1U79A

Crystal structure of atfkbp13
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
125
structure length
125
Chain Sequence
CEFSVSPSGLAFCDKVVGYGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLTFRIGVGEVIKGWDQGILGSDGIPPMLTGGKRTLRIPPELAYGDRGAGCKGGSCLIPPASVLLFDIEYIGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase 3
publication title Structural analysis uncovers a role for redox in regulating FKBP13, an immunophilin of the chloroplast thylakoid lumen
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Isomerase
total genus 27
structure length 125
sequence length 125
chains with identical sequence B, C, D, E
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2004-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1u79A00
3IK8A 3UI4A 5BXJA 4TNSA 3ODKA 4G2PA 2F4EA 2RUQA 3KAGA 3KABA 2JZVA 1FKSA 4DRMA 4U86A 3KADA 2RQSA 4JFIA 3PA7A 2M08A 2LGOA 4JFJA 1D7JA 1M5YA 4LAYA 3LUOA 3O5FA 1J6YA 4ITZA 4LAWA 2DG3A 3KAIA 3IKGA 2XP5A 3IHZA 2PBCA 2LJ4A 4DRJA 1FKJA 5HTGA 1EQ3A 1F40A 3PRDA 4JFLA 4G50A 3UI6A 4W9QA 5DIUA 5D75A 3O5JA 2XP6A 4MSPA 3RFWA 2PV3A 3JYMA 5DIVA 2ZR6A 3O5IA 1FJDA 1J4IA 1EYMA 1J4HA 3O5PA 3OOBA 3UF8A 4TW7A 4NNRA 1BKFA 1YW5A 1J4RA 2XPAA 4LAXA 2RSEA 1FKTA 3KAFA 1Q6IA 3JYJA 1FAPA 1QPFA 4DRNA 3KCEA 1FKDA 5HW7A 2DG4A 3O5DA 1FKIA 1FKLA 4QT3A 4DRKA 4ODRA 4ODQA 1N1AA 3GPKA 3KACA 5HUAA 2ITKA 1C9HA 3WH0A 3UI5A 1ZK6A 3O5OA 5HW6A 5GPGA 1R9HA 2FAPA 3KAHA 1ZCNA 4ODNA 2ZR5A 2RURA 3NI6A 4MGVA 4TYOA 2ZQTA 2M1IA 1KT1A 4JFMA 2MLXA 3NTPA 3I6CA 1FD9A 1NMWA 2MLZA 2PV1A 1KT0A 1D7IA 3O5GA 1U79A 4U84A 2N87A 4C02B 1Q6HA 5I98A 3H9RB 2KGJA 2KR7A 2ZQUA 2MLYA 4IQCA 2KE0A 4DRIA 2LKNA 1FKBA 1HXVA 1D7HA 3CGMA 2PPNA 1FKKA 1P5QA 5HKGA 1NSGA 3UQIA 1JNSA 4DZ3A 1QZ2A 1D6OA 2F2DA 4IQ2A 3B7XA 2XP4A 3O5EA 1B6CA 1FKRA 2KO7A 4O2TA 2Q5AA 2VCDA 4ODLA 1F8AB 4W9OA 3EY6A 2VN1A 5HT1A 2L2SA 4FN2A 4DZ2A 3RGCA 5HWCA 2M2AA 2ZR4A 4GGQA 2PPPA 4J4NA 3O5QA 2XPBA 2MF9A 3VAWA 4J4OA 1Y0OA 1A7XA 3TC5A 2XP8A 1NMVA 3IKDA 2D9FA 4LAVA 3O5MA 1Q6UA 2KFWA 2ZQVA 3FAPA 2XP9A 3TDBA 1TCOC 2FKEA 1PBKA 4ODPA 2ZQSA 1FKFA 1PINA 3O5LA 4ODMA 4TW8A 3NRKA 1L1PA 2LPVA 2OFNA 3O5RA 4W9PA 4R0XA 4DRHA 1YATA 2AWGA 3UQAA 1ROUA 4DIPA 4U85A 1FKHA 2F21A 1BL4A 3PRBA 4DROA 1JNTA 1T11A 4N19A 1QPLA 2Y78A 2KI3A 4DH0A 4IPXA 2XP7A 1JVWA 3KZ7A 1ROTA 2IF4A 4JFKA 2MPHA 2RUDA 4DT4A 4BF8A 5B8IC 5HW8A 2K8IA 3TCZA 2XP3A 3O5KA 2PV2A 2PPOA 4TW6A 4ODKA 5J6EA 3MDYB 4ODOA 4QT2A 4FAPA 3UQBA 5HWBA 4GIVA 2MNTA 3JXVA 2RUCA 1Q1CA 4TX0A 4JYSA 2UZ5A 2DG9A 3CGNA 4DRQA 5DITA 1FKGA 1W26A 4QIBA 4DRPA
chains in the Genus database with same CATH superfamily
3ODKA 4G2PA 5GPRA 2RUQA 4IT4A 3KABA 1FKSA 4Z2JA 4DRMA 3G6LA 3KADA 3ARPA 1TFVA 1D7JA 3LUOA 3O5FA 4LAWA 2A3CA 3WD4A 3CHFA 2PBCA 1FKJA 1W1PA 3PRDA 4G50A 5D75A 1UR9A 4AY1A 1FJDA 4P8XA 1EYMA 3O5PA 1EHNA 1Q6IA 3JYJA 4DWSC 4XAKA 4DRNA 4P8WA 1FKDA 4Q7NA 5HW7A 2WLZA 1FKLA 4ODQA 5HUAA 2ITKA 1GPFA 4W5UA 3UI5A 1ZK6A 5HW6A 1ZB5A 5GPGA 3KAHA 1D2KA 3NI6A 4MAVA 1X6LA 1XHGA 2MLXA 2O9OA 1FD9A 1NMWA 4U84A 4S3KA 3H9RB 1NH6A 1NWTA 3CGMA 1FKKA 2AOSA 1NSGA 3UQIA 4DZ3A 3B9DA 2F2DA 4IQ2A 2DT0A 2KO7A 4O2TA 3EY6A 2VN1A 5HT1A 3AS0A 4GGQA 2B5UB 3VAWA 1Y0OA 3TC5A 1NMVA 3IKDA 3O5MA 2A3EA 1TCOC 5JH8A 4HBEA 1PBKA 1FKFA 4ODMA 1FFQA 4TW8A 1E44A 2OFNA 4R0XA 4KR0B 1GRJA 4MNLA 2YBTA 1ROUA 3AS3A 5DEZA 2B31A 2WK2A 2XP7A 1W1TA 1JVWA 3ARUA 2IF4A 5HW8A 2RUDA 4BF8A 2XP3A 1LG2A 2PV2A 1VF8A 4ODOA 3ARZA 2QF8A 4GIVA 3JXVA 1Q1CA 4TX0A 3WL1A 1W26A 4DRPA 1E15A 1OWQA 4MNMA 3ARWA 2F4EA 4JFJA 1J6YA 3GU0A 3KAIA 4DRJA 3ARTA 1WNOA 3UI6A 5DIUA 2EULA 3O5JA 2XP6A 1KFWA 3RFWA 5DIVA 3RM4A 3CH9A 4DWSB 3OOBA 1HKIA 1RD6A 4TW7A 1J4RA 1YW5A 2IUZA 2RSEA 1FKTA 4UDMA 1SR0A 1JCHB 2ESCA 2DG4A 3O5DA 1E6PA 2ETNA 4DRKA 3CHEA 1H0IA 3CHDA 3O5OA 1E9LA 2FAPA 1ZCNA 2ZR5A 2RURA 2YBUA 4DWSA 3O5GA 2MLZA 1KT0A 1U79A 4ZS6A 1Q6HA 1HKKA 3FXYA 3ARXA 2LKNA 1FKBA 1HXVA 3G6MA 1GOIA 4WKAA 5HKGA 3AQUA 1JNSA 3WD2A 1D6OA 3CZ8A 1O6IA 2XP4A 3B7XA 4P8VA 1OGGA 1W9VA 2VCDA 1F8AB 3AS1A 4DZ2A 2L2SA 5HWCA 1ZL1A 2M2AA 2PPPA 3O5QA 4HARA 4LGXA 2D9FA 3FAPA 1LQ0A 3TDBA 3PR9A 2FKEA 3BMBA 3O5LA 2LPVA 3O5RA 1NWUA 4IT6A 2AWGA 2DSZA 3PRAA 1NWRA 4DIPA 4U85A 4WK9A 1FKHA 1BL4A 2FDMA 1UR8A 1GUVA 3ALGA 3AROA 4N19A 4DH0A 4IPXA 1HKJA 3FY1A 2A3AA 4DT4A 4JFKA 2MPHA 2A3BA 4R5EA 2K8IA 4MTVA 2PPOA 4ODKA 5J6EA 2PI6A 1E6NA 1HKMA 2MNTA 4WKHA 2DSUA 3EIPA 2DG9A 3GTYX 5DITA 3WL0A 2PN0A 4QIBA 3IK8A 3UI4A 4ZPWR 4TNSA 5BXJA 4ZPTR 2DSVA 4Z2IA 4WJXA 2RQSA 3ARVA 3PA7A 1W9PA 2M08A 2LGOA 4JFIA 4ITZA 2DG3A 3IKGA 2XP5A 2LJ4A 1K9TA 3CHCA 5HTGA 1EQ3A 1ZBCA 3RM8A 4MNKA 4L72B 2PV3A 3JYMA 4Z2KA 2ZR6A 3O5IA 4NZCA 5HBFA 3UF8A 1BKFA 4DWSD 2XPAA 1OGBA 3KAFA 4P8UA 4QT3A 3GPKA 3WH0A 5DO2A 1R9HA 4TYOA 4ODNA 4MGVA 1KT1A 1H0GA 1LL6A 2PV1A 2N87A 5DF0A 5I98A 1NWSA 2KGJA 2KR7A 2ZQUA 2MLYA 2KE0A 3WQWA 1D7HA 1JNDA 3WIJA 2PPNA 1XRVA 1E6RA 1QZ2A 1W1YA 3B9AA 3WD1A 1ZBKA 4W9OA 4FN2A 3RGCA 2ZR4A 2XPBA 3WD0A 2O92A 1A7XA 4LAVA 1Q6UA 2KFWA 2ZQVA 2XP9A 4NSBA 4URIA 1LL7A 2G8ZA 2DT2A 1PINA 1ZU8A 4W9PA 1LG1A 3UQAA 4KQZA 2F21A 1HJVA 1FFRA 1QPLA 2KI3A 4Q22A 1HJWA 3TCZA 1CTNA 4TW6A 3MDYB 5GQBA 4QT2A 3UQBA 5HWBA 4ML4A 2RUCA 4WKFA 4JYSA 1W1VA 3CGNA 3BXWA 4HBOA 3KAGA 2JZVA 4Z2LA 4WIWA 4U86A 1ZBWA 4LAYA 1M5YA 1HJXA 1W9UA 2WM0A 3IHZA 3WD3A 4Z2HA 3ARRA 3B8SA 1F40A 4JFLA 2DT1A 4W9QA 3WQVA 4MSPA 2F23A 1J4IA 1J4HA 1ITXA 4NNRA 4LAXA 2OLHA 3AS2A 3ARYA 1FAPA 1QPFA 3KCEA 4PTMA 1FKIA 3W4RA 4ODRA 1N1AA 3KACA 4S3JA 1C9HA 2P4VA 1SYTA 1LJYA 3OA5A 3ARSA 2ZQTA 1EDQA 2M1IA 1WAWA 4JFMA 3RMEA 3NTPA 3I6CA 1D7IA 1X6NA 4C02B 4IQCA 4DRIA 2G41A 1P5QA 2DPEA 4MNJA 1FKRA 3O5EA 1B6CA 2Q5AA 4ODLA 3RM9A 4J4NA 2MF9A 1EIBA 4J4OA 3ALFA 2XP8A 1WB0A 4ODPA 2ZQSA 3NRKA 1L1PA 4DRHA 1YATA 1E6ZA 3PRBA 4DROA 1JNTA 1T11A 4ZPVR 1IX5A 2Y78A 4MPKA 3KZ7A 1ROTA 5B8IC 4QZVB 1LL4A 3WKZA 3QOKA 3O5KA 2WLYA 2DSWA 3B9EA 4FAPA 1ZBVA 2DT3A 4Z2GA 3ARQA 1JNEA 2UZ5A 4L3NA 4DRQA 1FKGA
chains in the Genus database with same CATH topology
3ODKA 4G2PA 5GPRA 2RUQA 4IT4A 3KABA 1FKSA 4Z2JA 4DRMA 3G6LA 3KADA 3ARPA 1TFVA 1D7JA 3LUOA 3O5FA 4LAWA 2A3CA 3WD4A 3CHFA 2PBCA 1FKJA 1W1PA 3PRDA 4G50A 5D75A 1UR9A 4AY1A 1FJDA 4P8XA 1EYMA 3O5PA 1EHNA 1Q6IA 3JYJA 4DWSC 4XAKA 4DRNA 4P8WA 1FKDA 4Q7NA 5HW7A 2WLZA 1FKLA 4ODQA 5HUAA 2ITKA 1GPFA 4W5UA 3UI5A 1ZK6A 5HW6A 1ZB5A 5GPGA 3KAHA 1D2KA 3NI6A 4MAVA 1X6LA 1XHGA 2MLXA 2O9OA 1FD9A 1NMWA 4U84A 4S3KA 3H9RB 1NH6A 1NWTA 3CGMA 1FKKA 2AOSA 1NSGA 3UQIA 4DZ3A 3B9DA 2F2DA 4IQ2A 2DT0A 2KO7A 4O2TA 3EY6A 2VN1A 5HT1A 3AS0A 4GGQA 3VAWA 1Y0OA 3TC5A 1NMVA 3IKDA 3O5MA 2A3EA 1TCOC 5JH8A 4HBEA 1PBKA 1FKFA 4ODMA 1FFQA 4TW8A 2OFNA 4R0XA 4KR0B 4MNLA 2YBTA 1ROUA 3AS3A 5DEZA 2B31A 2WK2A 2XP7A 1W1TA 1JVWA 3ARUA 2IF4A 5HW8A 2RUDA 4BF8A 2XP3A 1LG2A 2PV2A 1VF8A 4ODOA 3ARZA 2QF8A 4GIVA 3JXVA 1Q1CA 4TX0A 3WL1A 1W26A 4DRPA 1E15A 1OWQA 4MNMA 3ARWA 2F4EA 4JFJA 1J6YA 3KAIA 4DRJA 3ARTA 1WNOA 3UI6A 5DIUA 3O5JA 2XP6A 1KFWA 3RFWA 5DIVA 3RM4A 3CH9A 4DWSB 3OOBA 1HKIA 1RD6A 4TW7A 1J4RA 1YW5A 2IUZA 2RSEA 1FKTA 1SR0A 2ESCA 2DG4A 3O5DA 1E6PA 4DRKA 3CHEA 1H0IA 3CHDA 3O5OA 1E9LA 2FAPA 1ZCNA 2ZR5A 2RURA 2YBUA 4DWSA 3O5GA 2MLZA 1KT0A 1U79A 4ZS6A 1Q6HA 1HKKA 3FXYA 3ARXA 2LKNA 1FKBA 1HXVA 3G6MA 1GOIA 4WKAA 5HKGA 3AQUA 1JNSA 3WD2A 1D6OA 3CZ8A 1O6IA 2XP4A 3B7XA 4P8VA 1OGGA 1W9VA 2VCDA 1F8AB 3AS1A 4DZ2A 2L2SA 5HWCA 1ZL1A 2M2AA 2PPPA 3O5QA 4HARA 4LGXA 2D9FA 3FAPA 1LQ0A 3TDBA 3PR9A 2FKEA 3O5LA 2LPVA 3O5RA 1NWUA 4IT6A 2AWGA 2DSZA 3PRAA 1NWRA 4DIPA 4U85A 4WK9A 1FKHA 1BL4A 2FDMA 1UR8A 1GUVA 3ALGA 3AROA 4N19A 4DH0A 4IPXA 1HKJA 3FY1A 2A3AA 4DT4A 4JFKA 2MPHA 2A3BA 4R5EA 2K8IA 4MTVA 2PPOA 4ODKA 5J6EA 2PI6A 1E6NA 1HKMA 2MNTA 4WKHA 2DSUA 2DG9A 5DITA 3WL0A 4QIBA 3IK8A 3UI4A 4ZPWR 4TNSA 5BXJA 4ZPTR 2DSVA 4Z2IA 4WJXA 2RQSA 3ARVA 3PA7A 1W9PA 2M08A 2LGOA 4JFIA 4ITZA 2DG3A 3IKGA 2XP5A 2LJ4A 1K9TA 3CHCA 5HTGA 1EQ3A 1ZBCA 3RM8A 4MNKA 4L72B 2PV3A 3JYMA 4Z2KA 2ZR6A 3O5IA 4NZCA 5HBFA 3UF8A 1BKFA 4DWSD 2XPAA 1OGBA 3KAFA 4P8UA 4QT3A 3GPKA 3WH0A 5DO2A 1R9HA 4TYOA 4ODNA 4MGVA 1KT1A 1H0GA 1LL6A 2PV1A 2N87A 5DF0A 5I98A 1NWSA 2KGJA 2KR7A 2ZQUA 2MLYA 2KE0A 3WQWA 1D7HA 1JNDA 3WIJA 2PPNA 1XRVA 1E6RA 1QZ2A 1W1YA 3B9AA 3WD1A 1ZBKA 4W9OA 4FN2A 3RGCA 2ZR4A 2XPBA 3WD0A 2O92A 1A7XA 4LAVA 1Q6UA 2KFWA 2ZQVA 2XP9A 4NSBA 4URIA 1LL7A 2G8ZA 2DT2A 1PINA 1ZU8A 4W9PA 1LG1A 3UQAA 4KQZA 2F21A 1HJVA 1FFRA 1QPLA 2KI3A 4Q22A 1HJWA 3TCZA 1CTNA 4TW6A 3MDYB 5GQBA 4QT2A 3UQBA 5HWBA 4ML4A 2RUCA 4WKFA 4JYSA 1W1VA 3CGNA 3BXWA 4HBOA 3KAGA 2JZVA 4Z2LA 4WIWA 4U86A 1ZBWA 4LAYA 1M5YA 1HJXA 1W9UA 2WM0A 3IHZA 3WD3A 4Z2HA 3ARRA 3B8SA 1F40A 4JFLA 2DT1A 4W9QA 3WQVA 4MSPA 1J4IA 1J4HA 1ITXA 4NNRA 4LAXA 2OLHA 3AS2A 3ARYA 1FAPA 1QPFA 3KCEA 4PTMA 1FKIA 3W4RA 4ODRA 1N1AA 3KACA 4S3JA 1C9HA 1SYTA 1LJYA 3OA5A 3ARSA 2ZQTA 1EDQA 2M1IA 1WAWA 4JFMA 3RMEA 3NTPA 3I6CA 1D7IA 1X6NA 4C02B 4IQCA 4DRIA 2G41A 1P5QA 2DPEA 4MNJA 1FKRA 3O5EA 1B6CA 2Q5AA 4ODLA 3RM9A 4J4NA 2MF9A 1EIBA 4J4OA 3ALFA 2XP8A 1WB0A 4ODPA 2ZQSA 3NRKA 1L1PA 4DRHA 1YATA 1E6ZA 3PRBA 4DROA 1JNTA 1T11A 4ZPVR 1IX5A 2Y78A 4MPKA 3KZ7A 1ROTA 5B8IC 4QZVB 1LL4A 3WKZA 3QOKA 3O5KA 2WLYA 2DSWA 3B9EA 4FAPA 1ZBVA 2DT3A 4Z2GA 3ARQA 1JNEA 2UZ5A 4L3NA 4DRQA 1FKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IK8 A;  3UI4 A;  5BXJ A;  4TNS A;  3ODK A;  4G2P A;  2F4E A;  2RUQ A;  3KAG A;  3KAB A;  2JZV A;  1FKS A;  4DRM A;  4U86 A;  3KAD A;  2RQS A;  4JFI A;  3PA7 A;  2M08 A;  2LGO A;  4JFJ A;  1D7J A;  1M5Y A;  4LAY A;  3LUO A;  3O5F A;  1J6Y A;  4ITZ A;  4LAW A;  2DG3 A;  3KAI A;  3IKG A;  2XP5 A;  3IHZ A;  2PBC A;  2LJ4 A;  4DRJ A;  1FKJ A;  5HTG A;  1EQ3 A;  1F40 A;  3PRD A;  4JFL A;  4G50 A;  3UI6 A;  4W9Q A;  5DIU A;  5D75 A;  3O5J A;  2XP6 A;  4MSP A;  3RFW A;  2PV3 A;  3JYM A;  5DIV A;  2ZR6 A;  3O5I A;  1FJD A;  1J4I A;  1EYM A;  1J4H A;  3O5P A;  3OOB A;  3UF8 A;  4TW7 A;  4NNR A;  1BKF A;  1YW5 A;  1J4R A;  2XPA A;  4LAX A;  2RSE A;  1FKT A;  3KAF A;  1Q6I A;  3JYJ A;  1FAP A;  1QPF A;  4DRN A;  3KCE A;  1FKD A;  5HW7 A;  2DG4 A;  3O5D A;  1FKI A;  1FKL A;  4QT3 A;  4DRK A;  4ODR A;  4ODQ A;  1N1A A;  3GPK A;  3KAC A;  5HUA A;  2ITK A;  1C9H A;  3WH0 A;  3UI5 A;  1ZK6 A;  3O5O A;  5HW6 A;  5GPG A;  1R9H A;  2FAP A;  3KAH A;  1ZCN A;  4ODN A;  2ZR5 A;  2RUR A;  3NI6 A;  4MGV A;  4TYO A;  2ZQT A;  2M1I A;  1KT1 A;  4JFM A;  2MLX A;  3NTP A;  3I6C A;  1FD9 A;  1NMW A;  2MLZ A;  2PV1 A;  1KT0 A;  1D7I A;  3O5G A;  1U79 A;  4U84 A;  2N87 A;  4C02 B;  1Q6H A;  5I98 A;  3H9R B;  2KGJ A;  2KR7 A;  2ZQU A;  2MLY A;  4IQC A;  2KE0 A;  4DRI A;  2LKN A;  1FKB A;  1HXV A;  1D7H A;  3CGM A;  2PPN A;  1FKK A;  1P5Q A;  5HKG A;  1NSG A;  3UQI A;  1JNS A;  4DZ3 A;  1QZ2 A;  1D6O A;  2F2D A;  4IQ2 A;  3B7X A;  2XP4 A;  3O5E A;  1B6C A;  1FKR A;  2KO7 A;  4O2T A;  2Q5A A;  2VCD A;  4ODL A;  1F8A B;  4W9O A;  3EY6 A;  2VN1 A;  5HT1 A;  2L2S A;  4FN2 A;  4DZ2 A;  3RGC A;  5HWC A;  2M2A A;  2ZR4 A;  4GGQ A;  2PPP A;  4J4N A;  3O5Q A;  2XPB A;  2MF9 A;  3VAW A;  4J4O A;  1Y0O A;  1A7X A;  3TC5 A;  2XP8 A;  1NMV A;  3IKD A;  2D9F A;  4LAV A;  3O5M A;  1Q6U A;  2KFW A;  2ZQV A;  3FAP A;  2XP9 A;  3TDB A;  1TCO C;  2FKE A;  1PBK A;  4ODP A;  2ZQS A;  1FKF A;  1PIN A;  3O5L A;  4ODM A;  4TW8 A;  3NRK A;  1L1P A;  2LPV A;  2OFN A;  3O5R A;  4W9P A;  4R0X A;  4DRH A;  1YAT A;  2AWG A;  3UQA A;  1ROU A;  4DIP A;  4U85 A;  1FKH A;  2F21 A;  1BL4 A;  3PRB A;  4DRO A;  1JNT A;  1T11 A;  4N19 A;  1QPL A;  2Y78 A;  2KI3 A;  4DH0 A;  4IPX A;  2XP7 A;  1JVW A;  3KZ7 A;  1ROT A;  2IF4 A;  4JFK A;  2MPH A;  2RUD A;  4DT4 A;  4BF8 A;  5B8I C;  5HW8 A;  2K8I A;  3TCZ A;  2XP3 A;  3O5K A;  2PV2 A;  2PPO A;  4TW6 A;  4ODK A;  5J6E A;  3MDY B;  4ODO A;  4QT2 A;  4FAP A;  3UQB A;  5HWB A;  4GIV A;  2MNT A;  3JXV A;  2RUC A;  1Q1C A;  4TX0 A;  4JYS A;  2UZ5 A;  2DG9 A;  3CGN A;  4DRQ A;  5DIT A;  1FKG A;  1W26 A;  4QIB A;  4DRP A; 
#chains in the Genus database with same CATH topology
 3ODK A;  4G2P A;  5GPR A;  2RUQ A;  4IT4 A;  3KAB A;  1FKS A;  4Z2J A;  4DRM A;  3G6L A;  3KAD A;  3ARP A;  1TFV A;  1D7J A;  3LUO A;  3O5F A;  4LAW A;  2A3C A;  3WD4 A;  3CHF A;  2PBC A;  1FKJ A;  1W1P A;  3PRD A;  4G50 A;  5D75 A;  1UR9 A;  4AY1 A;  1FJD A;  4P8X A;  1EYM A;  3O5P A;  1EHN A;  1Q6I A;  3JYJ A;  4DWS C;  4XAK A;  4DRN A;  4P8W A;  1FKD A;  4Q7N A;  5HW7 A;  2WLZ A;  1FKL A;  4ODQ A;  5HUA A;  2ITK A;  1GPF A;  4W5U A;  3UI5 A;  1ZK6 A;  5HW6 A;  1ZB5 A;  5GPG A;  3KAH A;  1D2K A;  3NI6 A;  4MAV A;  1X6L A;  1XHG A;  2MLX A;  2O9O A;  1FD9 A;  1NMW A;  4U84 A;  4S3K A;  3H9R B;  1NH6 A;  1NWT A;  3CGM A;  1FKK A;  2AOS A;  1NSG A;  3UQI A;  4DZ3 A;  3B9D A;  2F2D A;  4IQ2 A;  2DT0 A;  2KO7 A;  4O2T A;  3EY6 A;  2VN1 A;  5HT1 A;  3AS0 A;  4GGQ A;  2B5U B;  3VAW A;  1Y0O A;  3TC5 A;  1NMV A;  3IKD A;  3O5M A;  2A3E A;  1TCO C;  5JH8 A;  4HBE A;  1PBK A;  1FKF A;  4ODM A;  1FFQ A;  4TW8 A;  1E44 A;  2OFN A;  4R0X A;  4KR0 B;  1GRJ A;  4MNL A;  2YBT A;  1ROU A;  3AS3 A;  5DEZ A;  2B31 A;  2WK2 A;  2XP7 A;  1W1T A;  1JVW A;  3ARU A;  2IF4 A;  5HW8 A;  2RUD A;  4BF8 A;  2XP3 A;  1LG2 A;  2PV2 A;  1VF8 A;  4ODO A;  3ARZ A;  2QF8 A;  4GIV A;  3JXV A;  1Q1C A;  4TX0 A;  3WL1 A;  1W26 A;  4DRP A;  1E15 A;  1OWQ A;  4MNM A;  3ARW A;  2F4E A;  4JFJ A;  1J6Y A;  3GU0 A;  3KAI A;  4DRJ A;  3ART A;  1WNO A;  3UI6 A;  5DIU A;  2EUL A;  3O5J A;  2XP6 A;  1KFW A;  3RFW A;  5DIV A;  3RM4 A;  3CH9 A;  4DWS B;  3OOB A;  1HKI A;  1RD6 A;  4TW7 A;  1J4R A;  1YW5 A;  2IUZ A;  2RSE A;  1FKT A;  4UDM A;  1SR0 A;  1JCH B;  2ESC A;  2DG4 A;  3O5D A;  1E6P A;  2ETN A;  4DRK A;  3CHE A;  1H0I A;  3CHD A;  3O5O A;  1E9L A;  2FAP A;  1ZCN A;  2ZR5 A;  2RUR A;  2YBU A;  4DWS A;  3O5G A;  2MLZ A;  1KT0 A;  1U79 A;  4ZS6 A;  1Q6H A;  1HKK A;  3FXY A;  3ARX A;  2LKN A;  1FKB A;  1HXV A;  3G6M A;  1GOI A;  4WKA A;  5HKG A;  3AQU A;  1JNS A;  3WD2 A;  1D6O A;  3CZ8 A;  1O6I A;  2XP4 A;  3B7X A;  4P8V A;  1OGG A;  1W9V A;  2VCD A;  1F8A B;  3AS1 A;  4DZ2 A;  2L2S A;  5HWC A;  1ZL1 A;  2M2A A;  2PPP A;  3O5Q A;  4HAR A;  4LGX A;  2D9F A;  3FAP A;  1LQ0 A;  3TDB A;  3PR9 A;  2FKE A;  3BMB A;  3O5L A;  2LPV A;  3O5R A;  1NWU A;  4IT6 A;  2AWG A;  2DSZ A;  3PRA A;  1NWR A;  4DIP A;  4U85 A;  4WK9 A;  1FKH A;  1BL4 A;  2FDM A;  1UR8 A;  1GUV A;  3ALG A;  3ARO A;  4N19 A;  4DH0 A;  4IPX A;  1HKJ A;  3FY1 A;  2A3A A;  4DT4 A;  4JFK A;  2MPH A;  2A3B A;  4R5E A;  2K8I A;  4MTV A;  2PPO A;  4ODK A;  5J6E A;  2PI6 A;  1E6N A;  1HKM A;  2MNT A;  4WKH A;  2DSU A;  3EIP A;  2DG9 A;  3GTY X;  5DIT A;  3WL0 A;  2PN0 A;  4QIB A;  3IK8 A;  3UI4 A;  4ZPW R;  4TNS A;  5BXJ A;  4ZPT R;  2DSV A;  4Z2I A;  4WJX A;  2RQS A;  3ARV A;  3PA7 A;  1W9P A;  2M08 A;  2LGO A;  4JFI A;  4ITZ A;  2DG3 A;  3IKG A;  2XP5 A;  2LJ4 A;  1K9T A;  3CHC A;  5HTG A;  1EQ3 A;  1ZBC A;  3RM8 A;  4MNK A;  4L72 B;  2PV3 A;  3JYM A;  4Z2K A;  2ZR6 A;  3O5I A;  4NZC A;  5HBF A;  3UF8 A;  1BKF A;  4DWS D;  2XPA A;  1OGB A;  3KAF A;  4P8U A;  4QT3 A;  3GPK A;  3WH0 A;  5DO2 A;  1R9H A;  4TYO A;  4ODN A;  4MGV A;  1KT1 A;  1H0G A;  1LL6 A;  2PV1 A;  2N87 A;  5DF0 A;  5I98 A;  1NWS A;  2KGJ A;  2KR7 A;  2ZQU A;  2MLY A;  2KE0 A;  3WQW A;  1D7H A;  1JND A;  3WIJ A;  2PPN A;  1XRV A;  1E6R A;  1QZ2 A;  1W1Y A;  3B9A A;  3WD1 A;  1ZBK A;  4W9O A;  4FN2 A;  3RGC A;  2ZR4 A;  2XPB A;  3WD0 A;  2O92 A;  1A7X A;  4LAV A;  1Q6U A;  2KFW A;  2ZQV A;  2XP9 A;  4NSB A;  4URI A;  1LL7 A;  2G8Z A;  2DT2 A;  1PIN A;  1ZU8 A;  4W9P A;  1LG1 A;  3UQA A;  4KQZ A;  2F21 A;  1HJV A;  1FFR A;  1QPL A;  2KI3 A;  4Q22 A;  1HJW A;  3TCZ A;  1CTN A;  4TW6 A;  3MDY B;  5GQB A;  4QT2 A;  3UQB A;  5HWB A;  4ML4 A;  2RUC A;  4WKF A;  4JYS A;  1W1V A;  3CGN A;  3BXW A;  4HBO A;  3KAG A;  2JZV A;  4Z2L A;  4WIW A;  4U86 A;  1ZBW A;  4LAY A;  1M5Y A;  1HJX A;  1W9U A;  2WM0 A;  3IHZ A;  3WD3 A;  4Z2H A;  3ARR A;  3B8S A;  1F40 A;  4JFL A;  2DT1 A;  4W9Q A;  3WQV A;  4MSP A;  2F23 A;  1J4I A;  1J4H A;  1ITX A;  4NNR A;  4LAX A;  2OLH A;  3AS2 A;  3ARY A;  1FAP A;  1QPF A;  3KCE A;  4PTM A;  1FKI A;  3W4R A;  4ODR A;  1N1A A;  3KAC A;  4S3J A;  1C9H A;  2P4V A;  1SYT A;  1LJY A;  3OA5 A;  3ARS A;  2ZQT A;  1EDQ A;  2M1I A;  1WAW A;  4JFM A;  3RME A;  3NTP A;  3I6C A;  1D7I A;  1X6N A;  4C02 B;  4IQC A;  4DRI A;  2G41 A;  1P5Q A;  2DPE A;  4MNJ A;  1FKR A;  3O5E A;  1B6C A;  2Q5A A;  4ODL A;  3RM9 A;  4J4N A;  2MF9 A;  1EIB A;  4J4O A;  3ALF A;  2XP8 A;  1WB0 A;  4ODP A;  2ZQS A;  3NRK A;  1L1P A;  4DRH A;  1YAT A;  1E6Z A;  3PRB A;  4DRO A;  1JNT A;  1T11 A;  4ZPV R;  1IX5 A;  2Y78 A;  4MPK A;  3KZ7 A;  1ROT A;  5B8I C;  4QZV B;  1LL4 A;  3WKZ A;  3QOK A;  3O5K A;  2WLY A;  2DSW A;  3B9E A;  4FAP A;  1ZBV A;  2DT3 A;  4Z2G A;  3ARQ A;  1JNE A;  2UZ5 A;  4L3N A;  4DRQ A;  1FKG A; 
#chains in the Genus database with same CATH homology
 3ODK A;  4G2P A;  5GPR A;  2RUQ A;  4IT4 A;  3KAB A;  1FKS A;  4Z2J A;  4DRM A;  3G6L A;  3KAD A;  3ARP A;  1TFV A;  1D7J A;  3LUO A;  3O5F A;  4LAW A;  2A3C A;  3WD4 A;  3CHF A;  2PBC A;  1FKJ A;  1W1P A;  3PRD A;  4G50 A;  5D75 A;  1UR9 A;  4AY1 A;  1FJD A;  4P8X A;  1EYM A;  3O5P A;  1EHN A;  1Q6I A;  3JYJ A;  4DWS C;  4XAK A;  4DRN A;  4P8W A;  1FKD A;  4Q7N A;  5HW7 A;  2WLZ A;  1FKL A;  4ODQ A;  5HUA A;  2ITK A;  1GPF A;  4W5U A;  3UI5 A;  1ZK6 A;  5HW6 A;  1ZB5 A;  5GPG A;  3KAH A;  1D2K A;  3NI6 A;  4MAV A;  1X6L A;  1XHG A;  2MLX A;  2O9O A;  1FD9 A;  1NMW A;  4U84 A;  4S3K A;  3H9R B;  1NH6 A;  1NWT A;  3CGM A;  1FKK A;  2AOS A;  1NSG A;  3UQI A;  4DZ3 A;  3B9D A;  2F2D A;  4IQ2 A;  2DT0 A;  2KO7 A;  4O2T A;  3EY6 A;  2VN1 A;  5HT1 A;  3AS0 A;  4GGQ A;  3VAW A;  1Y0O A;  3TC5 A;  1NMV A;  3IKD A;  3O5M A;  2A3E A;  1TCO C;  5JH8 A;  4HBE A;  1PBK A;  1FKF A;  4ODM A;  1FFQ A;  4TW8 A;  2OFN A;  4R0X A;  4KR0 B;  4MNL A;  2YBT A;  1ROU A;  3AS3 A;  5DEZ A;  2B31 A;  2WK2 A;  2XP7 A;  1W1T A;  1JVW A;  3ARU A;  2IF4 A;  5HW8 A;  2RUD A;  4BF8 A;  2XP3 A;  1LG2 A;  2PV2 A;  1VF8 A;  4ODO A;  3ARZ A;  2QF8 A;  4GIV A;  3JXV A;  1Q1C A;  4TX0 A;  3WL1 A;  1W26 A;  4DRP A;  1E15 A;  1OWQ A;  4MNM A;  3ARW A;  2F4E A;  4JFJ A;  1J6Y A;  3KAI A;  4DRJ A;  3ART A;  1WNO A;  3UI6 A;  5DIU A;  3O5J A;  2XP6 A;  1KFW A;  3RFW A;  5DIV A;  3RM4 A;  3CH9 A;  4DWS B;  3OOB A;  1HKI A;  1RD6 A;  4TW7 A;  1J4R A;  1YW5 A;  2IUZ A;  2RSE A;  1FKT A;  1SR0 A;  2ESC A;  2DG4 A;  3O5D A;  1E6P A;  4DRK A;  3CHE A;  1H0I A;  3CHD A;  3O5O A;  1E9L A;  2FAP A;  1ZCN A;  2ZR5 A;  2RUR A;  2YBU A;  4DWS A;  3O5G A;  2MLZ A;  1KT0 A;  1U79 A;  4ZS6 A;  1Q6H A;  1HKK A;  3FXY A;  3ARX A;  2LKN A;  1FKB A;  1HXV A;  3G6M A;  1GOI A;  4WKA A;  5HKG A;  3AQU A;  1JNS A;  3WD2 A;  1D6O A;  3CZ8 A;  1O6I A;  2XP4 A;  3B7X A;  4P8V A;  1OGG A;  1W9V A;  2VCD A;  1F8A B;  3AS1 A;  4DZ2 A;  2L2S A;  5HWC A;  1ZL1 A;  2M2A A;  2PPP A;  3O5Q A;  4HAR A;  4LGX A;  2D9F A;  3FAP A;  1LQ0 A;  3TDB A;  3PR9 A;  2FKE A;  3O5L A;  2LPV A;  3O5R A;  1NWU A;  4IT6 A;  2AWG A;  2DSZ A;  3PRA A;  1NWR A;  4DIP A;  4U85 A;  4WK9 A;  1FKH A;  1BL4 A;  2FDM A;  1UR8 A;  1GUV A;  3ALG A;  3ARO A;  4N19 A;  4DH0 A;  4IPX A;  1HKJ A;  3FY1 A;  2A3A A;  4DT4 A;  4JFK A;  2MPH A;  2A3B A;  4R5E A;  2K8I A;  4MTV A;  2PPO A;  4ODK A;  5J6E A;  2PI6 A;  1E6N A;  1HKM A;  2MNT A;  4WKH A;  2DSU A;  2DG9 A;  5DIT A;  3WL0 A;  4QIB A;  3IK8 A;  3UI4 A;  4ZPW R;  4TNS A;  5BXJ A;  4ZPT R;  2DSV A;  4Z2I A;  4WJX A;  2RQS A;  3ARV A;  3PA7 A;  1W9P A;  2M08 A;  2LGO A;  4JFI A;  4ITZ A;  2DG3 A;  3IKG A;  2XP5 A;  2LJ4 A;  1K9T A;  3CHC A;  5HTG A;  1EQ3 A;  1ZBC A;  3RM8 A;  4MNK A;  4L72 B;  2PV3 A;  3JYM A;  4Z2K A;  2ZR6 A;  3O5I A;  4NZC A;  5HBF A;  3UF8 A;  1BKF A;  4DWS D;  2XPA A;  1OGB A;  3KAF A;  4P8U A;  4QT3 A;  3GPK A;  3WH0 A;  5DO2 A;  1R9H A;  4TYO A;  4ODN A;  4MGV A;  1KT1 A;  1H0G A;  1LL6 A;  2PV1 A;  2N87 A;  5DF0 A;  5I98 A;  1NWS A;  2KGJ A;  2KR7 A;  2ZQU A;  2MLY A;  2KE0 A;  3WQW A;  1D7H A;  1JND A;  3WIJ A;  2PPN A;  1XRV A;  1E6R A;  1QZ2 A;  1W1Y A;  3B9A A;  3WD1 A;  1ZBK A;  4W9O A;  4FN2 A;  3RGC A;  2ZR4 A;  2XPB A;  3WD0 A;  2O92 A;  1A7X A;  4LAV A;  1Q6U A;  2KFW A;  2ZQV A;  2XP9 A;  4NSB A;  4URI A;  1LL7 A;  2G8Z A;  2DT2 A;  1PIN A;  1ZU8 A;  4W9P A;  1LG1 A;  3UQA A;  4KQZ A;  2F21 A;  1HJV A;  1FFR A;  1QPL A;  2KI3 A;  4Q22 A;  1HJW A;  3TCZ A;  1CTN A;  4TW6 A;  3MDY B;  5GQB A;  4QT2 A;  3UQB A;  5HWB A;  4ML4 A;  2RUC A;  4WKF A;  4JYS A;  1W1V A;  3CGN A;  3BXW A;  4HBO A;  3KAG A;  2JZV A;  4Z2L A;  4WIW A;  4U86 A;  1ZBW A;  4LAY A;  1M5Y A;  1HJX A;  1W9U A;  2WM0 A;  3IHZ A;  3WD3 A;  4Z2H A;  3ARR A;  3B8S A;  1F40 A;  4JFL A;  2DT1 A;  4W9Q A;  3WQV A;  4MSP A;  1J4I A;  1J4H A;  1ITX A;  4NNR A;  4LAX A;  2OLH A;  3AS2 A;  3ARY A;  1FAP A;  1QPF A;  3KCE A;  4PTM A;  1FKI A;  3W4R A;  4ODR A;  1N1A A;  3KAC A;  4S3J A;  1C9H A;  1SYT A;  1LJY A;  3OA5 A;  3ARS A;  2ZQT A;  1EDQ A;  2M1I A;  1WAW A;  4JFM A;  3RME A;  3NTP A;  3I6C A;  1D7I A;  1X6N A;  4C02 B;  4IQC A;  4DRI A;  2G41 A;  1P5Q A;  2DPE A;  4MNJ A;  1FKR A;  3O5E A;  1B6C A;  2Q5A A;  4ODL A;  3RM9 A;  4J4N A;  2MF9 A;  1EIB A;  4J4O A;  3ALF A;  2XP8 A;  1WB0 A;  4ODP A;  2ZQS A;  3NRK A;  1L1P A;  4DRH A;  1YAT A;  1E6Z A;  3PRB A;  4DRO A;  1JNT A;  1T11 A;  4ZPV R;  1IX5 A;  2Y78 A;  4MPK A;  3KZ7 A;  1ROT A;  5B8I C;  4QZV B;  1LL4 A;  3WKZ A;  3QOK A;  3O5K A;  2WLY A;  2DSW A;  3B9E A;  4FAP A;  1ZBV A;  2DT3 A;  4Z2G A;  3ARQ A;  1JNE A;  2UZ5 A;  4L3N A;  4DRQ A;  1FKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...