3JYJA

Structure-based design of novel pin1 inhibitors (ii)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
113
structure length
113
Chain Sequence
b'EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-based design of novel human Pin1 inhibitors (II).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 40
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3jyjA00
4W9QA 4G50A 1C9HA 1JVWA 3UI4A 1KT0A 1Q6HA 1Y0OA 2RUQA 2OFNA 4J4NA 2ZQUA 2M2AA 4DRQA 3O5FA 3KADA 3UQIA 1F8AB 2MLZA 3PRBA 2ZQSA 3H9RB 3O5IA 3KACA 1ZK6A 4LAWA 3RFWA 2KE0A 4JFMA 1FKKA 2KO7A 5HW7A 1FKLA 3EY6A 1Q1CA 1EQ3A 1TCOC 1N1AA 4IQCA 1D6OA 1QZ2A 4ODRA 2KI3A 1D7HA 5HTGA 3KAHA 4ODQA 4FAPA 3WH0A 1J4RA 1Q6IA 3TC5A 1J4HA 5I98A 4TW8A 3IK8A 3O5OA 1U79A 2F21A 2Q5AA 5D75A 1NMWA 2DG3A 4ITZA 4FN2A 4GIVA 4W9PA 4DRMA 1FKGA 3PA7A 2XP4A 2RQSA 3JYMA 4JFJA 4R0XA 2ITKA 4JFIA 1FKSA 2FKEA 2MNTA 2MLYA 4DRHA 2RUDA 3IKGA 4NNRA 4DROA 5HUAA 1Q6UA 2L2SA 2MPHA 3KABA 3O5LA 1NSGA 1NMVA 3UF8A 2XP9A 2PV1A 3O5PA 5DIUA 1JNSA 3O5EA 4G2PA 5B8IC 2ZR4A 1JNTA 3OOBA 3CGNA 2ZQTA 3GPKA 1FKRA 5HW8A 4TX0A 3NRKA 3IHZA 3I6CA 3JYJA 4QIBA 2RUCA 2F2DA 4DT4A 4W9OA 4ODKA 5GPGA 3PRDA 4O2TA 1HXVA 2VN1A 3UQBA 1QPLA 2ZR5A 2KR7A 4DRJA 4ODPA 2ZR6A 3NTPA 1PINA 4LAVA 3B7XA 4IPXA 5J6EA 2KGJA 2KFWA 4JFLA 1FKBA 1YATA 2AWGA 4QT2A 2LJ4A 2XP8A 1FKJA 2XPAA 4DRNA 1BL4A 4U85A 4DRIA 4DIPA 1R9HA 4TNSA 4TW7A 4C02B 1PBKA 4ODLA 2N87A 1F40A 2MLXA 1ROUA 2XP5A 1A7XA 1EYMA 2K8IA 1ROTA 1D7IA 3TDBA 5HT1A 3VAWA 5HWCA 4U84A 3KAFA 5DITA 2VCDA 3O5GA 4DRPA 1FAPA 2F4EA 5BXJA 2XP7A 2RURA 2M08A 2UZ5A 3KAIA 4GGQA 1FKDA 2RSEA 4J4OA 5HW6A 1ZCNA 4QT3A 2Y78A 3LUOA 1L1PA 1YW5A 2LKNA 2ZQVA 3O5DA 2LGOA 4IQ2A 2PPNA 3IKDA 3KAGA 4LAXA 1FJDA 2LPVA 3O5MA 3TCZA 1D7JA 3UI6A 1FKFA 4N19A 4TW6A 3MDYB 4ODMA 2PBCA 3NI6A 3O5QA 3O5JA 4LAYA 5DIVA 2DG9A 2PV2A 2XP3A 3ODKA 1BKFA 1FKHA 1QPFA 1FD9A 2XP6A 4MGVA 4DZ2A 4BF8A 2D9FA 1T11A 2IF4A 1J4IA 3KZ7A 4ODOA 2JZVA 1FKIA 5HWBA 3KCEA 3RGCA 4DH0A 2FAPA 3UQAA 2PV3A 2PPOA 4ODNA 4DRKA 1W26A 4U86A 4TYOA 4MSPA 1M5YA 4JFKA 1B6CA 3O5RA 3FAPA 2XPBA 4JYSA 2MF9A 4DZ3A 2PPPA 1FKTA 3O5KA 5HKGA 2DG4A 1KT1A 1P5QA 2M1IA 3CGMA 3UI5A 3JXVA 1J6YA
chains in the Genus database with same CATH superfamily
1EIBA 1WB0A 4W9QA 4W5UA 2B5UB 3O5FA 2MLZA 2OLHA 2ZQSA 1ITXA 1ZK6A 4JFMA 1FKKA 3WD2A 4MAVA 1QZ2A 3B9EA 1UR8A 3TC5A 1J4HA 5I98A 5D75A 2Q5AA 1NMWA 4ITZA 4GIVA 4Q7NA 2RQSA 3GU0A 4JFIA 1FKSA 1HJWA 2MNTA 1VF8A 4Q22A 3WD1A 1NSGA 3UF8A 4LGXA 3O5PA 3ARZA 1JNSA 5B8IC 2ZR4A 3GPKA 2B31A 2FDMA 1LJYA 1KFWA 2F2DA 4DT4A 3ARYA 3ARUA 2VN1A 3UQBA 4DRJA 4LAVA 1PINA 1HKJA 3RM4A 3OA5A 4QT2A 3BXWA 2DT2A 4DIPA 1EHNA 4TNSA 4TW7A 3WL0A 1F40A 3CHDA 1A7XA 2K8IA 2IUZA 1NWUA 5HT1A 2P4VA 1W9UA 1SYTA 4DRPA 2F4EA 2DSZA 1X6LA 4GGQA 1FKDA 4J4OA 4QT3A 2Y78A 2WLZA 2ZQVA 3RM8A 1X6NA 1FKFA 4Z2JA 4ODMA 4MNKA 1TFVA 1ZU8A 3ODKA 1FD9A 4MGVA 1SR0A 2D9FA 3B9AA 1FKIA 4HBOA 3KCEA 2PI6A 4WIWA 2PV3A 3ARVA 2QF8A 4DRKA 1W26A 1E6PA 1B6CA 4P8WA 2XPBA 1E6NA 2DG4A 1P5QA 4IT6A 2A3AA 1E6RA 3UI4A 4ZPTR 2WM0A 2ZQUA 2M2AA 4DRQA 1H0IA 3KADA 3PRBA 4DWSC 3O5IA 3KACA 3G6MA 2DSUA 5HW7A 5GPRA 1UR9A 1N1AA 4ODRA 2KI3A 1O6IA 4IT4A 5HTGA 2EULA 4FAPA 3ARSA 3IK8A 1U79A 3CHCA 4FN2A 1NWTA 3WIJA 3JYMA 4JFJA 2DT1A 4R0XA 2ITKA 3W4RA 2FKEA 3CH9A 4ZPWR 3IKGA 2L2SA 3O5LA 3B8SA 2O92A 2ESCA 3ALGA 2WK2A 4S3KA 4G2PA 2YBTA 1GUVA 3CGNA 2ZQTA 4TX0A 3IHZA 3I6CA 3JYJA 2DSVA 4S3JA 2RUCA 3ARWA 4WKFA 2DSWA 3BMBA 3PRDA 4O2TA 5GPGA 1HXVA 2ZR5A 2KR7A 2ZR6A 4IPXA 4Z2LA 1OWQA 5J6EA 2KFWA 1FKBA 1YATA 2AWGA 2XPAA 3WL1A 4U85A 1EDQA 3AS3A 2N87A 3CHEA 2MLXA 1D2KA 4R5EA 4U84A 3KAFA 5DITA 3ALFA 3B9DA 2UZ5A 4P8VA 4WKAA 4P8UA 3LUOA 4Z2IA 2LKNA 3O5DA 4IQ2A 1JNDA 4LAXA 2LPVA 3TCZA 3UI6A 4N19A 1FFRA 3NI6A 2F23A 2DT3A 1GRJA 1LG2A 4P8XA 4LAYA 1FKHA 1T11A 4DWSD 3RM9A 1HKKA 4MNLA 4TYOA 1M5YA 4JFKA 2G41A 3ARPA 3FAPA 4JYSA 1HJXA 3ARXA 1W1YA 4URIA 1KT1A 2M1IA 3AROA 2DPEA 3JXVA 2YBUA 1RD6A 4G50A 1C9HA 1JVWA 1KT0A 2PN0A 1Y0OA 3UQIA 1F8AB 4LAWA 3H9RB 3RFWA 4KR0B 1FKLA 3EY6A 1Q1CA 1EQ3A 3WQWA 3WH0A 1J4RA 1E6ZA 4TW8A 5BXJA 3O5OA 1HKIA 2F21A 4WJXA 2DG3A 1ZL1A 2ETNA 4DRMA 5DF0A 2MLYA 4NNRA 4MTVA 1Q6UA 4WKHA 1NMVA 3CHFA 4L72B 1JCHB 2XP9A 2PV1A 1LG1A 1IX5A 2A3CA 3AS2A 3O5EA 1JNTA 5HW8A 1OGBA 3NRKA 4QIBA 3QOKA 1ZB5A 4ODKA 3RMEA 1QPLA 3NTPA 1ZBCA 2KGJA 2LJ4A 1FKJA 1BL4A 4Z2HA 1PBKA 1E15A 1EYMA 1ROTA 1D7IA 3TDBA 3CZ8A 2XP7A 3KAIA 2RSEA 1W9PA 1LL6A 2LGOA 3IKDA 3KAGA 3O5MA 1FFQA 1NH6A 2O9OA 3FY1A 3PR9A 4TW6A 1H0GA 3PRAA 2PBCA 3WD4A 4QZVB 4NZCA 2PV2A 4ML4A 4DWSA 1CTNA 2XP6A 4DZ2A 4ODOA 4ZS6A 2JZVA 4DH0A 2PPOA 3ARRA 1HJVA 1LL4A 3WQVA 3AS0A 3WD0A 3O5RA 4MPKA 4DZ3A 1NWSA 3UI5A 3CGMA 3G6LA 1J6YA 4ZPVR 1Q6HA 2RUQA 2OFNA 4J4NA 3ARQA 1ZBVA 2G8ZA 1LQ0A 2KE0A 2KO7A 1TCOC 4IQCA 1D6OA 5DEZA 1HKMA 3FXYA 1D7HA 1W1VA 3KAHA 4ODQA 1Q6IA 5DO2A 4C02B 4Z2KA 2WLYA 4W9PA 2A3BA 4NSBA 4WK9A 1FKGA 3PA7A 2XP4A 4XAKA 4DWSB 1ZBWA 4DRHA 2RUDA 4DROA 3AQUA 1WAWA 5HUAA 2MPHA 3KABA 4UDMA 3GTYX 4HARA 3EIPA 4KQZA 5JH8A 5DIUA 3ARTA 1LL7A 3AS1A 3OOBA 1FKRA 5GQBA 4W9OA 1XHGA 2DT0A 1E44A 1JNEA 1GOIA 1W9VA 1OGGA 4ODPA 3B7XA 3WD3A 2A3EA 4JFLA 1NWRA 3WKZA 1XRVA 2XP8A 4DRNA 4DRIA 1R9HA 4ODLA 1ROUA 2XP5A 1E9LA 4MNMA 4L3NA 3VAWA 5HWCA 2VCDA 3O5GA 1FAPA 1W1TA 2RURA 2M08A 4AY1A 1GPFA 5HW6A 1ZCNA 1L1PA 1WNOA 1YW5A 2PPNA 1FJDA 4Z2GA 1D7JA 3MDYB 4PTMA 1K9TA 3O5QA 3O5JA 5DIVA 2DG9A 2XP3A 1BKFA 1QPFA 2AOSA 4BF8A 1ZBKA 1J4IA 2IF4A 3KZ7A 5HWBA 3RGCA 2FAPA 3UQAA 4ODNA 4MNJA 1W1PA 4U86A 4MSPA 5HBFA 2MF9A 2PPPA 1FKTA 3O5KA 5HKGA 4HBEA
chains in the Genus database with same CATH topology
1EIBA 1WB0A 4W9QA 4W5UA 3O5FA 2MLZA 2OLHA 2ZQSA 1ITXA 1ZK6A 4JFMA 1FKKA 3WD2A 4MAVA 1QZ2A 3B9EA 1UR8A 3TC5A 1J4HA 5I98A 5D75A 2Q5AA 1NMWA 4ITZA 4GIVA 4Q7NA 2RQSA 4JFIA 1FKSA 1HJWA 2MNTA 1VF8A 4Q22A 3WD1A 1NSGA 3UF8A 4LGXA 3O5PA 3ARZA 1JNSA 5B8IC 2ZR4A 3GPKA 2B31A 2FDMA 1LJYA 1KFWA 2F2DA 4DT4A 3ARYA 3ARUA 2VN1A 3UQBA 4DRJA 4LAVA 1PINA 1HKJA 3RM4A 3OA5A 4QT2A 3BXWA 2DT2A 4DIPA 1EHNA 4TNSA 4TW7A 3WL0A 1F40A 3CHDA 1A7XA 2K8IA 2IUZA 1NWUA 5HT1A 1W9UA 1SYTA 4DRPA 2F4EA 2DSZA 1X6LA 4GGQA 1FKDA 4J4OA 4QT3A 2Y78A 2WLZA 2ZQVA 3RM8A 1X6NA 1FKFA 4Z2JA 4ODMA 4MNKA 1TFVA 1ZU8A 3ODKA 1FD9A 4MGVA 1SR0A 2D9FA 3B9AA 1FKIA 4HBOA 3KCEA 2PI6A 4WIWA 2PV3A 3ARVA 2QF8A 4DRKA 1W26A 1E6PA 1B6CA 4P8WA 2XPBA 1E6NA 2DG4A 1P5QA 4IT6A 2A3AA 1E6RA 3UI4A 4ZPTR 2WM0A 2ZQUA 2M2AA 4DRQA 1H0IA 3KADA 3PRBA 4DWSC 3O5IA 3KACA 3G6MA 2DSUA 5HW7A 5GPRA 1UR9A 1N1AA 4ODRA 2KI3A 1O6IA 4IT4A 5HTGA 4FAPA 3ARSA 3IK8A 1U79A 3CHCA 4FN2A 1NWTA 3WIJA 3JYMA 4JFJA 2DT1A 4R0XA 2ITKA 3W4RA 2FKEA 3CH9A 4ZPWR 3IKGA 2L2SA 3O5LA 3B8SA 2O92A 2ESCA 3ALGA 2WK2A 4S3KA 4G2PA 2YBTA 1GUVA 3CGNA 2ZQTA 4TX0A 3IHZA 3I6CA 3JYJA 2DSVA 4S3JA 2RUCA 3ARWA 4WKFA 2DSWA 3PRDA 4O2TA 5GPGA 1HXVA 2ZR5A 2KR7A 2ZR6A 4IPXA 4Z2LA 1OWQA 5J6EA 2KFWA 1FKBA 1YATA 2AWGA 2XPAA 3WL1A 4U85A 1EDQA 3AS3A 2N87A 3CHEA 2MLXA 1D2KA 4R5EA 4U84A 3KAFA 5DITA 3ALFA 3B9DA 2UZ5A 4P8VA 4WKAA 4P8UA 3LUOA 4Z2IA 2LKNA 3O5DA 4IQ2A 1JNDA 4LAXA 2LPVA 3TCZA 3UI6A 4N19A 1FFRA 3NI6A 2DT3A 1LG2A 4P8XA 4LAYA 1FKHA 1T11A 4DWSD 3RM9A 1HKKA 4MNLA 4TYOA 1M5YA 4JFKA 2G41A 3ARPA 3FAPA 4JYSA 1HJXA 3ARXA 1W1YA 4URIA 1KT1A 2M1IA 3AROA 2DPEA 3JXVA 2YBUA 1RD6A 4G50A 1C9HA 1JVWA 1KT0A 1Y0OA 3UQIA 1F8AB 4LAWA 3H9RB 3RFWA 4KR0B 1FKLA 3EY6A 1Q1CA 1EQ3A 3WQWA 3WH0A 1J4RA 1E6ZA 4TW8A 5BXJA 3O5OA 1HKIA 2F21A 4WJXA 2DG3A 1ZL1A 4DRMA 5DF0A 2MLYA 4NNRA 4MTVA 1Q6UA 4WKHA 1NMVA 3CHFA 4L72B 2XP9A 2PV1A 1LG1A 1IX5A 2A3CA 3AS2A 3O5EA 1JNTA 5HW8A 1OGBA 3NRKA 4QIBA 3QOKA 1ZB5A 4ODKA 3RMEA 1QPLA 3NTPA 1ZBCA 2KGJA 2LJ4A 1FKJA 1BL4A 4Z2HA 1PBKA 1E15A 1EYMA 1ROTA 1D7IA 3TDBA 3CZ8A 2XP7A 3KAIA 2RSEA 1W9PA 1LL6A 2LGOA 3IKDA 3KAGA 3O5MA 1FFQA 1NH6A 2O9OA 3FY1A 3PR9A 4TW6A 1H0GA 3PRAA 2PBCA 3WD4A 4QZVB 4NZCA 2PV2A 4ML4A 4DWSA 1CTNA 2XP6A 4DZ2A 4ODOA 4ZS6A 2JZVA 4DH0A 2PPOA 3ARRA 1HJVA 1LL4A 3WQVA 3AS0A 3WD0A 3O5RA 4MPKA 4DZ3A 1NWSA 3UI5A 3CGMA 3G6LA 1J6YA 4ZPVR 1Q6HA 2RUQA 2OFNA 4J4NA 3ARQA 1ZBVA 2G8ZA 1LQ0A 2KE0A 2KO7A 1TCOC 4IQCA 1D6OA 5DEZA 1HKMA 3FXYA 1D7HA 1W1VA 3KAHA 4ODQA 1Q6IA 5DO2A 4C02B 4Z2KA 2WLYA 4W9PA 2A3BA 4NSBA 4WK9A 1FKGA 3PA7A 2XP4A 4XAKA 4DWSB 1ZBWA 4DRHA 2RUDA 4DROA 3AQUA 1WAWA 5HUAA 2MPHA 3KABA 4HARA 4KQZA 5JH8A 5DIUA 3ARTA 1LL7A 3AS1A 3OOBA 1FKRA 5GQBA 4W9OA 1XHGA 2DT0A 1JNEA 1GOIA 1W9VA 1OGGA 4ODPA 3B7XA 3WD3A 2A3EA 4JFLA 1NWRA 3WKZA 1XRVA 2XP8A 4DRNA 4DRIA 1R9HA 4ODLA 1ROUA 2XP5A 1E9LA 4MNMA 4L3NA 3VAWA 5HWCA 2VCDA 3O5GA 1FAPA 1W1TA 2RURA 2M08A 4AY1A 1GPFA 5HW6A 1ZCNA 1L1PA 1WNOA 1YW5A 2PPNA 1FJDA 4Z2GA 1D7JA 3MDYB 4PTMA 1K9TA 3O5QA 3O5JA 5DIVA 2DG9A 2XP3A 1BKFA 1QPFA 2AOSA 4BF8A 1ZBKA 1J4IA 2IF4A 3KZ7A 5HWBA 3RGCA 2FAPA 3UQAA 4ODNA 4MNJA 1W1PA 4U86A 4MSPA 5HBFA 2MF9A 2PPPA 1FKTA 3O5KA 5HKGA 4HBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9Q A;  4G50 A;  1C9H A;  1JVW A;  3UI4 A;  1KT0 A;  1Q6H A;  1Y0O A;  2RUQ A;  2OFN A;  4J4N A;  2ZQU A;  2M2A A;  4DRQ A;  3O5F A;  3KAD A;  3UQI A;  1F8A B;  2MLZ A;  3PRB A;  2ZQS A;  3H9R B;  3O5I A;  3KAC A;  1ZK6 A;  4LAW A;  3RFW A;  2KE0 A;  4JFM A;  1FKK A;  2KO7 A;  5HW7 A;  1FKL A;  3EY6 A;  1Q1C A;  1EQ3 A;  1TCO C;  1N1A A;  4IQC A;  1D6O A;  1QZ2 A;  4ODR A;  2KI3 A;  1D7H A;  5HTG A;  3KAH A;  4ODQ A;  4FAP A;  3WH0 A;  1J4R A;  1Q6I A;  3TC5 A;  1J4H A;  5I98 A;  4TW8 A;  3IK8 A;  3O5O A;  1U79 A;  2F21 A;  2Q5A A;  5D75 A;  1NMW A;  2DG3 A;  4ITZ A;  4FN2 A;  4GIV A;  4W9P A;  4DRM A;  1FKG A;  3PA7 A;  2XP4 A;  2RQS A;  3JYM A;  4JFJ A;  4R0X A;  2ITK A;  4JFI A;  1FKS A;  2FKE A;  2MNT A;  2MLY A;  4DRH A;  2RUD A;  3IKG A;  4NNR A;  4DRO A;  5HUA A;  1Q6U A;  2L2S A;  2MPH A;  3KAB A;  3O5L A;  1NSG A;  1NMV A;  3UF8 A;  2XP9 A;  2PV1 A;  3O5P A;  5DIU A;  1JNS A;  3O5E A;  4G2P A;  5B8I C;  2ZR4 A;  1JNT A;  3OOB A;  3CGN A;  2ZQT A;  3GPK A;  1FKR A;  5HW8 A;  4TX0 A;  3NRK A;  3IHZ A;  3I6C A;  3JYJ A;  4QIB A;  2RUC A;  2F2D A;  4DT4 A;  4W9O A;  4ODK A;  5GPG A;  3PRD A;  4O2T A;  1HXV A;  2VN1 A;  3UQB A;  1QPL A;  2ZR5 A;  2KR7 A;  4DRJ A;  4ODP A;  2ZR6 A;  3NTP A;  1PIN A;  4LAV A;  3B7X A;  4IPX A;  5J6E A;  2KGJ A;  2KFW A;  4JFL A;  1FKB A;  1YAT A;  2AWG A;  4QT2 A;  2LJ4 A;  2XP8 A;  1FKJ A;  2XPA A;  4DRN A;  1BL4 A;  4U85 A;  4DRI A;  4DIP A;  1R9H A;  4TNS A;  4TW7 A;  4C02 B;  1PBK A;  4ODL A;  2N87 A;  1F40 A;  2MLX A;  1ROU A;  2XP5 A;  1A7X A;  1EYM A;  2K8I A;  1ROT A;  1D7I A;  3TDB A;  5HT1 A;  3VAW A;  5HWC A;  4U84 A;  3KAF A;  5DIT A;  2VCD A;  3O5G A;  4DRP A;  1FAP A;  2F4E A;  5BXJ A;  2XP7 A;  2RUR A;  2M08 A;  2UZ5 A;  3KAI A;  4GGQ A;  1FKD A;  2RSE A;  4J4O A;  5HW6 A;  1ZCN A;  4QT3 A;  2Y78 A;  3LUO A;  1L1P A;  1YW5 A;  2LKN A;  2ZQV A;  3O5D A;  2LGO A;  4IQ2 A;  2PPN A;  3IKD A;  3KAG A;  4LAX A;  1FJD A;  2LPV A;  3O5M A;  3TCZ A;  1D7J A;  3UI6 A;  1FKF A;  4N19 A;  4TW6 A;  3MDY B;  4ODM A;  2PBC A;  3NI6 A;  3O5Q A;  3O5J A;  4LAY A;  5DIV A;  2DG9 A;  2PV2 A;  2XP3 A;  3ODK A;  1BKF A;  1FKH A;  1QPF A;  1FD9 A;  2XP6 A;  4MGV A;  4DZ2 A;  4BF8 A;  2D9F A;  1T11 A;  2IF4 A;  1J4I A;  3KZ7 A;  4ODO A;  2JZV A;  1FKI A;  5HWB A;  3KCE A;  3RGC A;  4DH0 A;  2FAP A;  3UQA A;  2PV3 A;  2PPO A;  4ODN A;  4DRK A;  1W26 A;  4U86 A;  4TYO A;  4MSP A;  1M5Y A;  4JFK A;  1B6C A;  3O5R A;  3FAP A;  2XPB A;  4JYS A;  2MF9 A;  4DZ3 A;  2PPP A;  1FKT A;  3O5K A;  5HKG A;  2DG4 A;  1KT1 A;  1P5Q A;  2M1I A;  3CGM A;  3UI5 A;  3JXV A;  1J6Y A; 
#chains in the Genus database with same CATH topology
 1EIB A;  1WB0 A;  4W9Q A;  4W5U A;  2B5U B;  3O5F A;  2MLZ A;  2OLH A;  2ZQS A;  1ITX A;  1ZK6 A;  4JFM A;  1FKK A;  3WD2 A;  4MAV A;  1QZ2 A;  3B9E A;  1UR8 A;  3TC5 A;  1J4H A;  5I98 A;  5D75 A;  2Q5A A;  1NMW A;  4ITZ A;  4GIV A;  4Q7N A;  2RQS A;  3GU0 A;  4JFI A;  1FKS A;  1HJW A;  2MNT A;  1VF8 A;  4Q22 A;  3WD1 A;  1NSG A;  3UF8 A;  4LGX A;  3O5P A;  3ARZ A;  1JNS A;  5B8I C;  2ZR4 A;  3GPK A;  2B31 A;  2FDM A;  1LJY A;  1KFW A;  2F2D A;  4DT4 A;  3ARY A;  3ARU A;  2VN1 A;  3UQB A;  4DRJ A;  4LAV A;  1PIN A;  1HKJ A;  3RM4 A;  3OA5 A;  4QT2 A;  3BXW A;  2DT2 A;  4DIP A;  1EHN A;  4TNS A;  4TW7 A;  3WL0 A;  1F40 A;  3CHD A;  1A7X A;  2K8I A;  2IUZ A;  1NWU A;  5HT1 A;  2P4V A;  1W9U A;  1SYT A;  4DRP A;  2F4E A;  2DSZ A;  1X6L A;  4GGQ A;  1FKD A;  4J4O A;  4QT3 A;  2Y78 A;  2WLZ A;  2ZQV A;  3RM8 A;  1X6N A;  1FKF A;  4Z2J A;  4ODM A;  4MNK A;  1TFV A;  1ZU8 A;  3ODK A;  1FD9 A;  4MGV A;  1SR0 A;  2D9F A;  3B9A A;  1FKI A;  4HBO A;  3KCE A;  2PI6 A;  4WIW A;  2PV3 A;  3ARV A;  2QF8 A;  4DRK A;  1W26 A;  1E6P A;  1B6C A;  4P8W A;  2XPB A;  1E6N A;  2DG4 A;  1P5Q A;  4IT6 A;  2A3A A;  1E6R A;  3UI4 A;  4ZPT R;  2WM0 A;  2ZQU A;  2M2A A;  4DRQ A;  1H0I A;  3KAD A;  3PRB A;  4DWS C;  3O5I A;  3KAC A;  3G6M A;  2DSU A;  5HW7 A;  5GPR A;  1UR9 A;  1N1A A;  4ODR A;  2KI3 A;  1O6I A;  4IT4 A;  5HTG A;  2EUL A;  4FAP A;  3ARS A;  3IK8 A;  1U79 A;  3CHC A;  4FN2 A;  1NWT A;  3WIJ A;  3JYM A;  4JFJ A;  2DT1 A;  4R0X A;  2ITK A;  3W4R A;  2FKE A;  3CH9 A;  4ZPW R;  3IKG A;  2L2S A;  3O5L A;  3B8S A;  2O92 A;  2ESC A;  3ALG A;  2WK2 A;  4S3K A;  4G2P A;  2YBT A;  1GUV A;  3CGN A;  2ZQT A;  4TX0 A;  3IHZ A;  3I6C A;  3JYJ A;  2DSV A;  4S3J A;  2RUC A;  3ARW A;  4WKF A;  2DSW A;  3BMB A;  3PRD A;  4O2T A;  5GPG A;  1HXV A;  2ZR5 A;  2KR7 A;  2ZR6 A;  4IPX A;  4Z2L A;  1OWQ A;  5J6E A;  2KFW A;  1FKB A;  1YAT A;  2AWG A;  2XPA A;  3WL1 A;  4U85 A;  1EDQ A;  3AS3 A;  2N87 A;  3CHE A;  2MLX A;  1D2K A;  4R5E A;  4U84 A;  3KAF A;  5DIT A;  3ALF A;  3B9D A;  2UZ5 A;  4P8V A;  4WKA A;  4P8U A;  3LUO A;  4Z2I A;  2LKN A;  3O5D A;  4IQ2 A;  1JND A;  4LAX A;  2LPV A;  3TCZ A;  3UI6 A;  4N19 A;  1FFR A;  3NI6 A;  2F23 A;  2DT3 A;  1GRJ A;  1LG2 A;  4P8X A;  4LAY A;  1FKH A;  1T11 A;  4DWS D;  3RM9 A;  1HKK A;  4MNL A;  4TYO A;  1M5Y A;  4JFK A;  2G41 A;  3ARP A;  3FAP A;  4JYS A;  1HJX A;  3ARX A;  1W1Y A;  4URI A;  1KT1 A;  2M1I A;  3ARO A;  2DPE A;  3JXV A;  2YBU A;  1RD6 A;  4G50 A;  1C9H A;  1JVW A;  1KT0 A;  2PN0 A;  1Y0O A;  3UQI A;  1F8A B;  4LAW A;  3H9R B;  3RFW A;  4KR0 B;  1FKL A;  3EY6 A;  1Q1C A;  1EQ3 A;  3WQW A;  3WH0 A;  1J4R A;  1E6Z A;  4TW8 A;  5BXJ A;  3O5O A;  1HKI A;  2F21 A;  4WJX A;  2DG3 A;  1ZL1 A;  2ETN A;  4DRM A;  5DF0 A;  2MLY A;  4NNR A;  4MTV A;  1Q6U A;  4WKH A;  1NMV A;  3CHF A;  4L72 B;  1JCH B;  2XP9 A;  2PV1 A;  1LG1 A;  1IX5 A;  2A3C A;  3AS2 A;  3O5E A;  1JNT A;  5HW8 A;  1OGB A;  3NRK A;  4QIB A;  3QOK A;  1ZB5 A;  4ODK A;  3RME A;  1QPL A;  3NTP A;  1ZBC A;  2KGJ A;  2LJ4 A;  1FKJ A;  1BL4 A;  4Z2H A;  1PBK A;  1E15 A;  1EYM A;  1ROT A;  1D7I A;  3TDB A;  3CZ8 A;  2XP7 A;  3KAI A;  2RSE A;  1W9P A;  1LL6 A;  2LGO A;  3IKD A;  3KAG A;  3O5M A;  1FFQ A;  1NH6 A;  2O9O A;  3FY1 A;  3PR9 A;  4TW6 A;  1H0G A;  3PRA A;  2PBC A;  3WD4 A;  4QZV B;  4NZC A;  2PV2 A;  4ML4 A;  4DWS A;  1CTN A;  2XP6 A;  4DZ2 A;  4ODO A;  4ZS6 A;  2JZV A;  4DH0 A;  2PPO A;  3ARR A;  1HJV A;  1LL4 A;  3WQV A;  3AS0 A;  3WD0 A;  3O5R A;  4MPK A;  4DZ3 A;  1NWS A;  3UI5 A;  3CGM A;  3G6L A;  1J6Y A;  4ZPV R;  1Q6H A;  2RUQ A;  2OFN A;  4J4N A;  3ARQ A;  1ZBV A;  2G8Z A;  1LQ0 A;  2KE0 A;  2KO7 A;  1TCO C;  4IQC A;  1D6O A;  5DEZ A;  1HKM A;  3FXY A;  1D7H A;  1W1V A;  3KAH A;  4ODQ A;  1Q6I A;  5DO2 A;  4C02 B;  4Z2K A;  2WLY A;  4W9P A;  2A3B A;  4NSB A;  4WK9 A;  1FKG A;  3PA7 A;  2XP4 A;  4XAK A;  4DWS B;  1ZBW A;  4DRH A;  2RUD A;  4DRO A;  3AQU A;  1WAW A;  5HUA A;  2MPH A;  3KAB A;  4UDM A;  3GTY X;  4HAR A;  3EIP A;  4KQZ A;  5JH8 A;  5DIU A;  3ART A;  1LL7 A;  3AS1 A;  3OOB A;  1FKR A;  5GQB A;  4W9O A;  1XHG A;  2DT0 A;  1E44 A;  1JNE A;  1GOI A;  1W9V A;  1OGG A;  4ODP A;  3B7X A;  3WD3 A;  2A3E A;  4JFL A;  1NWR A;  3WKZ A;  1XRV A;  2XP8 A;  4DRN A;  4DRI A;  1R9H A;  4ODL A;  1ROU A;  2XP5 A;  1E9L A;  4MNM A;  4L3N A;  3VAW A;  5HWC A;  2VCD A;  3O5G A;  1FAP A;  1W1T A;  2RUR A;  2M08 A;  4AY1 A;  1GPF A;  5HW6 A;  1ZCN A;  1L1P A;  1WNO A;  1YW5 A;  2PPN A;  1FJD A;  4Z2G A;  1D7J A;  3MDY B;  4PTM A;  1K9T A;  3O5Q A;  3O5J A;  5DIV A;  2DG9 A;  2XP3 A;  1BKF A;  1QPF A;  2AOS A;  4BF8 A;  1ZBK A;  1J4I A;  2IF4 A;  3KZ7 A;  5HWB A;  3RGC A;  2FAP A;  3UQA A;  4ODN A;  4MNJ A;  1W1P A;  4U86 A;  4MSP A;  5HBF A;  2MF9 A;  2PPP A;  1FKT A;  3O5K A;  5HKG A;  4HBE A; 
#chains in the Genus database with same CATH homology
 1EIB A;  1WB0 A;  4W9Q A;  4W5U A;  3O5F A;  2MLZ A;  2OLH A;  2ZQS A;  1ITX A;  1ZK6 A;  4JFM A;  1FKK A;  3WD2 A;  4MAV A;  1QZ2 A;  3B9E A;  1UR8 A;  3TC5 A;  1J4H A;  5I98 A;  5D75 A;  2Q5A A;  1NMW A;  4ITZ A;  4GIV A;  4Q7N A;  2RQS A;  4JFI A;  1FKS A;  1HJW A;  2MNT A;  1VF8 A;  4Q22 A;  3WD1 A;  1NSG A;  3UF8 A;  4LGX A;  3O5P A;  3ARZ A;  1JNS A;  5B8I C;  2ZR4 A;  3GPK A;  2B31 A;  2FDM A;  1LJY A;  1KFW A;  2F2D A;  4DT4 A;  3ARY A;  3ARU A;  2VN1 A;  3UQB A;  4DRJ A;  4LAV A;  1PIN A;  1HKJ A;  3RM4 A;  3OA5 A;  4QT2 A;  3BXW A;  2DT2 A;  4DIP A;  1EHN A;  4TNS A;  4TW7 A;  3WL0 A;  1F40 A;  3CHD A;  1A7X A;  2K8I A;  2IUZ A;  1NWU A;  5HT1 A;  1W9U A;  1SYT A;  4DRP A;  2F4E A;  2DSZ A;  1X6L A;  4GGQ A;  1FKD A;  4J4O A;  4QT3 A;  2Y78 A;  2WLZ A;  2ZQV A;  3RM8 A;  1X6N A;  1FKF A;  4Z2J A;  4ODM A;  4MNK A;  1TFV A;  1ZU8 A;  3ODK A;  1FD9 A;  4MGV A;  1SR0 A;  2D9F A;  3B9A A;  1FKI A;  4HBO A;  3KCE A;  2PI6 A;  4WIW A;  2PV3 A;  3ARV A;  2QF8 A;  4DRK A;  1W26 A;  1E6P A;  1B6C A;  4P8W A;  2XPB A;  1E6N A;  2DG4 A;  1P5Q A;  4IT6 A;  2A3A A;  1E6R A;  3UI4 A;  4ZPT R;  2WM0 A;  2ZQU A;  2M2A A;  4DRQ A;  1H0I A;  3KAD A;  3PRB A;  4DWS C;  3O5I A;  3KAC A;  3G6M A;  2DSU A;  5HW7 A;  5GPR A;  1UR9 A;  1N1A A;  4ODR A;  2KI3 A;  1O6I A;  4IT4 A;  5HTG A;  4FAP A;  3ARS A;  3IK8 A;  1U79 A;  3CHC A;  4FN2 A;  1NWT A;  3WIJ A;  3JYM A;  4JFJ A;  2DT1 A;  4R0X A;  2ITK A;  3W4R A;  2FKE A;  3CH9 A;  4ZPW R;  3IKG A;  2L2S A;  3O5L A;  3B8S A;  2O92 A;  2ESC A;  3ALG A;  2WK2 A;  4S3K A;  4G2P A;  2YBT A;  1GUV A;  3CGN A;  2ZQT A;  4TX0 A;  3IHZ A;  3I6C A;  3JYJ A;  2DSV A;  4S3J A;  2RUC A;  3ARW A;  4WKF A;  2DSW A;  3PRD A;  4O2T A;  5GPG A;  1HXV A;  2ZR5 A;  2KR7 A;  2ZR6 A;  4IPX A;  4Z2L A;  1OWQ A;  5J6E A;  2KFW A;  1FKB A;  1YAT A;  2AWG A;  2XPA A;  3WL1 A;  4U85 A;  1EDQ A;  3AS3 A;  2N87 A;  3CHE A;  2MLX A;  1D2K A;  4R5E A;  4U84 A;  3KAF A;  5DIT A;  3ALF A;  3B9D A;  2UZ5 A;  4P8V A;  4WKA A;  4P8U A;  3LUO A;  4Z2I A;  2LKN A;  3O5D A;  4IQ2 A;  1JND A;  4LAX A;  2LPV A;  3TCZ A;  3UI6 A;  4N19 A;  1FFR A;  3NI6 A;  2DT3 A;  1LG2 A;  4P8X A;  4LAY A;  1FKH A;  1T11 A;  4DWS D;  3RM9 A;  1HKK A;  4MNL A;  4TYO A;  1M5Y A;  4JFK A;  2G41 A;  3ARP A;  3FAP A;  4JYS A;  1HJX A;  3ARX A;  1W1Y A;  4URI A;  1KT1 A;  2M1I A;  3ARO A;  2DPE A;  3JXV A;  2YBU A;  1RD6 A;  4G50 A;  1C9H A;  1JVW A;  1KT0 A;  1Y0O A;  3UQI A;  1F8A B;  4LAW A;  3H9R B;  3RFW A;  4KR0 B;  1FKL A;  3EY6 A;  1Q1C A;  1EQ3 A;  3WQW A;  3WH0 A;  1J4R A;  1E6Z A;  4TW8 A;  5BXJ A;  3O5O A;  1HKI A;  2F21 A;  4WJX A;  2DG3 A;  1ZL1 A;  4DRM A;  5DF0 A;  2MLY A;  4NNR A;  4MTV A;  1Q6U A;  4WKH A;  1NMV A;  3CHF A;  4L72 B;  2XP9 A;  2PV1 A;  1LG1 A;  1IX5 A;  2A3C A;  3AS2 A;  3O5E A;  1JNT A;  5HW8 A;  1OGB A;  3NRK A;  4QIB A;  3QOK A;  1ZB5 A;  4ODK A;  3RME A;  1QPL A;  3NTP A;  1ZBC A;  2KGJ A;  2LJ4 A;  1FKJ A;  1BL4 A;  4Z2H A;  1PBK A;  1E15 A;  1EYM A;  1ROT A;  1D7I A;  3TDB A;  3CZ8 A;  2XP7 A;  3KAI A;  2RSE A;  1W9P A;  1LL6 A;  2LGO A;  3IKD A;  3KAG A;  3O5M A;  1FFQ A;  1NH6 A;  2O9O A;  3FY1 A;  3PR9 A;  4TW6 A;  1H0G A;  3PRA A;  2PBC A;  3WD4 A;  4QZV B;  4NZC A;  2PV2 A;  4ML4 A;  4DWS A;  1CTN A;  2XP6 A;  4DZ2 A;  4ODO A;  4ZS6 A;  2JZV A;  4DH0 A;  2PPO A;  3ARR A;  1HJV A;  1LL4 A;  3WQV A;  3AS0 A;  3WD0 A;  3O5R A;  4MPK A;  4DZ3 A;  1NWS A;  3UI5 A;  3CGM A;  3G6L A;  1J6Y A;  4ZPV R;  1Q6H A;  2RUQ A;  2OFN A;  4J4N A;  3ARQ A;  1ZBV A;  2G8Z A;  1LQ0 A;  2KE0 A;  2KO7 A;  1TCO C;  4IQC A;  1D6O A;  5DEZ A;  1HKM A;  3FXY A;  1D7H A;  1W1V A;  3KAH A;  4ODQ A;  1Q6I A;  5DO2 A;  4C02 B;  4Z2K A;  2WLY A;  4W9P A;  2A3B A;  4NSB A;  4WK9 A;  1FKG A;  3PA7 A;  2XP4 A;  4XAK A;  4DWS B;  1ZBW A;  4DRH A;  2RUD A;  4DRO A;  3AQU A;  1WAW A;  5HUA A;  2MPH A;  3KAB A;  4HAR A;  4KQZ A;  5JH8 A;  5DIU A;  3ART A;  1LL7 A;  3AS1 A;  3OOB A;  1FKR A;  5GQB A;  4W9O A;  1XHG A;  2DT0 A;  1JNE A;  1GOI A;  1W9V A;  1OGG A;  4ODP A;  3B7X A;  3WD3 A;  2A3E A;  4JFL A;  1NWR A;  3WKZ A;  1XRV A;  2XP8 A;  4DRN A;  4DRI A;  1R9H A;  4ODL A;  1ROU A;  2XP5 A;  1E9L A;  4MNM A;  4L3N A;  3VAW A;  5HWC A;  2VCD A;  3O5G A;  1FAP A;  1W1T A;  2RUR A;  2M08 A;  4AY1 A;  1GPF A;  5HW6 A;  1ZCN A;  1L1P A;  1WNO A;  1YW5 A;  2PPN A;  1FJD A;  4Z2G A;  1D7J A;  3MDY B;  4PTM A;  1K9T A;  3O5Q A;  3O5J A;  5DIV A;  2DG9 A;  2XP3 A;  1BKF A;  1QPF A;  2AOS A;  4BF8 A;  1ZBK A;  1J4I A;  2IF4 A;  3KZ7 A;  5HWB A;  3RGC A;  2FAP A;  3UQA A;  4ODN A;  4MNJ A;  1W1P A;  4U86 A;  4MSP A;  5HBF A;  2MF9 A;  2PPP A;  1FKT A;  3O5K A;  5HKG A;  4HBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...