 3FY1A 4HBOA 4W9QA 2PV1A 3WQVA 1W26A 2PPOA 4DROA 4DWSC 3CHDA 2MPHA 4TW6A 2D9FA 3NRKA 1FKHA 2VN1A 1BL4A 1JVWA 2A3CA 3O5IA 3AS2A 4NNRA 1J4HA 3WL1A 4P8VA 4IT4A 2M08A 1JNTA 1SR0A 3WD0A 4WKAA 3KCEA 2MLYA 4TNSA 1NMWA 1D7JA 3O5GA 4JYSA 2AOSA 2RSEA 3AS0A 3O5OA 2Q5AA 1FKLA 1D7IA 2G8ZA 1E44A 3KAGA 3CGMA 4ITZA 3O5QA 4DT4A 4FAPA 3ARYA 5BXJA 3G6LA 5HT1A 1NWSA 1ZBKA 1E15A 2XP5A 5DITA 1ZBVA 5DO2A 1TFVA 4ODMA 3JXVA 3ARSA 1Q6IA 1D2KA 2A3AA 1XRVA 2DT2A 2RQSA 1W1YA 3TC5A 4DZ2A 4Q22A 4QIBA 1RD6A 4DRMA 1LL4A 2FAPA 1NWUA 2DG9A 4DRKA 2KR7A 3B8SA 2N87A 1W9UA 5GPGA 1W1VA 4G2PA 1JCHB 1PINA 3FXYA 2ZQSA 2B5UB 4JFMA 5HW7A 1GUVA 2ZQTA 2XPAA 4ZS6A 1EDQA 4MNLA 1GOIA 4ML4A 4KR0B 2YBTA 2DG3A 3KAIA 1FAPA 4JFIA 4G50A 3KABA 4L72B 3O5RA 2PI6A 2LKNA 4U84A 2F21A 2VCDA 3CHFA 1FKDA 3TDBA 1QPFA 1ZL1A 3WQWA
chains in the Genus database with same CATH topology
3OA5A 4LAVA 2WLYA 2B31A 2DT1A 4URIA 1JNEA 5HBFA 4W9OA 5HUAA 1Q1CA 5HWCA 3WD3A 1X6NA 2KE0A 4DH0A 2RURA 1YW5A 3ARQA 4ODOA 2XP4A 1FKGA 4J4OA 3WIJA 3ARVA 3ARWA 1FKBA 3ARUA 1Q6HA 5GQBA 4JFJA 2UZ5A 3LUOA 3GPKA 2XP3A 3IKDA 1FD9A 3ALGA 2ESCA 4ODLA 4S3KA 5D75A 4ODKA 4XAKA 1E6RA 3AS3A 4QT3A 1LL6A 4DRNA 2AWGA 3UQAA 1LL7A 2RUCA 1FKIA 1K9TA 4S3JA 4MNMA 4LAWA 1BKFA 3BXWA 3EY6A 3UF8A 1JNSA 1WAWA 2YBUA 4NSBA 1FKJA 1D6OA 1ZCNA 3O5MA 2KO7A 4IQ2A 2PV3A 2G41A 2WLZA 3I6CA 2M1IA 1KFWA 3G6MA 1H0IA 3IHZA 2WK2A 2DT3A 4DWSB 2DG4A 2PPNA 2JZVA 1OGBA 1X6LA 2MLZA 4NZCA 2DSUA 3KZ7A 2ZQUA 3JYMA 1YATA 1HKKA 1B6CA 4Z2LA 2PPPA 1FKTA 4W9PA 3UQBA 4MPKA 2PBCA 2K8IA 2OLHA 4MSPA 4DRPA 1EQ3A 1Q6UA 3NTPA 5I98A 3B7XA 4DRHA 3ARXA 3UI6A 4QZVB 1WB0A 2Y78A 4L3NA 3UI4A 4GIVA 5B8IC 3UQIA 1E9LA 3IKGA 4DWSA 1EIBA 3VAWA 5DF0A 1CTNA 1Y0OA 5DIVA 3WL0A 3JYJA 1J4RA 1HKMA 3OOBA 3UI5A 3CGNA 1J6YA 1OGGA 4GGQA 3PR9A 1A7XA 3AQUA 1F8AB 1FJDA 4DRJA 3B9EA 2IUZA 1UR8A 1XHGA 1HKJA 1ZBCA 1LQ0A 3KAHA 1VF8A 3B9AA 4ODRA 1O6IA 4PTMA 1HXVA 4J4NA 2F4EA 4WKHA 3O5FA 2RUQA 3KAFA 1M5YA 4JFKA 1LG2A 3WKZA 4Z2HA 4BF8A 3H9RB 1FKSA 3ARPA 1EYMA 3MDYB 1L1PA 3CHCA 1ROUA 1J4IA 1ZB5A 3RFWA 2O9OA 5GPRA 3KACA 4IQCA 3CZ8A 2MLXA 1D7HA 5J6EA 2OFNA 4MTVA 2QF8A 3NI6A 2MF9A 1FFRA 4Z2GA 1KT0A 1FKFA 1T11A 4P8UA 4TYOA 1E6NA 2KI3A 1HKIA 4WK9A 2XP8A 4Z2JA 2ZR6A 2F2DA 3PRAA 1W1PA 3PA7A 4DIPA 1NWRA 3ARZA 4IPXA 4MAVA 2ZR5A 2DSWA 2XP9A 3KADA 4U86A 4ODQA 3ARTA 1R9HA 1ROTA 1HJWA 4MNKA 3O5JA 4P8WA 4ZPTR 4AY1A 4O2TA 1HJXA 1UR9A 2DSVA 2FDMA 4TW8A 2PV2A 2KFWA 3PRBA 3B9DA 1IX5A 2DT0A 2L2SA 1U79A 4ZPWR 3WH0A 4ODNA 5HTGA 2LGOA 1NH6A 4Q7NA 3O5KA 2ZQVA 3QOKA 4KQZA 4QT2A 3AROA 3RM4A 4N19A 4ODPA 2A3BA 2WM0A 2A3EA 1QPLA 4LGXA 1F40A 1OWQA 2XP7A 2O92A 1PBKA 3ARRA 1GPFA 3ODKA 1SYTA 1NWTA 3WD4A 2DPEA 3FAPA 4FN2A 4W5UA 3RMEA 2LPVA 4WIWA 2ITKA 4MGVA 1NSGA 1QZ2A 4DZ3A 3O5PA 2M2AA 2DSZA 1WNOA 1LG1A 4TX0A 2LJ4A 1FKRA 2IF4A 5DEZA 3RGCA 5HKGA 4WKFA 4IT6A 1NMVA 1FFQA 1W9PA 1C9HA 4P8XA 4Z2KA 1FKKA 2ZR4A 3WD1A 3O5LA 4DRIA 4DWSD 4HBEA 4R0XA 3ALFA 3PRDA 3IK8A 5DIUA 2XPBA 4TW7A 3AS1A 4LAYA 3RM9A 3TCZA 1W9VA 1HJVA 1JNDA 4ZPVR 1E6ZA 3RM8A 4WJXA 5JH8A 3W4RA 3WD2A 1KT1A 2KGJA 4HARA 1H0GA 4Z2IA 1LJYA 2MNTA 3CH9A 1N1AA 5HWBA 4DRQA 1E6PA 5HW6A 3CHEA 2FKEA 2RUDA 1ITXA 1EHNA 4JFLA 3O5DA 4U85A 1TCOC 1ZBWA 5HW8A 4LAXA 1P5QA 3O5EA 1ZK6A 1ZU8A 1W1TA 2XP6A 4MNJA 4R5EA 4C02B 3FY1A 4HBOA 4W9QA 2PV1A 3WQVA 1W26A 2PPOA 4DROA 4DWSC 3CHDA 2MPHA 4TW6A 2D9FA 3NRKA 1FKHA 2VN1A 1BL4A 1JVWA 2A3CA 3O5IA 3AS2A 4NNRA 1J4HA 3WL1A 4P8VA 4IT4A 2M08A 1JNTA 1SR0A 3WD0A 4WKAA 3KCEA 2MLYA 4TNSA 1NMWA 1D7JA 3O5GA 4JYSA 2AOSA 2RSEA 3AS0A 3O5OA 2Q5AA 1FKLA 1D7IA 2G8ZA 3KAGA 3CGMA 4ITZA 3O5QA 4DT4A 4FAPA 3ARYA 5BXJA 3G6LA 5HT1A 1NWSA 1ZBKA 1E15A 2XP5A 5DITA 1ZBVA 5DO2A 1TFVA 4ODMA 3JXVA 3ARSA 1Q6IA 1D2KA 2A3AA 1XRVA 2DT2A 2RQSA 1W1YA 3TC5A 4DZ2A 4Q22A 4QIBA 1RD6A 4DRMA 1LL4A 2FAPA 1NWUA 2DG9A 4DRKA 2KR7A 2N87A 3B8SA 1W9UA 5GPGA 1W1VA 4G2PA 1PINA 3FXYA 2ZQSA 4JFMA 5HW7A 1GUVA 2ZQTA 2XPAA 4ZS6A 1EDQA 4MNLA 1GOIA 4ML4A 4KR0B 2YBTA 2DG3A 3KAIA 1FAPA 4JFIA 4G50A 3KABA 4L72B 3O5RA 2PI6A 2LKNA 4U84A 2F21A 2VCDA 3CHFA 1FKDA 3TDBA 1QPFA 1ZL1A 3WQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O2T A;  4LAX A;  1P5Q A;  3O5E A;  1ZK6 A;  4LAV A;  2XP6 A;  4DRH A;  3UI6 A;  4TW8 A;  4C02 B;  2PV2 A;  4W9O A;  5HUA A;  1Q1C A;  4W9Q A;  2PV1 A;  5HWC A;  1W26 A;  2PPO A;  2Y78 A;  4DRO A;  2KFW A;  3UI4 A;  3PRB A;  4GIV A;  2MPH A;  2KE0 A;  4DH0 A;  2L2S A;  4TW6 A;  5B8I C;  3UQI A;  1U79 A;  2D9F A;  3NRK A;  2RUR A;  1FKH A;  4ODN A;  2VN1 A;  1BL4 A;  1JVW A;  1YW5 A;  3IKG A;  3O5I A;  2LGO A;  3VAW A;  4ODO A;  4NNR A;  2XP4 A;  3O5K A;  2ZQV A;  1J4H A;  4QT2 A;  4N19 A;  4ODP A;  1Y0O A;  5DIV A;  2M08 A;  3JYJ A;  1JNT A;  1J4R A;  1FKG A;  1QPL A;  4J4O A;  3OOB A;  3UI5 A;  3CGN A;  1J6Y A;  1F40 A;  3KCE A;  4GGQ A;  2XP7 A;  1A7X A;  2MLY A;  4TNS A;  1PBK A;  1F8A B;  1FJD A;  1FKB A;  4DRJ A;  1NMW A;  1D7J A;  1Q6H A;  3O5G A;  3ODK A;  4JFJ A;  4JYS A;  2UZ5 A;  2RSE A;  3O5O A;  2Q5A A;  1FKL A;  1D7I A;  3FAP A;  3LUO A;  3GPK A;  4FN2 A;  2LPV A;  2XP3 A;  3KAG A;  3CGM A;  1FD9 A;  3IKD A;  3KAH A;  4ITZ A;  3O5Q A;  4ODR A;  4DT4 A;  4ODL A;  5D75 A;  1HXV A;  2ITK A;  4J4N A;  2F4E A;  4ODK A;  4FAP A;  4MGV A;  1NSG A;  1QZ2 A;  4DRK A;  4DZ3 A;  3O5P A;  5BXJ A;  2M2A A;  3O5F A;  5HT1 A;  2RUQ A;  3KAF A;  1M5Y A;  2XP5 A;  4JFK A;  4QT3 A;  5DIT A;  4TX0 A;  2LJ4 A;  4DRN A;  1FKR A;  2AWG A;  2IF4 A;  4BF8 A;  3RGC A;  5HKG A;  3UQA A;  3H9R B;  4ODM A;  1FKS A;  1NMV A;  2RUC A;  1C9H A;  3JXV A;  1Q6I A;  1EYM A;  1FKI A;  3MDY B;  1FKK A;  2ZR4 A;  1L1P A;  2RQS A;  4LAW A;  1BKF A;  1J4I A;  1ROU A;  3RFW A;  3TC5 A;  4DZ2 A;  3O5L A;  4QIB A;  3KAC A;  3EY6 A;  4IQC A;  3UF8 A;  4DRM A;  1JNS A;  2FAP A;  2MLX A;  4DRI A;  1D7H A;  5J6E A;  1FKJ A;  1D6O A;  1ZCN A;  3O5M A;  3PRD A;  4R0X A;  2KO7 A;  2OFN A;  3IK8 A;  2DG9 A;  2PV3 A;  4IQ2 A;  2XPB A;  4TW7 A;  2KR7 A;  2N87 A;  3NI6 A;  5DIU A;  2MF9 A;  5GPG A;  4G2P A;  1KT0 A;  1PIN A;  1FKF A;  3I6C A;  4LAY A;  2ZQS A;  1T11 A;  2M1I A;  4JFM A;  4TYO A;  3TCZ A;  5HW7 A;  2ZQT A;  2KI3 A;  2XPA A;  2XP8 A;  2ZR6 A;  3IHZ A;  2F2D A;  2DG4 A;  2DG3 A;  2PPN A;  2JZV A;  1FAP A;  3KAI A;  1KT1 A;  2KGJ A;  3PA7 A;  4DIP A;  2MLZ A;  4JFI A;  2MNT A;  3KZ7 A;  3WH0 A;  2ZQU A;  3JYM A;  1YAT A;  4G50 A;  1B6C A;  1N1A A;  3KAB A;  4IPX A;  5HTG A;  2ZR5 A;  2PPP A;  5HWB A;  2XP9 A;  3KAD A;  3O5R A;  4DRQ A;  4U86 A;  4ODQ A;  5HW6 A;  2FKE A;  1R9H A;  2LKN A;  1FKT A;  4U84 A;  4W9P A;  1ROT A;  2RUD A;  3UQB A;  2PBC A;  2F21 A;  2K8I A;  2VCD A;  4MSP A;  3O5J A;  4DRP A;  1EQ3 A;  4JFL A;  1FKD A;  1Q6U A;  3NTP A;  3O5D A;  3TDB A;  4U85 A;  5I98 A;  1TCO C;  3B7X A;  1QPF A;  5HW8 A; 
#chains in the Genus database with same CATH topology
 3OA5 A;  2PN0 A;  4LAV A;  2WLY A;  2B31 A;  2DT1 A;  4URI A;  1JNE A;  5HBF A;  4W9O A;  5HUA A;  1Q1C A;  5HWC A;  4UDM A;  3WD3 A;  1X6N A;  2KE0 A;  4DH0 A;  2RUR A;  1YW5 A;  3ARQ A;  2P4V A;  4ODO A;  2XP4 A;  3GU0 A;  1FKG A;  4J4O A;  3WIJ A;  3ARV A;  3ARW A;  1FKB A;  3ARU A;  1Q6H A;  5GQB A;  4JFJ A;  2UZ5 A;  3LUO A;  3GPK A;  2XP3 A;  3IKD A;  1FD9 A;  3ALG A;  2ESC A;  4ODL A;  4S3K A;  5D75 A;  4ODK A;  4XAK A;  1E6R A;  3AS3 A;  4QT3 A;  1LL6 A;  4DRN A;  2AWG A;  3UQA A;  1LL7 A;  2RUC A;  1FKI A;  1K9T A;  4S3J A;  4MNM A;  4LAW A;  1BKF A;  3BXW A;  3EY6 A;  3UF8 A;  1JNS A;  1WAW A;  2YBU A;  4NSB A;  1FKJ A;  1D6O A;  1ZCN A;  3O5M A;  2KO7 A;  4IQ2 A;  2PV3 A;  2G41 A;  2WLZ A;  3I6C A;  2M1I A;  1KFW A;  3G6M A;  1H0I A;  3IHZ A;  2WK2 A;  2DT3 A;  4DWS B;  2DG4 A;  2PPN A;  2JZV A;  1OGB A;  1X6L A;  2MLZ A;  4NZC A;  2DSU A;  3KZ7 A;  2ZQU A;  3JYM A;  1YAT A;  1HKK A;  1B6C A;  4Z2L A;  2PPP A;  2EUL A;  1FKT A;  4W9P A;  3UQB A;  4MPK A;  2PBC A;  2K8I A;  2OLH A;  4MSP A;  4DRP A;  1EQ3 A;  1Q6U A;  3NTP A;  5I98 A;  3B7X A;  4DRH A;  3ARX A;  3UI6 A;  4QZV B;  1WB0 A;  2Y78 A;  4L3N A;  3UI4 A;  4GIV A;  5B8I C;  3UQI A;  1E9L A;  3IKG A;  4DWS A;  1EIB A;  3VAW A;  5DF0 A;  1CTN A;  1Y0O A;  5DIV A;  3WL0 A;  3JYJ A;  1J4R A;  1HKM A;  3OOB A;  3UI5 A;  3CGN A;  1J6Y A;  1OGG A;  4GGQ A;  3PR9 A;  1A7X A;  3AQU A;  1F8A B;  1FJD A;  4DRJ A;  3B9E A;  2IUZ A;  1UR8 A;  1XHG A;  1HKJ A;  1ZBC A;  1LQ0 A;  3KAH A;  1VF8 A;  3B9A A;  4ODR A;  1O6I A;  4PTM A;  1HXV A;  4J4N A;  2F4E A;  4WKH A;  3O5F A;  2RUQ A;  3KAF A;  1M5Y A;  4JFK A;  1LG2 A;  3WKZ A;  4Z2H A;  4BF8 A;  3H9R B;  1FKS A;  3ARP A;  1EYM A;  3MDY B;  1L1P A;  3CHC A;  1ROU A;  1J4I A;  1ZB5 A;  3RFW A;  2O9O A;  5GPR A;  3KAC A;  4IQC A;  3CZ8 A;  2MLX A;  1D7H A;  5J6E A;  2OFN A;  4MTV A;  2QF8 A;  3NI6 A;  2MF9 A;  1FFR A;  4Z2G A;  1KT0 A;  1FKF A;  1T11 A;  4P8U A;  4TYO A;  1E6N A;  2KI3 A;  1HKI A;  4WK9 A;  2XP8 A;  4Z2J A;  2ZR6 A;  2F2D A;  3PRA A;  1W1P A;  3PA7 A;  4DIP A;  1NWR A;  3ARZ A;  4IPX A;  4MAV A;  2ZR5 A;  2DSW A;  2XP9 A;  3KAD A;  4U86 A;  4ODQ A;  3ART A;  1R9H A;  1ROT A;  1HJW A;  4MNK A;  3O5J A;  4P8W A;  4ZPT R;  4AY1 A;  4O2T A;  1HJX A;  1UR9 A;  2DSV A;  2FDM A;  4TW8 A;  2PV2 A;  2KFW A;  3PRB A;  3B9D A;  1IX5 A;  2DT0 A;  2L2S A;  1U79 A;  4ZPW R;  3WH0 A;  4ODN A;  5HTG A;  2LGO A;  1NH6 A;  4Q7N A;  3O5K A;  2ZQV A;  3QOK A;  4KQZ A;  4QT2 A;  3ARO A;  3RM4 A;  4N19 A;  4ODP A;  2A3B A;  2WM0 A;  2A3E A;  1QPL A;  4LGX A;  1F40 A;  1OWQ A;  2XP7 A;  2O92 A;  1PBK A;  3ARR A;  1GPF A;  3ODK A;  1SYT A;  1NWT A;  3WD4 A;  2DPE A;  3FAP A;  4FN2 A;  4W5U A;  3RME A;  2LPV A;  4WIW A;  2ITK A;  4MGV A;  1NSG A;  1QZ2 A;  4DZ3 A;  3O5P A;  2M2A A;  2DSZ A;  3GTY X;  1WNO A;  1LG1 A;  4TX0 A;  2LJ4 A;  1FKR A;  2IF4 A;  5DEZ A;  1GRJ A;  3RGC A;  5HKG A;  4WKF A;  4IT6 A;  1NMV A;  1FFQ A;  1W9P A;  1C9H A;  4P8X A;  4Z2K A;  1FKK A;  2ZR4 A;  3WD1 A;  3O5L A;  4DRI A;  4DWS D;  3EIP A;  4HBE A;  4R0X A;  3ALF A;  3PRD A;  3IK8 A;  5DIU A;  2XPB A;  4TW7 A;  3AS1 A;  4LAY A;  3RM9 A;  3TCZ A;  1W9V A;  1HJV A;  1JND A;  4ZPV R;  1E6Z A;  3RM8 A;  4WJX A;  5JH8 A;  3W4R A;  3WD2 A;  1KT1 A;  2KGJ A;  4HAR A;  1H0G A;  2F23 A;  1LJY A;  2MNT A;  4Z2I A;  2ETN A;  3CH9 A;  1N1A A;  3BMB A;  5HWB A;  4DRQ A;  1E6P A;  5HW6 A;  3CHE A;  2FKE A;  2RUD A;  1ITX A;  1EHN A;  4JFL A;  3O5D A;  4U85 A;  1TCO C;  1ZBW A;  5HW8 A;  4LAX A;  1P5Q A;  3O5E A;  1ZK6 A;  1ZU8 A;  1W1T A;  2XP6 A;  4MNJ A;  4R5E A;  4C02 B;  3FY1 A;  4HBO A;  4W9Q A;  2PV1 A;  3WQV A;  1W26 A;  2PPO A;  4DRO A;  4DWS C;  3CHD A;  2MPH A;  4TW6 A;  2D9F A;  3NRK A;  1FKH A;  2VN1 A;  1BL4 A;  1JVW A;  2A3C A;  3O5I A;  3AS2 A;  4NNR A;  1J4H A;  3WL1 A;  4P8V A;  4IT4 A;  2M08 A;  1JNT A;  1SR0 A;  3WD0 A;  4WKA A;  3KCE A;  2MLY A;  4TNS A;  1NMW A;  1D7J A;  3O5G A;  4JYS A;  2AOS A;  2RSE A;  3AS0 A;  3O5O A;  2Q5A A;  1FKL A;  1D7I A;  2G8Z A;  1E44 A;  3KAG A;  3CGM A;  4ITZ A;  3O5Q A;  4DT4 A;  4FAP A;  3ARY A;  5BXJ A;  3G6L A;  5HT1 A;  1NWS A;  1ZBK A;  1E15 A;  2XP5 A;  5DIT A;  1ZBV A;  5DO2 A;  1TFV A;  4ODM A;  3JXV A;  3ARS A;  1Q6I A;  1D2K A;  2A3A A;  1XRV A;  2DT2 A;  2RQS A;  1W1Y A;  3TC5 A;  4DZ2 A;  4Q22 A;  4QIB A;  1RD6 A;  4DRM A;  1LL4 A;  2FAP A;  1NWU A;  2DG9 A;  4DRK A;  2KR7 A;  3B8S A;  2N87 A;  1W9U A;  5GPG A;  1W1V A;  4G2P A;  1JCH B;  1PIN A;  3FXY A;  2ZQS A;  2B5U B;  4JFM A;  5HW7 A;  1GUV A;  2ZQT A;  2XPA A;  4ZS6 A;  1EDQ A;  4MNL A;  1GOI A;  4ML4 A;  4KR0 B;  2YBT A;  2DG3 A;  3KAI A;  1FAP A;  4JFI A;  4G50 A;  3KAB A;  4L72 B;  3O5R A;  2PI6 A;  2LKN A;  4U84 A;  2F21 A;  2VCD A;  3CHF A;  1FKD A;  3TDB A;  1QPF A;  1ZL1 A;  3WQW A; 
#chains in the Genus database with same CATH homology
 3OA5 A;  4LAV A;  2WLY A;  2B31 A;  2DT1 A;  4URI A;  1JNE A;  5HBF A;  4W9O A;  5HUA A;  1Q1C A;  5HWC A;  3WD3 A;  1X6N A;  2KE0 A;  4DH0 A;  2RUR A;  1YW5 A;  3ARQ A;  4ODO A;  2XP4 A;  1FKG A;  4J4O A;  3WIJ A;  3ARV A;  3ARW A;  1FKB A;  3ARU A;  1Q6H A;  5GQB A;  4JFJ A;  2UZ5 A;  3LUO A;  3GPK A;  2XP3 A;  3IKD A;  1FD9 A;  3ALG A;  2ESC A;  4ODL A;  4S3K A;  5D75 A;  4ODK A;  4XAK A;  1E6R A;  3AS3 A;  4QT3 A;  1LL6 A;  4DRN A;  2AWG A;  3UQA A;  1LL7 A;  2RUC A;  1FKI A;  1K9T A;  4S3J A;  4MNM A;  4LAW A;  1BKF A;  3BXW A;  3EY6 A;  3UF8 A;  1JNS A;  1WAW A;  2YBU A;  4NSB A;  1FKJ A;  1D6O A;  1ZCN A;  3O5M A;  2KO7 A;  4IQ2 A;  2PV3 A;  2G41 A;  2WLZ A;  3I6C A;  2M1I A;  1KFW A;  3G6M A;  1H0I A;  3IHZ A;  2WK2 A;  2DT3 A;  4DWS B;  2DG4 A;  2PPN A;  2JZV A;  1OGB A;  1X6L A;  2MLZ A;  4NZC A;  2DSU A;  3KZ7 A;  2ZQU A;  3JYM A;  1YAT A;  1HKK A;  1B6C A;  4Z2L A;  2PPP A;  1FKT A;  4W9P A;  3UQB A;  4MPK A;  2PBC A;  2K8I A;  2OLH A;  4MSP A;  4DRP A;  1EQ3 A;  1Q6U A;  3NTP A;  5I98 A;  3B7X A;  4DRH A;  3ARX A;  3UI6 A;  4QZV B;  1WB0 A;  2Y78 A;  4L3N A;  3UI4 A;  4GIV A;  5B8I C;  3UQI A;  1E9L A;  3IKG A;  4DWS A;  1EIB A;  3VAW A;  5DF0 A;  1CTN A;  1Y0O A;  5DIV A;  3WL0 A;  3JYJ A;  1J4R A;  1HKM A;  3OOB A;  3UI5 A;  3CGN A;  1J6Y A;  1OGG A;  4GGQ A;  3PR9 A;  1A7X A;  3AQU A;  1F8A B;  1FJD A;  4DRJ A;  3B9E A;  2IUZ A;  1UR8 A;  1XHG A;  1HKJ A;  1ZBC A;  1LQ0 A;  3KAH A;  1VF8 A;  3B9A A;  4ODR A;  1O6I A;  4PTM A;  1HXV A;  4J4N A;  2F4E A;  4WKH A;  3O5F A;  2RUQ A;  3KAF A;  1M5Y A;  4JFK A;  1LG2 A;  3WKZ A;  4Z2H A;  4BF8 A;  3H9R B;  1FKS A;  3ARP A;  1EYM A;  3MDY B;  1L1P A;  3CHC A;  1ROU A;  1J4I A;  1ZB5 A;  3RFW A;  2O9O A;  5GPR A;  3KAC A;  4IQC A;  3CZ8 A;  2MLX A;  1D7H A;  5J6E A;  2OFN A;  4MTV A;  2QF8 A;  3NI6 A;  2MF9 A;  1FFR A;  4Z2G A;  1KT0 A;  1FKF A;  1T11 A;  4P8U A;  4TYO A;  1E6N A;  2KI3 A;  1HKI A;  4WK9 A;  2XP8 A;  4Z2J A;  2ZR6 A;  2F2D A;  3PRA A;  1W1P A;  3PA7 A;  4DIP A;  1NWR A;  3ARZ A;  4IPX A;  4MAV A;  2ZR5 A;  2DSW A;  2XP9 A;  3KAD A;  4U86 A;  4ODQ A;  3ART A;  1R9H A;  1ROT A;  1HJW A;  4MNK A;  3O5J A;  4P8W A;  4ZPT R;  4AY1 A;  4O2T A;  1HJX A;  1UR9 A;  2DSV A;  2FDM A;  4TW8 A;  2PV2 A;  2KFW A;  3PRB A;  3B9D A;  1IX5 A;  2DT0 A;  2L2S A;  1U79 A;  4ZPW R;  3WH0 A;  4ODN A;  5HTG A;  2LGO A;  1NH6 A;  4Q7N A;  3O5K A;  2ZQV A;  3QOK A;  4KQZ A;  4QT2 A;  3ARO A;  3RM4 A;  4N19 A;  4ODP A;  2A3B A;  2WM0 A;  2A3E A;  1QPL A;  4LGX A;  1F40 A;  1OWQ A;  2XP7 A;  2O92 A;  1PBK A;  3ARR A;  1GPF A;  3ODK A;  1SYT A;  1NWT A;  3WD4 A;  2DPE A;  3FAP A;  4FN2 A;  4W5U A;  3RME A;  2LPV A;  4WIW A;  2ITK A;  4MGV A;  1NSG A;  1QZ2 A;  4DZ3 A;  3O5P A;  2M2A A;  2DSZ A;  1WNO A;  1LG1 A;  4TX0 A;  2LJ4 A;  1FKR A;  2IF4 A;  5DEZ A;  3RGC A;  5HKG A;  4WKF A;  4IT6 A;  1NMV A;  1FFQ A;  1W9P A;  1C9H A;  4P8X A;  4Z2K A;  1FKK A;  2ZR4 A;  3WD1 A;  3O5L A;  4DRI A;  4DWS D;  4HBE A;  4R0X A;  3ALF A;  3PRD A;  3IK8 A;  5DIU A;  2XPB A;  4TW7 A;  3AS1 A;  4LAY A;  3RM9 A;  3TCZ A;  1W9V A;  1HJV A;  1JND A;  4ZPV R;  1E6Z A;  3RM8 A;  4WJX A;  5JH8 A;  3W4R A;  3WD2 A;  1KT1 A;  2KGJ A;  4HAR A;  1H0G A;  4Z2I A;  1LJY A;  2MNT A;  3CH9 A;  1N1A A;  5HWB A;  4DRQ A;  1E6P A;  5HW6 A;  3CHE A;  2FKE A;  2RUD A;  1ITX A;  1EHN A;  4JFL A;  3O5D A;  4U85 A;  1TCO C;  1ZBW A;  5HW8 A;  4LAX A;  1P5Q A;  3O5E A;  1ZK6 A;  1ZU8 A;  1W1T A;  2XP6 A;  4MNJ A;  4R5E A;  4C02 B;  3FY1 A;  4HBO A;  4W9Q A;  2PV1 A;  3WQV A;  1W26 A;  2PPO A;  4DRO A;  4DWS C;  3CHD A;  2MPH A;  4TW6 A;  2D9F A;  3NRK A;  1FKH A;  2VN1 A;  1BL4 A;  1JVW A;  2A3C A;  3O5I A;  3AS2 A;  4NNR A;  1J4H A;  3WL1 A;  4P8V A;  4IT4 A;  2M08 A;  1JNT A;  1SR0 A;  3WD0 A;  4WKA A;  3KCE A;  2MLY A;  4TNS A;  1NMW A;  1D7J A;  3O5G A;  4JYS A;  2AOS A;  2RSE A;  3AS0 A;  3O5O A;  2Q5A A;  1FKL A;  1D7I A;  2G8Z A;  3KAG A;  3CGM A;  4ITZ A;  3O5Q A;  4DT4 A;  4FAP A;  3ARY A;  5BXJ A;  3G6L A;  5HT1 A;  1NWS A;  1ZBK A;  1E15 A;  2XP5 A;  5DIT A;  1ZBV A;  5DO2 A;  1TFV A;  4ODM A;  3JXV A;  3ARS A;  1Q6I A;  1D2K A;  2A3A A;  1XRV A;  2DT2 A;  2RQS A;  1W1Y A;  3TC5 A;  4DZ2 A;  4Q22 A;  4QIB A;  1RD6 A;  4DRM A;  1LL4 A;  2FAP A;  1NWU A;  2DG9 A;  4DRK A;  2KR7 A;  2N87 A;  3B8S A;  1W9U A;  5GPG A;  1W1V A;  4G2P A;  1PIN A;  3FXY A;  2ZQS A;  4JFM A;  5HW7 A;  1GUV A;  2ZQT A;  2XPA A;  4ZS6 A;  1EDQ A;  4MNL A;  1GOI A;  4ML4 A;  4KR0 B;  2YBT A;  2DG3 A;  3KAI A;  1FAP A;  4JFI A;  4G50 A;  3KAB A;  4L72 B;  3O5R A;  2PI6 A;  2LKN A;  4U84 A;  2F21 A;  2VCD A;  3CHF A;  1FKD A;  3TDB A;  1QPF A;  1ZL1 A;  3WQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...