1U79A

Crystal structure of atfkbp13
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
125
structure length
125
Chain Sequence
CEFSVSPSGLAFCDKVVGYGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLTFRIGVGEVIKGWDQGILGSDGIPPMLTGGKRTLRIPPELAYGDRGAGCKGGSCLIPPASVLLFDIEYIGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis uncovers a role for redox in regulating FKBP13, an immunophilin of the chloroplast thylakoid lumen
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Isomerase
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase 3
total genus 27
structure length 125
sequence length 125
chains with identical sequence B, C, D, E
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2004-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1u79A00
1Y0OA 2KI3A 1U79A 4TW7A 4IQ2A 5HUAA 1ZK6A 3NI6A 5D75A 2Q5AA 5BXJA 1EYMA 1FKRA 1FKHA 3O5RA 2VN1A 2XP4A 4LAXA 2KO7A 4DRIA 2PPPA 5HW8A 2F2DA 1QPFA 1D6OA 3TCZA 2DG3A 1FKSA 3KAIA 1L1PA 4JFJA 2MF9A 2MPHA 4DRHA 4U84A 3IKDA 2K8IA 2MNTA 3NTPA 2XP8A 2XPBA 1FKLA 2PPNA 4MGVA 1JVWA 2LPVA 2N87A 4TW6A 5HWBA 4IQCA 5GPGA 1PBKA 4W9OA 2F21A 1Q6IA 3OOBA 4DT4A 4GGQA 1KT1A 3UF8A 1D7JA 4DZ2A 4J4OA 4JYSA 2ZR4A 3UQIA 1BKFA 1HXVA 2RQSA 5B8IC 1Q6UA 3KADA 4ODOA 1FD9A 2M1IA 3JYMA 3O5MA 3O5QA 4QT2A 3O5FA 4J4NA 1ROUA 1B6CA 2DG9A 3NRKA 3O5LA 2DG4A 4LAYA 4U85A 2XPAA 3VAWA 4O2TA 4DH0A 1R9HA 1J4IA 1T11A 2XP6A 4TNSA 4JFLA 3PRDA 2PBCA 4U86A 4DRNA 1A7XA 1FAPA 3KAHA 3O5GA 3UI5A 2LJ4A 4C02B 4TX0A 1D7HA 1NMWA 1C9HA 1J4RA 1FKIA 2LGOA 5DITA 3UQBA 2XP3A 2OFNA 3EY6A 3O5OA 4JFKA 1M5YA 1ROTA 1F40A 1JNTA 1F8AB 2FKEA 2VCDA 4GIVA 2KFWA 3UI6A 2M08A 2MLYA 2FAPA 4QIBA 2Y78A 2AWGA 3IKGA 2RURA 4TW8A 2KR7A 4ODNA 2LKNA 3UI4A 3PRBA 2RSEA 3KAGA 3B7XA 1NMVA 3O5JA 2IF4A 1P5QA 3TDBA 3ODKA 5HW6A 1FKFA 4JFMA 1N1AA 4DRPA 3O5PA 1FKKA 3KCEA 4FN2A 1QZ2A 4ODLA 1FKGA 2RUCA 1J4HA 2JZVA 1YATA 2M2AA 2ZQVA 2KE0A 1FKDA 3IK8A 2PV1A 3KAFA 4DRQA 5DIUA 2ZR5A 2ZR6A 4NNRA 4DRMA 3PA7A 1FKBA 2ZQTA 3JYJA 2ITKA 2PV2A 1Q6HA 3KABA 3MDYB 4W9PA 1FKJA 2KGJA 4G2PA 4DIPA 1FJDA 4TYOA 2XP5A 4JFIA 5HTGA 4LAVA 5J6EA 3IHZA 2MLXA 3CGNA 4ITZA 1BL4A 1W26A 1JNSA 1D7IA 2RUQA 4QT3A 4IPXA 3I6CA 4DRKA 3LUOA 4ODMA 2L2SA 2UZ5A 1PINA 5DIVA 2PPOA 3O5IA 3TC5A 2XP9A 1Q1CA 2ZQSA 3WH0A 2RUDA 4DROA 2D9FA 4DZ3A 5I98A 2XP7A 3O5KA 4FAPA 1TCOC 3CGMA 4ODQA 4BF8A 4N19A 3RGCA 1EQ3A 4R0XA 3FAPA 3RFWA 1NSGA 5HW7A 3H9RB 4G50A 1QPLA 4W9QA 1FKTA 4LAWA 2ZQUA 3KZ7A 1KT0A 5HKGA 2F4EA 4ODPA 5HWCA 3UQAA 3JXVA 3KACA 3O5DA 4ODKA 4MSPA 5HT1A 1YW5A 4DRJA 1J6YA 3GPKA 2MLZA 4ODRA 2PV3A 3O5EA 1ZCNA
chains in the Genus database with same CATH superfamily
3ARVA 1U79A 3RM8A 1W9VA 4LAXA 1NWSA 1E44A 1WAWA 1GOIA 1QPFA 1D6OA 1E6ZA 4JFJA 3IKDA 2O9OA 2MNTA 3NTPA 4MGVA 1LQ0A 5DO2A 1LG2A 1JVWA 4Z2GA 2LPVA 3EIPA 5GPGA 2F21A 4DT4A 1KT1A 2ZR4A 3UQIA 3WL0A 2DPEA 2RQSA 3KADA 4ODOA 4PTMA 5HBFA 3O5MA 2DT3A 3B9AA 2FDMA 1R9HA 2WK2A 4TNSA 1FAPA 3UI5A 2LJ4A 3ALGA 3B9DA 3RMEA 1FKIA 4WKFA 1OGBA 4GIVA 4KQZA 2KFWA 2MLYA 1WB0A 4MAVA 2RURA 4TW8A 4ODNA 1W9UA 2YBUA 1FKFA 4ODLA 1FKGA 4WKAA 1HJWA 1J4HA 2JZVA 2ZQVA 4DRQA 3KAFA 4LGXA 1WNOA 4DRMA 2ZQTA 2ITKA 4W5UA 2PV2A 4R5EA 2DSUA 5HTGA 3IHZA 4ITZA 3QOKA 1D7IA 2RUQA 3CHDA 4P8UA 1EDQA 1FFQA 2L2SA 3PR9A 1OGGA 1Q1CA 4DROA 3WH0A 4DZ3A 2D9FA 1EQ3A 3RFWA 1QPLA 4HARA 2ZQUA 3KZ7A 3AS0A 2F4EA 5HWCA 1H0IA 1LG1A 3O5DA 4MSPA 1LL7A 1EIBA 1J6YA 3GPKA 2YBTA 1OWQA 3WKZA 4IQ2A 5D75A 1X6LA 2DT0A 1ZBCA 2XP4A 1RD6A 1GUVA 4S3JA 2F2DA 3WD4A 1L1PA 1HKKA 2MF9A 2MPHA 4U84A 4XAKA 2B31A 4Q22A 2K8IA 4NSBA 2XP8A 3OA5A 2PN0A 4TW6A 1NH6A 4IQCA 1PBKA 4W9OA 3WD3A 4Q7NA 1D7JA 4ZS6A 4JYSA 1BKFA 4DWSA 1NWUA 3ALFA 4P8VA 3O5FA 1B6CA 4MNMA 3NRKA 3O5LA 2DG4A 4Z2LA 2XPAA 3VAWA 4DH0A 3FXYA 4JFLA 3PRDA 2PBCA 3G6LA 3O5GA 1E6RA 2OFNA 3EY6A 1NWRA 1F40A 1W1TA 1F8AB 2FKEA 2VCDA 1ZBVA 2FAPA 1FFRA 2Y78A 3IKGA 3WD1A 2LKNA 1ZL1A 3PRBA 3KAGA 1XRVA 4IT4A 1NMVA 2IF4A 1P5QA 3TDBA 4AY1A 1HKMA 3ARUA 5JH8A 4DRPA 1HKJA 3O5PA 2ETNA 3CZ8A 4FN2A 2RUCA 1JCHB 2KE0A 2DSVA 3IK8A 3WQVA 3PA7A 1VF8A 2ESCA 3KABA 4W9PA 3ARTA 4DIPA 1FJDA 3AS1A 2MLXA 3CGNA 4DRKA 5DIVA 2PPOA 3O5IA 2ZQSA 1ZBWA 2XP7A 3WD0A 4ODQA 3CGMA 3RGCA 1NSGA 4UDMA 3H9RB 2EULA 1E6NA 2A3CA 5HKGA 1KT0A 2WLZA 4ODPA 3KACA 5HT1A 1YW5A 3W4RA 2KI3A 2G41A 1ZK6A 3NI6A 4QZVB 4HBEA 2Q5AA 1FKHA 3GTYX 2KO7A 3ARPA 2PPPA 5HW8A 2B5UB 3TCZA 3AS2A 3WIJA 4DRHA 3CH9A 3G6MA 2DT2A 1IX5A 1FKLA 1K9TA 2PPNA 1E6PA 2F23A 5GPRA 1ZBKA 5HWBA 3ARZA 1Q6IA 4GGQA 4DZ2A 3UF8A 4J4OA 2DSWA 1E15A 3B8SA 2A3AA 3AS3A 5B8IC 4WIWA 1Q6UA 3CHEA 1TFVA 1FD9A 3AQUA 2M1IA 4QT2A 2DG9A 4LAYA 4U85A 4O2TA 2XP6A 4DWSD 3ARSA 4ML4A 1HJVA 1W1YA 4Z2HA 1LL6A 1D7HA 1NMWA 1J4RA 2LGOA 4P8XA 3WD2A 3O5OA 1W1VA 4NZCA 4JFKA 2WM0A 2IUZA 1UR8A 3UI6A 2M08A 2WLYA 3UI4A 1JNEA 1HJXA 1KFWA 2RSEA 1NWTA 2QF8A 3RM9A 4MNKA 3O5JA 3ODKA 4MNLA 5HW6A 4MPKA 3WQWA 4MTVA 1FKDA 2ZR5A 2ZR6A 2A3BA 4NNRA 4ZPVR 3BXWA 1FKJA 4G2PA 4TYOA 3GU0A 2G8ZA 4P8WA 4LAVA 4L72B 5J6EA 1GPFA 1BL4A 1JNSA 5DF0A 4IPXA 2P4VA 4ODMA 2UZ5A 1D2KA 1PINA 3B9EA 2RUDA 4FAPA 4BF8A 1X6NA 4R0XA 3FAPA 5HW7A 1LJYA 3ARRA 4ZPTR 4W9QA 1FKTA 4LAWA 3JXVA 2MLZA 4ODRA 2PV3A 3O5EA 2OLHA 1Y0OA 4TW7A 5HUAA 5BXJA 1EYMA 1FKRA 3ARYA 3O5RA 2VN1A 4DRIA 3PRAA 2DG3A 1FKSA 2O92A 3KAIA 1JNDA 2XPBA 4WJXA 2N87A 1SR0A 3OOBA 4URIA 4HBOA 3CHCA 1HXVA 1W9PA 4L3NA 3JYMA 3O5QA 4IT6A 2DSZA 4J4NA 1ROUA 1ITXA 1H0GA 1LL4A 2DT1A 1J4IA 1T11A 4U86A 4DRNA 1A7XA 1GRJA 4DWSB 3KAHA 4C02B 4TX0A 1C9HA 4DWSC 5DITA 3UQBA 2XP3A 4KR0B 3RM4A 1M5YA 1ROTA 1JNTA 1ZB5A 4S3KA 1HKIA 4Z2KA 3FY1A 4QIBA 1E9LA 1O6IA 2AWGA 2KR7A 1CTNA 3B7XA 2PI6A 4JFMA 1N1AA 1FKKA 3KCEA 1QZ2A 1YATA 2M2AA 2PV1A 5DIUA 1FKBA 3JYJA 2A3EA 1Q6HA 4Z2JA 3MDYB 4Z2IA 2KGJA 2XP5A 4JFIA 1W1PA 4WKHA 4WK9A 1W26A 4QT3A 4MNJA 3WL1A 3I6CA 3LUOA 1XHGA 2AOSA 5DEZA 1ZU8A 3TC5A 2XP9A 3ARXA 5I98A 1UR9A 3ARQA 1EHNA 3O5KA 1TCOC 3BMBA 4N19A 1SYTA 4G50A 5GQBA 3CHFA 3ARWA 4ZPWR 3UQAA 3AROA 4ODKA 4DRJA 1ZCNA
chains in the Genus database with same CATH topology
3ARVA 1U79A 3RM8A 1W9VA 4LAXA 1NWSA 1WAWA 1GOIA 1QPFA 1D6OA 1E6ZA 4JFJA 3IKDA 2O9OA 2MNTA 3NTPA 4MGVA 1LQ0A 5DO2A 1LG2A 1JVWA 4Z2GA 2LPVA 5GPGA 2F21A 4DT4A 1KT1A 2ZR4A 3UQIA 3WL0A 2DPEA 2RQSA 3KADA 4ODOA 4PTMA 5HBFA 3O5MA 2DT3A 3B9AA 2FDMA 1R9HA 2WK2A 4TNSA 1FAPA 3UI5A 2LJ4A 3ALGA 3B9DA 3RMEA 1FKIA 4WKFA 1OGBA 4GIVA 4KQZA 2KFWA 2MLYA 1WB0A 4MAVA 2RURA 4TW8A 4ODNA 1W9UA 2YBUA 1FKFA 4ODLA 1FKGA 4WKAA 1HJWA 1J4HA 2JZVA 2ZQVA 4DRQA 3KAFA 4LGXA 1WNOA 4DRMA 2ZQTA 2ITKA 4W5UA 2PV2A 4R5EA 2DSUA 5HTGA 3IHZA 4ITZA 3QOKA 1D7IA 2RUQA 3CHDA 4P8UA 1EDQA 1FFQA 2L2SA 3PR9A 1OGGA 1Q1CA 4DROA 3WH0A 4DZ3A 2D9FA 1EQ3A 3RFWA 1QPLA 4HARA 2ZQUA 3KZ7A 3AS0A 2F4EA 5HWCA 1H0IA 1LG1A 3O5DA 4MSPA 1LL7A 1EIBA 1J6YA 3GPKA 2YBTA 1OWQA 3WKZA 4IQ2A 5D75A 1X6LA 2DT0A 1ZBCA 2XP4A 1RD6A 1GUVA 4S3JA 2F2DA 3WD4A 1L1PA 1HKKA 2MF9A 2MPHA 4U84A 4XAKA 2B31A 4Q22A 2K8IA 4NSBA 2XP8A 3OA5A 4TW6A 1NH6A 4IQCA 1PBKA 4W9OA 3WD3A 4Q7NA 1D7JA 4ZS6A 4JYSA 1BKFA 4DWSA 1NWUA 3ALFA 4P8VA 3O5FA 1B6CA 4MNMA 3NRKA 3O5LA 2DG4A 4Z2LA 2XPAA 3VAWA 4DH0A 3FXYA 4JFLA 3PRDA 2PBCA 3G6LA 3O5GA 1E6RA 2OFNA 3EY6A 1NWRA 1F40A 1W1TA 1F8AB 2FKEA 2VCDA 1ZBVA 2FAPA 1FFRA 2Y78A 3IKGA 3WD1A 2LKNA 1ZL1A 3PRBA 3KAGA 1XRVA 4IT4A 1NMVA 2IF4A 1P5QA 3TDBA 4AY1A 1HKMA 3ARUA 5JH8A 4DRPA 1HKJA 3O5PA 3CZ8A 4FN2A 2RUCA 2KE0A 3IK8A 2DSVA 3WQVA 3PA7A 1VF8A 2ESCA 3KABA 4W9PA 3ARTA 4DIPA 1FJDA 3AS1A 2MLXA 3CGNA 4DRKA 5DIVA 2PPOA 3O5IA 2ZQSA 1ZBWA 2XP7A 3WD0A 4ODQA 3CGMA 3RGCA 1NSGA 3H9RB 1E6NA 2A3CA 5HKGA 1KT0A 2WLZA 4ODPA 3KACA 5HT1A 1YW5A 3W4RA 2KI3A 2G41A 1ZK6A 3NI6A 4QZVB 4HBEA 2Q5AA 1FKHA 2KO7A 3ARPA 2PPPA 5HW8A 3TCZA 3AS2A 3WIJA 4DRHA 3CH9A 3G6MA 2DT2A 1IX5A 1FKLA 1K9TA 2PPNA 1E6PA 5GPRA 1ZBKA 5HWBA 3ARZA 1Q6IA 4GGQA 4DZ2A 3UF8A 4J4OA 2DSWA 1E15A 3B8SA 2A3AA 3AS3A 5B8IC 4WIWA 1Q6UA 3CHEA 1TFVA 1FD9A 3AQUA 2M1IA 4QT2A 2DG9A 4LAYA 4U85A 4O2TA 2XP6A 4DWSD 3ARSA 4ML4A 1HJVA 1W1YA 4Z2HA 1LL6A 1D7HA 1NMWA 1J4RA 2LGOA 4P8XA 3WD2A 3O5OA 1W1VA 4NZCA 4JFKA 2WM0A 2IUZA 1UR8A 3UI6A 2M08A 2WLYA 3UI4A 1JNEA 1HJXA 1KFWA 2RSEA 1NWTA 2QF8A 3RM9A 4MNKA 3O5JA 3ODKA 4MNLA 5HW6A 4MPKA 3WQWA 4MTVA 1FKDA 2ZR5A 2ZR6A 2A3BA 4NNRA 4ZPVR 3BXWA 1FKJA 4G2PA 4TYOA 2G8ZA 4P8WA 4LAVA 4L72B 5J6EA 1GPFA 1BL4A 1JNSA 5DF0A 4IPXA 4ODMA 2UZ5A 1D2KA 1PINA 3B9EA 2RUDA 4FAPA 4BF8A 1X6NA 4R0XA 3FAPA 5HW7A 1LJYA 3ARRA 4ZPTR 4W9QA 1FKTA 4LAWA 3JXVA 2MLZA 4ODRA 2PV3A 3O5EA 2OLHA 1Y0OA 4TW7A 5HUAA 5BXJA 1EYMA 1FKRA 3ARYA 3O5RA 2VN1A 4DRIA 3PRAA 2DG3A 1FKSA 2O92A 3KAIA 1JNDA 2XPBA 4WJXA 2N87A 1SR0A 3OOBA 4URIA 4HBOA 3CHCA 1HXVA 1W9PA 4L3NA 3JYMA 3O5QA 4IT6A 2DSZA 4J4NA 1ROUA 1ITXA 1H0GA 1LL4A 2DT1A 1J4IA 1T11A 4U86A 4DRNA 1A7XA 4DWSB 3KAHA 4C02B 4TX0A 1C9HA 4DWSC 5DITA 3UQBA 2XP3A 4KR0B 3RM4A 1M5YA 1ROTA 1JNTA 1ZB5A 4S3KA 1HKIA 4Z2KA 3FY1A 4QIBA 1E9LA 1O6IA 2AWGA 2KR7A 1CTNA 3B7XA 2PI6A 4JFMA 1N1AA 1FKKA 3KCEA 1QZ2A 1YATA 2M2AA 2PV1A 5DIUA 1FKBA 3JYJA 2A3EA 1Q6HA 4Z2JA 3MDYB 4Z2IA 2KGJA 2XP5A 4JFIA 1W1PA 4WKHA 4WK9A 1W26A 4QT3A 4MNJA 3WL1A 3I6CA 3LUOA 1XHGA 2AOSA 5DEZA 1ZU8A 3TC5A 2XP9A 3ARXA 5I98A 1UR9A 3ARQA 1EHNA 3O5KA 1TCOC 4N19A 1SYTA 4G50A 5GQBA 3CHFA 3ARWA 4ZPWR 3UQAA 3AROA 4ODKA 4DRJA 1ZCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y0O A;  2KI3 A;  1U79 A;  4TW7 A;  4IQ2 A;  5HUA A;  1ZK6 A;  3NI6 A;  5D75 A;  2Q5A A;  5BXJ A;  1EYM A;  1FKR A;  1FKH A;  3O5R A;  2VN1 A;  2XP4 A;  4LAX A;  2KO7 A;  4DRI A;  2PPP A;  5HW8 A;  2F2D A;  1QPF A;  1D6O A;  3TCZ A;  2DG3 A;  1FKS A;  3KAI A;  1L1P A;  4JFJ A;  2MF9 A;  2MPH A;  4DRH A;  4U84 A;  3IKD A;  2K8I A;  2MNT A;  3NTP A;  2XP8 A;  2XPB A;  1FKL A;  2PPN A;  4MGV A;  1JVW A;  2LPV A;  2N87 A;  4TW6 A;  5HWB A;  4IQC A;  5GPG A;  1PBK A;  4W9O A;  2F21 A;  1Q6I A;  3OOB A;  4DT4 A;  4GGQ A;  1KT1 A;  3UF8 A;  1D7J A;  4DZ2 A;  4J4O A;  4JYS A;  2ZR4 A;  3UQI A;  1BKF A;  1HXV A;  2RQS A;  5B8I C;  1Q6U A;  3KAD A;  4ODO A;  1FD9 A;  2M1I A;  3JYM A;  3O5M A;  3O5Q A;  4QT2 A;  3O5F A;  4J4N A;  1ROU A;  1B6C A;  2DG9 A;  3NRK A;  3O5L A;  2DG4 A;  4LAY A;  4U85 A;  2XPA A;  3VAW A;  4O2T A;  4DH0 A;  1R9H A;  1J4I A;  1T11 A;  2XP6 A;  4TNS A;  4JFL A;  3PRD A;  2PBC A;  4U86 A;  4DRN A;  1A7X A;  1FAP A;  3KAH A;  3O5G A;  3UI5 A;  2LJ4 A;  4C02 B;  4TX0 A;  1D7H A;  1NMW A;  1C9H A;  1J4R A;  1FKI A;  2LGO A;  5DIT A;  3UQB A;  2XP3 A;  2OFN A;  3EY6 A;  3O5O A;  4JFK A;  1M5Y A;  1ROT A;  1F40 A;  1JNT A;  1F8A B;  2FKE A;  2VCD A;  4GIV A;  2KFW A;  3UI6 A;  2M08 A;  2MLY A;  2FAP A;  4QIB A;  2Y78 A;  2AWG A;  3IKG A;  2RUR A;  4TW8 A;  2KR7 A;  4ODN A;  2LKN A;  3UI4 A;  3PRB A;  2RSE A;  3KAG A;  3B7X A;  1NMV A;  3O5J A;  2IF4 A;  1P5Q A;  3TDB A;  3ODK A;  5HW6 A;  1FKF A;  4JFM A;  1N1A A;  4DRP A;  3O5P A;  1FKK A;  3KCE A;  4FN2 A;  1QZ2 A;  4ODL A;  1FKG A;  2RUC A;  1J4H A;  2JZV A;  1YAT A;  2M2A A;  2ZQV A;  2KE0 A;  1FKD A;  3IK8 A;  2PV1 A;  3KAF A;  4DRQ A;  5DIU A;  2ZR5 A;  2ZR6 A;  4NNR A;  4DRM A;  3PA7 A;  1FKB A;  2ZQT A;  3JYJ A;  2ITK A;  2PV2 A;  1Q6H A;  3KAB A;  3MDY B;  4W9P A;  1FKJ A;  2KGJ A;  4G2P A;  4DIP A;  1FJD A;  4TYO A;  2XP5 A;  4JFI A;  5HTG A;  4LAV A;  5J6E A;  3IHZ A;  2MLX A;  3CGN A;  4ITZ A;  1BL4 A;  1W26 A;  1JNS A;  1D7I A;  2RUQ A;  4QT3 A;  4IPX A;  3I6C A;  4DRK A;  3LUO A;  4ODM A;  2L2S A;  2UZ5 A;  1PIN A;  5DIV A;  2PPO A;  3O5I A;  3TC5 A;  2XP9 A;  1Q1C A;  2ZQS A;  3WH0 A;  2RUD A;  4DRO A;  2D9F A;  4DZ3 A;  5I98 A;  2XP7 A;  3O5K A;  4FAP A;  1TCO C;  3CGM A;  4ODQ A;  4BF8 A;  4N19 A;  3RGC A;  1EQ3 A;  4R0X A;  3FAP A;  3RFW A;  1NSG A;  5HW7 A;  3H9R B;  4G50 A;  1QPL A;  4W9Q A;  1FKT A;  4LAW A;  2ZQU A;  3KZ7 A;  1KT0 A;  5HKG A;  2F4E A;  4ODP A;  5HWC A;  3UQA A;  3JXV A;  3KAC A;  3O5D A;  4ODK A;  4MSP A;  5HT1 A;  1YW5 A;  4DRJ A;  1J6Y A;  3GPK A;  2MLZ A;  4ODR A;  2PV3 A;  3O5E A;  1ZCN A; 
#chains in the Genus database with same CATH topology
 3ARV A;  1U79 A;  3RM8 A;  1W9V A;  4LAX A;  1NWS A;  1E44 A;  1WAW A;  1GOI A;  1QPF A;  1D6O A;  1E6Z A;  4JFJ A;  3IKD A;  2O9O A;  2MNT A;  3NTP A;  4MGV A;  1LQ0 A;  5DO2 A;  1LG2 A;  1JVW A;  4Z2G A;  2LPV A;  3EIP A;  5GPG A;  2F21 A;  4DT4 A;  1KT1 A;  2ZR4 A;  3UQI A;  3WL0 A;  2DPE A;  2RQS A;  3KAD A;  4ODO A;  4PTM A;  5HBF A;  3O5M A;  2DT3 A;  3B9A A;  2FDM A;  1R9H A;  2WK2 A;  4TNS A;  1FAP A;  3UI5 A;  2LJ4 A;  3ALG A;  3B9D A;  3RME A;  1FKI A;  4WKF A;  1OGB A;  4GIV A;  4KQZ A;  2KFW A;  2MLY A;  1WB0 A;  4MAV A;  2RUR A;  4TW8 A;  4ODN A;  1W9U A;  2YBU A;  1FKF A;  4ODL A;  1FKG A;  4WKA A;  1HJW A;  1J4H A;  2JZV A;  2ZQV A;  4DRQ A;  3KAF A;  4LGX A;  1WNO A;  4DRM A;  2ZQT A;  2ITK A;  4W5U A;  2PV2 A;  4R5E A;  2DSU A;  5HTG A;  3IHZ A;  4ITZ A;  3QOK A;  1D7I A;  2RUQ A;  3CHD A;  4P8U A;  1EDQ A;  1FFQ A;  2L2S A;  3PR9 A;  1OGG A;  1Q1C A;  4DRO A;  3WH0 A;  4DZ3 A;  2D9F A;  1EQ3 A;  3RFW A;  1QPL A;  4HAR A;  2ZQU A;  3KZ7 A;  3AS0 A;  2F4E A;  5HWC A;  1H0I A;  1LG1 A;  3O5D A;  4MSP A;  1LL7 A;  1EIB A;  1J6Y A;  3GPK A;  2YBT A;  1OWQ A;  3WKZ A;  4IQ2 A;  5D75 A;  1X6L A;  2DT0 A;  1ZBC A;  2XP4 A;  1RD6 A;  1GUV A;  4S3J A;  2F2D A;  3WD4 A;  1L1P A;  1HKK A;  2MF9 A;  2MPH A;  4U84 A;  4XAK A;  2B31 A;  4Q22 A;  2K8I A;  4NSB A;  2XP8 A;  3OA5 A;  2PN0 A;  4TW6 A;  1NH6 A;  4IQC A;  1PBK A;  4W9O A;  3WD3 A;  4Q7N A;  1D7J A;  4ZS6 A;  4JYS A;  1BKF A;  4DWS A;  1NWU A;  3ALF A;  4P8V A;  3O5F A;  1B6C A;  4MNM A;  3NRK A;  3O5L A;  2DG4 A;  4Z2L A;  2XPA A;  3VAW A;  4DH0 A;  3FXY A;  4JFL A;  3PRD A;  2PBC A;  3G6L A;  3O5G A;  1E6R A;  2OFN A;  3EY6 A;  1NWR A;  1F40 A;  1W1T A;  1F8A B;  2FKE A;  2VCD A;  1ZBV A;  2FAP A;  1FFR A;  2Y78 A;  3IKG A;  3WD1 A;  2LKN A;  1ZL1 A;  3PRB A;  3KAG A;  1XRV A;  4IT4 A;  1NMV A;  2IF4 A;  1P5Q A;  3TDB A;  4AY1 A;  1HKM A;  3ARU A;  5JH8 A;  4DRP A;  1HKJ A;  3O5P A;  2ETN A;  3CZ8 A;  4FN2 A;  2RUC A;  1JCH B;  2KE0 A;  2DSV A;  3IK8 A;  3WQV A;  3PA7 A;  1VF8 A;  2ESC A;  3KAB A;  4W9P A;  3ART A;  4DIP A;  1FJD A;  3AS1 A;  2MLX A;  3CGN A;  4DRK A;  5DIV A;  2PPO A;  3O5I A;  2ZQS A;  1ZBW A;  2XP7 A;  3WD0 A;  4ODQ A;  3CGM A;  3RGC A;  1NSG A;  4UDM A;  3H9R B;  2EUL A;  1E6N A;  2A3C A;  5HKG A;  1KT0 A;  2WLZ A;  4ODP A;  3KAC A;  5HT1 A;  1YW5 A;  3W4R A;  2KI3 A;  2G41 A;  1ZK6 A;  3NI6 A;  4QZV B;  4HBE A;  2Q5A A;  1FKH A;  3GTY X;  2KO7 A;  3ARP A;  2PPP A;  5HW8 A;  2B5U B;  3TCZ A;  3AS2 A;  3WIJ A;  4DRH A;  3CH9 A;  3G6M A;  2DT2 A;  1IX5 A;  1FKL A;  1K9T A;  2PPN A;  1E6P A;  2F23 A;  5GPR A;  1ZBK A;  5HWB A;  3ARZ A;  1Q6I A;  4GGQ A;  4DZ2 A;  3UF8 A;  4J4O A;  2DSW A;  1E15 A;  3B8S A;  2A3A A;  3AS3 A;  5B8I C;  4WIW A;  1Q6U A;  3CHE A;  1TFV A;  1FD9 A;  3AQU A;  2M1I A;  4QT2 A;  2DG9 A;  4LAY A;  4U85 A;  4O2T A;  2XP6 A;  4DWS D;  3ARS A;  4ML4 A;  1HJV A;  1W1Y A;  4Z2H A;  1LL6 A;  1D7H A;  1NMW A;  1J4R A;  2LGO A;  4P8X A;  3WD2 A;  3O5O A;  1W1V A;  4NZC A;  4JFK A;  2WM0 A;  2IUZ A;  1UR8 A;  3UI6 A;  2M08 A;  2WLY A;  3UI4 A;  1JNE A;  1HJX A;  1KFW A;  2RSE A;  1NWT A;  2QF8 A;  3RM9 A;  4MNK A;  3O5J A;  3ODK A;  4MNL A;  5HW6 A;  4MPK A;  3WQW A;  4MTV A;  1FKD A;  2ZR5 A;  2ZR6 A;  2A3B A;  4NNR A;  4ZPV R;  3BXW A;  1FKJ A;  4G2P A;  4TYO A;  3GU0 A;  2G8Z A;  4P8W A;  4LAV A;  4L72 B;  5J6E A;  1GPF A;  1BL4 A;  1JNS A;  5DF0 A;  4IPX A;  2P4V A;  4ODM A;  2UZ5 A;  1D2K A;  1PIN A;  3B9E A;  2RUD A;  4FAP A;  4BF8 A;  1X6N A;  4R0X A;  3FAP A;  5HW7 A;  1LJY A;  3ARR A;  4ZPT R;  4W9Q A;  1FKT A;  4LAW A;  3JXV A;  2MLZ A;  4ODR A;  2PV3 A;  3O5E A;  2OLH A;  1Y0O A;  4TW7 A;  5HUA A;  5BXJ A;  1EYM A;  1FKR A;  3ARY A;  3O5R A;  2VN1 A;  4DRI A;  3PRA A;  2DG3 A;  1FKS A;  2O92 A;  3KAI A;  1JND A;  2XPB A;  4WJX A;  2N87 A;  1SR0 A;  3OOB A;  4URI A;  4HBO A;  3CHC A;  1HXV A;  1W9P A;  4L3N A;  3JYM A;  3O5Q A;  4IT6 A;  2DSZ A;  4J4N A;  1ROU A;  1ITX A;  1H0G A;  1LL4 A;  2DT1 A;  1J4I A;  1T11 A;  4U86 A;  4DRN A;  1A7X A;  1GRJ A;  4DWS B;  3KAH A;  4C02 B;  4TX0 A;  1C9H A;  4DWS C;  5DIT A;  3UQB A;  2XP3 A;  4KR0 B;  3RM4 A;  1M5Y A;  1ROT A;  1JNT A;  1ZB5 A;  4S3K A;  1HKI A;  4Z2K A;  3FY1 A;  4QIB A;  1E9L A;  1O6I A;  2AWG A;  2KR7 A;  1CTN A;  3B7X A;  2PI6 A;  4JFM A;  1N1A A;  1FKK A;  3KCE A;  1QZ2 A;  1YAT A;  2M2A A;  2PV1 A;  5DIU A;  1FKB A;  3JYJ A;  2A3E A;  1Q6H A;  4Z2J A;  3MDY B;  4Z2I A;  2KGJ A;  2XP5 A;  4JFI A;  1W1P A;  4WKH A;  4WK9 A;  1W26 A;  4QT3 A;  4MNJ A;  3WL1 A;  3I6C A;  3LUO A;  1XHG A;  2AOS A;  5DEZ A;  1ZU8 A;  3TC5 A;  2XP9 A;  3ARX A;  5I98 A;  1UR9 A;  3ARQ A;  1EHN A;  3O5K A;  1TCO C;  3BMB A;  4N19 A;  1SYT A;  4G50 A;  5GQB A;  3CHF A;  3ARW A;  4ZPW R;  3UQA A;  3ARO A;  4ODK A;  4DRJ A;  1ZCN A; 
#chains in the Genus database with same CATH homology
 3ARV A;  1U79 A;  3RM8 A;  1W9V A;  4LAX A;  1NWS A;  1WAW A;  1GOI A;  1QPF A;  1D6O A;  1E6Z A;  4JFJ A;  3IKD A;  2O9O A;  2MNT A;  3NTP A;  4MGV A;  1LQ0 A;  5DO2 A;  1LG2 A;  1JVW A;  4Z2G A;  2LPV A;  5GPG A;  2F21 A;  4DT4 A;  1KT1 A;  2ZR4 A;  3UQI A;  3WL0 A;  2DPE A;  2RQS A;  3KAD A;  4ODO A;  4PTM A;  5HBF A;  3O5M A;  2DT3 A;  3B9A A;  2FDM A;  1R9H A;  2WK2 A;  4TNS A;  1FAP A;  3UI5 A;  2LJ4 A;  3ALG A;  3B9D A;  3RME A;  1FKI A;  4WKF A;  1OGB A;  4GIV A;  4KQZ A;  2KFW A;  2MLY A;  1WB0 A;  4MAV A;  2RUR A;  4TW8 A;  4ODN A;  1W9U A;  2YBU A;  1FKF A;  4ODL A;  1FKG A;  4WKA A;  1HJW A;  1J4H A;  2JZV A;  2ZQV A;  4DRQ A;  3KAF A;  4LGX A;  1WNO A;  4DRM A;  2ZQT A;  2ITK A;  4W5U A;  2PV2 A;  4R5E A;  2DSU A;  5HTG A;  3IHZ A;  4ITZ A;  3QOK A;  1D7I A;  2RUQ A;  3CHD A;  4P8U A;  1EDQ A;  1FFQ A;  2L2S A;  3PR9 A;  1OGG A;  1Q1C A;  4DRO A;  3WH0 A;  4DZ3 A;  2D9F A;  1EQ3 A;  3RFW A;  1QPL A;  4HAR A;  2ZQU A;  3KZ7 A;  3AS0 A;  2F4E A;  5HWC A;  1H0I A;  1LG1 A;  3O5D A;  4MSP A;  1LL7 A;  1EIB A;  1J6Y A;  3GPK A;  2YBT A;  1OWQ A;  3WKZ A;  4IQ2 A;  5D75 A;  1X6L A;  2DT0 A;  1ZBC A;  2XP4 A;  1RD6 A;  1GUV A;  4S3J A;  2F2D A;  3WD4 A;  1L1P A;  1HKK A;  2MF9 A;  2MPH A;  4U84 A;  4XAK A;  2B31 A;  4Q22 A;  2K8I A;  4NSB A;  2XP8 A;  3OA5 A;  4TW6 A;  1NH6 A;  4IQC A;  1PBK A;  4W9O A;  3WD3 A;  4Q7N A;  1D7J A;  4ZS6 A;  4JYS A;  1BKF A;  4DWS A;  1NWU A;  3ALF A;  4P8V A;  3O5F A;  1B6C A;  4MNM A;  3NRK A;  3O5L A;  2DG4 A;  4Z2L A;  2XPA A;  3VAW A;  4DH0 A;  3FXY A;  4JFL A;  3PRD A;  2PBC A;  3G6L A;  3O5G A;  1E6R A;  2OFN A;  3EY6 A;  1NWR A;  1F40 A;  1W1T A;  1F8A B;  2FKE A;  2VCD A;  1ZBV A;  2FAP A;  1FFR A;  2Y78 A;  3IKG A;  3WD1 A;  2LKN A;  1ZL1 A;  3PRB A;  3KAG A;  1XRV A;  4IT4 A;  1NMV A;  2IF4 A;  1P5Q A;  3TDB A;  4AY1 A;  1HKM A;  3ARU A;  5JH8 A;  4DRP A;  1HKJ A;  3O5P A;  3CZ8 A;  4FN2 A;  2RUC A;  2KE0 A;  3IK8 A;  2DSV A;  3WQV A;  3PA7 A;  1VF8 A;  2ESC A;  3KAB A;  4W9P A;  3ART A;  4DIP A;  1FJD A;  3AS1 A;  2MLX A;  3CGN A;  4DRK A;  5DIV A;  2PPO A;  3O5I A;  2ZQS A;  1ZBW A;  2XP7 A;  3WD0 A;  4ODQ A;  3CGM A;  3RGC A;  1NSG A;  3H9R B;  1E6N A;  2A3C A;  5HKG A;  1KT0 A;  2WLZ A;  4ODP A;  3KAC A;  5HT1 A;  1YW5 A;  3W4R A;  2KI3 A;  2G41 A;  1ZK6 A;  3NI6 A;  4QZV B;  4HBE A;  2Q5A A;  1FKH A;  2KO7 A;  3ARP A;  2PPP A;  5HW8 A;  3TCZ A;  3AS2 A;  3WIJ A;  4DRH A;  3CH9 A;  3G6M A;  2DT2 A;  1IX5 A;  1FKL A;  1K9T A;  2PPN A;  1E6P A;  5GPR A;  1ZBK A;  5HWB A;  3ARZ A;  1Q6I A;  4GGQ A;  4DZ2 A;  3UF8 A;  4J4O A;  2DSW A;  1E15 A;  3B8S A;  2A3A A;  3AS3 A;  5B8I C;  4WIW A;  1Q6U A;  3CHE A;  1TFV A;  1FD9 A;  3AQU A;  2M1I A;  4QT2 A;  2DG9 A;  4LAY A;  4U85 A;  4O2T A;  2XP6 A;  4DWS D;  3ARS A;  4ML4 A;  1HJV A;  1W1Y A;  4Z2H A;  1LL6 A;  1D7H A;  1NMW A;  1J4R A;  2LGO A;  4P8X A;  3WD2 A;  3O5O A;  1W1V A;  4NZC A;  4JFK A;  2WM0 A;  2IUZ A;  1UR8 A;  3UI6 A;  2M08 A;  2WLY A;  3UI4 A;  1JNE A;  1HJX A;  1KFW A;  2RSE A;  1NWT A;  2QF8 A;  3RM9 A;  4MNK A;  3O5J A;  3ODK A;  4MNL A;  5HW6 A;  4MPK A;  3WQW A;  4MTV A;  1FKD A;  2ZR5 A;  2ZR6 A;  2A3B A;  4NNR A;  4ZPV R;  3BXW A;  1FKJ A;  4G2P A;  4TYO A;  2G8Z A;  4P8W A;  4LAV A;  4L72 B;  5J6E A;  1GPF A;  1BL4 A;  1JNS A;  5DF0 A;  4IPX A;  4ODM A;  2UZ5 A;  1D2K A;  1PIN A;  3B9E A;  2RUD A;  4FAP A;  4BF8 A;  1X6N A;  4R0X A;  3FAP A;  5HW7 A;  1LJY A;  3ARR A;  4ZPT R;  4W9Q A;  1FKT A;  4LAW A;  3JXV A;  2MLZ A;  4ODR A;  2PV3 A;  3O5E A;  2OLH A;  1Y0O A;  4TW7 A;  5HUA A;  5BXJ A;  1EYM A;  1FKR A;  3ARY A;  3O5R A;  2VN1 A;  4DRI A;  3PRA A;  2DG3 A;  1FKS A;  2O92 A;  3KAI A;  1JND A;  2XPB A;  4WJX A;  2N87 A;  1SR0 A;  3OOB A;  4URI A;  4HBO A;  3CHC A;  1HXV A;  1W9P A;  4L3N A;  3JYM A;  3O5Q A;  4IT6 A;  2DSZ A;  4J4N A;  1ROU A;  1ITX A;  1H0G A;  1LL4 A;  2DT1 A;  1J4I A;  1T11 A;  4U86 A;  4DRN A;  1A7X A;  4DWS B;  3KAH A;  4C02 B;  4TX0 A;  1C9H A;  4DWS C;  5DIT A;  3UQB A;  2XP3 A;  4KR0 B;  3RM4 A;  1M5Y A;  1ROT A;  1JNT A;  1ZB5 A;  4S3K A;  1HKI A;  4Z2K A;  3FY1 A;  4QIB A;  1E9L A;  1O6I A;  2AWG A;  2KR7 A;  1CTN A;  3B7X A;  2PI6 A;  4JFM A;  1N1A A;  1FKK A;  3KCE A;  1QZ2 A;  1YAT A;  2M2A A;  2PV1 A;  5DIU A;  1FKB A;  3JYJ A;  2A3E A;  1Q6H A;  4Z2J A;  3MDY B;  4Z2I A;  2KGJ A;  2XP5 A;  4JFI A;  1W1P A;  4WKH A;  4WK9 A;  1W26 A;  4QT3 A;  4MNJ A;  3WL1 A;  3I6C A;  3LUO A;  1XHG A;  2AOS A;  5DEZ A;  1ZU8 A;  3TC5 A;  2XP9 A;  3ARX A;  5I98 A;  1UR9 A;  3ARQ A;  1EHN A;  3O5K A;  1TCO C;  4N19 A;  1SYT A;  4G50 A;  5GQB A;  3CHF A;  3ARW A;  4ZPW R;  3UQA A;  3ARO A;  4ODK A;  4DRJ A;  1ZCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...