4QZVB

Bat-derived coronavirus hku4 uses mers-cov receptor human cd26 for cell entry
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
208
structure length
208
Chain Sequence
b'TECDFSPMLTGVAPQVYNFKRLVFSNCNYNLTKLLSLFAVDEFSCNGISPDSIARGCYSTLTVDYFAYPLSMKSYIRPGSAGNIPLYNYKQSFANPTCRVMASVLANVTITKPHAYGYISKCSRLTGANQDVETPLYINPGEYSICRDFSPGGFSEDGQVFKRTLTQFEGGGLLIGVGTRVPMTDNLQMSFIISVQYGTGTDSVCPML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptidyl peptidase 4
publication title Bat Origins of MERS-CoV Supported by Bat Coronavirus HKU4 Usage of Human Receptor CD26.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/viral protein
total genus 41
structure length 208
sequence length 208
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.70 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4qzvB02
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4qzvB01
3D0GE 4KQZA 4KR0B 3SCIE 4QZVB 2DD8S 3BGFA 4L3NA 2GHVC 3D0HE 3D0IE 5DO2A 4L72B 2GHWA 3SCJE 3SCKE 3SCLE 4ZPWR 4ZPTR 4XAKA 4ZPVR 2AJFE 4ZS6A
chains in the Genus database with same CATH superfamily
2MTLA 4DX5A 2QTWA 2HEKA 3KLGB 1HD1A 5KG0A 4HHJA 2JDJA 1RCXB 4M5NA 2LA4A 3PA7A 4CYUA 4OYPA 1X5SA 3T3FA 3D3CJ 2YKAA 2PI4A 2B0GA 1RACB 2ZOMA 2VICA 1D9AA 4OYMA 3CF5Q 1HBNA 2BABA 3MAAA 4DV6J 1L5UA 4ER8A 4OYAA 4X4TA 1NKEA 4USKA 1H74A 4KHPF 2XS2A 5CQGA 1M5HA 2XNRA 2F1FA 1VISA 3WDOA 3A1YG 4G1IA 2CPZA 2WLZA 1VJQA 1LFWA 3EDQB 3GFXA 1U47A 2E9RX 4ODNA 1Y00A 3I5CA 5IT4A 4CQ1A 2XGPA 1Y5IB 1NSQA 2NS1B 1FO1A 3PCOB 2HNYA 2ITKA 5HK4A 3O1LA 4IO1A 2CQDA 4HT7A 4WIIA 1NJYA 1UFLA 4ODMA 5CYMA 4WTOB 5AJ3F 1S5ZA 4CH1A 2HBZB 4DUYF 1YATA 2GO8A 2QL9B 1S6UA 2E1RA 2KXFA 4DU7A 4N47A 3EVOA 1P27B 1QJHA 5BJRA 4GVLA 2ZH4A 4WBFA 2OIHA 1FKGA 4P8VA 4IQCA 4CLYA 3CHCA 4B3OA 1ZYQA 1GX6A 1Y5NB 3D5MA 3I56S 3ILIA 4JI6F 2PMHA 3VAMA 2VFUA 4HACB 4OHVA 2XYPB 3M8QB 3D67A 3M8SA 1JKHA 3CE8A 2QA2A 4DR5F 5K8MA 4CT8A 3CTRA 3G71S 4J4NA 5E3AA 4QPXA 1YJTA 3H2VE 2X1FA 5AE3A 1EAYC 1H0HB 4KGMA 3H59A 3CGNA 1PJ6A 1SL1A 2E1MC 4MYTA 3OFHA 1K9TA 4J9SA 5HVGA 3BO4A 3TC5A 4ED7A 4HLBA 2QZ8A 3BV8A 3UN3A 1D1UA 4K4ZA 3D4JA 1TL5A 1GQEA 5IQQA 1RTIB 1X0PA 4LAWA 4UZBA 4USMA 3CJSA 2IDEA 3B9EA 2AWZA 2A3CA 3IXQA 3J7AN 4TY9A 2OPQB 4M63A 5HMXA 4Y0FA 4WFAQ 3MM6B 4NZCA 2BJ9A 3PRDA 3PG9A 4C6AA 3IO1A 4QWCA 4CLSA 3KLEB 1FX4A 2YBVA 4K59A 4B9MA 4C11A 3I0SB 3FBBA 4FXDA 4CTAA 2BRLA 3G8TA 2XS5A 3AJ1A 5D75A 4PKDB 4OX9J 1BQNB 5DRKA 1IR0A 3LGHA 4RW9B 2PN6A 1JLQB 2IA0A 3QZ8A 2WZ1A 1LW0B 2CZ9A 3PXGa 5D6GA 4NZ6A 3EPIA 2B7CB 5J2MA 1B7FA 3IFEA 3GIIA 1JLFB 3H5XA 4ALZA 1OS5A 2BMBA 3TZWA 3PEJA 2DGVA 3PDNA 5HI7A 2XMJA 1MMNA 1IR2A 1RHJB 3FZBA 1IUJA 1HW8A 1FK9A 4H4OA 2RAQA 2V63A 1S1XB 4J91A 1ROUA 5IV4A 3KLIA 2I9SA 4CM2A 4F2SA 3CC2S 1PAUB 1JXVA 2DXDA 4D3GA 1L3VA 5DG8A 1NK5A 4FKYA 2WONB 3M2RA 3LPYA 5KG4A 3CHDA 3MR7A 2E5LJ 2B4PA 2DHAA 3N9UC 4CO0A 1YBTA 1HQ2A 3H4DA 3BQ0A 3Q2TC 1MMDA 4USTA 2HWHA 4DV7F 3CCUS 3KOAA 4UQTA 1T7PA 1HPZB 2O1PA 3CC4S 4RNMA 4JV0A 3GJTB 4ZLPA 1EP4B 1Q8BA 3IBFB 4FYVB 4MKAA 1VR6A 2MSTA 2ATLA 3SI8A 1OSDA 3ZTOA 1D7JA 4CLLA 3MMAB 4I2QB 4GVBB 3O8WA 1MROB 1Y5LB 2XZDB 3KHRA 2HS4A 1XTZA 2N7CA 3RM4A 1TK8A 2DH8A 1RAOA 3KAHA 2RHQB 1R0AA 3U1NA 2PGCA 3TVYA 3ZZUA 5GQBA 1UFWA 1JLGB 2IA6A 2CQ3A 3R5GA 2JZVA 4XIUA 1KKHA 3OR2B 1JLEB 4YQWA 1RT5B 2B3TB 2BKOA 2RJZA 1XRVA 3JYTA 3M9NB 2F65A 4IT4A 4C02B 2X3GA 2QT7A 4QIVA 4OX7A 3N6NA 4V1Ak 1VOMA 1FJGJ 3Q8SB 3M1VB 4DR1F 2RT3A 1SKSA 2ZBQA 2E29A 4MKVA 1GMUA 4L74A 4IKAA 4ED2A 2AZ1A 2X51A 3FEYB 4RU9A 2W9CA 4MJKA 3WZ0A 3I0RB 3Q8QB 2KHDA 3CCJS 4KV8A 4Y3CA 1X6LA 4CNYA 3OXLA 4PG5A 3RYLA 3PIPQ 4A8YA 4NYZA 4ZN3A 1TL7B 4DL4A 3GZ7A 5EX3A 5ETMA 3LF0A 3LALA 1IBMF 5GMKa 4YEAA 2X1BA 1Q16B 2E7XA 4FYYB 2AJ2A 3DRPA 1NJZA 2HHVA 3EIPA 3MEDB 2LXFA 4CRJA 4IT6A 2MKSA 4KO0A 5D3GB 2VF3A 3BYPA 3M9MB 4NXMJ 4RUHA 3MDFA 2BEFA 2CG4A 2AX1A 2VG6A 4MKYA 4PTMA 1RKJA 3W2VA 1GEHA 4PQAA 4F4ZA 1RT3A 5KFBA 3G6YA 1TL1A 1ZOTA 3K8VA 1FKIA 2ZQVA 2M3DA 4DSFA 4DL7A 1SKRA 2ZOGA 4I2PB 7FDRA 2R8HA 1WTBA 1F60B 4PPZA 3J7YU 4S3JA 1HBOA 3DNCA 3ENVA 4LIRA 3O5QA 1FKOA 1O6IA 2KO7A 1GAOA 1HNXJ 1RTHA 3LP2B 1QAJA 1L3TA 1FF2A 2C1EB 3UWTA 5ITHA 1HD0A 2IHR1 3OHBA 5F41A 3QT6A 1JNSA 3AAWB 4IQMA 1T9WA 3ZFVA 4Y6IA 1U6FA 2W4PA 1S6QB 2GVZA 4ECRA 2K06A 1C1CA 4TW8A 3HHDA 5SUHA 4JI3F 1RWNB 3ARXA 2DO4A 1P5QA 3RB3A 3BKTA 3MECB 2BE7D 2GHVC 2P9CA 1N54B 5DS7A 5LSLA 1SJ1A 2G2YA 3QGIA 2AKWB 3NEKA 4LRBA 2MJNA 2GA7A 4D3HA 5IC4B 3EE3A 4DQQA 3U02A 3DRRA 4DIPA 1FERA 4LR8A 4TXSA 2HW3A 1PKUA 2AF6A 4RBUA 3JSBA 4U85A 2HLUA 1TVRA 1ZBVA 4DX6A 4NX9A 4X2BA 2B43A 3RFWA 2DIVA 2RILA 2NXJA 1HI0P 2YKOA 3RM9A 5ETSA 1VCTA 1GRJA 2YX1A 1FRMA 3FQKA 4LMZA 3NCQA 3L4BC 4Y2MA 1LQ0A 3OUYB 4QWDA 4YDXA 4EBDA 2KFYA 3OSNA 5ETQA 3M2VB 2YNFB 3M7VA 3VAGA 1YWXA 2D41A 2LECA 1RWVB 3ARQA 3KADA 3R5JB 1EQMA 3GIRA 1IWAA 4AL7A 2ZC3A 3RZAA 1FEHA 3R6GB 1KWMA 3B8HA 2B31A 3BO2A 5GAHI 3RR7A 4DR6F 1Q7LB 1E6VA 2YTCA 1X5OA 4B9TA 2DCUB 3PEHA 2PPNA 2ADBA 1R6YA 1D09B 3HVWA 3MTJA 3PY8A 1WUUA 4QQBA 2RQ4A 5IWAF 3O5DA 1HQUA 1YJVA 2QX0A 2ATCB 2BXJA 2G0JA 2WVCA 5KG1A 4DZDA 4RU2A 2LGOA 2XWXA 2ZJQQ 2M8DB 1SKWA 1BHNA 4WE1A 4LVOP 2ZJRQ 1MWYA 2UVRA 3EDRB 4W5UA 2W01A 2DD8S 2DNKA 5K20B 4ED8A 3RAMA 4NEYA 1KS2A 1TKXB 1Q7YT 2DGTA 3T1YF 4B3MF 4IDKB 1K47A 4A8QA 1JMTA 5HAOA 3J7A1 2MKKA 2FY1A 1S9EB 1LQ9A 4W90B 4NOHA 4WKYA 3D6HB 4YR3A 1L1PA 2DPJA 1ZL1A 3Q8UA 4QU6A 1T9TA 1T8EA 1Q81T 2OPRA 3VQTA 3IWLA 4ID8A 1E6ZA 2KYXA 1D9FA 2RE1A 2IAJB 4BHQA 2G41A 2KB2A 4O3RA 1JB0C 4V19J 5M2RA 1HKIA 3GLJA 1QTMA 1UEVA 3H98A 1GMVA 1S6PA 4ZIWA 5K8NA 5DDPC 2O66A 3NGSA 1U49A 3D7SB 4PPDA 2HFNA 1MWZA 1U2RA 2V2VA 1ZM2A 1QSLA 2XMMA 2LA6A 2XS7A 2U2FA 4NLQA 4QR1A 5KFAA 2QLWA 1HKMA 4B9LA 3DOLA 3WQWA 4Z2HA 3DHXA 3A8JA 5KFFA 4F67A 1GT8A 1R9HA 3DLEA 4USVA 1VQ9S 2HRUA 3MEEB 3M6UA 4C8YA 2XNQA 3MDYB 2QE5A 3PO5A 2CG8A 3HD1A 5KAKA 4FPRA 4X64F 4NL5A 2ZE2B 2ASJA 4PQUA 2CVEA 4R25A 4HL9A 2QFIA 2MLXA 3V4IA 1UL3A 2YNHA 2MLYA 4MSPA 4XDCA 4LFAJ 4RWXA 1TR0A 3HFKA 2V4JB 2V0NA 3EMTA 2HFUA 2ZM6F 1QTNB 3HVTA 3QRRA 2EG2A 1ZAWA 1JCHB 1IQTA 4QCLA 1J4RA 4CDIA 1IN0A 1YJ9S 1NWSA 3IR6B 3DXSX 5E5NA 3OL9A 4PXDA 2K7JA 2VFSA 4CLUA 3FC9A 3P45B 2HNDA 5DDOC 4F3OA 2HMIA 1Y0OA 2MJUA 2RQMA 3MZIA 1W1VA 3CJKA 3GILA 3GTYX 4DRNA 4DBQA 4GO7X 2UUBJ 4USWA 4JYSA 2H1YA 3A12A 1FKLA 3LP0B 4DG1A 3D1HA 1XNRJ 1S1WB 4DV3F 5E33A 4LGXA 2A3AA 3J81j 1F40A 1FD8A 2HZCA 1YTYA 4H4KC 4KKOB 2RRAA 4RX6A 4DJBA 1T3OA 2DTJA 1WHVA 2RUDA 4KH0B 1N1AA 1SC6A 3HFVA 3OTBA 1JLBA 3Q24A 1RBLA 5G0RA 5E3QA 2MQLA 4A46A 2XGQA 5B0DA 2YWKA 3FCHA 4PG8A 1LWEA 2VPWB 2XHCA 2K1RA 1BLUA 3FCVA 4C8KA 3CCRS 3BH7B 2IRXA 1Y11A 3AFGA 5MAOA 2P4VA 4ITSA 2HRYA 5H1SV 5C42B 3FJ2A 4Q5VA 3M9OB 2NXEA 1FI4A 2ZH8A 1HQEB 3RAQA 1RAFB 4ODRA 3FXYA 2H4YB 4YOEA 3UDEA 2BOAA 1T02A 1VF8A 2VQEJ 2BE2A 2LQ9A 1KVIA 2PV2A 2ZH2A 1ZA2B 4ZJOA 2OPPB 4TNSA 2CQBA 3C6UA 4LRFA 2F8MA 2FGOA 4V19X 1HW9A 2LQBA 4QWBA 2XP3A 2RDIA 1NMVA 3BS9A 2MSSA 2RDDA 3NBPB 2KVIA 1VQSA 4LFCF 3O2IA 2LDIA 1DTTB 3CJ8A 4Q2LA 1YDLA 4B3TF 3PO4A 3OV7A 2HQGA 4NNRA 4B3RF 5HQLA 4PCQA 2VG5A 4X4OA 2MHEA 1DLOB 3TAMA 2EC0A 5HP1A 2BQ3A 1W9PA 1IBKF 5DDQC 1RAEB 1UWBA 1REVB 4RW8A 4Q0BB 4IUFA 3RTVA 3SXLA 3KUGA 4ZCMA 1OO0B 2LEPA 1FESA 4UUXA 1O8BA 3QLHA 4CYUB 5KFDA 3C66A 4ICLA 1ZM9A 2GQCA 1HBNB 4OLOA 1IQZA 3EGVA 2W8KA 4LREA 3ALGA 3NCRA 3OXGA 4LF4F 4DSJA 1UPPA 2DGXA 2DR6A 3N6LA 1NPPA 4HDGA 1A0OB 2E5IA 5KFSA 3POTB 4WK3A 1PAEX 1CTNA 4U8YA 2KKHA 4YB6A 4XO0A 2WRMA 3Q86A 3VAJA 2OFGX 1SIZA 4JFLA 1I94F 3KHLA 5F0UA 3TA0A 2ZUAA 1RTJA 4ELUA 1T9YA 1H2UX 2VG7A 1RA7A 1UJ5A 5DO2A 5K8OA 1HIYA 1XIQA 5BR8J 1Y0HA 3DHWC 1WF2A 3TANA 4JBCA 4NLWA 3EXCX 3MR5A 5L39A 2MZJA 4OI4A 3CWJA 1EX8A 1J4HA 4HT5A 1LG2A 1QDUB 4CO1A 4WFNQ 4J9UE 4B3OB 2P5VA 3HKWA 3B7XA 4I1TA 2CJYB 2QC3A 1GNKA 3O6QA 5LMUF 4EBEA 4QW8A 3PX6A 3EZ5A 4OMFG 3MM8B 3AODA 1S97A 1RBOB 3FVYA 3CHFA 3ITHA 1SJRA 3QMQA 1G4CA 3F0NA 2CQ1A 1CULA 1PYSB 1N32F 2JX2A 4WU2A 5DZ7A 3OTOJ 3M2UA 2EFOA 3SCLE 3MMBA 4TNOA 3H40A 3M8WA 3DYAA 4L6V3 2CJBA 4AQYF 3KHHA 3NTPA 1BQXA 1FWKA 4MT1A 2XWYA 1BD6A 5C24A 1V6HA 4OL8A 3DLBA 4WJBA 2DCLA 3GV8B 4DR7J 4O3OA 3NMAA 2DSWA 4BLGA 4KB7A 2IRUA 1IBCB 2QGFB 3P5BP 4RUAA 4FP9A 1N34F 2OPSB 2LEBA 2CZVC 4DUZF 2AYMA 2C3UA 1I5OB 1T95A 3MAHA 1UWAA 4AY1A 4DV1F 1XC9A 2Z2MA 5AJ3J 4Y2CA 1HNZJ 3LGMA 4IG3B 4L75A 4F0HA 3MEKA 2NQPA 1S72S 2L48A 3IWXA 4NASA 3ARWA 4MKBA 4LFBJ 4C11B 2YKNB 3OL6A 2EFPA 1XK8A 3DLJA 4ZLNA 3TAPA 3MCNA 4F36A 2ZR6A 5HT1A 3OT9A 5ETKA 6FD1A 1QAIA 3O5LA 5KFZA 3H2UB 1UZDA 1FT8A 3MR2A 2DNLA 2AU0A 5L9NA 2ZC4A 5K8PA 4KHMA 2OSQA 5HJXA 5J2MB 2NUHA 1BE4A 4QBUA 2UVVA 4DL0C 4OV6A 2B4UA 3T6BA 1D0EA 3CCES 1KQFB 3R5DA 3K5NA 1G7CB 2P6SA 4ZVPB 4P74A 3AH6A 1JNEA 3RRKA 3BGLA 3E3XA 4DR5J 1A9NB 3HULA 1H98A 3SSSA 2V9KA 4I69A 3GCXP 2B6AB 2XTJP 3BBFA 1YX2A 2VD3A 3KLHA 4BC9A 3H8YA 3NNHA 2J0WA 3R7SB 3W3SA 4HR2A 3EVMA 3P5TL 2HHUA 2HK2A 1U48A 3KLIB 1MU2A 2CNOB 4IOAQ 2UV8A 2CJ9A 2AEJA 3J81Y 2CQCA 3IRXB 2LFVA 2LU1A 3JTPA 4G1QA 1W1PA 2FZCB 1DQ9A 1Q1KA 1Y7PA 4ECVA 3RW7A 1LL7A 4KGXB 3US5A 1TUVA 4CLWA 4PXCA 3PR5B 2R7OA 1HBMA 3I31A 1BWVA 5ETLA 1HJXA 1HA1A 2IFXA 3TWZA 2B5JB 1OQ3A 2HZVA 1PILA 2IVMA 2YNGB 4PAAA 3TA2A 1U0HB 4DT4A 3I9ZA 2JEIA 5KFWA 2L41A 2VA3A 2XEXA 3OD2A 1ZETA 4WP8A 3EYZA 2MQQA 1FKSA 1YSJA 4LUBA 3QBCA 1RWXB 3DI6B 3SCKE 1HWLA 3DDIA 4CLKA 2VDHA 1ULRA 3QGPA 2A3EA 4OQJA 2ZQTA 5B0GA 2IM1A 3DN9A 2KZMA 3I5BA 3DCAA 2W9CB 1NPRA 4KV8B 2VA2A 3HO1A 1RYSA 4IH6A 1YBUA 3QAUA 5EWFA 4MK8A 4DX7A 1UEUA 4K8RA 1FXRA 1S0MA 5AXNA 4Y28C 1LK5A 2V4QA 3K5PA 3MR3A 2RHSB 3CIMA 3Q2SC 4K0KJ 5KT7A 3DRPB 3G6VA 4IRCA 1GK8A 2R7SA 2AJ0A 3HZEA 3IKDA 2CDQA 3NAHA 4G65A 1QY7A 3IRWP 1Q4RA 1JJ2R 1VQYA 2Q1LA 4IOCQ 4KO0B 1RWMB 5LL6d 1N5SA 5DITA 1E44A 4OX9F 2CPFA 2MPHA 5A76A 1K1SA 1VYAA 4FXVA 3J7ZT 1VQ6S 1GPFA 4OV1A 3ADAC 4RUCA 2VFTA 5KFXA 3RB6A 3Q8PB 1SKUB 1XMQJ 3W5YA 4YY3J 3M8QA 1SQFA 4IFYB 4P72A 2ZR4A 2HQDA 1SJ3P 4A4JA 2FHMA 1X7VA 1U7LA 1HBOB 1FKOB 4NMLA 3JQMA 4FS2A 1NU4A 2ZHAA 3CZ8A 1RTHB 2DNQA 2E66A 4CT9A 1YJ7A 3R5AA 4DSIA 5IT0A 4WK9A 3W5XA 2EVZA 5U47A 3W66A 3ISNC 4RNFA 1Q78A 3OLAA 5B08A 5DLGA 2IBKA 3J7YI 2E5LF 3BPDA 3CO0P 2XO7A 1SJ4P 2JVRA 1VI7A 2XBPA 2R4FA 2D3O1 3W4RA 2YH1A 5KFQA 3CCQS 2OPQA 3TO8A 3G2XA 3VGUA 2BJ8A 2EC2A 1JLCA 1B70B 1F5BA 1VBZA 3MM6A 1P9YA 2W4CA 3OJUA 3N28A 1OJ4A 2FJAB 3S8SA 3RBZA 1YK9A 5F8LA 2ZBRA 2FHJA 1S57A 3RGCA 3K17A 2J7WA 3KLEA 2G2ZA 3FBFA 2GO9A 4WWSA 3W5ZA 4NSBA 2GCFA 2QV6A 5KFPA 1PINA 1X4GA 3I0SA 2W7PA 4C48A 5IS2A 1F1BB 1TVRB 2B7BB 3FSXA 2Y78A 2XY5A 3FGVA 3V4MA 5HMYA 3GU0A 3IKGA 4FF1A 4DXLA 4OZ3A 3A8IA 4LIWA 4N77A 1MMLA 1C0UA 1ZM4A 3U1LA 4BBYA 2IUZA 4K7QA 1X4AA 3J80U 4MFBB 5M2PA 1FJGF 4E0DA 2UVWA 1JLFA 1WC5A 3LGNA 3VVTA 4GKKF 1WSVA 4LBHA 5IV3A 2VV5A 3M05A 4K4TA 4M5LA 3Q8RB 1F0XA 5IC6B 5I3UB 1T05B 4KE5A 3SZ2A 1NWTA 2GV1A 4ZN1A 2XP4A 3AXKA 5F3TA 3BJYA 1HI8A 3UI5A 2BM0A 2M2BA 5AE1A 2Y8WA 2UU9J 1PJ7A 2ZVIA 2DH7A 5AXLA 1SUQA 1H2TZ 3W8GA 1SJQA 4UY8T 3THTA 3CW2C 3R9LA 3R5CA 1BKFA 4UT4A 3JQJA 1WG4A 3UQAA 3QAEA 4ZHRA 2HKEA 2LVWA 1W2BR 4WKAA 3KJNB 4DSLA 2DRBA 4ZCKA 4DPOA 2KXHA 3M8ZA 1RT7B 9RUBA 3ARUA 4HTIA 3SMZA 3HDSA 4MNJA 1YG0A 2A3JA 2QLBB 2XCPA 3PW0A 2UUTA 4I2QA 4B3SJ 4GVBA 1MROA 3GMGA 4P73A 1M5YA 4J37A 1KT0A 4R5EA 2AQ4A 4PWUA 2F3JA 2BJ1A 4DQPA 5E3RA 1IM6A 3HXMA 1JLGA 3MR6A 2HGNA 3V6KA 2N82B 3D9BA 5K5MA 1HNXF 1FXDA 4X4VA 5B0EA 4TW7A 3BEGB 3OR2A 4UOGA 1IKWB 4ZPDA 2MKYA 2H48B 4ZCLA 3TX0A 4R0JA 4DFPA 1R0BG 3UI3A 3CD6S 3M1VA 3ODKA 2QL7B 7FD1A 1FRIA 2ILZA 1F9FA 4DUTA 4MPKA 1EKSA 3KLVA 1PBUA 2KL8A 4W4MA 4USJC 3M8PB 1CJVA 1S6PB 3CJ2A 4ZK7M 1U6ZA 2VN1A 1TKZA 7AT1B 2FVQA 4FF3A 4P2FA 4FNIA 2VPXB 2GS8A 2OKQA 3BREA 1NDLA 3HF5A 2YXLA 3I82A 4YB5A 2VBXA 1TUGB 3PVXA 1TCOC 4W9QA 2HVDA 3DOLB 3MXHP 1ZM3A 1N8RT 1DFDA 1FJ7A 2ZD1B 3R97A 1SJFA 1NAQA 4ILLA 2RUGA 4F0KA 1A7XA 2L08A 1KFWA 1VQNS 1QAYA 4PQUB 3JTOA 1RXOB 1U8WA 3V4IB 2YNHB 2DSVA 4WIWA 1URNA 4P75A 3O3LA 2E9ZA 1DAXA 3G86A 1FCAA 4WXWA 3FSYA 1J2VA 2LU2A 3AA9A 2DRAA 2DK2A 5HBFA 5AT1B 3LWMA 5CCLA 3EVWA 3T1YJ 2G4BA 4B3MJ 2GMHA 1KLMA 4UQGA 3RW6A 1LV5A 2X1GA 3H5YA 1FRKA 4ES3A 3LP2A 3KJVA 2OI2A 1LXNA 3O5JA 2HIQA 5HJYA 3QO9A 2HNDB 1YJRA 4ZP8A 3PHEA 2HMIB 3DFEA 1FFRA 4P2XA 1KP6A 1HKKA 1S6QA 4JV2A 1WTFA 3C46A 5JMNA 1VQMS 3O5FA 4DV4J 1UVIA 4ZVOB 3LQVA 3AXMA 1NUEA 1FNOA 3G6LA 4MTPA 1RBAA 3HFZB 1XHGA 1ACMB 2KJWA 3N5BA 2GIFA 3N01A 2PC6A 3IAM9 3QFHA 4FF2A 2M9KA 1JLAB 5KFIA 2ASDA 2BA9A 3D54A 1W7WA 3IGNA 4M5HA 4UZCA 3TZZA 3K5LA 1FA0A 3CCTA 4LR9A 2ZNYA 2XLKA 1JLBB 3QSYB 5D77A 2ZBPA 2F40A 2OGUA 3D3BJ 2CQ4A 4F50A 4NMXA 1S1VA 1WORA 2OP5A 1LWEB 3VGTA 4X64J 4U84A 1UVLA 3BF4A 3L09A 3CIZA 3KTQA 4DLGA 1AZSB 4A47A 2ZM6J 1FKAF 5M2UA 5HW7A 2RUSA 5DQHA 3HKZD 2BACA 2P2CB 4LF6F 2R42A 2W24A 5HL7Q 4TW6A 2AZ3A 4U96A 2LQJA 4UOHA 3EICA 1LWXA 2YNFA 3BGFA 4ZVSB 2YPZA 1H0GA 4NLRA 1RT6A 1Y3JA 4M1KA 1T9XA 1N33F 4OYXA 5GMEA 3HK2A 3UPFA 2KT5A 5L1IA 1PC5A 1F9HA 3KK2A 1FHTA 2DGUA 3QOKA 1NCLA 1WC1A 1W26A 3TAMB 3G87A 4TY8B 5LOQA 5A0YB 2HWIA 2KR7A 3FQLA 3PYDA 1NB7A 3WX8A 3OL7A 3GP9A 2FD2A 3MM9B 2OUGA 2I38A 5E41A 1RAJA 4CIOA 2M7SA 3QT5A 1C4CA 4O2TA 4MNKA 3TCZA 2A6OA 2LXUA 3PKYA 2NXCA 4CI0B 1DURA 1S0NA 5CZVA 3H5UA 5J1EB 5L1KA 2CWKA 2E7VA 2WVDA 5A6PA 1D8ZA 4ICLB 5I42B 3NGDA 3CCMS 1RCOB 2GJIA 5K9FA 5KOXA 4UTGA 2VODA 5J2PA 2EULA 5L38A 3CJRA 1VLYA 4O0NA 5B8IC 4O3QA 1N5YB 2DYAA 3QJLA 1EDQA 4C8ZA 1BMQB 2DY9A 5EHHA 2JNJA 2O5DA 4DPUA 1N48A 3TJAA 3WD4A 3QNWB 3BQ1A 1H72C 1CQNA 4CH0S 3OA5A 2H65B 2KG0A 2BYCA 2BM1A 2UUBF 1GFWB 3MTKA 3CDBA 5F9NA 1VDHA 2H5IB 2HBQB 1NDPA 2OMLA 4WKFA 1N5TA 1R31A 3R8YA 2Q5AA 4DV2J 3W63A 2NZCA 1YJUA 2MKIA 4YN3B 1SCJB 4RO0A 4K50A 2VG7B 3KABA 2J6TA 2R7UA 1RK8A 1NPKA 2VZ9A 3ZTSA 2MQMA 4NXNJ 5HBMA 1FJDA 2R8GA 1YQHA 2MF9A 2DH9A 2UXDJ 4ED6A 4ECQA 2CWXA 2RSQA 2ZQSA 5D4PA 1WAWA 2YWEA 3WX4A 3KDNA 5EN1A 2HVEA 3V2UC 3A13A 4C3MA 3TYTA 3MEEA 1UPMB 5FJ4A 2ZE2A 1WELA 4DSEA 3GYNA 3VALA 1ZBKA 3THPA 4KRWA 3ISZA 3CCLS 2EFVA 3ITHB 5D8HB 2VC1A 4KYZA 1CULB 4Y00A 5BYQA 2V4JA 2J5AA 1FRXA 3K7RA 3ZZYA 5KFMA 2XSFA 4PWWA 2L9WA 2V68A 1FFSB 4KY3A 2VQEF 3J7Z5 4MIAA 4LRAA 2GMJA 3JXOA 3RMEA 3U7JA 4ES1A 4W9OA 3DGVA 3N4WA 5AXMA 3RB0A 2FJVA 3VAWA 4M5JA 2CPEA 5KG2A 3WBZA 4PUOB 2KRRA 2P6TA 2HHWA 4C3LA 4MK7A 1DY3A 3ET6B 1IM4A 3HLUA 4R0XA 3MPYA 2UZAA 4P6QA 3MAQA 4A8XA 1S1WA 2WW4A 1NXIA 1PYTA 4CLFA 1TUWA 2Y9HA 1HJWA 3B9AA 1HWJA 3MCOA 1WG1A 1WHWA 2F9DA 2RURA 2J8AA 4K4UA 3JYJA 1T3NA 3ZNUA 3B6BA 2IM3A 1AFJA 4C8OA 4KKOA 3RAXA 2DGQA 3G82B 1KRPA 4WFBQ 2XYHB 5CH7B 3AS1A 3LH2S 2XO6A 4ZPAA 5FIIA 3O44A 2LXIA 3PFOA 1FKDA 2KO1A 3K0JA 1KEKA 1B99A 4MAKA 2YPYA 4JYAF 1M5OC 1UVNA 2DSZA 1RABB 2FVRA 2D3ZA 3E8OA 3QATA 4ENOA 5A2QY 1LL4A 3CDEA 4XPCA 2PD1A 4G50A 4IOBA 3KK3B 2XMTA 2NYHA 2NXUA 3DMJA 2YKPA 3CJ0A 1QE1B 2KJVA 3P3DA 5C42A 3PJWA 2HIYA 2IBOA 1Y10A 4LRCA 1Q6IA 4ZS6A 3OVAA 3W64A 2M88A 3MPDA 4M5DA 3RBEA 1RAHB 3QJJA 1V3ZA 3VAKA 1MU2B 2J9EA 1VGYA 4HKQA 2K8GA 3EJMA 3OBIA 3KAIA 2ACYA 5HMZA 4G1QB 3LANA 3TR5A 3KJFB 3NBPA 5BR8F 3A8EA 3QGGA 1KD1T 5HN0A 1DTTA 4OI3A 4EZ6A 2LJ4A 1U1KA 3O5KA 4DH0A 2DEIA 4U7UK 2A2CA 4WK1A 3C8YA 3VZIA 4X62J 2C3YA 4DUZJ 2R2RA 3GIMA 1P8GA 2KTQA 4QWEA 3KZ7A 1DLOA 2BE9B 2EKNA 3NXZA 3RUBL 3KNGA 2AGQA 1Q53A 4Q0BA 4UY85 4NLTA 4R5PA 1CJTB 3EZOA 1QD1A 5DG9A 2K3KA 5IT9Y 3FAPA 3V5RA 2ZH7A 2QSFA 4LSLA 5BYRA 2IYGA 8ATCB 3H7HB 3LW5C 4DR2F 5JXSA 2DRDA 4X66F 1LG1A 3ARTA 1FRHA 4DPXA 4KPYA 4DWIA 1R89A 3OTOF 4DL2A 3G6MA 2CQIA 5D4LA 4Q7AA 5A8WB 3WQPA 2DGWA 4DEZA 3WIUA 4G1PA 2ZH1A 3UQIA 4NLSA 1FDAA 3QGHA 3BGOP 3PX4A 3POTA 1UVMA 3C15B 4WFXA 2H54B 3AB4B 3OFGA 2M2AA 1S59A 4DR7F 4IG0B 3ZTPA 2PA3A 2N4DA 4ZMMA 1VBXA 2F4VJ 3CJTA 1S7IA 2CFXA 2PSZA 3T5HA 3VGVA 2HHHJ 4WU3A 1IKVB 2XZWA 5JVGQ 4URIA 1HHSA 1LFPA 2LMIA 4JI0J 5T14A 3NS7B 1HNZF 4O3SA 2R7TA 5DIVA 2VU5A 4JUZA 3S6EA 4OX6A 3CUNA 2WK2A 1UKUA 2F7VA 2HHQA 2V94A 4LFBF 3M30A 1PIEA 2C2MB 4EMDA 2D9PA 3P8BB 5A6WA 4BDPA 4NLYA 4RL1A 3GG1A 1NO8A 2CPXA 4EYIB 1FD9A 2HHPA 5KFCA 3G6XA 5DM6Q 3CEDA 3DXBA 5B0BA 4DRIA 2DNNA 4BCAA 4ZVTB 4NA1A 4QR0A 2EFNA 3MM8A 4ZPCA 1FFWB 1TAUA 2YH0A 2B8PA 2XPAA 2V34A 4GMKA 2DNYA 2VBWA 3W9IA 2OFNA 1XNQF 3SQGA 1UR8A 2L9NA 3K5OA 3R2DJ 4Y2KA 1NK8A 3JXVA 3TNVA 1NLKL 2IJFA 1OYEA 3PRAA 1EETA 2HBYB 1X4BA 5GMDA 5LSRA 2IJRA 2J9DA 4C8MA 4DV0J 2HNZA 2QLJB 1N52B 1S6OA 4P52A 2FYXA 4TLRA 3KMSA 5IFMA 1HBUB 4K4YA 3UO0A 3H90A 2V67A 1QVGR 1IJEB 3T41A 1YI2S 1S76D 1ROFA 2OPSA 1RHUB 2R8IA 4DRPA 3KMQA 4LBIA 4RNHA 2C3MA 1JLCB 2YWGA 3GFZA 2G2OA 1UETA 4MGVA 3AQPA 4LF5J 1TV6A 3R7NB 2CJXB 3DKDA 4IG3A 4DWSC 1LWCA 5KT4A 3UQBA 3OFFA 2C2OB 2YKNA 2F63A 1GOIA 2ZWOA 6FDRA 1CC8A 2KG1A 3PACA 1NHUA 1CVJA 2B5UB 4BC7A 3KDOA 4OHXA 2PMWA 5KTQA 2F21A 4CLZA 4TN2A 5JJBA 1JJCB 5L1LA 2V2QA 4DV5J 2XY6A 5C25A 3VF0B 1C0UB 1QZ2A 1RP5A 3M32B 4PWDA 4J7CA 2W2MP 4TYOA 4CO4A 2IPOB 4ECUA 1R8PA 2WAQD 4ILRA 4JI1J 3BH6B 4N19A 3AD8C 4ZPVR 3PW5A 2OLWA 4ES2A 4WKHA 1BGXT 2I6WA 2B6AA 2B9XA 2AV5A 2QFJA 4DN9A 3TOQA 2XMVA 1FWLA 1H7XA 1U1OA 1NK4A 1VQLS 4ED1A 3O5OA 3MFIA 3BBCA 3H42A 1X4CA 2MZTA 3IRXA 2JL9A 3FZ2A 4B02A 1SUQB 1D3WA 1U02A 5E2QA 2ZHOA 4YR0A 3OLBA 4K0KF 3LWLA 2EK6A 1U25A 2HRTA 1VFJA 4ZHRB 3Q89A 1Y9OA 2HS0A 3MHYA 2UXCJ 3N5FA 4JFJA 3NMRA 2ADCA 1EIBA 1AB8A 1SC4B 2HAFA 3PRVA 4Z2XA 3IK8A 4K4VA 4FVCA 1YRTA 1OY8A 1RLDA 1WNEA 2B5JA 3AOAA 2BANA 1R6VA 4O44B 4A8MP 3UCGA 2YNGA 2P9EA 3PFEA 4OYIA 4F3MA 1FAPA 1RZMA 1XMQF 1TAQA 4YY3F 1WJ9A 1VJWA 4ZPTR 2HQFA 1RADB 3RGIA 2OTLS 3FY1A 1U0HA 3CJ4A 1PGZA 4CZCA 4M5MA 4ZVEA 4WFYA 1AUSL 2UXBJ 3CMES 4QYZK 4P9SA 4WYWA 3B4MA 4OHYA 4FBUA 3DI6A 3I6PA 5B0FA 2LLZA 4EFAC 3B4DA 1WWHA 2PV3A 1PG5B 2HGLA 3VZHA 2XY7A 4QT2A 1S4FA 3H9RB 4ZKAA 4NI2B 4YDDB 2OH2A 4F7VA 3BXWA 4Q44A 2CPDA 4GKKJ 4NLGA 4DCJB 3KYLA 4Q8FA 2J0QD 4I6YA 4Y65A 2JEJA 3NGKA 4I64A 1CJVB 2WCXA 4HARA 1ITXA 3LP1A 1XERA 2CIMA 5D15A 1TKZB 2DNZA 2XP6A 5B09A 2Z30B 1AT1B 2G8ZA 4H4KA 1RU1A 2MNTA 3HD2A 3CD7A 3KUHA 4NCBA 3UDCA 3SYZA 3KK1B 1Q95G 1J4IA 2M70A 2NUUG 5D0EA 2XP9A 1KVKA 3O5TB 1TL3A 4AT1B 1HJVA 4WYLA 2ESCA 4EGLA 4B17A 2M5YA 3HJVA 2WTFA 2F4EA 2M08A 1VK8A 4N76A 2WSEC 4URSA 2JFDA 2FHJD 4DMZA 1NDCA 3BBBA 2HLTA 4IFYA 4FAPA 4X65J 3GV7B 3MMJA 1KLMB 4DCPB 4FF4A 3W60A 3AROA 3KJVB 3H0PA 2VKRA 2R7QA 5EDWA 3QO9B 1B4SA 2PBCA 3MD3A 1C0TA 3R27A 5FD1A 2VBZA 2UU9F 3KXDA 4W98A 3DLGB 2CQPA 1HHTP 3C16A 4QZVB 4WFZA 5CCMA 3T5KA 3MPWA 2DHGA 3UF8A 2PO4A 4DZ2A 1N6QA 4ECWA 2LKNA 2CZ4A 1ZBTA 5HO4A 2CXEA 5HVHA 5F3ZA 4QIGA 2CQGA 3CSKA 1HNIA 2HBRB 1IJFB 2MKCA 1NZ8A 3C14B 3D6TB 1NM2A 3IA0A 1VQ8S 1RHQB 3V81B 2AJFE 4K4SA 2D69A 5KG5A 4B3SF 1HHQA 2NSBA 4CO5A 2EEYA 4Z2GA 3G8QA 4RNNA 5EWEA 3LAKA 1S0OA 1BXNA 3UFCX 1HNWF 1S1VB 3QYYA 2JWNA 4OI0A 1HMVA 1VQOS 2J8SA 4GGQA 2H9ZA 5GADU 4P2SA 1LNQA 1PBKA 3OOBA 4AUKA 3ULHA 1GMWA 3T19A 4QPTA 2PEBA 4N7TA 2YY3A 3DOKB 2KI2A 4DR3J 3E01A 2ZITA 4MFBA 1EZZB 4J9OA 4EZ9A 3OXFA 4Y34A 4K2JA 1WKLA 3IMQJ 3S7RA 4DCOB 3OTEA 3WD2A 1FFGB 2RSEA 1KVJA 1H7WA 2UUCJ 3NKYA 4DS4A 2FJBB 3P49B 5I3UA 3E51A 1T05A 1RT6B 4OYZA 3F56A 4YHHJ 1HARA 5KG6A 1PBAA 5KOWA 2CNKB 3E2EA 4EI2A 4QW9A 3KK2B 2JH3A 2JRSA 5IOLA 3IP0A 2QN6B 1QPLA 3Q83A 4W9PA 1C2PA 1NHKL 2Y0BB 2R2TA 4TYAA 4NWBA 1XEZA 1OWXA 2ACMA 1RT7A 3NRBA 1KTQA 2DT3A 2HFVA 2RIJA 2L9DA 3SFUA 2WOMB 4EYHB 1NZAA 4I0WA 2AJ1A 1FTRA 4OI6A 2EW9A 5LJ5Y 4DR4J 1VRTA 4ZVGA 5J2PB 2HQIA 2BJEA 3Q0AA 2Q43A 2B4VA 2RS8A 1U4BA 2IVYA 3KCEA 3GONA 4AL5A 4QYZJ 3BGRA 1WI6A 4KT0C 2R3VA 1NK6A 2QA4G 2QEXS 1RWKB 1IKWA 5DF0A 3SCJE 2QRRA 5E0OA 1RKIA 2VOOA 2MY7A 3QRQA 2L3MA 4DV4F 1EQ0A 4LF6J 1SI9A 1XMBA 4ZP7A 2WB1D 2HFSA 8AT1B 1KR4A 5D4NA 2ZDOA 3B78A 2IJNA 1SBRA 3M8PA 4NLDA 2ETNA 2DPEA 4WIQA 1PSDA 1FKTA 2WM0A 1C9HA 1TFVA 4DWSB 5HBMB 1N33J 4HHHA 2MEWA 2UUAJ 2V8PA 4PR6A 1NNDA 3UI6A 2HYIB 4ZITA 4LVNP 2XYGB 2N3LA 3CDUA 4LT6A 3UW1A 1VRUB 4LAXA 2BR0A 1RJJA 3GYGA 4U8VA 2I5JB 5ETRA 5HLFA 3GPAA 1EIYB 2ZD1A 1SV5B 2LP4A 4P7VA 1F3FA 1YKWA 4MK9A 3HHNB 1RYRA 2BQUA 4MH8A 1FVSA 1URRA 4ODLA 1U26A 1Q6HA 1SL2A 3F44A 5DLFA 3D1OA 1EJ7L 4ECSA 5K14B 2XC9A 3HVRA 1LOUA 2DNPA 4BF8A 2VFRA 1UMJA 5KFUA 2GJ2A 1DTQB 3TJ9A 2Y1JA 2GQQA 2KH9A 3EUNA 1FKKA 3AA8A 2DY1A 3GSDA 5C7PA 4Z2LA 1RWWB 4FDFA 2DHSA 3ARSA 1RLCL 5KT5A 3HP6A 2XLIA 5F8GA 1B0TA 2L2SA 1WOPA 3MPUB 2FIUA 4C8LA 1AXQA 5J1NA 3S01A 3FFIA 2J7KA 2NZ4A 2XI2A 4FXWA 3KAGA 3R2CJ 2DNRA 1VIXA 4XK8C 2XMAA 2E5GA 2WBRA 2W1BA 2ZHBA 3ALFA 2OJ3A 1W25A 4RW7B 3QIDA 4F26A 1P6TA 3ZZ0A 2A3BA 1S1TA 2CRLA 3GCWP 4F4AA 2MHNA 1OGGA 1DZ5A 3LPEA 2Z58B 2ROEA 2COLA 5HQ8A 3I55S 1GX5A 1NJXA 2BDPA 3HSDA 4LF7J 1JLAA 1QAXA 4OYBA 5H9EK 1WEZA 5KG7A 5HANA 1M5SA 1JXLA 3J81U 1NK9A 2OAUA 1YIJS 2V5HG 3CD0A 3CDWA 1O0PA 3UD4P 4P10A 2P9GA 1N88A 2RRBA 4OZ1A 4KPCA 3AS0A 3WKZA 1R27B 4HI2A 3M6VA 2IM0A 1RTDB 4I56A 3DMJB 5I3QA 1O51A 2MGZB 2DBBA 1E6NA 4DL3A 5HVFA 4OIXA 1UAWA 4F8RA 2YKQA 5FLXU 1AZSA 2EBGA 4DRJA 1R8HA 3VAFA 4M5DB 3UNYA 1TKDA 5DJBA 1TKTA 2ZDPA 1UA0A 1IKXB 1KSPA 2LEAA 1FEEA 1M1GA 3C3LA 3NWRA 4DV2F 4FN5A 5AXKA 1MG7A 5LXYA 1F8AB 5FDLB 5HW6A 4NXNF 3FUYA 1X9SA 2DHHA 4FYDA 4A8KA 2UXDF 2XZTB 4L3NA 2XMKA 1SYTA 1AUDA 2DSUA 3DRSB 4TLQA 4M95A 1WEYA 2OSRA 4FYWB 2CKWA 1RISA 2J6UA 4TY8A 5A0YA 2VH7A 3H2LA 2QMWA 2JHEA 2HGMA 3ZO7A 4YP3A 3MM9A 3KLFA 4R5PB 4IQ2A 4Z2IA 1QUPA 1V5VA 3Q8YA 4DWSD 2OO4A 3CCWA 4XAKA 5HWCA 4LSLB 2R7VA 2QF8A 1ITPA 5J1EA 1WC6A 1JNTA 4CLTA 2MKHA 4WF9Q 1S99A 2HS3A 5I42A 3HHLC 1MN7A 5HW8A 3VCDA 1U1PA 2PDAA 3RJMB 3GR0A 4I7FA 1NSKL 3UCZP 3ARPA 1TTHB 4JYAJ 2MB0B 2RUCA 1N5YA 1KBRA 4YMEA 1VC0A 2KHCA 1FWPA 3T5JA 3D1QA 2CJAA 3ZZPA 2R7WA 2BQRA 1Q79A 1KC8T 5HKGA 3K58A 1FKPB 1X4FA 4A8OA 5DG7A 3L3CA 1S10A 4JP8A 3RB4A 1CG2A 1W1TA 1M5KC 4JI7J 3DC2A 3I4HX 1OMSA 4GC7A 4GKJJ 5DEZA 2NSCA 5DQIA 1UA1A 2YBTA 4IPXA 3W1YC 2GGPA 4OZLA 1N5VA 1LW2B 2AYBA 2KZZA 3NGTA 1GXUA 1J5EJ 2Z2ZA 3IN5A 2RU3A 3BR8A 4DOZA 1IX5A 3KG0A 3M30B 1DARA 2YQ3A 3UI4A 4BS2A 2E44A 3IM8A 4MNMA 3MMCB 4P8UA 4R8UA 4JV5J 4LF9J 3TI0A 3O5PA 4DQSA 5CYQB 1VQ7S 2Z2YB 4X84A 3BO3A 4KGZB 1JWWA 1B0PA 1JIHA 1RQ0A 2GX8A 2M8HA 3MM5B 2QA4S 3R5BA 2RMLA 4F02A 3G8SA 3NS5A 3LUYA 1U09A 3D2WA 5ETOA 4DR2J 2YKMB 1E6RA 4Y2AA 2K3IA 3KUEA 3IWNC 4X66J 3SQGB 1WHYA 3THVA 4UDMA 3MM7A 4TX0A 2FLOA 3JSMA 2ZZTA 2E7WA 3TVZA 2R2SA 4G2PA 1EETB 1EARA 1E6PA 5RUBA 3T5LA 1BQMB 1J5OA 2ROPA 2QO3A 4A48A 2HNZB 2WVEA 4NLXA 1IBLJ 3B9DA 5IM0A 3WC2A 4PUOA 2F2DA 4ZLLA 3EPGA 4OZJA 2VPZB 3IG1A 1T0TV 4OJ1A 4J4OA 3FMWA 4X62F 2Q79A 5IZHA 1FDDA 3ET6A 4KIAA 4B08A 1IWGA 1H38A 4TU7A 5KFOA 2N3OA 2LDYA 3BYRA 3T1HJ 4PEOA 4DF8A 1TV6B 3OL8A 2EK1A 1CBKA 1FXLA 1JK9B 1LWCB 1PCAA 3EGWB 1NMEB 3WIJA 2ZR5A 5H9EJ 4RNOA 1CLFA 1FDNA 4O0IA 3RRGA 3G82A 2VBYA 2Q66A 1X0FA 4ZJQA 4MAVA 1JNZB 2CQHA 3ENQA 2AMCB 3PYEA 1OY9A 4AFFA 3GFYA 2ZQUA 1UW9A 4LR7A 1I3OB 4L73A 2XI3A 3P6YC 2V69A 5C25B 1Z2ZA 3QWPA 1HYSA 4PWDB 2MZ1A 3KG4A 4M5GA 3CJ3A 3TUIC 1HR0F 1UP1A 3HSGA 1X9WA 1Q1CA 1GXTA 1X9MA 2YX4A 3KK3A 1Q86T 3HX9A 2W7AA 3JSYA 2Y8YA 2CUYA 4KFBB 3TUJC 4NA2A 1QE1A 3WIVA 4ZLJA 1T03A 1XNQJ 1E9LA 2F4VF 3AQOA 2QMXA 3UE2A 1WC0A 2OMOA 4WTYA 4U6PA 4WCEQ 2F5GA 2RQCA 1I6JA 3BN7A 2HHHF 4JI8F 5A8KA 2DT9A 1YRXA 1DJ0A 1T9UA 4OZ2A 4J90A 2YX7A 3BB5A 4JI0F 2HSEB 3Q8VA 1CJUB 1REGX 2FC9A 1RT2A 5KFVA 2XG8A 3TP2A 2XP8A 4G6VB 2VQFJ 2V2KA 3NCPA 4B9UA 3IHZA 5DGAA 4LF8J 2C2DA 1D7IA 3DOMB 3NGUA 2DG4A 5BYSA 2G1DA 1M5PC 3C6TB 2GVDB 3TUPA 5J1PA 1SB6A 2C3OA 5EWGA 1ZBWA 2QYGA 2BANB 2ALZA 2A2DA 1CJTA 3SDEA 1RAIB 4EUVA 3SIPB 1GTEA 5J2QA 2IMOA 4RBVA 1DHMA 3D28A 3L7OA 2VKZG 2O67A 2NYIA 3UN5A 3MUMP 4ELVA 1QVFR 1RHRB 1VMBA 3CCZA 3N79A 3CGIA 5THWA 1MWQA 2IC3A 4M8LA 2JZ5A 3W9HA 4GIVA 4KQZA 3HT3A 3PW2A 4F4KA 3GR1A 1RWPB 2NCKL 3QSIA 1A6LA 3MUVP 2RF2B 3AT1B 2IRYA 3GWCA 3DRYA 5A8WA 2MXYA 5DIUA 2AEMA 4DV0F 4NRUA 2MQNA 2QYCA 4JV1A 4C98A 2JJ4D 3C15A 3WD0A 2PA8D 3SSRA 4WKRA 4IG0A 5HROB 3BSAA 4QIWD 3SSQA 1JJHA 3WD3A 2VC0A 3GIKA 4I67A 4DF4A 2N4CA 3EM1A 3LP1B 2VPYB 4CM0A 2AIRB 3QFWA 4DL5A 5CHCB 1IKVA 4WPAA 3TAQA 4LJMA 3HJFA 1N5QA 4DZ6A 5GAEU 1NK7A 3OVSA 4GRSA 3Q23A 2BV3A 4LF5F 4LSNA 3CMAS 2WHOA 2BUNA 2XHWA 5DDRC 2Y0SD 3PX0A 3AY0A 2AWGA 2F9JA 1VBKA 2G13A 3GIJA 4JI4J 1WDTA 1TL3B 2RDJA 5JUMA 3OFEA 3W2WA 1OIAA 3ILOA 2EFGA 5CD4A 3FEZA 2H4WB 4ECTA 2POKA 3EGNA 2OFHX 1O5JA 4DFJA 3ZZRA 2KXNB 4DV5F 4KSEB 1SXLA 2VIHA 5IQ6A 2KT3A 3VTIA 2O3DA 5KT3A 3CT9A 4R0EA 4JI1F 2I1RA 2IY5B 3AJ2A 2DT0A 2OLHA 1RU2A 3PZPA 4DFKA 4KJIA 4Z37A 3DGPB 1FVQA 2M1IA 2QA1A 1Z4UA 1XR7A 4HH0A 4W92B 2MQ8A 1C0TB 4N41A 4YS2A 3CDAA 3UR3C 2ZEJA 5HQMA 1KTVA 1C1BB 2Q6BA 2B9YA 2D1CA 3C16B 2YNIB 1OPZA 1S7HA 2IMWP 2NR0A 1NMWA 4K2XA 1XBWA 1HBUA 1VQPS 4ETXA 4JOUA 1N6QB 2N7YA 3QIPB 3R7BB 4CO2A 3DM2A 1S4EA 5CXTA 4C8NA 3F73A 2DNHA 2UXCF 1SQEA 1IKYB 3TARA 1E6YB 1TFYA 1HNIB 1WF1A 5ADZA 1QPFA 4ATNA 1CSJA 1TL4A 4JI5J 3M6XA 3NWGA 1U1RA 4OJGA 4PYAA 4TKTA 3NY0A 1W2IA 2OEKA 1ZU8A 2HAIA 4EBCA 2DVIA 3HHLB 3OTCA 4KGVB 4Q45A 1D6OA 2WVFA 4TVAB 2EWHA 4M94A 1IR1A 2BRKA 2HQCA 2DG3A 4RPFA 2M4MA 3BSNA 2RNEA 1KFSA 1HMVB 3ILLA 1J27A 3KWMA 2UXBF 2U1AA 4C0OC 2WLYA 3RM8A 3AHPA 3M32A 2B8QA 4DDFA 1XMOJ 5D4OA 3E01B 3M6WA 1U6BA 3V6HA 5T7LA 1YITS 2RH3A 1SIWB 2RS2A 4J9KA 5SZTA 1UJ4A 1V3RA 4RKUC 4U86A 3FRYA 2DR8A 1B0VA 2X3DA 1S1UA 2HPUA 5GPGA 4ZOSA 1U2FA 2FQQB 5GADI 3FEXB 2H3EB 4J9LA 1N56A 4Q2MA 1HLWA 3F41A 4J5OA 2ZH5A 3KNAA 1FNXH 1S12A 3P4UB 1LXJA 3HZGA 1ICEB 2CPIA 4WP3A 3GJRB 3ZTRA 2E5JA 4JFIA 2BZ2A 2R8KA 3D6FB 4E98A 3N6MA 3UVJA 2PT0A 2ZKUA 4PZVA 1I1GA 3QQCD 1NB2A 3UN2A 2FUG9 2QL5B 3BKFA 4O3NA 4C9DA 3OPKA 5F8HA 4K4WA 5BXIA 2V8DA 4O44A 4DPWA 3LTOA 2G1HA 4DROA 3HT0A 1DRZA 1VRTB 1PJ5A 1KT1A 4O3PA 4X65F 5HUAA 2V8GA 1NBEB 4YR2A 2F4FA 3GYXB 3V6JA 3I96A 3VGSA 1HNWJ 3EGZA 1YZ6A 1EHNA 3MEGB 3TVKA 3BGRB 2CPJA 1Y4ZB 3MUTP 2J0SD 2GIRA 3HI9A 4RLEA 4DL6A 1LWFB 3R1HA 3RBDA 2J0XA 2B9EA 5MLCV 1CPZA 3T1AA 2FC8A 4OI2A 3UQSA 1K44A 5DQGA 5I3PA 2APOA 4WJXA 2NPFA 3AD7C 4Q7NA 4NI2A 2HFOA 2C22A 2C2RA 5E3PA 2E5HA 4OZ0A 4CNZA 4Y2IA 4MNLA 5I98A 3IM9A 1CS4B 1RB0A 3CJQA 4J9VA 2W7OA 4ZVUB 1KOHA 1Q6UA 4C0BA 5T41A 2HVZA 2RQKA 1NKBA 3WC0A 3OR1B 1H2VZ 1N36F 2VASA 3GV5B 4H4MA 1OGBA 3BPSP 4RW6A 2VOPA 1X8DA 2FLNA 1RUSA 4ED5A 3KK1A 4ZPWR 2DR5A 1M5VC 3DDKA 4KH1B 2W25A 4DS5A 2BVZA 2CQ2A 2AYEA 4LSZB 3LO3A 2GHPA 5HLFB 2KGJA 3JSRA 3VAHA 3CH9A 1KQGB 1V3SA 2C2KB 1T11A 2A18A 1S9GB 2MMYA 3IGVA 1N0VC 2R7XA 4LRDA 1GTHA 4ZVQB 9ATCB 2ILYA 2VB6A 1U79A 2FDNA 4J9QA 4URGA 1JX4A 4LF2A 4PRFA 1QSYA 2IM2A 3U27A 4DR3F 2O01C 3HHLD 1KQSR 3ARZA 2RKIA 2HVIA 5B0CA 2FKEA 4RJVA 1K1QA 3A3PB 4I6WA 2PMZD 3JAMU 3WL1A 1KQKA 4F4XA 1W9VA 2UUCF 4USHA 2CVIA 3MPVA 2OD6A 1UR9A 2EFQA 2F8EX 1WC3A 4YHHF 3FFIB 2MZRA 4Q22A 1GMWD 1VHFA 3W61A 4P71A 1UEKA 5KFJA 4UUWA 3IBWA 2H51B 1AYEA 4ID5B 1HI1A 3DLGA 2XM3A 4C97A 1RT4B 1U24A 3DU6A 4IR9A 1VHIA 3NAIA 3ELHA 2BW7A 3BN4A 4ILMA 4OZ5A 1XR5A 4FZVA 5A2QU 5ETNA 1S1TB 5A8RA 1WHXA 4IQXA 1KOOA 4JI2F 3DLKA 4IYQA 3I9V9 4U7UD 3O5GA 1KFDA 4XTTA 3BZQA 1FJEB 4U7CA 5DZ6A 3OW2R 1ZPVA 1LEOA 3C14A 3D6MB 3V81A 2ZWPA 2W9BA 2OEJA 4DR4F 2V8VA 2VUGA 1A7GE 5L1JA 2JLGA 1YBAA 2DT2A 3TRGA 3WHIA 2I0XA 2ASLA 1NK0A 3ZZOA 4ANCA 1BC6A 4CLPA 4U95A 1EKRA 2C2NA 1RDRA 2ERRA 2ASYA 1NH6A 1FKRA 4TU9A 2D3UA 4GO5X 2AT1B 1R0CB 4HYKA 3R1LA 1U45A 3I4PA 2SXLA 2GW8A 5KFHA 1I51B 3DOKA 1NJIT 3HSJA 2CPYA 2XPBA 3G4SS 3K57A 4EWTA 3V6DA 2C42A 1M1KT 3VQSA 4ED0A 2A10A 1TKTB 3MAAB 2DO0A 5IT9U 1FDBA 3KAFA 1F2GA 4C2MA 1C4AA 1PYOB 1SC3B 3UR0A 4PG6A 1ZK6A 4DZ3A 2DGSA 4GC6A 3G96A 2JVOA 3ZZTA 4KTQA 2IDLA 4YUDA 1X5PA 2UUAF 1FE4A 1SH0A 2DGOA 1ZTTA 3JS9A 2FJDB 3L7PA 4OHWA 3W9JA 2QG9B 3AS2A 6AT1B 2HNYB 3HM9A 1WKJA 3IR7B 2JOQA 1SR0A 3EY6A 2ZFHA 3C19A 4FYXB 2DR9A 1NWRA 1APSA 3FK4A 4OYOA 1MLAA 2FJEB 3KLFB 4N8OA 1V9OA 5CYMB 5LMNJ 2CADA 2FVPA 3BKUA 2I8EA 3TA1A 3O5EA 5C2GA 1VC5A 3TX8A 3H4BA 2UUWA 4ML4A 2Y1RI 2DR7A 3KJQB 3TW0A 2CDRB 4Z2KA 3MCSA 2WOMA 5F0WA 3ILJA 4C3KA 2H5JB 2R9LA 4MMOA 2M0GB 1IXKA 4J9NA 1R7IA 4JFMA 1RWUA 4N56A 5J6EA 4I7FB 1RSCA 1RHMB 3DU5A 3IS9A 2YQ0A 3MF5A 4O4RA 5D0GA 3ETOA 1WEXA 4OHZA 2V4RA 1TK5A 2E1AA 2LCWA 5CZXA 2UP1A 3K2YA 2C2ZB 5LT5A 2KI3A 4ECXA 3OHAA 1HWUA 2W2OP 2XB2D 2PIIA 3X3UA 1JKHB 4IFVA 1UVKA 4EO6A 2BX6A 4HHUA 1FX2A 2DISA 4KGKA 2PI6A 3CVKA 2QLFB 4FN2A 5GAGU 3W65A 2F23A 2PI5A 2GGPB 3PJ9A 1YLXA 4KHPJ 3GJSB 1S49A 2YQ1A 1VQ4S 2ZBCA 4MIWA 1X31C 4DWSA 1OQ6A 4Z7CA 5C5JA 4FPIA 2VHGA 3D0HE 2ZH3A 4LF7F 1Z1ZA 1CJKA 3I32A 3AOBA 3PTWA 2PPPA 5KFGA 1Q8KA 3OQ2A 4R8UB 1VRUA 4RWWA 4E2FB 2I5JA 4FBTA 2XSJA 1WF0A 4AXJA 2ALYB 2ZBIA 4DRQA 1RA6A 1SV5A 4ZP9A 3RU0A 5L46A 4HBEA 1KONA 5B0AA 2KM8C 1B3TA 3GJQB 4QJVA 2MYFA 2B51A 3QWUA 4DUYJ 5K14A 1G3OA 3UDLA 4PXEA 4OI1A 1Y3KA 5J2NA 2Z8QA 1M1HA 1DTQA 4Z2JA 2HFZA 4CTAB 4WP9A 4CH7A 4URQU 2XQCA 3MM7B 3JSMB 3AOCA 4I6AA 4DV6F 4FKXA 4NCGA 3OJSA 1UZHA 1J5OB 1FE0A 3CCSS 2GAHC 1X6NA 4F4WA 2FB0A 2GMLA 2M52A 4JI6J 3M8RA 5IM0B 4DHVA 3A8KA 1UJ6A 2CAJA 4TU8A 5KFKA 2UZ5A 5D78A 1RT1A 3GFHA 3IG1B 3C2PA 1NHVA 3DLLQ 4C0HA 2DEJA 3TQEA 5LSOA 3R6LB 3EWGA 3B82A 4OFZA 2C3PA 2VFVA 4RW7A 4AL6A 4USUA 1FK9B 4H4OB 1NJWA 3A4TA 3PR4A 3K59A 4DI6A 4HVZA 1UTAA 2VL1A 2MZSA 1X4HA 3RBXA 1L3UA 4O4GA 4DU8A 1HNVA 3M2RB 1QM9A 1R3NA 4RR5A 3MWBA 4ZVRB 1O6XA 4RW4A 2FLLA 3CNQP 2JEGA 2FTRA 2Z56B 3PR9A 5DGBA 4DFMA 2GZOA 2RB7A 3BSOA 5H9FK 2B4OA 4UOCA 1Z2LA 4JB8B 1CC7A 2BOPA 1SQGA 2DJWA 4NA3A 1NSPA 3FSIA 1TFWA 3TJ8A 1HYSB 3W7BA 5FLXY 1D8YA 1WG5A 2QSWA 2V2ZA 4QU7A 1FRLA 3SEOA 1G1XA 2JC0A 4HTJA 1X4DA 2Z4PA 1RTDA 5EGYA 1AROP 3HMJG 1GXLA 2MGZA 5KFNA 3KLGA 5DETA 1NDKA 2RVJA 4X4PA 1T03B 1R0AB 2VJVA 2ZH6A 1F2HA 4JI7F 3HSZA 2FJWA 4QT3A 2BJDA 1PO6A 1S48A 4GKJF 4ZP6A 4ED4A 1ZPWX 1VIOA 1TMMA 3HCXA 4L3KA 5A8KB 4KAIA 1IKXA 4AD6A 1J6YA 4ODQA 1NWUA 1OY6A 2G9OA 3JYTB 3CCVS 1D2KA 1N0UA 5KT2A 2WBMA 4NLUA 1NEEA 3ISND 1YJWS 1N4LA 5FDLA 1RT2B 2A1BA 3IR5B 5KFEA 2AGPA 3KACA 4JFKA 1J5EF 2PN0A 1EYMA 4HEA9 2KRBA 3MD1A 2BJ7A 1AFIA 3DDNA 3DRSA 3W62A 4JV5F 4LF9F 3NOGA 4NPOA 4IH7A 5CABA 1K73T 4IH5A 4CP5A 2Y1LB 3EX7B 1KN6A 3SDEB 4DQRA 4ED3A 5J2QB 1SPBP 3B8SA 2WSFC 1FRJA 4YB1P 4E8UA 4S0MA 2J9DE 3NG8A 2IC3B 1NSAA 5GPRA 1XJWB 4DV7J 1U1NA 2NLWA 3PNIA 2FLPA 4LF1A 4YB7A 1F5CA 4ZJLA 4K5RA 1Q8IA 4B9NA 1JNDA 2WSCC 2VG6B 1E15A 3W2VB 2ZZNA 2J6SA 2V9WA 1OYDA 2OEMA 2D74B 4LAYA 1ZS6A 1RT3B 1HR0J 1IBLF 2LQ8A 2FHOB 1UCNA 2BJ3A 1TL1B 2NXNA 4PXBA 4L76A 2QMUB 4HACA 4TQRA 3BSCA 1FKPA 2GIQA 1HWKA 1YW5A 4EU0A 2B56A 1P9QC 8RUCA 4Q43A 3RG6A 4X4UA 2XLJA 3CB4A 1NH8A 2DB1A 2KE0A 4NLPA 2XMWA 2MQOA 1U1LA 3GG0A 5LM7E 1WNOA 3VR1A 4JI8J 1RWOB 3T1HF 5LXRA 2CYYA 1EQ3A 2QIFA 2RU9A 2V6AA 1LW2A 4OLPA 4LSNB 3GSIA 1EHWA 1F6TA 4I68A 2GVZB 2KVQE 4DR1J 1LKZA 3OSPA 4A8WA 3X1LB 1K9MT 1R8BA 2HHXA 1C1CB 4U9RA 4ZPBA 4ECZA 2K2PA 2A0FB 3LUOA 3HVAA 1DQ8A 1RTIA 3W2WB 2X1AA 5L9XA 5HATA 2IYIA 3MMCA 4XDDA 2P8IA 4F0MA 2LKZA 2PEHA 5GAEI 1RHKB 1P1TA 1X5TA 1DQAA 5CYQA 1RTZA 1YHQS 1XR6A 3DLHA 5ETPA 4NCAA 2K8IA 2AJQA 1U0SA 1MSWD 3MM5A 1M90T 1IBMJ 2QJ3A 2MPUA 4ZA1A 3DRRB 1QLNA 4QIEA 2RRNA 2DIUA 1TZ0A 3VAIA 2HWTA 2EPIA 4QR2A 2R7RA 2YKMA 3CMQA 1OSCA 3T9ZA 4LQ3A 4M5IA 3NP5A 4F25A 5L8RC 1GH8A 2JLFA 1ZH5A 4H54A 1R8AA 1BQNA 1BQMA 1H6KX 1X4EA 4RW9A 1B7YB 3U1MA 1JLQA 5D0HA 4OX8A 2WB4A 1LW0A 4G3IA 2GHWA 1T9VA 3LAMA 3JYMA 2RUQA 5F9LA 4YFUA 3ARRA 3ICLA 1JXEA 3OTDA 1U1QA 2VQFF 2KFNA 2ZKTA 3BGUA 3DM2B 3UD3P 3CC7S 4LF8F 1MN9A 1HKAA 2EBEA 1NH7A 2XMUA 3WQVA 2KDOA 2PE8A 3VV2B 3K5MA 3O5MA 3BQ2A 2BKNA 2AX0A 1S1XA 3NNCA 1FKJA 3HHKA 1EB0A 4P7TA 3ENWA 4ECYA 2CJQA 3CHEA 2GJFA 2HQ3A 3LA0A 1SVDA 2W9AA 2WONA 4FVMA 4NEZA 1ZB5A 2Q6CA 4Z7YA 3AJDA 2WW8A 1E6VB 3QT7A 1H3DA 3H25A 1HWIA 4JI3J 5H9FJ 4IO9Q 2UV8G 3UNGC 2G0CA 1LL6A 2E1PA 2AHOB 1ROTA 3T6JA 1JJ4A 2R2UA 1HPZA 4NXMF 1EP4A 4FS1A 1HQUB 2FVSA 3FCWA 2NPIA 4PABA 1CEZA 2AJ4A 2JSXA 4P8XA 4ETZA 2OHDA 3MMAA 5T7LB 3QT8A 5BXJA 2EI5A 4NE9C 4WE1B 1ZAXA 1UW4A 4KFBA 2I2YA 3RRHA 4F4YA 5KG3A 3ETMA 1S1UB 4ODOA 4DPYA 1F9EB 2HZAA 3ENAA 3TQ1A 4AE5A 4NYOA 2LYVA 4PG7A 1H73A 2Z0GA 4C4WA 2IVFB 1WSRA 4U67Q 3NL0A 1B6CA 1S77D 4OJ3A 2YBUA 1YRUA 1JLEA 1RT5A 4LAVA 1UVJA 4ZDNA 1CJUA 2G0IA 4LQ9A 2LQ5A 2VCDA 3SV3A 2OPRB 1FTCA 1R8CA 4FNHA 1VBYA 2HURA 4BWMA 4JI4F 3D68A 3SFGA 3UVJB 4DQIA 3DOMA 1V5IB 2KM8B 5ETTA 2GQ2A 2BKPA 3I0RA 1WOOA 1VS3A 2DNGA 2GVDA 3C6TA 2XULA 3MFHA 2HG4A 2D9OA 3MGJA 2WK4A 1FD2A 2ZNZA 4MYUA 3SV4A 3PYFA 4ANDA 1PC4A 2PV1A 1TL7A 1TU0B 1YZ7A 2CPHA 2CJKA 4HI1A 1S0VA 2RQSA 2OTJS 1ZZNA 3MOJB 3UCUP 1FFQA 4N8NA 1BWEA 4F2RA 5GVQA 2HVHA 2PFDA 5E7OB 5KFYA 4DR6J 3BMBA 1YVFA 1LK7A 3MEDA 3PKMA 3DLEB 2D9FA 3WH0A 3NGRA 2VONA 5B7WA 4RUBA 5D3GA 1W9UA 2RF2A 4ZVHA 5IWAJ 2W2NP 4M5KA 2D3OR 3H20A 5G4DA 2RD5C 1QSSA 3SCIE 2DPIA 3EXYA 4TQSA 1BUXA 2AP6A 1WOSA 2KT2A 3CULA 2HHTA 3DRXA 3FBCA 4I2PA 5HROA 3B54A 3NLCA 4KC5A 3BR9A 3HVTB 4ODPA 4UF4A 3KG1A 1QUVA 5E3CA 3M4XA 2KYZA 2KFWA 1U2CA 3I6CA 2FAPA 1RAGB 4UW2A 4HDHA 4USIA 1AW0A 1WB0A 5CYJA 4JI5F 1KHWA 1U8SA 4H4MB 4RW6B 3K8WA 1M0SA 1VK3A 1DBDA 2QLXA 2V50A 2JFKA 3CJKB 3ZC4A 3D0IE 4RBTA 2DXFA 2HK3A 3MURP 4MIBA 4A8SA 4NLOA 2PPOA 3I5AA 3M8YA 4DG1B 1KNZA 2FVCA 1ZTWA 4EEYA 4KR0B 1K8AT 3L7UA 2FDMA 3P96A 2Q3PA 1G6BA 2C2EA 2H5EA 4S3KA 3MECA 1S79A 1NKCA 3H5SA 2DG9A 4J9RA 2FHKA 2DKOB 1XMOF 2RKIB 1HFEL 4CCHA 1HXVA 3FRZA 3FMBA 2XP5A 2Z2LA 1SH2A 1RI7A 5G0RB 3AQUA 3NI6A 3ZXWA 2YVSA 2MY8A 3Q22A 1F5AA 2FGCA 3DGPA 2AGOA 4NYPA 5CAAA 1D9DA 1VC6A 1RGVA 2K1RB 5HMWA 4IRDA 3ZTQA 1NSGA 2CA9A 1IVZA 1FNMA 2CNNB 4EO8A 2B9WA 4NRTA 3TDBA 1C1BA 3UD5A 5F8IA 2R8JA 2F8HA 2YNIA 2Z57B 1Q5VA 2GFFA 1T94A 4J9MA 3N0VA 3OUYA 4DN0A 3QIPA 2BE2B 5A8RB 5GAHU 4HBOA 2AOSA 3DLKB 3GQCA 3CD5A 1Q82T 3C6UB 1IKYA 3TZYA 2PFFB 3M2VA 3LOUA 3AD9C 1E6YA 1ZAVA 1AA1B 2NREA 5AE2A 1N36J 4EK2A 1GUVA 4F3QA 3NNAA 1LJYA 3PW7A 2LPVA 2J7UA 1KLNA 2W9BB 3HHLA 2VG5B 3ARYA 5KFTA 1MW7A 2JLEA 3L95X 5JH8A 5HP1B 2X7IA 1TQLA 4DV3J 1HL6A 1UWBB 3J80Y 1BY9A 4TYBA 4RW8B 3VWSA 3T9NA 3G9CA 1YJNS 3RR8A 3SQOP 1RAAB 3A3NB 1L3SA 3OVBA 2JC1A 2JEFA 3UDVA 1ELOA 4ANEA 3JQKA 3KHGA 1F3VA 4DRKA 1JQGA 2Y1IA 5I4MA 3QLHB 2XP7A 1TK0A 2K7KA 3TUZC 2DHXA 2BW2A 5EUHA 3WL0A 3D0GE 2AEFA 4N5SA 4LFAF 3V6DB 1K0TA 4KHRA 1NRKA 1VQ5S 3CJ5A 4L72B 2J76E 3MI7X 2KU7A 5KFRA 4DPTA 1WDDA 4I4BA 3S1TA 4P8WA 1K0VA 1TKXA 2W2PP 4IDKA 1TP7A 4ELTA 3PYGA 3PV8A 4ITZA 3A3OB 2FPHX 2DITA 3ZZZA 1S9EA 4QYRA 2WVBA 4F04B 3KFWX 1TMJA 3QZ7A 3GPKA 5F8NA 1L3KA 4AXIA 3FNNA 2DNOA 2Y3YA 4X4RA 2ZVSA 4DRHA 1ZA1B 4K4XA 2CQ0A 4BWJA 2GC8A 5IXUA 4X4QA 4IRKA 2IAJA 1XNRF 2UVUA 2EKYA 4JI2J 1RTJB 5KFLA 5LJ3Y 2E9TA 5D0RA 2ZOFA 4KBIA 3FKBA 1YGYA 4QIFA 3JB9k 1SC1B 4P2MA 4PG4A 3MOZA 4LFCJ 2AYGA 1R43A 2FZKB 1P1LA 4PYDA 3PHTA 2A6MA 3HHEA 1VQKS 2D7SA 3CO9A 2W4DA 4B3TJ 4B3RJ 2YWWA 4J9PA 1BL4A 3AS3A 1MNEA 2KN4A 4QIBA 5JVHQ 2DT1A 3CPWR 3NRKA 3VHQA 3IS9B 1HKJA 1VLOA 3O5IA 1IBKJ 4X4SA 3MEGA 2C28A 2HHSA 3TEHB 4ODKA 3VVUA 2YWHA 3D66A 1LWFA 1WKKA 4WZMA 4NZ0A 3PIOQ 4HH1A 4CO3A 2DNMA 2FY8A 2VDIA 1G2EA 3QRPA 4IFVB 1VRQC 2XCAA 3CXCR 1FJCA 4DRMA 2W8LA 1WC4A 1Q5YA 3FBEA 3GB0A 4XPEA 2AD9A 2GNKA 2ROGA 3QJPA 3BDEA 2MLZA 3M2UB 4QOTA 3SBMA 2ZH9A 1FKHA 4B9SA 2O92A 4LF4J 3MMBB 3TZXA 3I87A 4CWBA 3DYAB 1CS4A 4WZQA 1TELA 2AW0A 1W1YA 1ZBCA 5CA5A 4ERDA 4A8FA 4QWAA 5C24B 3L9ZA 1SH3A 3OR1A 4C7QA 2ABYA 2CNLB 4OJHA 3GE9A 3ONQA 4RZRA 2OD4A 1CJKB 3PJXA 1KDNA 2MZQA 2IF4A 3AB2B 5GAGI 2O9OA 2ZUGA 3PW4A 2XSJB 3TEGA 3LP0A 4O23A 2MQPA 1I94J 2E1CA 2W2QP 5HSPA 1RE1B 4LBPA 5C2CA 4AYBD 4NLVA 4B9VA 2N87A 1S9GA 3PRBA 3NS6A 2BBEA 1ZCNA 1D7HA 2FZGB 1FKBA 3JAMY 5J2NB 5KT6A 4K5SA 3ARVA 4WXOA 1RD6A 1CQMA 4IR1A 3R3TA 3WD1A 3EZUA 2OELA 2YWFA 5CD4H 1Q8LA 2EG1A 4OZNA 4NCGB 2EXUA 1U1MA 3IAS9 5EX0A 3HPOA 4ZIVA 3W8PA 5LMUJ 2ZZMA 1WD6A 3IBCB 2MKJA 2J9CA 3NOCA 5DM7Q 4UOFA 3JTNA 1RT1B 1KHVA 4ID5A 4OYWA 1RT4A 1UFKA 2IIHA 3O5RA 1N32J 1JNRB 5HWBA 1HQEA 3PM9A 4DSKA 3KLHB 1H0IA 1XWLA 3BDPA 3K89A 4NZ7A 1WACA 4X4NA 4AQYJ 2V8HA 1FKFA 5LMNF 2OPPA 1OWQA 4O4GB 3QPIA 3CGMA 1XN9A 3ZNJ1 1WI8A 4DX8H 1HNVB 4ZCIA 3FDSA 4Q8EA 2KFZA 3G6ES 1XQIA 4RW4B 1ZZFA 2ZJPQ 5F8MA 1S9FA 4ZVFA 2GAGC 3IC1A 1N34J 1Q0NA 2DXEA 1JVWA 2FJXA 1SL0A 2VJUA 1HBMB 2MDAA 5HTGA 3MCMA 4MTVA 4DV1J 5ETVA 1OPIA 1X60A 5F8JA 4DLEA 1REVA 1B64A 3BM7A 3KKFA
chains in the Genus database with same CATH topology
1S1TB 1VK8A 1RYSA 3HO1A 5A8RA 1WHXA 3KLGB 4IQXA 4N76A 1HD1A 4IH6A 5KG0A 1KOOA 2WSEC 4URSA 4HHJA 3DLKA 2JFDA 4JI2F 2FHJD 4IYQA 2JDJA 4DMZA 2HLTA 2LA4A 3I9V9 4IFYA 3O5GA 1KFDA 3QAUA 5EWFA 3PA7A 4FAPA 3BZQA 1FJEB 4U7CA 1X5SA 3T3FA 4MK8A 3OW2R 2YKAA 3GV7B 2PI4A 2B0GA 1UEUA 1ZPVA 3MMJA 1FXRA 2ZOMA 1KLMB 1S0MA 1D9AA 5AXNA 4Y28C 3CF5Q 1LK5A 1HBNA 2V4QA 2BABA 3K5PA 3MR3A 1L5UA 4FF4A 3CIMA 3V81A 3Q2SC 3AROA 5KT7A 4X4TA 1NKEA 3KJVB 3DRPB 3G6VA 4IRCA 4KHPF 2W9BA 2XS2A 2R7SA 2AJ0A 4DR4F 3HZEA 2V8VA 3IKDA 2VKRA 2CDQA 2R7QA 3NAHA 2VUGA 1QY7A 5EDWA 3QO9B 1A7GE 5CQGA 1M5HA 5L1JA 2XNRA 2JLGA 2PBCA 3IRWP 1Q4RA 1YBAA 3MD3A 1C0TA 1JJ2R 1VQYA 4DR3F 2DT2A 2F1FA 2Q1LA 2VBZA 3R27A 5FD1A 4IOCQ 2UU9F 3TRGA 2I0XA 4KO0B 2ASLA 1NK0A 3DLGB 3WDOA 2CQPA 3A1YG 5LL6d 1N5SA 5DITA 4G1IA 2CPZA 3ZZOA 2WLZA 1HHTP 1LFWA 3GFXA 1BC6A 1U47A 2E9RX 4OX9F 2CPFA 4QZVB 4ODNA 4WFZA 5CCMA 1Y00A 1RDRA 3I5CA 3T5KA 3MPWA 4CQ1A 5IT4A 2ERRA 2ASYA 1NH6A 2MPHA 2XGPA 1FKRA 2DHGA 4TU9A 1Y5IB 3UF8A 2NS1B 1K1SA 2D3UA 4FXVA 1FO1A 3J7ZT 1VQ6S 2PO4A 2HNYA 4GO5X 4DZ2A 1GPFA 4OV1A 1N6QA 2ITKA 4ECWA 4HYKA 4RUCA 2LKNA 2CZ4A 2VFTA 3R1LA 1U45A 3I4PA 3O1LA 1ZBTA 2SXLA 5KFXA 3Q8PB 3RB6A 5HO4A 4IO1A 2GW8A 5KFHA 3M8QA 4IFYB 2ZR4A 2CQDA 4HT7A 5F3ZA 3DOKA 4WIIA 1UFLA 4QIGA 1NJYA 2CQGA 4ODMA 1SJ3P 1NJIT 4A4JA 2CPYA 5CYMA 2FHMA 3CSKA 1HNIA 2XPBA 1X7VA 3G4SS 4EWTA 3K57A 1IJFB 2C42A 3V6DA 1M1KT 2MKCA 3VQSA 4ED0A 1U7LA 5AJ3F 1HBOB 2A10A 1TKTB 2DO0A 3IA0A 1FKOB 4NMLA 1VQ8S 4CH1A 4FS2A 1NU4A 3V81B 1FDBA 4DUYF 2AJFE 1YATA 3KAFA 4K4SA 1F2GA 2GO8A 2ZHAA 3CZ8A 1S6UA 1RTHB 2DNQA 2E66A 2E1RA 4CT9A 2KXFA 4C2MA 5KG5A 1C4AA 3UR0A 4PG6A 4B3SF 4N47A 1ZK6A 4DZ3A 2NSBA 3R5AA 2DGSA 4DSIA 4GC6A 3G96A 4CO5A 4Z2GA 5IT0A 1P27B 2JVOA 3ZZTA 1QJHA 3G8QA 4KTQA 4RNNA 4WK9A 4YUDA 1X5PA 5EWEA 3LAKA 2UUAF 2EVZA 1S0OA 1FE4A 5U47A 1SH0A 5BJRA 2DGOA 3ISNC 1ZTTA 3UFCX 2ZH4A 1S1VB 4RNFA 3QYYA 1HNWF 2FJDB 2JWNA 3L7PA 4OHWA 2OIHA 1FKGA 1Q78A 3OLAA 4P8VA 4IQCA 4OI0A 5B08A 3CHCA 1HMVA 5DLGA 1VQOS 3AS2A 4B3OA 2IBKA 4GGQA 3J7YI 2E5LF 2H9ZA 1ZYQA 2XO7A 1SJ4P 2JVRA 5GADU 4P2SA 1GX6A 1Y5NB 2HNYB 1VI7A 1PBKA 3OOBA 3D5MA 4AUKA 3I56S 3HM9A 2XBPA 3ULHA 4JI6F 2R4FA 2PMHA 3VAMA 3IR7B 3W4RA 2VFUA 2YH1A 2JOQA 1SR0A 3EY6A 4OHVA 2ZFHA 3M8QB 5KFQA 3T19A 4QPTA 2DR9A 1NWRA 1APSA 2YY3A 3DOKB 2FJEB 3KLFB 4N8OA 1V9OA 2KI2A 5CYMB 3CCQS 2OPQA 3TO8A 3M8SA 2FVPA 1JKHA 3E01A 2ZITA 4MFBA 3CE8A 2I8EA 1JLCA 1F5BA 2QA2A 4J9OA 4DR5F 3TA1A 5K8MA 4EZ9A 3O5EA 3OXFA 4CT8A 1VC5A 4Y34A 3CTRA 3TX8A 3MM6A 2W4CA 2UUWA 3OJUA 3H4BA 3G71S 3N28A 1VBZA 4ML4A 2FJAB 2Y1RI 2DR7A 4J4NA 3TW0A 3S8SA 3MCSA 4Z2KA 5E3AA 4QPXA 3S7RA 2WOMA 3OTEA 1YJTA 5F0WA 3WD2A 5F8LA 2FHJA 3H2VE 2RSEA 1KVJA 2X1FA 1H7WA 5AE3A 4C3KA 3RGCA 2R9LA 2J7WA 3KLEA 4MMOA 1H0HB 4KGMA 2GO9A 2M0GB 3NKYA 3H59A 4DS4A 2FJBB 3P49B 4NSBA 2GCFA 2QV6A 5I3UA 3CGNA 3E51A 1IXKA 4J9NA 1T05A 1RT6B 1R7IA 5KFPA 1SL1A 1PINA 1X4GA 3F56A 2E1MC 1HARA 3I0SA 5KG6A 2W7PA 4JFMA 1RWUA 4N56A 5J6EA 5KOWA 5IS2A 4I7FB 1TVRB 2B7BB 3FSXA 3OFHA 4MYTA 3E2EA 1K9TA 4J9SA 2Y78A 3BO4A 3TC5A 3DU5A 3IS9A 4ED7A 2XY5A 4HLBA 4QW9A 3MF5A 2QZ8A 3FGVA 3KK2B 2JH3A 3V4MA 1D1UA 5HMYA 4K4ZA 2JRSA 4O4RA 1TL5A 3ETOA 1GQEA 3IKGA 4FF1A 1WEXA 5IQQA 1RTIB 4OHZA 1QPLA 1X0PA 4W9PA 1C2PA 2V4RA 4LIWA 4N77A 4LAWA 1TK5A 2E1AA 2LCWA 5CZXA 2UP1A 3K2YA 5LT5A 1MMLA 1C0UA 2KI3A 3B9EA 1ZM4A 2AWZA 3U1LA 3OHAA 2A3CA 3IXQA 2R2TA 4ECXA 1HWUA 4BBYA 2IUZA 4TYAA 4TY9A 2OPQB 2XB2D 2PIIA 1X4AA 1JKHB 3X3UA 4IFVA 1UVKA 4MFBB 4NWBA 1XEZA 4M63A 5M2PA 1OWXA 5HMXA 1FJGF 4EO6A 4E0DA 2UVWA 1JLFA 1RT7A 3LGNA 4Y0FA 2DISA 3NRBA 4WFAQ 4GKKF 1KTQA 3MM6B 4NZCA 2DT3A 4KGKA 2RIJA 3PRDA 2L9DA 2PI6A 3CVKA 2VV5A 3SFUA 3M05A 4K4TA 3IO1A 2WOMB 4FN2A 5GAGU 4QWCA 4EYHB 1NZAA 3Q8RB 4I0WA 2PI5A 2AJ1A 2GGPB 1F0XA 3KLEB 1FTRA 4OI6A 2EW9A 5LJ5Y 5I3UB 1S49A 1T05B 4KE5A 4K59A 3SZ2A 1NWTA 4C11A 1VQ4S 4B9MA 2GV1A 3I0SB 2ZBCA 2XP4A 1VRTA 4FXDA 4ZVGA 4CTAA 5F3TA 2BRLA 3BJYA 1HI8A 4MIWA 4DWSA 2HQIA 5J2PB 1OQ6A 3G8TA 2BJEA 3Q0AA 3UI5A 2BM0A 2M2BA 2Q43A 5AE1A 2B4VA 5C5JA 2RS8A 2XS5A 3AJ1A 3D0HE 5D75A 2DH7A 1U4BA 2IVYA 3KCEA 2ZH3A 4PKDB 5AXLA 1SUQA 4LF7F 1H2TZ 1Z1ZA 4AL5A 4QYZJ 1BQNB 1SJQA 4UY8T 5DRKA 1IR0A 3I32A 3THTA 3BGRA 4RW9B 2PPPA 1WI6A 1JLQB 2IA0A 2PN6A 3R5CA 1BKFA 4KT0C 5KFGA 3QZ8A 1NK6A 2QA4G 3OQ2A 1LW0B 3PXGa 1WG4A 4R8UB 5D6GA 2QEXS 3UQAA 4NZ6A 3QAEA 1VRUA 1IKWA 4ZHRA 4RWWA 3EPIA 2B7CB 5J2MA 2LVWA 2I5JA 1W2BR 4FBTA 4WKAA 2XSJA 4DSLA 2DRBA 5DF0A 3SCJE 4ZCKA 1WF0A 2QRRA 4AXJA 4DPOA 2ZBIA 5E0OA 4DRQA 1RA6A 1B7FA 1SV5A 4ZP9A 3IFEA 1RKIA 3RU0A 2KXHA 2VOOA 2MY7A 3GIIA 1JLFB 1RT7B 4HBEA 2L3MA 3H5XA 4ALZA 1KONA 5B0AA 2KM8C 1OS5A 4QJVA 3PEJA 2DGVA 2MYFA 3PDNA 4DV4F 5HI7A 3ARUA 4HTIA 3SMZA 2XMJA 1SI9A 1XMBA 3HDSA 1MMNA 3FZBA 2B51A 4MNJA 1YG0A 3QWUA 1IUJA 2A3JA 4ZP7A 2WB1D 2XCPA 1HW8A 3PW0A 5K14A 1G3OA 3UDLA 1KR4A 5D4NA 2UUTA 4PXEA 4I2QA 2ZDOA 4OI1A 1FK9A 1MROA 1Y3KA 4H4OA 3B78A 5J2NA 1S1XB 2IJNA 3GMGA 1SBRA 2Z8QA 1M5YA 1ROUA 1DTQA 3M8PA 4NLDA 2DPEA 4Z2JA 2HFZA 4J37A 1PSDA 4CTAB 1FKTA 1KT0A 1C9HA 1TFVA 2WM0A 4R5EA 4DWSB 2I9SA 3KLIA 4CH7A 5HBMB 2AQ4A 4URQU 4PWUA 4F2SA 2F3JA 3CC2S 4D3GA 1L3VA 3MM7B 4PR6A 5E3RA 3JSMB 4DQPA 1NNDA 3UI6A 5DG8A 3HXMA 1NK5A 1JLGA 4I6AA 4DV6F 2WONB 3MR6A 4NCGA 3OJSA 3M2RA 3LPYA 2HYIB 1J5OB 1FE0A 2HGNA 3CCSS 5KG4A 3V6KA 3CHDA 1X6NA 2N82B 4LVNP 4F4WA 2B4PA 5K5MA 2DHAA 2FB0A 1HNXF 1FXDA 2GMLA 4X4VA 5B0EA 4TW7A