4QZVB

Bat-derived coronavirus hku4 uses mers-cov receptor human cd26 for cell entry
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
208
structure length
208
Chain Sequence
TECDFSPMLTGVAPQVYNFKRLVFSNCNYNLTKLLSLFAVDEFSCNGISPDSIARGCYSTLTVDYFAYPLSMKSYIRPGSAGNIPLYNYKQSFANPTCRVMASVLANVTITKPHAYGYISKCSRLTGANQDVETPLYINPGEYSICRDFSPGGFSEDGQVFKRTLTQFEGGGLLIGVGTRVPMTDNLQMSFIISVQYGTGTDSVCPML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bat Origins of MERS-CoV Supported by Bat Coronavirus HKU4 Usage of Human Receptor CD26.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/viral protein
molecule keywords Dipeptidyl peptidase 4
total genus 41
structure length 208
sequence length 208
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.70 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4qzvB02
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4qzvB01
3BGFA 5DO2A 3SCJE 2DD8S 4ZS6A 3D0GE 4L3NA 3SCKE 4KR0B 2GHWA 2GHVC 3D0IE 4L72B 4ZPVR 4QZVB 3SCIE 3SCLE 4ZPWR 4ZPTR 4KQZA 4XAKA 3D0HE 2AJFE
chains in the Genus database with same CATH superfamily
3LF0A 4QPTA 2XS7A 1YJWS 3R6LB 5C7PA 2DD8S 2ASYA 1UEVA 5J6EA 4RW4A 4UUXA 2P9EA 3MCSA 3ARSA 4DV3F 1RWMB 2QT7A 3I0SB 2DPIA 2AEFA 1HKIA 4KGVB 4WTYA 5KFZA 3IP0A 1NJWA 3CCTA 3NS7B 1Y4ZB 3BH6B 5J2PB 2HLTA 3R8YA 3OBIA 2PI4A 2R2SA 4KH0B 4ED7A 2IY5B 1KONA 2Q5AA 1VF8A 4U84A 2C3UA 3CJ4A 2B51A 3PRVA 4IH6A 4RW9B 3UDEA 2K2PA 1W2BR 2Z0GA 4NXNF 1V3ZA 4OYIA 3W60A 5L9XA 1UJ4A 2JC1A 3DOLB 3L95X 3P5TL 1OGBA 2XO7A 4P9SA 1SKSA 2VZ9A 2CA9A 1EYMA 2G8ZA 4QWBA 4OI3A 4U67Q 3J7YU 1R31A 2A3BA 2QLJB 1RAIB 3LP1B 2DGVA 3SEOA 2RRAA 1YKWA 5CA5A 4AXJA 2BJ1A 1ZTWA 1TK0A 3DOMB 1YGYA 3EIPA 2CJBA 4G65A 2DT3A 1TUWA 5GAHU 1SC1B 3ILJA 2Z57B 1S6UA 4CP5A 1UVJA 2VBXA 1VRQC 1U24A 2M08A 3O5RA 1YG0A 4PR6A 4NRTA 4WPAA 2XY6A 1NB2A 4RW4B 4X4UA 2R8IA 4C3MA 2W9CA 1CG2A 3CDEA 2WM0A 3TDBA 1OS5A 3JTPA 3NGRA 3RB0A 3IHZA 1TL5A 1L3VA 1AFJA 4NLXA 3W61A 1FD8A 4F4ZA 1H6KX 1RJJA 2R7TA 1S1XB 1LKZA 1FDNA 2AIRB 1XMOJ 1NJXA 1H72C 1FKGA 1HHTP 4ENOA 3W2WB 5ADZA 2J0SD 3GSIA 1PC5A 1SC4B 2V5HG 3PX0A 1J5OA 3D6TB 4IFVA 4FBUA 4CLSA 2YKNB 4IRKA 4K0KF 3HFKA 4DJBA 4JUZA 1CC8A 2Y9HA 1DAXA 3TQ1A 2O3DA 3JYMA 3B54A 2E5JA 2PC6A 2YNGA 3ARQA 2DT2A 4HLBA 2C2KB 4TW7A 2U1AA 4LFCJ 4GKJF 4N76A 2F21A 3V6DB 1G7CB 3G86A 3H2UB 2VB6A 1C0UB 1HI8A 4LSNB 4K50A 3DRRA 1L3KA 4DSIA 5IT9U 5LXRA 2EK6A 1IBLF 3M8RA 5J2NA 3MXHP 1JX4A 1EDQA 1Q78A 4MYUA 2OSRA 5FJ4A 4KR0B 4S3KA 5GAGU 3HVRA 4H4KC 2ZQTA 2H48B 4L73A 3FQLA 4CLLA 4QIFA 1VFJA 3OFFA 3T1YJ 3KUGA 3JYJA 1CJKB 1YK9A 2LKZA 4DX6A 2HHHJ 4KHPF 3Q86A 2UUCF 1AZSA 3VQSA 1J5OB 2DR6A 4RR5A 4Z2IA 4NE9C 1EETA 4Z2GA 4X4OA 4D3GA 1W9UA 5A8WB 3I5BA 3ZC4A 4IYQA 3VWSA 3O44A 3NAHA 5T7LB 2Y8YA 2IRUA 5HWBA 3E2EA 2HHXA 1GTHA 4MT1A 5HI7A 4URGA 1HD1A 4B9LA 2FVRA 2QL7B 3UQSA 3SDEA 4UDMA 1SJFA 1AUDA 1KQGB 2NPIA 1P8GA 3GG0A 4FS1A 1GK8A 1W1YA 2IJFA 2VUGA 1RT3A 3I31A 4I6AA 4WBFA 3JYTA 4EZ9A 2VA3A 1RA7A 3WD1A 2WBMA 3N01A 1E6VB 2KFZA 1JLQB 1FNOA 2LMIA 1FKOA 4QPXA 3NMAA 5GMDA 1YITS 1OIAA 5E5NA 4KGZB 4BLGA 1Q0NA 4ZIWA 2LJ4A 4ODRA 2XULA 3I0RB 3OVAA 2D3OR 3PR5B 3OJUA 3TA1A 3O5LA 2IBOA 3GFHA 1FERA 2VC0A 1U2CA 2VQEF 2DR9A 1KOOA 3UR0A 2VJUA 3CCVS 3W3SA 4IUFA 1M5HA 2ETNA 2FHJD 1H98A 4LGXA 3HVWA 4PXDA 5B7WA 5KT7A 4LF4J 3TP2A 1SCJB 2DR8A 1SH2A 2DNLA 4DQRA 4C3KA 4DG1A 2RJZA 2ALYB 3FVYA 2CWKA 2K3IA 2DHXA 1VRTA 3CCQS 2JEIA 2LFVA 3NGTA 1R27B 5LJ5Y 1JXEA 4U8YA 2R2UA 4JI8J 4WZQA 5HBMA 4ZJLA 3IBFB 4F4YA 5J1EA 1S48A 3GIKA 1CVJA 4PQUB 3RM8A 2NUUG 2ZVSA 3CIMA 1F9FA 2QA4S 9ATCB 2GIRA 3M8PA 4AFFA 1UWBA 2C3MA 3DC2A 4X4QA 2FAPA 4GKJJ 2MY8A 1G4CA 3K0JA 1H38A 4MNJA 4Z2HA 3KDNA 5CYMA 3O5MA 2XMTA 4DH0A 3KJQB 3QAUA 2JC0A 4NWBA 4KGKA 4TU8A 2J7UA 3AB2B 4U8VA 3TAMB 2MKJA 2VFRA 4X2BA 3T3FA 1VC5A 2CPZA 5J2MA 1R43A 3OXGA 3PYFA 4P2FA 4DR4J 3UQIA 1UA0A 1W7WA 4KGMA 4USHA 1JNSA 2VDIA 1IKWA 3I32A 4DPWA 2JL9A 2PA8D 3A3PB 3BM7A 4Q5VA 3CJRA 5F3TA 2HS4A 4K4WA 3N5FA 3BSAA 2EBEA 4DX5A 3M2UA 1WC5A 2XSFA 3WL0A 1B7YB 2DNKA 4JI5J 3PG9A 1D3WA 2WB4A 1S1WB 3BR9A 4LVNP 2CVIA 3MDYB 3FDSA 3LPEA 3NI6A 3D6FB 4ZPCA 2XWXA 1J5EF 3F56A 3HHLB 3GJRB 5E41A 3X1LB 3UE2A 1DQ8A 2XYHB 3HP6A 2XPBA 1EZZB 2AHOB 4ETXA 5B8IC 3PEHA 4O3PA 3D6MB 2FVSA 3FZ2A 2MZ1A 3BQ2A 1X6NA 4KHMA 4YB7A 3T1HF 3PV8A 5KFHA 2Q79A 4P7VA 3ZZUA 1SYTA 4U7CA 3R1LA 3EXCX 2A3CA 4PYDA 1LWFB 2KKHA 4CLZA 1RK8A 3Q83A 5C5JA 4YP3A 2CRLA 1IBCB 1LWEA 1T03B 2J9DA 3AODA 2AWGA 3DOKB 3ENQA 4PXEA 1XC9A 3CVKA 3M8QB 3OFEA 2W9AA 4DR3J 2DJWA 3LP2A 3CD5A 3RGIA 4LRBA 3PIPQ 2QEXS 1UVIA 5KFRA 4C2MA 4USMA 5K8NA 2B7BB 1HWLA 4CH0S 3KMSA 4IQMA 1K1SA 1RHMB 3BQ1A 3MTKA 4KY3A 5ETTA 1IBMF 3VV2B 1TMMA 1RTIB 4UOFA 1XQIA 2VONA 2WW4A 3NRBA 1RADB 3DLEB 1OO0B 2IJNA 4IH7A 2JDJA 1S6QA 2EPIA 4FPIA 5D4LA 4AT1B 2GV1A 2NLWA 2RQSA 2RD5C 3A8EA 3NCRA 4NOHA 4OZ0A 4J9OA 3V6DA 1IBMJ 4A47A 4RBUA 4WYLA 4CLYA 1NZ8A 2GC8A 4WK1A 3JSMB 2B9EA 2XTJP 3EM1A 1BUXA 1FNMA 1UJ5A 3MMBB 2XP7A 2VQEJ 2M3DA 2UUTA 3C14A 2D41A 3EXYA 1DLOB 4DV7F 1YJNS 3KAHA 3GCWP 3M05A 4DV1J 4EBDA 1C4AA 2P8IA 3DGPA 4K2JA 4ZJQA 1YQHA 4ZCIA 3MR2A 4DR5J 2C2DA 3QPIA 4C8LA 4IOAQ 3DCAA 4LAWA 1WI8A 2H5IB 4HVZA 1L5UA 3PM9A 2CQ1A 2DRAA 1IKXB 2BX6A 5KG7A 5C25B 1NDPA 1TFWA 1NWSA 1N88A 3D5MA 4ECSA 1O8BA 2HQGA 4LF6J 3R6GB 1X7VA 2KL8A 4ZOSA 5DEZA 1X0PA 4R25A 4WFBQ 4RW6A 4DOZA 3DRPB 3SYZA 4DL4A 1URRA 5BXJA 3U7JA 5B0BA 1NK5A 1T7PA 1QE1A 2XNQA 1NMVA 3VQTA 3GYXB 2ZOGA 3WC0A 4LT6A 1IJFB 2OGUA 1LFPA 2LEPA 3CCWA 2RRNA 2HFZA 2KVQE 1CJUA 4TVAB 5DZ6A 3F73A 1IX5A 1EQ3A 1YIJS 3IK8A 1N48A 2AEJA 4O0NA 2AYBA 2M88A 4PCQA 4CTAA 1TQLA 2DSVA 3R1HA 4FYDA 1FJDA 1NB7A 1LG2A 1ZK6A 4M5KA 3HF5A 1UZHA 2OPPB 1FFWB 3KG0A 3W63A 2R8KA 3ENVA 1JLQA 2O5DA 2V2QA 2FJWA 2FY1A 2M8DB 1KVJA 4QR2A 2JVRA 3OR2B 3IWXA 2W2NP 3UDVA 4X65F 2MLYA 4MGVA 2CPIA 5CHCB 1H0HB 4C97A 2ZNYA 5D0HA 1GX5A 2OD6A 3CB4A 4HBEA 1REVA 4KGXB 1Y3JA 4CLPA 4ZLPA 1LL7A 1HQEA 3OA5A 1S6PB 2CJQA 3I82A 2HPUA 2LQJA 1KQKA 3SSSA 3R27A 3TAMA 3TZXA 4DV0J 1SL2A 4HL9A 2DH8A 3KLHB 2J9EA 2DG3A 3MMAA 5IM0A 3LGNA 2XSJA 1TL7B 4TW6A 4WJXA 1N5TA 4ETZA 4JV1A 2KRBA 1ZOTA 2QIFA 4YDDB 3HPOA 2EKNA 2MJNA 4DV6F 2MLXA 4TW8A 1BQXA 2VKRA 3QIPA 2F8HA 4MFBB 2OPPA 4Q7AA 3UO0A 3CJQA 1P1TA 3I6CA 2DB1A 3JXOA 2JVOA 5ETPA 5HMZA 5KT5A 3OUYB 3NTPA 3ALGA 4URIA 1IM4A 5DLGA 4NXNJ 1FE4A 2G2ZA 2OEJA 1HR0J 3J7Z5 4ECWA 2JWNA 1RT1A 3PFEA 3VAHA 1YRXA 2M4MA 4K8RA 4F3OA 4NXMJ 3SSRA 1ITXA 3AB4B 3VGTA 1RYRA 4LSLB 1RAFB 4W90B 1C1CB 1LEOA 3M9NB 1N33J 1HNVA 3JQJA 2V6AA 2L2SA 3DYAA 2HK3A 1QPFA 2BKOA 1W25A 2HVEA 5EX0A 3GILA 5D3GA 3KFWX 3UI4A 2QO3A 2MKCA 4ZPTR 2DGQA 3X3UA 3CDAA 4C7QA 4WFZA 4JFMA 1FKRA 3CUNA 1VQYA 3TAQA 2PIIA 1X60A 1U0SA 3HO1A 5CZXA 1SH3A 1NLKL 4RWXA 3PO5A 4AL5A 2V9KA 2HVDA 1AT1B 1FFSB 3KNGA 1Q8IA 1PSDA 4RX6A 1JIHA 4ZVQB 1RT2A 4JI8F 2E9ZA 4X4NA 3FKBA 2VN1A 3ZZ0A 5I3UB 1NH7A 1XWLA 2B43A 2GA7A 1JLFA 4P8UA 4G6VB 2BE2B 4CO4A 4WXWA 3HXMA 3DLGB 1TL1A 3TA0A 1LV5A 4J9RA 2EFPA 5BYQA 5FDLA 3N9UC 1FKFA 3D3CJ 1X6LA 3SI8A 1EQ0A 3GU0A 5HUAA 4OZNA 4R0JA 4YY3F 1DTTA 3IGVA 3VGUA 4H4MB 4GGQA 1LWXA 2B56A 3ZZRA 4AY1A 4LSLA 3BSOA 4DU7A 5A8RB 2H9ZA 3GSDA 1U8WA 3M8ZA 3ARRA 4X84A 4YQWA 4HTJA 4A4JA 4NA3A 5A2QY 1JJ4A 2HGLA 3BYPA 4MYTA 3Q8RB 3KLIB 2AP6A 2HRUA 4DR1J 4HKQA 9RUBA 4H4OA 2DNNA 2GJIA 3L4BC 2ZHAA 3VAWA 2BOAA 2X1BA 2YNFB 1S4EA 3GE9A 4KO0B 5B08A 3J81U 5EWEA 4JYSA 3EGNA 1RWWB 2HIYA 4TYAA 3H2VE 2QA1A 3OL6A 2A18A 4AL7A 1JK9B 1I51B 4QIGA 5G4DA 1WOSA 1MLAA 1Q8BA 4J4OA 2Q1LA 1U1NA 2HHUA 4UTGA 1JWWA 4I56A 2ATLA 3R5BA 2PPNA 2MQ8A 4Z2LA 2Z2ZA 2CADA 2HURA 4Y2CA 3BJYA 2YWKA 3G6MA 2CQCA 4N8OA 5B09A 3I55S 1GMVA 3WBZA 1QAJA 4KHPJ 2XLIA 1ZZFA 3O3LA 3NGKA 4CT9A 5DM6Q 2RUCA 2L08A 2RQKA 3KLEA 2NYHA 4W98A 4CLWA 1REGX 3R7SB 1RTJB 1JLEA 3A8IA 3OJSA 1I3OB 2BJEA 3DXBA 1SJQA 3G2XA 4FYVB 5M2RA 3MGJA 4IRDA 2A2CA 1UZDA 2EG1A 1IWGA 2BXJA 2IDLA 2V4JB 3MEGB 5IQ6A 2JLGA 3C8YA 4DQSA 1KLNA 2JEGA 1O6IA 1WSRA 2F7VA 1UEUA 3BO3A 2HVIA 1YTYA 1RLCL 1M5PC 3QJJA 5A8KA 4J9NA 1H2VZ 4I1TA 2MGZA 4Y2KA 1HKJA 1VLYA 4I6WA 4IG3A 4KFBB 2MMYA 3DMJA 1U6FA 4DZ2A 3FCVA 1TKDA 2JEFA 1HFEL 2ZD1A 4IDKB 3JSYA 5AJ3F 3K59A 2AYGA 3RW6A 4F67A 3OTOF 2EULA 5ETNA 5KAKA 2J0WA 2N3LA 3PYDA 5F8MA 1WKLA 3MPWA 2VBZA 2YPYA 2ZH9A 4OJ1A 1NK0A 3GONA 4TY8B 5DM7Q 3KJNB 4HBOA 2HG4A 5KFCA 1XMQF 5HLFB 1E6PA 4J9PA 5D4NA 4NMLA 1XERA 1B99A 3LTOA 1VQSA 1SKUB 3D7SB 4TYBA 5DETA 2B4VA 5IT0A 2I9SA 2VU5A 4MMOA 3EUNA 4YB1P 1N54B 1J4IA 1N36J 1RU1A 2EVZA 3DU5A 4KKOA 2I8EA 4C8MA 3P49B 3AJ1A 1RA6A 4KV8A 2DHHA 3I9ZA 2XY5A 1RWNB 3TVZA 1BQNA 4O2TA 2DISA 2KHDA 1FK9A 3QSYB 3PKMA 1NHUA 3H5YA 4HH0A 5DRKA 2WOMA 4DSFA 1QTMA 2M2AA 1KHWA 3PDNA 2AOSA 1FRLA 4EWTA 5DQIA 3PA7A 1A6LA 4E2FB 2V63A 3RB6A 4G3IA 3Q0AA 3ARVA 2VFVA 2Y3YA 1TKXB 2XZWA 3O8WA 4AQYF 5T7LA 3T6JA 2V9WA 2NSCA 2ZM6F 3MPUB 2ZBIA 2GIQA 1DTQA 4NA2A 1K8AT 5A76A 1XNQJ 2KH9A 1S9EA 4B3SF 1F9HA 2L3MA 4HHHA 4DLEA 3AHPA 3T19A 4NZ7A 3TOQA 1N0UA 1LXNA 3PNIA 3U27A 5FLXU 4HYKA 1Q7LB 1U4BA 5HSPA 2NXUA 1I1GA 2WBRA 1TFVA 4PG8A 4PWDB 5CYQB 5T14A 3SMZA 4DBQA 8RUCA 2R7RA 3TVYA 1W2IA 1FXDA 1NDLA 1ZU8A 1X4AA 5MAOA 3MAAB 4C11A 3J81j 2MLZA 3DRSB 1TL3B 1VJWA 4ZK7M 1FDBA 2HGMA 3M8WA 2HHPA 2DGXA 2VFSA 3CHFA 4KPCA 5KFAA 1SC3B 4WKRA 2EFQA 3N6NA 1NKBA 4DU8A 4P6QA 3UF8A 4I2QA 3BH7B 1VYAA 2UXDJ 1FD2A 2J6UA 2U2FA 3HSGA 1Q16B 4OYWA 3QZ7A 1Z1ZA 2QX0A 2RIJA 2BW7A 3MPDA 3CNQP 4ODNA 2PPOA 4XDCA 3MM6A 4DS4A 2LDIA 3OPKA 1WHYA 2MTLA 3FGVA 1HQUB 1OY6A 2DNGA 2VG6A 3GFXA 3MZIA 2MQNA 2VV5A 1CQNA 3M32B 4JI6F 3KTQA 2M7SA 1SQEA 4IT4A 3MUMP 1JLFB 2MPUA 1W9PA 2DNZA 2VL1A 3CULA 1GAOA 1RWPB 1EB0A 1YATA 3BMBA 3IFEA 3W2WA 1Q86T 3PR9A 1IQZA 3PHEA 3BN7A 2ZH4A 1WC0A 4N47A 4QWAA 2JRSA 5F8HA 3O5JA 4DQIA 2GQ2A 1PYTA 3PRAA 4OLPA 2RE1A 1X4BA 3LWLA 1QVGR 2K06A 3BB5A 1NKCA 3ODKA 1RSCA 4JI2J 5CYMB 1VK8A 2VG7A 5HQLA 3PX4A 4B9UA 3ARYA 1JNRB 2BEFA 2GVDB 2B8QA 2DXDA 5KFWA 2GW8A 5HATA 2XLJA 2H4YB 1NPKA 4R0EA 4P8WA 5BR8F 4MNLA 2YKAA 5L1IA 4U96A 4NLWA 2D1CA 3F0NA 3IRXA 4TU7A 2RMLA 3THVA 2CG4A 1AFIA 1VRUB 1F6TA 4I64A 4TLQA 1FFQA 5B0CA 1S6PA 3L7UA 1CEZA 2R7VA 5BR8J 4UY8T 2F4EA 2F40A 4Z7YA 2R7XA 1MW7A 1LW2A 2EI5A 1MNEA 2YH0A 1ZAVA 2DIUA 2DNOA 3CCES 3VGSA 3OV7A 1XBWA 2CPEA 4M94A 2JNJA 3A1YG 3T1AA 4AE5A 3CCUS 4B3MF 2LGOA 3NAIA 4ELVA 3V2UC 2FLLA 2HAFA 1C9HA 2YKMB 2K1RB 5DIVA 5KG1A 2Z2LA 3P96A 1VOMA 4LR9A 2XMAA 3Q8PB 2UUWA 2N7CA 2IF4A 4MSPA 3UD3P 4B9MA 5GVQA 2VBWA 3T5HA 3CD0A 3IS9A 4M5GA 2HHWA 2FVPA 4ZCKA 2ZZMA 1V3SA 4DR4F 2CIMA 2QLWA 2LQBA 1UR9A 2SXLA 3CIZA 7FD1A 1FNXH 1LK7A 3NCPA 2ZBQA 5AE2A 1RT3B 3JYTB 4JV5F 1JLGA 1TV6B 3IWLA 3GJTB 3RBEA 1TK8A 1TMJA 1ZM3A 2V34A 4J4NA 3RM4A 5C25A 4GC6A 1U1RA 2MB0B 1T9VA 4F02A 3G8QA 1PCAA 3KAFA 1VS3A 2GX8A 2H54B 5DDOC 2Z2MA 1GX6A 1NDKA 5HANA 3O5QA 4QYZJ 4HACA 3ZTPA 4B02A 5L39A 3CC2S 4DR2F 1AROP 1RHJB 5CZVA 3FK4A 4YB5A 2DNQA 4A8QA 4CLKA 1MU2A 1Q4RA 3BGLA 4KAIA 5KFQA 2E5HA 3SCIE 4MPKA 4ZPDA 1YJUA 3CCSS 1GMUA 2MHEA 5FDLB 5L9NA 2RUGA 3KCEA 2XMWA 3VAGA 3K5PA 1NK7A 2KM8C 1RWUA 2BE7D 1JXLA 1Y00A 3ARUA 2UVUA 2RUSA 3CD7A 4E0DA 3C2PA 4B9NA 2QA2A 2QSWA 3A12A 3WHIA 1HBMA 4EU0A 3MTJA 5H9FK 2PPPA 3VAJA 3A4TA 5KFTA 4NI2A 4XTTA 2ZQUA 2CPHA 5CQGA 4PQAA 4BWMA 4F7VA 3KK3A 3M8SA 3T5KA 4O4GA 5L1LA 5HP1A 1HBOA 1CPZA 4HACB 5HAOA 2AGPA 3C6UA 1Y0OA 2C2NA 1SPBP 1W26A 2N87A 3MM6B 1T9XA 3S8SA 2E1AA 1M90T 2EFOA 4TX0A 1YSJA 4JFJA 2Q6CA 1T94A 2C2MB 2X3DA 2XMMA 4FF4A 2IVYA 2UXCF 3V6JA 4LIWA 1X5OA 3FC9A 4U7UK 1U2RA 1WOPA 3TUPA 2FHOB 3M30B 3W64A 1C1BA 3C15B 2B31A 4X4RA 4X4VA 1Z2LA 3CCLS 4DUZF 2B5JB 4OI6A 1FA0A 1S9EB 2K7JA 4DV5F 1ZM9A 2MQPA 2CNOB 1B0PA 4ED3A 2ACMA 4P71A 1IBKJ 2ZQVA 1TELA 1WELA 2YVSA 1UFWA 2BABA 3QGIA 2XEXA 4JI7F 1M5KC 2J7KA 4ODPA 3NGSA 2KJWA 5DG7A 1YWXA 2E1RA 3OVSA 4PUOA 4MNKA 4FBTA 3HSJA 1LFWA 2HKEA 3NCQA 4MK8A 2V4JA 4DRNA 3MEGA 5F8IA 1LXJA 5EWFA 2AWZA 4RUBA 3TNVA 1IN0A 3BS9A 3AAWB 5CD4H 4NI2B 2FD2A 1RT5A 4QWDA 4G2PA 3OT9A 3Q22A 5K5MA 2LU1A 5LT5A 1N52B 2LKNA 2CJAA 1JLBA 4DL3A 1S9GB 2DH9A 1QSLA 2X51A 1HNIA 3I0SA 4DFJA 2MKYA 4MTPA 1KSPA 2MKHA 4EYHB 2CKWA 4CIOA 4Q0BB 3HKZD 2FZCB 1U45A 2X1FA 3OTDA 2N3OA 3PJWA 5HK4A 2BYCA 2OFGX 4RW9A 4X66J 2UVVA 2WVEA 1B6CA 3ZO7A 2XY7A 1K47A 1T05B 1UVNA 2WZ1A 1RP5A 2Z30B 1N6QB 3R7NB 1LQ0A 5MLCV 3O1LA 5HL7Q 5J1EB 1VQ8S 4A8FA 1LQ9A 4EO6A 4OHWA 2ZH7A 1IM6A 4NCAA 4PRFA 1LW0A 1FE0A 5K20B 5LSOA 1V5IB 3HMJG 3BDPA 5LJ3Y 4L3KA 4CO1A 4P75A 3G6YA 1SB6A 1H0GA 1CJVA 4Y3CA 1HD0A 3CTRA 2ABYA 4CM0A 3MFIA 2YTCA 3R2DJ 5T41A 1X5SA 2YBUA 1DLOA 2GVDA 3MMBA 4R8UB 1WTFA 5D0RA 3PJ9A 1S4FA 4DWSA 1KLMA 3BSNA 4NX9A 1GFWB 2ZH2A 2IA6A 2DO0A 2C2EA 3HLUA 4P2MA 3G6XA 3JSMA 1Y5LB 3TW0A 1KT1A 3TUIC 3UFCX 2UU9J 3FSIA 1PBAA 1RBLA 1UAWA 3I5AA 3O5GA 2UVRA 1WB0A 1RACB 3PYEA 4DRKA 4TYOA 2LLZA 2QG9B 1T05A 2IAJA 2RQ4A 5KFYA 1M1GA 3OVBA 2M52A 4BDPA 1WAWA 2A0FB 3AXMA 2ASLA 3NP5A 4YN3B 4G1QA 3WD2A 3FEXB 4CO0A 5JUMA 2H51B 3OUYA 2PSZA 2IVFB 1RAEB 1VBXA 4CTAB 2R9LA 4ZJOA 1SXLA 3D3BJ 3IAS9 2ALZA 2EC0A 2HFNA 5IFMA 2BE9B 1QUVA 2NSBA 3CWJA 1EARA 4I2QB 4LR8A 4TLRA 5A0YB 1HBUA 4ATNA 3FCHA 1U1QA 1VQ4S 1N34J 2FLNA 4QR0A 5BYRA 4HTIA 4DSLA 2YY3A 2FHKA 1U1MA 4O3QA 1RTZA 2R7UA 4YEAA 2RDIA 3K8VA 2EG2A 3CO0P 2D69A 2FKEA 1C0TA 2HNDA 1DURA 3ET6B 3LGHA 5DDRC 4NYZA 2C28A 2BANA 3AA8A 4NLRA 4WTOB 2OEMA 2HBQB 2VG5A 4UOHA 3US5A 5DGBA 1TCOC 1FDAA 1FRMA 3CCZA 2ZC3A 3EVWA 2AGQA 1ZYQA 4PKDB 1EHNA 2NXNA 3M2UB 4W9PA 3PEJA 3G6VA 3AFGA 1EX8A 2OUGA 3W5ZA 5AT1B 4LR7A 3J7ZT 1C1BB 4EYIB 4PAAA 4A8SA 1Q6IA 4OX8A 1ITPA 4YB6A 4ZDNA 2KT3A 2DIVA 2RQMA 3Q24A 4OX9J 4DV4J 1HQEB 2D9PA 2R2RA 3OFHA 1DQAA 1SI9A 4WKHA 1X4GA 3PTWA 1FXRA 1KDNA 3O6QA 5CAAA 2QFIA 4DLGA 3V6KA 1D1UA 2QMUB 4PZVA 4LF9J 1O0PA 2P6SA 1F3FA 2V68A 4WU2A 4G1PA 4USUA 4G50A 1U0HA 1VI7A 4WKYA 1RT6B 2BA9A 2IM0A 3MR6A 1C2PA 3M9OB 3C6TA 3UN3A 3KK3B 1ZH5A 5KFMA 1FK9B 2OEKA 3MM7B 2IM1A 2C22A 2UVWA 5K8OA 5HO4A 4S3JA 1M5YA 2L9DA 3HHLC 3IAM9 4JI5F 2KZMA 1W9VA 4DRQA 4JFIA 5EWGA 2DNPA 4DR7J 2V8DA 1VC6A 4DRIA 3AQUA 1GMWD 2RS8A 1YBTA 3FCWA 4J9KA 4KB7A 3H40A 3V4IB 2V2KA 3BBBA 4Q22A 2CJXB 5B0FA 3CJ8A 2DY9A 2M8HA 1LL4A 2YWGA 3OQ2A 6FDRA 1GMWA 1JNTA 3M7VA 1DQ9A 4WE1B 1RAOA 3DYAB 3MECB 3QGHA 5KFXA 3ZZPA 1N5SA 2KE0A 5KFSA 1GT8A 3BZQA 2HHTA 1CULA 3D68A 2QFJA 3TA2A 4NSBA 4M5JA 1YI2S 1CLFA 3DKDA 4B9VA 2E44A 2CJ9A 2NPFA 2A10A 2HSEB 2V2ZA 3CJKA 3KACA 3QNWB 4OFZA 5LSRA 1H73A 3G6ES 2AD9A 1WNEA 1W1PA 3NKYA 3SFUA 3TZWA 3EICA 1X31C 2KJVA 5BXIA 2BW2A 1X4FA 4PPZA 1U6ZA 2PMHA 1R8CA 3MM7A 4HDGA 4C8ZA 3E8OA 4F8RA 2HNYA 1Q8KA 1M5OC 2OJ3A 3MF5A 2GO8A 2QTWA 2GHVC 3G82B 1IWAA 2QL5B 3GWCA 3AQPA 1CS4A 4TY9A 2XM3A 2CZ9A 2FVCA 3M4XA 4F0KA 4N5SA 3WQVA 2J7WA 1N1AA 5J2MB 5THWA 2GO9A 1ULRA 2HQFA 4X4SA 3QGGA 3KNAA 2KYXA 4ED8A 1HNIB 1NJZA 3O5DA 5DGAA 3AXKA 4ICLB 4NEZA 4U85A 3ARTA 1SC6A 5J1PA 3RGCA 2KT2A 5IZHA 4FP9A 4ES2A 5GAGI 4DRHA 1Q6HA 3MOZA 1N36F 4U7UD 1UA1A 2YNIB 2G2YA 2CDQA 4DR6J 2FGCA 4M63A 4AD6A 1FKTA 3DRSA 1RHQB 4YDXA 3I6PA 3QRQA 3K89A 3HULA 1U25A 2HFUA 2H1YA 5KFGA 1X9SA 3HK2A 1VCTA 4ED0A 4CQ1A 2CQDA 1TZ0A 2IUZA 3IC1A 3ILLA 2VPXB 5EDWA 1NUEA 2FHMA 5ETQA 2KGJA 2F2DA 2COLA 3SV3A 2AMCB 2V8PA 3N4WA 2IVMA 3KK2A 4NNRA 1RT4B 2L9WA 1A7XA 3MMCB 4NCGB 5LXYA 3K5NA 4K4YA 2BDPA 2AJ4A 3QWUA 1CC7A 1FKAF 1XNRF 1FRHA 1YDLA 2GAGC 2B5UB 3IR7B 2FC8A 2G0CA 3OFGA 4F4AA 4C4WA 4B3RF 1WF0A 2OHDA 2DH7A 2K8GA 3BPDA 4JV0A 4B3TJ 4Q8FA 4LF5F 4IT6A 1MROB 4QU7A 1FKSA 2O67A 1BQMB 1J4HA 2UZ5A 4O4GB 1CQMA 2BE2A 2BMBA 1BXNA 2GNKA 3IM8A 2OMLA 1GH8A 3WDOA 3CDBA 1UVLA 3BGOP 4F50A 2LXFA 4PWWA 2AT1B 2CQ4A 2RVJA 4CNYA 5IQQA 2Z8QA 4K5RA 1NSPA 3H4DA 2KM8B 1V5VA 4JP8A 5E33A 2MQQA 2IJRA 3MPVA 2CQ0A 3I5CA 1SUQA 1WORA 2LU2A 1YJTA 2J6SA 2GS8A 3E3XA 3AS0A 4ES1A 2FJEB 1BHNA 5HVHA 4DX7A 2UUAF 4U6PA 3MCNA 3LAKA 3UD5A 1PJ5A 5AJ3J 3MR3A 4J5OA 4CO3A 1Q53A 2R7OA 2UU9F 2HZAA 2UUBJ 4ZLNA 3LP1A 1U1KA 3D0HE 1RT1B 1D7IA 2IC3B 2XHWA 3KWMA 1HBNB 4ZPBA 5LM7E 5F3ZA 3L3CA 4UZBA 4C9DA 1UL3A 2W9CB 3ADAC 1RT7A 1T95A 2DCUB 3C19A 2CG8A 4K5SA 2UV8G 4NYPA 1V6HA 2CAJA 2O9OA 3EPIA 3P6YC 4WF9Q 3UI6A 1WC6A 3GTYX 1SQFA 4PTMA 2FIUA 3PW4A 2R8JA 4LUBA 3CHCA 3DNCA 4HH1A 1WI6A 3RAQA 4I2PB 1SJ4P 1UEKA 3PHTA 4I4BA 5L8RC 1PC4A 1HKMA 4LSZB 2DG4A 3B9AA 4FZVA 4J9VA 1DTQB 2XLKA 1XEZA 3IS9B 2CYYA 3Q8YA 3IGNA 4L72B 3TCZA 2DHAA 2YPZA 1AA1B 4M8LA 4MJKA 4NRUA 5LL6d 2VQFJ 2VJVA 3QIDA 4DV5J 1QVFR 4JI4F 4BC7A 4LRFA 4F3MA 2QC3A 1XMOF 3M8YA 4Z2JA 4JI3F 4FAPA 3D2WA 2QLFB 2PMZD 3TQEA 1HNZJ 2CQIA 4YR0A 1FRJA 1UFKA 4OJ3A 2LECA 5FLXY 3EGWB 3W8GA 1S7IA 2R2TA 3M8PB 2YH1A 4PG5A 3EWGA 1BGXT 3I96A 2AU0A 2VA2A 4I6YA 4URSA 5HW6A 5KFIA 4Q8EA 4OI1A 3VAMA 5KFKA 4DX8H 2RF2B 4J37A 3N6MA 3BF4A 4CLFA 1GQEA 5KFOA 4FYWB 4DFMA 3MPYA 3BO2A 3DLJA 1RYSA 2WVDA 2B6AB 4IFYA 4DWSB 3OOBA 1KLMB 1SV5A 3H42A 3HZGA 3IG1B 4GRSA 5IV3A 4GKKF 4LF7F 3A8KA 3ISNC 3WIVA 2MJUA 2E5IA 3MHYA 3W5XA 4B3RJ 4WK9A 2I0XA 3S6EA 4B3TF 4EZ6A 2RU3A 2IMWP 1NM2A 4I7FA 3NWRA 4MTVA 3TJAA 2HEKA 3KMQA 1D09B 3RB3A 3KYLA 1HQUA 1RTDB 3FEZA 1Y11A 1VC0A 3ZZOA 2MZTA 3MEKA 1HLWA 3QT6A 4EBCA 1H7WA 2L41A 3R5AA 1KTVA 2CUYA 4MK7A 4WWSA 5HP1B 3CCRS 4PEOA 1WOOA 3O2IA 3W8PA 3V81B 4C8YA 4MKBA 1E6VA 1YBAA 2DXEA 3K58A 1D2KA 1R89A 2IPOB 4Q2MA 3MM5B 2N4CA 4Y34A 2VASA 2RUQA 2HIQA 4ZHRB 5K14A 1SJ3P 3OHBA 4ZVEA 4ODQA 2UP1A 3B82A 2B0GA 4FF3A 3B4DA 4J9LA 5IV4A 3M9MB 2QMWA 2VCDA 4LMZA 1RAGB 2X7IA 1T3NA 1ACMB 1WG1A 3CJ0A 3U1LA 4WJBA 2MNTA 3SXLA 3FRZA 3U1NA 4ELUA 2XP3A 4ZVFA 1YRUA 4Q0BA 2DO4A 5KTQA 4X64J 3PX6A 1M0SA 1S49A 4DPOA 4OX6A 4NLQA 1ROUA 3SQGB 2UUAJ 1FF2A 2ZITA 2QN6B 3VHQA 4ZIVA 1HMVB 3GJSB 1RLDA 1RDRA 1C4CA 2FZGB 2J9CA 1U09A 1HJWA 1RCXB 4O3NA 4ANCA 2O92A 3PKYA 1SUQB 1XJWB 1P1LA 1IR1A 2G0JA 1XMBA 2DNHA 4P2XA 1ELOA 2KG1A 3CDUA 4F4WA 1LK5A 4ODLA 4KYZA 1NBEB 2ZWOA 2F4VJ 2UXCJ 2ZR4A 4OYMA 5EX3A 4OI4A 5E7OB 4DZDA 4EEYA 4DR7F 5L46A 3MMJA 4X62J 1D9FA 1UPMB 2Y1RI 1QAYA 1X8DA 2FPHX 5HMXA 3KLHA 1BLUA 2HFVA 3DRRB 3CEDA 1CSJA 3LH2S 4OZ1A 2J76E 4KKOB 3K5LA 3IBCB 4RUCA 1HWIA 1KVKA 3CGIA 1VHIA 3M32A 5DIUA 5HBFA 1TKXA 3P45B 2KHCA 3KG4A 5KG6A 4ZMMA 2N82B 2WCXA 3R5CA 1WHVA 1EHWA 3GZ7A 1NWUA 5KG3A 1HW8A 4B17A 1S1TA 3MM9B 1VQNS 3B8SA 2F9DA 2ILYA 4YR3A 1F1BB 4AQYJ 1Y7PA 1D7HA 1QDUB 3BN4A 2ZM6J 4A8YA 2QLXA 4JI4J 4KBIA 4YMEA 3GQCA 1HJVA 1JCHB 3QQCD 3CC7S 3KAGA 1RCOB 1IKWB 5IC6B 4Y28C 3C16B 3HX9A 1KC8T 2Y0SD 1U8SA 4CWBA 4IQCA 2IMOA 2ZJQQ 1UPPA 2ZE2A 3MR7A 4ID5B 2YQ0A 3PYGA 4LFAJ 3QRPA 2OAUA 4J9QA 1NK4A 4OZ2A 4DV2F 4NZ6A 4AXIA 4PWDA 3GYNA 1X4HA 4RL1A 5CABA 3IKDA 4ZPVR 4L75A 5CCLA 2D3O1 3K5OA 1I94F 5LMNJ 1S1VB 1U26A 3AD8C 1NPRA 1RWOB 4O44B 3TRGA 1S0MA 1RHUB 1Y9OA 1XR6A 3D67A 4BBYA 5C24B 4IO9Q 4G1IA 3Q23A 3FQKA 1OMSA 1ZBKA 3SCJE 4OZJA 4ZKAA 5KG4A 1R8BA 1REVB 5F8LA 1Y0HA 2FLOA 5K9FA 3G82A 4ZVPB 1PBUA 3RU0A 5KFLA 3WIUA 1CS4B 3BO4A 4RU2A 4DROA 2DGSA 4DXLA 3UPFA 1B7FA 1FKDA 3KUHA 3HSDA 3ZZTA 2IFXA 1KQSR 3EVOA 4C6AA 4K59A 3W66A 2BQRA 2GCFA 5J2QA 2HRTA 1RXOB 1HYSB 1RB0A 4MIAA 4TNOA 4QBUA 2OO4A 3FBCA 3QT8A 1RKIA 1T0TV 2P5VA 2DTJA 4JFKA 4HDHA 1GNKA 2C2RA 5DS7A 4IR1A 2HW3A 3OXLA 3BKFA 2ESCA 1BD6A 1ZPWX 4Y2MA 4AUKA 1R8HA 4DF4A 3PW7A 2ROEA 4B9SA 2CZ4A 4NLTA 1IR0A 4DRJA 1F8AB 4WYWA 4ECYA 4DS5A 1S1VA 2ZBCA 3TX8A 1SH0A 2HHVA 2DSWA 1EKSA 1R8AA 2ADBA 2MKIA 2ZH5A 5HMYA 1KD1T 1N32J 1ZZNA 3PRDA 1B0TA 1F60B 2BVZA 3F41A 4L76A 2OPSB 3A3OB 1HIYA 4ELTA 2AW0A 2DGWA 1M1KT 4UQTA 2B3TB 1FRIA 3NOGA 4B08A 1U6BA 2GHPA 1TKZB 1T9UA 2RF2A 3CW2C 2IDEA 3D4JA 5H9EJ 3DRXA 1FJGF 3DRYA 1QE1B 2R8GA 2VOPA 4Q43A 2NXEA 2OMOA 4NLOA 4L6V3 3KZ7A 1MWZA 2E1MC 1FDDA 4HI1A 4O3OA 4DZ3A 3T41A 3WX8A 5I3QA 3BBCA 2GVZB 3D6HB 4P74A 5D0EA 2OPRB 1SKWA 1JKHA 1R7IA 2VPZB 3HD2A 3FFIB 5D77A 1TL1B 1QJHA 2CWXA 2QMXA 1RHRB 1NSKL 3OSNA 1U49A 2MZJA 3BBFA 3AH6A 3MEDA 3MURP 3RM9A 1HKAA 1OPZA 2A6MA 2QL9B 2VPYB 1HBOB 2RB7A 3KLGB 3CMAS 4WIWA 1GUVA 4CM2A 2ZH1A 4DUTA 5KT6A 4LFCF 2BKNA 2D74B 4OYAA 4RW7B 3BXWA 1DRZA 2AYEA 2XG8A 4UOGA 3VVTA 3HDSA 5M2UA 4LRCA 2HHSA 1CJTB 4WU3A 2M5YA 1K0TA 1QZ2A 3M8QA 2NYIA 4NASA 1APSA 1NH6A 1JVWA 3FSXA 2DNYA 3KLIA 1WC1A 4FXWA 4DWIA 4M5MA 4X66F 4OHVA 1LNQA 1VIXA 5KT2A 4I68A 3T1YF 4PYAA 2YKOA 1FTRA 3TC5A 8ATCB 5JJBA 4ZITA 2ZJRQ 5A8WA 3I56S 1FJCA 3W65A 1TKTB 2I5JB 5ETOA 1ZA2B 2XHCA 1DZ5A 5L38A 1AZSB 2WK4A 4DL0C 1E6NA 1UR8A 2RKIB 2W25A 4QJVA 3HHLA 2P6TA 3VAIA 2UXBJ 3OLBA 3BGUA 1OJ4A 2O1PA 4JI6J 1O5JA 4XPCA 1FX4A 4F26A 1T9WA 2V2VA 2VKZG 3VTIA 4QCLA 2XZDB 3WX4A 3TO8A 2VD3A 1N8RT 2Q6BA 2DGTA 1H2UX 5L1JA 1RTJA 1H3DA 1F40A 1BQNB 1R6YA 1HBUB 3AA9A 4RPFA 3UDLA 4M95A 2AX1A 4NLDA 2BRLA 3GMGA 3ZXWA 4DUYF 3ZZYA 4NLPA 4MH8A 1HNWF 4JI0F 1MROA 4IG0A 4GVLA 4P52A 1XHGA 3QT7A 3SBMA 2IYGA 3GR1A 4F4XA 3UR3C 1HHQA 1DJ0A 1JB0C 1UETA 3CMES 3OLAA 4O3RA 1BY9A 2CNLB 5DO2A 2YKMA 4I7FB 2LQ5A 3UCGA 3CH9A 5EGYA 6AT1B 2CPFA 1RBAA 3EE3A 4YOEA 1IVZA 5F41A 4PXBA 2FC9A 3BV8A 1LW2B 5BYSA 3R3TA 5HN0A 4IFYB 2RS2A 3DLHA 3PO4A 4XDDA 4DI6A 3IG1A 1H2TZ 1CJVB 3MCOA 4DN9A 3EYZA 1K9TA 2ZD1B 4IDKA 3VALA 4JI1F 2LYVA 4CLTA 3NNHA 3T5LA 2Y78A 1Z2ZA 4NYOA 2APOA 3UCZP 1FAPA 1WC4A 5FIIA 3V4MA 1NK6A 5KFJA 2XP4A 1VBYA 2YX7A 3FBFA 1RHKB 4TY8A 5A8RA 4C0BA 4ZCMA 5I42B 5DZ7A 4J90A 1UWBB 2D3ZA 1S72S 2OTJS 1DTTB 1S12A 3DHXA 4UUWA 2XQCA 2AJ1A 4WXOA 5IS2A 4YS2A 3VGVA 2Y1IA 3N0VA 1W1VA 4C48A 2DCLA 2JJ4D 1QAIA 2HMIA 3R2CJ 4IG0B 4V1Ak 1XRVA 4Z2XA 3N28A 3SSQA 2KI3A 2W4DA 5CCMA 2PI6A 2GGPB 1GXUA 3UCUP 1S5ZA 1YX2A 2EXUA 3JQKA 1QUPA 1JQGA 1FEEA 3CJTA 1PG5B 2VC1A 4KSEB 1UJ6A 4W92B 1F2GA 1HPZA 4OYBA 3FRYA 5B0DA 2AJQA 3W62A 4P72A 2OI2A 1TVRB 1TU0B 5B0GA 4M5LA 3R5DA 4N8NA 2FJAB 3SFGA 2RAQA 2CQHA 2AJ0A 2DHGA 3T9ZA 3M6VA 1JLCA 3IR5B 2AEMA 2J0XA 2DT1A 1JKHB 1M1HA 1SL0A 1TAUA 1WEXA 2OSQA 1KP6A 4GC7A 2ERRA 1S0VA 2E7VA 2WAQD 4FF1A 2NZ4A 2VF3A 3UI3A 3LGMA 5KOXA 1ZTTA 1WG4A 1C1CA 3ICLA 1OY8A 2KG0A 3HHLD 1SJRA 1Y5NB 4DV3J 1S9FA 3W9JA 2CPYA 2LEAA 4WP8A 4DCJB 4DT4A 6FD1A 2Z58B 2C2OB 2HLUA 4HEA9 3B8HA 7AT1B 4GVBA 3I4HX 1VQKS 2MXYA 2RH3A 2ZHOA 2ZUAA 2ZNZA 2XP6A 3MAAA 3UN5A 2ATCB 4C11B 2BOPA 3EDRB 4RNHA 3NNAA 3D1OA 1WJ9A 1JLAB 2MKKA 1Q6UA 3G96A 2RQCA 3AS1A 4TQRA 3NGDA 2G41A 2WSCC 3R5JB 3WZ0A 1GEHA 3AD7C 3FY1A 3HVAA 4OYZA 4JI0J 3MAHA 4P7TA 5D4PA 2NS1B 2HVZA 1V9OA 2BBEA 2RUDA 3RMEA 5KT3A 4QW8A 2B4OA 2PV1A 2AF6A 3J7YI 1RWVB 4DZ6A 2AGOA 1RT6A 2LXIA 3O5FA 4LF6F 5DG9A 2ZOFA 1JLCB 2OIHA 3CZ8A 4W5UA 4M1KA 5GAEI 2OPRA 2DPEA 3KK1B 3CGNA 4FVCA 3FFIA 3THPA 2GQCA 4G1QB 3QLHA 2G1HA 1QM9A 2IYIA 4JOUA 1B0VA 1FCAA 2M0GB 3IXQA 5AE1A 2XCAA 2R4FA 3M1VB 1HNVB 3QYYA 1WNOA 1RT4A 3HI9A 1MSWD 4KV8B 3AOCA 4LF2A 1NPPA 5DQGA 5D78A 1SV5B 3GB0A 2PBCA 2OKQA 2P9CA 5KG0A 4WFNQ 1U47A 4I69A 2WTFA 3L7PA 1TFYA 3WL1A 5IT4A 4JYAJ 2DITA 1QD1A 3TZZA 1T11A 3S1TA 3QZ8A 1DBDA 2KB2A 4KH1B 4N7TA 2XPAA 1Q1CA 4ML4A 1CULB 4RBVA 4A8WA 5AE3A 4JI3J 3C3LA 3TJ9A 2EEYA 4CCHA 4DG1B 1I94J 2NUHA 3UNGC 2CNNB 4EK2A 2VOOA 3A8JA 4LBHA 4MAKA 3ZTOA 2W9BA 3IO1A 3HT3A 1S1XA 2J5AA 3RR7A 2MKSA 2POKA 3OR1B 4ZS6A 4OMFG 5HBMB 5KFNA 2X1AA 2XYPB 5IT9Y 4W9OA 2MQOA 1NEEA 3MM8B 1VGYA 1KR4A 1VRTB 3THTA 4ZVRB 5BJRA 1OPIA 2OFHX 3N6LA 2WSFC 1FVSA 3P3DA 4BCAA 1NDCA 3CXCR 3N5BA 5EHHA 2RDDA 1FKHA 2NCKL 4MIWA 4QWCA 3KHHA 1M5VC 1Q8LA 5J2QB 4OL8A 3P8BB 3GIRA 2F63A 5KFVA 4DV2J 1Q5VA 3RBDA 4OJHA 1KT0A 1HXVA 3OR2A 3OTBA 2HWHA 1U1LA 2FZKB 1JLEB 1U0HB 3ZTSA 2KFYA 2VG6B 4DV4F 4LFBF 2KFNA 1FX2A 3LP0A 4HT7A 2FJDB 2JLFA 4ICLA 4B3OB 1R0CB 3Q8UA 3PCOB 1HWKA 4X65J 1WF1A 3PZPA 2RSEA 1UFLA 3AT1B 2ZKUA 1RT7B 3ENAA 3KHGA 3IR6B 4IOBA 2VBYA 1RTIA 3GG1A 3U02A 2BUNA 4R5PB 2CVEA 1HKKA 2E1CA 2DR7A 4IH5A 4WP9A 3NNCA 2UXBF 1XR7A 4KT0C 3C15A 4EI2A 3SV4A 2W9BB 2VH7A 2YWFA 2YNFA 2GMJA 1OYEA 3D9BA 4DPUA 2OTLS 5IC4B 2L48A 3NY0A 3AOAA 1Y3KA 1Q81T 3NBPB 1PGZA 1E6ZA 1QPLA 1N4LA 1KVIA 3TX0A 2GHWA 4HHUA 1JJ2R 1N33F 1HI1A 3IMQJ 5I98A 2QYGA 4M5DB 3QJLA 4A8OA 2WW8A 1FJEB 4XK8C 5SZTA 2DSZA 1S10A 3NEKA 1PBKA 4OV6A 4XO0A 5IXUA 4CYUA 1UCNA 4ID8A 4DCPB 4ZCLA 4WZMA 1JXVA 5A6PA 3QBCA 1VQMS 1BQMA 4X4PA 4LF4F 1KRPA 2VIHA 2MZRA 2OP5A 3WQPA 2HWTA 1GTEA 3HFVA 1U2FA 5DF0A 1D9AA 4LJMA 4DV1F 1VQ7S 2DG9A 1TTHB 4GMKA 1V3RA 5K8MA 4V19J 1U1PA 1FKIA 5JH8A 2FTRA 1M5SA 2ROPA 1OQ3A 3H20A 1P9QC 1FESA 4CH7A 2R7SA 4C02B 3D0GE 3DLKB 3B78A 1SVDA 1NMWA 1YHQS 2YKPA 4EMDA 4LQ3A 1QLNA 1C0UA 4LSNA 3EY6A 2B4UA 5H1SV 3QRRA 3GPKA 2RILA 3JSRA 2LEBA 2BJ8A 2OLWA 2VODA 4PG7A 4RUAA 1HYSA 2A1BA 2YNGB 3HHDA 4QW9A 5JMNA 3V4IA 4R5EA 2KI2A 2JHEA 1BWVA 4LF1A 2VHGA 3GLJA 1JNEA 4KJIA 4F3QA 1S97A 2V8GA 2XP9A 4LVOP 4V19X 1RAHB 4OIXA 2DY1A 1S99A 1JNZB 1WKKA 2P2CB 3KHLA 3OL9A 3J81Y 5CYJA 4I0WA 4F25A 1L3UA 1X9MA 4XAKA 1DHMA 3MDFA 2IRXA 5HJYA 1SR0A 2RU9A 2GFFA 1GRJA 3I4PA 1XNRJ 3CC4S 1FKPB 3OXFA 1P27B 3FEYB 2GMHA 4Y65A 3W2VB 2DPJA 2VDHA 2ZKTA 1ZETA 3RB4A 1NWTA 2YNHA 1E44A 1ZBTA 3E01A 4TU9A 2CPXA 2K7KA 4FNIA 2BRKA 3DOMA 5K14B 1U7LA 1HNXF 2UUCJ 4DR1F 1VK3A 2DGUA 4RBTA 3FSYA 1FKJA 3SQGA 4RNNA 2WRMA 2ROGA 5ETMA 4ODMA 5KG5A 1E15A 4BS2A 3NLCA 1SJ1A 2EFGA 3HFZB 3T9NA 4F0HA 1OGGA 2JZ5A 1X5TA 2CPJA 4B3MJ 3O5OA 1MWQA 3MEDB 2W2QP 1VIOA 2MHNA 2V94A 2ZDOA 2WONB 3MM8A 2HFSA 4K4SA 5HTGA 2WLYA 3KJFB 1NHVA 1WDDA 3SQOP 4BHQA 3CF5Q 3MUVP 1RKJA 3JB9k 3GR0A 3HHEA 2ZOMA 2HNYB 3H2LA 4P8VA 1HR0F 2F8MA 2E5LJ 4NLVA 5E2QA 4DN0A 5D6GA 1HQ2A 3UVJA 3FBEA 1N5YA 4DDFA 1ZPVA 2LPVA 2C2ZB 4FS2A 1E9LA 2H5JB 2MGZB 3U1MA 1TUVA 3KADA 2E7XA 3A13A 1VRUA 4IG3B 2DT0A 3T6BA 2IA0A 1HBNA 4RW8B 1PYOB 2FJXA 3VR1A 2XP5A 5AXNA 1FKLA 4MFBA 3ZNJ1 1LJYA 3MEEB 3VCDA 2GMLA 4RLEA 2V4RA 2W8LA 2Y1JA 2HVHA 1ZBCA 3TANA 1TL7A 3C6TB 3LALA 4YFUA 4A48A 3IKGA 2HS0A 3DMJB 1HNXJ 1FKKA 1HHSA 5KFUA 4DL6A 4RJVA 3B6BA 5K8PA 2WONA 1ZM4A 2DT9A 5JVHQ 3LA0A 1S7HA 1P6TA 2RHSB 3FMBA 2E29A 1VR6A 3G71S 2R8HA 1E6RA 3D1HA 2E9RX 3TZYA 2ZR5A 4FPRA 4TQSA 3G8TA 3LWMA 2I2YA 3B9DA 3H59A 1OSDA 1RISA 2BM0A 4QYZK 3RRGA 2Q43A 4KO0A 1NCLA 1S0OA 3D66A 4K0KJ 3NXZA 2NR0A 2J8SA 2CQGA 3TUZC 4K2XA 1AB8A 1LWCB 3UW1A 1VQ5S 3DLLQ 1QSYA 3DI6B 4ED2A 1C0TB 1YZ7A 2HNDB 2M1IA 2NXCA 2ZZTA 3ET6A 3GP9A 4NZ0A 1KNZA 2WK2A 3BPSP 4GVBB 1PILA 5AXMA 7FDRA 4USIA 2NREA 1KFWA 2ZEJA 1FEHA 2A3JA 4PXCA 2DHSA 3LANA 2W8KA 4ECRA 4NLGA 2PN0A 4ITZA 4DWSC 3KJVB 1KQFB 2WSEC 4XIUA 2VG5B 4HI2A 2PN6A 4NPOA 4OI2A 5DJBA 3AOBA 4ZVSB 3QO9A 1FTCA 4JB8B 1KHVA 4TXSA 1S79A 3IRWP 3H5XA 4KTQA 3LQVA 1PYSB 2QGFB 4CLUA 1T9YA 2GJFA 4FF2A 2F5GA 4UW2A 3D1QA 3BEGB 4DRPA 1X4CA 1YVFA 5F0WA 4Y00A 3D54A 2UV8A 4DV0F 3FXYA 5J2NB 3DXSX 1SBRA 1VDHA 3J80U 4HARA 1VISA 2RHQB 2B7CB 3UDCA 4FXDA 4M5IA 5F9NA 4N77A 5IOLA 2QSFA 5KOWA 2CQPA 3CPWR 2AQ4A 1NJIT 1LWCA 1D9DA 1AYEA 1E6YA 2Z56B 2G1DA 3EGVA 4ZN1A 1F3VA 3EZ5A 1IQTA 1H7XA 1RU2A 3GIIA 2IAJB 5KFPA 3QMQA 4DSJA 1W1TA 1VBKA 3KHRA 4K4UA 4ZP8A 4MKYA 5J2PA 2IM3A 3JAMU 2W7AA 3BR8A 5D4OA 4QIWD 2KU7A 2E5LF 2ZUGA 4OJGA 2ZJPQ 2ZDPA 2V4QA 1JNDA 4ITSA 1K1QA 2ZH8A 5HLFA 1K73T 3O5PA 2BQ3A 2LQ8A 4IPXA 3DDNA 4IO1A 3ULHA 4MNMA 1S57A 1S76D 5HKGA 1N5YB 3ZTRA 5HW8A 2G4BA 5I42A 3EZUA 5HWCA 1PAEX 4ZP9A 3SCLE 4YUDA 1RAJA 3ZNUA 4DRMA 2HWIA 4ILRA 3RUBL 5DG8A 4ANEA 2FVQA 1WTBA 1VQLS 1IR2A 5LSLA 1NZAA 4MK9A 5GPRA 4FDFA 4F04B 3H8YA 2M70A 1HWUA 3AQOA 3AY0A 3M6WA 2CQBA 1D6OA 4X4TA 3FNNA 1Q79A 2KN4A 4QIEA 5A8KB 4PABA 2RDJA 4EBEA 4BF8A 1N56A 4WKFA 3R7BB 4GO5X 5ETVA 2HZVA 4LAYA 1BWEA 2KR7A 4PG6A 8AT1B 4W9QA 5HT1A 2BR0A 1K44A 3G6LA 2YWWA 4R5PA 4AL6A 2XS5A 1RABB 2V67A 4HHJA 2F4VF 3FAPA 2YBTA 4C8KA 1UVKA 2CZVC 3RJMB 5AXLA 1RTHB 5ITHA 4K4VA 1F5AA 2WVFA 4EFAC 3ITHB 4OZ3A 3MAQA 4DPYA 2PT0A 4CO5A 2G2OA 3JS9A 3HJFA 5KT4A 4O23A 2K1RA 5E3CA 4LAXA 3BGFA 4R8UA 2LXUA 1NJYA 3H25A 4NA1A 1NKEA 1OQ6A 1PJ6A 4I2PA 5AXKA 3CJ5A 1G1XA 3LUYA 1TR0A 5DITA 1UW9A 4OYOA 1SIZA 4ES3A 1VQ6S 4IQ2A 2DBBA 1IKXA 4CDIA 3RYLA 4DR2J 3IWNC 4ED5A 3DGVA 3KDOA 2O01C 2YKQA 3DDIA 4U95A 3Q8QB 2AYMA 2W4PA 3O5TB 3HHNB 3O5IA 4GIVA 4RU9A 1BE4A 3A3NB 3D0IE 1FVQA 1I6JA 1BMQB 2PEHA 4WIQA 2BJ3A 5EN1A 1XN9A 3MECA 1HBMB 1EETB 2B4PA 5HJXA 4RNOA 1S6OA 2OELA 3QLHB 2Z4PA 4DV6J 2F3JA 4WK3A 3G9CA 5HROA 3MUTP 2J0QD 4O0IA 2DGOA 1R9HA 3JQMA 3KLEB 4NXMF 4DCOB 2H3EB 3CJ3A 2IRYA 4Q45A 3R5GA 1YJVA 4DL7A 2ZH6A 3KABA 2CPDA 3HVTB 2EWHA 1BKFA 5B0EA 2MYFA 3DDKA 1IKVA 3M1VA 2Q3PA 4MAVA 2W2OP 3CO9A 2OLHA 2CQ2A 3HZEA 3M2VB 3TYTA 2A6OA 1NHKL 2HRYA 3L7OA 3JTOA 1VHFA 5EUHA 3BREA 4FN2A 4DUYJ 2DR5A 4Z7CA 2FB0A 1PIEA 3LP2B 4J91A 4QIBA 1S1TB 1ROFA 1WG5A 3E01B 3ETMA 3MM9A 4LF8J 1TAQA 1HARA 2UZAA 4RUHA 1T03A 1VQ9S 3DOKA 3ZFVA 2DRDA 3GJQB 3LOUA 2R3VA 4H54A 1RE1B 3HM9A 1F9EB 1RGVA 3GFZA 2BJ7A 1FKPA 1FFRA 3MCMA 4RZRA 1NXIA 5M2PA 3EPGA 1XTZA 2R7QA 3EMTA 3VZHA 3KJVA 1EQMA 4KE5A 4NL5A 3NGUA 1IBKF 4ZVGA 1XK8A 4ILLA 1ROTA 1IKYB 1KBRA 5HVGA 3PW0A 1FJ7A 4H4MA 2KXHA 1WUUA 4OHZA 5G0RB 3QWPA 3AJ2A 4EUVA 1VJQA 3Q2SC 2PV3A 5C42A 3GIMA 3H4BA 1VBZA 3PR4A 2C3PA 2MDAA 4RNMA 2XGQA 1N34F 3EX7B 4USTA 3QO9B 3DFEA 2C3YA 1ZCNA 4B3OA 2EW9A 1R0AB 1JLGB 1TV6A 1BC6A 2F8EX 2LCWA 4EGLA 1ZBVA 3VZIA 3KLFB 1GOIA 4USJC 2KO1A 4OX9F 1TK5A 3M2VA 3MM5A 2JLEA 2VPWB 4OZ5A 5IWAJ 4F4KA 3KLGA 1OY9A 2PEBA 1L1PA 3AROA 2G13A 3BQ0A 4K4XA 5HQ8A 1RTDA 4OI0A 5JVGQ 2HAIA 2KDOA 3M2RA 5FD1A 3ARWA 3BDEA 1FKOB 3OW2R 3TEHB 4JV2A 3PW5A 4LF7J 1KKHA 2VFUA 2WOMB 2JFDA 3BSCA 3GCXP 1RT5B 2DNRA 4ALZA 4IFVB 1DFDA 2YWEA 3AS2A 3JSBA 4ZA1A 3OL8A 1WACA 1S1UB 2W4CA 2VICA 4CO2A 1AW0A 1BL4A 2I1RA 2ZC4A 4NLUA 4WE1A 3WQWA 3ISZA 5B0AA 5C2GA 1WEZA 4IKAA 2OFNA 3ARZA 3H90A 2FDMA 4FYXB 2B6AA 5F9LA 2HMIB 3DM2A 3H5SA 1LW0B 1RZMA 2AZ1A 2F4FA 1CJUB 3QAEA 1D7JA 3CJ2A 4M5NA 5DDQC 5GAEU 2XMKA 2FJVA 1YLXA 1TKTA 2FJBB 1O6XA 2H4WB 2I5JA 1GPFA 2IC3A 3I87A 4NEYA 4LAVA 1FRKA 4UF4A 1NMEB 3GYGA 1X4EA 4FN5A 2AJ2A 2QRRA 4DR3F 1T8EA 2YWHA 1NK9A 1N6QA 4IQXA 3FZBA 5LOQA 3ENWA 3J7A1 1OYDA 3RFWA 2EK1A 3HT0A 4QT3A 3MOJB 3C66A 1MMLA 1WD6A 3IBWA 5DDPC 5HMWA 4LRDA 3EZOA 3FBBA 3TVKA 4LREA 1NSGA 4KFBA 1HA1A 1R0BG 2HQIA 1KWMA 3QGPA 2G0IA 4FNHA 3M2RB 4EO8A 5U47A 3ZZZA 2E66A 2KVIA 4NLYA 4QR1A 2M2BA 2DK2A 3RAMA 1D0EA 2BZ2A 1KEKA 4WFAQ 3LAMA 1KFSA 4LF8F 2V50A 3DLKA 2B8PA 2YBVA 3RZAA 3WD4A 1FD9A 1YRTA 4PQUA 4DPTA 5LMUF 3IN5A 1UW4A 3OTCA 2XZTB 1J27A 5E3AA 1LG1A 2QZ8A 2FLPA 3NL0A 3Q2TC 3SDEB 3KOAA 4ERDA 1B3TA 1WSVA 4P8XA 3NS5A 4PPDA 5ETSA 2DEJA 3CJKB 3TWZA 3DLEA 4ED1A 2BV3A 2GIFA 1S6QB 3ELHA 5GADI 2NQPA 2DYAA 5D8HB 3W9HA 1PKUA 2WVBA 3MMCA 4NCGA 2P4VA 1F5BA 3K17A 5D0GA 1D8ZA 3IRXB 2W2MP 4N56A 2V69A 3DN9A 2CJKA 2PI5A 4Q7NA 4JI7J 1CTNA 5ETRA 2OPQB 3ILOA 3O5EA 2F23A 4ECTA 2H65B 4ILMA 3BGRA 4JI1J 1OSCA 1Q1KA 2RURA 4ECQA 2DNMA 1B70B 2W7PA 3WD0A 4ER8A 3VVUA 4YHHJ 2BANB 4C0OC 5J1NA 3NG8A 1KFDA 1UWAA 1URNA 4N19A 2XYGB 2IIHA 2XMUA 4ZVTB 1SIWB 4P73A 3DLGA 3PXGa 4NZCA 3RRKA 3TR5A 2XO6A 1T02A 5E3PA 2YNIA 4UQGA 1EIYB 4NMXA 3CD6S 1WC3A 1ZL1A 3M30A 1RT2B 1LL6A 2YQ1A 5D75A 3HJVA 3IM9A 4WP3A 5I3UA 2EFVA 2HQDA 1T9TA 3MWBA 1HI0P 3UWTA 4OYXA 2HBRB 1KN6A 4ODOA 2IBKA 2HK2A 1HJXA 1FWLA 1RQ0A 3ARPA 1TVRA 1AXQA 2HBYB 4GO7X 2QV6A 4CZCA 5I4MA 1A0OB 2RNEA 2MSTA 2YKNA 5KG2A 4ZHRA 1NU4A 2XMVA 5A2QU 5F0UA 2EKYA 1UP1A 4UT4A 2XS2A 1TP7A 1X4DA 2XGPA 4O3SA 3RBZA 4K4ZA 2MQLA 4CYUB 5KFBA 4L3NA 3CSKA 3OSPA 4OQJA 1RWXB 4LFBJ 2WVCA 2X1GA 1ZM2A 2FDNA 4A8MP 4QWEA 4B3SJ 3HKWA 4Q44A 3ILIA 2OPSA 4WIIA 2PDAA 3K8WA 2XBPA 1RWKB 2HNZB 2ZR6A 2GVZA 2JOQA 4OV1A 3HSZA 5F8NA 4ZLLA 4DR5F 2HGNA 1DARA 3GFYA 1QAXA 3MEEA 2FY8A 2CDRB 2QJ3A 3WH0A 2W2PP 3KG1A 3QFHA 4LIRA 4LRAA 4WKAA 2BACA 2ITKA 4J7CA 4LQ9A 2VG7B 2XWYA 3MMAB 4PG4A 5IM0B 1UMJA 2A3AA 4A8XA 5HW7A 2EFNA 2MPHA 2YX4A 3AS3A 1TL4A 3OD2A 1K0VA 1NSQA 3LO3A 3WD3A 3RG6A 4OHYA 4HR2A 5GQBA 2KFWA 1AUSL 2G9OA 2PA3A 5GADU 4X64F 4RKUC 3UI5A 2D9FA 1RBOB 3DM2B 5LMUJ 1FHTA 3VAKA 2E1PA 1SQGA 1R3NA 2YQ3A 4LF5J 2Z2YB 2ILZA 3CHEA 3BYRA 3LP0B 2CNKB 4USVA 4CRJA 3K5MA 3FJ2A 3HCXA 4JI2F 3CCMS 1OWQA 4IRCA 3RBXA 4IR9A 2VQFF 3KLFA 2K8IA 3R97A 2IM2A 1A7GE 2JEJA 3L9ZA 4F36A 2KRRA 2L9NA 1JMTA 1UVMA 2JX2A 2RRBA 2E7WA 2ZBRA 2DEIA 1CBKA 1PAUB 4KHRA 1QTNB 1J2VA 2GGPA 3I0RA 3GV7B 4K4TA 2DSUA 3W2VA 2KZZA 1G3OA 1NWRA 4P10A 3UNYA 3V5RA 4AYBD 1FJGJ 3J7AN 2Q66A 4DV7J 3RR8A 4KQZA 1ZS6A 3TI0A 1Q5YA 2B5JA 3W5YA 2AJFE 4YHHF 4FKXA 1U48A 1G2EA 3CJSA 1IJEB 2QF8A 3PACA 5E3RA 3RAXA 3MD1A 5HQMA 1YBUA 3W4RA 2HZCA 2JFKA 1J4RA 5L1KA 2Y8WA 1FWPA 4RO0A 2YNHB 4B9TA 2E9TA 1RD6A 4DFPA 3PW2A 2C42A 2ZZNA 4FVMA 2RKIA 4GKKJ 2IHR1 2XI3A 1Y5IB 2FYXA 3LW5C 2JSXA 2ZE2B 5C24A 3ZTQA 2YXLA 1OWXA 5H9EK 1EIBA 3LUOA 2AV5A 4O44A 2Y1LB 3PJXA 4Y2IA 3DGPB 4DHVA 4N41A 2PFFB 4LF9F 3BKUA 5A0YA 1WWHA 2J9DE 4KRWA 4DPXA 2V8HA 4NLSA 4ECUA 5GPGA 3CE8A 3HVTA 1WKJA 1ZAXA 4Y2AA 3GPAA 3UN2A 4CNZA 1CJTA 1E6YB 4JBCA 4Y0FA 3MFHA 1FFGB 1R8PA 3QSIA 3GIJA 4F2SA 1WDTA 1EP4B 1WF2A 1S0NA 1L3TA 1S9GA 2I38A 2GJ2A 4QOTA 3O5KA 3W9IA 3T1HJ 2XCPA 3ETOA 1MU2B 1SKRA 1L3SA 2XNRA 2JZVA 3PRBA 4R0XA 1FWKA 2K3KA 3TUJC 5CXTA 3OL7A 3CDWA 2CQ3A 1JJCB 4TN2A 3R9LA 1N5QA 4ZVUB 1TL3A 3EGZA 3QT5A 2MSSA 3EDQB 3FUYA 1P5QA 4ZP7A 3KK1A 3HHKA 5GMEA 2KYZA 3POTB 2FUG9 1J6YA 5F8GA 2N7YA 3N79A 4C0HA 3TARA 1DY3A 2D3UA 3E51A 1MMNA 1IUJA 5CYQA 3OHAA 1ZAWA 5ETKA 1ICEB 4ZP6A 3MI7X 1MN9A 2ZBPA 3DHWC 4W4MA 1UTAA 2PE8A 1XIQA 3KXDA 5HVFA 3VF0B 3B9EA 4A46A 2MZQA 4FXVA 3JAMY 4YR2A 5KFFA 4KC5A 4MKAA 1N0VC 4M5DA 4PWUA 1UKUA 1HNWJ 1B64A 5DQHA 2X3GA 1B4SA 3WIJA 2RT3A 1ZBWA 1TKZA 2UUBF 2JH3A 1NNDA 3VAFA 3CT9A 1D8YA 3G4SS 3T5JA 1LWEB 4Q2LA 4C8OA 5GMKa 2W24A 2F1FA 4UOCA 2FGOA 3L09A 4J9MA 3OTOJ 1S1UA 1WEYA 2LA6A 3NRKA 3OTEA 3Q8VA 3GV5B 2FQQB 2XSJB 4ANDA 4CT8A 3ARXA 2ZWPA 1X0FA 2AKWB 3H98A 4XPEA 3J80Y 1YJ9S 1N32F 2V0NA 3QOKA 1VLOA 4QU6A 4WFXA 2PGCA 4FYYB 4Z37A 1KS2A 2CFXA 3B7XA 2FHJA 4JYAF 1F2HA 4DUZJ 3CHDA 4DIPA 4S0MA 1RTHA 2R7WA 2NXJA 2PMWA 2BJ9A 3W1YC 4OLOA 5C2CA 4X62F 3Q8SB 1EAYC 1O51A 1JLBB 3AD9C 4O4RA 3DOLA 5A6WA 2PFDA 4MKVA 2NZCA 2WB1D 4QQBA 4CI0B 1RAAB 2CXEA 3WKZA 1MMDA 3OR1A 4YY3J 2PD1A 4ED4A 5CH7B 3SZ2A 4ECXA 2EC2A 2J6TA 4TKTA 3WC2A 3KK2B 4QIVA 1S77D 3ALFA 1F0XA 2C1EB 2LQ9A 3H0PA 1XR5A 4RW8A 3ISND 4DR6F 5E3QA 2I6WA 2HNZA 1HNZF 2PV2A 4DWSD 5IWAF 3QJPA 3KAIA 2DVIA 5E0OA 1JJHA 4J9UE 1PO6A 4DL5A 1NRKA 4ECVA 2MF9A 3NMRA 4Z2KA 1EKRA 4OHXA 5LMNF 2DRBA 1YJ7A 3Q89A 1U79A 1NO8A 4ED6A 4DFKA 3GV8B 1FRXA 1EJ7L 4BC9A 4J9SA 2ASJA 3PFOA 4UZCA 5H9FJ 1NK8A 2HS3A 2ZH3A 3DRPA 2YX1A 3UQAA 1HW9A 4LBIA 2HHHF 4ZPWR 2XC9A 2OH2A 2DXFA 2MQMA 2WLZA 2XMJA 4Y6IA 2UXDF 2XB2D 3CGMA 1I5OB 1R6VA 1TUGB 4M5HA 2HQCA 4IOCQ 4ID5A 1YW5A 1X5PA 1SL1A 4ECZA 2WHOA 4KIAA 4MIBA 3FMWA 3TEGA 1NH8A 5ETLA 1FKBA 1H0IA 1ZB5A 1T3OA 2B9XA 3C16A 4ZVOB 3TJ8A 1Q82T 4RNFA 4DSEA 3K2YA 4OYPA 1NAQA 3NOCA 4ODKA 3UVJB 2LP4A 1RI7A 5KFEA 1IKVB 2V8VA 1F5CA 1VQOS 3LPYA 1MWYA 3BKTA 4DSKA 4UY85 3C14B 3CCJS 4WCEQ 2AZ3A 4DQPA 1LOUA 1S59A 4ZPAA 2ACYA 4NCBA 1GXTA 3H7HB 2HQ3A 4PUOB 3ONQA 1NSAA 4WFYA 2GAHC 2B9YA 4E98A 2ADCA 2KTQA 4A8KA 4QYRA 4OX7A 4D3HA 1FT8A 1KTQA 4H4OB 1VMBA 5RUBA 2ZVIA 4QZVB 1P9YA 4ZLJA 5KFDA 1YZ6A 3BGRB 1MN7A 5G0RA 5C42B 2AX0A 5JXSA 3RW7A 3H9RB 2C3OA 2MY7A 4HT5A 4K7QA 2QA4G 1H74A 2GZOA 5SUHA 1IKYA 2MEWA 1MG7A 4DQQA 3QATA 4RW6B 4DMZA 2OD4A 3H5UA 3V6HA 1U02A 3SIPB 2KXNB 1JLAA 3RRHA 1R0AA 4FKYA 1XMQJ 3DLBA 2PO4A 3JXVA 4RWWA 2KXFA 1QSSA 2D9OA 2KT5A 3AJDA 2VFTA 3POTA 2KO7A 1S1WA 2RSQA 3HD1A 2XP8A 3QIPB 2DKOB 4LBPA 4C3LA 1LWFA 5D15A 3PVXA 1FI4A 3RTVA 3C6UB 2M9KA 2R42A 2BJDA 1HMVA 2QE5A 4RW7A 1X9WA 2H5EA 1FXLA 4USWA 3P4UB 2LDYA 3UD4P 1PINA 4OZLA 3MD3A 2EBGA 3I9V9 3K57A 1Y10A 1YJRA 1ZA1B 2CJYB 3CMQA 3F44A 1IXKA 3K7RA 3DI6A 3QFWA 4TNSA 1FO1A 2N4DA 2Y0BB 3ITHA 3KKFA 3NS6A 3S01A 3S7RA 1EP4A 1Q95G 1CJKA 4JFLA 2LA4A 3W7BA 5CD4A 4KPYA 2HHQA 1IBLJ 1K9MT 1A9NB 1G6BA 2HBZB 3PIOQ 2B9WA 1KOHA 2P9GA 2ZHBA 3KLVA 2W7OA 1QY7A 5D3GB 2HYIB 1HPZB 1WHWA 4DF8A 3DU6A 2GQQA 2O66A 3IA0A 4F0MA 3M6UA 3D28A 4USKA 5GAHI 2A3EA 2W1BA 1RUSA 4C98A 1Z4UA 3G8SA 4LFAF 5F8JA 2XI2A 2F65A 4U9RA 3KUEA 4C8NA 3SCKE 2ZQSA 3V81A 4JV5J 4DEZA 2MZSA 4P2SA 3TAPA 1HWJA 1PJ7A 2HFOA 2ZFHA 2BQUA 4QT2A 2A2DA 3NBPA 3PY8A 1VQPS 4E8UA 3B4MA 2D7SA 5HROB 4ZN3A 2ASDA 4CH1A 1XNQF 2LVWA 2BM1A 4BWJA 3NWGA 2W01A 3EJMA 3JTNA 4L74A 4ZVHA 3UQBA 1N5VA 4DL2A 1U1OA 2OPQA 2E5GA 3P5BP 3MR5A 1GXLA 5DLFA 2QYCA 1Q7YT 3G87A 4U86A 4F2RA 4I67A 1HL6A 3EVMA 3M6XA 1J5EJ 2F9JA 2QLBB 5I3PA 3C46A 2J8AA 4H4KA 4URQU 1WHXA 2BKPA
chains in the Genus database with same CATH topology
3LF0A 4QPTA 2XS7A 1YJWS 2DD8S 2ASYA 1UEVA 5J6EA 4RW4A 4UUXA 2P9EA 3MCSA 3ARSA 4DV3F 3I0SB 2QT7A 1HKIA 4WTYA 5KFZA 3CCTA 1Y4ZB 5J2PB 2HLTA 3OBIA 2PI4A 2R2SA 4ED7A 1KONA 2Q5AA 1VF8A 4U84A 2C3UA 3CJ4A 2B51A 4IH6A 4RW9B 5MLCV 1W2BR 2K2PA 2Z0GA 4NXNF 1V3ZA 5L9XA 1UJ4A 2JC1A 3DOLB 3L95X 3P5TL 1OGBA 2XO7A 1SKSA 2VZ9A 4U67Q 1EYMA 2G8ZA 4QWBA 4OI3A 3J7YU 1R31A 2A3BA 3LP1B 2DGVA 3SEOA 2RRAA 5CA5A 4AXJA 1ZTWA 1YGYA 2CJBA 5GAHU 2DT3A 1S6UA 1UVJA 2VBXA 1U24A 2M08A 3O5RA 1YG0A 4PR6A 4NRTA 2XY6A 4RW4B 4X4UA 2R8IA 4C3MA 2W9CA 1CG2A 3CDEA 2WM0A 3TDBA 1OS5A 3JTPA 3RB0A 1L3VA 3IHZA 1TL5A 1AFJA 4NLXA 4F4ZA 1FD8A 1H6KX 1RJJA 1S1XB 1LKZA 1FDNA 1NJXA 1FKGA 3W2WB 5ADZA 2J0SD 1PC5A 3PX0A 2V5HG 4IRKA 1J5OA 4IFVA 4FBUA 4K0KF 2YKNB 3HFKA 4DJBA 4JUZA 1CC8A 1DAXA 3TQ1A 2O3DA 3JYMA 5DM6Q 2E5JA 2PC6A 2YNGA 3ARQA 2DT2A 4HLBA 4GKJF 4TW7A 2U1AA 4N76A 2F21A 3V6DB 1G7CB 3G86A 3H2UB 2VB6A 1C0UB 1HI8A 4LSNB 4K50A 3DRRA 1L3KA 4DSIA 5LXRA 2EK6A 3M8RA 5J2NA 3MXHP 1JX4A 1EDQA 1Q78A 4MYUA 2OSRA 5FJ4A 4KR0B 4S3KA 5GAGU 3HVRA 4H4KC 2ZQTA 3SI8A 1S97A 3FQLA 4QIFA 1VFJA 3OFFA 3JYJA 2LKZA 2UUCF 3VQSA 1J5OB 4Z2IA 1EETA 4Z2GA 4X4OA 4D3GA 1W9UA 5A8WB 3I5BA 3ZC4A 4IYQA 3VWSA 3O44A 3NAHA 5T7LB 2IRUA 5HWBA 3E2EA 2HHXA 1GTHA 5HI7A 4URGA 1HD1A 4B9LA 2FVRA 3UQSA 3SDEA 1SJFA 1AUDA 1KQGB 2NPIA 1P8GA 3GG0A 4FS1A 2IJFA 1W1YA 2VUGA 3I31A 1RT3A 4I6AA 3JYTA 4EZ9A 2VA3A 1RA7A 3WD1A 2WBMA 3N01A 1E6VB 2KFZA 1JLQB 1FNOA 2LMIA 1FKOA 4QPXA 3NMAA 1YITS 1OIAA 5E5NA 2LJ4A 4ODRA 2XULA 3I0RB 3OVAA 2D3OR 3PR5B 3OJUA 3TA1A 3O5LA 2IBOA 3GFHA 1FERA 2VC0A 2VQEF 2DR9A 1KOOA 3UR0A 3W3SA 3CCVS 4IUFA 1M5HA 2FHJD 1H98A 4LGXA 3HVWA 4PXDA 5B7WA 5KT7A 3TP2A 2DR8A 1SH2A 2DNLA 4DQRA 4C3KA 4DG1A 2RJZA 3FVYA 2K3IA 2DHXA 1VRTA 3CCQS 1R27B 5LJ5Y 1JXEA 2R2UA 4WZQA 5HBMA 4F4YA 5J1EA 1S48A 3GIKA 1CVJA 3RM8A 2NUUG 2ZVSA 3CIMA 1F9FA 2QA4S 2GIRA 3M8PA 4AFFA 1UWBA 2C3MA 3DC2A 4X4QA 2FAPA 2MY8A 3K0JA 1H38A 4MNJA 4Z2HA 5CYMA 3O5MA 2XMTA 4DH0A 3QAUA 2JC0A 4NWBA 4KGKA 4TU8A 2J7UA 3AB2B 3TAMB 2MKJA 2VFRA 4X2BA 3T3FA 1VC5A 2CPZA 5J2MA 1R43A 3OXGA 3UQIA 1UA0A 4KGMA 4USHA 1JNSA 1IKWA 3I32A 2JL9A 2PA8D 3BM7A 4Q5VA 5F3TA 2HS4A 4K4WA 3N5FA 3BSAA 2EBEA 3M2UA 2XSFA 3WL0A 2DNKA 1D3WA 2WB4A 1S1WB 3BR9A 4LVNP 2CVIA 3MDYB 3FDSA 3NI6A 4ZPCA 1J5EF 2XWXA 3F56A 3HHLB 3X1LB 3UE2A 1DQ8A 3HP6A 2XPBA 2FVSA 4ETXA 5B8IC 3PEHA 4O3PA 3FZ2A 2MZ1A 3BQ2A 1X6NA 4KHMA 4YB7A 3T1HF 3PV8A 5KFHA 2Q79A 4P7VA 3ZZUA 1SYTA 4U7CA 3R1LA 3EXCX 2A3CA 1LWFB 2KKHA 1RK8A 5C5JA 4YP3A 2CRLA 1LWEA 1T03B 2J9DA 2AWGA 3DOKB 3ENQA 4PXEA 1XC9A 3CVKA 3M8QB 3OFEA 2W9AA 2DJWA 3LP2A 3CD5A 3PIPQ 2QEXS 1UVIA 5KFRA 4C2MA 5K8NA 2B7BB 1HWLA 4CH0S 3KMSA 4IQMA 1K1SA 1IBMF 3BQ1A 3MTKA 2VONA 1RTIB 3NRBA 3DLEB 4IH7A 1OO0B 2IJNA 2JDJA 1S6QA 2EPIA 5DDRC 5D4LA 4J9OA 2GV1A 2NLWA 2RQSA 2RD5C 3A8EA 3NCRA 4NOHA 4OZ0A 3V6DA 4A47A 4RBUA 4WYLA 2GC8A 4WK1A 3JSMB 1FNMA 1UJ5A 3MMBB 2XP7A 4DV7F 2M3DA 2UUTA 3EXYA 2D41A 1YJNS 1DLOB 3KAHA 3M05A 4EBDA 1C4AA 3DGPA 1YQHA 4ZCIA 3MR2A 2C2DA 3QPIA 4C8LA 4IOAQ 3DCAA 4LAWA 1WI8A 4HVZA 1L5UA 3PM9A 2CQ1A 2DRAA 1IKXB 5KG7A 1TFWA 5C25B 1NWSA 1N88A 3D5MA 4ECSA 1O8BA 1X7VA 4ZOSA 5DEZA 1X0PA 4R25A 4WFBQ 4RW6A 4DOZA 3DRPB 3SYZA 4DL4A 1URRA 5BXJA 3U7JA 5B0BA 1NK5A 1T7PA 1QE1A 2XNQA 1NMVA 3VQTA 3GYXB 2ZOGA 3WC0A 4LT6A 1IJFB 3CCWA 1LFPA 2LEPA 5B09A 2RRNA 2HFZA 1N48A 2DPIA 3F73A 4B9SA 4Q8EA 1IX5A 1EQ3A 1YIJS 3IK8A 2AYBA 2M88A 4PCQA 4CTAA 2DSVA 1TQLA 3R1HA 4FYDA 1FJDA 1NB7A 1LG2A 1ZK6A 3HF5A 2OPPB 3KG0A 2R8KA 3ENVA 1JLQA 2O5DA 2FJWA 2FY1A 2M8DB 1KVJA 4QR2A 2JVRA 3OR2B 3IWXA 4X65F 2MLYA 4MGVA 2CPIA 5CHCB 1H0HB 4C97A 2ZNYA 1GX5A 2OD6A 3CB4A 4HBEA 1REVA 1Y3JA 4ZLPA 1LL7A 1HQEA 3OA5A 1S6PB 2CJQA 3I82A 2HPUA 2LQJA 1KQKA 3SSSA 3R27A 3TAMA 1SL2A 2HMIB 1HYSA 4HL9A 2DH8A 3KLHB 2J9EA 2DG3A 3MMAA 5IM0A 3LGNA 2XSJA 4TW6A 4WJXA 1N5TA 4ETZA 4JV1A 2KRBA 1ZOTA 2QIFA 4YDDB 3HPOA 2MJNA 4DV6F 2MLXA 4TW8A 1BQXA 2VKRA 3QIPA 2F8HA 4MFBB 2OPPA 4Q7AA 1NJWA 1N5YA 1P1TA 3I6CA 2DB1A 4B3MF 2JVOA 5HMZA 5KT5A 3NTPA 3ALGA 4URIA 1IM4A 5DLGA 1FE4A 3J7Z5 4ECWA 2JWNA 1RT1A 3PFEA 3VAHA 1YRXA 2M4MA 4F3OA 3SSRA 1ITXA 3AB4B 1RYRA 4LSLB 4W90B 1C1CB 3M9NB 1HNVA 2L2SA 3DYAA 1QPFA 3GILA 1W25A 5EX0A 5D3GA 3KFWX 3UI4A 2QO3A 2MKCA 4ZPTR 2DGQA 3X3UA 3CDAA 4C7QA 4WFZA 4JFMA 1FKRA 3CUNA 1VQYA 3TAQA 2PIIA 3HO1A 5CZXA 1SH3A 4RWXA 3PO5A 4AL5A 2V9KA 3KNGA 1Q8IA 1PSDA 4RX6A 1JIHA 2E9ZA 1RT2A 4JI8F 2VN1A 3ZZ0A 5I3UB 1NH7A 1XWLA 2B43A 2GA7A 1JLFA 4P8UA 4G6VB 2BE2B 4CO4A 4WXWA 3HXMA 3DLGB 1TL1A 3TA0A 1LV5A 4J9RA 2EFPA 5BYQA 5FDLA 3N9UC 1FKFA 1X6LA 5HUAA 4OZNA 4R0JA 4YY3F 1DTTA 3IGVA 4H4MB 4GGQA 2B56A 3ZZRA 4AY1A 4LSLA 3BSOA 5A8RB 2H9ZA 3GSDA 3ARRA 4X84A 4YQWA 4HTJA 4A4JA 4NA3A 5A2QY 1JJ4A 2HGLA 4MYTA 3Q8RB 3KLIB 2AP6A 2HRUA 4HKQA 4H4OA 2DNNA 2GJIA 2ZHAA 3VAWA 2X1BA 2YNFB 4KO0B 5B08A 3GE9A 5EWEA 4JYSA 3EGNA 4TYAA 3H2VE 2QA1A 3OL6A 2A18A 4AL7A 1JK9B 4QIGA 5G4DA 1Q8BA 2Q1LA 4J4OA 1U1NA 2HHUA 4I56A 2ATLA 3R5BA 2PPNA 3BJYA 4Z2LA 1G1XA 4Y2CA 1QAJA 2YWKA 3G6MA 2CQCA 4N8OA 3I55S 3WBZA 2XLIA 1ZZFA 3O3LA 3NGKA 4CT9A 3KLEA 2RUCA 2L08A 2RQKA 3IRWP 3OJSA 1RTJB 1JLEA 2BJEA 3DXBA 1SJQA 4IRDA 5M2RA 3MGJA 2A2CA 2V4JB 2EG1A 2BXJA 3MEGB 2JLGA 5IQ6A 3C8YA 4DQSA 1KLNA 2HVIA 1O6IA 2F7VA 3BO3A 1UEUA 1YTYA 1M5PC 3QJJA 5A8KA 4J9NA 1H2VZ 4I1TA 2MGZA 4Y2KA 1HKJA 1VLYA 4I6WA 4IG3A 4KFBB 2MMYA 3DMJA 1U6FA 4DZ2A 1TKDA 2JEFA 1HFEL 2ZD1A 4IDKB 3JSYA 5AJ3F 3K59A 2AYGA 3RW6A