3JYJA

Structure-based design of novel pin1 inhibitors (ii)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
113
structure length
113
Chain Sequence
EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of novel human Pin1 inhibitors (II).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 40
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3jyjA00
4LAXA 1HXVA 1YATA 1L1PA 1FKLA 2XP6A 3ODKA 4FN2A 5HUAA 2L2SA 2RSEA 5J6EA 1P5QA 1R9HA 1YW5A 1D7JA 2MPHA 1Q6HA 3JXVA 1EQ3A 5BXJA 2PPPA 4J4OA 5HW7A 2MF9A 1F40A 4N19A 3O5IA 3UQBA 1JNTA 4C02B 3IK8A 1BL4A 1FKRA 4JFLA 3O5GA 1JVWA 3KAHA 2MNTA 2PV2A 5HW6A 4NNRA 3FAPA 4TW6A 2ZQTA 2KE0A 3O5OA 1B6CA 4DRMA 2UZ5A 1C9HA 4ODPA 3UI6A 3O5LA 2JZVA 3O5PA 4FAPA 1PBKA 2OFNA 2RURA 3TDBA 3TCZA 5I98A 2LJ4A 2K8IA 2VCDA 4JFJA 3B7XA 2DG9A 1EYMA 1ZCNA 3WH0A 2XPBA 3GPKA 2ZQUA 1U79A 5HKGA 3O5DA 1NMVA 4TW7A 4MSPA 3PRBA 4LAYA 4ODKA 3TC5A 4LAWA 4DH0A 1FKHA 4QT3A 3PA7A 1FKGA 1F8AB 3UF8A 1ZK6A 4DZ2A 3CGMA 5HWCA 1KT1A 5HWBA 2LPVA 4JFMA 1ROTA 4QIBA 2KI3A 2ZR6A 2Y78A 5GPGA 3UI4A 4MGVA 4DT4A 4ITZA 3JYMA 3I6CA 2F2DA 2KFWA 3NI6A 1ROUA 3O5EA 4IQCA 2LGOA 4DRNA 2N87A 3IKDA 3PRDA 4ODOA 4TX0A 5DIUA 5HTGA 3O5JA 4O2TA 1FKKA 2Q5AA 4GGQA 2DG4A 2XP7A 3O5FA 2KGJA 3UI5A 1FD9A 4JYSA 4U84A 1D7HA 4DRQA 4IQ2A 5HT1A 4DRPA 2F21A 3NRKA 2ZR5A 4QT2A 1D6OA 1Q1CA 2ZQSA 3EY6A 4R0XA 4U86A 3KAFA 3OOBA 2PPOA 3KZ7A 1NSGA 3JYJA 3IHZA 3UQAA 2DG3A 3H9RB 1NMWA 2VN1A 1PINA 2M08A 2M1IA 3KABA 3KCEA 2MLZA 2PPNA 3UQIA 4DRKA 4W9PA 4TYOA 2ZR4A 2IF4A 2FKEA 3VAWA 2RQSA 3KAGA 4G50A 2ITKA 1FKSA 2MLXA 4W9QA 2PV3A 3NTPA 4ODLA 1FKDA 1KT0A 4ODNA 1J4IA 3MDYB 2PV1A 2F4EA 1BKFA 2KR7A 3KAIA 2M2AA 1FAPA 4ODQA 3O5RA 2XP4A 1A7XA 3IKGA 3LUOA 1M5YA 1FKIA 1QZ2A 1FKTA 1N1AA 1TCOC 3KACA 1QPFA 4LAVA 5HW8A 2PBCA 3RGCA 2ZQVA 3O5KA 1FKBA 3CGNA 1FKJA 4TNSA 5D75A 4DRIA 2FAPA 1FJDA 4U85A 1J6YA 2RUCA 4JFIA 1FKFA 4ODRA 4J4NA 1W26A 4JFKA 1JNSA 1J4HA 2KO7A 2XP5A 3RFWA 4G2PA 1D7IA 5B8IC 2XP9A 5DIVA 4W9OA 1Q6UA 1QPLA 2LKNA 4DZ3A 4DRHA 2XPAA 3O5MA 2XP8A 1Y0OA 4DRJA 4GIVA 2MLYA 2D9FA 3O5QA 4BF8A 4DROA 4DIPA 4TW8A 2XP3A 4IPXA 4ODMA 1T11A 2RUDA 2RUQA 2AWGA 1Q6IA 1J4RA 3KADA 5DITA
chains in the Genus database with same CATH superfamily
1HXVA 1E44A 4Q22A 1YATA 1FKLA 3ODKA 1P5QA 1YW5A 1D7JA 3JXVA 1E9LA 5BXJA 2O9OA 5HW7A 1W1VA 1LL6A 1JNTA 1OGGA 4JFLA 1W1YA 2MNTA 3ARSA 2KE0A 3BXWA 1B6CA 3ARZA 1C9HA 4FAPA 2JZVA 1PBKA 2OFNA 3TDBA 2LJ4A 2K8IA 2VCDA 3B8SA 2DG9A 2ZQUA 1HKJA 1NWSA 4QT3A 3EIPA 1FKGA 3UF8A 4DZ2A 1GOIA 1KT1A 5HWBA 4L72B 5GQBA 5DF0A 2Y78A 4MGVA 3WD4A 5DEZA 4DT4A 1H0IA 2F2DA 1W9UA 3CZ8A 1ROUA 1SR0A 2N87A 4P8UA 5DIUA 3FY1A 3O5JA 1EIBA 2Q5AA 2XP7A 1W1PA 3UI5A 1FD9A 4JYSA 4MNLA 1ITXA 4IQ2A 5HT1A 1UR8A 4R0XA 2ZQSA 3EY6A 1LL4A 3GU0A 1HJWA 1E6PA 2IF4A 2YBTA 3WD2A 3G6LA 3ARUA 4Q7NA 2MLXA 3NTPA 4HBEA 1NH6A 2F4EA 2XP4A 3LUOA 4MTVA 2DPEA 3KACA 2A3BA 3ARPA 2ZQVA 3CHCA 1RD6A 5D75A 3RM8A 4ODRA 3ARTA 1JNSA 2XP5A 5B8IC 3AROA 2XP9A 1QPLA 3WQWA 2LKNA 4DWSD 3FXYA 4DRHA 4ZPWR 1LG2A 2A3EA 4DRJA 4GIVA 4DROA 3ARQA 2EULA 2XP3A 4QZVB 1T11A 1E15A 3ALFA 1X6LA 1J4RA 3WL0A 5HKGA 1D2KA 2ETNA 2XP6A 4S3JA 4FN2A 5J6EA 4UDMA 1FFQA 1Q6HA 1SYTA 2DT2A 2PPPA 4URIA 2MF9A 4WIWA 4C02B 3O5GA 1JVWA 2A3CA 4NNRA 4NZCA 4TW6A 2ZQTA 4DRMA 3UI6A 3O5LA 4KQZA 1ZL1A 2ESCA 3B7XA 1ZCNA 1WAWA 2WM0A 1U79A 1IX5A 3G6MA 3TC5A 4LAWA 1LQ0A 3PA7A 1ZK6A 1VF8A 2DSUA 3AS2A 1H0GA 1ROTA 2KI3A 2ZR6A 1NWUA 3ARVA 4ITZA 3JYMA 1LJYA 1W9VA 2KFWA 3O5EA 2QF8A 3CH9A 4O2TA 2KGJA 4DWSA 2F21A 1JNEA 1D6OA 4QT2A 4U86A 3OOBA 2M1IA 5HBFA 3KCEA 4R5EA 4DRKA 4WK9A 3AS0A 3KAGA 3WL1A 2OLHA 1W1TA 4W9QA 4ODLA 4ODNA 4Z2KA 3ALGA 4ODQA 3O5RA 3IKGA 1FKTA 2WLZA 4LGXA 2PBCA 3RGCA 1EDQA 1HKKA 4TNSA 1FKJA 3W4RA 1FJDA 4JFIA 4J4NA 1WB0A 3ARWA 2FDMA 4W9OA 1Q6UA 1ZBWA 3O5MA 4MNMA 2MLYA 4BF8A 2B5UB 4NSBA 4WKFA 1ZBVA 1LL7A 4ODMA 3WQVA 2RUDA 3B9DA 1M5YA 3KADA 2A3AA 5DITA 1HJXA 3WD0A 1GUVA 1KFWA 2L2SA 2RSEA 3RMEA 2MPHA 3CHDA 2AOSA 4Z2JA 1EQ3A 1OWQA 1WNOA 1F40A 4N19A 3O5IA 3UQBA 4ZPVR 1W9PA 4MNKA 4S3KA 5JH8A 4DWSB 3O5OA 2UZ5A 4ODPA 2RURA 3PRAA 4XAKA 5I98A 1EYMA 2XPBA 3GPKA 4TW7A 1GPFA 1HKIA 1E6RA 4LAYA 4MSPA 4ODKA 4DH0A 4IT6A 1NWRA 5HWCA 2LPVA 4JFMA 4HARA 4QIBA 3WD3A 3ARRA 3AS1A 3UI4A 3B9EA 3ARYA 2LGOA 4DRNA 3IKDA 5HTGA 4AY1A 4TX0A 2B31A 4MAVA 4Z2LA 2DG4A 1O6IA 3O5FA 4U84A 1ZU8A 4DRQA 4Z2IA 2DSZA 3NRKA 1FFRA 2PPOA 5DO2A 3BMBA 2M08A 3KABA 2MLZA 3UQIA 4W9PA 4TYOA 2ZR4A 2FKEA 4WKAA 2ITKA 1FKSA 4KR0B 2YBUA 1GRJA 1KT0A 3MDYB 2PV1A 3KAIA 1K9TA 2PN0A 1FKIA 1TCOC 3O5KA 3CGNA 4DRIA 3QOKA 4IT4A 4U85A 1J6YA 3RM9A 1FKFA 1W26A 1J4HA 2KO7A 1D7IA 5DIVA 4DZ3A 3WKZA 2XPAA 1Y0OA 2D9FA 3O5QA 4DIPA 4TW8A 2DSVA 2RUQA 4LAXA 4W5UA 1L1PA 5HUAA 5GPRA 1R9HA 3ARXA 3GTYX 1TFVA 4Z2GA 1HKMA 4J4OA 1LG1A 3IK8A 1BL4A 1FKRA 3KAHA 2PV2A 5HW6A 3FAPA 3O5PA 3WD1A 3TCZA 3AS3A 4JFJA 4ZS6A 3WH0A 3O5DA 1NMVA 3PRBA 1FKHA 2G41A 1XRVA 1F8AB 3CGMA 4HBOA 1UR9A 3OA5A 1E6NA 5GPGA 3I6CA 1JCHB 1HJVA 1XHGA 3NI6A 4IQCA 4P8XA 3PRDA 4ODOA 2WK2A 4DWSC 1ZB5A 3WIJA 2O92A 1FKKA 4GGQA 3RM4A 2IUZA 2PI6A 1D7HA 4MPKA 4DRPA 2ZR5A 4WJXA 1Q1CA 3KAFA 3CHEA 3KZ7A 1NSGA 3JYJA 3IHZA 3UQAA 2DG3A 3H9RB 2P4VA 1NMWA 3AQUA 2VN1A 1PINA 2DT0A 2DT1A 2PPNA 4ZPTR 1X6NA 3VAWA 2F23A 2RQSA 4G50A 1OGBA 2DSWA 2PV3A 4MNJA 1FKDA 1J4IA 1BKFA 2KR7A 2M2AA 1FAPA 4PTMA 1A7XA 2WLYA 1QZ2A 2DT3A 1N1AA 1QPFA 4LAVA 5HW8A 1FKBA 4WKHA 2FAPA 1ZBKA 1ZBCA 1JNDA 2RUCA 4P8VA 4JFKA 3CHFA 4Z2HA 1CTNA 4ML4A 3RFWA 4G2PA 1EHNA 2G8ZA 2XP8A 1E6ZA 3B9AA 1NWTA 4L3NA 4P8WA 3PR9A 4IPXA 2AWGA 1Q6IA
chains in the Genus database with same CATH topology
1HXVA 4Q22A 1YATA 1FKLA 3ODKA 1P5QA 1YW5A 1D7JA 3JXVA 1E9LA 5BXJA 2O9OA 5HW7A 1W1VA 1LL6A 1JNTA 1OGGA 4JFLA 1W1YA 2MNTA 3ARSA 2KE0A 3BXWA 1B6CA 3ARZA 1C9HA 4FAPA 2JZVA 1PBKA 2OFNA 3TDBA 2LJ4A 2K8IA 2VCDA 3B8SA 2DG9A 2ZQUA 1HKJA 1NWSA 4QT3A 1FKGA 3UF8A 4DZ2A 1GOIA 1KT1A 5HWBA 4L72B 5GQBA 5DF0A 2Y78A 4MGVA 3WD4A 5DEZA 4DT4A 1H0IA 2F2DA 1W9UA 3CZ8A 1ROUA 1SR0A 2N87A 4P8UA 5DIUA 3FY1A 3O5JA 1EIBA 2Q5AA 2XP7A 1W1PA 3UI5A 1FD9A 4JYSA 4MNLA 1ITXA 4IQ2A 5HT1A 1UR8A 4R0XA 2ZQSA 3EY6A 1LL4A 1HJWA 1E6PA 2IF4A 2YBTA 3WD2A 3G6LA 3ARUA 4Q7NA 2MLXA 3NTPA 4HBEA 1NH6A 2F4EA 2XP4A 3LUOA 4MTVA 2DPEA 3KACA 2A3BA 3ARPA 2ZQVA 3CHCA 1RD6A 5D75A 3RM8A 4ODRA 3ARTA 1JNSA 2XP5A 5B8IC 3AROA 2XP9A 1QPLA 3WQWA 2LKNA 4DWSD 3FXYA 4DRHA 4ZPWR 1LG2A 2A3EA 4DRJA 4GIVA 4DROA 3ARQA 2XP3A 4QZVB 1T11A 1E15A 3ALFA 1X6LA 1J4RA 3WL0A 5HKGA 1D2KA 2XP6A 4S3JA 4FN2A 5J6EA 1FFQA 1Q6HA 1SYTA 2DT2A 2PPPA 4URIA 2MF9A 4WIWA 4C02B 3O5GA 1JVWA 2A3CA 4NNRA 4NZCA 4TW6A 2ZQTA 4DRMA 3UI6A 3O5LA 4KQZA 1ZL1A 2ESCA 3B7XA 1ZCNA 1WAWA 2WM0A 1U79A 1IX5A 3G6MA 3TC5A 4LAWA 1LQ0A 3PA7A 1ZK6A 1VF8A 2DSUA 3AS2A 1H0GA 1ROTA 2KI3A 2ZR6A 1NWUA 3ARVA 4ITZA 3JYMA 1LJYA 1W9VA 2KFWA 3O5EA 2QF8A 3CH9A 4O2TA 2KGJA 4DWSA 2F21A 1JNEA 1D6OA 4QT2A 4U86A 3OOBA 2M1IA 5HBFA 3KCEA 4R5EA 4DRKA 4WK9A 3AS0A 3KAGA 3WL1A 2OLHA 1W1TA 4W9QA 4ODLA 4ODNA 4Z2KA 3ALGA 4ODQA 3O5RA 3IKGA 1FKTA 2WLZA 4LGXA 2PBCA 3RGCA 1EDQA 1HKKA 4TNSA 1FKJA 3W4RA 1FJDA 4JFIA 4J4NA 1WB0A 3ARWA 2FDMA 4W9OA 1Q6UA 1ZBWA 3O5MA 4MNMA 2MLYA 4BF8A 4NSBA 4WKFA 1ZBVA 1LL7A 4ODMA 3WQVA 2RUDA 3B9DA 1M5YA 3KADA 2A3AA 5DITA 1HJXA 3WD0A 1GUVA 1KFWA 2L2SA 2RSEA 3RMEA 2MPHA 3CHDA 2AOSA 4Z2JA 1EQ3A 1OWQA 1WNOA 1F40A 4N19A 3O5IA 3UQBA 4ZPVR 1W9PA 4MNKA 4S3KA 5JH8A 4DWSB 3O5OA 2UZ5A 4ODPA 2RURA 3PRAA 4XAKA 5I98A 1EYMA 2XPBA 3GPKA 4TW7A 1GPFA 1HKIA 1E6RA 4LAYA 4MSPA 4ODKA 4DH0A 4IT6A 1NWRA 5HWCA 2LPVA 4JFMA 4HARA 4QIBA 3WD3A 3ARRA 3AS1A 3UI4A 3B9EA 3ARYA 2LGOA 4DRNA 3IKDA 5HTGA 4AY1A 4TX0A 2B31A 4MAVA 4Z2LA 2DG4A 1O6IA 3O5FA 4U84A 1ZU8A 4DRQA 4Z2IA 2DSZA 3NRKA 1FFRA 2PPOA 5DO2A 2M08A 3KABA 2MLZA 3UQIA 4W9PA 4TYOA 2ZR4A 2FKEA 4WKAA 2ITKA 1FKSA 4KR0B 2YBUA 1KT0A 3MDYB 2PV1A 3KAIA 1K9TA 1FKIA 1TCOC 3O5KA 3CGNA 4DRIA 3QOKA 4IT4A 4U85A 1J6YA 3RM9A 1FKFA 1W26A 1J4HA 2KO7A 1D7IA 5DIVA 4DZ3A 3WKZA 2XPAA 1Y0OA 2D9FA 3O5QA 4DIPA 4TW8A 2DSVA 2RUQA 4LAXA 4W5UA 1L1PA 5HUAA 5GPRA 1R9HA 3ARXA 1TFVA 4Z2GA 1HKMA 4J4OA 1LG1A 3IK8A 1BL4A 1FKRA 3KAHA 2PV2A 5HW6A 3FAPA 3O5PA 3WD1A 3TCZA 3AS3A 4JFJA 4ZS6A 3WH0A 3O5DA 1NMVA 3PRBA 1FKHA 2G41A 1XRVA 1F8AB 3CGMA 4HBOA 1UR9A 3OA5A 1E6NA 5GPGA 3I6CA 1HJVA 1XHGA 3NI6A 4IQCA 4P8XA 3PRDA 4ODOA 2WK2A 4DWSC 1ZB5A 3WIJA 2O92A 1FKKA 4GGQA 3RM4A 2IUZA 2PI6A 1D7HA 4MPKA 4DRPA 2ZR5A 4WJXA 1Q1CA 3KAFA 3CHEA 3KZ7A 1NSGA 3JYJA 3IHZA 3UQAA 2DG3A 3H9RB 1NMWA 3AQUA 2VN1A 1PINA 2DT0A 2DT1A 2PPNA 4ZPTR 1X6NA 3VAWA 2RQSA 4G50A 1OGBA 2DSWA 2PV3A 4MNJA 1FKDA 1J4IA 1BKFA 2KR7A 2M2AA 1FAPA 4PTMA 1A7XA 2WLYA 1QZ2A 2DT3A 1N1AA 1QPFA 4LAVA 5HW8A 1FKBA 4WKHA 2FAPA 1ZBKA 1ZBCA 1JNDA 2RUCA 4P8VA 4JFKA 3CHFA 4Z2HA 1CTNA 4ML4A 3RFWA 4G2PA 1EHNA 2G8ZA 2XP8A 1E6ZA 3B9AA 1NWTA 4L3NA 4P8WA 3PR9A 4IPXA 2AWGA 1Q6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LAX A;  1HXV A;  1YAT A;  1L1P A;  1FKL A;  2XP6 A;  3ODK A;  4FN2 A;  5HUA A;  2L2S A;  2RSE A;  5J6E A;  1P5Q A;  1R9H A;  1YW5 A;  1D7J A;  2MPH A;  1Q6H A;  3JXV A;  1EQ3 A;  5BXJ A;  2PPP A;  4J4O A;  5HW7 A;  2MF9 A;  1F40 A;  4N19 A;  3O5I A;  3UQB A;  1JNT A;  4C02 B;  3IK8 A;  1BL4 A;  1FKR A;  4JFL A;  3O5G A;  1JVW A;  3KAH A;  2MNT A;  2PV2 A;  5HW6 A;  4NNR A;  3FAP A;  4TW6 A;  2ZQT A;  2KE0 A;  3O5O A;  1B6C A;  4DRM A;  2UZ5 A;  1C9H A;  4ODP A;  3UI6 A;  3O5L A;  2JZV A;  3O5P A;  4FAP A;  1PBK A;  2OFN A;  2RUR A;  3TDB A;  3TCZ A;  5I98 A;  2LJ4 A;  2K8I A;  2VCD A;  4JFJ A;  3B7X A;  2DG9 A;  1EYM A;  1ZCN A;  3WH0 A;  2XPB A;  3GPK A;  2ZQU A;  1U79 A;  5HKG A;  3O5D A;  1NMV A;  4TW7 A;  4MSP A;  3PRB A;  4LAY A;  4ODK A;  3TC5 A;  4LAW A;  4DH0 A;  1FKH A;  4QT3 A;  3PA7 A;  1FKG A;  1F8A B;  3UF8 A;  1ZK6 A;  4DZ2 A;  3CGM A;  5HWC A;  1KT1 A;  5HWB A;  2LPV A;  4JFM A;  1ROT A;  4QIB A;  2KI3 A;  2ZR6 A;  2Y78 A;  5GPG A;  3UI4 A;  4MGV A;  4DT4 A;  4ITZ A;  3JYM A;  3I6C A;  2F2D A;  2KFW A;  3NI6 A;  1ROU A;  3O5E A;  4IQC A;  2LGO A;  4DRN A;  2N87 A;  3IKD A;  3PRD A;  4ODO A;  4TX0 A;  5DIU A;  5HTG A;  3O5J A;  4O2T A;  1FKK A;  2Q5A A;  4GGQ A;  2DG4 A;  2XP7 A;  3O5F A;  2KGJ A;  3UI5 A;  1FD9 A;  4JYS A;  4U84 A;  1D7H A;  4DRQ A;  4IQ2 A;  5HT1 A;  4DRP A;  2F21 A;  3NRK A;  2ZR5 A;  4QT2 A;  1D6O A;  1Q1C A;  2ZQS A;  3EY6 A;  4R0X A;  4U86 A;  3KAF A;  3OOB A;  2PPO A;  3KZ7 A;  1NSG A;  3JYJ A;  3IHZ A;  3UQA A;  2DG3 A;  3H9R B;  1NMW A;  2VN1 A;  1PIN A;  2M08 A;  2M1I A;  3KAB A;  3KCE A;  2MLZ A;  2PPN A;  3UQI A;  4DRK A;  4W9P A;  4TYO A;  2ZR4 A;  2IF4 A;  2FKE A;  3VAW A;  2RQS A;  3KAG A;  4G50 A;  2ITK A;  1FKS A;  2MLX A;  4W9Q A;  2PV3 A;  3NTP A;  4ODL A;  1FKD A;  1KT0 A;  4ODN A;  1J4I A;  3MDY B;  2PV1 A;  2F4E A;  1BKF A;  2KR7 A;  3KAI A;  2M2A A;  1FAP A;  4ODQ A;  3O5R A;  2XP4 A;  1A7X A;  3IKG A;  3LUO A;  1M5Y A;  1FKI A;  1QZ2 A;  1FKT A;  1N1A A;  1TCO C;  3KAC A;  1QPF A;  4LAV A;  5HW8 A;  2PBC A;  3RGC A;  2ZQV A;  3O5K A;  1FKB A;  3CGN A;  1FKJ A;  4TNS A;  5D75 A;  4DRI A;  2FAP A;  1FJD A;  4U85 A;  1J6Y A;  2RUC A;  4JFI A;  1FKF A;  4ODR A;  4J4N A;  1W26 A;  4JFK A;  1JNS A;  1J4H A;  2KO7 A;  2XP5 A;  3RFW A;  4G2P A;  1D7I A;  5B8I C;  2XP9 A;  5DIV A;  4W9O A;  1Q6U A;  1QPL A;  2LKN A;  4DZ3 A;  4DRH A;  2XPA A;  3O5M A;  2XP8 A;  1Y0O A;  4DRJ A;  4GIV A;  2MLY A;  2D9F A;  3O5Q A;  4BF8 A;  4DRO A;  4DIP A;  4TW8 A;  2XP3 A;  4IPX A;  4ODM A;  1T11 A;  2RUD A;  2RUQ A;  2AWG A;  1Q6I A;  1J4R A;  3KAD A;  5DIT A; 
#chains in the Genus database with same CATH topology
 1HXV A;  1E44 A;  4Q22 A;  1YAT A;  1FKL A;  3ODK A;  1P5Q A;  1YW5 A;  1D7J A;  3JXV A;  1E9L A;  5BXJ A;  2O9O A;  5HW7 A;  1W1V A;  1LL6 A;  1JNT A;  1OGG A;  4JFL A;  1W1Y A;  2MNT A;  3ARS A;  2KE0 A;  3BXW A;  1B6C A;  3ARZ A;  1C9H A;  4FAP A;  2JZV A;  1PBK A;  2OFN A;  3TDB A;  2LJ4 A;  2K8I A;  2VCD A;  3B8S A;  2DG9 A;  2ZQU A;  1HKJ A;  1NWS A;  4QT3 A;  3EIP A;  1FKG A;  3UF8 A;  4DZ2 A;  1GOI A;  1KT1 A;  5HWB A;  4L72 B;  5GQB A;  5DF0 A;  2Y78 A;  4MGV A;  3WD4 A;  5DEZ A;  4DT4 A;  1H0I A;  2F2D A;  1W9U A;  3CZ8 A;  1ROU A;  1SR0 A;  2N87 A;  4P8U A;  5DIU A;  3FY1 A;  3O5J A;  1EIB A;  2Q5A A;  2XP7 A;  1W1P A;  3UI5 A;  1FD9 A;  4JYS A;  4MNL A;  1ITX A;  4IQ2 A;  5HT1 A;  1UR8 A;  4R0X A;  2ZQS A;  3EY6 A;  1LL4 A;  3GU0 A;  1HJW A;  1E6P A;  2IF4 A;  2YBT A;  3WD2 A;  3G6L A;  3ARU A;  4Q7N A;  2MLX A;  3NTP A;  4HBE A;  1NH6 A;  2F4E A;  2XP4 A;  3LUO A;  4MTV A;  2DPE A;  3KAC A;  2A3B A;  3ARP A;  2ZQV A;  3CHC A;  1RD6 A;  5D75 A;  3RM8 A;  4ODR A;  3ART A;  1JNS A;  2XP5 A;  5B8I C;  3ARO A;  2XP9 A;  1QPL A;  3WQW A;  2LKN A;  4DWS D;  3FXY A;  4DRH A;  4ZPW R;  1LG2 A;  2A3E A;  4DRJ A;  4GIV A;  4DRO A;  3ARQ A;  2EUL A;  2XP3 A;  4QZV B;  1T11 A;  1E15 A;  3ALF A;  1X6L A;  1J4R A;  3WL0 A;  5HKG A;  1D2K A;  2ETN A;  2XP6 A;  4S3J A;  4FN2 A;  5J6E A;  4UDM A;  1FFQ A;  1Q6H A;  1SYT A;  2DT2 A;  2PPP A;  4URI A;  2MF9 A;  4WIW A;  4C02 B;  3O5G A;  1JVW A;  2A3C A;  4NNR A;  4NZC A;  4TW6 A;  2ZQT A;  4DRM A;  3UI6 A;  3O5L A;  4KQZ A;  1ZL1 A;  2ESC A;  3B7X A;  1ZCN A;  1WAW A;  2WM0 A;  1U79 A;  1IX5 A;  3G6M A;  3TC5 A;  4LAW A;  1LQ0 A;  3PA7 A;  1ZK6 A;  1VF8 A;  2DSU A;  3AS2 A;  1H0G A;  1ROT A;  2KI3 A;  2ZR6 A;  1NWU A;  3ARV A;  4ITZ A;  3JYM A;  1LJY A;  1W9V A;  2KFW A;  3O5E A;  2QF8 A;  3CH9 A;  4O2T A;  2KGJ A;  4DWS A;  2F21 A;  1JNE A;  1D6O A;  4QT2 A;  4U86 A;  3OOB A;  2M1I A;  5HBF A;  3KCE A;  4R5E A;  4DRK A;  4WK9 A;  3AS0 A;  3KAG A;  3WL1 A;  2OLH A;  1W1T A;  4W9Q A;  4ODL A;  4ODN A;  4Z2K A;  3ALG A;  4ODQ A;  3O5R A;  3IKG A;  1FKT A;  2WLZ A;  4LGX A;  2PBC A;  3RGC A;  1EDQ A;  1HKK A;  4TNS A;  1FKJ A;  3W4R A;  1FJD A;  4JFI A;  4J4N A;  1WB0 A;  3ARW A;  2FDM A;  4W9O A;  1Q6U A;  1ZBW A;  3O5M A;  4MNM A;  2MLY A;  4BF8 A;  2B5U B;  4NSB A;  4WKF A;  1ZBV A;  1LL7 A;  4ODM A;  3WQV A;  2RUD A;  3B9D A;  1M5Y A;  3KAD A;  2A3A A;  5DIT A;  1HJX A;  3WD0 A;  1GUV A;  1KFW A;  2L2S A;  2RSE A;  3RME A;  2MPH A;  3CHD A;  2AOS A;  4Z2J A;  1EQ3 A;  1OWQ A;  1WNO A;  1F40 A;  4N19 A;  3O5I A;  3UQB A;  4ZPV R;  1W9P A;  4MNK A;  4S3K A;  5JH8 A;  4DWS B;  3O5O A;  2UZ5 A;  4ODP A;  2RUR A;  3PRA A;  4XAK A;  5I98 A;  1EYM A;  2XPB A;  3GPK A;  4TW7 A;  1GPF A;  1HKI A;  1E6R A;  4LAY A;  4MSP A;  4ODK A;  4DH0 A;  4IT6 A;  1NWR A;  5HWC A;  2LPV A;  4JFM A;  4HAR A;  4QIB A;  3WD3 A;  3ARR A;  3AS1 A;  3UI4 A;  3B9E A;  3ARY A;  2LGO A;  4DRN A;  3IKD A;  5HTG A;  4AY1 A;  4TX0 A;  2B31 A;  4MAV A;  4Z2L A;  2DG4 A;  1O6I A;  3O5F A;  4U84 A;  1ZU8 A;  4DRQ A;  4Z2I A;  2DSZ A;  3NRK A;  1FFR A;  2PPO A;  5DO2 A;  3BMB A;  2M08 A;  3KAB A;  2MLZ A;  3UQI A;  4W9P A;  4TYO A;  2ZR4 A;  2FKE A;  4WKA A;  2ITK A;  1FKS A;  4KR0 B;  2YBU A;  1GRJ A;  1KT0 A;  3MDY B;  2PV1 A;  3KAI A;  1K9T A;  2PN0 A;  1FKI A;  1TCO C;  3O5K A;  3CGN A;  4DRI A;  3QOK A;  4IT4 A;  4U85 A;  1J6Y A;  3RM9 A;  1FKF A;  1W26 A;  1J4H A;  2KO7 A;  1D7I A;  5DIV A;  4DZ3 A;  3WKZ A;  2XPA A;  1Y0O A;  2D9F A;  3O5Q A;  4DIP A;  4TW8 A;  2DSV A;  2RUQ A;  4LAX A;  4W5U A;  1L1P A;  5HUA A;  5GPR A;  1R9H A;  3ARX A;  3GTY X;  1TFV A;  4Z2G A;  1HKM A;  4J4O A;  1LG1 A;  3IK8 A;  1BL4 A;  1FKR A;  3KAH A;  2PV2 A;  5HW6 A;  3FAP A;  3O5P A;  3WD1 A;  3TCZ A;  3AS3 A;  4JFJ A;  4ZS6 A;  3WH0 A;  3O5D A;  1NMV A;  3PRB A;  1FKH A;  2G41 A;  1XRV A;  1F8A B;  3CGM A;  4HBO A;  1UR9 A;  3OA5 A;  1E6N A;  5GPG A;  3I6C A;  1JCH B;  1HJV A;  1XHG A;  3NI6 A;  4IQC A;  4P8X A;  3PRD A;  4ODO A;  2WK2 A;  4DWS C;  1ZB5 A;  3WIJ A;  2O92 A;  1FKK A;  4GGQ A;  3RM4 A;  2IUZ A;  2PI6 A;  1D7H A;  4MPK A;  4DRP A;  2ZR5 A;  4WJX A;  1Q1C A;  3KAF A;  3CHE A;  3KZ7 A;  1NSG A;  3JYJ A;  3IHZ A;  3UQA A;  2DG3 A;  3H9R B;  2P4V A;  1NMW A;  3AQU A;  2VN1 A;  1PIN A;  2DT0 A;  2DT1 A;  2PPN A;  4ZPT R;  1X6N A;  3VAW A;  2F23 A;  2RQS A;  4G50 A;  1OGB A;  2DSW A;  2PV3 A;  4MNJ A;  1FKD A;  1J4I A;  1BKF A;  2KR7 A;  2M2A A;  1FAP A;  4PTM A;  1A7X A;  2WLY A;  1QZ2 A;  2DT3 A;  1N1A A;  1QPF A;  4LAV A;  5HW8 A;  1FKB A;  4WKH A;  2FAP A;  1ZBK A;  1ZBC A;  1JND A;  2RUC A;  4P8V A;  4JFK A;  3CHF A;  4Z2H A;  1CTN A;  4ML4 A;  3RFW A;  4G2P A;  1EHN A;  2G8Z A;  2XP8 A;  1E6Z A;  3B9A A;  1NWT A;  4L3N A;  4P8W A;  3PR9 A;  4IPX A;  2AWG A;  1Q6I A; 
#chains in the Genus database with same CATH homology
 1HXV A;  4Q22 A;  1YAT A;  1FKL A;  3ODK A;  1P5Q A;  1YW5 A;  1D7J A;  3JXV A;  1E9L A;  5BXJ A;  2O9O A;  5HW7 A;  1W1V A;  1LL6 A;  1JNT A;  1OGG A;  4JFL A;  1W1Y A;  2MNT A;  3ARS A;  2KE0 A;  3BXW A;  1B6C A;  3ARZ A;  1C9H A;  4FAP A;  2JZV A;  1PBK A;  2OFN A;  3TDB A;  2LJ4 A;  2K8I A;  2VCD A;  3B8S A;  2DG9 A;  2ZQU A;  1HKJ A;  1NWS A;  4QT3 A;  1FKG A;  3UF8 A;  4DZ2 A;  1GOI A;  1KT1 A;  5HWB A;  4L72 B;  5GQB A;  5DF0 A;  2Y78 A;  4MGV A;  3WD4 A;  5DEZ A;  4DT4 A;  1H0I A;  2F2D A;  1W9U A;  3CZ8 A;  1ROU A;  1SR0 A;  2N87 A;  4P8U A;  5DIU A;  3FY1 A;  3O5J A;  1EIB A;  2Q5A A;  2XP7 A;  1W1P A;  3UI5 A;  1FD9 A;  4JYS A;  4MNL A;  1ITX A;  4IQ2 A;  5HT1 A;  1UR8 A;  4R0X A;  2ZQS A;  3EY6 A;  1LL4 A;  1HJW A;  1E6P A;  2IF4 A;  2YBT A;  3WD2 A;  3G6L A;  3ARU A;  4Q7N A;  2MLX A;  3NTP A;  4HBE A;  1NH6 A;  2F4E A;  2XP4 A;  3LUO A;  4MTV A;  2DPE A;  3KAC A;  2A3B A;  3ARP A;  2ZQV A;  3CHC A;  1RD6 A;  5D75 A;  3RM8 A;  4ODR A;  3ART A;  1JNS A;  2XP5 A;  5B8I C;  3ARO A;  2XP9 A;  1QPL A;  3WQW A;  2LKN A;  4DWS D;  3FXY A;  4DRH A;  4ZPW R;  1LG2 A;  2A3E A;  4DRJ A;  4GIV A;  4DRO A;  3ARQ A;  2XP3 A;  4QZV B;  1T11 A;  1E15 A;  3ALF A;  1X6L A;  1J4R A;  3WL0 A;  5HKG A;  1D2K A;  2XP6 A;  4S3J A;  4FN2 A;  5J6E A;  1FFQ A;  1Q6H A;  1SYT A;  2DT2 A;  2PPP A;  4URI A;  2MF9 A;  4WIW A;  4C02 B;  3O5G A;  1JVW A;  2A3C A;  4NNR A;  4NZC A;  4TW6 A;  2ZQT A;  4DRM A;  3UI6 A;  3O5L A;  4KQZ A;  1ZL1 A;  2ESC A;  3B7X A;  1ZCN A;  1WAW A;  2WM0 A;  1U79 A;  1IX5 A;  3G6M A;  3TC5 A;  4LAW A;  1LQ0 A;  3PA7 A;  1ZK6 A;  1VF8 A;  2DSU A;  3AS2 A;  1H0G A;  1ROT A;  2KI3 A;  2ZR6 A;  1NWU A;  3ARV A;  4ITZ A;  3JYM A;  1LJY A;  1W9V A;  2KFW A;  3O5E A;  2QF8 A;  3CH9 A;  4O2T A;  2KGJ A;  4DWS A;  2F21 A;  1JNE A;  1D6O A;  4QT2 A;  4U86 A;  3OOB A;  2M1I A;  5HBF A;  3KCE A;  4R5E A;  4DRK A;  4WK9 A;  3AS0 A;  3KAG A;  3WL1 A;  2OLH A;  1W1T A;  4W9Q A;  4ODL A;  4ODN A;  4Z2K A;  3ALG A;  4ODQ A;  3O5R A;  3IKG A;  1FKT A;  2WLZ A;  4LGX A;  2PBC A;  3RGC A;  1EDQ A;  1HKK A;  4TNS A;  1FKJ A;  3W4R A;  1FJD A;  4JFI A;  4J4N A;  1WB0 A;  3ARW A;  2FDM A;  4W9O A;  1Q6U A;  1ZBW A;  3O5M A;  4MNM A;  2MLY A;  4BF8 A;  4NSB A;  4WKF A;  1ZBV A;  1LL7 A;  4ODM A;  3WQV A;  2RUD A;  3B9D A;  1M5Y A;  3KAD A;  2A3A A;  5DIT A;  1HJX A;  3WD0 A;  1GUV A;  1KFW A;  2L2S A;  2RSE A;  3RME A;  2MPH A;  3CHD A;  2AOS A;  4Z2J A;  1EQ3 A;  1OWQ A;  1WNO A;  1F40 A;  4N19 A;  3O5I A;  3UQB A;  4ZPV R;  1W9P A;  4MNK A;  4S3K A;  5JH8 A;  4DWS B;  3O5O A;  2UZ5 A;  4ODP A;  2RUR A;  3PRA A;  4XAK A;  5I98 A;  1EYM A;  2XPB A;  3GPK A;  4TW7 A;  1GPF A;  1HKI A;  1E6R A;  4LAY A;  4MSP A;  4ODK A;  4DH0 A;  4IT6 A;  1NWR A;  5HWC A;  2LPV A;  4JFM A;  4HAR A;  4QIB A;  3WD3 A;  3ARR A;  3AS1 A;  3UI4 A;  3B9E A;  3ARY A;  2LGO A;  4DRN A;  3IKD A;  5HTG A;  4AY1 A;  4TX0 A;  2B31 A;  4MAV A;  4Z2L A;  2DG4 A;  1O6I A;  3O5F A;  4U84 A;  1ZU8 A;  4DRQ A;  4Z2I A;  2DSZ A;  3NRK A;  1FFR A;  2PPO A;  5DO2 A;  2M08 A;  3KAB A;  2MLZ A;  3UQI A;  4W9P A;  4TYO A;  2ZR4 A;  2FKE A;  4WKA A;  2ITK A;  1FKS A;  4KR0 B;  2YBU A;  1KT0 A;  3MDY B;  2PV1 A;  3KAI A;  1K9T A;  1FKI A;  1TCO C;  3O5K A;  3CGN A;  4DRI A;  3QOK A;  4IT4 A;  4U85 A;  1J6Y A;  3RM9 A;  1FKF A;  1W26 A;  1J4H A;  2KO7 A;  1D7I A;  5DIV A;  4DZ3 A;  3WKZ A;  2XPA A;  1Y0O A;  2D9F A;  3O5Q A;  4DIP A;  4TW8 A;  2DSV A;  2RUQ A;  4LAX A;  4W5U A;  1L1P A;  5HUA A;  5GPR A;  1R9H A;  3ARX A;  1TFV A;  4Z2G A;  1HKM A;  4J4O A;  1LG1 A;  3IK8 A;  1BL4 A;  1FKR A;  3KAH A;  2PV2 A;  5HW6 A;  3FAP A;  3O5P A;  3WD1 A;  3TCZ A;  3AS3 A;  4JFJ A;  4ZS6 A;  3WH0 A;  3O5D A;  1NMV A;  3PRB A;  1FKH A;  2G41 A;  1XRV A;  1F8A B;  3CGM A;  4HBO A;  1UR9 A;  3OA5 A;  1E6N A;  5GPG A;  3I6C A;  1HJV A;  1XHG A;  3NI6 A;  4IQC A;  4P8X A;  3PRD A;  4ODO A;  2WK2 A;  4DWS C;  1ZB5 A;  3WIJ A;  2O92 A;  1FKK A;  4GGQ A;  3RM4 A;  2IUZ A;  2PI6 A;  1D7H A;  4MPK A;  4DRP A;  2ZR5 A;  4WJX A;  1Q1C A;  3KAF A;  3CHE A;  3KZ7 A;  1NSG A;  3JYJ A;  3IHZ A;  3UQA A;  2DG3 A;  3H9R B;  1NMW A;  3AQU A;  2VN1 A;  1PIN A;  2DT0 A;  2DT1 A;  2PPN A;  4ZPT R;  1X6N A;  3VAW A;  2RQS A;  4G50 A;  1OGB A;  2DSW A;  2PV3 A;  4MNJ A;  1FKD A;  1J4I A;  1BKF A;  2KR7 A;  2M2A A;  1FAP A;  4PTM A;  1A7X A;  2WLY A;  1QZ2 A;  2DT3 A;  1N1A A;  1QPF A;  4LAV A;  5HW8 A;  1FKB A;  4WKH A;  2FAP A;  1ZBK A;  1ZBC A;  1JND A;  2RUC A;  4P8V A;  4JFK A;  3CHF A;  4Z2H A;  1CTN A;  4ML4 A;  3RFW A;  4G2P A;  1EHN A;  2G8Z A;  2XP8 A;  1E6Z A;  3B9A A;  1NWT A;  4L3N A;  4P8W A;  3PR9 A;  4IPX A;  2AWG A;  1Q6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...