1U79A

Crystal structure of atfkbp13
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
125
structure length
125
Chain Sequence
b'CEFSVSPSGLAFCDKVVGYGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLTFRIGVGEVIKGWDQGILGSDGIPPMLTGGKRTLRIPPELAYGDRGAGCKGGSCLIPPASVLLFDIEYIGKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase 3
publication title Structural analysis uncovers a role for redox in regulating FKBP13, an immunophilin of the chloroplast thylakoid lumen
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Isomerase
total genus 27
structure length 125
sequence length 125
chains with identical sequence B, C, D, E
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2004-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1u79A00
4ODMA 3TC5A 4IPXA 1EYMA 4U84A 2PPOA 2XP7A 4ODRA 2FKEA 2Y78A 4O2TA 4DRNA 2F2DA 2F21A 1ZCNA 4U86A 1JVWA 1A7XA 1R9HA 2ZR4A 3KAGA 3KCEA 4ITZA 2MLZA 3UF8A 3JYMA 2XP5A 3NRKA 1FKJA 4DRQA 4DT4A 2M2AA 2RSEA 2MLXA 1Q6IA 4DRIA 2Q5AA 4N19A 3O5EA 1F40A 1FKLA 4ODLA 3PRBA 3JYJA 4JFMA 1NSGA 1FKDA 4ODOA 3TCZA 1ZK6A 4LAXA 1N1AA 2RQSA 4ODPA 3KZ7A 4GIVA 4LAVA 5HWCA 4JFIA 1EQ3A 2ZQSA 2KR7A 1FKTA 2F4EA 1FKGA 4MSPA 2ZQUA 2RUDA 3H9RB 3KAIA 2XP3A 5DIVA 2ZQVA 4ODQA 4LAWA 2DG3A 3O5RA 4W9PA 5B8IC 5HUAA 2KGJA 3O5MA 2FAPA 3O5JA 4DZ2A 1D7HA 4J4OA 2MPHA 1FD9A 1JNSA 3O5LA 3VAWA 2KE0A 4DRMA 2KO7A 3UI6A 2DG4A 3O5OA 3O5IA 2ZQTA 5J6EA 3UQBA 1FKRA 3KADA 1TCOC 3UI4A 3O5FA 2XPAA 3O5KA 2KFWA 2ZR5A 2JZVA 2MNTA 1B6CA 4MGVA 3UI5A 2M1IA 1FKSA 1NMVA 2XPBA 3I6CA 4DRJA 2PV1A 1ROTA 4GGQA 3GPKA 3PA7A 2RURA 3IKGA 4G50A 4JFLA 2KI3A 4TX0A 4ODNA 3IKDA 4QT3A 4DRHA 2PV2A 1L1PA 2PPPA 1Q1CA 2L2SA 3O5GA 5HW7A 1FAPA 3NTPA 3TDBA 2N87A 2AWGA 4U85A 2ITKA 1BKFA 2PBCA 3JXVA 5DIUA 4BF8A 5BXJA 1C9HA 3NI6A 3ODKA 3IK8A 4TNSA 4J4NA 4W9OA 5HWBA 1FKFA 2PPNA 2M08A 3O5QA 3O5PA 2DG9A 1HXVA 3CGNA 1KT0A 1YW5A 4ODKA 4TW7A 5GPGA 2K8IA 4NNRA 1M5YA 1P5QA 5I98A 1NMWA 1F8AB 3O5DA 1D7JA 2XP4A 4DH0A 4DRKA 1W26A 1QPFA 1J4HA 2PV3A 4QT2A 3B7XA 3KAHA 3MDYB 2LJ4A 5D75A 5DITA 4FAPA 1BL4A 4TW6A 1KT1A 3KAFA 2LPVA 3WH0A 1T11A 2OFNA 4DRPA 1Q6HA 2LKNA 2RUQA 3KABA 4JFKA 5HT1A 4DZ3A 4QIBA 3FAPA 4DROA 1D6OA 1J4RA 1QZ2A 2VCDA 1JNTA 1FKHA 3CGMA 4FN2A 4IQCA 2LGOA 1QPLA 2XP6A 3KACA 4JFJA 4JYSA 4C02B 4R0XA 5HKGA 1D7IA 3IHZA 3RFWA 5HW8A 4IQ2A 1FKBA 4TW8A 3RGCA 4G2PA 3LUOA 1YATA 4DIPA 1Q6UA 1ROUA 1U79A 4LAYA 4TYOA 5HTGA 1PINA 1FJDA 2VN1A 1J4IA 2UZ5A 3UQIA 2MF9A 1FKKA 1J6YA 3UQAA 2ZR6A 2XP9A 2MLYA 1PBKA 2RUCA 4W9QA 2D9FA 1FKIA 3PRDA 3OOBA 1Y0OA 2XP8A 2IF4A 5HW6A 3EY6A
chains in the Genus database with same CATH superfamily
3TC5A 1EYMA 4DRNA 4ODRA 2Y78A 3ARZA 4L72B 2WM0A 4ITZA 3RMEA 4DRQA 1RD6A 1F40A 3PRBA 3JYJA 4JFMA 3TCZA 1FKDA 4LAXA 4JFIA 4PTMA 3ARSA 1D2KA 2F4EA 2DSZA 2ZQVA 1X6LA 4W9PA 1LQ0A 3O5MA 3CHEA 4WKAA 4J4OA 2MPHA 1FD9A 2DSWA 4ZPWR 1JNSA 3O5LA 2KE0A 2DG4A 3O5OA 4ZPVR 4P8WA 1H0GA 1GPFA 1TCOC 2XPAA 3O5KA 2MNTA 1B6CA 1LL7A 2M1IA 1FKSA 3GPKA 1ZBWA 3RM4A 3AS2A 4P8VA 4ODNA 3IKDA 4QT3A 4LGXA 3BXWA 2L2SA 5HW7A 1FAPA 4MNKA 2AWGA 1BKFA 2PBCA 1W1PA 4TNSA 3WD1A 1LL6A 3O5PA 2G41A 3CGNA 1YW5A 4TW7A 4NNRA 1M5YA 1P5QA 5I98A 2DT2A 1F8AB 4DH0A 2O9OA 4NSBA 5DITA 2LJ4A 4FAPA 1ITXA 3B9DA 1HKJA 2LPVA 1OGGA 1T11A 1JNDA 1D6OA 4IT6A 1JNTA 1ZB5A 4JYSA 3KACA 4DWSD 2FDMA 4R0XA 4WKHA 4DWSB 4IQ2A 1O6IA 3WL0A 4MNMA 1U79A 4LAYA 1W9VA 1FJDA 4MTVA 2UZ5A 1PBKA 1FKIA 3PRDA 4WIWA 5DIUA 4ODMA 3ARVA 1E44A 4U84A 2F2DA 2WK2A 3ARXA 3KAGA 2ZR4A 3UF8A 1GUVA 1H0IA 3JYMA 1FKJA 5DF0A 4DT4A 3PRAA 2A3AA 4DRIA 4N19A 1GRJA 1FFQA 5DO2A 1NSGA 3AS1A 2G8ZA 1N1AA 2RQSA 4ODPA 3KZ7A 4GIVA 1NWRA 1FKTA 4MSPA 1FKGA 3G6LA 3OA5A 4LAWA 2DG3A 4URIA 2DT1A 2KGJA 1WNOA 1E9LA 3CHFA 3QOKA 1D7HA 3AS3A 4IT4A 3WQVA 3ARYA 4DRMA 3O5IA 1ZBCA 3PR9A 3KADA 2WLYA 3O5FA 2ZR5A 2JZVA 2XPBA 2PV1A 1ROTA 2KI3A 4TX0A 2YBUA 1L1PA 2EULA 1Q1CA 2P4VA 4U85A 4BF8A 3IK8A 4J4NA 2YBTA 1FKFA 1IX5A 3O5QA 2DG9A 3ARWA 1KT0A 5GPGA 1TFVA 1SYTA 1NMWA 3O5DA 4Q7NA 4DRKA 1JCHB 1J4HA 2PV3A 4MNJA 1BL4A 4TW6A 3RM8A 2RUQA 4Q22A 4QIBA 2OLHA 3ARRA 4Z2GA 1QZ2A 3WD3A 2VCDA 3CGMA 4IQCA 3CHDA 1W1YA 1OWQA 3WD0A 4NZCA 5HKGA 5HW8A 1FKBA 2AOSA 4KR0B 1YATA 4DIPA 1Q6UA 5HTGA 1J6YA 2MF9A 4HBEA 3UQAA 1JNEA 1LL4A 1OGBA 3OOBA 1Y0OA 2PN0A 2IF4A 4WK9A 3EY6A 4IPXA 2PPOA 2FKEA 4O2TA 5DEZA 1JVWA 1A7XA 3KCEA 3NRKA 1X6NA 2RSEA 3ALFA 4MNLA 2MLXA 1Q6IA 2F23A 2Q5AA 4UDMA 1UR8A 1HJWA 1FKLA 1KFWA 1ZK6A 1ZBKA 3B9AA 4WJXA 1WAWA 4WKFA 1EQ3A 5HWCA 2ZQSA 2KR7A 2ZQUA 2RUDA 5DIVA 4P8XA 5GQBA 4DWSA 5B8IC 2DSUA 5HUAA 3CZ8A 4Z2IA 1ZL1A 3VAWA 2KO7A 1HJXA 2ZQTA 1HKIA 2KFWA 4MGVA 3UI5A 1NMVA 3I6CA 3RM9A 4DRJA 1NH6A 3GTYX 4HBOA 4GGQA 5JH8A 3PA7A 2RURA 4JFLA 2PV2A 2PPPA 1EHNA 1E6ZA 2N87A 3WD2A 2ITKA 3JXVA 4Z2HA 3AS0A 3B8SA 1VF8A 4W9OA 3ARTA 2A3BA 4W5UA 1NWUA 2M08A 1HXVA 1HKKA 4ODKA 2DT3A 4Z2JA 4Z2LA 1LJYA 3KAHA 3MDYB 5D75A 1EIBA 1KT1A 3KAFA 3FXYA 1E15A 4S3KA 2ETNA 3KABA 5HT1A 4DZ3A 4DROA 1J4RA 1E6NA 4MPKA 2LGOA 2XP6A 1W1VA 1D7IA 3IHZA 4P8UA 2B31A 2DPEA 2O92A 1E6RA 3LUOA 1ROUA 1W1TA 4TYOA 1PINA 3ARPA 3UQIA 4L3NA 2ZR6A 3WD4A 2MLYA 4ODOA 3ARUA 3EIPA 5GPRA 4XAKA 3AQUA 2XP7A 1HJVA 2ESCA 2F21A 1ZCNA 4U86A 1R9HA 2MLZA 2XP5A 3CH9A 1K9TA 2M2AA 4Z2KA 3WIJA 3GU0A 3WKZA 3WQWA 3O5EA 4ODLA 1LG2A 4LAVA 4R5EA 3H9RB 3ARQA 2XP3A 3KAIA 1W9PA 4ODQA 3O5RA 2QF8A 1FFRA 2FAPA 3O5JA 4DZ2A 4KQZA 3G6MA 3UI6A 1FKRA 5J6EA 3UQBA 1W9UA 3UI4A 2DT0A 5HBFA 4AY1A 3IKGA 4G50A 4DRHA 3WL1A 2IUZA 1EDQA 3O5GA 2DSVA 3NTPA 3TDBA 1ZU8A 2B5UB 1WB0A 5BXJA 1C9HA 3NI6A 3ODKA 5HWBA 3B9EA 2PPNA 2PI6A 3BMBA 4QZVB 4ZPTR 2K8IA 3FY1A 4HARA 1D7JA 2XP4A 1ZBVA 3ALGA 1W26A 1QPFA 4QT2A 3B7XA 3AROA 2A3EA 1NWSA 3WH0A 4DRPA 2OFNA 1Q6HA 2LKNA 4JFKA 3W4RA 4MAVA 1CTNA 1NWTA 3FAPA 2A3CA 1UR9A 3CHCA 4ML4A 4FN2A 1FKHA 4JFJA 1QPLA 4C02B 1E6PA 2WLZA 3RFWA 1HKMA 1LG1A 4TW8A 3RGCA 4G2PA 1XHGA 1GOIA 1SR0A 2VN1A 1J4IA 1XRVA 1FKKA 4ZS6A 4S3JA 2XP9A 2RUCA 4W9QA 4DWSC 2D9FA 2XP8A 5HW6A
chains in the Genus database with same CATH topology
3TC5A 1EYMA 4DRNA 4ODRA 2Y78A 3ARZA 4L72B 2WM0A 4ITZA 3RMEA 4DRQA 1RD6A 1F40A 3PRBA 3JYJA 4JFMA 3TCZA 1FKDA 4LAXA 4JFIA 4PTMA 3ARSA 1D2KA 2F4EA 2DSZA 2ZQVA 1X6LA 4W9PA 1LQ0A 3O5MA 3CHEA 4WKAA 4J4OA 2MPHA 1FD9A 2DSWA 4ZPWR 1JNSA 3O5LA 2KE0A 2DG4A 3O5OA 4ZPVR 4P8WA 1H0GA 1GPFA 1TCOC 2XPAA 3O5KA 2MNTA 1B6CA 1LL7A 2M1IA 1FKSA 3GPKA 1ZBWA 3RM4A 3AS2A 4P8VA 4ODNA 3IKDA 4QT3A 4LGXA 3BXWA 2L2SA 5HW7A 1FAPA 4MNKA 2AWGA 1BKFA 2PBCA 1W1PA 4TNSA 3WD1A 1LL6A 3O5PA 2G41A 3CGNA 1YW5A 4TW7A 4NNRA 1M5YA 1P5QA 5I98A 2DT2A 1F8AB 4DH0A 2O9OA 4NSBA 5DITA 2LJ4A 4FAPA 1ITXA 3B9DA 1HKJA 2LPVA 1OGGA 1T11A 1JNDA 1D6OA 4IT6A 1JNTA 1ZB5A 4JYSA 3KACA 4DWSD 2FDMA 4R0XA 4WKHA 4DWSB 4IQ2A 1O6IA 3WL0A 4MNMA 1U79A 4LAYA 1W9VA 1FJDA 4MTVA 2UZ5A 1PBKA 1FKIA 3PRDA 4WIWA 5DIUA 4ODMA 3ARVA 4U84A 2F2DA 2WK2A 3ARXA 3KAGA 2ZR4A 3UF8A 1GUVA 1H0IA 3JYMA 1FKJA 5DF0A 4DT4A 3PRAA 2A3AA 4DRIA 4N19A 1FFQA 5DO2A 1NSGA 3AS1A 2G8ZA 1N1AA 2RQSA 4ODPA 3KZ7A 4GIVA 1NWRA 1FKTA 4MSPA 1FKGA 3G6LA 3OA5A 4LAWA 2DG3A 4URIA 2DT1A 2KGJA 1WNOA 1E9LA 3CHFA 3QOKA 1D7HA 3AS3A 4IT4A 3WQVA 3ARYA 4DRMA 3O5IA 1ZBCA 3PR9A 3KADA 2WLYA 3O5FA 2ZR5A 2JZVA 2XPBA 2PV1A 1ROTA 2KI3A 4TX0A 2YBUA 1L1PA 1Q1CA 4U85A 4BF8A 3IK8A 4J4NA 2YBTA 1FKFA 1IX5A 3O5QA 2DG9A 3ARWA 1KT0A 5GPGA 1TFVA 1SYTA 1NMWA 3O5DA 4Q7NA 4DRKA 1J4HA 2PV3A 4MNJA 1BL4A 4TW6A 3RM8A 2RUQA 4Q22A 4QIBA 2OLHA 3ARRA 4Z2GA 1QZ2A 3WD3A 2VCDA 3CGMA 4IQCA 3CHDA 1W1YA 1OWQA 3WD0A 4NZCA 5HKGA 5HW8A 1FKBA 2AOSA 4KR0B 1YATA 4DIPA 1Q6UA 5HTGA 1J6YA 2MF9A 4HBEA 3UQAA 1JNEA 1LL4A 1OGBA 3OOBA 1Y0OA 2IF4A 4WK9A 3EY6A 4IPXA 2PPOA 2FKEA 4O2TA 5DEZA 1JVWA 1A7XA 3KCEA 3NRKA 1X6NA 2RSEA 3ALFA 4MNLA 2MLXA 1Q6IA 2Q5AA 1UR8A 1HJWA 1FKLA 1KFWA 1ZK6A 1ZBKA 3B9AA 4WJXA 1WAWA 4WKFA 1EQ3A 5HWCA 2ZQSA 2KR7A 2ZQUA 2RUDA 5DIVA 4P8XA 5GQBA 4DWSA 5B8IC 2DSUA 5HUAA 3CZ8A 4Z2IA 1ZL1A 3VAWA 2KO7A 1HJXA 2ZQTA 1HKIA 2KFWA 4MGVA 3UI5A 1NMVA 3I6CA 3RM9A 4DRJA 1NH6A 4HBOA 5JH8A 4GGQA 3PA7A 2RURA 4JFLA 2PV2A 2PPPA 1EHNA 1E6ZA 2N87A 3WD2A 2ITKA 3JXVA 4Z2HA 3AS0A 3B8SA 1VF8A 4W9OA 3ARTA 2A3BA 4W5UA 1NWUA 2M08A 1HXVA 1HKKA 4ODKA 2DT3A 4Z2JA 4Z2LA 1LJYA 3KAHA 3MDYB 5D75A 1EIBA 1KT1A 3KAFA 3FXYA 1E15A 4S3KA 3KABA 5HT1A 4DZ3A 4DROA 1J4RA 1E6NA 4MPKA 2LGOA 2XP6A 1W1VA 1D7IA 3IHZA 4P8UA 2B31A 2DPEA 2O92A 1E6RA 3LUOA 1ROUA 1W1TA 4TYOA 1PINA 3ARPA 3UQIA 4L3NA 2ZR6A 3WD4A 2MLYA 4ODOA 3ARUA 5GPRA 4XAKA 3AQUA 2XP7A 1HJVA 2ESCA 2F21A 1ZCNA 4U86A 1R9HA 2MLZA 2XP5A 3CH9A 1K9TA 2M2AA 4Z2KA 3WIJA 3WKZA 3WQWA 3O5EA 4ODLA 1LG2A 4LAVA 4R5EA 3H9RB 3ARQA 2XP3A 3KAIA 1W9PA 4ODQA 3O5RA 2QF8A 1FFRA 2FAPA 3O5JA 4DZ2A 4KQZA 3G6MA 3UI6A 1FKRA 5J6EA 3UQBA 1W9UA 3UI4A 2DT0A 5HBFA 4AY1A 3IKGA 4G50A 4DRHA 3WL1A 2IUZA 1EDQA 3O5GA 2DSVA 3NTPA 3TDBA 1ZU8A 1WB0A 5BXJA 1C9HA 3NI6A 3ODKA 5HWBA 3B9EA 2PPNA 2PI6A 4QZVB 4ZPTR 2K8IA 3FY1A 4HARA 1D7JA 2XP4A 1ZBVA 3ALGA 1W26A 1QPFA 4QT2A 3B7XA 3AROA 2A3EA 1NWSA 3WH0A 4DRPA 2OFNA 1Q6HA 2LKNA 4JFKA 3W4RA 4MAVA 1CTNA 1NWTA 3FAPA 2A3CA 1UR9A 3CHCA 4ML4A 4FN2A 1FKHA 4JFJA 1QPLA 4C02B 1E6PA 2WLZA 3RFWA 1HKMA 1LG1A 4TW8A 3RGCA 4G2PA 1XHGA 1GOIA 1SR0A 2VN1A 1J4IA 1XRVA 1FKKA 4ZS6A 4S3JA 2XP9A 2RUCA 4W9QA 4DWSC 2D9FA 2XP8A 5HW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ODM A;  3TC5 A;  4IPX A;  1EYM A;  4U84 A;  2PPO A;  2XP7 A;  4ODR A;  2FKE A;  2Y78 A;  4O2T A;  4DRN A;  2F2D A;  2F21 A;  1ZCN A;  4U86 A;  1JVW A;  1A7X A;  1R9H A;  2ZR4 A;  3KAG A;  3KCE A;  4ITZ A;  2MLZ A;  3UF8 A;  3JYM A;  2XP5 A;  3NRK A;  1FKJ A;  4DRQ A;  4DT4 A;  2M2A A;  2RSE A;  2MLX A;  1Q6I A;  4DRI A;  2Q5A A;  4N19 A;  3O5E A;  1F40 A;  1FKL A;  4ODL A;  3PRB A;  3JYJ A;  4JFM A;  1NSG A;  1FKD A;  4ODO A;  3TCZ A;  1ZK6 A;  4LAX A;  1N1A A;  2RQS A;  4ODP A;  3KZ7 A;  4GIV A;  4LAV A;  5HWC A;  4JFI A;  1EQ3 A;  2ZQS A;  2KR7 A;  1FKT A;  2F4E A;  1FKG A;  4MSP A;  2ZQU A;  2RUD A;  3H9R B;  3KAI A;  2XP3 A;  5DIV A;  2ZQV A;  4ODQ A;  4LAW A;  2DG3 A;  3O5R A;  4W9P A;  5B8I C;  5HUA A;  2KGJ A;  3O5M A;  2FAP A;  3O5J A;  4DZ2 A;  1D7H A;  4J4O A;  2MPH A;  1FD9 A;  1JNS A;  3O5L A;  3VAW A;  2KE0 A;  4DRM A;  2KO7 A;  3UI6 A;  2DG4 A;  3O5O A;  3O5I A;  2ZQT A;  5J6E A;  3UQB A;  1FKR A;  3KAD A;  1TCO C;  3UI4 A;  3O5F A;  2XPA A;  3O5K A;  2KFW A;  2ZR5 A;  2JZV A;  2MNT A;  1B6C A;  4MGV A;  3UI5 A;  2M1I A;  1FKS A;  1NMV A;  2XPB A;  3I6C A;  4DRJ A;  2PV1 A;  1ROT A;  4GGQ A;  3GPK A;  3PA7 A;  2RUR A;  3IKG A;  4G50 A;  4JFL A;  2KI3 A;  4TX0 A;  4ODN A;  3IKD A;  4QT3 A;  4DRH A;  2PV2 A;  1L1P A;  2PPP A;  1Q1C A;  2L2S A;  3O5G A;  5HW7 A;  1FAP A;  3NTP A;  3TDB A;  2N87 A;  2AWG A;  4U85 A;  2ITK A;  1BKF A;  2PBC A;  3JXV A;  5DIU A;  4BF8 A;  5BXJ A;  1C9H A;  3NI6 A;  3ODK A;  3IK8 A;  4TNS A;  4J4N A;  4W9O A;  5HWB A;  1FKF A;  2PPN A;  2M08 A;  3O5Q A;  3O5P A;  2DG9 A;  1HXV A;  3CGN A;  1KT0 A;  1YW5 A;  4ODK A;  4TW7 A;  5GPG A;  2K8I A;  4NNR A;  1M5Y A;  1P5Q A;  5I98 A;  1NMW A;  1F8A B;  3O5D A;  1D7J A;  2XP4 A;  4DH0 A;  4DRK A;  1W26 A;  1QPF A;  1J4H A;  2PV3 A;  4QT2 A;  3B7X A;  3KAH A;  3MDY B;  2LJ4 A;  5D75 A;  5DIT A;  4FAP A;  1BL4 A;  4TW6 A;  1KT1 A;  3KAF A;  2LPV A;  3WH0 A;  1T11 A;  2OFN A;  4DRP A;  1Q6H A;  2LKN A;  2RUQ A;  3KAB A;  4JFK A;  5HT1 A;  4DZ3 A;  4QIB A;  3FAP A;  4DRO A;  1D6O A;  1J4R A;  1QZ2 A;  2VCD A;  1JNT A;  1FKH A;  3CGM A;  4FN2 A;  4IQC A;  2LGO A;  1QPL A;  2XP6 A;  3KAC A;  4JFJ A;  4JYS A;  4C02 B;  4R0X A;  5HKG A;  1D7I A;  3IHZ A;  3RFW A;  5HW8 A;  4IQ2 A;  1FKB A;  4TW8 A;  3RGC A;  4G2P A;  3LUO A;  1YAT A;  4DIP A;  1Q6U A;  1ROU A;  1U79 A;  4LAY A;  4TYO A;  5HTG A;  1PIN A;  1FJD A;  2VN1 A;  1J4I A;  2UZ5 A;  3UQI A;  2MF9 A;  1FKK A;  1J6Y A;  3UQA A;  2ZR6 A;  2XP9 A;  2MLY A;  1PBK A;  2RUC A;  4W9Q A;  2D9F A;  1FKI A;  3PRD A;  3OOB A;  1Y0O A;  2XP8 A;  2IF4 A;  5HW6 A;  3EY6 A; 
#chains in the Genus database with same CATH topology
 3TC5 A;  1EYM A;  4DRN A;  4ODR A;  2Y78 A;  3ARZ A;  4L72 B;  2WM0 A;  4ITZ A;  3RME A;  4DRQ A;  1RD6 A;  1F40 A;  3PRB A;  3JYJ A;  4JFM A;  3TCZ A;  1FKD A;  4LAX A;  4JFI A;  4PTM A;  3ARS A;  1D2K A;  2F4E A;  2DSZ A;  2ZQV A;  1X6L A;  4W9P A;  1LQ0 A;  3O5M A;  3CHE A;  4WKA A;  4J4O A;  2MPH A;  1FD9 A;  2DSW A;  4ZPW R;  1JNS A;  3O5L A;  2KE0 A;  2DG4 A;  3O5O A;  4ZPV R;  4P8W A;  1H0G A;  1GPF A;  1TCO C;  2XPA A;  3O5K A;  2MNT A;  1B6C A;  1LL7 A;  2M1I A;  1FKS A;  3GPK A;  1ZBW A;  3RM4 A;  3AS2 A;  4P8V A;  4ODN A;  3IKD A;  4QT3 A;  4LGX A;  3BXW A;  2L2S A;  5HW7 A;  1FAP A;  4MNK A;  2AWG A;  1BKF A;  2PBC A;  1W1P A;  4TNS A;  3WD1 A;  1LL6 A;  3O5P A;  2G41 A;  3CGN A;  1YW5 A;  4TW7 A;  4NNR A;  1M5Y A;  1P5Q A;  5I98 A;  2DT2 A;  1F8A B;  4DH0 A;  2O9O A;  4NSB A;  5DIT A;  2LJ4 A;  4FAP A;  1ITX A;  3B9D A;  1HKJ A;  2LPV A;  1OGG A;  1T11 A;  1JND A;  1D6O A;  4IT6 A;  1JNT A;  1ZB5 A;  4JYS A;  3KAC A;  4DWS D;  2FDM A;  4R0X A;  4WKH A;  4DWS B;  4IQ2 A;  1O6I A;  3WL0 A;  4MNM A;  1U79 A;  4LAY A;  1W9V A;  1FJD A;  4MTV A;  2UZ5 A;  1PBK A;  1FKI A;  3PRD A;  4WIW A;  5DIU A;  4ODM A;  3ARV A;  1E44 A;  4U84 A;  2F2D A;  2WK2 A;  3ARX A;  3KAG A;  2ZR4 A;  3UF8 A;  1GUV A;  1H0I A;  3JYM A;  1FKJ A;  5DF0 A;  4DT4 A;  3PRA A;  2A3A A;  4DRI A;  4N19 A;  1GRJ A;  1FFQ A;  5DO2 A;  1NSG A;  3AS1 A;  2G8Z A;  1N1A A;  2RQS A;  4ODP A;  3KZ7 A;  4GIV A;  1NWR A;  1FKT A;  4MSP A;  1FKG A;  3G6L A;  3OA5 A;  4LAW A;  2DG3 A;  4URI A;  2DT1 A;  2KGJ A;  1WNO A;  1E9L A;  3CHF A;  3QOK A;  1D7H A;  3AS3 A;  4IT4 A;  3WQV A;  3ARY A;  4DRM A;  3O5I A;  1ZBC A;  3PR9 A;  3KAD A;  2WLY A;  3O5F A;  2ZR5 A;  2JZV A;  2XPB A;  2PV1 A;  1ROT A;  2KI3 A;  4TX0 A;  2YBU A;  1L1P A;  2EUL A;  1Q1C A;  2P4V A;  4U85 A;  4BF8 A;  3IK8 A;  4J4N A;  2YBT A;  1FKF A;  1IX5 A;  3O5Q A;  2DG9 A;  3ARW A;  1KT0 A;  5GPG A;  1TFV A;  1SYT A;  1NMW A;  3O5D A;  4Q7N A;  4DRK A;  1JCH B;  1J4H A;  2PV3 A;  4MNJ A;  1BL4 A;  4TW6 A;  3RM8 A;  2RUQ A;  4Q22 A;  4QIB A;  2OLH A;  3ARR A;  4Z2G A;  1QZ2 A;  3WD3 A;  2VCD A;  3CGM A;  4IQC A;  3CHD A;  1W1Y A;  1OWQ A;  3WD0 A;  4NZC A;  5HKG A;  5HW8 A;  1FKB A;  2AOS A;  4KR0 B;  1YAT A;  4DIP A;  1Q6U A;  5HTG A;  1J6Y A;  2MF9 A;  4HBE A;  3UQA A;  1JNE A;  1LL4 A;  1OGB A;  3OOB A;  1Y0O A;  2PN0 A;  2IF4 A;  4WK9 A;  3EY6 A;  4IPX A;  2PPO A;  2FKE A;  4O2T A;  5DEZ A;  1JVW A;  1A7X A;  3KCE A;  3NRK A;  1X6N A;  2RSE A;  3ALF A;  4MNL A;  2MLX A;  1Q6I A;  2F23 A;  2Q5A A;  4UDM A;  1UR8 A;  1HJW A;  1FKL A;  1KFW A;  1ZK6 A;  1ZBK A;  3B9A A;  4WJX A;  1WAW A;  4WKF A;  1EQ3 A;  5HWC A;  2ZQS A;  2KR7 A;  2ZQU A;  2RUD A;  5DIV A;  4P8X A;  5GQB A;  4DWS A;  5B8I C;  2DSU A;  5HUA A;  3CZ8 A;  4Z2I A;  1ZL1 A;  3VAW A;  2KO7 A;  1HJX A;  2ZQT A;  1HKI A;  2KFW A;  4MGV A;  3UI5 A;  1NMV A;  3I6C A;  3RM9 A;  4DRJ A;  1NH6 A;  3GTY X;  4HBO A;  4GGQ A;  5JH8 A;  3PA7 A;  2RUR A;  4JFL A;  2PV2 A;  2PPP A;  1EHN A;  1E6Z A;  2N87 A;  3WD2 A;  2ITK A;  3JXV A;  4Z2H A;  3AS0 A;  3B8S A;  1VF8 A;  4W9O A;  3ART A;  2A3B A;  4W5U A;  1NWU A;  2M08 A;  1HXV A;  1HKK A;  4ODK A;  2DT3 A;  4Z2J A;  4Z2L A;  1LJY A;  3KAH A;  3MDY B;  5D75 A;  1EIB A;  1KT1 A;  3KAF A;  3FXY A;  1E15 A;  4S3K A;  2ETN A;  3KAB A;  5HT1 A;  4DZ3 A;  4DRO A;  1J4R A;  1E6N A;  4MPK A;  2LGO A;  2XP6 A;  1W1V A;  1D7I A;  3IHZ A;  4P8U A;  2B31 A;  2DPE A;  2O92 A;  1E6R A;  3LUO A;  1ROU A;  1W1T A;  4TYO A;  1PIN A;  3ARP A;  3UQI A;  4L3N A;  2ZR6 A;  3WD4 A;  2MLY A;  4ODO A;  3ARU A;  3EIP A;  5GPR A;  4XAK A;  3AQU A;  2XP7 A;  1HJV A;  2ESC A;  2F21 A;  1ZCN A;  4U86 A;  1R9H A;  2MLZ A;  2XP5 A;  3CH9 A;  1K9T A;  2M2A A;  4Z2K A;  3WIJ A;  3GU0 A;  3WKZ A;  3WQW A;  3O5E A;  4ODL A;  1LG2 A;  4LAV A;  4R5E A;  3H9R B;  3ARQ A;  2XP3 A;  3KAI A;  1W9P A;  4ODQ A;  3O5R A;  2QF8 A;  1FFR A;  2FAP A;  3O5J A;  4DZ2 A;  4KQZ A;  3G6M A;  3UI6 A;  1FKR A;  5J6E A;  3UQB A;  1W9U A;  3UI4 A;  2DT0 A;  5HBF A;  4AY1 A;  3IKG A;  4G50 A;  4DRH A;  3WL1 A;  2IUZ A;  1EDQ A;  3O5G A;  2DSV A;  3NTP A;  3TDB A;  1ZU8 A;  2B5U B;  1WB0 A;  5BXJ A;  1C9H A;  3NI6 A;  3ODK A;  5HWB A;  3B9E A;  2PPN A;  2PI6 A;  3BMB A;  4QZV B;  4ZPT R;  2K8I A;  3FY1 A;  4HAR A;  1D7J A;  2XP4 A;  1ZBV A;  3ALG A;  1W26 A;  1QPF A;  4QT2 A;  3B7X A;  3ARO A;  2A3E A;  1NWS A;  3WH0 A;  4DRP A;  2OFN A;  1Q6H A;  2LKN A;  4JFK A;  3W4R A;  4MAV A;  1CTN A;  1NWT A;  3FAP A;  2A3C A;  1UR9 A;  3CHC A;  4ML4 A;  4FN2 A;  1FKH A;  4JFJ A;  1QPL A;  4C02 B;  1E6P A;  2WLZ A;  3RFW A;  1HKM A;  1LG1 A;  4TW8 A;  3RGC A;  4G2P A;  1XHG A;  1GOI A;  1SR0 A;  2VN1 A;  1J4I A;  1XRV A;  1FKK A;  4ZS6 A;  4S3J A;  2XP9 A;  2RUC A;  4W9Q A;  4DWS C;  2D9F A;  2XP8 A;  5HW6 A; 
#chains in the Genus database with same CATH homology
 3TC5 A;  1EYM A;  4DRN A;  4ODR A;  2Y78 A;  3ARZ A;  4L72 B;  2WM0 A;  4ITZ A;  3RME A;  4DRQ A;  1RD6 A;  1F40 A;  3PRB A;  3JYJ A;  4JFM A;  3TCZ A;  1FKD A;  4LAX A;  4JFI A;  4PTM A;  3ARS A;  1D2K A;  2F4E A;  2DSZ A;  2ZQV A;  1X6L A;  4W9P A;  1LQ0 A;  3O5M A;  3CHE A;  4WKA A;  4J4O A;  2MPH A;  1FD9 A;  2DSW A;  4ZPW R;  1JNS A;  3O5L A;  2KE0 A;  2DG4 A;  3O5O A;  4ZPV R;  4P8W A;  1H0G A;  1GPF A;  1TCO C;  2XPA A;  3O5K A;  2MNT A;  1B6C A;  1LL7 A;  2M1I A;  1FKS A;  3GPK A;  1ZBW A;  3RM4 A;  3AS2 A;  4P8V A;  4ODN A;  3IKD A;  4QT3 A;  4LGX A;  3BXW A;  2L2S A;  5HW7 A;  1FAP A;  4MNK A;  2AWG A;  1BKF A;  2PBC A;  1W1P A;  4TNS A;  3WD1 A;  1LL6 A;  3O5P A;  2G41 A;  3CGN A;  1YW5 A;  4TW7 A;  4NNR A;  1M5Y A;  1P5Q A;  5I98 A;  2DT2 A;  1F8A B;  4DH0 A;  2O9O A;  4NSB A;  5DIT A;  2LJ4 A;  4FAP A;  1ITX A;  3B9D A;  1HKJ A;  2LPV A;  1OGG A;  1T11 A;  1JND A;  1D6O A;  4IT6 A;  1JNT A;  1ZB5 A;  4JYS A;  3KAC A;  4DWS D;  2FDM A;  4R0X A;  4WKH A;  4DWS B;  4IQ2 A;  1O6I A;  3WL0 A;  4MNM A;  1U79 A;  4LAY A;  1W9V A;  1FJD A;  4MTV A;  2UZ5 A;  1PBK A;  1FKI A;  3PRD A;  4WIW A;  5DIU A;  4ODM A;  3ARV A;  4U84 A;  2F2D A;  2WK2 A;  3ARX A;  3KAG A;  2ZR4 A;  3UF8 A;  1GUV A;  1H0I A;  3JYM A;  1FKJ A;  5DF0 A;  4DT4 A;  3PRA A;  2A3A A;  4DRI A;  4N19 A;  1FFQ A;  5DO2 A;  1NSG A;  3AS1 A;  2G8Z A;  1N1A A;  2RQS A;  4ODP A;  3KZ7 A;  4GIV A;  1NWR A;  1FKT A;  4MSP A;  1FKG A;  3G6L A;  3OA5 A;  4LAW A;  2DG3 A;  4URI A;  2DT1 A;  2KGJ A;  1WNO A;  1E9L A;  3CHF A;  3QOK A;  1D7H A;  3AS3 A;  4IT4 A;  3WQV A;  3ARY A;  4DRM A;  3O5I A;  1ZBC A;  3PR9 A;  3KAD A;  2WLY A;  3O5F A;  2ZR5 A;  2JZV A;  2XPB A;  2PV1 A;  1ROT A;  2KI3 A;  4TX0 A;  2YBU A;  1L1P A;  1Q1C A;  4U85 A;  4BF8 A;  3IK8 A;  4J4N A;  2YBT A;  1FKF A;  1IX5 A;  3O5Q A;  2DG9 A;  3ARW A;  1KT0 A;  5GPG A;  1TFV A;  1SYT A;  1NMW A;  3O5D A;  4Q7N A;  4DRK A;  1J4H A;  2PV3 A;  4MNJ A;  1BL4 A;  4TW6 A;  3RM8 A;  2RUQ A;  4Q22 A;  4QIB A;  2OLH A;  3ARR A;  4Z2G A;  1QZ2 A;  3WD3 A;  2VCD A;  3CGM A;  4IQC A;  3CHD A;  1W1Y A;  1OWQ A;  3WD0 A;  4NZC A;  5HKG A;  5HW8 A;  1FKB A;  2AOS A;  4KR0 B;  1YAT A;  4DIP A;  1Q6U A;  5HTG A;  1J6Y A;  2MF9 A;  4HBE A;  3UQA A;  1JNE A;  1LL4 A;  1OGB A;  3OOB A;  1Y0O A;  2IF4 A;  4WK9 A;  3EY6 A;  4IPX A;  2PPO A;  2FKE A;  4O2T A;  5DEZ A;  1JVW A;  1A7X A;  3KCE A;  3NRK A;  1X6N A;  2RSE A;  3ALF A;  4MNL A;  2MLX A;  1Q6I A;  2Q5A A;  1UR8 A;  1HJW A;  1FKL A;  1KFW A;  1ZK6 A;  1ZBK A;  3B9A A;  4WJX A;  1WAW A;  4WKF A;  1EQ3 A;  5HWC A;  2ZQS A;  2KR7 A;  2ZQU A;  2RUD A;  5DIV A;  4P8X A;  5GQB A;  4DWS A;  5B8I C;  2DSU A;  5HUA A;  3CZ8 A;  4Z2I A;  1ZL1 A;  3VAW A;  2KO7 A;  1HJX A;  2ZQT A;  1HKI A;  2KFW A;  4MGV A;  3UI5 A;  1NMV A;  3I6C A;  3RM9 A;  4DRJ A;  1NH6 A;  4HBO A;  5JH8 A;  4GGQ A;  3PA7 A;  2RUR A;  4JFL A;  2PV2 A;  2PPP A;  1EHN A;  1E6Z A;  2N87 A;  3WD2 A;  2ITK A;  3JXV A;  4Z2H A;  3AS0 A;  3B8S A;  1VF8 A;  4W9O A;  3ART A;  2A3B A;  4W5U A;  1NWU A;  2M08 A;  1HXV A;  1HKK A;  4ODK A;  2DT3 A;  4Z2J A;  4Z2L A;  1LJY A;  3KAH A;  3MDY B;  5D75 A;  1EIB A;  1KT1 A;  3KAF A;  3FXY A;  1E15 A;  4S3K A;  3KAB A;  5HT1 A;  4DZ3 A;  4DRO A;  1J4R A;  1E6N A;  4MPK A;  2LGO A;  2XP6 A;  1W1V A;  1D7I A;  3IHZ A;  4P8U A;  2B31 A;  2DPE A;  2O92 A;  1E6R A;  3LUO A;  1ROU A;  1W1T A;  4TYO A;  1PIN A;  3ARP A;  3UQI A;  4L3N A;  2ZR6 A;  3WD4 A;  2MLY A;  4ODO A;  3ARU A;  5GPR A;  4XAK A;  3AQU A;  2XP7 A;  1HJV A;  2ESC A;  2F21 A;  1ZCN A;  4U86 A;  1R9H A;  2MLZ A;  2XP5 A;  3CH9 A;  1K9T A;  2M2A A;  4Z2K A;  3WIJ A;  3WKZ A;  3WQW A;  3O5E A;  4ODL A;  1LG2 A;  4LAV A;  4R5E A;  3H9R B;  3ARQ A;  2XP3 A;  3KAI A;  1W9P A;  4ODQ A;  3O5R A;  2QF8 A;  1FFR A;  2FAP A;  3O5J A;  4DZ2 A;  4KQZ A;  3G6M A;  3UI6 A;  1FKR A;  5J6E A;  3UQB A;  1W9U A;  3UI4 A;  2DT0 A;  5HBF A;  4AY1 A;  3IKG A;  4G50 A;  4DRH A;  3WL1 A;  2IUZ A;  1EDQ A;  3O5G A;  2DSV A;  3NTP A;  3TDB A;  1ZU8 A;  1WB0 A;  5BXJ A;  1C9H A;  3NI6 A;  3ODK A;  5HWB A;  3B9E A;  2PPN A;  2PI6 A;  4QZV B;  4ZPT R;  2K8I A;  3FY1 A;  4HAR A;  1D7J A;  2XP4 A;  1ZBV A;  3ALG A;  1W26 A;  1QPF A;  4QT2 A;  3B7X A;  3ARO A;  2A3E A;  1NWS A;  3WH0 A;  4DRP A;  2OFN A;  1Q6H A;  2LKN A;  4JFK A;  3W4R A;  4MAV A;  1CTN A;  1NWT A;  3FAP A;  2A3C A;  1UR9 A;  3CHC A;  4ML4 A;  4FN2 A;  1FKH A;  4JFJ A;  1QPL A;  4C02 B;  1E6P A;  2WLZ A;  3RFW A;  1HKM A;  1LG1 A;  4TW8 A;  3RGC A;  4G2P A;  1XHG A;  1GOI A;  1SR0 A;  2VN1 A;  1J4I A;  1XRV A;  1FKK A;  4ZS6 A;  4S3J A;  2XP9 A;  2RUC A;  4W9Q A;  4DWS C;  2D9F A;  2XP8 A;  5HW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...