1U79A

Crystal structure of atfkbp13
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
125
structure length
125
Chain Sequence
CEFSVSPSGLAFCDKVVGYGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLTFRIGVGEVIKGWDQGILGSDGIPPMLTGGKRTLRIPPELAYGDRGAGCKGGSCLIPPASVLLFDIEYIGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase 3
publication title Structural analysis uncovers a role for redox in regulating FKBP13, an immunophilin of the chloroplast thylakoid lumen
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 27
structure length 125
sequence length 125
chains with identical sequence B, C, D, E
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2004-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1u79A00
1T11A 3O5LA 2XPAA 1ROUA 1JVWA 1QPFA 1D7HA 1YW5A 2LJ4A 2XP5A 4QT3A 3PRDA 2ZR6A 1ZK6A 5I98A 1Q6IA 3B7XA 2M2AA 3OOBA 2KO7A 4TX0A 3O5DA 4U85A 2Y78A 4G2PA 4TYOA 4U84A 2KR7A 2D9FA 2FAPA 2LKNA 4U86A 4G50A 5HTGA 2JZVA 3O5QA 2XP8A 4W9PA 1F8AB 4IQ2A 2M08A 2VN1A 1FJDA 4LAVA 2RUDA 1Q6UA 3O5OA 3JXVA 1A7XA 1KT1A 1TCOC 4DZ2A 1L1PA 3O5PA 1J4IA 2RUQA 3IKDA 2Q5AA 2ZQVA 3IHZA 3KABA 4DT4A 1F40A 1QPLA 3O5MA 4DRMA 1NMWA 2XP3A 5HUAA 5HW8A 3UQBA 5D75A 1FKDA 2RQSA 2KGJA 2PV1A 3CGNA 2RUCA 4IPXA 2XPBA 3RFWA 4JFJA 4LAXA 3KAHA 2KI3A 4DRHA 5HKGA 3PA7A 4IQCA 1D7IA 1Y0OA 3KADA 2K8IA 3UI4A 3KACA 1JNSA 1R9HA 2PPPA 4ODMA 4TW8A 5DITA 5HWBA 4TW7A 1J4HA 1ZCNA 2ITKA 1M5YA 1W26A 2LGOA 2PBCA 3O5FA 4DRPA 4MGVA 1FKRA 2FKEA 3IKGA 2DG4A 1EQ3A 1D7JA 4DRNA 5B8IC 4JFKA 1N1AA 3O5KA 3KZ7A 3TDBA 1Q1CA 3O5GA 3VAWA 3O5RA 3NTPA 5DIUA 4DH0A 1Q6HA 3TC5A 1HXVA 2F21A 4O2TA 2DG9A 2ZQSA 4JFIA 5DIVA 2AWGA 3IK8A 4NNRA 3UI6A 1ROTA 3O5IA 5GPGA 3NRKA 2MF9A 1EYMA 1KT0A 3KCEA 2OFNA 4ITZA 5HT1A 3KAIA 2ZQUA 4DIPA 1FKIA 2PV3A 2XP7A 2MLYA 4GGQA 3WH0A 2F4EA 3KAFA 2L2SA 4DRIA 4N19A 1FKGA 2XP6A 4JFLA 4DROA 1FKHA 1FKLA 1FKTA 1QZ2A 3H9RB 1PINA 2IF4A 1J4RA 4JFMA 4MSPA 4DRQA 5HWCA 2XP9A 2DG3A 3GPKA 1FKFA 3LUOA 1NMVA 4ODKA 1BKFA 1NSGA 1C9HA 1P5QA 3MDYB 4R0XA 5BXJA 1FKKA 4LAWA 2VCDA 3O5EA 2ZR4A 3I6CA 1JNTA 4TW6A 2M1IA 2PPNA 2UZ5A 3CGMA 3UQIA 3FAPA 5HW6A 5HW7A 4ODPA 4ODOA 2RURA 4J4NA 4W9QA 3PRBA 4GIVA 4FAPA 2MNTA 1FKSA 3KAGA 3TCZA 3JYJA 2MLXA 3UF8A 4W9OA 4BF8A 4DRKA 2KFWA 1J6YA 4LAYA 2PPOA 4ODLA 3ODKA 2PV2A 4QT2A 4C02B 3JYMA 1FAPA 3UQAA 4J4OA 2RSEA 3EY6A 4TNSA 3RGCA 4ODRA 4QIBA 1B6CA 2MPHA 1U79A 4JYSA 4ODQA 2KE0A 3O5JA 2LPVA 1FD9A 4FN2A 2MLZA 5J6EA 4DRJA 3UI5A 1YATA 1FKJA 2F2DA 3NI6A 4ODNA 2ZR5A 1BL4A 1FKBA 1D6OA 1PBKA 2N87A 2XP4A 4DZ3A 2ZQTA
chains in the Genus database with same CATH superfamily
2XPAA 2OLHA 4QT3A 3PRDA 2ZR6A 1ZK6A 2WK2A 3B7XA 2M2AA 2WLYA 4TYOA 4G2PA 5JH8A 1GPFA 2D9FA 3ARZA 4MPKA 4U86A 1TFVA 3BMBA 4W9PA 2G8ZA 4IQ2A 4PTMA 1D2KA 2VN1A 4LAVA 3O5OA 3JXVA 1A7XA 4QZVB 1WB0A 3IHZA 3KABA 4XAKA 1UR9A 3WD4A 3O5MA 3BXWA 5D75A 1FKDA 3CGNA 2PV1A 2XPBA 4JFJA 3KAHA 5HKGA 5GQBA 4WKAA 5HBFA 3UI4A 2DSWA 2PBCA 4MTVA 4KR0B 4MGVA 1FKRA 1ZL1A 1FFRA 1D7JA 3O5GA 4HBOA 4P8WA 4WJXA 2DT3A 4O2TA 1LL7A 4IT4A 1OGGA 3GTYX 1ROTA 3O5IA 4Z2JA 5GPGA 2FDMA 4ITZA 2PN0A 1X6LA 1WNOA 4DRIA 4N19A 1FKGA 4MNJA 3H9RB 4WK9A 1HJXA 1NWTA 3RM8A 1NMVA 1NSGA 3FXYA 4R0XA 1EDQA 2VCDA 3O5EA 2P4VA 4TW6A 2B31A 2UZ5A 3CGMA 1W1VA 4HBEA 3B9AA 5HW6A 4W9QA 1XRVA 3PRBA 3TCZA 1NWUA 1EHNA 3JYJA 4DRKA 1HKMA 4Z2IA 2PV2A 3WQVA 3CHDA 4TNSA 1B6CA 3AROA 3ARSA 2QF8A 4DWSD 3UI5A 3UF8A 1LG2A 1LJYA 1FKBA 1ZBWA 4MNLA 3WD1A 3O5LA 1JVWA 1QPFA 3B9EA 1HKKA 3CZ8A 3OOBA 4LGXA 2DPEA 3O5DA 1EIBA 1IX5A 1K9TA 4G50A 5HTGA 3O5QA 1E6PA 3W4RA 1F8AB 1W9UA 3ARTA 2ESCA 1Q6UA 1L1PA 1KT1A 1TCOC 4DZ2A 4URIA 2DT2A 2RUQA 3IKDA 2ZQVA 3WKZA 4DWSB 1QPLA 4P8XA 5HW8A 3UQBA 2KGJA 1SYTA 2A3CA 2RUCA 1VF8A 2WLZA 2K8IA 3KACA 2EULA 2O92A 3WL0A 3ALFA 5HWBA 1J4HA 2ITKA 1W26A 3WD3A 3B9DA 2AOSA 2FKEA 1W9VA 3ARUA 4P8UA 3GU0A 3RM9A 1Q1CA 1NH6A 3VAWA 4ZS6A 5DIUA 1LQ0A 4Q22A 3TC5A 1E9LA 2F21A 2DG9A 2ZQSA 4JFIA 3IK8A 4L3NA 5HT1A 3WH0A 4MAVA 2MLYA 4UDMA 3WQWA 1E6RA 4DROA 2DSZA 2IF4A 1J4RA 4JFMA 4MSPA 2XP9A 3GPKA 1FKFA 4ZPWR 3MDYB 1P5QA 2F23A 3CHCA 3ARYA 3G6MA 1NWSA 2PPNA 4J4NA 1JNDA 3FY1A 2MNTA 1FKSA 2DT1A 3ARPA 2KFWA 1J6YA 4ODLA 3ODKA 4C02B 1ZBKA 3JYMA 2A3EA 2O9OA 3EY6A 4ODRA 4QIBA 1GUVA 1ZB5A 3O5JA 1FD9A 5DEZA 4MNMA 4Z2GA 5J6EA 1W1PA 3PRAA 4NSBA 2DSUA 3NI6A 1FKJA 2F2DA 4QT2A 1XHGA 2ZQTA 4WKFA 3ARXA 1ROUA 4IT6A 4WIWA 5HUAA 2LJ4A 1D7HA 1YW5A 3WIJA 5I98A 1E44A 2KO7A 3QOKA 1NWRA 4U85A 1E6ZA 4NZCA 2FAPA 2LKNA 4MNKA 1LG1A 4P8VA 4ZPTR 2RUDA 3AQUA 1SR0A 4DWSC 1OWQA 1NMWA 2XP3A 4DRHA 2KI3A 3PA7A 4W5UA 1ITXA 4ML4A 1R9HA 2PPPA 4ODMA 4TW8A 2LGOA 1M5YA 4R5EA 3IKGA 1HJVA 2DT0A 3WD0A 4JFKA 1N1AA 1E6NA 3KZ7A 3O5RA 1HXVA 5DIVA 2AWGA 3B8SA 3NRKA 2MF9A 1KT0A 2OFNA 2YBTA 3KAIA 4DIPA 1FKIA 2PV3A 3AS1A 5DO2A 4GGQA 2F4EA 2B5UB 1WAWA 3KAFA 2L2SA 1X6NA 1CTNA 3RM4A 2XP6A 4JFLA 1FKHA 1FKLA 1PINA 4S3KA 4DRQA 3LUOA 1BKFA 5BXJA 1C9HA 3CHFA 2M1IA 4ODPA 4ODOA 2RURA 3KAGA 2A3BA 4W9OA 2ETNA 4BF8A 2PPOA 1W1TA 1FAPA 2MPHA 1O6IA 2G41A 4ODQA 4Z2KA 1LL6A 2LPVA 1UR8A 4FN2A 4DRJA 2PI6A 4ODNA 1D6OA 1PBKA 3RGCA 3WL1A 1T11A 4L72B 1GOIA 2WM0A 2XP5A 1Q6IA 3CHEA 1W9PA 5GPRA 4HARA 4TX0A 1W1YA 2Y78A 4U84A 2KR7A 2DSVA 2JZVA 1HKIA 3AS3A 2XP8A 2M08A 1FJDA 3ARVA 1HKJA 3O5PA 1J4IA 2Q5AA 1F40A 4DT4A 3RMEA 1H0GA 4DRMA 1GRJA 4Q7NA 4Z2HA 2RQSA 2IUZA 4IPXA 3RFWA 4LAXA 4IQCA 1D7IA 1JCHB 1Y0OA 3KADA 1JNSA 5DITA 4TW7A 1H0IA 1ZCNA 3O5FA 5DF0A 4DRPA 1JNEA 2DG4A 1EQ3A 1OGBA 3CH9A 4DRNA 5B8IC 3O5KA 3TDBA 3NTPA 4DH0A 1Q6HA 4WKHA 4NNRA 3UI6A 3KCEA 1EYMA 1RD6A 2ZQUA 4Z2LA 2XP7A 3OA5A 1FFQA 3EIPA 1E15A 3AS0A 3ARQA 1FKTA 1QZ2A 1ZBVA 5HWCA 2DG3A 3AS2A 4ODKA 3ARWA 1FKKA 4LAWA 2YBUA 2ZR4A 3I6CA 3PR9A 1JNTA 3UQIA 3FAPA 5HW7A 4FAPA 4GIVA 3ALGA 4S3JA 2MLXA 1LL4A 1ZU8A 4LAYA 1KFWA 3UQAA 4J4OA 2RSEA 3WD2A 2A3AA 3G6LA 1U79A 4JYSA 2KE0A 4KQZA 2MLZA 4DWSA 1YATA 3ARRA 2ZR5A 1BL4A 1ZBCA 4ZPVR 4AY1A 2N87A 1HJWA 2XP4A 4DZ3A
chains in the Genus database with same CATH topology
2XPAA 2OLHA 4QT3A 3PRDA 2ZR6A 1ZK6A 2WK2A 3B7XA 2M2AA 2WLYA 4TYOA 4G2PA 5JH8A 1GPFA 2D9FA 3ARZA 4MPKA 4U86A 1TFVA 4W9PA 2G8ZA 4IQ2A 4PTMA 1D2KA 2VN1A 4LAVA 3O5OA 3JXVA 1A7XA 4QZVB 1WB0A 3IHZA 3KABA 4XAKA 1UR9A 3WD4A 3O5MA 3BXWA 5D75A 1FKDA 3CGNA 2PV1A 2XPBA 4JFJA 3KAHA 5HKGA 5GQBA 4WKAA 5HBFA 3UI4A 2DSWA 2PBCA 4MTVA 4KR0B 4MGVA 1FKRA 1ZL1A 1FFRA 1D7JA 3O5GA 4HBOA 4P8WA 4WJXA 2DT3A 4O2TA 1LL7A 4IT4A 1OGGA 1ROTA 3O5IA 4Z2JA 5GPGA 2FDMA 4ITZA 1X6LA 1WNOA 4DRIA 4N19A 1FKGA 4MNJA 3H9RB 4WK9A 1HJXA 1NWTA 3RM8A 1NMVA 1NSGA 3FXYA 4R0XA 1EDQA 2VCDA 3O5EA 4TW6A 2B31A 2UZ5A 3CGMA 1W1VA 4HBEA 3B9AA 5HW6A 4W9QA 1XRVA 3PRBA 3TCZA 1NWUA 1EHNA 3JYJA 4DRKA 1HKMA 4Z2IA 2PV2A 3WQVA 3CHDA 4TNSA 1B6CA 3AROA 3ARSA 2QF8A 4DWSD 3UI5A 3UF8A 1LG2A 1LJYA 1FKBA 1ZBWA 4MNLA 3WD1A 3O5LA 1JVWA 1QPFA 3B9EA 1HKKA 3CZ8A 3OOBA 4LGXA 2DPEA 3O5DA 1EIBA 1IX5A 1K9TA 4G50A 5HTGA 3O5QA 1E6PA 3W4RA 1F8AB 1W9UA 3ARTA 2ESCA 1Q6UA 1L1PA 1KT1A 1TCOC 4DZ2A 4URIA 2DT2A 2RUQA 3IKDA 2ZQVA 3WKZA 4DWSB 1QPLA 4P8XA 5HW8A 3UQBA 2KGJA 1SYTA 2A3CA 2RUCA 1VF8A 2WLZA 2K8IA 3KACA 2O92A 3WL0A 3ALFA 5HWBA 1J4HA 2ITKA 1W26A 3WD3A 3B9DA 2AOSA 2FKEA 1W9VA 3ARUA 4P8UA 3RM9A 1Q1CA 1NH6A 3VAWA 4ZS6A 5DIUA 1LQ0A 4Q22A 3TC5A 1E9LA 2F21A 2DG9A 2ZQSA 4JFIA 3IK8A 4L3NA 5HT1A 3WH0A 4MAVA 2MLYA 3WQWA 1E6RA 4DROA 2DSZA 2IF4A 1J4RA 4JFMA 4MSPA 2XP9A 3GPKA 1FKFA 4ZPWR 1P5QA 3MDYB 3CHCA 3ARYA 3G6MA 1NWSA 2PPNA 4J4NA 1JNDA 3FY1A 2MNTA 1FKSA 2DT1A 3ARPA 2KFWA 1J6YA 4ODLA 3ODKA 4C02B 1ZBKA 3JYMA 2A3EA 2O9OA 3EY6A 4ODRA 4QIBA 1GUVA 1ZB5A 3O5JA 1FD9A 5DEZA 4MNMA 4Z2GA 5J6EA 1W1PA 3PRAA 4NSBA 2DSUA 3NI6A 1FKJA 2F2DA 4QT2A 1XHGA 2ZQTA 4WKFA 3ARXA 1ROUA 4IT6A 4WIWA 5HUAA 2LJ4A 1D7HA 1YW5A 3WIJA 5I98A 2KO7A 3QOKA 1NWRA 4U85A 1E6ZA 4NZCA 2FAPA 2LKNA 4MNKA 1LG1A 4P8VA 4ZPTR 2RUDA 3AQUA 1SR0A 4DWSC 1OWQA 1NMWA 2XP3A 4DRHA 2KI3A 3PA7A 4W5UA 1ITXA 4ML4A 1R9HA 2PPPA 4ODMA 4TW8A 2LGOA 1M5YA 4R5EA 3IKGA 1HJVA 2DT0A 3WD0A 4JFKA 1N1AA 1E6NA 3KZ7A 3O5RA 1HXVA 5DIVA 2AWGA 3B8SA 3NRKA 2MF9A 1KT0A 2OFNA 2YBTA 3KAIA 4DIPA 1FKIA 2PV3A 3AS1A 5DO2A 4GGQA 2F4EA 1WAWA 3KAFA 2L2SA 1X6NA 1CTNA 3RM4A 2XP6A 4JFLA 1FKHA 1FKLA 1PINA 4S3KA 4DRQA 3LUOA 1BKFA 5BXJA 1C9HA 3CHFA 2M1IA 4ODPA 4ODOA 2RURA 3KAGA 2A3BA 4W9OA 4BF8A 2PPOA 1W1TA 1FAPA 2MPHA 1O6IA 2G41A 4ODQA 4Z2KA 1LL6A 2LPVA 1UR8A 4FN2A 4DRJA 2PI6A 4ODNA 1D6OA 1PBKA 3RGCA 3WL1A 1T11A 4L72B 1GOIA 2WM0A 2XP5A 1Q6IA 3CHEA 1W9PA 5GPRA 4HARA 4TX0A 1W1YA 2Y78A 4U84A 2KR7A 2DSVA 2JZVA 1HKIA 3AS3A 2XP8A 2M08A 1FJDA 3ARVA 1HKJA 3O5PA 1J4IA 2Q5AA 1F40A 4DT4A 3RMEA 1H0GA 4DRMA 4Q7NA 4Z2HA 2RQSA 2IUZA 4IPXA 3RFWA 4LAXA 4IQCA 1D7IA 1Y0OA 3KADA 1JNSA 5DITA 4TW7A 1H0IA 1ZCNA 3O5FA 5DF0A 4DRPA 1JNEA 2DG4A 1EQ3A 1OGBA 3CH9A 4DRNA 5B8IC 3O5KA 3TDBA 3NTPA 4DH0A 1Q6HA 4WKHA 4NNRA 3UI6A 3KCEA 1EYMA 1RD6A 2ZQUA 4Z2LA 2XP7A 3OA5A 1FFQA 1E15A 3AS0A 3ARQA 1FKTA 1QZ2A 1ZBVA 5HWCA 2DG3A 3AS2A 4ODKA 3ARWA 1FKKA 4LAWA 2YBUA 2ZR4A 3I6CA 3PR9A 1JNTA 3UQIA 3FAPA 5HW7A 4FAPA 4GIVA 3ALGA 4S3JA 2MLXA 1LL4A 1ZU8A 4LAYA 1KFWA 3UQAA 4J4OA 2RSEA 3WD2A 2A3AA 3G6LA 1U79A 4JYSA 2KE0A 4KQZA 2MLZA 4DWSA 1YATA 3ARRA 2ZR5A 1BL4A 1ZBCA 4ZPVR 4AY1A 2N87A 1HJWA 2XP4A 4DZ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T11 A;  3O5L A;  2XPA A;  1ROU A;  1JVW A;  1QPF A;  1D7H A;  1YW5 A;  2LJ4 A;  2XP5 A;  4QT3 A;  3PRD A;  2ZR6 A;  1ZK6 A;  5I98 A;  1Q6I A;  3B7X A;  2M2A A;  3OOB A;  2KO7 A;  4TX0 A;  3O5D A;  4U85 A;  2Y78 A;  4G2P A;  4TYO A;  4U84 A;  2KR7 A;  2D9F A;  2FAP A;  2LKN A;  4U86 A;  4G50 A;  5HTG A;  2JZV A;  3O5Q A;  2XP8 A;  4W9P A;  1F8A B;  4IQ2 A;  2M08 A;  2VN1 A;  1FJD A;  4LAV A;  2RUD A;  1Q6U A;  3O5O A;  3JXV A;  1A7X A;  1KT1 A;  1TCO C;  4DZ2 A;  1L1P A;  3O5P A;  1J4I A;  2RUQ A;  3IKD A;  2Q5A A;  2ZQV A;  3IHZ A;  3KAB A;  4DT4 A;  1F40 A;  1QPL A;  3O5M A;  4DRM A;  1NMW A;  2XP3 A;  5HUA A;  5HW8 A;  3UQB A;  5D75 A;  1FKD A;  2RQS A;  2KGJ A;  2PV1 A;  3CGN A;  2RUC A;  4IPX A;  2XPB A;  3RFW A;  4JFJ A;  4LAX A;  3KAH A;  2KI3 A;  4DRH A;  5HKG A;  3PA7 A;  4IQC A;  1D7I A;  1Y0O A;  3KAD A;  2K8I A;  3UI4 A;  3KAC A;  1JNS A;  1R9H A;  2PPP A;  4ODM A;  4TW8 A;  5DIT A;  5HWB A;  4TW7 A;  1J4H A;  1ZCN A;  2ITK A;  1M5Y A;  1W26 A;  2LGO A;  2PBC A;  3O5F A;  4DRP A;  4MGV A;  1FKR A;  2FKE A;  3IKG A;  2DG4 A;  1EQ3 A;  1D7J A;  4DRN A;  5B8I C;  4JFK A;  1N1A A;  3O5K A;  3KZ7 A;  3TDB A;  1Q1C A;  3O5G A;  3VAW A;  3O5R A;  3NTP A;  5DIU A;  4DH0 A;  1Q6H A;  3TC5 A;  1HXV A;  2F21 A;  4O2T A;  2DG9 A;  2ZQS A;  4JFI A;  5DIV A;  2AWG A;  3IK8 A;  4NNR A;  3UI6 A;  1ROT A;  3O5I A;  5GPG A;  3NRK A;  2MF9 A;  1EYM A;  1KT0 A;  3KCE A;  2OFN A;  4ITZ A;  5HT1 A;  3KAI A;  2ZQU A;  4DIP A;  1FKI A;  2PV3 A;  2XP7 A;  2MLY A;  4GGQ A;  3WH0 A;  2F4E A;  3KAF A;  2L2S A;  4DRI A;  4N19 A;  1FKG A;  2XP6 A;  4JFL A;  4DRO A;  1FKH A;  1FKL A;  1FKT A;  1QZ2 A;  3H9R B;  1PIN A;  2IF4 A;  1J4R A;  4JFM A;  4MSP A;  4DRQ A;  5HWC A;  2XP9 A;  2DG3 A;  3GPK A;  1FKF A;  3LUO A;  1NMV A;  4ODK A;  1BKF A;  1NSG A;  1C9H A;  1P5Q A;  3MDY B;  4R0X A;  5BXJ A;  1FKK A;  4LAW A;  2VCD A;  3O5E A;  2ZR4 A;  3I6C A;  1JNT A;  4TW6 A;  2M1I A;  2PPN A;  2UZ5 A;  3CGM A;  3UQI A;  3FAP A;  5HW6 A;  5HW7 A;  4ODP A;  4ODO A;  2RUR A;  4J4N A;  4W9Q A;  3PRB A;  4GIV A;  4FAP A;  2MNT A;  1FKS A;  3KAG A;  3TCZ A;  3JYJ A;  2MLX A;  3UF8 A;  4W9O A;  4BF8 A;  4DRK A;  2KFW A;  1J6Y A;  4LAY A;  2PPO A;  4ODL A;  3ODK A;  2PV2 A;  4QT2 A;  4C02 B;  3JYM A;  1FAP A;  3UQA A;  4J4O A;  2RSE A;  3EY6 A;  4TNS A;  3RGC A;  4ODR A;  4QIB A;  1B6C A;  2MPH A;  1U79 A;  4JYS A;  4ODQ A;  2KE0 A;  3O5J A;  2LPV A;  1FD9 A;  4FN2 A;  2MLZ A;  5J6E A;  4DRJ A;  3UI5 A;  1YAT A;  1FKJ A;  2F2D A;  3NI6 A;  4ODN A;  2ZR5 A;  1BL4 A;  1FKB A;  1D6O A;  1PBK A;  2N87 A;  2XP4 A;  4DZ3 A;  2ZQT A; 
#chains in the Genus database with same CATH topology
 2XPA A;  2OLH A;  4QT3 A;  3PRD A;  2ZR6 A;  1ZK6 A;  2WK2 A;  3B7X A;  2M2A A;  2WLY A;  4TYO A;  4G2P A;  5JH8 A;  1GPF A;  2D9F A;  3ARZ A;  4MPK A;  4U86 A;  1TFV A;  3BMB A;  4W9P A;  2G8Z A;  4IQ2 A;  4PTM A;  1D2K A;  2VN1 A;  4LAV A;  3O5O A;  3JXV A;  1A7X A;  4QZV B;  1WB0 A;  3IHZ A;  3KAB A;  4XAK A;  1UR9 A;  3WD4 A;  3O5M A;  3BXW A;  5D75 A;  1FKD A;  3CGN A;  2PV1 A;  2XPB A;  4JFJ A;  3KAH A;  5HKG A;  5GQB A;  4WKA A;  5HBF A;  3UI4 A;  2DSW A;  2PBC A;  4MTV A;  4KR0 B;  4MGV A;  1FKR A;  1ZL1 A;  1FFR A;  1D7J A;  3O5G A;  4HBO A;  4P8W A;  4WJX A;  2DT3 A;  4O2T A;  1LL7 A;  4IT4 A;  1OGG A;  3GTY X;  1ROT A;  3O5I A;  4Z2J A;  5GPG A;  2FDM A;  4ITZ A;  2PN0 A;  1X6L A;  1WNO A;  4DRI A;  4N19 A;  1FKG A;  4MNJ A;  3H9R B;  4WK9 A;  1HJX A;  1NWT A;  3RM8 A;  1NMV A;  1NSG A;  3FXY A;  4R0X A;  1EDQ A;  2VCD A;  3O5E A;  2P4V A;  4TW6 A;  2B31 A;  2UZ5 A;  3CGM A;  1W1V A;  4HBE A;  3B9A A;  5HW6 A;  4W9Q A;  1XRV A;  3PRB A;  3TCZ A;  1NWU A;  1EHN A;  3JYJ A;  4DRK A;  1HKM A;  4Z2I A;  2PV2 A;  3WQV A;  3CHD A;  4TNS A;  1B6C A;  3ARO A;  3ARS A;  2QF8 A;  4DWS D;  3UI5 A;  3UF8 A;  1LG2 A;  1LJY A;  1FKB A;  1ZBW A;  4MNL A;  3WD1 A;  3O5L A;  1JVW A;  1QPF A;  3B9E A;  1HKK A;  3CZ8 A;  3OOB A;  4LGX A;  2DPE A;  3O5D A;  1EIB A;  1IX5 A;  1K9T A;  4G50 A;  5HTG A;  3O5Q A;  1E6P A;  3W4R A;  1F8A B;  1W9U A;  3ART A;  2ESC A;  1Q6U A;  1L1P A;  1KT1 A;  1TCO C;  4DZ2 A;  4URI A;  2DT2 A;  2RUQ A;  3IKD A;  2ZQV A;  3WKZ A;  4DWS B;  1QPL A;  4P8X A;  5HW8 A;  3UQB A;  2KGJ A;  1SYT A;  2A3C A;  2RUC A;  1VF8 A;  2WLZ A;  2K8I A;  3KAC A;  2EUL A;  2O92 A;  3WL0 A;  3ALF A;  5HWB A;  1J4H A;  2ITK A;  1W26 A;  3WD3 A;  3B9D A;  2AOS A;  2FKE A;  1W9V A;  3ARU A;  4P8U A;  3GU0 A;  3RM9 A;  1Q1C A;  1NH6 A;  3VAW A;  4ZS6 A;  5DIU A;  1LQ0 A;  4Q22 A;  3TC5 A;  1E9L A;  2F21 A;  2DG9 A;  2ZQS A;  4JFI A;  3IK8 A;  4L3N A;  5HT1 A;  3WH0 A;  4MAV A;  2MLY A;  4UDM A;  3WQW A;  1E6R A;  4DRO A;  2DSZ A;  2IF4 A;  1J4R A;  4JFM A;  4MSP A;  2XP9 A;  3GPK A;  1FKF A;  4ZPW R;  3MDY B;  1P5Q A;  2F23 A;  3CHC A;  3ARY A;  3G6M A;  1NWS A;  2PPN A;  4J4N A;  1JND A;  3FY1 A;  2MNT A;  1FKS A;  2DT1 A;  3ARP A;  2KFW A;  1J6Y A;  4ODL A;  3ODK A;  4C02 B;  1ZBK A;  3JYM A;  2A3E A;  2O9O A;  3EY6 A;  4ODR A;  4QIB A;  1GUV A;  1ZB5 A;  3O5J A;  1FD9 A;  5DEZ A;  4MNM A;  4Z2G A;  5J6E A;  1W1P A;  3PRA A;  4NSB A;  2DSU A;  3NI6 A;  1FKJ A;  2F2D A;  4QT2 A;  1XHG A;  2ZQT A;  4WKF A;  3ARX A;  1ROU A;  4IT6 A;  4WIW A;  5HUA A;  2LJ4 A;  1D7H A;  1YW5 A;  3WIJ A;  5I98 A;  1E44 A;  2KO7 A;  3QOK A;  1NWR A;  4U85 A;  1E6Z A;  4NZC A;  2FAP A;  2LKN A;  4MNK A;  1LG1 A;  4P8V A;  4ZPT R;  2RUD A;  3AQU A;  1SR0 A;  4DWS C;  1OWQ A;  1NMW A;  2XP3 A;  4DRH A;  2KI3 A;  3PA7 A;  4W5U A;  1ITX A;  4ML4 A;  1R9H A;  2PPP A;  4ODM A;  4TW8 A;  2LGO A;  1M5Y A;  4R5E A;  3IKG A;  1HJV A;  2DT0 A;  3WD0 A;  4JFK A;  1N1A A;  1E6N A;  3KZ7 A;  3O5R A;  1HXV A;  5DIV A;  2AWG A;  3B8S A;  3NRK A;  2MF9 A;  1KT0 A;  2OFN A;  2YBT A;  3KAI A;  4DIP A;  1FKI A;  2PV3 A;  3AS1 A;  5DO2 A;  4GGQ A;  2F4E A;  2B5U B;  1WAW A;  3KAF A;  2L2S A;  1X6N A;  1CTN A;  3RM4 A;  2XP6 A;  4JFL A;  1FKH A;  1FKL A;  1PIN A;  4S3K A;  4DRQ A;  3LUO A;  1BKF A;  5BXJ A;  1C9H A;  3CHF A;  2M1I A;  4ODP A;  4ODO A;  2RUR A;  3KAG A;  2A3B A;  4W9O A;  2ETN A;  4BF8 A;  2PPO A;  1W1T A;  1FAP A;  2MPH A;  1O6I A;  2G41 A;  4ODQ A;  4Z2K A;  1LL6 A;  2LPV A;  1UR8 A;  4FN2 A;  4DRJ A;  2PI6 A;  4ODN A;  1D6O A;  1PBK A;  3RGC A;  3WL1 A;  1T11 A;  4L72 B;  1GOI A;  2WM0 A;  2XP5 A;  1Q6I A;  3CHE A;  1W9P A;  5GPR A;  4HAR A;  4TX0 A;  1W1Y A;  2Y78 A;  4U84 A;  2KR7 A;  2DSV A;  2JZV A;  1HKI A;  3AS3 A;  2XP8 A;  2M08 A;  1FJD A;  3ARV A;  1HKJ A;  3O5P A;  1J4I A;  2Q5A A;  1F40 A;  4DT4 A;  3RME A;  1H0G A;  4DRM A;  1GRJ A;  4Q7N A;  4Z2H A;  2RQS A;  2IUZ A;  4IPX A;  3RFW A;  4LAX A;  4IQC A;  1D7I A;  1JCH B;  1Y0O A;  3KAD A;  1JNS A;  5DIT A;  4TW7 A;  1H0I A;  1ZCN A;  3O5F A;  5DF0 A;  4DRP A;  1JNE A;  2DG4 A;  1EQ3 A;  1OGB A;  3CH9 A;  4DRN A;  5B8I C;  3O5K A;  3TDB A;  3NTP A;  4DH0 A;  1Q6H A;  4WKH A;  4NNR A;  3UI6 A;  3KCE A;  1EYM A;  1RD6 A;  2ZQU A;  4Z2L A;  2XP7 A;  3OA5 A;  1FFQ A;  3EIP A;  1E15 A;  3AS0 A;  3ARQ A;  1FKT A;  1QZ2 A;  1ZBV A;  5HWC A;  2DG3 A;  3AS2 A;  4ODK A;  3ARW A;  1FKK A;  4LAW A;  2YBU A;  2ZR4 A;  3I6C A;  3PR9 A;  1JNT A;  3UQI A;  3FAP A;  5HW7 A;  4FAP A;  4GIV A;  3ALG A;  4S3J A;  2MLX A;  1LL4 A;  1ZU8 A;  4LAY A;  1KFW A;  3UQA A;  4J4O A;  2RSE A;  3WD2 A;  2A3A A;  3G6L A;  1U79 A;  4JYS A;  2KE0 A;  4KQZ A;  2MLZ A;  4DWS A;  1YAT A;  3ARR A;  2ZR5 A;  1BL4 A;  1ZBC A;  4ZPV R;  4AY1 A;  2N87 A;  1HJW A;  2XP4 A;  4DZ3 A; 
#chains in the Genus database with same CATH homology
 2XPA A;  2OLH A;  4QT3 A;  3PRD A;  2ZR6 A;  1ZK6 A;  2WK2 A;  3B7X A;  2M2A A;  2WLY A;  4TYO A;  4G2P A;  5JH8 A;  1GPF A;  2D9F A;  3ARZ A;  4MPK A;  4U86 A;  1TFV A;  4W9P A;  2G8Z A;  4IQ2 A;  4PTM A;  1D2K A;  2VN1 A;  4LAV A;  3O5O A;  3JXV A;  1A7X A;  4QZV B;  1WB0 A;  3IHZ A;  3KAB A;  4XAK A;  1UR9 A;  3WD4 A;  3O5M A;  3BXW A;  5D75 A;  1FKD A;  3CGN A;  2PV1 A;  2XPB A;  4JFJ A;  3KAH A;  5HKG A;  5GQB A;  4WKA A;  5HBF A;  3UI4 A;  2DSW A;  2PBC A;  4MTV A;  4KR0 B;  4MGV A;  1FKR A;  1ZL1 A;  1FFR A;  1D7J A;  3O5G A;  4HBO A;  4P8W A;  4WJX A;  2DT3 A;  4O2T A;  1LL7 A;  4IT4 A;  1OGG A;  1ROT A;  3O5I A;  4Z2J A;  5GPG A;  2FDM A;  4ITZ A;  1X6L A;  1WNO A;  4DRI A;  4N19 A;  1FKG A;  4MNJ A;  3H9R B;  4WK9 A;  1HJX A;  1NWT A;  3RM8 A;  1NMV A;  1NSG A;  3FXY A;  4R0X A;  1EDQ A;  2VCD A;  3O5E A;  4TW6 A;  2B31 A;  2UZ5 A;  3CGM A;  1W1V A;  4HBE A;  3B9A A;  5HW6 A;  4W9Q A;  1XRV A;  3PRB A;  3TCZ A;  1NWU A;  1EHN A;  3JYJ A;  4DRK A;  1HKM A;  4Z2I A;  2PV2 A;  3WQV A;  3CHD A;  4TNS A;  1B6C A;  3ARO A;  3ARS A;  2QF8 A;  4DWS D;  3UI5 A;  3UF8 A;  1LG2 A;  1LJY A;  1FKB A;  1ZBW A;  4MNL A;  3WD1 A;  3O5L A;  1JVW A;  1QPF A;  3B9E A;  1HKK A;  3CZ8 A;  3OOB A;  4LGX A;  2DPE A;  3O5D A;  1EIB A;  1IX5 A;  1K9T A;  4G50 A;  5HTG A;  3O5Q A;  1E6P A;  3W4R A;  1F8A B;  1W9U A;  3ART A;  2ESC A;  1Q6U A;  1L1P A;  1KT1 A;  1TCO C;  4DZ2 A;  4URI A;  2DT2 A;  2RUQ A;  3IKD A;  2ZQV A;  3WKZ A;  4DWS B;  1QPL A;  4P8X A;  5HW8 A;  3UQB A;  2KGJ A;  1SYT A;  2A3C A;  2RUC A;  1VF8 A;  2WLZ A;  2K8I A;  3KAC A;  2O92 A;  3WL0 A;  3ALF A;  5HWB A;  1J4H A;  2ITK A;  1W26 A;  3WD3 A;  3B9D A;  2AOS A;  2FKE A;  1W9V A;  3ARU A;  4P8U A;  3RM9 A;  1Q1C A;  1NH6 A;  3VAW A;  4ZS6 A;  5DIU A;  1LQ0 A;  4Q22 A;  3TC5 A;  1E9L A;  2F21 A;  2DG9 A;  2ZQS A;  4JFI A;  3IK8 A;  4L3N A;  5HT1 A;  3WH0 A;  4MAV A;  2MLY A;  3WQW A;  1E6R A;  4DRO A;  2DSZ A;  2IF4 A;  1J4R A;  4JFM A;  4MSP A;  2XP9 A;  3GPK A;  1FKF A;  4ZPW R;  1P5Q A;  3MDY B;  3CHC A;  3ARY A;  3G6M A;  1NWS A;  2PPN A;  4J4N A;  1JND A;  3FY1 A;  2MNT A;  1FKS A;  2DT1 A;  3ARP A;  2KFW A;  1J6Y A;  4ODL A;  3ODK A;  4C02 B;  1ZBK A;  3JYM A;  2A3E A;  2O9O A;  3EY6 A;  4ODR A;  4QIB A;  1GUV A;  1ZB5 A;  3O5J A;  1FD9 A;  5DEZ A;  4MNM A;  4Z2G A;  5J6E A;  1W1P A;  3PRA A;  4NSB A;  2DSU A;  3NI6 A;  1FKJ A;  2F2D A;  4QT2 A;  1XHG A;  2ZQT A;  4WKF A;  3ARX A;  1ROU A;  4IT6 A;  4WIW A;  5HUA A;  2LJ4 A;  1D7H A;  1YW5 A;  3WIJ A;  5I98 A;  2KO7 A;  3QOK A;  1NWR A;  4U85 A;  1E6Z A;  4NZC A;  2FAP A;  2LKN A;  4MNK A;  1LG1 A;  4P8V A;  4ZPT R;  2RUD A;  3AQU A;  1SR0 A;  4DWS C;  1OWQ A;  1NMW A;  2XP3 A;  4DRH A;  2KI3 A;  3PA7 A;  4W5U A;  1ITX A;  4ML4 A;  1R9H A;  2PPP A;  4ODM A;  4TW8 A;  2LGO A;  1M5Y A;  4R5E A;  3IKG A;  1HJV A;  2DT0 A;  3WD0 A;  4JFK A;  1N1A A;  1E6N A;  3KZ7 A;  3O5R A;  1HXV A;  5DIV A;  2AWG A;  3B8S A;  3NRK A;  2MF9 A;  1KT0 A;  2OFN A;  2YBT A;  3KAI A;  4DIP A;  1FKI A;  2PV3 A;  3AS1 A;  5DO2 A;  4GGQ A;  2F4E A;  1WAW A;  3KAF A;  2L2S A;  1X6N A;  1CTN A;  3RM4 A;  2XP6 A;  4JFL A;  1FKH A;  1FKL A;  1PIN A;  4S3K A;  4DRQ A;  3LUO A;  1BKF A;  5BXJ A;  1C9H A;  3CHF A;  2M1I A;  4ODP A;  4ODO A;  2RUR A;  3KAG A;  2A3B A;  4W9O A;  4BF8 A;  2PPO A;  1W1T A;  1FAP A;  2MPH A;  1O6I A;  2G41 A;  4ODQ A;  4Z2K A;  1LL6 A;  2LPV A;  1UR8 A;  4FN2 A;  4DRJ A;  2PI6 A;  4ODN A;  1D6O A;  1PBK A;  3RGC A;  3WL1 A;  1T11 A;  4L72 B;  1GOI A;  2WM0 A;  2XP5 A;  1Q6I A;  3CHE A;  1W9P A;  5GPR A;  4HAR A;  4TX0 A;  1W1Y A;  2Y78 A;  4U84 A;  2KR7 A;  2DSV A;  2JZV A;  1HKI A;  3AS3 A;  2XP8 A;  2M08 A;  1FJD A;  3ARV A;  1HKJ A;  3O5P A;  1J4I A;  2Q5A A;  1F40 A;  4DT4 A;  3RME A;  1H0G A;  4DRM A;  4Q7N A;  4Z2H A;  2RQS A;  2IUZ A;  4IPX A;  3RFW A;  4LAX A;  4IQC A;  1D7I A;  1Y0O A;  3KAD A;  1JNS A;  5DIT A;  4TW7 A;  1H0I A;  1ZCN A;  3O5F A;  5DF0 A;  4DRP A;  1JNE A;  2DG4 A;  1EQ3 A;  1OGB A;  3CH9 A;  4DRN A;  5B8I C;  3O5K A;  3TDB A;  3NTP A;  4DH0 A;  1Q6H A;  4WKH A;  4NNR A;  3UI6 A;  3KCE A;  1EYM A;  1RD6 A;  2ZQU A;  4Z2L A;  2XP7 A;  3OA5 A;  1FFQ A;  1E15 A;  3AS0 A;  3ARQ A;  1FKT A;  1QZ2 A;  1ZBV A;  5HWC A;  2DG3 A;  3AS2 A;  4ODK A;  3ARW A;  1FKK A;  4LAW A;  2YBU A;  2ZR4 A;  3I6C A;  3PR9 A;  1JNT A;  3UQI A;  3FAP A;  5HW7 A;  4FAP A;  4GIV A;  3ALG A;  4S3J A;  2MLX A;  1LL4 A;  1ZU8 A;  4LAY A;  1KFW A;  3UQA A;  4J4O A;  2RSE A;  3WD2 A;  2A3A A;  3G6L A;  1U79 A;  4JYS A;  2KE0 A;  4KQZ A;  2MLZ A;  4DWS A;  1YAT A;  3ARR A;  2ZR5 A;  1BL4 A;  1ZBC A;  4ZPV R;  4AY1 A;  2N87 A;  1HJW A;  2XP4 A;  4DZ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...