4QZVB

Bat-derived coronavirus hku4 uses mers-cov receptor human cd26 for cell entry
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
208
structure length
208
Chain Sequence
TECDFSPMLTGVAPQVYNFKRLVFSNCNYNLTKLLSLFAVDEFSCNGISPDSIARGCYSTLTVDYFAYPLSMKSYIRPGSAGNIPLYNYKQSFANPTCRVMASVLANVTITKPHAYGYISKCSRLTGANQDVETPLYINPGEYSICRDFSPGGFSEDGQVFKRTLTQFEGGGLLIGVGTRVPMTDNLQMSFIISVQYGTGTDSVCPML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/viral protein
molecule keywords Dipeptidyl peptidase 4
publication title Bat Origins of MERS-CoV Supported by Bat Coronavirus HKU4 Usage of Human Receptor CD26.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 208
sequence length 208
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.70 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4qzvB02
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4qzvB01
3BGFA 4ZPTR 2AJFE 3D0GE 2GHVC 3SCIE 2DD8S 3D0IE 4ZPWR 3D0HE 3SCJE 4ZS6A 4ZPVR 3SCLE 4XAKA 4QZVB 4KR0B 3SCKE 4L72B 5DO2A 4KQZA 4L3NA 2GHWA
chains in the Genus database with same CATH superfamily
1EETB 3EYZA 4Q43A 4RNHA 1XNRJ 4K2JA 1Z2LA 2FJAB 2FB0A 1XJWB 2NQPA 2A1BA 1P27B 3OFFA 3CCWA 3WIVA 1FNXH 1H2TZ 1XWLA 4OYIA 1KS2A 4DQIA 4UDMA 1TV6B 4JI0J 2WHOA 4CLUA 2CZ9A 5L1JA 5HTGA 4CNYA 2HBRB 1I51B 1VRQC 3J80Y 2HS0A 3BV8A 3Q8QB 2YWGA 4MAVA 2YKMA 2XMUA 5EN1A 2EVZA 1T03A 2KI3A 2W4DA 4JFLA 3IG1A 2Y78A 3D6MB 5K9FA 4C9DA 3DDIA 3FCHA 3PVXA 1RB0A 2GHVC 1N34F 1LQ0A 4LQ9A 4JI4J 1R6YA 2KT5A 2L9DA 2R7RA 1U6BA 4DV7J 2XP4A 1Q8LA 1Q82T 4HHJA 2MKYA 4Z2KA 1S1XA 2V4JA 4CLKA 1BQMB 3FDSA 4NPOA 5I4MA 4OI4A 1M5KC 2RQCA 4ZVPB 1S9FA 3OLAA 3Q83A 3IBWA 3I6PA 1RLCL 1BQXA 4OLOA 2ZM6J 2PV1A 1U0SA 2BE9B 4NZ0A 3O5DA 3G86A 3BGFA 2C28A 4X64J 2WSEC 3OL8A 3H8YA 1TU0B 4GGQA 2VA3A 3SYZA 3CDBA 3NOCA 3DOMA 4PTMA 1DRZA 2GNKA 3M8YA 3B9EA 5LOQA 3ARYA 1NWTA 3AA9A 3HJVA 1P8GA 3W7BA 2RDDA 2DXDA 1ZCNA 3W62A 2IYIA 1W1VA 5D75A 5KFIA 3B78A 3SV3A 1HBOB 3UQBA 2XP6A 4DV1J 2PI4A 1YJVA 3BKTA 4DR3J 3L9ZA 4CLPA 2DT3A 3TA2A 2BW7A 2N4DA 1LQ9A 3Q8UA 2UUBF 4U9RA 4DPXA 2E9RX 1T05B 2HS4A 1JJ4A 3CCQS 3OOBA 1OWQA 4DU7A 2HNDB 5DG8A 2NUHA 3D6FB 1EX8A 5I42A 1N5QA 2XS7A 4I7FB 2F5GA 1S1TA 1ZPWX 4LFBF 2W9BB 5HBMB 1RWVB 2DB1A 4LGXA 2KM8B 4OYOA 1H0HB 4E2FB 3M05A 4G1QB 4P75A 3PW2A 5LXRA 4DRIA 2HBQB 5AXNA 1R6VA 2RRNA 2ZH4A 1VBXA 5L39A 4HI1A 3Q8PB 1XMOJ 1E6YA 1LXNA 1S77D 2JWNA 5KT4A 3CIMA 2EEYA 1TFWA 1S0OA 1FNMA 4ODRA 3SSQA 3MFIA 4NZ6A 3BGRB 4QIEA 2KU7A 2RUSA 4PUOA 2CQBA 1HBUA 4M5KA 4QT3A 2YKNA 3M8PA 4IFYA 5EWEA 2VC1A 2UVUA 3TAQA 2YWEA 1I1GA 4O4RA 1E9LA 1VRTA 1TVRB 1BUXA 3IMQJ 4ECSA 4ODKA 4AXIA 4P7TA 2B4UA 2VJUA 2KG1A 1WC6A 1JLCB 2IDLA 3K5NA 4LR8A 1CJVB 1MROA 4RZRA 4EBCA 3MHYA 1DURA 2UUCF 2HEKA 2OPSB 5HQMA 1GXLA 3FRZA 4BCAA 4BF8A 4RW8A 3DM2A 2OEKA 1UVMA 4ANDA 5KFDA 1LWEA 1T9XA 3T1AA 3AJ1A 2V68A 2PGCA 2KDOA 3MMAB 3CGNA 2C3PA 5HP1B 1VHFA 5IC4B 3CSKA 1MWYA 4PXDA 2Z2MA 4S3JA 4FNIA 2CYYA 3DRRA 5CYMA 2I5JB 4RW4B 1DFDA 2C2MB 2WCXA 2Y0BB 1FWPA 1R9HA 1K8AT 1W2BR 1OPZA 4ZN1A 4ED2A 2K8IA 3MR5A 4DR4J 4FYDA 3RB6A 2VBZA 2AHOB 3DLGB 3ENWA 3GLJA 1X6LA 5HVHA 2ZH5A 1TKDA 2XZWA 2BJEA 4B9MA 3KUHA 4IG0B 2PFDA 2ZNYA 3MEGB 2P6TA 3S1TA 5IV3A 4W98A 1ZBCA 3J7YU 3Q8VA 1U6ZA 1RAAB 1S9GB 2YPYA 4KIAA 3AY0A 3LP2B 5LMUJ 2IM1A 3M1VB 1MMDA 3KG4A 5J2MA 4QW8A 4R8UB 3TAMA 2NZCA 2M5YA 1CJTB 3N01A 4DOZA 3TJ8A 2C22A 2CQ1A 4IFVA 2R7XA 1E6NA 2DH7A 1ROUA 3UQSA 2VOOA 4EEYA 2AD9A 3E8OA 4XTTA 3TA0A 4P2MA 2ADCA 5L1IA 1DTTA 2J9EA 5DDQC 3MF5A 4I1TA 4KY3A 2FC8A 1IBKF 2R7SA 2HNYB 1F5AA 4C02B 3GV5B 2HFZA 1SJ1A 4F0KA 5AJ3J 3OR2B 4PG5A 1E6VA 2K06A 1GMWA 1D1UA 2DPIA 3FQKA 4F3OA 1EDQA 3OL7A 3RB3A 1A9NB 2CG4A 3EX7B 4OYAA 4U7UK 4NXMF 5IV4A 3O44A 5M2UA 2R7WA 1U7LA 1HD0A 1TMJA 3S01A 4UQTA 2ZKTA 5FD1A 1UR8A 4HARA 4K4WA 2ZITA 4UOFA 5KG1A 3HHLC 3DMJB 3CHDA 2B8PA 3W9JA 3MM6A 4F4AA 4QZVB 3A3OB 3LTOA 3SSRA 3I87A 2PPNA 2FGOA 2OD6A 3JQKA 3L7OA 3O5TB 5F8MA 2ATLA 3OT9A 4D3HA 2E7WA 5GMEA 2PBCA 3IGVA 1RD6A 1H98A 1TR0A 2DGOA 2I2YA 2PC6A 1FKHA 4LF6F 1HNVB 4Y2CA 3KUEA 5HATA 1RQ0A 4DV5J 3DLEA 3Q8RB 5CABA 2GO8A 2ZZMA 1Y00A 4M5IA 1NK7A 2VF3A 3BM7A 3UD4P 4F2RA 3AXKA 4TW6A 5B0FA 4YQWA 1MNEA 4XDCA 2VJVA 1Y9OA 1TK5A 4OX8A 3UCZP 5ETOA 3WX4A 1HD1A 3Q2SC 3FKBA 2JEFA 4LSLB 2XNQA 1QZ2A 2CJYB 5IQQA 2OPPB 3DRPB 2J6UA 2MSTA 1RHRB 2ZQSA 2AJFE 5G0RB 2IIHA 4EYHB 1QLNA 4DL4A 2KJWA 1T05A 4IDKB 4DV2F 3WBZA 1RHQB 2CPXA 4DL6A 2WB1D 2PMZD 2YWFA 1X4HA 4Y65A 3CDEA 3P4UB 4MIAA 4ES3A 4C8ZA 4JI1F 1WNEA 4O44B 4EWTA 1FFQA 2VASA 3R27A 3BBFA 1NK4A 2B3TB 3G71S 4Q22A 4ERDA 1Z4UA 2PI6A 1SIZA 4PG6A 1KDNA 4B3MF 3MM8B 4ZP8A 4GC6A 4OMFG 2QA2A 4DCPB 3VGSA 1S1WA 1XNQJ 4ZCLA 2XQCA 1O5JA 4CP5A 1NB2A 3HHEA 4TU8A 3BREA 2DNHA 4C7QA 3EVOA 4G50A 1RTDB 4KE5A 3TR5A 3HF5A 4X4QA 2YKOA 2PIIA 3IR7B 2HWIA 1GAOA 4UUXA 3BGRA 1KFDA 5M2RA 4OYZA 5KFSA 5A6PA 1WG4A 4PG7A 2CQ0A 3A13A 2NS1B 2YNGB 1U4BA 1UEKA 4DV4F 4OX9F 1M5SA 3HMJG 1T7PA 1KT1A 1HNWF 4GKKJ 2MQQA 2DR7A 2XP7A 3IC1A 1OQ3A 9ATCB 4CLTA 3RU0A 3D1OA 3FCVA 1G3OA 4OZ3A 3KABA 1H7XA 1YATA 1HQEB 2FTRA 4N8NA 3TUPA 4KFBA 1Q6HA 1CJVA 1JCHB 3M6WA 3IA0A 1OS5A 1KTQA 1SJRA 2EFOA 2RB7A 4ZHRA 4WK3A 2DY1A 4KQZA 2E1MC 1UKUA 1K1SA 3ZTRA 4WKFA 1G2EA 4NLTA 2XMVA 1YVFA 3MTKA 2IC3B 3I5CA 3W63A 4IUFA 1YSJA 1DLOB 3QGPA 3R7NB 2GIFA 2I5JA 4LRAA 4CO5A 4F26A 1O8BA 3MZIA 3F0NA 2V69A 2WVDA 3Q8YA 4IQXA 1RWXB 4M63A 1HR0F 1VMBA 2X1GA 2W7AA 5L46A 3J81j 2FUG9 3NNCA 4F67A 3MEGA 1YX2A 1M5YA 4FXVA 5A0YB 1X4AA 3T1YF 3NGUA 1KEKA 3M2VA 4XPCA 4FS1A 3QJPA 4AT1B 2HAFA 4R8UA 2ZD1B 4WJXA 4J9RA 3TZZA 3ISND 1CJTA 3K57A 2M08A 4OFZA 2DNKA 1X60A 4NI2A 3M32B 1RYSA 5B0GA 4GO5X 1RHJB 5J2PA 1NO8A 2HNYA 3ARXA 2RDJA 2DY9A 2PFFB 1U0HA 4ED1A 4LBIA 2KG0A 1Q95G 5E3QA 3VAGA 4H54A 2MZTA 1KR4A 4WP8A 3CJKB 3U1MA 1WDDA 4DQSA 3DGVA 2DR9A 3ARWA 1YJRA 4F2SA 1NK8A 1RT5A 4BLGA 1J6YA 3GIRA 2HRYA 2ALYB 2ATCB 1FKJA 2VOPA 2FC9A 5HJYA 3M30B 2NXEA 3W65A 4EO6A 2KTQA 3QZ8A 4MIWA 1MSWD 4PRFA 4ES2A 3J7A1 5H9FK 2FZCB 2OHDA 2KHCA 2W1BA 2DITA 2QLFB 4ITZA 4I6AA 3CJ2A 4EO8A 1FE0A 3PV8A 3OXFA 1WDTA 3DMJA 4EBEA 3CD6S 3QWPA 2MQ8A 1S6OA 3G2XA 1RHKB 2QLBB 5KFGA 3KAFA 3H59A 3AD8C 2VA2A 5BYSA 2R8HA 1KN6A 2FQQB 2GS8A 4I6YA 3V6KA 2D3O1 1D2KA 2HQDA 4RLEA 1O51A 1T94A 2OKQA 2ZDPA 2HKEA 3I9ZA 4PQUA 3GJSB 1KTVA 1B6CA 4P8VA 2ZFHA 4DBQA 2UP1A 2VQFF 3EGWB 3BN7A 1U2CA 2RU9A 5BJRA 1M5PC 4G1PA 5IXUA 1M1KT 3Q86A 1PILA 1V3RA 3HHLB 4C3MA 5KFRA 3IS9A 4CLLA 4OI1A 2X3DA 4DR7J 4YB6A 1VC0A 3PJ9A 2MMYA 1YBUA 2B9WA 3K89A 2MY7A 3KLFB 2D74B 3ZFVA 3QIPB 4LIWA 5J2NA 5CYQB 2HIYA 1M1GA 3P6YC 1ELOA 3DGPB 1DTQB 2YNIB 1RTIB 3IKGA 3WX8A 1S57A 4OZJA 4NMXA 3BN4A 2MKJA 4KSEB 4DRPA 2NSBA 3MDYB 2W2OP 4Q2LA 2CPZA 4ETXA 1G4CA 2F40A 2YTCA 3KFWX 4TY8A 1EHWA 5KFTA 5G4DA 3PIOQ 1ZTTA 1P6TA 1A7XA 1S7IA 4CWBA 1REGX 2WONA 2IA0A 2AJQA 1S5ZA 2ZR5A 1J4IA 1QPFA 5J1PA 1S1VA 4X4VA 3I55S 3PW4A 1IR1A 1K0TA 4O44A 3IO1A 3AHPA 1RAHB 1S6UA 3VGUA 4DS5A 5HAOA 2G2OA 2NXCA 1MWZA 2MZRA 3W61A 1B3TA 1IKXA 2R2TA 2XPBA 2HAIA 5E2QA 1KVKA 3I0RB 5IS2A 4TNOA 2D41A 2UUAF 1U1QA 5LSLA 5KFFA 1RT6A 1F9FA 4TNSA 4DV3J 1U24A 2YWWA 3QAUA 2FJWA 1RAEB 1DJ0A 3BPSP 3OFHA 2B6AB 5GAHU 4KYZA 1VLYA 4XPEA 2XNRA 3F41A 1FX4A 2Q6BA 2DSVA 2L3MA 3I56S 5HL7Q 2BM0A 1XRVA 2CZ4A 1OSDA 2JJ4D 2W7PA 4AUKA 4Q45A 3FBBA 2LMIA 1NZAA 3CC7S 2M8HA 5D0HA 3EWGA 1IXKA 1FKPB 3LGMA 5L1KA 1NB7A 1URRA 3MMBA 2V4QA 3HFKA 2FKEA 4N77A 5GAGI 1HI0P 1U79A 5DEZA 2P5VA 3FFIA 5EX0A 2R7VA 4C8YA 3PRDA 5LL6d 4U7UD 4DUTA 2LA6A 4DPUA 3PYEA 1FRHA 4N5SA 1PG5B 4CQ1A 1KOHA 1IN0A 2AX1A 2XLJA 5A6WA 2WVFA 3KG1A 4G65A 3ODKA 5HMXA 5F3TA 1RHUB 2A3BA 2CIMA 2UVRA 2CJKA 4U67Q 2DHSA 4U8VA 4TU9A 1RWNB 3BKUA 5ETTA 4ELUA 4ZITA 1RWWB 3O5MA 3JS9A 2M52A 4UY8T 4DZ3A 2CXEA 3AD9C 3CWJA 3H25A 3W4RA 1HNZJ 3C3LA 1MLAA 1O6XA 4X65F 4PEOA 2A2CA 5HROB 1VK3A 2KKHA 1S6QB 1PINA 2HK2A 3TYTA 4W9QA 5FLXY 2MKCA 1XBWA 2YKAA 2A3EA 3AOBA 2F65A 2MZQA 2HHQA 3DDKA 2J76E 3WH0A 3RM9A 2ZC3A 3EDQB 2W24A 2FAPA 4RBTA 1TFVA 4RR5A 2FJXA 2QEXS 3TVZA 3CT9A 5K8MA 5A0YA 2GVZA 1QDUB 2BQ3A 3P3DA 4OLPA 3RBEA 3PNIA 2MQLA 2OEJA 4LF4F 1S49A 2CNNB 3VAIA 4O2TA 2LKZA 3UDVA 4RW7B 5HW7A 4ZCIA 4C8LA 1T02A 2VL1A 2ASLA 3ULHA 4KO0B 4PWDB 3DOKB 5B09A 1Q1KA 1J4HA 4K4VA 3JSYA 1WEXA 3GSDA 3GZ7A 2RRAA 2UXBF 3FSIA 2QA4S 4DRMA 2H5JB 3RAQA 3UVJA 4CH1A 2Z2YB 1QAIA 4A8WA 1HHSA 4ZOSA 4B3OA 3QFWA 1FJGJ 4AFFA 1YBAA 2HZCA 4YB5A 1X4DA 3KUGA 3M30A 4IQMA 3UD5A 3J7Z5 3MM9A 1HNXJ 2FHOB 1SH0A 4DSEA 4LF8J 4USVA 4U96A 3GIKA 1JXLA 2QTWA 2P9CA 1T0TV 1W1YA 1R0AA 2RNEA 4P9SA 5T14A 4J9OA 5JMNA 1JNRB 3DLHA 5CD4H 5KG4A 1N52B 4ZPDA 3MFHA 1FJCA 1L3VA 3PHTA 5A8WB 3ET6A 3BEGB 4USJC 3UN5A 3FEXB 3SEOA 1WJ9A 1D6OA 2BZ2A 1Q4RA 1FE4A 1NJXA 3K5MA 5K5MA 5H1SV 5KFCA 1NCLA 4K4TA 1UA1A 1EKRA 3TO8A 2LCWA 3KCEA 5D4OA 1QSYA 3HHLA 2CNOB 3C46A 3W2WA 2UUWA 4JI5F 5E3PA 4YUDA 4X62J 1EP4A 2CUYA 5J1EB 2Z2LA 2KVQE 3TA1A 2VFTA 5CXTA 2L48A 3PKYA 4PPDA 1HQUB 4QIFA 4UY85 1FDNA 3KADA 2D7SA 2VONA 2K3KA 1NLKL 1O0PA 1SXLA 3AS0A 1RTIA 1IWAA 1ZB5A 4FN5A 1U6FA 3MAAB 1IM6A 4LF7F 3I6CA 3KMQA 2WW8A 1ZM4A 5C24B 2XYHB 4R5PA 3M2RA 3IP0A 2CQCA 1CEZA 4TXSA 4JYAF 2Z2ZA 1HJXA 2HPUA 3QRRA 4DL2A 4IT6A 2P4VA 3TRGA 3ADAC 5B0AA 4ATNA 3ZZPA 3KYLA 4CLSA 1W1PA 2LU2A 1WHWA 4ECZA 5J6EA 1KNZA 3D4JA 3HHLD 1DQ8A 2CRLA 1S9EB 4DQQA 2C2DA 4F25A 4IG3A 4USWA 3G96A 1NSKL 5A8RA 1LOUA 1FDDA 3ZZYA 2DR5A 3JSBA 1BWVA 4DUYJ 3QT6A 3M8SA 3LW5C 2HZAA 2IRXA 2HMIA 3WHIA 2Z4PA 1J5OB 3ARTA 4M5NA 4Y00A 3ZC4A 1S7HA 2HQIA 4GKJJ 2B6AA 3POTA 3FRYA 1XMQJ 1EKSA 5GPGA 4DZDA 5H9EJ 4O4GA 1XR6A 3C14A 1PO6A 4HHHA 1TL5A 2MEWA 3AS1A 4Z2GA 2HHWA 1CG2A 4ZDNA 2W7OA 2KFWA 2WBMA 3MMCB 2IVYA 3GFZA 3T1HF 3RM8A 1WKKA 2CNLB 2OSQA 1YJTA 3AT1B 1Q7LB 4B9UA 1Y3JA 4V19J 3MR7A 5D78A 4OZLA 1NK0A 2QFJA 2B4OA 1VHIA 4PG4A 2APOA 2VG5A 2ASJA 1V3ZA 2HQCA 2MKHA 2XB2D 1BWEA 4AL7A 1WC5A 2BJ9A 4Z2JA 4DRNA 2IFXA 3HVTA 4ZVRB 4HBOA 3MI7X 4QW9A 1RE1B 2W9CA 5CA5A 3CNQP 1HPZB 4L3KA 2CDRB 2VDIA 1D09B 3GCWP 1JLQB 1GUVA 5FJ4A 4CLZA 2Z57B 1U1PA 2QC3A 2DR8A 2MNTA 2DNPA 3V6DB 3CTRA 3KOAA 5KFEA 3JAMU 3IKDA 2V6AA 3WQPA 2AEMA 5HROA 2O5DA 5HN0A 3HVWA 2DGVA 1NKCA 5B0DA 2J8SA 2AWZA 4JFJA 4LREA 4W9PA 2GIQA 2G8ZA 2FJBB 3B7XA 3G8QA 1CJKB 4O3RA 3KWMA 5HO4A 2HLTA 2JFKA 1C4AA 2WOMB 4IRKA 4LRBA 2BA9A 2HK3A 2YPZA 4WKAA 2BXJA 4J91A 3GILA 4LVOP 1IBMJ 1UAWA 2YX4A 3BH7B 3OFGA 4DR6J 4YDXA 2I38A 2BJ1A 8ATCB 4LVNP 4Y2AA 1EHNA 4DJBA 1D7HA 1I3OB 3NOGA 1ZM3A 5KG7A 1GNKA 2DR6A 1SPBP 2QL7B 3L4BC 3W9IA 4H4MB 3PR9A 3BO4A 4AL6A 2KRRA 3K7RA 1HI8A 4WK1A 1VBZA 2ZE2B 4CZCA 3DRSA 2IMWP 5IZHA 4N7TA 2BQUA 1NSAA 2XMMA 2P9EA 3HHKA 4K2XA 1WNOA 3NMAA 1NHUA 4JV0A 2YBUA 4O3OA 2DGTA 4TYAA 1TKXA 3PX4A 3TZXA 2YWHA 2JLGA 1EARA 3NKYA 3R5DA 3PRAA 3NP5A 3FGVA 4QCLA 1YGYA 3G4SS 1RWUA 2BVZA 1RABB 3H5SA 4RBVA 4IQCA 2WSFC 2G9OA 4LSZB 1RT4A 2HVIA 1U1NA 2MZ1A 2GHWA 1HI1A 1X5SA 2XS2A 4JI0F 5A8WA 5HWCA 1SJ4P 5HQLA 4USUA 4CO4A 1RAIB 1H0GA 1G7CB 2VBXA 1BKFA 2HVHA 4EBDA 4CM2A 2RDIA 5J1NA 5M2PA 4DX6A 5KFQA 2DPJA 4ZK7M 2IRUA 1RU2A 4QQBA 1ZPVA 3MR2A 1REVB 1LL7A 3M9OB 1RYRA 1JLFB 4YHHJ 4B3SJ 4MK8A 4IYQA 3R5BA 3BF4A 3H40A 1YBTA 1C1CB 2HGMA 2HBZB 3W66A 2DD8S 4JI2J 3BQ2A 4DV7F 1RDRA 4PXBA 2I6WA 4FXWA 2W9AA 5HSPA 1XR7A 4GMKA 4N8OA 2RQ4A 4ECTA 2YQ0A 4F50A 4ZN3A 5F9NA 2DHHA 4A48A 1Y4ZB 2QRRA 5C24A 4DG1A 3M9MB 3TANA 3KHGA 5F9LA 1BY9A 5GMDA 1KP6A 4CDIA 3T5LA 1SL2A 3ISZA 3TJ9A 3DYAB 1NRKA 4X64F 1UCNA 2F3JA 3AQUA 5EX3A 2GMHA 1X7VA 2UU9F 4LRFA 1CPZA 2E5LF 5CYJA 3D9BA 2BW2A 1YJWS 4LF9J 1WF0A 1N32F 1VQLS 4LF5F 2V50A 4RJVA 3IN5A 2EC0A 4UUWA 4YR3A 2KN4A 2F4VF 2OP5A 5EUHA 3MXHP 3CJ8A 2XLIA 4RWWA 2NSCA 1P1TA 2EG1A 1IKVB 1J5OA 1Q86T 4CTAA 3LUOA 3GCXP 4JI6F 1S6PB 2F8EX 1LEOA 5KG3A 1V9OA 3PW7A 1PGZA 1RT3B 4WF9Q 1QM9A 1Q5VA 2BJDA 3AB4B 3V2UC 4YS2A 1RAJA 3PEHA 3CCRS 4IOBA 1OWXA 3SIPB 3O5RA 3KLIB 3GFYA 1UWBA 2BMBA 2EK6A 1Q78A 4GC7A 1Q16B 4C8KA 3TC5A 1D9DA 2ZR4A 4WKYA 4JI3F 3KAIA 1Q8KA 2MPHA 2RS2A 1HYSB 3O2IA 1YJNS 4USMA 1KLMA 2QL5B 3R2CJ 3MM7A 5F8GA 2ASDA 1HJWA 3BMBA 3M8QA 2HQGA 4NXNJ 5FIIA 2GC8A 3FC9A 4NLQA 1B0PA 3CJTA 1HPZA 3RW6A 3GV7B 1XMBA 1YQHA 1IJEB 5GADI 1NMVA 4N19A 1GT8A 2JEIA 3TEHB 4ZP6A 2FHJD 1KC8T 3IAM9 4DRHA 2CWXA 2FVCA 2YH0A 1NDLA 1VI7A 4DEZA 3NY0A 3NGDA 3SFUA 1N34J 3R2DJ 3K5LA 2CJAA 2YKQA 1WC4A 4O3SA 3HKZD 1RWKB 4CLFA 1RSCA 2O66A 3LP1A 1RP5A 4B9SA 3BH6B 1YRUA 4KTQA 5DITA 1HBNB 4A8SA 2OAUA 3CHEA 2HZVA 1ITPA 4QR2A 1P9YA 1CLFA 5GQBA 3AH6A 3GYXB 2XSFA 4MNJA 2ZH1A 3VAMA 4DR5F 5C25A 4DRJA 2DO4A 4UF4A 5F8IA 1FKDA 1UETA 1X5OA 1OGGA 3O5FA 2XM3A 4BC9A 2MKKA 1Y10A 1AXQA 3I4PA 1RAFB 3NCRA 1BD6A 1TAUA 4UOHA 4LRCA 3UCUP 4NX9A 1JLEA 3BQ0A 5LJ3Y 1ROTA 1VJWA 2K3IA 2QFIA 2BE7D 2LECA 3FBEA 4A47A 4LFAJ 2ROGA 2ILYA 4B9VA 4MFBB 3OL6A 4HHUA 1K47A 4KGVB 3TEGA 2DTJA 2DBBA 3P45B 4Z2HA 2D3ZA 3H5YA 2ZH9A 4K4SA 3OA5A 2HQFA 1SUQB 3SBMA 1C1BA 2AGOA 3LA0A 3LALA 3TUZC 1BQNA 4M5LA 1SKWA 1KVIA 1R31A 1U45A 2UUBJ 4NCGA 4ECXA 3WD3A 3AS3A 3Q23A 3CCES 2GHPA 1Q5YA 1D3WA 2KZZA 2UVVA 1HKMA 2BJ7A 2BANB 2EC2A 1OY6A 1HWKA 3ENAA 2L9NA 4U7CA 3VAJA 3GG0A 4DH0A 1EZZB 2RF2B 3SXLA 2V5HG 1VQ9S 1HARA 2XZDB 1FTCA 4AL5A 3ZZUA 5AJ3F 3HD1A 2ADBA 2W8LA 3H20A 2RU3A 1SJQA 4ENOA 4QR1A 3PY8A 1X9WA 3KHRA 4L6V3 3NEKA 2JVOA 2G13A 3PW5A 1JJ2R 1REVA 3CO9A 2MQOA 3RRHA 1JLFA 3JYJA 2GGPB 1VBKA 5I3QA 1VGYA 2OFHX 3QLHB 2WAQD 5K8PA 3L7UA 2ZQTA 1IWGA 3QPIA 5DG9A 3ETOA 2LQ5A 3HKWA 3SCKE 3HFVA 1VYAA 4PWUA 3S7RA 2XP9A 4HYKA 3M8ZA 1LW2A 5DIUA 1FAPA 3BR9A 1WHYA 3KDOA 3MURP 1L3TA 2VPZB 4ODQA 2GMJA 3DXSX 4TLRA 1UVJA 5F8NA 4FBTA 4F36A 2BRKA 3DDNA 3G82A 3DNCA 3GTYX 4M94A 1MW7A 1VQ7S 2JEGA 4GVBA 1PYSB 2OLWA 2H5EA 2IVFB 2ZOMA 1B0VA 1VOMA 1JKHA 3DYAA 4NLXA 3KJVA 2RH3A 2WLZA 2IDEA 5DM6Q 3QSYB 4ODNA 3BJYA 2UUCJ 3P5TL 4DFKA 5DGAA 5D4NA 3M2UB 2CDQA 1DQAA 2ZJPQ 2Z8QA 4HDHA 2V2ZA 3T3FA 3TWZA 4YB7A 1TL7A 4EU0A 4WU2A 1FEHA 2EK1A 2M88A 3SI8A 3QATA 1PC5A 2LDYA 1U47A 4M5DB 5B0BA 4WZMA 3I0SB 1ZTWA 4MKYA 1X31C 4LF2A 3OTDA 3UE2A 5KFUA 3FXYA 3DI6B 4P72A 1SC4B 1S6PA 3GONA 2MQNA 4LAVA 4NSBA 4MYUA 3B4DA 1V5IB 4LAYA 3RMEA 3H0PA 1RT3A 4CCHA 3GJRB 2BJ3A 3ILLA 2XMJA 5JVHQ 2P8IA 2H5IB 2CJXB 2G2YA 1DBDA 4MSPA 2C3YA 2EI5A 4HH0A 3KLIA 4OI2A 4J4OA 1SQGA 4IR1A 1LG2A 3EXCX 2ASYA 2CQPA 4K50A 1HYSA 2F8HA 1C0UA 3MPUB 1VJQA 5EWFA 4RW9B 3ARPA 3BO3A 3JTPA 3OUYB 2N3LA 2BR0A 4RNOA 1ZU8A 4A46A 2M2BA 2MTLA 4YP3A 1VQPS 3AOAA 1IBKJ 3KK1B 2P9GA 4Q7NA 1KHWA 1RBLA 5KT7A 4P71A 1WC0A 3VF0B 2KM8C 1Q0NA 1VS3A 3MPWA 2KB2A 4J5OA 2FDMA 5CD4A 4MK7A 3U1NA 3O5IA 4Z7YA 3T5KA 1TKZB 2XSJB 4GIVA 2HFOA 4NXMJ 2XTJP 3GB0A 5AE1A 1NH6A 4HACB 4M1KA 2LDIA 1RISA 2GW8A 4ZCMA 3C66A 2LU1A 3RB4A 4P52A 5B0EA 1TKTA 3VAKA 3QRPA 1MMNA 1JLGA 3DOLB 4J9UE 3PYDA 4NE9C 2IA6A 2LKNA 4TYBA 1NHVA 2WLYA 1SIWB 4N41A 2WW4A 3C16B 3EXYA 3KK2B 4LSNB 1T95A 3PJXA 4JFKA 3W64A 3QFHA 1ZAXA 4FYVB 2Q5AA 3A8EA 2VG7B 1XK8A 1B7YB 2DGSA 4WFBQ 4MNLA 1OJ4A 4ZPBA 4F3QA 4ELVA 1KOOA 1XIQA 3GQCA 3IFEA 1PBUA 4ED3A 1LL6A 3MWBA 1AB8A 4DSFA 3AJ2A 3T9ZA 4JI7F 3ISNC 1WUUA 3US5A 2N87A 2QJ3A 4QYZJ 4BS2A 2G1HA 5DQHA 2XLKA 1VRUA 1UVIA 4WIIA 1P1LA 4ITSA 1PYOB 1HNIB 2HS3A 1LWCA 1F5BA 1N36J 1AW0A 3IBFB 1VQNS 2QL9B 3E01A 3CH9A 1Q53A 4Q44A 3VAWA 4NA1A 5T7LB 2GMLA 3PCOB 3DCAA 1SUQA 1FCAA 2MQMA 4ES1A 1WG1A 4Z7CA 2PN0A 2FY1A 5KFWA 3SCIE 2ERRA 3OHAA 2AYGA 3N5BA 2RMLA 1B70B 4DV2J 1N1AA 1APSA 2POKA 3IK8A 3T41A 1SKRA 4ECRA 4FF3A 3I4HX 2K1RA 4WPAA 3QWUA 1ZETA 1FXLA 5KFPA 4JI1J 2GFFA 4KC5A 1X0FA 2RIJA 1HIYA 1W26A 4ODPA 3UI5A 5HLFA 4F4YA 5KT3A 1JNEA 5JXSA 3CC2S 4G6VB 3FJ2A 2JHEA 1DZ5A 2KVIA 3QO9B 3X3UA 4B3MJ 3FVYA 3A4TA 5HVGA 1ZBTA 1SV5A 1WSRA 1CJUB 4ID5A 2HBYB 3QIDA 2J8AA 5SUHA 4IOCQ 3DHWC 3RZAA 1OYDA 1F5CA 3RTVA 5IOLA 2A3CA 1W25A 3OSPA 2UXCF 3J81U 4IRDA 4HTIA 2XG8A 4HH1A 3LWLA 3AOCA 2AZ1A 5LJ5Y 2B5JB 2ZVIA 3HM9A 4IT4A 1FRMA 2EFQA 4DV4J 4K7QA 1OSCA 3K58A 2PI5A 3HVRA 3RAXA 1GTEA 2GV1A 3HJFA 3ARSA 1MU2A 3W3SA 3JSMB 2FD2A 1F6TA 1S0MA 1Y5LB 3K59A 2OPQA 3HT0A 1RK8A 2E5GA 1RA7A 2FLPA 4L75A 2ZBRA 3MPDA 1M5VC 3CMAS 5I3UB 2E1AA 8AT1B 1RZMA 4ZVGA 4U85A 1XN9A 1LK7A 2C2RA 4Q2MA 4CO2A 1NSGA 2HHPA 1WWHA 2Y1LB 5D0RA 3MPVA 3BKFA 5IWAJ 1BE4A 4ELTA 4DIPA 3ICLA 3MD1A 1S4FA 2V67A 2WVBA 4OX7A 4C97A 4R0XA 4FF4A 1WSVA 1R0CB 1A6LA 2OD4A 4X4OA 3SQGB 2PV2A 2LFVA 3I0SA 5A76A 4N76A 2LJ4A 4EMDA 4F04B 3C6TA 2YQ3A 4F4KA 5DM7Q 3KLHB 5GAEI 1V3SA 3CJ3A 3CD0A 1KBRA 2DG9A 1ZZNA 2UV8G 5DZ7A 3D5MA 3RR7A 2YX1A 4WFXA 3HSGA 4F02A 3CJ5A 2AEFA 4A8OA 1W9VA 3G6ES 1TUWA 2V9KA 4USKA 3L95X 3MMJA 1HKAA 1EYMA 3SDEA 2ZEJA 1ZH5A 2KT3A 2OGUA 1KD1T 1G1XA 3OTOJ 3TVYA 3GIIA 2K8GA 3VALA 2XY7A 1WTBA 4WYWA 4DR2F 1GTHA 1U26A 3CCTA 1N0UA 1WKJA 3B4MA 5KFXA 4DLEA 3MGJA 4IH7A 4I2PB 1U48A 4DV0F 3EDRB 3WD0A 4CLYA 4KKOA 4BWMA 1PBKA 3RFWA 3GR1A 1NPRA 2PSZA 1LL4A 2QT7A 4OIXA 1NMEB 3CULA 4PAAA 3L3CA 2A6MA 4BHQA 4M95A 4ZMMA 2IRYA 4NLWA 2KGJA 3ITHB 5ETNA 4Y34A 3EUNA 5D8HB 5KFAA 3GMGA 4U84A 2VQEF 1U1LA 4PZVA 4K5RA 1JJHA 1ZL1A 2F2DA 3AAWB 2JFDA 2ZBPA 3D68A 5AXMA 3DOLA 2IM3A 3OFEA 4F0MA 4Q0BB 1DY3A 4CIOA 3BSOA 5ETVA 3G9CA 5JVGQ 2LVWA 4I2QB 1FFRA 1R8AA 3FMBA 2KFYA 2QSWA 3GFHA 1ITXA 1NSQA 2QE5A 2VG7A 2R2RA 3KNGA 2YH1A 3OVBA 1FI4A 5HW8A 2N82B 2VQFJ 2BABA 1WTFA 4PABA 2V8PA 1IKYB 3B8HA 4I67A 3OLBA 1N5VA 2VG6B 3DC2A 4WKRA 1J5EF 4BBYA 1SC1B 1QE1B 4CYUA 4ICLB 5KFOA 1KQFB 4O3QA 1XTZA 3G6LA 3LGHA 4NASA 3JAMY 4LIRA 1HNIA 2BE2A 1RTHB 2XYPB 5HUAA 1JXVA 4DPWA 1FVSA 4C6AA 1IBLF 1LNQA 3CHFA 1A0OB 3D0GE 5L8RC 1N8RT 2PT0A 5T7LA 4MTPA 2OFNA 4RNNA 2M7SA 1VFJA 3MTJA 1SI9A 1KKHA 3H98A 3MM5B 4UT4A 3EJMA 1U1OA 3D1HA 2J6SA 1N5YB 1X4CA 5BR8F 3B54A 5HW6A 4WFAQ 5KFHA 2RILA 1XC9A 1X9SA 5K14A 3H5XA 3QZ7A 3DLKA 5EHHA 2JH3A 4QU6A 1N4LA 3KK3A 1HMVB 4DPTA 1KQKA 2CQGA 2ZQUA 1TL1A 2F23A 2UV8A 5B08A 2DPEA 2FY8A 4JV1A 3IRXB 5K8NA 2VHGA 3ZZ0A 1R8HA 3HSJA 3W2VA 4Y2MA 1FJGF 4K59A 1KRPA 4DZ6A 3RBDA 3JXVA 1AZSA 1C2PA 1WG5A 1R8CA 5A8KB 2UXDF 2YX7A 2IHR1 2H51B 4LF8F 1CQMA 1TFYA 3BPDA 4HVZA 1UPPA 5ETLA 4HI2A 1P5QA 1HFEL 3UDCA 2XMWA 4DN9A 1EETA 3THTA 1LWFB 3R3TA 2EFNA 1S1UB 4V1Ak 2MGZB 3ZTPA 4NCAA 3NGTA 3M6XA 1S10A 2IY5B 2PPPA 3BZQA 4L72B 3UDLA 1VQ4S 4NLVA 2EW9A 1NJIT 1TV6A 3T5HA 1U25A 1M0SA 3T6JA 3BBBA 2V34A 1HWIA 5DZ6A 3IWXA 1F3VA 5I3UA 2GQQA 3A12A 5SZTA 2DNMA 3WL1A 4LUBA 1HWLA 2NPIA 3CUNA 3BB5A 1ZA2B 2NXNA 2JC1A 4Q7AA 4ANCA 3ARUA 3CF5Q 1GX5A 4ZVHA 4DROA 2PMWA 4X65J 2RUCA 5RUBA 2HFUA 1OMSA 2OIHA 3DN9A 2C3MA 1BQMA 1Z1ZA 2BKNA 3KLHA 3KJNB 3ZZTA 4UW2A 4ZPCA 2ILZA 2P6SA 4ZVSB 4LBHA 2HVEA 3NRKA 4ANEA 4F7VA 3F73A 4R25A 2J0WA 1Q8IA 2W25A 1URNA 2HHVA 3I96A 2YBTA 2MY8A 4OYWA 3THVA 2MB0B 2X1AA 2YY3A 3HLUA 3RR8A 3UCGA 1BXNA 3DLJA 3FK4A 2V63A 4G1IA 3LP0B 4NLDA 1U8WA 1PJ7A 1CS4B 2AMCB 4OHVA 2ZJQQ 2B7BB 2ZUAA 1W2IA 3BO2A 1FKOB 1UVKA 4R0JA 4YMEA 3BSCA 1HBOA 2D3UA 3FNNA 3GV8B 2DSWA 1UVLA 1CC7A 1HL6A 5ADZA 4NLRA 5HK4A 1WACA 2DISA 2QYGA 2XPAA 4DUZF 1H73A 1ZOTA 3OTEA 1IM4A 1XMQF 1BL4A 3ENQA 3OTBA 2UXBJ 4LQ3A 4WE1B 4FF2A 2DNOA 1NAQA 4Y2IA 2FPHX 2H3EB 2HRTA 1YLXA 2I8EA 2LXFA 5KT2A 2IJRA 2HNDA 4CH0S 3G8SA 5ITHA 4JYSA 3JSRA 4OZ2A 1N6QB 4I7FA 4KBIA 2VH7A 4KHPJ 1TCOC 2W9BA 5HBMA 3RB0A 4B3RF 3VWSA 3ENVA 4HDGA 2AOSA 3O1LA 3EVMA 4XK8C 1SL1A 4G1QA 4DS4A 3PG9A 3GJQB 4DXLA 4A4JA 3PDNA 3OR1B 5ETRA 4I2QA 1EIYB 4QT2A 1GXTA 4ZKAA 2HFNA 2G1DA 1NH7A 4MH8A 3PACA 1W1TA 2ZOGA 5ETKA 1Q81T 4ML4A 3MPYA 1VF8A 3QGGA 1RT1B 4B9LA 3IG1B 4JI5J 1QE1A 4ICLA 4LT6A 3TUIC 2D3OR 1TVRA 5DS7A 3EZOA 4RU2A 4WP9A 1RTHA 1HHTP 1JWWA 4RX6A 1E6ZA 2MYFA 3AA8A 4USTA 2JNJA 1S1XB 2AEJA 2V4JB 2Q6CA 2VCDA 1JLCA 2LXUA 2XO7A 3W5YA 3VAHA 4GO7X 2R4FA 5A2QU 5BYQA 2KRBA 3DRXA 2OPSA 3AD7C 4DFJA 1FKAF 2D9OA 5K8OA 5MAOA 1FA0A 4DDFA 4WXWA 4HT7A 3IAS9 4AY1A 1IKWB 3R6LB 3MMAA 2V2VA 3MCSA 3SCLE 3W60A 5HBFA 3NMRA 4JYAJ 5HP1A 1YKWA 3KNAA 4F0HA 2VN1A 3VGVA 1TL4A 3QMQA 6FDRA 2QIFA 4O0NA 2C2EA 3FSXA 2BV3A 4RW4A 2E66A 4X4SA 1Y0HA 1Y5NB 3OVSA 1JK9B 4I64A 2RUDA 1RCOB 3CMQA 4USIA 1H0IA 1B99A 2C2OB 5GAGU 2HHXA 3DLGA 2DGWA 4TW7A 3A3PB 3PRVA 3VVUA 2X1FA 3VV2B 3KLVA 3FZBA 5L1LA 4PXCA 2EFGA 3BXWA 5LMNF 1HWUA 1R8BA 4IG0A 1TK8A 2DXEA 2YXLA 4CO1A 1VR6A 1UWAA 2QZ8A 4FAPA 1U1MA 1S9GA 1VBYA 3N5FA 2DNNA 4K0KJ 3LP2A 3O5QA 4B17A 3M1VA 2ZDOA 3R8YA 3M9NB 1KONA 2HIQA 4C8OA 4NLUA 1VQ6S 1LFPA 3R5CA 1X4BA 2N4CA 3CCVS 3H2LA 1D9AA 2DNLA 3R1HA 1JMTA 2FYXA 4K4XA 5I42B 3GR0A 2RS8A 1S1TB 2DRDA 1YJ9S 2MGZA 3CJRA 1LWXA 3TX8A 1RT2B 5DRKA 3T1HJ 3W8PA 2AX0A 2EULA 3IBCB 3WQWA 3D3BJ 2IYGA 4NZCA 1U09A 2RD5C 4Z37A 4LF1A 2ROPA 3EPGA 1R8PA 3NAHA 4KAIA 3HK2A 3OR2A 1WD6A 1F60B 2IUZA 4ZPWR 2MSSA 1E6YB 4ILRA 2VKZG 4KH0B 2HVZA 1X5TA 3E51A 2VZ9A 1WC1A 1ZM2A 4ZLPA 4RU9A 4C98A 4PUOB 2OTLS 4F4XA 4MNMA 2YKNB 3NGKA 2NXUA 4KGMA 1QTMA 3M8PB 2NREA 3PX0A 2QF8A 4ED8A 2RUGA 5JJBA 2Y1IA 2IJNA 2VPWB 1VRTB 4YB1P 4YR2A 4YOEA 4QPXA 4DV6F 3KAGA 4DX8H 4FXDA 3CCJS 2K7KA 3LAKA 1UMJA 5EGYA 1V6HA 3R6GB 1PBAA 4YY3F 1MROB 4ILMA 2JL9A 4OX6A 1PJ5A 2CPYA 2M9KA 3AQPA 4RW8B 4RNMA 1B64A 4ZVUB 1HNVA 1LWEB 2G2ZA 4ZJLA 3TNVA 3TI0A 4KHMA 4ED0A 3N4WA 3IGNA 2HURA 3NWGA 4RW6B 4HBEA 4ZS6A 3QGHA 4PKDB 2RRBA 4JFMA 2LEPA 3DRRB 3NNAA 4ED5A 2J7UA 4YEAA 1FKOA 1GXUA 1X6NA 2MLYA 3RM4A 3WIUA 2YQ1A 1RBAA 4MJKA 4J37A 4LSLA 2JX2A 4TQRA 3R7BB 1KLNA 4DI6A 4OJ1A 2OPPA 3VVTA 3DRPA 1XR5A 5DF0A 4TQSA 3S6EA 5G0RA 5DLGA 4MIBA 2WB4A 3IR6B 2DNZA 1GRJA 3R7SB 5F8LA 4IDKA 1PIEA 2HGLA 4ALZA 3KKFA 4NRUA 2BX6A 4NA2A 2AGQA 3RYLA 3CC4S 2HYIB 1S59A 1FRLA 4IFVB 1VQYA 1FDBA 3WC0A 2LPVA 2BYCA 3P5BP 4DSIA 4DCJB 4ZVFA 1U2RA 1XERA 2HWHA 2FVPA 2GAGC 1IUJA 2KXNB 2HFSA 3G6MA 1DTTB 3MM8A 3NS7B 1UP1A 4KGKA 4NXNF 2W2NP 1PCAA 1YZ6A 3RGIA 2HHTA 2QO3A 3O5EA 1SH3A 3OR1A 4FN2A 4ECWA 1RTDA 3K8WA 1J2VA 1XHGA 3S8SA 3KAHA 1E6VB 4AE5A 1HXVA 2C42A 1ZYQA 1H6KX 2DEJA 4WP3A 3H4DA 1S76D 2MKSA 3CCLS 2WK4A 1K44A 5KG0A 2XYGB 2YNGA 3MAHA 1RT1A 2C2ZB 3NLCA 1S97A 1G6BA 3ZXWA 4DRKA 1FKSA 2QA4G 2GX8A 4FDFA 3TZWA 5HT1A 2W2PP 1VQKS 1FF2A 3R5AA 1U49A 1HHQA 1PAUB 1QUPA 5F3ZA 3MM6B 1HQEA 2ITKA 1FFSB 3CDUA 3AQOA 1BC6A 4P7VA 1VLOA 4AYBD 3QGIA 2Z56B 3OTCA 4M5JA 3T6BA 2AZ3A 2XI3A 4AQYF 5D4PA 1RKIA 4QOTA 5IT9U 2EBGA 4P74A 1NPKA 4QIVA 4XAKA 4U6PA 1MN7A 2QLXA 1IKWA 4K4YA 2IC3A 5E3RA 3ZZRA 1FT8A 2FJEB 1OGBA 1NDCA 1Y0OA 1ZAWA 4CT9A 3DLEB 2UU9J 2NYIA 1IR2A 1DLOA 4PQAA 4URGA 4M8LA 2E5LJ 2WZ1A 3BYPA 1HA1A 2RQSA 1N32J 4LFAF 2OLHA 4LF5J 3A8JA 3R97A 4LFCF 2A10A 4J9NA 2DIVA 3N79A 4P8WA 1QPLA 1N54B 2F4VJ 4FBUA 2DSUA 4KHRA 1S4EA 2B4PA 4IH6A 4DWSC 1NWSA 2XZTB 4U8YA 1FVQA 3ILIA 4DRQA 3O5JA 1T3OA 2QLJB 3QJJA 4JI6J 2ZQVA 4C8MA 4TKTA 5DDPC 5KFVA 2ZD1A 2XY5A 4KRWA 3WC2A 2V8GA 5AXKA 4ZJQA 3Q8SB 4C3KA 2GZOA 4RWXA 3FEZA 4PYAA 1I94J 2AKWB 3SSSA 3M32A 4X4TA 4Y2KA 3OXGA 1TQLA 1RT2A 3V6JA 1JNTA 5AE3A 1FKTA 4A8MP 2E1PA 2GJ2A 3VZHA 3ZZOA 3ONQA 3U27A 2F8MA 2JLEA 4JI3J 2DKOB 3CIZA 3JYMA 1S1WB 1X4GA 2XCPA 3UW1A 2XWXA 1PAEX 3IR5B 3ZTSA 3EY6A 4X66J 5IM0B 5CZVA 1FKFA 3LAMA 3CJKA 1Y11A 2N7YA 1ULRA 1D7IA 4EUVA 4B3TJ 4FNHA 3HPOA 2XHCA 1T9VA 2W4CA 3MCNA 3C19A 4LAXA 2CJQA 4WBFA 2G0JA 3L7PA 2MDAA 3UN3A 4RKUC 3KHLA 3J81Y 4OV6A 2JLFA 3LPYA 5THWA 1IBCB 5KT6A 3TVKA 4CNZA 2DO0A 2AGPA 1JNZB 2D69A 3SV4A 1K0VA 2QMXA 4JV5F 3NCPA 4MAKA 5DLFA 4KFBB 3CEDA 3FY1A 2VODA 3FBFA 3K2YA 3GIJA 1RGVA 4ZHRB 2JZVA 1F3FA 1OY9A 4DL7A 2CPEA 1VIOA 3QNWB 1QVGR 4OZ5A 4ECUA 3C15B 3K5OA 1T8EA 2J0QD 1JVWA 3V81B 4E0DA 3Q24A 1D7JA 2W01A 4DR5J 3EPIA 4XDDA 4EZ6A 4RW6A 3KLFA 5L9NA 3DU5A 5D4LA 3QIPA 1NZ8A 5ETQA 3HZGA 3MD3A 5CYQA 3NL0A 2DH8A 2CPJA 1YJ7A 4ZIVA 3DGPA 3V4MA 1DTQA 2YNIA 2QGFB 2ZH6A 1X0PA 4LMZA 4W5UA 2Q43A 2DT2A 1XEZA 4NYOA 1RJJA 2DIUA 3D0HE 4EFAC 2KZMA 3EGNA 5KFMA 3UI4A 3NS6A 1NNDA 3DU6A 3R5JB 3M2VB 3HSDA 2HHHJ 3O5OA 2WBRA 2WK2A 4J9QA 4IOAQ 4WIWA 3Q2TC 5DQGA 2DEIA 2R7TA 4C11B 1M5HA 3TCZA 3H90A 3VQSA 2OI2A 4E8UA 2G0IA 1HJVA 4P2SA 2NCKL 1AUDA 3LOUA 4BC7A 1RI7A 4NI2B 2ABYA 1FJ7A 2GIRA 2XEXA 4S0MA 4WZQA 4DR1F 1K9TA 2B9YA 2OMLA 1I6JA 5J2PB 1L1PA 3I0RA 2JEJA 2OPRB 3BGUA 1F2GA 3UR3C 1U0HB 1T9WA 4YR0A 4J9LA 2B43A 2V2QA 2E7VA 2OFGX 3G87A 3C2PA 1F9EB 2VKRA 1RT5B 4MKVA 3PYGA 4ZPTR 2MXYA 1NK9A 5F41A 1NJWA 2XHWA 3UQIA 3ELHA 3H2UB 1FKPA 2ZZNA 2FHKA 2KI2A 4XIUA 2CWKA 1YWXA 3TP2A 4NLYA 2X3GA 3TW0A 3PRBA 3TX0A 2B9XA 4GRSA 4ILLA 5HI7A 2AU0A 2W4PA 4LAWA 3H42A 4WK9A 3QT8A 5IT4A 1LK5A 4ZP7A 3B82A 4PQUB 1YTYA 4DSLA 1SJ3P 1D9FA 1YK9A 3IS9B 5IC6B 2M70A 2AJ1A 1GMWD 1UZHA 2IPOB 2PA3A 2B56A 4TU7A 2M8DB 1NK6A 3CD7A 4IPXA 2ZNZA 4QJVA 3NBPB 4MMOA 1WF2A 2M3DA 5J2NB 1S6QA 3ZNJ1 1N36F 3ETMA 1W7WA 4EGLA 1H7WA 1Q6UA 3M6VA 4JBCA 2KT2A 4TVAB 1SR0A 4NEYA 4OJHA 2E5JA 3D54A 4DX5A 4TY8B 3OPKA 1S79A 2WM0A 1IJFB 4C0BA 1S0VA 4A8YA 3CCMS 2WONB 1BGXT 3WQVA 3KLGB 1ACMB 1S1VB 1N33F 1DARA 4ZLNA 2DNRA 2F9JA 4A8XA 2Y0SD 4TY9A 5GADU 1NKBA 1E15A 1H38A 2BACA 4WCEQ 4RW7A 4DWSB 2OELA 4IO9Q 4KO0A 3QOKA 2KFNA 1IKXB 2E7XA 3OV7A 5J2QB 4PWDA 3DOKA 3VGTA 2LYVA 5IM0A 2IBOA 1LFWA 4O23A 4IR9A 1RT6B 3W5XA 4QWDA 3CO0P 4Y28C 3ARRA 4L73A 3CVKA 2B31A 4EZ9A 3O6QA 2AT1B 1PKUA 5KAKA 4CT8A 2KYXA 1O6IA 4JI8F 2CPFA 5LT5A 4ZVOB 1VQ8S 3MEKA 1EIBA 3W1YC 3UDEA 2HRUA 1XNRF 1GH8A 5HKGA 4I68A 1IVZA 3MMBB 4DQRA 3F56A 1FD9A 4DL0C 3D6TB 3CCUS 1YDLA 2PD1A 2ACYA 1U8SA 3FFIB 4URSA 1CQNA 1S72S 2EFPA 4C8NA 5K20B 4P2FA 5AE2A 4HKQA 2R3VA 4PPZA 1F1BB 4ED6A 3FAPA 2Q79A 3KZ7A 3T5JA 1N5SA 3J7YI 3PR5B 4I6WA 3KXDA 3D7SB 3TJAA 1PYTA 2V8DA 3AODA 5L38A 4X2BA 2XP3A 1K9MT 3C15A 3V81A 5IWAF 2XC9A 2W2QP 2N3OA 1EQMA 4C2MA 2G0CA 5HJXA 2EXUA 5J1EA 2XI2A 1YRTA 2CNKB 2QLWA 2CPIA 3M8RA 4JI4F 1HQUA 4G2PA 2WVCA 2D9PA 2FVQA 4QR0A 2ZBIA 4JI7J 1YZ7A 3PX6A 1JNDA 1QUVA 4N56A 4X4NA 3RBZA 4P73A 1FD2A 2LQBA 2FDNA 2GO9A 3MAAA 1NXIA 3ALGA 2NYHA 1RA6A 3QT7A 4DMZA 2ZM6F 7FD1A 5KFBA 3ZO7A 2LGOA 3D3CJ 1R43A 2MLZA 2BM1A 1FESA 2C3UA 2IBKA 1D0EA 1TK0A 1AA1B 3I5BA 2GVZB 1UW9A 4CO3A 5E41A 2Y3YA 5F8JA 4C11A 2AQ4A 4HL9A 4LBPA 5HMYA 1QY7A 2DXFA 1AFIA 4QYZK 2AWGA 1S9EA 3OTOF 3JQJA 4OHXA 2R7OA 2AV5A 1QVFR 2DVIA 1LV5A 4Z2LA 1F8AB 5E3AA 1H3DA 4ZLLA 4DV1F 1WHXA 1DAXA 2BBEA 2QMWA 2XS5A 4DR3F 2OPRA 2R8KA 3PTWA 2Z30B 1RCXB 2VBYA 2OTJS 2U2FA 2JDJA 2J7WA 3UVJB 2FZGB 4B3OB 1FTRA 2RQMA 3LGNA 2AYBA 2YBVA 2UVWA 1ZBVA 4OI0A 2FHJA 3BDPA 2M0GB 3N6NA 4OI6A 2XMAA 2BOPA 3OVAA 1GEHA 2XMKA 4I0WA 4WXOA 2UXCJ 3MM9B 2XGQA 2I1RA 1SKSA 3EMTA 4DFMA 1OYEA 1FXRA 2CPHA 1OPIA 3NWRA 4ETZA 2QYCA 2ZH2A 3MMCA 3U02A 2VC0A 1R0AB 4DT4A 1KT0A 2M4MA 3L09A 3LWMA 4S3KA 2PDAA 1SJFA 4AD6A 3GU0A 2C2KB 4OHWA 1YRXA 3ET6B 3MOZA 2B5UB 2EKYA 4UTGA 4RUBA 1XMOF 2DG3A 1RKJA 6FD1A 5E0OA 5L9XA 2IM2A 2CZVC 1CBKA 2DJWA 3J7AN 1L3UA 4PG8A 2UZAA 2N7CA 3SCJE 2J6TA 3NS5A 3TQ1A 3QJLA 1JLQA 1YHQS 2JRSA 3W2WB 2BDPA 3PA7A 1EP4B 3V6DA 4MTVA 5CZXA 3DLLQ 1ZZFA 3UQAA 2FZKB 2VIHA 4ZIWA 5DG7A 3H2VE 3PHEA 3NBPA 3UWTA 4KR0B 3R9LA 4FYYB 1NH8A 4OV1A 3TOQA 3FQLA 5EDWA 4KPCA 3EE3A 1CJKA 1S48A 5KG6A 4UOGA 4OZNA 2JOQA 4R5PB 3ARQA 2H4YB 3M2RB 2WOMA 4UOCA 2VV5A 4H4KC 5HQ8A 3KLGA 3ILJA 2HHSA 1A7GE 5A2QY 3H5UA 1TUGB 3ARVA 3Q22A 1NBEB 3UI6A 2XBPA 1OY8A 3G6VA 2VICA 1X8DA 4OL8A 3NI6A 4EYIB 4MKAA 1F40A 2F7VA 4MKBA 2MKIA 1WAWA 2IF4A 1ROFA 4DWSA 5E3CA 3K0JA 2YNFB 2C3OA 4IG3B 2OEMA 4QBUA 4QWCA 5A8RB 2ESCA 4DR4F 4H4MA 4WU3A 2AYMA 3V5RA 3VCDA 5J2QA 3MECB 4ER8A 5IFMA 5IQ6A 4ZPAA 2XULA 2E1RA 1YJUA 4RUHA 2ZE2A 2HMIB 1WC3A 2I0XA 1JNSA 3PZPA 1E6PA 1JIHA 2CFXA 3JTOA 1FO1A 4QIBA 5E5NA 5F8HA 4DR2J 1SH2A 3KJQB 3AROA 5LMUF 3J7ZT 1NEEA 4TLQA 5BXIA 3POTB 4FS2A 2Y8WA 3JB9k 2KE0A 4DV0J 1H72C 2DCUB 2C1EB 3FMWA 4ID8A 4O4GB 2LEBA 4M5GA 2K2PA 3C14B 3MUMP 3DFEA 2VDHA 4NWBA 1MG7A 1WELA 2A3JA 2RVJA 1YW5A 3SQOP 2DRAA 2FGCA 3IRWP 4ZVEA 2FVSA 2G4BA 1U1RA 3Q0AA 4U86A 3WIJA 3U7JA 1FD8A 2VQEJ 2H54B 4DWIA 4IQ2A 2HFVA 3PKMA 1TZ0A 4LFBJ 1FFWB 3NXZA 4DWSD 2W8KA 1FRKA 4NRTA 1GQEA 2C2NA 4FP9A 3RW7A 2VG5B 1LJYA 1W9PA 4NLPA 3RGCA 1UFLA 4DSJA 1SB6A 2X1BA 2ZHAA 3HVTB 1EJ7L 4L74A 2W9CB 3UNGC 1HBMB 3BSAA 5BYRA 3OQ2A 2DNQA 3MEDB 2F9DA 1JJCB 4V19X 3PW0A 2K7JA 4HR2A 3GWCA 1HKKA 1NSPA 2CKWA 1C1CA 4ODMA 3TZYA 3GJTB 2ALZA 2DSZA 2DNYA 1FEEA 2MQPA 1JLBB 1J5EJ 3LH2S 3KG0A 2LA4A 2AJ4A 1ZK6A 3EZUA 5C7PA 2VPYB 3N9UC 5D0EA 5E33A 3KLEB 2MPUA 4B9NA 4GVLA 2DYAA 2IMOA 3MR6A 4ED7A 2DHAA 2RHQB 2VPXB 3D1QA 1IBLJ 4RL1A 3A3NB 1RWMB 3BDEA 3DLBA 1NHKL 3ZZZA 4WKHA 1IQTA 2B8QA 1SL0A 4DV5F 2L9WA 4WJBA 2H9ZA 5C42B 4FPRA 5BR8J 3RAMA 2R9LA 2V4RA 1N48A 1GPFA 4USHA 3KHHA 1H2UX 3A1YG 1R0BG 4DN0A 2E44A 4MNKA 2YVSA 4OYBA 2CQIA 1F2HA 3NGRA 3WDOA 2JVRA 2CVIA 1R89A 2LP4A 5D3GB 2AIRB 3H7HB 1IKVA 4HEA9 2SXLA 3HULA 3C6UB 4OZ1A 1UJ4A 2M1IA 3WD4A 4G3IA 3DRSB 4YFUA 2RKIB 3CCSS 3CB4A 2V9WA 3EZ5A 1YI2S 3MUTP 2O01C 1FKKA 3BS9A 4ODOA 1VQOS 2KFZA 1J4RA 2FHMA 3HCXA 3W8GA 7FDRA 1TKXB 2PPOA 2AW0A 3JXOA 1FK9B 4J9PA 2VFRA 2R7UA 2WTFA 3IWLA 2ZWOA 2UXDJ 3ILOA 4KHPF 1RHMB 1IX5A 1HQ2A 4RPFA 2VBWA 2ZC4A 4EK2A 3EICA 1JQGA 4AXJA 1RT4B 3GYNA 1YG0A 1EAYC 1XNQF 5DDRC 2CAJA 4JUZA 2DGQA 2ZOFA 2OMOA 2VU5A 3M8WA 4J9MA 1T9TA 3DKDA 3HDSA 3CDWA 1ZA1B 2YNHB 1T9YA 2Y1RI 3J80U 2O1PA 4DU8A 1CVJA 2CA9A 5GAEU 4MYTA 4TW8A 2FLOA 1FRJA 2JSXA 2QMUB 5D0GA 4PYDA 2J9CA 4RUCA 2RSEA 4M5MA 1Q8BA 4GKKF 1FKBA 2IM0A 1X4FA 5ETMA 2R8IA 5D15A 2RJZA 3I31A 2DT9A 3LPEA 2UZ5A 2XP5A 1U2FA 4WFYA 2V2KA 4NCBA 4JFIA 3GFXA 1Y5IB 1C9HA 2CJBA 3B8SA 4PCQA 3PIPQ 5JUMA 1KHVA 1FJEB 3D67A 4ECYA 4ED4A 3PM9A 4Q8EA 1F9HA 3HX9A 4KB7A 1UL3A 5GAHI 4DG1B 1HBNA 1RAGB 2MHEA 1RT7B 3TDBA 2PA8D 5EWGA 2EBEA 3W5ZA 2RUQA 4DPYA 4WYLA 3PXGa 2E9TA 2CQDA 1RACB 1T9UA 2WRMA 4NOHA 3VZIA 1NWRA 5IT9Y 3O3LA 4IRCA 1R27B 4CO0A 1V5VA 2A3AA 1HKIA 4LF6J 2F63A 5D6GA 2RAQA 2YNFA 4DL3A 1VC6A 2KXHA 4B08A 1B7FA 2J0XA 2DHXA 4JB8B 4KV8B 3BBCA 1EB0A 3SZ2A 2ZVSA 3MECA 3RUBL 3OJSA 2Q1LA 3MUVP 4MFBA 1N88A 9RUBA 1KSPA 5CCLA 2IVMA 1HW8A 4MT1A 2BJ8A 3CGIA 1SKUB 2Y9HA 1AT1B 4MPKA 4CTAB 1PJ6A 5IT0A 4R5EA 2XGPA 4FVCA 1Q7YT 3EVWA 1F0XA 1TL3B 4C0OC 4K0KF 2H4WB 4LRDA 4DUZJ 2A2DA 3RG6A 4M5HA 1HLWA 4QWAA 5BXJA 2ZWPA 2LEAA 3RRKA 1BMQB 1QTNB 2RE1A 3JQMA 3QBCA 2BANA 1UWBB 3QT5A 6AT1B 4QWEA 4RBUA 1VDHA 4A8QA 2RF2A 1ZBKA 3CJQA 5H9FJ 4I4BA 1B0TA 2QX0A 3BGOP 1FWKA 3W9HA 4B3RJ 1FKIA 1J27A 5LM7E 3GG1A 1KLMB 3HVAA 3MM7B 2ZH7A 4DSKA 4F4WA 3M8QB 4A8FA 1I5OB 1B4SA 3CD5A 1SQEA 2Z0GA 2HSEB 3T9NA 1HBMA 2R7QA 3MEDA 2AYEA 2FJVA 2KR7A 2GGPA 3QLHA 1GX6A 1RWOB 2F4EA 4DX7A 2CG8A 4P6QA 5KTQA 1CSJA 2CPDA 1JLBA 4K4ZA 4KGXB 3LANA 4O3PA 1RLDA 3CJ4A 4FZVA 1LG1A 1QSLA 4OX9J 1HNWJ 3KLEA 4RUAA 3P96A 3KDNA 3QQCD 3DHXA 4B9TA 3SMZA 3AXMA 3TQEA 5HVFA 4JOUA 3LP1B 1FDAA 2H1YA 1TAQA 5JH8A 3N6LA 4DR7F 2RSQA 4ZCKA 7AT1B 3OBIA 3M2UA 3PO4A 4W90B 4X4PA 3UD3P 5C42A 5C25B 3ARZA 2DT1A 2A6OA 2B51A 2PN6A 3KJFB 5KOWA 5B7WA 1ZBWA 5DIVA 3P49B 3CJ0A 3JYTB 2LQJA 5DJBA 2NLWA 2BQRA 2HGNA 1Q79A 2EWHA 1S0NA 1S12A 1JLEB 3VHQA 3MDFA 3P8BB 4Q5VA 4DQPA 3LO3A 5D3GA 4M5DA 3OW2R 3HP6A 1L3KA 5KG2A 4J90A 2OH2A 2DHGA 2DG4A 1R3NA 3C6UA 2P2CB 3O8WA 1N5TA 3Q89A 5C2CA 1SCJB 2RKIA 1NJYA 3DI6A 4C4WA 2XP8A 1SC3B 4O0IA 1HR0J 2CVEA 1NDKA 1C1BB 2O92A 2X7IA 4TX0A 5LMNJ 1ZM9A 4ODLA 1FK9A 1BQNB 2FLLA 3OXLA 3HFZB 4MK9A 4NCGB 3T1YJ 2QG9B 2DCLA 4FVMA 2XO6A 3AB2B 3JTNA 2Y1JA 4KH1B 3MR3A 2G41A 2CQ3A 2EFVA 3CHCA 3HT3A 3V4IB 1ZS6A 3OHBA 4RW9A 1K73T 3N6MA 4CM0A 3OUYA 4PXEA 1GMVA 4QIGA 3LUYA 4DV3F 1RU1A 2YNHA 2DGXA 5C2GA 4ZJOA 3AJDA 2A0FB 4Y3CA 3KK1A 2ZUGA 2J9DE 1FRIA 5U47A 4JP8A 1T3NA 3OD2A 5DDOC 2LLZA 2PV3A 2M2AA 2LQ9A 2KO7A 3MEEB 1NUEA 1OQ6A 1UA0A 5B8IC 4UZBA 4XO0A 4NYZA 2MZJA 3O5LA 1TKZA 2XSJA 4B02A 4DF4A 1MN9A 1JX4A 1LW2B 2OJ3A 4CRJA 1KQGB 2BKOA 3GE9A 3UFCX 4HACA 2ACMA 3FCWA 3D66A 1HW9A 1NPPA 4WFZA 1H2VZ 2DH9A 3QAEA 1FX2A 3G82B 2O67A 4YDDB 3I9V9 4K4UA 2KHDA 1UZDA 2V8HA 4DV6J 1TP7A 3UF8A 3B6BA 4GVBB 4QU7A 4ZVTB 4WTYA 3C16A 1RT7A 3KK2A 5I98A 4FYWB 4LSNA 1NU4A 3G8TA 2PMHA 4NYPA 1JKHB 5F0UA 4YY3J 3KJVB 1CULB 4CLWA 2HNZB 1RADB 2BRLA 1M5OC 1TMMA 4NLSA 2VD3A 1HNZF 5B0CA 2GJIA 1UJ5A 1WOOA 1TL7B 2E9ZA 1C4CA 4Q8FA 4KV8A 4NEZA 2FIUA 4X84A 1VIXA 5MLCV 4H4KA 3T19A 4Z2XA 3KTQA 1HKJA 2CQHA 3C8YA 1FKGA 3UN2A 2KO1A 3BR8A 4WWSA 1IR0A 4DL5A 4NNRA 2XMTA 1SBRA 1RTZA 4OJGA 2AJ2A 4K5SA 1NMWA 2EKNA 1TL3A 3EGZA 1WI6A 3FBCA 4QWBA 4CI0B 3O5KA 3GPKA 2DGUA 1WI8A 3NG8A 3B9DA 3OL9A 2F4FA 3FEYB 2L08A 4URIA 2VFVA 1I94F 3SFGA 4W9OA 3KMSA 1TELA 2NUUG 5CH7B 4L3NA 2EPIA 3NRBA 4K8RA 1CC8A 3CPWR 2YWKA 2VB6A 2BEFA 1U02A 2V8VA 4OHYA 3RBXA 1WEZA 3I5AA 2XWYA 4PWWA 4C3LA 4OQJA 1C0UB 1PC4A 4X66F 1EQ0A 3RJMB 3QO9A 5FDLB 4P8UA 2RT3A 1CJUA 3AFGA 2NR0A 3EIPA 3MOJB 4TYOA 4B3TF 2JZ5A 3ALFA 1X5PA 2UUAJ 1Z2ZA 2OSRA 1Y3KA 1AUSL 3A8KA 2DRBA 3G6XA 1HNXF 2VFSA 2J5AA 5GPRA 2UUTA 4J9SA 2MZSA 3CGMA 2ETNA 1KQSR 2B5JA 3HI9A 4P10A 3EM1A 1JLAB 1K1QA 2ZHBA 3PYFA 4J7CA 1VCTA 2X51A 2CJ9A 2ZKUA 3HD2A 1TUVA 2GVDB 1YIJS 4DCOB 2R8GA 2I9SA 2LQ8A 1BLUA 3JSMA 1TKTB 3M7VA 4O3NA 1JLGB 2XY6A 3HO1A 2OUGA 1AFJA 2L41A 2Z58B 4P8XA 2IAJB 1EQ3A 1P9QC 2MHNA 3UO0A 4EI2A 2E5IA 2YKPA 4AQYJ 3WL0A 3M6UA 4X62F 1GFWB 1D8YA 3RRGA 2MJNA 1LW0B 3FSYA 1RBOB 4LR9A 2HQ3A 1RAOA 1X9MA 1OIAA 1S99A 4RNFA 1SC6A 3D0IE 4F8RA 3CE8A 3JYTA 2IJFA 1H74A 5LSRA 3LQVA 4R0EA 1D8ZA 2MJUA 1YITS 3NNHA 4ECVA 1VRUB 3SQGA 4ZVQB 1KFWA 1NK5A 3IWNC 2BUNA 2NZ4A 4LFCJ 2R8JA 1LWCB 2AJ0A 3E3XA 4DFPA 3E01B 2V0NA 3I82A 4BWJA 2HHHF 4L76A 4MGVA 4N47A 1FERA 2RHSB 3VTIA 4OYPA 2GQ2A 3LF0A 3CZ8A 4ZPVR 5CQGA 3HHDA 2AP6A 5DO2A 1MWQA 2VFUA 3N0VA 4UQGA 1R7IA 2F1FA 1L5UA 4RO0A 4YN3B 1WKLA 8RUCA 5HMWA 4QPTA 3TARA 4KPYA 4ZLJA 3X1LB 4LF4J 4H4OB 1RTJB 3R5GA 3THPA 2K1RB 3OSNA 1DHMA 1WF1A 4DUYF 1QD1A 4I56A 3V4IA 1E6RA 1FFGB 1X4EA 5HLFB 2AF6A 3FUYA 2MF9A 1C0TB 5HWBA 2ZZTA 1GOIA 1SV5B 2QA1A 4GKJF 3PJWA 4NL5A 4ID5B 4OI3A 1AROP 3IXQA 4I2PA 5ETSA 4HLBA 2W2MP 1FKLA 4OZ0A 1VC5A 2QV6A 5HMZA 3MCMA 3NGSA 3GYGA 1N0VC 5DQIA 3MEEA 4DF8A 3O5PA 1VQSA 3PO5A 3ITHA 2PEBA 1E44A 2ZH8A 1RUSA 2A18A 4FYXB 1QJHA 2CQ2A 2DK2A 2Q66A 2KXFA 3CJSA 1SQFA 1WOSA 3F44A 2CQ4A 3IM9A 4OYXA 1U1KA 2ZJRQ 3O5GA 1UW4A 4URQU 4Q0BA 1MU2B 3GPAA 2RURA 1FXDA 3H4BA 2OPQB 3CCZA 2WSCC 3BQ1A 2F21A 2KH9A 4JV5J 3BSNA 1PSDA 1RXOB 4QYRA 2U1AA 1VQ5S 1CULA 2H65B 1GMUA 3WKZA 4LJMA 2D9FA 4Z2IA 4CH7A 4KJIA 2HNZA 3CDAA 4J9VA 3GSIA 3NCQA 1IKYA 4F4ZA 2KJVA 1DQ9A 2YKMB 5KG5A 2VG6A 4E98A 1T03B 4J9KA 2ZBQA 5CAAA 2BKPA 3K8VA 5CHCB 4ECQA 5ETPA 4ZP9A 4KGZB 1MMLA 1Y7PA 5KFKA 1T11A 5I3PA 3GP9A 4NLGA 1FWLA 5E7OB 1UR9A 3A8IA 4A8KA 3C6TB 4U95A 1QSSA 3PFOA 2GAHC 2V94A 1GK8A 1IQZA 3D6HB 4FF1A 2J7KA 2HG4A 4LF7J 3BGLA 3K5PA 1IBMF 3ZTOA 3MM5A 3CXCR 1QAXA 3PEJA 1SVDA 4DR6F 4KT0C 2QN6B 1N5YA 2ROEA 4X4RA 1NJZA 2HHUA 1VISA 1XQIA 1JB0C 2PE8A 4DZ2A 3SDEB 3DOMB 1HMVA 2DNGA 2RQKA 1WHVA 1KVJA 3IRXA 2ZH3A 1UVNA 3H9RB 3HZEA 1L3SA 4IKAA 3K17A 1UEUA 2L2SA 4DR1J 2GQCA 5FDLA 1ZAVA 2R2UA 3D28A 3R1LA 2KL8A 4F3MA 2XCAA 5GVQA 3ZTQA 3TAPA 2E5HA 2FJDB 5C5JA 4ZA1A 5F0WA 2ZBCA 3E2EA 2HW3A 3EGVA 2BOAA 5A8KA 3UI3A 3QSIA 3QYYA 1FNOA 5HANA 4KKOB 3VQTA 3VR1A 4W4MA 4DPOA 2D1CA 4NLOA 3V6HA 3D2WA 3CMES 1UFWA 2E1CA 4FPIA 1JXEA 2O3DA 3B9AA 4UZCA 1JLAA 1LWFA 1SYTA 4QIWD 1LXJA 1NDPA 3MAQA 5LXYA 1UTAA 3BYRA 1S1UA 3UNYA 4NMLA 4HTJA 2LXIA 2GVDA 2DT0A 3KACA 1FRXA 5KOXA 1FHTA 3G6YA 2Q3PA 1UFKA 2HVDA 4DLGA 1BHNA 4W92B 1LKZA 1FKRA 1M90T 1M1HA 1QAJA 2GJFA 3NTPA 2J9DA 2IAJA 3AS2A 3MCOA 2O9OA 4YHHF 2FVRA 3WD2A 4B3SF 4Y6IA 1WEYA 1VQMS 4NA3A 2WVEA 5H9EK 3N28A 1Q6IA 4C0HA 1LW0A 1HWJA 1UEVA 3M4XA 4P2XA 1AYEA 1OO0B 4TN2A 5LSOA 1HBUB 2PEHA 2NXJA 5T41A 4JI2F 4WFNQ 3OJUA 4IFYB 3FZ2A 1KFSA 4CYUB 1UJ6A 5FLXU 5CCMA 2E29A 3DXBA 1RWPB 4OYMA 3HSZA 1NWUA 4OHZA 2KYZA 3PFEA 3WD1A 3UR0A 3PR4A 2COLA 5KFZA 2BE2B 3VAFA 4BDPA 2GCFA 5DETA 5KFYA 4J4NA 4WTOB 4PR6A 1TTHB 3WZ0A 3IM8A 2HWTA 2H48B 4FKXA 3GIMA 2JC0A 5GMKa 2ZHOA 1WORA 2CADA 1ICEB 4X4UA 5KFJA 1W9UA 3DM2B 1NKEA 2HLUA 4LF9F 3ZNUA 5D77A 4D3GA 5K14B 2GA7A 3LP0A 1N33J 3DLKB 4C48A 4OJ3A 4H4OA 1RTJA 1WOPA 1CTNA 4LR7A 3KK3B 5KT5A 1CS4A 5CYMB 1TL1B 1KWMA 1VK8A 2R42A 2OO4A 3HXMA 1N56A 2B4VA 3UPFA 4DHVA 3HHNB 5DGBA 4WIQA 1C0TA 3QRQA 2B9EA 1NM2A 4NZ7A 3W2VB 2QSFA 1WB0A 2R2SA 5KFNA 5AXLA 2Y8YA 1AZSB 2VUGA 4FKYA 2EG2A 4WE1A 4HT5A 3NAIA 4IO1A 5KFLA 1FJDA 2J0SD 5AT1B 2FLNA 2NPFA 3U1LA 3CW2C 3I32A 2B0GA 2ZR6A 2MLXA 1QAYA 4Y0FA 3DRYA 5J2MB 3IHZA 4I69A 3TUJC 3TAMB 4JV2A 1UPMB 4JI8J 1N6QA 1Q1CA 2B7CB 4IH5A 2PO4A
chains in the Genus database with same CATH topology
3NRKA 5IFMA 1EETB 1JLQB 5IQ6A 1GUVA 3EYZA 4Q43A 4RNHA 5FJ4A 4ZPAA 3F73A 2XULA 2E1RA 1YJUA 4RUHA 1U1PA 4R25A 1Z2LA 2J0WA 2ZE2A 2HMIB 1Q8IA 2FJAB 2I0XA 2DR8A 2FB0A 2W25A 2MNTA 1URNA 1JNSA 2DNPA 3V6DB 2NQPA 3PZPA 3I96A 3CTRA 1E6PA 1JIHA 2YBTA 2CFXA 2HHVA 2MY8A 3JTOA 1FO1A 3KOAA 2A1BA 5KFEA 1P27B 3THVA 2MB0B 4QIBA 2X1AA 2YY3A 3IKDA 3HLUA 5E5NA 3RR8A 5F8HA 3OFFA 3CCWA 1SH2A 3UCGA 5HROA 1FNXH 3AROA 1H2TZ 5LMUF 2OIHA 1XWLA 3J7ZT 3DLJA 1KS2A 1NEEA 4DQIA 4TLQA 1TV6B 2O5DA 2WHOA 3POTB 4FS2A 5HN0A 3JB9k 2KE0A 3LP0B 4G1IA 4NLDA 3HVWA 2DCUB 2DGVA 1NKCA 5B0DA 3FMWA 5L1JA 4ID8A 5HTGA 2AWZA 4CNYA 4JFJA 4O4GB 2LEBA 2K2PA 4W9PA 2GIQA 2G8ZA 3MUMP 2FJBB 3B7XA 4OHVA 2ZJQQ 3G8QA 2B7BB 3DFEA 3J80Y 4NWBA 1WELA 1W2IA 4O3RA 2A3JA 3KWMA 2HS0A 2RVJA 3BO2A 1YW5A 1FKOB 1UVKA 3Q8QB 2DRAA 5HO4A 2FGCA 2YWGA 4R0JA 4ZVEA 3IRWP 2FVSA 4YMEA 4MAVA 2HLTA 2YKMA 1U1RA 2G4BA 2JFKA 3Q0AA 2XMUA 3BSCA 1C4AA 4U86A 1HBOA 2D3UA 3FNNA 5EN1A 2WOMB 3GV8B 4IRKA 3WIJA 3U7JA 2DSWA 1FD8A 2BA9A 2EVZA 1CC7A 1UVLA 4WKAA 1T03A 1HL6A 2BXJA 2KI3A 2W4DA 4JFLA 3IG1A 5ADZA 4LVOP 3GILA 1UAWA 2Y78A 4NLRA 1WACA 2DISA 4DWIA 4IQ2A 2YX4A 3PKMA 2XPAA 3OFGA 5K9FA 1TZ0A 4DUZF 4C9DA 4DWSD 2W8KA 1FRKA 1ZOTA 3FCHA 2I38A 4NRTA 4YDXA 3PVXA 3OTEA 1IM4A 1GQEA 1XMQF 1BL4A 4LVNP 3ENQA 4FP9A 3OTBA 4Y2AA 3RW7A 2GHVC 1N34F 4WE1B 1LQ0A 2VG5B 4LQ9A 4LQ3A 4FF2A 1R6YA 2DNOA 1TFYA 1LJYA 1W9PA 1EHNA 4NLPA 1NAQA 2KT5A 4Y2IA 4DJBA 1D7HA 2L9DA 2R7RA 1U6BA 2FPHX 2XP4A 3RGCA 1UFLA 1ZM3A 1Q8LA 1SB6A 2X1BA 4DSJA 1Q82T 4HHJA 5KG7A 4Z2KA 2ZHAA 3HVTB 1S1XA 2V4JA 2W9CB 1GNKA 1BQMB 2I8EA 1HBMB 2LXFA 3BSAA 3FDSA 2HNDA 5BYRA 3UNGC 4NPOA 5I4MA 3OQ2A 2DNQA 4CH0S 4OI4A 3MEDB 3G8SA 5ITHA 1M5KC 2RQCA 4JYSA 3JSRA 1N6QB 4H4MB 3PR9A 2F9DA 1S9FA 3BO4A 4AL6A 3OLAA 2KRRA 4V19X 4I7FA 3PW0A 2K7JA 2VH7A 4KBIA 3K7RA 3IBWA 3I6PA 3GWCA 1TCOC 1BQXA 1HI8A 4OLOA 2W9BA 5HBMA 4WK1A 3RB0A 1HKKA 2PV1A 1VBZA 3VWSA 4B3RF 2ZE2B 4CZCA 3ENVA 3DRSA 4HDGA 2AOSA 5IZHA 2IMWP 2BQUA 2CKWA 1C1CA 3O5DA 4NZ0A 4ODMA 2XMMA 2P9EA 3O1LA 3HHKA 3G86A 4XK8C 4K2XA 1SL1A 1WNOA 2ALZA 4G1QA 3BGFA 4DS4A 2DSZA 2DNYA 1FEEA 2MQPA 3NMAA 1NHUA 1JLBB 2C28A 2WSEC 3LH2S 3OL8A 3H8YA 3KG0A 4JV0A 2YBUA 2LA4A 4GGQA 2AJ4A 4O3OA 2VA3A 2DGTA 1ZK6A 3SYZA 4TYAA 3EZUA 1TKXA 3CDBA 3PX4A 3DOMA 4PTMA 2YWHA 4A4JA 2JLGA 1DRZA 2VPYB 3N9UC 3OR1B 3NKYA 3PDNA 4I2QA 2MPUA 2GNKA 5E33A 3KLEB 4B9NA 3B9EA 3R5DA 3PRAA 3ARYA 2IMOA 3FGVA 3NP5A 1NWTA 3MR6A 4ED7A 3AA9A 4QCLA 4QT2A 1GXTA 2DHAA 1YGYA 1P8GA 2VPXB 4ZKAA 3W7BA 3G4SS 1ZCNA 2IYIA 2HFNA 1W1VA 2G1DA 3D1QA 1RWUA 1NH7A 4MH8A 5D75A 2BVZA 3PACA 1W1TA 5KFIA 2ZOGA 3H5SA 3B78A 3SV3A 4RBVA 4IQCA 1Q81T 4ML4A 2WSFC 2G9OA 1RT4A 1HBOB 3MPYA 3BDEA 2HVIA 1U1NA 1VF8A 3DLBA 3UQBA 3QGGA 2XP6A 1RT1B 3ZZZA 4B9LA 4WKHA 2MZ1A 2PI4A 3IG1B 1IQTA 1YJVA 1QE1A 2GHWA 1SL0A 1HI1A 1X5SA 4ICLA 4DV5F 2XS2A 4JI0F 2L9WA 2DT3A 5A8WA 4WJBA 3TA2A 5HWCA 4LT6A 3TUIC 2D3OR 2H9ZA 2N4DA 5C42B 1LQ9A 1TVRA 5DS7A 1SJ4P 4FPRA 4CO4A 2UUBF 1H0GA 1G7CB 2VBXA 3RAMA 1BKFA 2R9LA 4RU2A 2HVHA 4EBDA 4U9RA 2V4RA 1N48A 1RTHA 1GPFA 4USHA 3KHHA 1HHTP 2E9RX 1JWWA 4RX6A 1E6ZA 2RDIA 1T05B 1H2UX 2MYFA 3AA8A 2HS4A 3A1YG 5J1NA 5M2PA 5KFQA 1JJ4A 2DPJA 4DN0A 3OOBA 1OWQA 1S1XB 4ZK7M 3CCQS 2V4JB 2E44A 2Q6CA 2VCDA 4MNKA 1JLCA 2LXUA 2XO7A 2HNDB 5DG8A 2NUHA 2YVSA 2IRUA 4QQBA 1ZPVA 3MR2A 2CQIA 1REVB 3WDOA 1LL7A 3M9OB 2JVRA 1RYRA 1JLFB 2CVIA 3VAHA 1R89A 5I42A 5D3GB 1N5QA 4GO7X 2R4FA 2XS7A 4MK8A 4I7FB 5BYQA 2KRBA 4IYQA 3DRXA 2OPSA 3R5BA 1S1TA 1ZPWX 1IKVA 4HEA9 3BF4A 2SXLA 4DFJA 2W9BB 5HBMB 3H40A 4LFBF 3C6UB 4OZ1A 1UJ4A 1FKAF 2D9OA 2M1IA 5K8OA 3WD4A 5MAOA 1FA0A 4DDFA 4G3IA 4WXWA 3DRSB 4YFUA 2RKIB 3CCSS 1C1CB 2DB1A 3CB4A 4HT7A 4LGXA 2HGMA 2KM8B 2V9WA 3IAS9 3EZ5A 1YI2S 1H0HB 3MUTP 2O01C 2DD8S 1FKKA 3BS9A 3M05A 4G1QB 4ODOA 4AY1A 1IKWB 1VQOS 3BQ2A 4DV7F 2KFZA 3MMAA 3MCSA 3SCLE 1J4RA 5HBFA 2FHMA 3PW2A 3NMRA 5HP1A 5LXRA 1RDRA 4DRIA 4PXBA 3KNAA 7FDRA 5AXNA 2VN1A 1TKXB 2PPOA 4FXWA 2AW0A 2W9AA 1FK9B 2RRNA 2ZH4A 1TL4A 4J9PA 1VBXA 3QMQA 5L39A 1XR7A 2VFRA 4GMKA 2R7UA 2WTFA 4HI1A 4N8OA 3IWLA 2RQ4A 1BC6A 6FDRA 3Q8PB 4ECTA 4F50A 2QIFA 2C2EA 1E6YA 3FSXA 1LXNA 2BV3A 4RW4A 5F9NA 1S77D 2E66A 4X4SA 1Y0HA 4KHPF 2JWNA 5KT4A 3CIMA 4A48A 1TFWA 1S0OA 1Y4ZB 1Y5NB 1IX5A 1JK9B 4ODRA 1FNMA 2QRRA 4I64A 5C24A 3SSQA 2RUDA 4DG1A 3MFIA 4USIA 3M9MB 2VBWA 2ZC4A 4NZ6A 3BGRB 1H0IA 3TANA 4QIEA 3KHGA 2KU7A 5F9LA 4PUOA 2CQBA 1BY9A 4AXJA 5GAGU 2HHXA 3DLGA 1HBUA 3T5LA 1SL2A 4QT3A 3ISZA 2DGWA 2YKNA 1RT4B 4TW7A 3DYAB 1NRKA 4X64F 2X1FA 3GYNA 1YG0A 2F3JA 3M8PA 4IFYA 3KLVA 1XNQF 5DDRC 3AQUA 5EWEA 5EX3A 2VC1A 3FZBA 3TAQA 5L1LA 2UVUA 2GMHA 4PXCA 4JUZA 2EFGA 3BXWA 1X7VA 1HWUA 1R8BA 5LMNF 2UU9F 4IG0A 1TK8A 2DGQA 2ZOFA 1CPZA 2OMOA 1I1GA 2YWEA 1E9LA 4O4RA 5CYJA 2E5LF 1VRTA 1TVRB 4J9MA 4ECSA 2BW2A 4CO1A 1YJWS 3HDSA 4ODKA 2QZ8A 3CDWA 1WF0A 1N32F 4AXIA 4FAPA 1U1MA 2YNHB 1S9GA 1VQLS 2Y1RI 3N5FA 2DNNA 1VBYA 3LP2A 4LF5F 2O1PA 3O5QA 4P7TA 4B17A 3M1VA 1CVJA 2ZDOA 2B4UA 3M9NB 3IN5A 1KONA 2HIQA 4C8OA 2EC0A 2KG1A 4UUWA 5GAEU 4NLUA 1VQ6S 4MYTA 1LFPA 3R5CA 1JLCB 1X4BA 4TW8A 2N4CA 3K5NA 3CCVS 3H2LA 1D9AA 2DNLA 4YR3A 1JMTA 2KN4A 3R1HA 2F4VF 2FLOA 1FRJA 2JSXA 2OP5A 1MROA 5EUHA 4K4XA 5I42B 3MXHP 4RZRA 2J9CA 2XLIA 4RUCA 4EBCA 3MHYA 4RWWA 1DURA 2UUCF 3GR0A 2RS8A 2RSEA 2NSCA 1P1TA 2EG1A 2OPSB 1S1TB 1IKVB 1J5OA 1Q8BA 1YJ9S 2MGZA 4GKKF 1Q86T 1GXLA 1FKBA 4CTAA 3TX8A 3LUOA 2IM0A 3FRZA 4BF8A 1X4FA 4BCAA