3JYJA

Structure-based design of novel pin1 inhibitors (ii)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
113
structure length
113
Chain Sequence
EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-based design of novel human Pin1 inhibitors (II).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 40
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3jyjA00
2MLZA 3TCZA 3IHZA 2Q5AA 4ODMA 4TW7A 3O5GA 3O5KA 4G50A 5HWCA 3O5PA 1Q6HA 4LAYA 4G2PA 4N19A 1PBKA 1R9HA 2MF9A 1FKLA 5DIUA 4C02B 1Q6UA 4ODRA 1FKDA 4DRJA 3KABA 3O5OA 1FKGA 2KFWA 2VN1A 2XP4A 3IK8A 3PRBA 4W9PA 5DITA 1FKTA 1BKFA 1FKKA 3KAGA 5HW8A 2M2AA 3O5JA 2KR7A 4R0XA 3IKDA 1D7JA 1EQ3A 1U79A 3JYMA 1W26A 5HT1A 1TCOC 1KT0A 3ODKA 3O5RA 2LPVA 3GPKA 4GIVA 2RURA 1JNSA 3NTPA 2ITKA 4J4NA 4ODOA 2M08A 1F8AB 1QPFA 4LAXA 4MGVA 4ODQA 2RUDA 4TW8A 2LGOA 1T11A 4U84A 2ZQTA 2PV1A 1FAPA 2XPAA 2XP5A 4DH0A 4LAVA 4DRIA 5HUAA 2ZR6A 3RFWA 3EY6A 2XP7A 4W9OA 2KE0A 3H9RB 3RGCA 2XPBA 3VAWA 5HW6A 3O5IA 2MLXA 1NMVA 2IF4A 1J4RA 2LJ4A 4DRQA 4O2TA 2OFNA 3O5LA 2PV2A 2XP3A 1NSGA 4QIBA 2DG9A 2KI3A 3NI6A 4DRKA 2FKEA 2PBCA 3JYJA 3JXVA 3TDBA 1ZK6A 2XP6A 1Q1CA 4DIPA 2ZQSA 4MSPA 2RUQA 2JZVA 3KZ7A 4JYSA 3KADA 2F21A 2F2DA 4LAWA 5DIVA 3LUOA 1FKBA 3O5FA 2K8IA 3O5DA 4NNRA 3IKGA 3O5QA 4DZ3A 4IPXA 5GPGA 3UQIA 3OOBA 4QT3A 1F40A 1A7XA 1J4HA 2MNTA 4TW6A 2D9FA 4DRNA 1EYMA 1ROTA 1M5YA 2PPNA 4JFLA 4JFJA 4ODPA 1Y0OA 4JFKA 1Q6IA 1QPLA 2KGJA 4DROA 1JVWA 2L2SA 3B7XA 4JFMA 2RUCA 4ODLA 5HW7A 2FAPA 2ZR4A 4QT2A 3UQBA 1D7IA 3UI6A 1J4IA 1FJDA 2LKNA 5HWBA 5HTGA 4BF8A 1FKSA 2XP9A 2ZQUA 2PV3A 1JNTA 2AWGA 2UZ5A 4DRHA 3KAHA 1HXVA 4FN2A 5J6EA 1C9HA 1ROUA 4DZ2A 1N1AA 3KAIA 1FKFA 3KCEA 3PA7A 1FKJA 3UI4A 1YATA 3UF8A 2Y78A 3NRKA 4DRPA 1FKHA 1B6CA 1BL4A 3FAPA 5D75A 3TC5A 5B8IC 4TNSA 5BXJA 4GGQA 3O5EA 4JFIA 3UQAA 3KAFA 1FD9A 2N87A 4U86A 2MLYA 1YW5A 3UI5A 3CGNA 4DT4A 2MPHA 4W9QA 2PPOA 4TYOA 1P5QA 2F4EA 5HKGA 2M1IA 2ZQVA 3O5MA 4FAPA 1J6YA 1FKRA 1L1PA 3KACA 4IQ2A 1D6OA 1ZCNA 3PRDA 4ITZA 2XP8A 1D7HA 1NMWA 4IQCA 2DG3A 1KT1A 3CGMA 2DG4A 1QZ2A 4TX0A 2VCDA 4DRMA 2ZR5A 3I6CA 2RSEA 1FKIA 2PPPA 4J4OA 5I98A 4ODNA 4ODKA 1PINA 2RQSA 2KO7A 3MDYB 3WH0A 4U85A
chains in the Genus database with same CATH superfamily
2MLZA 3IHZA 2DT1A 4ODMA 3O5KA 2WM0A 1Q6HA 3RM4A 4N19A 4P8UA 4C02B 1H0IA 4DRJA 3AS1A 1WB0A 5GPRA 4W9PA 1HJVA 1FKKA 3GTYX 3ALFA 1D7JA 1U79A 3CH9A 3JYMA 1TCOC 4S3KA 1K9TA 2YBTA 4LGXA 4KR0B 4ODOA 2AOSA 1EIBA 2RUDA 2LGOA 3ARQA 4TW8A 4U84A 4DH0A 2ZR6A 1OGGA 3RFWA 2A3AA 1JCHB 3PRAA 2A3EA 3RGCA 2XPBA 4P8XA 1NWUA 1W9UA 4O2TA 2OFNA 3O5LA 2PV2A 1OWQA 4MNKA 4QIBA 1HJXA 3WL1A 1ZK6A 2XP6A 1Q1CA 2ZQSA 3G6LA 1VF8A 2DT2A 1W1TA 4JYSA 4MAVA 3IKGA 4DZ3A 4IPXA 4QT3A 1ROTA 3WD0A 3ARUA 4ZPTR 4DWSB 1Q6IA 4ODLA 1TFVA 2ZR4A 4URIA 4QT2A 1J4IA 2LKNA 3ARPA 1E6PA 2UZ5A 4DRHA 3ALGA 1XRVA 3FY1A 1ROUA 1FKFA 3KCEA 3PA7A 1BL4A 5D75A 1GOIA 3WQVA 5B8IC 4MNJA 1XHGA 3AS3A 4IT6A 3BXWA 2O92A 3KAFA 1E15A 3WIJA 2DSVA 4KQZA 3UI5A 4ML4A 3WD2A 2ZQVA 3O5MA 4FAPA 3GU0A 4ITZA 1NMWA 4IQCA 1KT1A 2ZR5A 1FKIA 4J4OA 4ODNA 3WL0A 1PINA 2RQSA 3ARZA 4W5UA 4TW7A 4G50A 3O5PA 4LAYA 1PBKA 1SYTA 1FKLA 1Q6UA 4ZPWR 4ZPVR 1NWSA 3KABA 4ZS6A 2KFWA 3AROA 1KFWA 3KAGA 2M2AA 2KR7A 3IKDA 1GPFA 3QOKA 5HT1A 1UR9A 2RURA 4J4NA 4LAXA 4MGVA 4ODQA 4WJXA 1T11A 2ZQTA 2XPAA 4P8WA 2XP5A 4DRIA 5HW6A 1ZBVA 1NMVA 1NH6A 1LL7A 1J4RA 4MNLA 1LG1A 3TDBA 1HKIA 1ITXA 4MSPA 4Z2IA 4Z2LA 1ZBWA 3ARWA 2K8IA 4NNRA 5GPGA 1F40A 2MNTA 2PI6A 1NWRA 2D9FA 1EYMA 4JFLA 2PPNA 1HKMA 4JFJA 4ODPA 1Y0OA 4JFKA 5HW7A 3B7XA 2RUCA 1FFRA 1JNDA 3UQBA 3UI6A 4Z2HA 3ARRA 5HTGA 1E6NA 2ZQUA 1JNTA 4Q7NA 4L72B 1HJWA 1LL6A 3AS2A 1N1AA 3UI4A 2YBUA 1WNOA 3NRKA 2ETNA 3TC5A 3EIPA 3O5EA 4JFIA 1FD9A 2N87A 3CGNA 4L3NA 1IX5A 2F4EA 1LJYA 1J6YA 3CHCA 3KACA 1D6OA 1ZCNA 2XP8A 2DG3A 4HARA 2QF8A 4TX0A 2VCDA 3I6CA 2WLZA 3B9AA 4P8VA 3WH0A 4U85A 3TCZA 1D2KA 1ZU8A 3RMEA 5HWCA 2G41A 3WD3A 1NWTA 4ODRA 3B9DA 3IK8A 2XP4A 4NZCA 5DITA 3AQUA 1FKTA 1X6LA 1BKFA 1EQ3A 2B5UB 2DSZA 4R0XA 4Z2KA 4DWSD 1W26A 1KT0A 3G6MA 1ZL1A 4GIVA 1JNSA 3NTPA 2ITKA 2O9OA 2M08A 1ZBCA 1EHNA 1GRJA 2PV1A 1FAPA 4MPKA 4DWSA 2XP7A 2KE0A 3H9RB 5JH8A 2MLXA 4MNMA 2DPEA 1FFQA 4DRQA 1W9PA 5DF0A 2XP3A 3FXYA 2DG9A 2KI3A 4DRKA 3JYJA 3JXVA 1H0GA 4AY1A 4DIPA 2JZVA 3KZ7A 5DIVA 2F21A 2F2DA 4QZVB 1FKBA 3O5FA 2A3CA 3O5QA 3W4RA 1A7XA 1WAWA 1J4HA 1OGBA 3AS0A 4DRNA 1M5YA 3ARYA 2FDMA 4DROA 2FAPA 1FJDA 4WKFA 4UDMA 5DEZA 3PR9A 1FKSA 2XP9A 2PV3A 2DSUA 2PN0A 3KAHA 1HXVA 4Z2GA 5J6EA 1C9HA 3ARXA 3RM9A 4DZ2A 4R5EA 3KAIA 3WKZA 1YATA 3UF8A 2Y78A 4DRPA 1FKHA 3FAPA 4Q22A 4TNSA 4NSBA 4PTMA 4GGQA 5BXJA 3UQAA 1SR0A 3ARSA 2A3BA 1W1PA 1W9VA 2PPOA 1P5QA 4IT4A 3RM8A 3CHEA 1FKRA 3ARTA 4IQ2A 3PRDA 4HBEA 2DG4A 4DRMA 4HBOA 1EDQA 2RSEA 4MTVA 2PPPA 5I98A 4ODKA 3MDYB 4WKAA 2Q5AA 3WQWA 3O5GA 2B31A 4G2PA 3OA5A 1R9HA 2MF9A 5DIUA 3CHFA 1E6ZA 1FKDA 3O5OA 1FKGA 2VN1A 1JNEA 3PRBA 5HW8A 3O5JA 3B9EA 4WKHA 2OLHA 3O5RA 2LPVA 1UR8A 1W1VA 3GPKA 3ODKA 1ZBKA 3B8SA 2DT0A 3WD1A 1F8AB 1QPFA 2DT3A 4LAVA 5HUAA 1HKJA 3EY6A 4W9OA 3VAWA 2DSWA 3O5IA 2IF4A 2LJ4A 1O6IA 3ARVA 1NSGA 3NI6A 2FKEA 2PBCA 3WD4A 4WK9A 1LL4A 2RUQA 3KADA 4LAWA 2G8ZA 3LUOA 3O5DA 1E9LA 2P4VA 3UQIA 3OOBA 1RD6A 4XAKA 4TW6A 5DO2A 1QPLA 2KGJA 2WLYA 1JVWA 2L2SA 4JFMA 2F23A 1D7IA 3BMBA 5HWBA 4BF8A 2AWGA 3CHDA 1GUVA 4FN2A 5GQBA 1E44A 4DWSC 1FKJA 1B6CA 2ESCA 1CTNA 4U86A 2MLYA 1YW5A 3CZ8A 1LQ0A 4DT4A 2MPHA 2WK2A 4W9QA 4WIWA 5HKGA 4TYOA 2M1IA 4S3JA 1L1PA 2EULA 1W1YA 1D7HA 1HKKA 5HBFA 1X6NA 3CGMA 1QZ2A 4Z2JA 1ZB5A 2IUZA 2KO7A 1E6RA 1LG2A
chains in the Genus database with same CATH topology
2MLZA 3IHZA 2DT1A 4ODMA 3O5KA 2WM0A 1Q6HA 3RM4A 4N19A 4P8UA 4C02B 1H0IA 4DRJA 3AS1A 1WB0A 5GPRA 4W9PA 1HJVA 1FKKA 3ALFA 1D7JA 1U79A 3CH9A 3JYMA 1TCOC 4S3KA 1K9TA 2YBTA 4LGXA 4KR0B 4ODOA 2AOSA 1EIBA 2RUDA 2LGOA 3ARQA 4TW8A 4U84A 4DH0A 2ZR6A 1OGGA 3RFWA 2A3AA 3PRAA 2A3EA 3RGCA 2XPBA 4P8XA 1NWUA 1W9UA 4O2TA 2OFNA 3O5LA 2PV2A 1OWQA 4MNKA 4QIBA 1HJXA 3WL1A 1ZK6A 2XP6A 1Q1CA 2ZQSA 3G6LA 1VF8A 2DT2A 1W1TA 4JYSA 4MAVA 3IKGA 4DZ3A 4IPXA 4QT3A 1ROTA 3WD0A 3ARUA 4ZPTR 4DWSB 1Q6IA 4ODLA 1TFVA 2ZR4A 4URIA 4QT2A 1J4IA 2LKNA 3ARPA 1E6PA 2UZ5A 4DRHA 3ALGA 1XRVA 3FY1A 1ROUA 1FKFA 3KCEA 3PA7A 1BL4A 5D75A 1GOIA 3WQVA 5B8IC 4MNJA 1XHGA 3AS3A 4IT6A 3BXWA 2O92A 3KAFA 1E15A 3WIJA 2DSVA 4KQZA 3UI5A 4ML4A 3WD2A 2ZQVA 3O5MA 4FAPA 4ITZA 1NMWA 4IQCA 1KT1A 2ZR5A 1FKIA 4J4OA 4ODNA 3WL0A 1PINA 2RQSA 3ARZA 4W5UA 4TW7A 4G50A 3O5PA 4LAYA 1PBKA 1SYTA 1FKLA 1Q6UA 4ZPWR 4ZPVR 1NWSA 3KABA 4ZS6A 2KFWA 3AROA 1KFWA 3KAGA 2M2AA 2KR7A 3IKDA 1GPFA 3QOKA 5HT1A 1UR9A 2RURA 4J4NA 4LAXA 4MGVA 4ODQA 4WJXA 1T11A 2ZQTA 2XPAA 4P8WA 2XP5A 4DRIA 5HW6A 1ZBVA 1NMVA 1NH6A 1LL7A 1J4RA 4MNLA 1LG1A 3TDBA 1HKIA 1ITXA 4MSPA 4Z2IA 4Z2LA 1ZBWA 3ARWA 2K8IA 4NNRA 5GPGA 1F40A 2MNTA 2PI6A 1NWRA 2D9FA 1EYMA 4JFLA 2PPNA 1HKMA 4JFJA 4ODPA 1Y0OA 4JFKA 5HW7A 3B7XA 2RUCA 1FFRA 1JNDA 3UQBA 3UI6A 4Z2HA 3ARRA 5HTGA 1E6NA 2ZQUA 1JNTA 4Q7NA 4L72B 1HJWA 1LL6A 3AS2A 1N1AA 3UI4A 2YBUA 1WNOA 3NRKA 3TC5A 3O5EA 4JFIA 1FD9A 2N87A 3CGNA 4L3NA 1IX5A 2F4EA 1LJYA 1J6YA 3CHCA 3KACA 1D6OA 1ZCNA 2XP8A 2DG3A 4HARA 2QF8A 4TX0A 2VCDA 3I6CA 2WLZA 3B9AA 4P8VA 3WH0A 4U85A 3TCZA 1D2KA 1ZU8A 3RMEA 5HWCA 2G41A 3WD3A 1NWTA 4ODRA 3B9DA 3IK8A 2XP4A 4NZCA 5DITA 3AQUA 1FKTA 1X6LA 1BKFA 1EQ3A 2DSZA 4R0XA 4Z2KA 4DWSD 1W26A 1KT0A 3G6MA 1ZL1A 4GIVA 1JNSA 3NTPA 2ITKA 2O9OA 2M08A 1ZBCA 1EHNA 2PV1A 1FAPA 4MPKA 4DWSA 2XP7A 2KE0A 3H9RB 5JH8A 2MLXA 4MNMA 2DPEA 1FFQA 4DRQA 1W9PA 5DF0A 2XP3A 3FXYA 2DG9A 2KI3A 4DRKA 3JYJA 3JXVA 1H0GA 4AY1A 4DIPA 2JZVA 3KZ7A 5DIVA 2F21A 2F2DA 4QZVB 1FKBA 3O5FA 2A3CA 3O5QA 3W4RA 1A7XA 1WAWA 1J4HA 1OGBA 3AS0A 4DRNA 1M5YA 3ARYA 2FDMA 4DROA 2FAPA 1FJDA 4WKFA 5DEZA 3PR9A 1FKSA 2XP9A 2PV3A 2DSUA 3KAHA 1HXVA 4Z2GA 5J6EA 1C9HA 3ARXA 3RM9A 4DZ2A 4R5EA 3KAIA 3WKZA 1YATA 3UF8A 2Y78A 4DRPA 1FKHA 3FAPA 4Q22A 4TNSA 4NSBA 4PTMA 4GGQA 5BXJA 3UQAA 1SR0A 3ARSA 2A3BA 1W1PA 1W9VA 2PPOA 1P5QA 4IT4A 3RM8A 3CHEA 1FKRA 3ARTA 4IQ2A 3PRDA 4HBEA 2DG4A 4DRMA 4HBOA 1EDQA 2RSEA 4MTVA 2PPPA 5I98A 4ODKA 3MDYB 4WKAA 2Q5AA 3WQWA 3O5GA 2B31A 4G2PA 3OA5A 1R9HA 2MF9A 5DIUA 3CHFA 1E6ZA 1FKDA 3O5OA 1FKGA 2VN1A 1JNEA 3PRBA 5HW8A 3O5JA 3B9EA 4WKHA 2OLHA 3O5RA 2LPVA 1UR8A 1W1VA 3GPKA 3ODKA 1ZBKA 3B8SA 2DT0A 3WD1A 1F8AB 1QPFA 2DT3A 4LAVA 5HUAA 1HKJA 3EY6A 4W9OA 3VAWA 2DSWA 3O5IA 2IF4A 2LJ4A 1O6IA 3ARVA 1NSGA 3NI6A 2FKEA 2PBCA 3WD4A 4WK9A 1LL4A 2RUQA 3KADA 4LAWA 2G8ZA 3LUOA 3O5DA 1E9LA 3UQIA 3OOBA 1RD6A 4XAKA 4TW6A 5DO2A 1QPLA 2KGJA 2WLYA 1JVWA 2L2SA 4JFMA 1D7IA 5HWBA 4BF8A 2AWGA 3CHDA 1GUVA 4FN2A 5GQBA 4DWSC 1FKJA 1B6CA 2ESCA 1CTNA 4U86A 2MLYA 1YW5A 3CZ8A 1LQ0A 4DT4A 2MPHA 2WK2A 4W9QA 4WIWA 5HKGA 4TYOA 2M1IA 4S3JA 1L1PA 1W1YA 1D7HA 1HKKA 5HBFA 1X6NA 3CGMA 1QZ2A 4Z2JA 1ZB5A 2IUZA 2KO7A 1E6RA 1LG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MLZ A;  3TCZ A;  3IHZ A;  2Q5A A;  4ODM A;  4TW7 A;  3O5G A;  3O5K A;  4G50 A;  5HWC A;  3O5P A;  1Q6H A;  4LAY A;  4G2P A;  4N19 A;  1PBK A;  1R9H A;  2MF9 A;  1FKL A;  5DIU A;  4C02 B;  1Q6U A;  4ODR A;  1FKD A;  4DRJ A;  3KAB A;  3O5O A;  1FKG A;  2KFW A;  2VN1 A;  2XP4 A;  3IK8 A;  3PRB A;  4W9P A;  5DIT A;  1FKT A;  1BKF A;  1FKK A;  3KAG A;  5HW8 A;  2M2A A;  3O5J A;  2KR7 A;  4R0X A;  3IKD A;  1D7J A;  1EQ3 A;  1U79 A;  3JYM A;  1W26 A;  5HT1 A;  1TCO C;  1KT0 A;  3ODK A;  3O5R A;  2LPV A;  3GPK A;  4GIV A;  2RUR A;  1JNS A;  3NTP A;  2ITK A;  4J4N A;  4ODO A;  2M08 A;  1F8A B;  1QPF A;  4LAX A;  4MGV A;  4ODQ A;  2RUD A;  4TW8 A;  2LGO A;  1T11 A;  4U84 A;  2ZQT A;  2PV1 A;  1FAP A;  2XPA A;  2XP5 A;  4DH0 A;  4LAV A;  4DRI A;  5HUA A;  2ZR6 A;  3RFW A;  3EY6 A;  2XP7 A;  4W9O A;  2KE0 A;  3H9R B;  3RGC A;  2XPB A;  3VAW A;  5HW6 A;  3O5I A;  2MLX A;  1NMV A;  2IF4 A;  1J4R A;  2LJ4 A;  4DRQ A;  4O2T A;  2OFN A;  3O5L A;  2PV2 A;  2XP3 A;  1NSG A;  4QIB A;  2DG9 A;  2KI3 A;  3NI6 A;  4DRK A;  2FKE A;  2PBC A;  3JYJ A;  3JXV A;  3TDB A;  1ZK6 A;  2XP6 A;  1Q1C A;  4DIP A;  2ZQS A;  4MSP A;  2RUQ A;  2JZV A;  3KZ7 A;  4JYS A;  3KAD A;  2F21 A;  2F2D A;  4LAW A;  5DIV A;  3LUO A;  1FKB A;  3O5F A;  2K8I A;  3O5D A;  4NNR A;  3IKG A;  3O5Q A;  4DZ3 A;  4IPX A;  5GPG A;  3UQI A;  3OOB A;  4QT3 A;  1F40 A;  1A7X A;  1J4H A;  2MNT A;  4TW6 A;  2D9F A;  4DRN A;  1EYM A;  1ROT A;  1M5Y A;  2PPN A;  4JFL A;  4JFJ A;  4ODP A;  1Y0O A;  4JFK A;  1Q6I A;  1QPL A;  2KGJ A;  4DRO A;  1JVW A;  2L2S A;  3B7X A;  4JFM A;  2RUC A;  4ODL A;  5HW7 A;  2FAP A;  2ZR4 A;  4QT2 A;  3UQB A;  1D7I A;  3UI6 A;  1J4I A;  1FJD A;  2LKN A;  5HWB A;  5HTG A;  4BF8 A;  1FKS A;  2XP9 A;  2ZQU A;  2PV3 A;  1JNT A;  2AWG A;  2UZ5 A;  4DRH A;  3KAH A;  1HXV A;  4FN2 A;  5J6E A;  1C9H A;  1ROU A;  4DZ2 A;  1N1A A;  3KAI A;  1FKF A;  3KCE A;  3PA7 A;  1FKJ A;  3UI4 A;  1YAT A;  3UF8 A;  2Y78 A;  3NRK A;  4DRP A;  1FKH A;  1B6C A;  1BL4 A;  3FAP A;  5D75 A;  3TC5 A;  5B8I C;  4TNS A;  5BXJ A;  4GGQ A;  3O5E A;  4JFI A;  3UQA A;  3KAF A;  1FD9 A;  2N87 A;  4U86 A;  2MLY A;  1YW5 A;  3UI5 A;  3CGN A;  4DT4 A;  2MPH A;  4W9Q A;  2PPO A;  4TYO A;  1P5Q A;  2F4E A;  5HKG A;  2M1I A;  2ZQV A;  3O5M A;  4FAP A;  1J6Y A;  1FKR A;  1L1P A;  3KAC A;  4IQ2 A;  1D6O A;  1ZCN A;  3PRD A;  4ITZ A;  2XP8 A;  1D7H A;  1NMW A;  4IQC A;  2DG3 A;  1KT1 A;  3CGM A;  2DG4 A;  1QZ2 A;  4TX0 A;  2VCD A;  4DRM A;  2ZR5 A;  3I6C A;  2RSE A;  1FKI A;  2PPP A;  4J4O A;  5I98 A;  4ODN A;  4ODK A;  1PIN A;  2RQS A;  2KO7 A;  3MDY B;  3WH0 A;  4U85 A; 
#chains in the Genus database with same CATH topology
 2MLZ A;  3IHZ A;  2DT1 A;  4ODM A;  3O5K A;  2WM0 A;  1Q6H A;  3RM4 A;  4N19 A;  4P8U A;  4C02 B;  1H0I A;  4DRJ A;  3AS1 A;  1WB0 A;  5GPR A;  4W9P A;  1HJV A;  1FKK A;  3GTY X;  3ALF A;  1D7J A;  1U79 A;  3CH9 A;  3JYM A;  1TCO C;  4S3K A;  1K9T A;  2YBT A;  4LGX A;  4KR0 B;  4ODO A;  2AOS A;  1EIB A;  2RUD A;  2LGO A;  3ARQ A;  4TW8 A;  4U84 A;  4DH0 A;  2ZR6 A;  1OGG A;  3RFW A;  2A3A A;  1JCH B;  3PRA A;  2A3E A;  3RGC A;  2XPB A;  4P8X A;  1NWU A;  1W9U A;  4O2T A;  2OFN A;  3O5L A;  2PV2 A;  1OWQ A;  4MNK A;  4QIB A;  1HJX A;  3WL1 A;  1ZK6 A;  2XP6 A;  1Q1C A;  2ZQS A;  3G6L A;  1VF8 A;  2DT2 A;  1W1T A;  4JYS A;  4MAV A;  3IKG A;  4DZ3 A;  4IPX A;  4QT3 A;  1ROT A;  3WD0 A;  3ARU A;  4ZPT R;  4DWS B;  1Q6I A;  4ODL A;  1TFV A;  2ZR4 A;  4URI A;  4QT2 A;  1J4I A;  2LKN A;  3ARP A;  1E6P A;  2UZ5 A;  4DRH A;  3ALG A;  1XRV A;  3FY1 A;  1ROU A;  1FKF A;  3KCE A;  3PA7 A;  1BL4 A;  5D75 A;  1GOI A;  3WQV A;  5B8I C;  4MNJ A;  1XHG A;  3AS3 A;  4IT6 A;  3BXW A;  2O92 A;  3KAF A;  1E15 A;  3WIJ A;  2DSV A;  4KQZ A;  3UI5 A;  4ML4 A;  3WD2 A;  2ZQV A;  3O5M A;  4FAP A;  3GU0 A;  4ITZ A;  1NMW A;  4IQC A;  1KT1 A;  2ZR5 A;  1FKI A;  4J4O A;  4ODN A;  3WL0 A;  1PIN A;  2RQS A;  3ARZ A;  4W5U A;  4TW7 A;  4G50 A;  3O5P A;  4LAY A;  1PBK A;  1SYT A;  1FKL A;  1Q6U A;  4ZPW R;  4ZPV R;  1NWS A;  3KAB A;  4ZS6 A;  2KFW A;  3ARO A;  1KFW A;  3KAG A;  2M2A A;  2KR7 A;  3IKD A;  1GPF A;  3QOK A;  5HT1 A;  1UR9 A;  2RUR A;  4J4N A;  4LAX A;  4MGV A;  4ODQ A;  4WJX A;  1T11 A;  2ZQT A;  2XPA A;  4P8W A;  2XP5 A;  4DRI A;  5HW6 A;  1ZBV A;  1NMV A;  1NH6 A;  1LL7 A;  1J4R A;  4MNL A;  1LG1 A;  3TDB A;  1HKI A;  1ITX A;  4MSP A;  4Z2I A;  4Z2L A;  1ZBW A;  3ARW A;  2K8I A;  4NNR A;  5GPG A;  1F40 A;  2MNT A;  2PI6 A;  1NWR A;  2D9F A;  1EYM A;  4JFL A;  2PPN A;  1HKM A;  4JFJ A;  4ODP A;  1Y0O A;  4JFK A;  5HW7 A;  3B7X A;  2RUC A;  1FFR A;  1JND A;  3UQB A;  3UI6 A;  4Z2H A;  3ARR A;  5HTG A;  1E6N A;  2ZQU A;  1JNT A;  4Q7N A;  4L72 B;  1HJW A;  1LL6 A;  3AS2 A;  1N1A A;  3UI4 A;  2YBU A;  1WNO A;  3NRK A;  2ETN A;  3TC5 A;  3EIP A;  3O5E A;  4JFI A;  1FD9 A;  2N87 A;  3CGN A;  4L3N A;  1IX5 A;  2F4E A;  1LJY A;  1J6Y A;  3CHC A;  3KAC A;  1D6O A;  1ZCN A;  2XP8 A;  2DG3 A;  4HAR A;  2QF8 A;  4TX0 A;  2VCD A;  3I6C A;  2WLZ A;  3B9A A;  4P8V A;  3WH0 A;  4U85 A;  3TCZ A;  1D2K A;  1ZU8 A;  3RME A;  5HWC A;  2G41 A;  3WD3 A;  1NWT A;  4ODR A;  3B9D A;  3IK8 A;  2XP4 A;  4NZC A;  5DIT A;  3AQU A;  1FKT A;  1X6L A;  1BKF A;  1EQ3 A;  2B5U B;  2DSZ A;  4R0X A;  4Z2K A;  4DWS D;  1W26 A;  1KT0 A;  3G6M A;  1ZL1 A;  4GIV A;  1JNS A;  3NTP A;  2ITK A;  2O9O A;  2M08 A;  1ZBC A;  1EHN A;  1GRJ A;  2PV1 A;  1FAP A;  4MPK A;  4DWS A;  2XP7 A;  2KE0 A;  3H9R B;  5JH8 A;  2MLX A;  4MNM A;  2DPE A;  1FFQ A;  4DRQ A;  1W9P A;  5DF0 A;  2XP3 A;  3FXY A;  2DG9 A;  2KI3 A;  4DRK A;  3JYJ A;  3JXV A;  1H0G A;  4AY1 A;  4DIP A;  2JZV A;  3KZ7 A;  5DIV A;  2F21 A;  2F2D A;  4QZV B;  1FKB A;  3O5F A;  2A3C A;  3O5Q A;  3W4R A;  1A7X A;  1WAW A;  1J4H A;  1OGB A;  3AS0 A;  4DRN A;  1M5Y A;  3ARY A;  2FDM A;  4DRO A;  2FAP A;  1FJD A;  4WKF A;  4UDM A;  5DEZ A;  3PR9 A;  1FKS A;  2XP9 A;  2PV3 A;  2DSU A;  2PN0 A;  3KAH A;  1HXV A;  4Z2G A;  5J6E A;  1C9H A;  3ARX A;  3RM9 A;  4DZ2 A;  4R5E A;  3KAI A;  3WKZ A;  1YAT A;  3UF8 A;  2Y78 A;  4DRP A;  1FKH A;  3FAP A;  4Q22 A;  4TNS A;  4NSB A;  4PTM A;  4GGQ A;  5BXJ A;  3UQA A;  1SR0 A;  3ARS A;  2A3B A;  1W1P A;  1W9V A;  2PPO A;  1P5Q A;  4IT4 A;  3RM8 A;  3CHE A;  1FKR A;  3ART A;  4IQ2 A;  3PRD A;  4HBE A;  2DG4 A;  4DRM A;  4HBO A;  1EDQ A;  2RSE A;  4MTV A;  2PPP A;  5I98 A;  4ODK A;  3MDY B;  4WKA A;  2Q5A A;  3WQW A;  3O5G A;  2B31 A;  4G2P A;  3OA5 A;  1R9H A;  2MF9 A;  5DIU A;  3CHF A;  1E6Z A;  1FKD A;  3O5O A;  1FKG A;  2VN1 A;  1JNE A;  3PRB A;  5HW8 A;  3O5J A;  3B9E A;  4WKH A;  2OLH A;  3O5R A;  2LPV A;  1UR8 A;  1W1V A;  3GPK A;  3ODK A;  1ZBK A;  3B8S A;  2DT0 A;  3WD1 A;  1F8A B;  1QPF A;  2DT3 A;  4LAV A;  5HUA A;  1HKJ A;  3EY6 A;  4W9O A;  3VAW A;  2DSW A;  3O5I A;  2IF4 A;  2LJ4 A;  1O6I A;  3ARV A;  1NSG A;  3NI6 A;  2FKE A;  2PBC A;  3WD4 A;  4WK9 A;  1LL4 A;  2RUQ A;  3KAD A;  4LAW A;  2G8Z A;  3LUO A;  3O5D A;  1E9L A;  2P4V A;  3UQI A;  3OOB A;  1RD6 A;  4XAK A;  4TW6 A;  5DO2 A;  1QPL A;  2KGJ A;  2WLY A;  1JVW A;  2L2S A;  4JFM A;  2F23 A;  1D7I A;  3BMB A;  5HWB A;  4BF8 A;  2AWG A;  3CHD A;  1GUV A;  4FN2 A;  5GQB A;  1E44 A;  4DWS C;  1FKJ A;  1B6C A;  2ESC A;  1CTN A;  4U86 A;  2MLY A;  1YW5 A;  3CZ8 A;  1LQ0 A;  4DT4 A;  2MPH A;  2WK2 A;  4W9Q A;  4WIW A;  5HKG A;  4TYO A;  2M1I A;  4S3J A;  1L1P A;  2EUL A;  1W1Y A;  1D7H A;  1HKK A;  5HBF A;  1X6N A;  3CGM A;  1QZ2 A;  4Z2J A;  1ZB5 A;  2IUZ A;  2KO7 A;  1E6R A;  1LG2 A; 
#chains in the Genus database with same CATH homology
 2MLZ A;  3IHZ A;  2DT1 A;  4ODM A;  3O5K A;  2WM0 A;  1Q6H A;  3RM4 A;  4N19 A;  4P8U A;  4C02 B;  1H0I A;  4DRJ A;  3AS1 A;  1WB0 A;  5GPR A;  4W9P A;  1HJV A;  1FKK A;  3ALF A;  1D7J A;  1U79 A;  3CH9 A;  3JYM A;  1TCO C;  4S3K A;  1K9T A;  2YBT A;  4LGX A;  4KR0 B;  4ODO A;  2AOS A;  1EIB A;  2RUD A;  2LGO A;  3ARQ A;  4TW8 A;  4U84 A;  4DH0 A;  2ZR6 A;  1OGG A;  3RFW A;  2A3A A;  3PRA A;  2A3E A;  3RGC A;  2XPB A;  4P8X A;  1NWU A;  1W9U A;  4O2T A;  2OFN A;  3O5L A;  2PV2 A;  1OWQ A;  4MNK A;  4QIB A;  1HJX A;  3WL1 A;  1ZK6 A;  2XP6 A;  1Q1C A;  2ZQS A;  3G6L A;  1VF8 A;  2DT2 A;  1W1T A;  4JYS A;  4MAV A;  3IKG A;  4DZ3 A;  4IPX A;  4QT3 A;  1ROT A;  3WD0 A;  3ARU A;  4ZPT R;  4DWS B;  1Q6I A;  4ODL A;  1TFV A;  2ZR4 A;  4URI A;  4QT2 A;  1J4I A;  2LKN A;  3ARP A;  1E6P A;  2UZ5 A;  4DRH A;  3ALG A;  1XRV A;  3FY1 A;  1ROU A;  1FKF A;  3KCE A;  3PA7 A;  1BL4 A;  5D75 A;  1GOI A;  3WQV A;  5B8I C;  4MNJ A;  1XHG A;  3AS3 A;  4IT6 A;  3BXW A;  2O92 A;  3KAF A;  1E15 A;  3WIJ A;  2DSV A;  4KQZ A;  3UI5 A;  4ML4 A;  3WD2 A;  2ZQV A;  3O5M A;  4FAP A;  4ITZ A;  1NMW A;  4IQC A;  1KT1 A;  2ZR5 A;  1FKI A;  4J4O A;  4ODN A;  3WL0 A;  1PIN A;  2RQS A;  3ARZ A;  4W5U A;  4TW7 A;  4G50 A;  3O5P A;  4LAY A;  1PBK A;  1SYT A;  1FKL A;  1Q6U A;  4ZPW R;  4ZPV R;  1NWS A;  3KAB A;  4ZS6 A;  2KFW A;  3ARO A;  1KFW A;  3KAG A;  2M2A A;  2KR7 A;  3IKD A;  1GPF A;  3QOK A;  5HT1 A;  1UR9 A;  2RUR A;  4J4N A;  4LAX A;  4MGV A;  4ODQ A;  4WJX A;  1T11 A;  2ZQT A;  2XPA A;  4P8W A;  2XP5 A;  4DRI A;  5HW6 A;  1ZBV A;  1NMV A;  1NH6 A;  1LL7 A;  1J4R A;  4MNL A;  1LG1 A;  3TDB A;  1HKI A;  1ITX A;  4MSP A;  4Z2I A;  4Z2L A;  1ZBW A;  3ARW A;  2K8I A;  4NNR A;  5GPG A;  1F40 A;  2MNT A;  2PI6 A;  1NWR A;  2D9F A;  1EYM A;  4JFL A;  2PPN A;  1HKM A;  4JFJ A;  4ODP A;  1Y0O A;  4JFK A;  5HW7 A;  3B7X A;  2RUC A;  1FFR A;  1JND A;  3UQB A;  3UI6 A;  4Z2H A;  3ARR A;  5HTG A;  1E6N A;  2ZQU A;  1JNT A;  4Q7N A;  4L72 B;  1HJW A;  1LL6 A;  3AS2 A;  1N1A A;  3UI4 A;  2YBU A;  1WNO A;  3NRK A;  3TC5 A;  3O5E A;  4JFI A;  1FD9 A;  2N87 A;  3CGN A;  4L3N A;  1IX5 A;  2F4E A;  1LJY A;  1J6Y A;  3CHC A;  3KAC A;  1D6O A;  1ZCN A;  2XP8 A;  2DG3 A;  4HAR A;  2QF8 A;  4TX0 A;  2VCD A;  3I6C A;  2WLZ A;  3B9A A;  4P8V A;  3WH0 A;  4U85 A;  3TCZ A;  1D2K A;  1ZU8 A;  3RME A;  5HWC A;  2G41 A;  3WD3 A;  1NWT A;  4ODR A;  3B9D A;  3IK8 A;  2XP4 A;  4NZC A;  5DIT A;  3AQU A;  1FKT A;  1X6L A;  1BKF A;  1EQ3 A;  2DSZ A;  4R0X A;  4Z2K A;  4DWS D;  1W26 A;  1KT0 A;  3G6M A;  1ZL1 A;  4GIV A;  1JNS A;  3NTP A;  2ITK A;  2O9O A;  2M08 A;  1ZBC A;  1EHN A;  2PV1 A;  1FAP A;  4MPK A;  4DWS A;  2XP7 A;  2KE0 A;  3H9R B;  5JH8 A;  2MLX A;  4MNM A;  2DPE A;  1FFQ A;  4DRQ A;  1W9P A;  5DF0 A;  2XP3 A;  3FXY A;  2DG9 A;  2KI3 A;  4DRK A;  3JYJ A;  3JXV A;  1H0G A;  4AY1 A;  4DIP A;  2JZV A;  3KZ7 A;  5DIV A;  2F21 A;  2F2D A;  4QZV B;  1FKB A;  3O5F A;  2A3C A;  3O5Q A;  3W4R A;  1A7X A;  1WAW A;  1J4H A;  1OGB A;  3AS0 A;  4DRN A;  1M5Y A;  3ARY A;  2FDM A;  4DRO A;  2FAP A;  1FJD A;  4WKF A;  5DEZ A;  3PR9 A;  1FKS A;  2XP9 A;  2PV3 A;  2DSU A;  3KAH A;  1HXV A;  4Z2G A;  5J6E A;  1C9H A;  3ARX A;  3RM9 A;  4DZ2 A;  4R5E A;  3KAI A;  3WKZ A;  1YAT A;  3UF8 A;  2Y78 A;  4DRP A;  1FKH A;  3FAP A;  4Q22 A;  4TNS A;  4NSB A;  4PTM A;  4GGQ A;  5BXJ A;  3UQA A;  1SR0 A;  3ARS A;  2A3B A;  1W1P A;  1W9V A;  2PPO A;  1P5Q A;  4IT4 A;  3RM8 A;  3CHE A;  1FKR A;  3ART A;  4IQ2 A;  3PRD A;  4HBE A;  2DG4 A;  4DRM A;  4HBO A;  1EDQ A;  2RSE A;  4MTV A;  2PPP A;  5I98 A;  4ODK A;  3MDY B;  4WKA A;  2Q5A A;  3WQW A;  3O5G A;  2B31 A;  4G2P A;  3OA5 A;  1R9H A;  2MF9 A;  5DIU A;  3CHF A;  1E6Z A;  1FKD A;  3O5O A;  1FKG A;  2VN1 A;  1JNE A;  3PRB A;  5HW8 A;  3O5J A;  3B9E A;  4WKH A;  2OLH A;  3O5R A;  2LPV A;  1UR8 A;  1W1V A;  3GPK A;  3ODK A;  1ZBK A;  3B8S A;  2DT0 A;  3WD1 A;  1F8A B;  1QPF A;  2DT3 A;  4LAV A;  5HUA A;  1HKJ A;  3EY6 A;  4W9O A;  3VAW A;  2DSW A;  3O5I A;  2IF4 A;  2LJ4 A;  1O6I A;  3ARV A;  1NSG A;  3NI6 A;  2FKE A;  2PBC A;  3WD4 A;  4WK9 A;  1LL4 A;  2RUQ A;  3KAD A;  4LAW A;  2G8Z A;  3LUO A;  3O5D A;  1E9L A;  3UQI A;  3OOB A;  1RD6 A;  4XAK A;  4TW6 A;  5DO2 A;  1QPL A;  2KGJ A;  2WLY A;  1JVW A;  2L2S A;  4JFM A;  1D7I A;  5HWB A;  4BF8 A;  2AWG A;  3CHD A;  1GUV A;  4FN2 A;  5GQB A;  4DWS C;  1FKJ A;  1B6C A;  2ESC A;  1CTN A;  4U86 A;  2MLY A;  1YW5 A;  3CZ8 A;  1LQ0 A;  4DT4 A;  2MPH A;  2WK2 A;  4W9Q A;  4WIW A;  5HKG A;  4TYO A;  2M1I A;  4S3J A;  1L1P A;  1W1Y A;  1D7H A;  1HKK A;  5HBF A;  1X6N A;  3CGM A;  1QZ2 A;  4Z2J A;  1ZB5 A;  2IUZ A;  2KO7 A;  1E6R A;  1LG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...