3JYJA

Structure-based design of novel pin1 inhibitors (ii)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
113
structure length
113
Chain Sequence
EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-based design of novel human Pin1 inhibitors (II).
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3jyjA00
1F40A 1N1AA 1FKHA 3JYMA 4N19A 1ZCNA 4QT2A 1A7XA 4U85A 4W9PA 2FAPA 4TYOA 1EQ3A 4LAXA 3CGMA 1FKDA 3IK8A 3O5PA 4FN2A 4JFJA 4JFLA 4DT4A 1FKLA 2KGJA 2Y78A 2ZQUA 2XP9A 3KAIA 2XPAA 2JZVA 4JYSA 3TC5A 4DRPA 3JYJA 5HTGA 1NSGA 4ODKA 3O5DA 2VCDA 1FJDA 4C02B 4DRIA 5HW6A 5HW8A 1PINA 1FKJA 3RGCA 3IHZA 4DRJA 4DIPA 4O2TA 1HXVA 4DRKA 3RFWA 5I98A 1QPLA 2F2DA 4LAVA 3KADA 3O5MA 3UI6A 5BXJA 1D7HA 2D9FA 1M5YA 2F21A 4ODLA 1KT0A 1Y0OA 3IKDA 1FKBA 1KT1A 1FKKA 3KACA 4TW7A 5DIUA 1Q6HA 3NTPA 4J4NA 2XP3A 5HWCA 2IF4A 3GPKA 1Q1CA 2XPBA 1NMWA 4ODMA 4DRHA 1FKGA 2F4EA 5HWBA 4DROA 2AWGA 1J4HA 2KI3A 4G2PA 5B8IC 2RUDA 3NI6A 4ODPA 2KFWA 4DZ2A 2L2SA 3KABA 2LGOA 4TNSA 2RUQA 1FD9A 2MLXA 2XP7A 4LAWA 4DRQA 1FKRA 1FKTA 1YW5A 1J4RA 1BKFA 2MPHA 2ZQVA 4IQCA 4MGVA 2LKNA 1J4IA 3LUOA 3PRBA 2M08A 3JXVA 3O5KA 3TDBA 2RUCA 4TW6A 3O5FA 4IQ2A 3NRKA 1W26A 3O5QA 2PV2A 2FKEA 2ZQSA 4QT3A 4JFKA 4QIBA 5DITA 2PPOA 2VN1A 4ODQA 3UQIA 4J4OA 2LJ4A 2PPNA 2RURA 1FKIA 2XP8A 4JFMA 2Q5AA 4IPXA 4W9QA 5D75A 3EY6A 3VAWA 2DG9A 3O5LA 4LAYA 1J6YA 3KAGA 1C9HA 2LPVA 2KE0A 2M2AA 2PV3A 1QPFA 2MLYA 3WH0A 3UI4A 3UQBA 1Q6UA 4R0XA 2K8IA 2OFNA 1JNSA 1F8AB 3KCEA 3I6CA 5J6EA 3UQAA 2UZ5A 5DIVA 4DH0A 1Q6IA 1FKSA 1P5QA 4U84A 3O5GA 4TW8A 4DRNA 3O5IA 2DG4A 1PBKA 2RQSA 2ZQTA 2PPPA 4NNRA 1ZK6A 4ODNA 4ODOA 3ODKA 3PA7A 2MNTA 4ODRA 2PBCA 4GGQA 1D7IA 2DG3A 4DRMA 1R9HA 3IKGA 5HUAA 1BL4A 2XP5A 5HKGA 4FAPA 1ROUA 2XP6A 4G50A 3FAPA 1JVWA 3KZ7A 3O5EA 4ITZA 1D7JA 3UF8A 1NMVA 3B7XA 1D6OA 4DZ3A 2MF9A 1ROTA 4TX0A 3UI5A 3MDYB 5GPGA 1FKFA 2M1IA 2RSEA 5HW7A 3OOBA 2ZR4A 4JFIA 2PV1A 3KAHA 3O5RA 3KAFA 2N87A 3H9RB 1YATA 1B6CA 2ITKA 2ZR6A 1QZ2A 1T11A 1U79A 4BF8A 4U86A 1EYMA 4GIVA 3O5OA 1FAPA 1TCOC 2KO7A 2XP4A 4W9OA 1L1PA 2KR7A 5HT1A 3CGNA 2ZR5A 2MLZA 1JNTA 3PRDA 4MSPA 3TCZA 3O5JA
chains in the Genus database with same CATH superfamily
1FKHA 4MTVA 1NWSA 1LJYA 4TYOA 1EQ3A 1E9LA 3RM4A 2XP9A 4WKFA 1WAWA 4L72B 3OA5A 2FDMA 4DIPA 4S3JA 1HXVA 3ARPA 5BXJA 3WL0A 3ALFA 1GPFA 1M5YA 1E6NA 3WKZA 4ZS6A 1O6IA 1NMWA 1H0GA 2KI3A 2L2SA 4TNSA 2RUQA 2XP7A 1GUVA 4DWSD 1LL4A 2ZQVA 1J4RA 4IQCA 4MGVA 3LUOA 2O9OA 3B9AA 4TW6A 1JNDA 4IQ2A 3NRKA 5DITA 1HKKA 4J4OA 2LJ4A 4W9QA 4ZPTR 1J6YA 1C9HA 2M2AA 2KE0A 2MLYA 1VF8A 1GOIA 4WK9A 1JNSA 4URIA 3UQAA 2UZ5A 5DIVA 3O5GA 4DRNA 4PTMA 3RGCA 1JCHB 1ITXA 2PPPA 2RQSA 4ODOA 2QF8A 2DG3A 3PR9A 1R9HA 2DSZA 3IKGA 2XP5A 1UR9A 1OWQA 2YBUA 3FAPA 1W1VA 1D7JA 3B7XA 1JNEA 5GPRA 1E44A 4TX0A 3UI5A 4MNJA 4KQZA 2P4VA 5HW7A 2ZR4A 2PV1A 3KAHA 2WLYA 1YATA 1B6CA 2ITKA 2ZR6A 1QZ2A 1OGGA 4GIVA 2XP4A 4MSPA 1JNTA 4DT4A 4DROA 5HUAA 3ARQA 3O5JA 1E6ZA 4N19A 1SYTA 1W9VA 1ZCNA 4QT2A 2ESCA 4W9PA 4KR0B 3RM9A 4DRPA 2XPAA 3JYJA 4ODKA 1FJDA 3O5DA 3WD4A 4DRIA 5HW6A 3AS0A 4WKHA 5HBFA 1EIBA 4HBEA 2DPEA 2F2DA 4MPKA 5DO2A 1D7HA 5DEZA 1ZBWA 2F21A 1Y0OA 1X6NA 3GTYX 1KT1A 1KFWA 1RD6A 3KACA 5DF0A 5HWCA 3GPKA 1Q1CA 2WK2A 3G6MA 1FKGA 5HWBA 2DT0A 4G2PA 4ODPA 2IUZA 2KFWA 3BMBA 4Z2HA 1CTNA 4WIWA 4DRQA 2MLXA 4LAWA 2LKNA 3PRBA 3O5KA 3ALGA 3O5FA 2ZQSA 2DSVA 2PPOA 1EHNA 2PPNA 4Z2GA 1FKIA 2Q5AA 4L3NA 3EY6A 2DG9A 3O5LA 4LAYA 1TFVA 1QPFA 3UI4A 4WJXA 2K8IA 3KCEA 5J6EA 1Q6IA 1FKSA 3O5IA 2DG4A 1ZK6A 5JH8A 4MAVA 3PA7A 4ODRA 3ARTA 1D7IA 3ARVA 4XAKA 2A3BA 5HKGA 2XP6A 3KZ7A 4UDMA 4ML4A 1D6OA 4NZCA 4Z2KA 3MDYB 3OOBA 1UR8A 3O5RA 4HARA 1U79A 1LL6A 3ARZA 3B9DA 4Q22A 3CHDA 3O5OA 1FAPA 1LQ0A 3ARRA 4W9OA 1L1PA 5HT1A 2AOSA 3WL1A 1F40A 1N1AA 2EULA 4Z2IA 1A7XA 4U85A 2F23A 4LAXA 1NH6A 1W1PA 1FKDA 3IK8A 4FN2A 4JFJA 4JFLA 4DWSB 2Y78A 2ZQUA 2A3CA 3KAIA 3TC5A 2JZVA 3AROA 4C02B 3CZ8A 1PINA 3AS1A 3IHZA 5I98A 1QPLA 4LAVA 3KADA 1E6PA 3O5MA 3UI6A 4P8UA 2ETNA 4P8VA 1H0IA 1IX5A 1FKBA 1FKKA 1LL7A 2B5UB 4TW7A 3NTPA 4P8WA 4DRHA 1W9PA 3ARYA 2F4EA 3B9EA 3EIPA 2AWGA 1J4HA 3W4RA 4DZ2A 3KABA 2LGOA 1FD9A 3QOKA 1FKRA 1FKTA 1YW5A 3ARSA 1BKFA 2MPHA 1GRJA 2M08A 3JXVA 3TDBA 2RUCA 3O5QA 3CHEA 2FKEA 4JFKA 1ZB5A 2XP8A 4JFMA 4MNLA 4IPXA 1EDQA 3ARUA 3WH0A 3UQBA 2DSUA 3B8SA 3CH9A 3WD1A 4DH0A 4U84A 4TW8A 2DSWA 3CHFA 2DT3A 4ODNA 1WB0A 3ODKA 2MNTA 2DT2A 1W1TA 2PN0A 4Q7NA 3ARXA 4G50A 3O5EA 4NSBA 3UF8A 1NMVA 1HJVA 3FXYA 4IT4A 2OLHA 3WQWA 4AY1A 4DWSA 2M1IA 2RSEA 3KAFA 1E6RA 2N87A 3PRAA 2PI6A 4BF8A 1T11A 1OGBA 4Z2JA 2KR7A 4MNKA 4QZVB 2DT1A 2ZR5A 3PRDA 3TCZA 3FY1A 1WNOA 4DWSC 3JYMA 1FFQA 1HKMA 2FAPA 3CGMA 3O5PA 2O92A 1FKLA 2A3EA 2KGJA 4JYSA 1ZBCA 5HTGA 1NSGA 2VCDA 1NWTA 5HW8A 1FKJA 2A3AA 4DRJA 1ZBVA 4DRKA 3RFWA 2B31A 2WM0A 4ZPVR 2D9FA 4ODLA 1HJXA 1KT0A 3IKDA 5DIUA 4MNMA 1Q6HA 4J4NA 2XP3A 3CHCA 2IF4A 2XPBA 4ODMA 1HKJA 3ARWA 3BXWA 5B8IC 2RUDA 3NI6A 1LG1A 2WLZA 3RM8A 1J4IA 1HKIA 1NWUA 2YBTA 1W26A 3AS3A 2PV2A 4QT3A 4QIBA 2VN1A 4ODQA 1W1YA 3UQIA 2RURA 1LG2A 1ZBKA 5D75A 3WD2A 3AS2A 3VAWA 1NWRA 3KAGA 2G41A 3WIJA 2LPVA 2PV3A 3WD0A 1W9UA 4WKAA 4ZPWR 1Q6UA 4HBOA 4R0XA 1XRVA 4S3KA 5GQBA 2OFNA 1F8AB 4R5EA 3I6CA 1XHGA 4Z2LA 1K9TA 1P5QA 3WQVA 2ZQTA 1PBKA 4NNRA 1SR0A 1FFRA 3AQUA 2G8ZA 2PBCA 4GGQA 4DRMA 1BL4A 3WD3A 4FAPA 1ROUA 3RMEA 1JVWA 1ZL1A 4ITZA 4LGXA 4DZ3A 2MF9A 4IT6A 1HJWA 1ZU8A 1ROTA 1D2KA 5GPGA 1E15A 1FKFA 4JFIA 1X6LA 3H9RB 4W5UA 4P8XA 4U86A 1EYMA 3GU0A 1TCOC 2KO7A 3G6LA 3CGNA 2MLZA 4O2TA
chains in the Genus database with same CATH topology
1FKHA 4MTVA 1NWSA 1LJYA 4TYOA 1EQ3A 1E9LA 3RM4A 2XP9A 4WKFA 1WAWA 4L72B 3OA5A 2FDMA 4DIPA 4S3JA 1HXVA 3ARPA 5BXJA 3WL0A 3ALFA 1GPFA 1M5YA 1E6NA 3WKZA 4ZS6A 1O6IA 1NMWA 1H0GA 2KI3A 2L2SA 4TNSA 2RUQA 2XP7A 1GUVA 4DWSD 1LL4A 2ZQVA 1J4RA 4IQCA 4MGVA 3LUOA 2O9OA 3B9AA 4TW6A 1JNDA 4IQ2A 3NRKA 5DITA 1HKKA 4J4OA 2LJ4A 4W9QA 4ZPTR 1J6YA 1C9HA 2M2AA 2KE0A 2MLYA 1VF8A 1GOIA 4WK9A 1JNSA 4URIA 3UQAA 2UZ5A 5DIVA 3O5GA 4DRNA 4PTMA 3RGCA 1ITXA 2RQSA 2PPPA 4ODOA 2QF8A 2DG3A 3PR9A 1R9HA 2DSZA 3IKGA 2XP5A 1UR9A 1OWQA 2YBUA 3FAPA 1W1VA 1D7JA 3B7XA 1JNEA 5GPRA 4TX0A 3UI5A 4MNJA 4KQZA 5HW7A 2ZR4A 2PV1A 3KAHA 2WLYA 1YATA 1B6CA 2ITKA 2ZR6A 1QZ2A 1OGGA 4GIVA 2XP4A 4MSPA 1JNTA 4DT4A 4DROA 5HUAA 3ARQA 3O5JA 1E6ZA 4N19A 1SYTA 1W9VA 1ZCNA 4QT2A 2ESCA 4W9PA 4KR0B 3RM9A 4DRPA 2XPAA 3JYJA 4ODKA 1FJDA 3O5DA 3WD4A 4DRIA 5HW6A 3AS0A 4WKHA 5HBFA 1EIBA 4HBEA 2DPEA 2F2DA 4MPKA 5DO2A 1D7HA 5DEZA 1ZBWA 2F21A 1Y0OA 1X6NA 1KT1A 1KFWA 1RD6A 3KACA 5DF0A 5HWCA 3GPKA 1Q1CA 2WK2A 3G6MA 1FKGA 5HWBA 2DT0A 4G2PA 4ODPA 2IUZA 2KFWA 4Z2HA 1CTNA 4WIWA 4DRQA 2MLXA 4LAWA 2LKNA 3PRBA 3O5KA 3ALGA 3O5FA 2ZQSA 2DSVA 2PPOA 1EHNA 2PPNA 4Z2GA 1FKIA 2Q5AA 4L3NA 3EY6A 2DG9A 3O5LA 4LAYA 1TFVA 1QPFA 3UI4A 4WJXA 2K8IA 3KCEA 5J6EA 1Q6IA 1FKSA 3O5IA 2DG4A 1ZK6A 5JH8A 4MAVA 3PA7A 4ODRA 3ARTA 1D7IA 3ARVA 4XAKA 2A3BA 5HKGA 2XP6A 3KZ7A 4ML4A 1D6OA 4NZCA 4Z2KA 3MDYB 3OOBA 1UR8A 3O5RA 4HARA 1U79A 1LL6A 3ARZA 3B9DA 4Q22A 3CHDA 3O5OA 1FAPA 1LQ0A 3ARRA 4W9OA 1L1PA 5HT1A 2AOSA 3WL1A 1F40A 1N1AA 4Z2IA 1A7XA 4U85A 4LAXA 1NH6A 1W1PA 1FKDA 3IK8A 4FN2A 4JFJA 4JFLA 4DWSB 2Y78A 2ZQUA 2A3CA 3KAIA 3TC5A 2JZVA 3AROA 4C02B 3CZ8A 1PINA 3AS1A 3IHZA 5I98A 1QPLA 4LAVA 3KADA 1E6PA 3O5MA 3UI6A 4P8UA 4P8VA 1H0IA 1IX5A 1FKBA 1FKKA 1LL7A 4TW7A 3NTPA 4P8WA 4DRHA 1W9PA 3ARYA 2F4EA 3B9EA 2AWGA 1J4HA 3W4RA 4DZ2A 3KABA 2LGOA 1FD9A 3QOKA 1FKRA 1FKTA 1YW5A 3ARSA 1BKFA 2MPHA 2M08A 3JXVA 3TDBA 2RUCA 3O5QA 3CHEA 2FKEA 4JFKA 1ZB5A 2XP8A 4JFMA 4MNLA 4IPXA 1EDQA 3ARUA 3WH0A 3UQBA 2DSUA 3B8SA 3CH9A 3WD1A 4DH0A 4U84A 4TW8A 2DSWA 3CHFA 2DT3A 4ODNA 1WB0A 3ODKA 2MNTA 2DT2A 1W1TA 4Q7NA 3ARXA 4G50A 3O5EA 4NSBA 3UF8A 1NMVA 1HJVA 3FXYA 4IT4A 2OLHA 3WQWA 4AY1A 4DWSA 2M1IA 2RSEA 3KAFA 1E6RA 2N87A 3PRAA 2PI6A 4BF8A 1T11A 1OGBA 4Z2JA 2KR7A 4MNKA 4QZVB 2DT1A 2ZR5A 3PRDA 3TCZA 3FY1A 1WNOA 4DWSC 3JYMA 1FFQA 1HKMA 2FAPA 3CGMA 3O5PA 2O92A 1FKLA 2A3EA 2KGJA 4JYSA 1ZBCA 5HTGA 1NSGA 2VCDA 1NWTA 5HW8A 1FKJA 2A3AA 4DRJA 1ZBVA 4DRKA 3RFWA 2B31A 2WM0A 4ZPVR 2D9FA 4ODLA 1HJXA 1KT0A 3IKDA 5DIUA 4MNMA 1Q6HA 4J4NA 2XP3A 3CHCA 2IF4A 2XPBA 4ODMA 1HKJA 3ARWA 3BXWA 5B8IC 2RUDA 3NI6A 1LG1A 2WLZA 3RM8A 1J4IA 1HKIA 1NWUA 2YBTA 1W26A 3AS3A 2PV2A 4QT3A 4QIBA 2VN1A 4ODQA 1W1YA 3UQIA 2RURA 1LG2A 1ZBKA 5D75A 3WD2A 3AS2A 3VAWA 1NWRA 3KAGA 2G41A 3WIJA 2LPVA 2PV3A 3WD0A 1W9UA 4WKAA 4ZPWR 1Q6UA 4HBOA 4R0XA 1XRVA 4S3KA 5GQBA 2OFNA 1F8AB 4R5EA 3I6CA 1XHGA 4Z2LA 1K9TA 1P5QA 3WQVA 2ZQTA 1PBKA 4NNRA 1SR0A 1FFRA 3AQUA 2G8ZA 2PBCA 4GGQA 4DRMA 1BL4A 3WD3A 4FAPA 1ROUA 3RMEA 1JVWA 1ZL1A 4ITZA 4LGXA 4DZ3A 2MF9A 4IT6A 1HJWA 1ZU8A 1ROTA 1D2KA 5GPGA 1E15A 1FKFA 4JFIA 1X6LA 3H9RB 4W5UA 4P8XA 4U86A 1EYMA 1TCOC 2KO7A 3G6LA 3CGNA 2MLZA 4O2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F40 A;  1N1A A;  1FKH A;  3JYM A;  4N19 A;  1ZCN A;  4QT2 A;  1A7X A;  4U85 A;  4W9P A;  2FAP A;  4TYO A;  1EQ3 A;  4LAX A;  3CGM A;  1FKD A;  3IK8 A;  3O5P A;  4FN2 A;  4JFJ A;  4JFL A;  4DT4 A;  1FKL A;  2KGJ A;  2Y78 A;  2ZQU A;  2XP9 A;  3KAI A;  2XPA A;  2JZV A;  4JYS A;  3TC5 A;  4DRP A;  3JYJ A;  5HTG A;  1NSG A;  4ODK A;  3O5D A;  2VCD A;  1FJD A;  4C02 B;  4DRI A;  5HW6 A;  5HW8 A;  1PIN A;  1FKJ A;  3RGC A;  3IHZ A;  4DRJ A;  4DIP A;  4O2T A;  1HXV A;  4DRK A;  3RFW A;  5I98 A;  1QPL A;  2F2D A;  4LAV A;  3KAD A;  3O5M A;  3UI6 A;  5BXJ A;  1D7H A;  2D9F A;  1M5Y A;  2F21 A;  4ODL A;  1KT0 A;  1Y0O A;  3IKD A;  1FKB A;  1KT1 A;  1FKK A;  3KAC A;  4TW7 A;  5DIU A;  1Q6H A;  3NTP A;  4J4N A;  2XP3 A;  5HWC A;  2IF4 A;  3GPK A;  1Q1C A;  2XPB A;  1NMW A;  4ODM A;  4DRH A;  1FKG A;  2F4E A;  5HWB A;  4DRO A;  2AWG A;  1J4H A;  2KI3 A;  4G2P A;  5B8I C;  2RUD A;  3NI6 A;  4ODP A;  2KFW A;  4DZ2 A;  2L2S A;  3KAB A;  2LGO A;  4TNS A;  2RUQ A;  1FD9 A;  2MLX A;  2XP7 A;  4LAW A;  4DRQ A;  1FKR A;  1FKT A;  1YW5 A;  1J4R A;  1BKF A;  2MPH A;  2ZQV A;  4IQC A;  4MGV A;  2LKN A;  1J4I A;  3LUO A;  3PRB A;  2M08 A;  3JXV A;  3O5K A;  3TDB A;  2RUC A;  4TW6 A;  3O5F A;  4IQ2 A;  3NRK A;  1W26 A;  3O5Q A;  2PV2 A;  2FKE A;  2ZQS A;  4QT3 A;  4JFK A;  4QIB A;  5DIT A;  2PPO A;  2VN1 A;  4ODQ A;  3UQI A;  4J4O A;  2LJ4 A;  2PPN A;  2RUR A;  1FKI A;  2XP8 A;  4JFM A;  2Q5A A;  4IPX A;  4W9Q A;  5D75 A;  3EY6 A;  3VAW A;  2DG9 A;  3O5L A;  4LAY A;  1J6Y A;  3KAG A;  1C9H A;  2LPV A;  2KE0 A;  2M2A A;  2PV3 A;  1QPF A;  2MLY A;  3WH0 A;  3UI4 A;  3UQB A;  1Q6U A;  4R0X A;  2K8I A;  2OFN A;  1JNS A;  1F8A B;  3KCE A;  3I6C A;  5J6E A;  3UQA A;  2UZ5 A;  5DIV A;  4DH0 A;  1Q6I A;  1FKS A;  1P5Q A;  4U84 A;  3O5G A;  4TW8 A;  4DRN A;  3O5I A;  2DG4 A;  1PBK A;  2RQS A;  2ZQT A;  2PPP A;  4NNR A;  1ZK6 A;  4ODN A;  4ODO A;  3ODK A;  3PA7 A;  2MNT A;  4ODR A;  2PBC A;  4GGQ A;  1D7I A;  2DG3 A;  4DRM A;  1R9H A;  3IKG A;  5HUA A;  1BL4 A;  2XP5 A;  5HKG A;  4FAP A;  1ROU A;  2XP6 A;  4G50 A;  3FAP A;  1JVW A;  3KZ7 A;  3O5E A;  4ITZ A;  1D7J A;  3UF8 A;  1NMV A;  3B7X A;  1D6O A;  4DZ3 A;  2MF9 A;  1ROT A;  4TX0 A;  3UI5 A;  3MDY B;  5GPG A;  1FKF A;  2M1I A;  2RSE A;  5HW7 A;  3OOB A;  2ZR4 A;  4JFI A;  2PV1 A;  3KAH A;  3O5R A;  3KAF A;  2N87 A;  3H9R B;  1YAT A;  1B6C A;  2ITK A;  2ZR6 A;  1QZ2 A;  1T11 A;  1U79 A;  4BF8 A;  4U86 A;  1EYM A;  4GIV A;  3O5O A;  1FAP A;  1TCO C;  2KO7 A;  2XP4 A;  4W9O A;  1L1P A;  2KR7 A;  5HT1 A;  3CGN A;  2ZR5 A;  2MLZ A;  1JNT A;  3PRD A;  4MSP A;  3TCZ A;  3O5J A; 
#chains in the Genus database with same CATH topology
 1FKH A;  4MTV A;  1NWS A;  1LJY A;  4TYO A;  1EQ3 A;  1E9L A;  3RM4 A;  2XP9 A;  4WKF A;  1WAW A;  4L72 B;  3OA5 A;  2FDM A;  4DIP A;  4S3J A;  1HXV A;  3ARP A;  5BXJ A;  3WL0 A;  3ALF A;  1GPF A;  1M5Y A;  1E6N A;  3WKZ A;  4ZS6 A;  1O6I A;  1NMW A;  1H0G A;  2KI3 A;  2L2S A;  4TNS A;  2RUQ A;  2XP7 A;  1GUV A;  4DWS D;  1LL4 A;  2ZQV A;  1J4R A;  4IQC A;  4MGV A;  3LUO A;  2O9O A;  3B9A A;  4TW6 A;  1JND A;  4IQ2 A;  3NRK A;  5DIT A;  1HKK A;  4J4O A;  2LJ4 A;  4W9Q A;  4ZPT R;  1J6Y A;  1C9H A;  2M2A A;  2KE0 A;  2MLY A;  1VF8 A;  1GOI A;  4WK9 A;  1JNS A;  4URI A;  3UQA A;  2UZ5 A;  5DIV A;  3O5G A;  4DRN A;  4PTM A;  3RGC A;  1JCH B;  1ITX A;  2PPP A;  2RQS A;  4ODO A;  2QF8 A;  2DG3 A;  3PR9 A;  1R9H A;  2DSZ A;  3IKG A;  2XP5 A;  1UR9 A;  1OWQ A;  2YBU A;  3FAP A;  1W1V A;  1D7J A;  3B7X A;  1JNE A;  5GPR A;  1E44 A;  4TX0 A;  3UI5 A;  4MNJ A;  4KQZ A;  2P4V A;  5HW7 A;  2ZR4 A;  2PV1 A;  3KAH A;  2WLY A;  1YAT A;  1B6C A;  2ITK A;  2ZR6 A;  1QZ2 A;  1OGG A;  4GIV A;  2XP4 A;  4MSP A;  1JNT A;  4DT4 A;  4DRO A;  5HUA A;  3ARQ A;  3O5J A;  1E6Z A;  4N19 A;  1SYT A;  1W9V A;  1ZCN A;  4QT2 A;  2ESC A;  4W9P A;  4KR0 B;  3RM9 A;  4DRP A;  2XPA A;  3JYJ A;  4ODK A;  1FJD A;  3O5D A;  3WD4 A;  4DRI A;  5HW6 A;  3AS0 A;  4WKH A;  5HBF A;  1EIB A;  4HBE A;  2DPE A;  2F2D A;  4MPK A;  5DO2 A;  1D7H A;  5DEZ A;  1ZBW A;  2F21 A;  1Y0O A;  1X6N A;  3GTY X;  1KT1 A;  1KFW A;  1RD6 A;  3KAC A;  5DF0 A;  5HWC A;  3GPK A;  1Q1C A;  2WK2 A;  3G6M A;  1FKG A;  5HWB A;  2DT0 A;  4G2P A;  4ODP A;  2IUZ A;  2KFW A;  3BMB A;  4Z2H A;  1CTN A;  4WIW A;  4DRQ A;  2MLX A;  4LAW A;  2LKN A;  3PRB A;  3O5K A;  3ALG A;  3O5F A;  2ZQS A;  2DSV A;  2PPO A;  1EHN A;  2PPN A;  4Z2G A;  1FKI A;  2Q5A A;  4L3N A;  3EY6 A;  2DG9 A;  3O5L A;  4LAY A;  1TFV A;  1QPF A;  3UI4 A;  4WJX A;  2K8I A;  3KCE A;  5J6E A;  1Q6I A;  1FKS A;  3O5I A;  2DG4 A;  1ZK6 A;  5JH8 A;  4MAV A;  3PA7 A;  4ODR A;  3ART A;  1D7I A;  3ARV A;  4XAK A;  2A3B A;  5HKG A;  2XP6 A;  3KZ7 A;  4UDM A;  4ML4 A;  1D6O A;  4NZC A;  4Z2K A;  3MDY B;  3OOB A;  1UR8 A;  3O5R A;  4HAR A;  1U79 A;  1LL6 A;  3ARZ A;  3B9D A;  4Q22 A;  3CHD A;  3O5O A;  1FAP A;  1LQ0 A;  3ARR A;  4W9O A;  1L1P A;  5HT1 A;  2AOS A;  3WL1 A;  1F40 A;  1N1A A;  2EUL A;  4Z2I A;  1A7X A;  4U85 A;  2F23 A;  4LAX A;  1NH6 A;  1W1P A;  1FKD A;  3IK8 A;  4FN2 A;  4JFJ A;  4JFL A;  4DWS B;  2Y78 A;  2ZQU A;  2A3C A;  3KAI A;  3TC5 A;  2JZV A;  3ARO A;  4C02 B;  3CZ8 A;  1PIN A;  3AS1 A;  3IHZ A;  5I98 A;  1QPL A;  4LAV A;  3KAD A;  1E6P A;  3O5M A;  3UI6 A;  4P8U A;  2ETN A;  4P8V A;  1H0I A;  1IX5 A;  1FKB A;  1FKK A;  1LL7 A;  2B5U B;  4TW7 A;  3NTP A;  4P8W A;  4DRH A;  1W9P A;  3ARY A;  2F4E A;  3B9E A;  3EIP A;  2AWG A;  1J4H A;  3W4R A;  4DZ2 A;  3KAB A;  2LGO A;  1FD9 A;  3QOK A;  1FKR A;  1FKT A;  1YW5 A;  3ARS A;  1BKF A;  2MPH A;  1GRJ A;  2M08 A;  3JXV A;  3TDB A;  2RUC A;  3O5Q A;  3CHE A;  2FKE A;  4JFK A;  1ZB5 A;  2XP8 A;  4JFM A;  4MNL A;  4IPX A;  1EDQ A;  3ARU A;  3WH0 A;  3UQB A;  2DSU A;  3B8S A;  3CH9 A;  3WD1 A;  4DH0 A;  4U84 A;  4TW8 A;  2DSW A;  3CHF A;  2DT3 A;  4ODN A;  1WB0 A;  3ODK A;  2MNT A;  2DT2 A;  1W1T A;  2PN0 A;  4Q7N A;  3ARX A;  4G50 A;  3O5E A;  4NSB A;  3UF8 A;  1NMV A;  1HJV A;  3FXY A;  4IT4 A;  2OLH A;  3WQW A;  4AY1 A;  4DWS A;  2M1I A;  2RSE A;  3KAF A;  1E6R A;  2N87 A;  3PRA A;  2PI6 A;  4BF8 A;  1T11 A;  1OGB A;  4Z2J A;  2KR7 A;  4MNK A;  4QZV B;  2DT1 A;  2ZR5 A;  3PRD A;  3TCZ A;  3FY1 A;  1WNO A;  4DWS C;  3JYM A;  1FFQ A;  1HKM A;  2FAP A;  3CGM A;  3O5P A;  2O92 A;  1FKL A;  2A3E A;  2KGJ A;  4JYS A;  1ZBC A;  5HTG A;  1NSG A;  2VCD A;  1NWT A;  5HW8 A;  1FKJ A;  2A3A A;  4DRJ A;  1ZBV A;  4DRK A;  3RFW A;  2B31 A;  2WM0 A;  4ZPV R;  2D9F A;  4ODL A;  1HJX A;  1KT0 A;  3IKD A;  5DIU A;  4MNM A;  1Q6H A;  4J4N A;  2XP3 A;  3CHC A;  2IF4 A;  2XPB A;  4ODM A;  1HKJ A;  3ARW A;  3BXW A;  5B8I C;  2RUD A;  3NI6 A;  1LG1 A;  2WLZ A;  3RM8 A;  1J4I A;  1HKI A;  1NWU A;  2YBT A;  1W26 A;  3AS3 A;  2PV2 A;  4QT3 A;  4QIB A;  2VN1 A;  4ODQ A;  1W1Y A;  3UQI A;  2RUR A;  1LG2 A;  1ZBK A;  5D75 A;  3WD2 A;  3AS2 A;  3VAW A;  1NWR A;  3KAG A;  2G41 A;  3WIJ A;  2LPV A;  2PV3 A;  3WD0 A;  1W9U A;  4WKA A;  4ZPW R;  1Q6U A;  4HBO A;  4R0X A;  1XRV A;  4S3K A;  5GQB A;  2OFN A;  1F8A B;  4R5E A;  3I6C A;  1XHG A;  4Z2L A;  1K9T A;  1P5Q A;  3WQV A;  2ZQT A;  1PBK A;  4NNR A;  1SR0 A;  1FFR A;  3AQU A;  2G8Z A;  2PBC A;  4GGQ A;  4DRM A;  1BL4 A;  3WD3 A;  4FAP A;  1ROU A;  3RME A;  1JVW A;  1ZL1 A;  4ITZ A;  4LGX A;  4DZ3 A;  2MF9 A;  4IT6 A;  1HJW A;  1ZU8 A;  1ROT A;  1D2K A;  5GPG A;  1E15 A;  1FKF A;  4JFI A;  1X6L A;  3H9R B;  4W5U A;  4P8X A;  4U86 A;  1EYM A;  3GU0 A;  1TCO C;  2KO7 A;  3G6L A;  3CGN A;  2MLZ A;  4O2T A; 
#chains in the Genus database with same CATH homology
 1FKH A;  4MTV A;  1NWS A;  1LJY A;  4TYO A;  1EQ3 A;  1E9L A;  3RM4 A;  2XP9 A;  4WKF A;  1WAW A;  4L72 B;  3OA5 A;  2FDM A;  4DIP A;  4S3J A;  1HXV A;  3ARP A;  5BXJ A;  3WL0 A;  3ALF A;  1GPF A;  1M5Y A;  1E6N A;  3WKZ A;  4ZS6 A;  1O6I A;  1NMW A;  1H0G A;  2KI3 A;  2L2S A;  4TNS A;  2RUQ A;  2XP7 A;  1GUV A;  4DWS D;  1LL4 A;  2ZQV A;  1J4R A;  4IQC A;  4MGV A;  3LUO A;  2O9O A;  3B9A A;  4TW6 A;  1JND A;  4IQ2 A;  3NRK A;  5DIT A;  1HKK A;  4J4O A;  2LJ4 A;  4W9Q A;  4ZPT R;  1J6Y A;  1C9H A;  2M2A A;  2KE0 A;  2MLY A;  1VF8 A;  1GOI A;  4WK9 A;  1JNS A;  4URI A;  3UQA A;  2UZ5 A;  5DIV A;  3O5G A;  4DRN A;  4PTM A;  3RGC A;  1ITX A;  2RQS A;  2PPP A;  4ODO A;  2QF8 A;  2DG3 A;  3PR9 A;  1R9H A;  2DSZ A;  3IKG A;  2XP5 A;  1UR9 A;  1OWQ A;  2YBU A;  3FAP A;  1W1V A;  1D7J A;  3B7X A;  1JNE A;  5GPR A;  4TX0 A;  3UI5 A;  4MNJ A;  4KQZ A;  5HW7 A;  2ZR4 A;  2PV1 A;  3KAH A;  2WLY A;  1YAT A;  1B6C A;  2ITK A;  2ZR6 A;  1QZ2 A;  1OGG A;  4GIV A;  2XP4 A;  4MSP A;  1JNT A;  4DT4 A;  4DRO A;  5HUA A;  3ARQ A;  3O5J A;  1E6Z A;  4N19 A;  1SYT A;  1W9V A;  1ZCN A;  4QT2 A;  2ESC A;  4W9P A;  4KR0 B;  3RM9 A;  4DRP A;  2XPA A;  3JYJ A;  4ODK A;  1FJD A;  3O5D A;  3WD4 A;  4DRI A;  5HW6 A;  3AS0 A;  4WKH A;  5HBF A;  1EIB A;  4HBE A;  2DPE A;  2F2D A;  4MPK A;  5DO2 A;  1D7H A;  5DEZ A;  1ZBW A;  2F21 A;  1Y0O A;  1X6N A;  1KT1 A;  1KFW A;  1RD6 A;  3KAC A;  5DF0 A;  5HWC A;  3GPK A;  1Q1C A;  2WK2 A;  3G6M A;  1FKG A;  5HWB A;  2DT0 A;  4G2P A;  4ODP A;  2IUZ A;  2KFW A;  4Z2H A;  1CTN A;  4WIW A;  4DRQ A;  2MLX A;  4LAW A;  2LKN A;  3PRB A;  3O5K A;  3ALG A;  3O5F A;  2ZQS A;  2DSV A;  2PPO A;  1EHN A;  2PPN A;  4Z2G A;  1FKI A;  2Q5A A;  4L3N A;  3EY6 A;  2DG9 A;  3O5L A;  4LAY A;  1TFV A;  1QPF A;  3UI4 A;  4WJX A;  2K8I A;  3KCE A;  5J6E A;  1Q6I A;  1FKS A;  3O5I A;  2DG4 A;  1ZK6 A;  5JH8 A;  4MAV A;  3PA7 A;  4ODR A;  3ART A;  1D7I A;  3ARV A;  4XAK A;  2A3B A;  5HKG A;  2XP6 A;  3KZ7 A;  4ML4 A;  1D6O A;  4NZC A;  4Z2K A;  3MDY B;  3OOB A;  1UR8 A;  3O5R A;  4HAR A;  1U79 A;  1LL6 A;  3ARZ A;  3B9D A;  4Q22 A;  3CHD A;  3O5O A;  1FAP A;  1LQ0 A;  3ARR A;  4W9O A;  1L1P A;  5HT1 A;  2AOS A;  3WL1 A;  1F40 A;  1N1A A;  4Z2I A;  1A7X A;  4U85 A;  4LAX A;  1NH6 A;  1W1P A;  1FKD A;  3IK8 A;  4FN2 A;  4JFJ A;  4JFL A;  4DWS B;  2Y78 A;  2ZQU A;  2A3C A;  3KAI A;  3TC5 A;  2JZV A;  3ARO A;  4C02 B;  3CZ8 A;  1PIN A;  3AS1 A;  3IHZ A;  5I98 A;  1QPL A;  4LAV A;  3KAD A;  1E6P A;  3O5M A;  3UI6 A;  4P8U A;  4P8V A;  1H0I A;  1IX5 A;  1FKB A;  1FKK A;  1LL7 A;  4TW7 A;  3NTP A;  4P8W A;  4DRH A;  1W9P A;  3ARY A;  2F4E A;  3B9E A;  2AWG A;  1J4H A;  3W4R A;  4DZ2 A;  3KAB A;  2LGO A;  1FD9 A;  3QOK A;  1FKR A;  1FKT A;  1YW5 A;  3ARS A;  1BKF A;  2MPH A;  2M08 A;  3JXV A;  3TDB A;  2RUC A;  3O5Q A;  3CHE A;  2FKE A;  4JFK A;  1ZB5 A;  2XP8 A;  4JFM A;  4MNL A;  4IPX A;  1EDQ A;  3ARU A;  3WH0 A;  3UQB A;  2DSU A;  3B8S A;  3CH9 A;  3WD1 A;  4DH0 A;  4U84 A;  4TW8 A;  2DSW A;  3CHF A;  2DT3 A;  4ODN A;  1WB0 A;  3ODK A;  2MNT A;  2DT2 A;  1W1T A;  4Q7N A;  3ARX A;  4G50 A;  3O5E A;  4NSB A;  3UF8 A;  1NMV A;  1HJV A;  3FXY A;  4IT4 A;  2OLH A;  3WQW A;  4AY1 A;  4DWS A;  2M1I A;  2RSE A;  3KAF A;  1E6R A;  2N87 A;  3PRA A;  2PI6 A;  4BF8 A;  1T11 A;  1OGB A;  4Z2J A;  2KR7 A;  4MNK A;  4QZV B;  2DT1 A;  2ZR5 A;  3PRD A;  3TCZ A;  3FY1 A;  1WNO A;  4DWS C;  3JYM A;  1FFQ A;  1HKM A;  2FAP A;  3CGM A;  3O5P A;  2O92 A;  1FKL A;  2A3E A;  2KGJ A;  4JYS A;  1ZBC A;  5HTG A;  1NSG A;  2VCD A;  1NWT A;  5HW8 A;  1FKJ A;  2A3A A;  4DRJ A;  1ZBV A;  4DRK A;  3RFW A;  2B31 A;  2WM0 A;  4ZPV R;  2D9F A;  4ODL A;  1HJX A;  1KT0 A;  3IKD A;  5DIU A;  4MNM A;  1Q6H A;  4J4N A;  2XP3 A;  3CHC A;  2IF4 A;  2XPB A;  4ODM A;  1HKJ A;  3ARW A;  3BXW A;  5B8I C;  2RUD A;  3NI6 A;  1LG1 A;  2WLZ A;  3RM8 A;  1J4I A;  1HKI A;  1NWU A;  2YBT A;  1W26 A;  3AS3 A;  2PV2 A;  4QT3 A;  4QIB A;  2VN1 A;  4ODQ A;  1W1Y A;  3UQI A;  2RUR A;  1LG2 A;  1ZBK A;  5D75 A;  3WD2 A;  3AS2 A;  3VAW A;  1NWR A;  3KAG A;  2G41 A;  3WIJ A;  2LPV A;  2PV3 A;  3WD0 A;  1W9U A;  4WKA A;  4ZPW R;  1Q6U A;  4HBO A;  4R0X A;  1XRV A;  4S3K A;  5GQB A;  2OFN A;  1F8A B;  4R5E A;  3I6C A;  1XHG A;  4Z2L A;  1K9T A;  1P5Q A;  3WQV A;  2ZQT A;  1PBK A;  4NNR A;  1SR0 A;  1FFR A;  3AQU A;  2G8Z A;  2PBC A;  4GGQ A;  4DRM A;  1BL4 A;  3WD3 A;  4FAP A;  1ROU A;  3RME A;  1JVW A;  1ZL1 A;  4ITZ A;  4LGX A;  4DZ3 A;  2MF9 A;  4IT6 A;  1HJW A;  1ZU8 A;  1ROT A;  1D2K A;  5GPG A;  1E15 A;  1FKF A;  4JFI A;  1X6L A;  3H9R B;  4W5U A;  4P8X A;  4U86 A;  1EYM A;  1TCO C;  2KO7 A;  3G6L A;  3CGN A;  2MLZ A;  4O2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...