4QZVB

Bat-derived coronavirus hku4 uses mers-cov receptor human cd26 for cell entry
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
208
structure length
208
Chain Sequence
TECDFSPMLTGVAPQVYNFKRLVFSNCNYNLTKLLSLFAVDEFSCNGISPDSIARGCYSTLTVDYFAYPLSMKSYIRPGSAGNIPLYNYKQSFANPTCRVMASVLANVTITKPHAYGYISKCSRLTGANQDVETPLYINPGEYSICRDFSPGGFSEDGQVFKRTLTQFEGGGLLIGVGTRVPMTDNLQMSFIISVQYGTGTDSVCPML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bat Origins of MERS-CoV Supported by Bat Coronavirus HKU4 Usage of Human Receptor CD26.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/viral protein
molecule keywords Dipeptidyl peptidase 4
total genus 41
structure length 208
sequence length 208
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.70 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4qzvB02
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4qzvB01
4ZPTR 3SCIE 4L3NA 3SCLE 4ZS6A 3D0IE 4ZPVR 2GHVC 2GHWA 3BGFA 2DD8S 3SCKE 4XAKA 4QZVB 2AJFE 5DO2A 4L72B 4KR0B 3D0HE 4ZPWR 4KQZA 3SCJE 3D0GE
chains in the Genus database with same CATH superfamily
3KMSA 4DV2F 3UQIA 2XZDB 1LL4A 2E5GA 4L3NA 3N5FA 1P1TA 3DLEA 4JI2J 3ISND 3KMQA 4WXWA 2G2YA 5HVHA 2EG1A 4FF1A 1C0UA 2XGPA 3QRRA 1W1PA 2D69A 2DH9A 1E6NA 5F41A 2IA0A 1FNMA 4IFYB 2AJ4A 4CTAA 3CJ0A 5AE3A 1Q8KA 1S0MA 4LVNP 2UUAJ 2ALYB 2F9JA 2N82B 4TNSA 2DNRA 1TKTB 2GQ2A 3FQKA 1EJ7L 1TAQA 2NS1B 2VF3A 2HPUA 1Y7PA 3IG1A 2CPXA 3M8PA 5HBMA 2HBYB 1BQMB 4GO5X 2MY8A 2BJ7A 4ALZA 3RTVA 2PI4A 4LFBJ 2AP6A 5SZTA 3WDOA 2CQ1A 4M1KA 4WFZA 1R27B 3RYLA 1G7CB 3MECB 3J7ZT 1XNQF 3IXQA 3AJ2A 4J9QA 5E3PA 2RHSB 3ZXWA 3BGRB 3GPAA 4CLPA 5J1EB 3TZXA 1JLAB 1BQNB 1KHWA 4FF3A 4DV7F 1F9EB 2VD3A 3Q8QB 5C42B 3O5GA 4YS2A 2EULA 3A1YG 5DZ6A 6FDRA 5KT3A 1AYEA 2DXDA 1BUXA 2AV5A 2P8IA 4HTIA 4RU9A 5LMNF 2E44A 3TAQA 4FXDA 2XMKA 4HDHA 4NL5A 4RW8A 5IV3A 1Y4ZB 4YHHF 2R8IA 4NYOA 3N6LA 2YNGB 2Z2MA 3V6HA 4JI1F 1U47A 3NS7B 4ZIVA 4I7FA 2RKIB 1HBUA 3NRBA 3RM8A 4Z2HA 2P9EA 4F4KA 4PWDB 1JLAA 1BQNA 1R6YA 4USIA 1TVRA 1PC4A 4B02A 1NMWA 2ROPA 4TYAA 3JYTB 4Q7NA 2EFVA 4DV2J 4DR1F 2F5GA 2AX0A 4GKKF 1DZ5A 2XSFA 2EG2A 4DXLA 3CDUA 2DT3A 4ZHRB 4OLOA 2R8HA 2HEKA 2IVMA 1IQTA 1DARA 1F9HA 3WIVA 4DU7A 1AA1B 2C2MB 2YNGA 1XK8A 3FEXB 4FVMA 2F2DA 1XR6A 3HSDA 3ARUA 1HXVA 1OYDA 2EFNA 2V6AA 4O44A 2QTWA 2VJUA 1Q82T 1ZBWA 1DY3A 2FVPA 2BABA 2VG6A 4FZVA 2Q5AA 3DHXA 2X1GA 1NK0A 2L3MA 4LAYA 1FDDA 4LRAA 2RJZA 2M3DA 4N76A 1ZU8A 4J4OA 1S5ZA 3HZEA 4K2XA 1WOSA 2HVHA 5D0HA 2X7IA 2JEFA 1GMWD 1BLUA 1P27B 2BJDA 2N7CA 2BOPA 4IR9A 1D0EA 4BF8A 1N52B 4JFMA 1CJUB 1QUVA 2RF2A 4HVZA 4DSFA 1VC5A 3LUYA 1QPLA 5CABA 4GVBB 4DL2A 2HK2A 1JJCB 3OUYB 2XNRA 1T8EA 1P8GA 2GQCA 1LWEB 2KN4A 2MHNA 1N5TA 1XN9A 3K2YA 1F0XA 4EMDA 2ZQTA 3QRPA 1XWLA 1APSA 3G4SS 3MDFA 1JQGA 4FKYA 3RR8A 2DTJA 2BJEA 4TU8A 2MZRA 1IN0A 3T6JA 4USUA 2R2SA 4ML4A 1EAYC 2GQQA 4BHQA 1JLCA 2GZOA 3H20A 1HW8A 3U27A 2WONA 3C6TA 4QIVA 3SCLE 2H51B 2JSXA 2VC0A 3EMTA 5CZVA 4CO3A 3OUYA 2C2EA 2FVRA 2XTJP 1RU2A 4C2MA 3CCRS 3MM7B 3R5BA 2K2PA 3OR2A 2NUHA 4UUXA 5DLGA 3TI0A 2PMHA 4Q2LA 2KRRA 2MKCA 2UUCJ 3VVUA 3CCSS 2JNJA 4ZVTB 4AE5A 3JAMY 2LJ4A 3MUTP 3B6BA 3NCQA 2QEXS 3VR1A 3KHGA 2RDIA 3GYGA 3H90A 4KB7A 5HMYA 2CJQA 1LW2A 3CTRA 1JVWA 4ZHRA 1UVNA 4AL7A 1XRVA 3I0RA 3AFGA 4ETXA 4TQRA 1FI4A 3IR5B 4MNMA 2CRLA 2UUCF 2V4JB 2IAJB 5EX0A 3WD3A 1UL3A 3CF5Q 1ZAVA 3VGSA 3PTWA 4NZCA 2QLWA 2Z2ZA 3DRPA 3I5AA 5JXSA 3VWSA 2DRDA 3T9NA 4B17A 1XNRF 2R2TA 3LGNA 4HDGA 1Q81T 3R5CA 3NG8A 4C0OC 4DPYA 2WW8A 5B0BA 3KLFB 3UN2A 1RWXB 3H7HB 1DTQA 3OLAA 3K57A 2ZZNA 1NPRA 2FC9A 2HFZA 2R7TA 1YRTA 4KKOB 1GUVA 4D3HA 3HF5A 3HFKA 1CJVB 1PBKA 1RWUA 4FAPA 4QU7A 1ZM4A 3FEZA 1FO1A 2J8AA 3BR8A 3G82A 4ICLA 4M8LA 1HBMB 2VFVA 2XZWA 3GFXA 1FKPA 1REGX 2HMIB 2F63A 4YMEA 4IQCA 3LALA 1N6QB 2L08A 1SR0A 4F4XA 2VDIA 2KJVA 2ZC4A 4OFZA 5G0RA 5KG1A 2ZH3A 3NNHA 2J6UA 2MQPA 2BKPA 3NMAA 5HANA 2PN6A 2QJ3A 4JUZA 1C1CA 1TK0A 2R8GA 3TEHB 2P6SA 3KFWX 5CYMA 1VS3A 2CPEA 4Y2MA 2OP5A 1X5SA 4OI2A 3SIPB 3ZTSA 2XULA 4B9LA 3N6NA 3IKGA 2D3OR 2PFDA 4UOCA 1CQMA 2JJ4D 3SFUA 1DLOA 1D09B 1S9EA 2PMZD 1S48A 5A8WB 4Q2MA 2A18A 4LFCJ 2E66A 2WSCC 2AU0A 4ODRA 5KFEA 1Y5NB 1B6CA 2XMWA 3DYAB 2GO8A 3R5DA 2CPFA 3IWXA 4KT0C 1Y00A 1RT6B 2OPPA 4ZP7A 2BA9A 2CJKA 3MMBA 3F0NA 2AGQA 4TN2A 4YOEA 3RAMA 3T1YJ 2CDRB 1WAWA 4FYDA 3DXBA 3BSCA 5CAAA 1JNTA 2EPIA 3KOAA 3KAHA 1Q16B 3G9CA 2MPUA 2RD5C 2APOA 3T19A 4NX9A 4R0JA 1FT8A 3WD2A 4K0KJ 3OBIA 1QE1B 1SXLA 2MKHA 1RADB 4ED4A 3I4HX 5E33A 1RLDA 4PPDA 4Z2GA 1NU4A 3WD0A 2KXFA 1SUQA 3UN3A 4TLRA 1URRA 2WZ1A 2MXYA 3IP0A 2ZH6A 2C2DA 4KV8A 3OXGA 4RR5A 3OSPA 3DRSB 3V2UC 5A8KA 3MMJA 3FFIB 1KQGB 1LG2A 1T0TV 4FVCA 1N4LA 2FVSA 1FKOB 4W90B 1UMJA 2YKQA 1TKZB 2AJ0A 4HR2A 5HROB 3QPIA 3POTA 4K4YA 2KYZA 3T5KA 2DR5A 1IUJA 1HNIB 2BW2A 4MTPA 3MDYB 1SH0A 2M7SA 1H2UX 5ETPA 1S1TA 1WJ9A 1REVB 4OQJA 3IGVA 5IOLA 4DQQA 5J2MA 2KHDA 2FKEA 2PE8A 2VOOA 1UWBA 3DDKA 2FPHX 3P3DA 4QR2A 5EWEA 3GV8B 2HSEB 1ZTWA 2MKSA 4MYUA 5HT1A 1PYOB 2OH2A 3JYTA 4DCPB 5KT4A 4J9LA 3TAPA 5KG4A 4TW8A 2KT2A 2E5IA 4FNIA 1S9FA 3HHLA 1H0HB 3H42A 4CO1A 4WE1B 3AS3A 2FJDB 2ZNYA 3MM6B 4M5NA 3L9ZA 4DT4A 2EFQA 5IFMA 3BO4A 1WWHA 4LF8F 4W9QA 4ERDA 3TCZA 3G6YA 2R7SA 1EIBA 1NJWA 1TKTA 1WEXA 3W5YA 4NA1A 1U45A 1E6VA 1RT6A 2RS2A 2LCWA 1NBEB 2XEXA 3W60A 2UXCJ 4ECXA 2HNYA 2XP8A 1U02A 2HHUA 3M2RA 3V5RA 3NGRA 3OL9A 1NMEB 4ZPAA 3KHLA 3MCNA 2D9PA 4LSNB 2PEBA 1TL1A 5ADZA 1K73T 4U67Q 4NCAA 5GAGU 2CG8A 4MAVA 3KJQB 3DFEA 5IQ6A 2R7WA 4OZ3A 1AW0A 1NSAA 4TU7A 1CC8A 4Y2AA 1HARA 3EPIA 2WBMA 3CCZA 4WXOA 3LAKA 1VIXA 3N28A 3GIIA 3BSNA 2E1CA 2QT7A 4WIQA 3RZAA 4UY8T 5T14A 5H9FK 3QJLA 1RJJA 3O5OA 2OTJS 2G9OA 4PXDA 1RI7A 2LPVA 2OLHA 1T9XA 4F0MA 2XLIA 4IO9Q 4FS1A 4QWDA 4WU3A 2VB6A 4XIUA 1N5YB 1HNIA 3L7PA 4NI2B 1WC3A 2DXEA 2QFIA 3ARWA 2HLUA 1FJGJ 5D4PA 3R2DJ 4K4ZA 1YBAA 3PCOB 2W01A 3FZ2A 4OV1A 5EWFA 4RNHA 3HPOA 4DRQA 5FDLB 1RKIA 3D6HB 3P45B 5T7LA 1XNQJ 3KUGA 5HLFA 2ZC3A 2VPZB 1QSLA 1SV5B 5GVQA 2KFYA 2XY6A 2VG6B 4K7QA 2AZ3A 2YNFB 5LSOA 1JXEA 2B8QA 3ZNUA 4LBIA 1KOOA 2KI3A 2LDYA 4HHJA 3UWTA 1EKSA 4ECYA 3MAAA 2O66A 1T9UA 3NGDA 1NSPA 4NLTA 4Z2XA 5T7LB 3M8SA 3T1HF 2BRLA 3R1LA 1FF2A 3FMBA 1S1UA 4F3MA 4K4WA 4ILLA 3HM9A 5CYJA 4H54A 5J2NB 3MF5A 4ZA1A 1IBKF 2MLZA 1BMQB 3OR2B 1EX8A 2PSZA 1PAEX 2RSQA 3DRYA 3T9ZA 2AKWB 2HRYA 3BM7A 4KPCA 4OZLA 2C3MA 5KG6A 1YSJA 4R8UB 3HXMA 4DN9A 4KO0B 2JLEA 3I87A 5EX3A 2G4BA 3CJ3A 4ZJLA 1L5UA 2WM0A 5IWAF 3DOMB 4DQPA 2EFGA 3QWPA 2M2BA 3ODKA 3RW7A 3BGFA 5F8JA 5RUBA 3HO1A 3FDSA 3GZ7A 5IC4B 4X4OA 2YWWA 2Z4PA 2IVFB 2WCXA 2HBZB 3VVTA 3HVRA 5DM7Q 5KFDA 1T95A 1VQSA 5F8IA 2HHHF 3LPYA 1G1XA 3CD6S 5J2PB 4NLXA 1H2TZ 2GW8A 5B0FA 3CPWR 2F8HA 4YR2A 4WZQA 4X4SA 2XC9A 4KFBA 2DKOB 1UJ5A 4DX8H 5BXJA 3SBMA 3R9LA 3KADA 1A7GE 4X65F 4AQYJ 4DPOA 5CA5A 5DITA 3PIPQ 4DQSA 4LF5F 4ODNA 4GIVA 3BQ0A 3AY0A 4YY3F 1W1YA 2FUG9 4H4OA 3SQGA 2DJWA 2W7PA 3TUZC 4MYTA 4Z2LA 4KGZB 2G2OA 1PAUB 3PO5A 3B9DA 4AD6A 1VBKA 4ZVEA 3AD8C 3CO9A 3PJWA 4KFBB 4OZ1A 4GKJJ 3FVYA 1LG1A 3NS6A 4MKVA 2C2KB 1HKIA 3BBFA 3DMJA 3L3CA 3M8ZA 5A6WA 5E3RA 5K8NA 4DFPA 3KAFA 3VAWA 4LF5J 4CLZA 2JC0A 2D7SA 2ZJRQ 3ILJA 5I3UA 2JOQA 2XCPA 3FSIA 2RRBA 3K5MA 1JLQB 1UVIA 2UVWA 2V50A 2ESCA 2BE2A 1B70B 2G1HA 3NY0A 5D0RA 1M5HA 4FYYB 5KFTA 4NLPA 4OX8A 3D6TB 3V4IB 3ITHB 1ZH5A 2O01C 4GKJF 4KE5A 3MMAA 1QUPA 3CCTA 5L9XA 3HP6A 3NNCA 2B5JA 2W2PP 1VQ4S 3AS1A 5B8IC 5HW7A 3ADAC 4LQ9A 4TNOA 4ZN3A 1HBMA 3ISZA 4RNOA 5EWGA 2MGZB 4B3TF 4L74A 4QIBA 4UW2A 2HFUA 1ZM9A 1JXLA 4P9SA 2CQCA 3PYDA 3VGUA 4DF4A 2QA2A 4WK1A 3K5OA 3Q23A 3M2UA 3DOMA 4XPCA 3PDNA 3JTNA 2GHVC 4NOHA 3AROA 2CJYB 2ZBIA 1LNQA 3MURP 1RZMA 2FJEB 2R3VA 3SSSA 1IVZA 2CNLB 1ZAWA 1KOHA 2Z8QA 4JI6F 3KUHA 1RAFB 2RAQA 1RWMB 3EGNA 3TR5A 3RB6A 1X4DA 3TO8A 2YNIB 3CJRA 5KFIA 2ZBCA 3CDAA 1ROTA 4RZRA 2BQ3A 3AQPA 4C8ZA 1S6PA 4RO0A 4B9TA 2DSZA 2OHDA 2XNQA 3FCVA 1KVIA 4C8OA 1TFVA 3M30B 3RG6A 1FD8A 3DYAA 3KHRA 3K58A 1KQSR 4ELVA 4JI6J 5KFSA 2J9EA 1BXNA 2MEWA 2M52A 2QA4S 3PW2A 1T94A 1P1LA 4IT4A 2XHCA 4J7CA 3DLLQ 2R8JA 4WKAA 1WKJA 3H98A 2DITA 7AT1B 3AJ1A 4EU0A 1RT5A 4QIWD 1VDHA 4UDMA 2OEKA 4CIOA 1SC3B 1T3OA 3PRDA 1YWXA 2XS2A 3MGJA 1CC7A 5CYMB 3VQSA 2DNYA 3HT0A 3IFEA 3RAQA 2FVQA 4K5RA 4IH5A 3TA0A 1DQ8A 1D7HA 5KFCA 3BSAA 4HBEA 4I6AA 4P74A 3IN5A 1RLCL 1YRUA 4RUCA 2CQDA 1M1KT 4L72B 3KG0A 1U48A 4EBEA 2X3GA 3DRRA 3R97A 4TU9A 2ILYA 4DL7A 5D8HB 2LEAA 4TY8A 4B9NA 4N41A 2QMWA 5DGAA 4K4TA 2V2QA 1RAEB 2ZDPA 3E2EA 3NP5A 3CJ5A 1HKKA 2FLPA 1FD9A 1RT7B 2NPIA 5ETKA 2VA3A 1FXRA 2ZE2A 4NLRA 3W1YC 1SQGA 2JHEA 4ITSA 2J76E 4R5PA 2PI6A 2PV3A 1KHVA 1S7IA 1BQXA 2D1CA 2QMXA 3KJVB 3JQMA 2NYHA 1ZYQA 4ZS6A 4ZPVR 2AT1B 1Q86T 8RUCA 2GJFA 3N0VA 3BDPA 5HJXA 1HA1A 3PX6A 1T02A 1QSSA 2CDQA 5L1IA 2RRNA 5KFYA 1IM4A 4K2JA 5LXRA 4OHYA 4QT3A 4Q45A 4PRFA 4WE1A 1RT7A 2OPRB 4WP9A 4C4WA 4X4RA 2ZH9A 4IT6A 2VL1A 1NK8A 2E5HA 1NSGA 3DRSA 4I7FB 3LA0A 5A8KB 4WIWA 1CULA 3VZIA 4E2FB 5ETQA 1IR0A 4QQBA 1RAIB 1IBMF 4ODKA 1LK7A 2WHOA 2XCAA 2XI2A 2WTFA 2CFXA 4USVA 3CT9A 4DPXA 3ARRA 3CC7S 3TVYA 5GAEI 1UVJA 3RJMB 2RUDA 5DIUA 1Z2LA 3S1TA 4C11B 1D1UA 3UD3P 2HIYA 4DFMA 4DSEA 2ZQUA 1VLOA 4OHWA 1KVJA 4KHPJ 3AOAA 3GR1A 3TARA 3E51A 2GGPA 1WKKA 4KHRA 4C8YA 1VF8A 4OYXA 4WZMA 4OX7A 1LEOA 4HH0A 1EHNA 1OPZA 3A3PB 2RRAA 1HD1A 5A2QY 4A8OA 1FCAA 3QGPA 4MK9A 4DRKA 5HTGA 1RT4A 2HVDA 2ZQVA 4JV0A 3M6UA 4WTOB 1OY8A 2ZJPQ 2BJ8A 2G0IA 3B82A 1LQ9A 1JLCB 4A8WA 1F5BA 1WOOA 1JLBB 2AEMA 3W2WB 3ZTRA 3CCVS 1UPPA 2ZM6J 1SIZA 3AJDA 3FSXA 4U8YA 3PW7A 1E6VB 3OFEA 3BXWA 1LWCB 4F50A 2B9WA 2IJNA 1NDLA 4MFBA 4DR2F 1A0OB 2BANA 1CPZA 3RGCA 1WTFA 3TAMB 2D3UA 4G1PA 2H4WB 1ZOTA 3CDEA 3S6EA 2GX8A 1S0VA 3MEKA 1K0TA 4ECUA 4I64A 4XK8C 3LANA 2ZM6F 3G8SA 4HACB 3T3FA 2M2AA 3D9BA 4I2QA 5FLXU 4UZCA 2C42A 2AGPA 2QLXA 3R2CJ 4DV5J 4AXJA 4DBQA 2XLKA 4QIGA 2GIRA 3CD7A 3M8RA 3D3BJ 3MXHP 1FKHA 4LF6F 3T6BA 2WOMB 4CLUA 3LOUA 2FLNA 1FKLA 2QZ8A 2ZH2A 4KO0A 1Q1KA 5HUAA 2LA4A 4IH6A 1XIQA 1U1KA 3D54A 1HNXF 1D7JA 4MAKA 7FD1A 3KNAA 3GJTB 4LT6A 4PG8A 1R0AB 4O3OA 2PIIA 1BD6A 3AH6A 1GMWA 2JC1A 5KFGA 4CLSA 2R7RA 4U86A 1ZZFA 1W2IA 2W2OP 2YWGA 5CYQA 4KPYA 3KDNA 3QMQA 4KAIA 4L75A 2B0GA 2BOAA 1PCAA 4KKOA 2B31A 2DGSA 4G65A 2MF9A 4Y65A 5LL6d 4YB5A 2V5HG 5IT0A 1TAUA 3B8HA 3MFIA 2KT5A 1HNXJ 4KHPF 2RILA 1O6IA 2FQQB 3FJ2A 2ADCA 4DSIA 2ASDA 3RM4A 4PG4A 1RTDA 4DU8A 4B9SA 1FRLA 3HD2A 4CYUB 1I1GA 1MWYA 4ANEA 1EZZB 1VHIA 4AL5A 1S9GA 1NK4A 4H4OB 2XY7A 2GIQA 1X4CA 5C25A 1MMDA 2FJWA 2B7BB 1UAWA 2EC0A 1C0TB 4HT7A 2LP4A 1HD0A 1RWOB 1N5QA 3HVTB 4KQZA 1Q0NA 4U84A 1VRUB 2IF4A 3M2UB 4DMZA 3T1HJ 2D9OA 2RIJA 1U49A 4URQU 1KDNA 2BR0A 5CXTA 4J5OA 1YJVA 2KTQA 1VRQC 2DHGA 2W2MP 2WAQD 2B4UA 3VAIA 4NXNF 4DI6A 4O3PA 3BN7A 2PPPA 4DIPA 1FKPB 2Z58B 5FD1A 2I9SA 3SCIE 3FMWA 3H59A 4ZPDA 2DHAA 3QJJA 1M5SA 4AUKA 3CHCA 2DNMA 4B3MF 2HVIA 2FHKA 2GV1A 3ARPA 1C1CB 2UUAF 2XPAA 3OHAA 4NXNJ 4KH1B 4X62J 3FZBA 1F40A 4OJ3A 4A8SA 1BY9A 1H72C 3D1HA 4B3RF 1UR9A 2DNNA 1U1RA 1U8SA 5G4DA 2FJXA 2HHHJ 2CXEA 2DGXA 3M32B 5LT5A 3PKYA 3GV5B 1M5OC 1EETA 4Z2IA 4C6AA 2Y1RI 3OVBA 1NUEA 1WELA 3CE8A 2H9ZA 3G82B 3TDBA 4ICLB 4RBVA 4YUDA 2V4RA 3P6YC 1RWNB 1X6NA 3Q8PB 1R8HA 2MZQA 3RUBL 3TEGA 3FEYB 1HQUB 1WDDA 3R7BB 2IYIA 3UR3C 1VQ6S 2YX4A 1GMVA 4WP3A 5D15A 5G0RB 5K14A 2M1IA 1YJTA 4J9VA 4A46A 5AE2A 3ALFA 2B8PA 1ZBKA 2QLBB 4PCQA 2LQ9A 4ZDNA 4V19J 4I67A 4DROA 2LXIA 2LECA 4ZCIA 3N5BA 6FD1A 1HBOB 1W7WA 3VALA 4RPFA 1B0TA 2CVEA 3PW4A 3TQEA 3IM9A 3MPUB 2D74B 4O23A 2UV8A 1NAQA 1B0VA 3KLVA 4F67A 1V3SA 3W66A 4YEAA 1ITPA 2Q79A 3QQCD 3DC2A 1LOUA 4PWWA 3US5A 3MZIA 4F0KA 1SJ1A 3G6XA 4LFBF 4NA3A 2XG8A 1RT5B 3WZ0A 3ARQA 2KH9A 3V4IA 3ONQA 3GMGA 3UI6A 3I0SA 2OUGA 2J7KA 1BQMA 2F1FA 2HRTA 4KYZA 3CWJA 1FXDA 4CO0A 5DG8A 5GAEU 3V6DA 1WSVA 2ILZA 3EVMA 5SUHA 2RE1A 4Y2CA 4Z7YA 1D9DA 2DIUA 4B3MJ 2VG5A 4FXVA 4Q7AA 3U1MA 1PGZA 1RBLA 2HVZA 4WU2A 4P72A 3EJMA 4CZCA 4CCHA 1WC1A 4PTMA 3JSRA 4MNLA 2JDJA 4F0HA 2DG9A 4RNFA 5J1EA 4O3SA 4IH7A 1TL4A 1MNEA 1ZM2A 4ED2A 4YB1P 3EUNA 3EXYA 1FVQA 1DBDA 4JV5F 2Z30B 3EGWB 4H4KA 3BGUA 2CZ9A 1U2RA 5JH8A 5GQBA 2C3UA 1IKYA 3M8QA 3IBFB 4K4SA 1A9NB 1EYMA 3DU6A 1NWRA 1SYTA 2CG4A 4MGVA 5LJ3Y 4QU6A 3NRKA 4O2TA 1KTVA 1K8AT 3M05A 4YR3A 4K4UA 5HW6A 1ZETA 2AOSA 1Q7LB 4LSLA 2YTCA 3MR5A 2DT9A 3WQVA 5F8HA 3LH2S 2LVWA 1VQYA 3T5HA 4HARA 3CD0A 4JFKA 2E1AA 1ULRA 3OSNA 3V81A 2HHSA 2ZBRA 2JZ5A 2AD9A 1W26A 2J8SA 1X9WA 1CJTB 2CJ9A 5K14B 5E41A 3CCQS 3CJ4A 3K5NA 4AQYF 5I42A 1T05A 1Q6UA 2IC3A 2POKA 2YWHA 5HATA 4ODMA 2BDPA 5ETOA 4DV7J 2HZVA 3LP0B 5K9FA 1ZA2B 1LQ0A 2PV1A 1IBKJ 2EEYA 4DPTA 5EDWA 3JTOA 1WTBA 5HWCA 2CA9A 2N4DA 3KXDA 3NGKA 1G3OA 3Q89A 3RRGA 4UF4A 1B4SA 1S57A 3TUIC 4PQUA 4EO8A 1U1OA 5I42B 1T05B 5AXMA 2OSRA 5E3AA 2HGLA 3UDLA 4CO2A 2DEIA 2HHPA 4H4KC 3O5EA 5IWAJ 3RAXA 2G0JA 4MIWA 5DDPC 2JEIA 4HHUA 2RMLA 4DR1J 2J9CA 3HHLD 3CGMA 4DCOB 2HRUA 3PM9A 3NCRA 1VQMS 3PX0A 2HNYB 4DUTA 3OFHA 2VG5B 5DZ7A 2FLLA 5A76A 2HGMA 4DF8A 2VKRA 2XYPB 3QZ7A 3WIUA 1FWLA 1KP6A 2P9CA 4OX6A 1QJHA 2IM3A 2DYAA 1HNWJ 4LJMA 2HHWA 4F7VA 3QFHA 1XHGA 2Q6CA 2RQSA 2GC8A 5J2NA 1OJ4A 2EBEA 2X1FA 1FAPA 1RAAB 1U25A 2YNFA 1TV6B 1RTJA 2HAFA 2O5DA 2GIFA 1HWKA 3ENAA 3KG4A 3THVA 2CZ4A 4P52A 5EN1A 2PPNA 3BF4A 4P2FA 1XQIA 3T41A 3NKYA 3MAAB 1FKGA 2V94A 3BGRA 2ERRA 4EGLA 1N36F 4HACA 4PPZA 3IAM9 4ZOSA 2BJ3A 2Y8YA 1A7XA 1GAOA 1S1VB 1IBMJ 4F02A 4IRCA 5IT9Y 2M5YA 3DDIA 4HHHA 1LW2B 2KJWA 2GHPA 1HQEB 2KI2A 4WKYA 1BKFA 4EZ6A 3QRQA 1VC6A 3B9EA 3FCWA 2HQFA 1OQ3A 5H1SV 3MR3A 3OW2R 2BX6A 2Q3PA 3FRYA 1HWLA 3IMQJ 4U95A 1FNXH 2BXJA 1ICEB 2VFRA 4YN3B 2J7UA 2KG0A 4K50A 2R4FA 1W25A 1QLNA 2HVEA 1ZCNA 2XP4A 1LXNA 4OI0A 4FDFA 3IA0A 1WEZA 1H98A 2AJFE 4DRHA 1D8YA 3QZ8A 1NB2A 3C66A 3ARYA 3G71S 4CM0A 1PIEA 1IKWA 1LK5A 2YKMA 3A3NB 2WOMA 5E3CA 1YDLA 5B0AA 1RTIB 1ZBVA 4BC9A 3D0HE 2WLYA 2DR9A 2DIVA 1LWCA 2VV5A 4DWIA 4FBUA 2ROGA 2W7AA 1U2FA 1ACMB 3R8YA 5C7PA 4S0MA 4WKFA 2HFSA 5B0CA 5CD4H 4WF9Q 3A12A 3EZ5A 2ZR4A 1RACB 3GU0A 4DWSC 2W4DA 1R0AA 3UQSA 3CVKA 1RAOA 3HD1A 4LGXA 2P6TA 4BWMA 5KTQA 1IKWB 2YKMB 2XMAA 1N6QA 1OWQA 1FHTA 2RF2B 1NH7A 1JWWA 1T9YA 3SQOP 5EGYA 4ZP8A 4FN5A 1F6TA 1FRKA 1PBUA 1QY7A 1UJ4A 3ETMA 1QM9A 3LP2A 3MPYA 2OMOA 3TRGA 4F4AA 4DRIA 2VPWB 1QAIA 1E9LA 1RSCA 3CJKA 3QJPA 5F8NA 3MM9B 4C3MA 1XMQJ 2W9CA 5F0UA 5J2QB 1FKAF 4W5UA 1KQKA 4NE9C 4CYUA 1RHKB 4IR1A 3I56S 1F3FA 1S97A 3TUPA 4P2SA 2P4VA 3VQTA 1VK3A 2ZVIA 3TYTA 3TVKA 5A8WA 2KE0A 1E6RA 2DT1A 2XI3A 3FCHA 4RUAA 5HKGA 4ECSA 3OTBA 2IJFA 3G6MA 4IKAA 3TOQA 3J81j 3HVAA 2RDDA 3DGPA 3ZZTA 3M9NB 2WB1D 5DGBA 2VHGA 1VOMA 1FFSB 2D3O1 1L3UA 5HP1A 3FUYA 2YWKA 4JV2A 2OTLS 3DGVA 4M63A 3TQ1A 2ZNZA 3MHYA 4KY3A 2FZCB 1AXQA 1LL7A 4M5IA 2W2NP 2ROEA 5MLCV 2HHTA 3ZZOA 4UT4A 4PYAA 5HMWA 3V6DB 2ASJA 1R3NA 2W24A 1UZDA 2XSJA 4NCGA 2F23A 1B64A 3I82A 5M2UA 2BE7D 5KT7A 4XPEA 2IIHA 3SXLA 4LF8J 1FE4A 1HQUA 2V9KA 2IM1A 5C42A 1JLQA 4DR5F 1JX4A 4ILMA 4R25A 1TKDA 2FHJA 1VRTA 2FHJD 2RUQA 2IRUA 3OD2A 2O92A 1FD2A 1MWQA 3M6VA 4OYPA 4LR7A 1EETB 1P6TA 5D4LA 5D3GA 2OPPB 1XEZA 1ROUA 2AYGA 1D9FA 2RKIA 1ZBTA 1X4EA 2IVYA 3JXOA 4ZLPA 5A0YB 4ZLJA 4QWCA 4QJVA 1MU2A 2VU5A 3MM8B 4OZ2A 4MIBA 1LW0B 3GFHA 4Z2JA 2OEJA 3KWMA 2DRAA 2J6SA 2U1AA 2CJBA 1S12A 5LJ5Y 3H0PA 3C16B 1WACA 1GX6A 4QR1A 2AGOA 3MM5B 2KFNA 4BC7A 3JXVA 5HL7Q 3CJKB 3L7OA 1YHQS 4K0KF 1FNOA 1ZL1A 1N34F 1NWSA 1SUQB 4O44B 3W61A 3N9UC 1F8AB 5K20B 2KHCA 4LRCA 1MU2B 2E7XA 2QYCA 2V8DA 3EXCX 3MM8A 4LF4J 4DRJA 3GSDA 2OFNA 1JK9B 1JLFB 3BDEA 3D3CJ 3GWCA 3TA2A 2ZQSA 3WH0A 1AZSA 1EP4A 3DNCA 3DOKB 3MUVP 2W8KA 1RYSA 3Q2TC 1HBNB 1ITXA 3CC2S 1VQNS 1KN6A 3M30A 1S6QA 3GYNA 1WORA 2JZVA 1L3KA 3GG1A 1QVGR 4USWA 3FBFA 5KAKA 3K0JA 2B4VA 3LTOA 2WSFC 4DG1B 1BHNA 5GADU 3OL6A 1YZ6A 2FGCA 4MTVA 1FKFA 2QRRA 5THWA 1LWEA 4C97A 2F8MA 2KT3A 3A8JA 3G86A 3AQOA 4KGVB 3OFFA 4P8XA 1JKHB 4DUYF 1Q4RA 2UXBJ 1RA6A 2GHWA 1U6ZA 4OJGA 2JWNA 3HHLB 4GMKA 5IT4A 2EFOA 4OZ5A 1I5OB 4WFNQ 1D3WA 1Y10A 1FTRA 2GCFA 4IDKB 4IRDA 5KFVA 3LUOA 4QOTA 1RUSA 2XMTA 2FZKB 1YQHA 2ZBPA 1NPKA 4I4BA 4U8VA 2G41A 2LQJA 2PO4A 4ZPBA 1KONA 2XMJA 2OMLA 1KT0A 1D8ZA 2BACA 2OPSA 2PT0A 4DV5F 5CHCB 4ZCLA 2I0XA 4GC7A 1WNOA 1H2VZ 4NLVA 1X4GA 2NR0A 1SI9A 3JS9A 2UUTA 4CT9A 2B4OA 3MI7X 3O5DA 3HKZD 5M2PA 2DT0A 2XP9A 5HAOA 2ASLA 2OO4A 5DDQC 3UQBA 2WBRA 4KV8B 1R8CA 4N8OA 5K8PA 5LSRA 1OY6A 3PEJA 3F73A 2LYVA 3OL7A 2MQOA 1U2CA 1X6LA 4LBPA 2R7QA 5KFFA 2V2ZA 1SJQA 2A2DA 2MKIA 3WX4A 3BQ2A 2GVDA 3D1OA 1C1BA 2M8HA 1S7HA 3CJ2A 2W4CA 2LXUA 4ECRA 4WK9A 3H25A 1E6PA 2DHSA 3NOGA 3J7A1 1H6KX 1RWPB 1SC4B 2YWFA 4DPWA 1MG7A 3ARXA 5GMKa 3M2VB 3EZOA 3KYLA 3IWNC 2EBGA 2AMCB 5HWBA 4UUWA 4NNRA 4URGA 5F8MA 5BR8F 1FK9B 2BBEA 4WFXA 3PX4A 5KFUA 4JFLA 2ZJQQ 4DSKA 2AYMA 1JIHA 3NGSA 2DO4A 4O3RA 1RXOB 3OFGA 2Q66A 3T5JA 2COLA 3P49B 4M95A 1NHVA 4KIAA 3MR2A 4C98A 3U1NA 4KGXB 3GJSB 5AT1B 1TR0A 1KNZA 4FN2A 5EUHA 2OLWA 3L95X 5KFZA 3MCSA 5A2QU 4PYDA 4BCAA 2MY7A 3CSKA 5BR8J 3AB4B 1OWXA 2HQIA 1FWPA 1JMTA 3Q83A 5LMUF 3MR7A 2XZTB 3QGHA 2KM8C 1GK8A 2IFXA 1LWXA 3KLEA 2NLWA 4IOCQ 1PYSB 1X31C 1JLBA 3W2WA 4F25A 3ALGA 3TJ8A 4DL4A 3WKZA 1NKEA 3GE9A 1NHKL 3PACA 3H2LA 4A8FA 2N7YA 1RA7A 1TL1B 3MPWA 4GRSA 4UOGA 4ZKAA 2RQMA 3EGZA 3J7AN 1Q78A 1CS4A 3UF8A 3WIJA 5DEZA 1IJFB 1PYTA 4TW7A 2PDAA 1JXVA 3UI4A 3FK4A 4QBUA 2N3OA 1D6OA 3G6VA 5J2QA 3PZPA 4W92B 1S9GB 4JV5J 3QSIA 2CQHA 1RWWB 2LEPA 3I6PA 1B99A 2I1RA 4FPRA 4ID5B 4TYOA 3I31A 2JL9A 2DPEA 3BKFA 4EI2A 2XMUA 3UR0A 2YPYA 4ED8A 1K44A 1X4BA 1FRMA 1RBAA 2IDEA 3D7SB 3K5PA 1HQ2A 2VQFJ 5KFWA 4Q44A 2B9XA 5JVGQ 1EQ0A 5KFOA 3CDBA 1JNZB 3C6UB 1AFJA 1UTAA 2QMUB 2WB4A 4OYBA 4WJBA 2DNKA 4MKBA 1XC9A 2R7XA 3CCUS 1M5PC 2W2QP 3M1VB 4F8RA 3QFWA 4PQAA 4LF7J 1DQAA 1IBLF 5C25B 3PO4A 1AROP 1N54B 3UD5A 5D4NA 1HI1A 1IQZA 2YQ0A 3FBEA 2K3KA 5E5NA 1KFWA 3MPVA 1S4EA 1HQEA 2JRSA 1QZ2A 2ZUAA 3SQGB 4IQXA 4ZPTR 1V5VA 2CADA 5BXIA 3KAGA 3IR6B 2VDHA 3DU5A 4RX6A 4U6PA 3HFVA 4QW8A 1FKOA 2ZDOA 2ZKUA 3CJQA 4PG5A 1JJ4A 1HPZB 5KFXA 1N56A 1BL4A 2VONA 5HVGA 3W5XA 2F9DA 1C9HA 3MECA 4LF2A 2PC6A 3DMJB 3L4BC 2H5JB 2FD2A 4I1TA 4ZVQB 4OI3A 1ZS6A 1UWBB 3J81Y 4WWSA 4F26A 4ECWA 3P5BP 1U79A 2CQ3A 3I0RB 4X84A 3CHEA 4ODPA 3PYGA 4YFUA 2B9EA 3AXMA 1WUUA 1RGVA 3C16A 1HPZA 5L46A 1RT3A 1WF1A 1RCOB 3FFIA 1KFDA 1SKWA 3Q8RB 1UVLA 2UP1A 2DGVA 3AQUA 4JI8J 4FNHA 1RDRA 4B08A 4DHVA 4PABA 2ZH1A 2VQFF 4DQRA 2UUBJ 1SCJB 3SSQA 2DY1A 2NXCA 1YBTA 4NWBA 3C15A 1JLFA 2CQ4A 2VA2A 4C8NA 1C4CA 1X4FA 2MZJA 2AF6A 3RMEA 3SDEB 1VGYA 5J2PA 3KK2A 2BKNA 2O67A 3TNVA 3GR0A 3NCPA 2JVRA 1WKLA 4DL3A 1S76D 5F3TA 4X4QA 1IBLJ 3LWLA 4FS2A 4IG3A 2G2ZA 4ZVOB 4QIFA 3NS5A 4DZ6A 5IV4A 2HWTA 2Y78A 1QVFR 2I8EA 1HWIA 2AWZA 4J9SA 1KBRA 2I5JA 3W9IA 1HMVB 3GLJA 2KKHA 4I6YA 4P73A 4N47A 2YNIA 3D66A 4ZN1A 1NK7A 1NWUA 1UETA 1ZPVA 3KK3A 3H5XA 2KM8B 2HNDA 3MUMP 2DH8A 2K7KA 4F4YA 3DLJA 1Y5IB 1JNSA 4W9OA 1R89A 2YX1A 2Y1LB 3OL8A 5D3GB 5DDOC 3O5QA 4HL9A 4IDKA 4V1Ak 1OGBA 2BYCA 2KVQE 5GPRA 1OPIA 2MNTA 2BRKA 2MQLA 2MZSA 2OD6A 2PD1A 2Q6BA 2YKNA 2YKPA 4FPIA 1QSYA 4WJXA 3VCDA 1J5OB 3BPSP 1TCOC 2AW0A 4ANCA 4DZDA 4BS2A 2HNDB 3OVAA 4J9RA 3DLKB 2FHMA 1M90T 1FEHA 2XSJB 1LL6A 4NCGB 1SQEA 3UQAA 2HAIA 4XAKA 3JSYA 3MMAB 3CC4S 2QF8A 1ROFA 2J0WA 3V6JA 3G6LA 1J27A 2M9KA 2VBXA 2CWKA 5CCLA 1IR2A 1URNA 4YDXA 4ZP6A 2KGJA 3UDVA 1G6BA 3HVWA 2L41A 3W64A 2OPRA 4DL5A 2DGWA 3O1LA 1NWTA 2NXNA 4RUBA 4Y3CA 1F3VA 2GFFA 3H40A 4DR5J 1U0SA 5D75A 3WD1A 3IR7B 4JI5F 1FKKA 1U26A 1YK9A 3PR5B 1X0FA 2CPDA 1J4RA 2W1BA 3AD7C 3H5SA 2H65B 1K9MT 2ALZA 3N79A 2FJBB 5CZXA 4AXIA 4RL1A 3ARSA 1KT1A 1T11A 2DBBA 3J7YI 3UCZP 3GP9A 1HIYA 1KS2A 2CQBA 3BEGB 4DG1A 3WQWA 5KFPA 3IKDA 2UXDJ 3CULA 3LP1B 4ED0A 3MCOA 1YJ9S 3GIRA 3UO0A 3SMZA 2XY5A 4RW4A 1N88A 1VBYA 2AJQA 1RP5A 3HK2A 4NLWA 2X1BA 4Y6IA 3E8OA 4QYZK 2JLFA 4LF6J 4GGQA 1RTZA 3TWZA 3M9OB 5KFJA 4LRFA 4NZ0A 4ED7A 2QC3A 1XMBA 4DDFA 1RHJB 3ETOA 1YVFA 2DPJA 4LF4F 2R42A 3UFCX 1FERA 1VQPS 4ITZA 1KWMA 2VPXB 3B4DA 2CIMA 3P5TL 2YBUA 3UVJA 3V6KA 2Y9HA 3NI6A 3EGVA 2H3EB 3OA5A 1S6QB 2QGFB 4DFKA 1LWFB 1UVMA 3KTQA 2V69A 4MFBB 2YBVA 4KRWA 1N33J 2FLOA 2OD4A 2KO7A 4ODQA 4EBCA 1JNEA 2QL7B 1AUDA 1HYSA 5GMDA 1F9FA 3IHZA 3QT6A 1GX5A 4LREA 1FA0A 3OTEA 1R0CB 2IC3B 1SQFA 3CJ8A 3VTIA 5H9FJ 4DS5A 2IY5B 4Y00A 4NLQA 4LAWA 1JKHA 5C5JA 1YJRA 5ITHA 3DRRB 1GXUA 2A3EA 1DURA 1NZ8A 4RW9A 4CH7A 3BPDA 4X4PA 2PV2A 1FK9A 2R9LA 3ARVA 2G1DA 3H4DA 3ZZUA 1O8BA 4ZITA 4YHHJ 3OHBA 1NH8A 1FDBA 4O4GB 4TX0A 3IC1A 4IOBA 1RTJB 1GNKA 3ZO7A 4DLEA 1T03B 4DL6A 3ET6B 2KYXA 2JVOA 4PZVA 2RQKA 3R1HA 3MD1A 5E3QA 1KLMA 3CH9A 2WK4A 3C19A 2ACMA 4RJVA 1LKZA 4PKDB 5DDRC 5L9NA 2DR8A 4PUOA 3PR4A 2GVZA 3ARZA 3C8YA 1KQFB 3HJFA 4B3RJ 2CPIA 2KDOA 4M5DA 4OZJA 3ET6A 4P8UA 3D6FB 5CYQB 2MQMA 1S0NA 2E5LJ 1TL3B 1YRXA 1WEYA 3MPDA 4H4MB 3B54A 4ES2A 1RD6A 4I2QB 2IMWP 4NXMJ 3ZC4A 2E1MC 5F8GA 2BKOA 2VUGA 2ZHBA 1Y0HA 4ETZA 4A8MP 2DGTA 1SKRA 1FKDA 2CPZA 2CNKB 2CUYA 4DUZF 1RTDB 3NMRA 3B9AA 2VG7A 4P75A 1MSWD 2MLXA 3B8SA 2I2YA 5I98A 4DEZA 4ZVFA 4PG7A 1E6ZA 1TL3A 3EICA 1WC4A 1FVSA 4NZ6A 2BZ2A 5HLFB 5HO4A 3GONA 1N48A 1TMJA 2YKOA 3VAKA 1LWFA 4M5JA 2K1RB 3UCUP 2EFPA 4U85A 2JFDA 2KO1A 3MM7A 5HVFA 3E01B 3SCJE 4YB7A 4ZVGA 1GMUA 4DOZA 3M8PB 3BH7B 2Z2YB 3GFZA 3RBXA 2OIHA 4JYAJ 3QIPB 2KG1A 4P71A 2HQ3A 2L9WA 3R6GB 1Q1CA 3OJUA 4EEYA 4IRKA 3LPEA 4NYZA 5KFMA 1UWAA 1XBWA 4IYQA 2N87A 4CM2A 4S3KA 5F9LA 1GTEA 1KC8T 2DNQA 1WOPA 4B9VA 1FKSA 2BQUA 1KRPA 2BANB 3SEOA 5DQHA 1W2BR 4B3SF 3C2PA 8AT1B 1HNWF 3CMES 1VR6A 2FDMA 1BGXT 1EB0A 1CSJA 1NMVA 4FYWB 4J91A 4KBIA 3BN4A 3QIPA 3QBCA 1F5CA 3Q0AA 3LO3A 3K7RA 1Q8BA 4G6VB 3MM6A 2HLTA 3F44A 5I3PA 2E5LF 1H3DA 1SPBP 2J5AA 3TANA 4NXMF 2ZITA 4B3SJ 3AOBA 1SH2A 2UVUA 4DN0A 3M8YA 1NRKA 3UDCA 1NLKL 1UR8A 1PJ7A 1TVRB 3LW5C 3UW1A 3SYZA 2UU9J 4N77A 3JQJA 4P7TA 3W9HA 1UJ6A 2PA8D 4FXWA 1F2HA 1N1AA 3MEEB 3D0IE 4N8NA 2IBKA 4ZK7M 5HJYA 1DHMA 1FJ7A 3DI6B 2AYBA 4O3QA 1SB6A 2XYHB 3MCMA 1R0BG 2YPZA 4X64J 1D7IA 4U7UK 3GV7B 2LDIA 4GO7X 4CNYA 3X1LB 2X51A 3QOKA 3KK1B 2PEHA 2YKNB 5DG7A 4KR0B 3BH6B 4OYOA 1H7WA 3ZZPA 4R0XA 3G96A 4P8VA 3KK2B 4A8QA 3O5LA 4ILRA 3DI6A 4NEYA 2OGUA 1XERA 3SSRA 1V3ZA 3WQPA 4ID8A 2A1BA 5L38A 3WL0A 4LBHA 3OXLA 4MMOA 2DCUB 3BJYA 2ZWOA 3NGUA 1QAYA 4I68A 3QNWB 2F4EA 1WC5A 2CNNB 1YJ7A 3K89A 2QLFB 4PQUB 1M1GA 3KK1A 1NJIT 3MAHA 2RU9A 2HQCA 4OYIA 1HBNA 2N4CA 1C0TA 2QL5B 4NI2A 4F4WA 1UA1A 1WI6A 2HG4A 3CDWA 4PAAA 1HHQA 3RRKA 4DX5A 1Q8IA 3WC2A 4MSPA 1F5AA 2RH3A 4TXSA 2MMYA 1S59A 4WBFA 2AWGA 1IWAA 2QE5A 3R6LB 2LXFA 3IG1B 3ILOA 5EHHA 2WONB 3C6TB 4J9KA 1SJ4P 1E6YB 1P9QC 2LGOA 1RTHB 2PPOA 1TTHB 3CZ8A 2WVDA 1NHUA 1J2VA 1Q95G 1HMVA 1XTZA 1IX5A 2LQBA 4IO1A 3AXKA 4RW4B 1HJWA 1MN9A 4CLTA 3IRXA 2CQ0A 2UU9F 1M5KC 3TA1A 1F1BB 3BBCA 4DX7A 2DEJA 5L1LA 3PR9A 2CJAA 2O3DA 1TZ0A 1LXJA 2EVZA 4UZBA 4WKHA 1YX2A 3X3UA 4F4ZA 3C15B 3MOJB 4K59A 4ZLNA 1W9UA 4DRMA 1UKUA 4MH8A 3ENVA 4BLGA 4JI3F 3AODA 3ZZYA 3MEEA 2UZAA 5AE1A 3GB0A 1X5OA 4LR9A 1Y11A 2H5EA 3OTOJ 2EW9A 3SV3A 1IKVA 5F9NA 2LA6A 1HBUB 1FX2A 2IAJA 2OFGX 3OJSA 1HYSB 5A8RA 1TL7A 2MZ1A 2R7OA 1NKBA 1REVA 4JFIA 1MLAA 1N0VC 2GS8A 3JTPA 4IG0B 5KFHA 4J9OA 1WDTA 3EM1A 1RE1B 4J9PA 2HFNA 4NLUA 3QYYA 2DSWA 2BJ9A 3LWMA 3TP2A 1JCHB 3GYXB 4Y2IA 3ENWA 3KLFA 3QWUA 1DTQB 1TQLA 3CB4A 4MK7A 1NSQA 1NDCA 5LMUJ 4IFVA 2XS5A 2V68A 1TP7A 2ZWPA 3OQ2A 3QIDA 1M0SA 2N3LA 4YDDB 3OVSA 4PXBA 3IRWP 1UFKA 5H9EJ 1S72S 1SJFA 2E9RX 1VMBA 1WHVA 3O5MA 3KKFA 1HNVA 2J9DA 4WK3A 3O5RA 5AJ3J 1N8RT 3LF0A 1CJVA 2V0NA 3BGLA 4ECQA 3MFHA 1DQ9A 4ECZA 4ED1A 2B56A 2XMVA 4Q0BB 5ETVA 2MKYA 2EI5A 1S1WA 1H0IA 4QYZJ 2XYGB 3D6MB 5KFLA 1H38A 1O51A 3WHIA 3FY1A 1YJWS 2CPYA 2FZGB 2G0CA 3PW0A 5H9EK 2GNKA 2GVDB 2KRBA 2V2KA 4RBTA 2WSEC 1KR4A 4TY9A 1HNVB 2QA1A 4OI6A 3UI3A 2CPHA 1RT2A 2ZE2B 1YTYA 2LU1A 4H4MA 5A6PA 1SBRA 2YBTA 1U09A 2CNOB 2EK1A 4C0HA 4RU2A 4U96A 2MSSA 1RHRB 1Z1ZA 4JI3J 5C24B 2E7WA 3AD9C 5DJBA 4B3OB 2UXCF 4ES3A 1B3TA 4DR3F 2NSBA 4CLWA 2OEMA 2IBOA 1S49A 2H54B 2DSVA 2DG3A 3TZYA 1NJYA 2L2SA 2BMBA 4ZJQA 4NASA 1EQMA 1TMMA 4PR6A 2UXDF 1FWKA 3O5KA 1BE4A 4LF1A 4Q43A 2X1AA 4U7UD 1M5YA 1CS4B 3DCAA 2FJVA 2MGZA 2HNZA 2Y1JA 2WVBA 1GQEA 1N0UA 1AT1B 2GAGC 3PIOQ 1FKRA 4IQ2A 1K47A 2KFZA 1GRJA 3V81B 4Q8FA 4LSZB 4HI1A 4Z37A 1YKWA 3W4RA 4NEZA 3D68A 4I56A 4DCJB 3QGGA 1X60A 2HS3A 4JP8A 4ZPWR 1UFLA 5GAHI 2YX7A 2ZHAA 2XWYA 2KZZA 3HULA 1M5VC 2ZZTA 3RGIA 2XPBA 1VRUA 5K5MA 4FKXA 3JSMB 4K4XA 1S0OA 3QO9A 2RQ4A 3OTDA 1FJCA 3T5LA 1NEEA 2F4VJ 4OX9F 4MIAA 2DRBA 2F21A 2ATCB 4USJC 5B09A 3O8WA 4JI4J 3PYFA 1HJVA 1FJDA 3C3LA 3KAIA 1RAJA 1TKZA 3HT3A 3KDOA 4K4VA 3NAHA 2F3JA 4HEA9 5LXYA 4B9MA 2VFTA 1YZ7A 2HKEA 2BQRA 2K1RA 2MJUA 3H5UA 1XJWB 1NK5A 3PJ9A 4O4GA 1WHXA 2OPQA 2MLYA 1OMSA 3CNQP 3PNIA 3MTJA 3QT5A 4ZCKA 4DR7J 1WD6A 2A6MA 4NLDA 2VG7B 2F65A 1BC6A 2V4JA 2Y0BB 2ZOGA 1RCXB 1J5EJ 4QR0A 4DWSB 2ATLA 4Z2KA 2VBYA 4YB6A 3THTA 1CJKB 1T7PA 3ICLA 3IBCB 1IWGA 4CO4A 4ZPCA 5D78A 5T41A 4C48A 5F3ZA 2IHR1 4EFAC 1EIYB 4IUFA 4OI4A 4QW9A 3K5LA 2DHHA 2HW3A 2RB7A 3H2VE 1TKXA 4NRUA 1S10A 2DT2A 2I6WA 1FKBA 5IQQA 1WI8A 4X66J 3J80Y 3LP2B 3M6WA 1PSDA 3MTKA 3NAIA 5KFBA 2Y1IA 1DRZA 3TJ9A 2YQ1A 4P2MA 2FYXA 2E1RA 3NXZA 2KFWA 2V8HA 1GH8A 4DH0A 1VQ7S 4Q8EA 4FBTA 2M4MA 4C9DA 1FKIA 4Q5VA 3BR9A 3BO3A 5E7OB 1KFSA 3KJVA 3M7VA 1NDKA 2WVFA 3GPKA 3UNYA 2F4VF 1AFIA 5J1NA 2EK6A 1HR0J 2M70A 2NQPA 4ANDA 3ELHA 4N5SA 2AQ4A 2BM1A 2CVIA 1WF2A 2J9DE 3I4PA 3SZ2A 3MMBB 1HFEL 4DV4J 3QO9B 3R5AA 2JEGA 3GJRB 4A4JA 3PXGa 5J6EA 1HL6A 1CJUA 3BBBA 2KL8A 2QO3A 2ITKA 1NK6A 4GVBA 1JJ2R 3N6MA 3CUNA 2WRMA 1R43A 2RQCA 2ZR5A 2B43A 2GJ2A 1QE1A 2F8EX 1ZA1B 4LSLB 4NA2A 3TJAA 4RNMA 2VQEJ 3BO2A 1T3NA 2MPHA 4JI5J 4IFYA 4G1QA 4CP5A 2IRYA 3A8KA 2HQDA 2DGOA 2LMIA 2CQGA 2DNOA 2IM0A 3FKBA 4JI0F 3VF0B 2ASYA 2OAUA 2ZBQA 3MM5A 2LKNA 4QZVB 5IM0B 1JLGB 3UD4P 3NL0A 1HKMA 2EKNA 3UNGC 2DISA 1LFPA 3FNNA 4M5LA 4WKRA 1TUWA 3O44A 4DRNA 1HW9A 4HLBA 1Q53A 4I0WA 4URSA 3HI9A 5HROA 2B51A 1W9PA 1VHFA 2QLJB 4C8MA 3O3LA 3PV8A 4KH0B 5J1PA 4OYMA 3KK3B 2HQGA 3D1QA 3OV7A 1RT4B 3KABA 2W9AA 2R2UA 3GG0A 1XMOF 2V34A 4LAVA 1QTMA 4JI0J 2FAPA 1NZAA 1X5PA 2BE9B 2PA3A 2W25A 3HLUA 4USMA 1RABB 1JLGA 1EDQA 3DN9A 3HX9A 4C3KA 2M88A 3M9MB 4X4UA 4B3TJ 3DDNA 4EZ9A 2AX1A 4RNNA 3QLHA 3Q22A 5HBFA 5ETSA 4PXCA 3HJVA 2U2FA 5GAHU 4DR6F 2XHWA 5GPGA 1FTCA 4OMFG 2LEBA 3DM2A 4A47A 4LUBA 1QDUB 1FKTA 2Y0SD 3WX8A 3MR6A 3GCWP 3TZZA 4UQGA 1XMOJ 5HW8A 4LRDA 2MKJA 3L7UA 2NXEA 1U1PA 3POTB 2DG4A 3UI5A 2DNGA 3BKTA 4CNZA 1FRHA 1N33F 3A13A 5HSPA 1FX4A 3DGPB 2V8VA 2QG9B 1SH3A 2CPJA 3HFZB 1IJEB 3I55S 4DS4A 1K1QA 3Q86A 3GQCA 5HP1B 2NREA 4R5EA 1HLWA 1T9TA 1K0VA 1RQ0A 5DRKA 4HYKA 3ILLA 3NWRA 2UV8G 1GTHA 5L1JA 4DUZJ 2CJXB 5M2RA 1M1HA 3GIMA 3ARTA 2XBPA 1YI2S 2VQEF 2OPSB 3M2RB 2HWHA 4WYWA 3PRBA 3THPA 4DJBA 4X4NA 1TL7B 1JLEB 2FVCA 2QN6B 2YVSA 3CEDA 5JUMA 1WSRA 5IZHA 2B5UB 4U7CA 3HHLC 1S99A 3VAFA 4WIIA 4C7QA 4EYIB 4UOHA 2R8KA 4DQIA 3PA7A 1O0PA 1SJRA 2CKWA 4MPKA 1HWJA 3DLGA 3HCXA 2P2CB 4HT5A 4ZVUB 2DY9A 3G8TA 5LMNJ 3PEHA 2B6AA 2WK2A 1U6BA 4LFAF 2HWIA 4DUYJ 2UXBF 1KSPA 2ZEJA 4UY85 3RB3A 3UN5A 2AHOB 3O5IA 4QPTA 4NMLA 1IBCB 4U9RA 5I3QA 2VFUA 5IS2A 5CD4A 4J4NA 2NXUA 2MB0B 4C8KA 2XGQA 4W9PA 4IG0A 4OYAA 4LF9J 4WFYA 4J37A 3PY8A 3IRXB 5IT9U 1Y5LB 1VBZA 1RWVB 4RW6B 4AT1B 3I5CA 1DFDA 2ZUGA 1X4HA 4PWUA 3LAMA 5KG0A 1FRJA 2RUGA 5I3UB 2DHXA 1FFGB 1F60B 2Z2LA 4FYVB 1RT1B 3KLIA 1RBOB 4IFVB 2A2CA 2ETNA 4J9NA 2UVVA 1RTIA 1X8DA 3KZ7A 3HDSA 2OELA 3QT8A 4DFJA 4HKQA 2DNLA 2PGCA 5KOXA 1QPFA 1YJUA 3QATA 2G8ZA 1IXKA 4J9UE 3W5ZA 4ES1A 3H4BA 2DNPA 3I6CA 2HZCA 2VKZG 1IM6A 2IUZA 4K5SA 3TZWA 4RW6A 3J80U 1GEHA 4CH1A 1SKSA 1VQKS 4I6WA 4X62F 4G3IA 3JYJA 4DZ3A 2K8IA 4OLPA 1PKUA 2FY8A 1WC0A 2WVEA 1Y9OA 4M5DB 1CLFA 4LF7F 2FHOB 3CIMA 5D4OA 4ZIWA 2LKZA 1CJTA 4QWBA 4LQ3A 4OV6A 4ZVHA 1J4IA 3BB5A 2PMWA 1BWVA 3PW5A 3CO0P 3W8GA 1KKHA 5HK4A 1L3SA 4LMZA 4FF4A 2VODA 2BVZA 2M0GB 4MNKA 2RVJA 3C14B 3ILIA 1TELA 3IS9B 3FC9A 3B7XA 4I2PB 1ZPWX 1NNDA 2GMJA 3EZUA 2IDLA 2A3BA 5BYRA 1UZHA 3CCES 2JLGA 2K7JA 3DRPB 2DSUA 1RWKB 1J6YA 3TX8A 1RAGB 2MTLA 4DWSD 3SI8A 4URIA 1B7YB 1UW4A 1RHMB 2GO9A 2V67A 4ZJOA 3HMJG 1S1TB 5C2GA 4DR4F 1H7XA 2GAHC 4CH0S 3RBEA 2XP6A 2J0XA 2A0FB 2UUWA 2VASA 3KLEB 2V2VA 2VJVA 2M08A 2VZ9A 2LFVA 3HHEA 3WBZA 2IA6A 1TKXB 1MROB 4M94A 2RDJA 1N5VA 1RAHB 1UCNA 3OTCA 1OGGA 6AT1B 3D67A 2RNEA 1U4BA 3G8QA 1SJ3P 2YXLA 1S79A 1VYAA 1WC6A 2O9OA 2B9YA 4P10A 3R7NB 5FLXY 2ZH7A 4JI8F 3T1YF 1KD1T 4X64F 4LVOP 5IXUA 4DV1J 5KFRA 1RT1A 1QD1A 1I51B 3NEKA 4RLEA 4ID5A 4DR3J 3RRHA 4E0DA 3PVXA 2HHXA 2AYEA 1PINA 2PBCA 2IMOA 2KU7A 3FXYA 2OSQA 3CJSA 4YR0A 4A8YA 3CIZA 2XWXA 1EQ3A 3M2VA 4FP9A 2DR7A 1PJ5A 1P9YA 1YATA 1UFWA 2Z0GA 4OYZA 5DS7A 2YH1A 4NCBA 2A3JA 1Q5VA 3EY6A 4ZCMA 1Q7YT 1RB0A 4DV1F 3W2VA 5F8LA 1CBKA 4RBUA 1QAJA 1DLOB 1S9EB 2HFVA 1R31A 4C8LA 1QTNB 2IM2A 2NCKL 5CQGA 4ODOA 4NPOA 2BEFA 4BDPA 4FF2A 1U8WA 2VC1A 4HBOA 1Q79A 4PG6A 5HMXA 1GFWB 2W7OA 4ER8A 2RS8A 4X2BA 1VRTB 1EHWA 2GMLA 1S6OA 1H73A 1ELOA 1GPFA 2CQIA 3W8PA 1S6UA 2L9NA 2MQQA 2XO6A 1KEKA 3Q24A 1HKJA 1W1VA 2QFJA 1UPMB 4Y2KA 4P2XA 5J2MB 1FEEA 2XQCA 5KT6A 3JSBA 1L3VA 1AZSB 2RURA 3QSYB 4WCEQ 3I32A 1C0UB 3M4XA 4EWTA 5GAGI 2V4QA 1NH6A 1PC5A 1X0PA 1X4AA 1I94F 3CHFA 3SDEA 2BE2B 3B4MA 4O0NA 1FDNA 3MEGB 4RKUC 2DCLA 3UDEA 2J0QD 3SCKE 1SC1B 1GXTA 1LJYA 2AEJA 2J6TA 3GJQB 1XR5A 1R8AA 2LQ5A 2LQ8A 2OPQB 2QSWA 4L3KA 4DL0C 1VBXA 3IM8A 2YKAA 3CCLS 3EX7B 4PWDA 2EXUA 3IBWA 2WLZA 2OI2A 3GFYA 1UEUA 2BJ1A 1K9TA 3HHDA 3IO1A 4XTTA 3ULHA 1D9AA 1O6XA 3DRXA 2DGQA 3F56A 1I94J 3CXCR 4ODLA 3KNGA 2HFOA 1FRIA 1AB8A 4WPAA 4ZVRB 3HZGA 3GSIA 1R6VA 4W4MA 1RISA 3DKDA 5CCMA 3D28A 1CTNA 1F2GA 3NLCA 2UUBF 2C28A 2IPOB 2J7WA 3M1VA 1Y0OA 1DJ0A 5IC6B 4ZMMA 4M5GA 2VIHA 1VQ9S 1A6LA 4BBYA 5B7WA 2QA4G 2RHQB 5ETRA 3KJFB 2MQ8A 4KJIA 3NBPB 2IYGA 3I9ZA 2HGNA 1OQ6A 4B9UA 1EARA 3BREA 1ZZNA 3GIJA 2ZH8A 3CCJS 3JAMU 3ISNC 1OSCA 4ECVA 3JQKA 3EIPA 2FIUA 2DGUA 3QLHB 5FJ4A 3V4MA 4JI2F 1NJZA 1N36J 2HHQA 1E44A 3CGIA 1VQOS 3A4TA 1MW7A 2LLZA 2QSFA 4QWEA 1K1SA 3TUJC 3ZZZA 4QCLA 2MSTA 3T1AA 4DV0J 4D3GA 1YIJS 1HBOA 1OO0B 3W62A 5K8MA 3Q8VA 2D3ZA 4LSNA 4ENOA 4C02B 4NLOA 4O4RA 4BWJA 3ZZ0A 4JBCA 4HI2A 2GA7A 3FSYA 1X7VA 3W9JA 1U1MA 3J81U 1TFYA 1G2EA 1W1TA 1VFJA 1Q5YA 3CD5A 3K8VA 4CI0B 5KT5A 4AFFA 1GOIA 1KTQA 1TUVA 2GJIA 1UEKA 2ZOFA 2CWXA 3EWGA 3O5JA 3H8YA 4RWXA 2P9GA 4M5KA 4DZ2A 1ZM3A 2HBQB 2L9DA 3BS9A 3QAEA 2H4YB 1IKVB 2L48A 4G2PA 2QIFA 1C1BB 2YQ3A 3KUEA 3O2IA 1E6YA 1RTHA 1HI8A 1PJ6A 4KGKA 1NCLA 2H5IB 1MN7A 5GMEA 4AYBD 2FY1A 1LW0A 1X5TA 5U47A 1OYEA 4Y34A 4YQWA 2XM3A 1N5YA 1I6JA 2NZ4A 2FTRA 1RK8A 1SC6A 3ENQA 3S01A 4AY1A 2Z57B 3NTPA 2B6AB 1VLYA 1Q8LA 2ZVSA 3P96A 1V6HA 5FDLA 2CYYA 4O0IA 2HZAA 3QAUA 2W9BA 2AJ1A 1ZB5A 2GGPB 1FXLA 3EYZA 2Z56B 4R8UA 2VH7A 5DETA 4J9MA 1JLEA 3CHDA 2KB2A 3M8QB 2W8LA 3ITHA 3BYRA 5D0EA 3RU0A 3DM2B 1EP4B 3DOKA 4Q22A 1VK8A 3O6QA 2R7UA 3NBPA 2KZMA 3ZTOA 2B7CB 4EO6A 3PHEA 2CZVC 2DNZA 1FESA 3FGVA 3HKWA 1SIWB 2FGOA 3LGHA 5C24A 2C3YA 4DPUA 3AHPA 4E8UA 4F3QA 2MJNA 3I5BA 4F36A 3RBZA 1U7LA 5A8RB 4X66F 1SKUB 1YLXA 1S1UB 2W9BB 1UVKA 2E5JA 3LQVA 3S7RA 3TW0A 3EDRB 4X65J 8ATCB 1U1NA 3AA8A 1ZAXA 3C6UA 2UVRA 2HYIB 4YY3J 4OZNA 2XB2D 3TC5A 4R0EA 2VBZA 3KACA 3DLKA 3Q8UA 4MK8A 4PUOB 1U6FA 3IWLA 2QYGA 3MAQA 2WVCA 1SL1A 3JYMA 5ETMA 4EK2A 3HHNB 4JYAF 2B3TB 4B3OA 3GTYX 5HQMA 1WG1A 3F41A 3I9V9 3PHTA 4NLSA 4OHVA 4P6QA 4CDIA 5AXNA 3RBDA 4JI1J 3DLGB 2XP7A 4OZ0A 3QGIA 4M5HA 1WHWA 4WP8A 4C3LA 3GIKA 4E98A 2RT3A 2DD8S 1IR1A 2FDNA 2C2OB 1C2PA 1N5SA 3MMCB 3PYEA 1FRXA 3R27A 4N7TA 1PO6A 1WF0A 5L8RC 3D2WA 1OIAA 5KFNA 1U0HA 4KGMA 5FIIA 2HNZB 4EUVA 3TAMA 3VHQA 4GC6A 4LAXA 1U24A 1VQ8S 2QL9B 3KLGB 3EPGA 1NDPA 3DXSX 2C2NA 1KLMB 2RUSA 1U1LA 4ZLLA 1KLNA 4JV1A 3LP1A 2R2RA 1PG5B 3KJNB 4DR2J 4LF9F 4NRTA 2VOPA 2E9TA 5JJBA 4Y0FA 3JSMA 5DQIA 4LRBA 2DPIA 3NNAA 3P8BB 4G50A 1DTTB 1OS5A 1U0HB 3PFEA 1TV6A 1VJWA 3CMQA 4TVAB 4USTA 2DNHA 4Z7CA 1MWZA 3WD4A 1WG5A 3DLEB 4TY8B 5ETTA 3W63A 5DM6Q 2KVIA 1HR0F 3MEDB 2ZZMA 1R8PA 2WW4A 2RSEA 3K8WA 5D77A 5BJRA 1Y3JA 2EWHA 2LU2A 1VISA 2QV6A 2X3DA 3OR1B 2MDAA 3W65A 2HS0A 2V8PA 4ZVSB 5E0OA 1NSKL 1JB0C 4A8XA 1N34J 3S8SA 1HHSA 4CTAB 3VAGA 3SFGA 2DH7A 2OKQA 1BWEA 2K8GA 2VN1A 1NXIA 4UTGA 5KG3A 3R3TA 3UCGA 5KG2A 3EE3A 4P7VA 5B08A 4IOAQ 1OY9A 1O5JA 4N19A 1SL2A 4TKTA 1J5EF 4ED5A 1TU0B 1CEZA 4X4VA 3MEDA 3RM9A 4RW7B 2UZ5A 1VJQA 1PILA 1VQ5S 3L09A 2CAJA 3EDQB 1CQNA 5K8OA 3BZQA 9RUBA 4OHXA 1JNRB 2MZTA 3W2VB 4NLYA 2NYIA 1FDAA 1MMLA 7FDRA 4QIEA 1CULB 5L1KA 1Q6IA 4V19X 1XR7A 1CVJA 4JB8B 1DAXA 2VICA 3CJTA 5DLFA 2VBWA 3DOLA 3HSGA 5BYSA 1YJNS 2IRXA 4UQTA 1WHYA 2R7VA 1HHTP 2YH0A 1OSDA 2F40A 4RW8B 2YNHA 3E3XA 1FFWB 2P5VA 5KG7A 4OYWA 4X4TA 5ETLA 4WFBQ 4M5MA 3VAMA 4DR4J 4IG3B 4OL8A 1VI7A 3K59A 1YG0A 5JVHQ 2ZR6A 2AEFA 2KXNB 4GKKJ 2IJRA 2PN0A 1YGYA 2E7VA 2K3IA 3LP0A 3GCXP 4LFAJ 3G6ES 1YITS 4DR6J 2YWEA 4IQMA 4MNJA 1YBUA 2O1PA 3MEGA 4XDDA 4F04B 1S4FA 3PJXA 2Y8WA 1Q6HA 3U7JA 1TK8A 1R8BA 1DTTA 1P5QA 1KVKA 2AJ2A 3TX0A 2V8GA 2PFFB 3PKMA 2BM0A 4CLFA 5HBMB 3DHWC 1WB0A 4JYSA 3MWBA 2KR7A 4R5PB 5DQGA 1LV5A 3RR7A 2K06A 2E1PA 4LFCF 1HKAA 3H9RB 2XMMA 3KCEA 5MAOA 1J4HA 3OTOF 1J5OA 1ZBCA 2DR6A 3PRVA 1L3TA 4G1QB 1FE0A 1TUGB 5DG9A 1VC0A 3RW6A 4CWBA 1XMQF 4WYLA 2Q43A 4ZP9A 5C2CA 3E01A 3NGTA 1NO8A 1V5IB 1NB7A 1UEVA 3BYPA 3J7YU 3BSOA 2ABYA 2RU3A 4ELTA 5KFQA 1YW5A 4RW7A 4CQ1A 1WNEA 4ECTA 2ACYA 5AXLA 4C0BA 4JOUA 5LOQA 2A10A 5I4MA 2OJ3A 4KC5A 4EBDA 9ATCB 4DV3F 4GVLA 4WFAQ 1ZTTA 2C22A 5HQLA 4Y28C 2ZH5A 4DSLA 4KHMA 3VGTA 3IK8A 1RHQB 3B78A 4W98A 3DLBA 4F2SA 3KLHB 3TVZA 2A6OA 2ZKTA 3M6XA 3UVJB 3NWGA 4MKAA 2HS4A 1H0GA 1NK9A 2VFSA 1Z2ZA 1UW9A 3VZHA 3CGNA 1SV5A 3AA9A 3OOBA 2B4PA 1I3OB 4F2RA 4DV3J 5DF0A 5ETNA 5IM0A 3WL1A 1R7IA 4ED3A 4NMXA 2NPFA 4F3OA 3C46A 4NZ7A 3D4JA 4CLLA 4DRPA 2DVIA 4RW9B 1N32J 4JFJA 2C3PA 1CG2A 2MHEA 3M8WA 3BQ1A 1X9SA 2OFHX 4C11A 1EKRA 1QAXA 4OHZA 3NOCA 5HN0A 2D41A 4S3JA 3Q8YA 3U02A 4L6V3 5CH7B 2RUCA 4TW6A 2NXJA 3WC0A 1S77D 2HHVA 4NYPA 3EVWA 3G87A 5D0GA 3CMAS 1XNRJ 3R5GA 2MYFA 2CQ2A 4LIWA 5HMZA 1N32F 2HBRB 4MJKA 2GVZB 4HTJA 2MKKA 3LGMA 4OI1A 2ZOMA 5B0DA 3BMBA 4I69A 3PFOA 1B0PA 2Y3YA 4USKA 3O5FA 2JEJA 2FC8A 2MQNA 4DV6F 4O3NA 4CLKA 2ZH4A 3PRAA 1E15A 2JFKA 2NSCA 1MMNA 5DO2A 3KLIB 5B0EA 2C1EB 2V9WA 2EKYA 4QPXA 1TFWA 1R9HA 1G4CA 3W3SA 5KFAA 3ZZRA 4JI7J 3ZFVA 3MD3A 2J0SD 4EYHB 4XO0A 1T03A 3W7BA 1FKJA 1IKXB 2SXLA 3KHHA 1NPPA 3RB0A 1JJHA 4QT2A 1RU1A 3G2XA 5F0WA 3RFWA 2ZHOA 3EVOA 4CO5A 2W9CB 4OIXA 4DSJA 2I38A 4CLYA 4TYBA 4DV6J 4OJHA 2ADBA 3AOCA 4ELUA 3AT1B 3M32A 3QT7A 3J7Z5 3KLHA 3KG1A 2BV3A 4JI7F 2D9FA 3MOZA 2Q1LA 4ATNA 5AJ3F 1UP1A 3D5MA 1TK5A 4Q0BA 1V9OA 1LFWA 4PXEA 4UOFA 2C2RA 1RHUB 4RWWA 4HH1A 5E2QA 1D2KA 3AAWB 3HHKA 5LSLA 5JMNA 4N56A 2GMHA 4KSEB 2XS7A 3AS2A 1L1PA 4J90A 4A8KA 1HJXA 5HQ8A 2BW7A 3ZNJ1 4NSBA 3OPKA 2ZFHA 2E9ZA 2HK3A 1S1XA 2BUNA 2FB0A 2JH3A 1VQLS 2PI5A 5KOWA 1Y3KA 1TL5A 2AZ1A 3AB2B 1V3RA 1SL0A 1PBAA 3P4UB 2AIRB 3A8EA 4QYRA 2HMIA 1SVDA 2DXFA 2E29A 3MMCA 5B0GA 3AS0A 2XP3A 5LM7E 3OLBA 4P8WA 1H74A 4ED6A 3I96A 3C14A 3IS9A 4I2PA 4L76A 3CCMS 5BYQA 1MROA 2V63A 4DLGA 3SV4A 1RT3B 1RKJA 3BV8A 2FJAB 3HSZA 3I0SB 5L39A 3BKUA 2C2ZB 1U1QA 4MT1A 3RB4A 1FFRA 3A8IA 4MKYA 2XP5A 4WTYA 2DO0A 1NKCA 2CQPA 5A0YA 2DK2A 3ZTQA 2ZD1A 4DX6A 1UA0A 1S1VA 2NZCA 3FAPA 4USHA 1HNZJ 1HI0P 3DLHA 3R7SB 3UPFA 3HVTA 3N01A 1FJGF 2JX2A 3OXFA 5KT2A 3VV2B 1Z4UA 1JNDA 1IKXA 2VPYB 1S6PB 1T9VA 1FJEB 1VIOA 3KLGA 4DV4F 2B5JB 4TQSA 5GADI 3GILA 2A3AA 2YNHB 2G13A 2ZD1B 1CJKA 4FYXB 1IKYB 2F7VA 1S1WB 4XDCA 2I5JB 2NUUG 4IPXA 3D0GE 3A3OB 4G1IA 1W9VA 1WG4A 1HNZF 5DIVA 3VGVA 1X9MA 1RYRA 4L73A 4OX9J 1B7FA 2M8DB 4QWAA 4JI4F 5KFKA 2H48B 4DV0F 4KTQA 1RT2B 2HIQA 3CCWA 3JB9k 2QX0A 3MM9A 3R5JB 4ZVPB 2H1YA 3FQLA 2F4FA 3K17A 4LR8A 1HWUA 5D6GA 2XO7A 3OT9A 3OR1A 2VCDA 4OJ1A 3H5YA 3H2UB 2A3CA 3FBCA 5AXKA 1ZK6A 3ZTPA 4A48A 4RUHA 3PG9A 3UE2A 4NLGA 2KXHA 3IAS9 1S1XB 3CW2C 3N4WA 3BGOP 4YP3A 1GXLA 1VCTA 1AUSL 4PEOA 2XLJA 1NJXA 3VAJA 3FBBA 3U1LA 2HURA 4DWSA 3DOLB 5KG5A 1NM2A 5HI7A 3VAHA 4DR7F 4CT8A 3FRZA 3Q2SC 4K8RA 4CRJA 4LIRA 4AL6A 2YY3A 3Q8SB 2DB1A 2EC2A 1FFQA 3O5PA 4TLQA 3HSJA 1GT8A 1T9WA 3IGNA 1C4AA 2W4PA 3O5TB 2C3OA
chains in the Genus database with same CATH topology
3KMSA 4DV2F 3UQIA 1LL4A 2E5GA 4L3NA 3N5FA 1P1TA 3DLEA 3ISND 4WXWA 2EG1A 4FF1A 1C0UA 2XGPA 1W1PA 2DH9A 1E6NA 5F41A 2IA0A 1FNMA 4IFYB 2AJ4A 4CTAA 3CJ0A 5AE3A 1S0MA 4LVNP 2F9JA 2N82B 4TNSA 2DNRA 1TKTB 2GQ2A 3FQKA 1TAQA 2NS1B 3IG1A 5HBMA 2HPUA 1Y7PA 3M8PA 2CPXA 4ALZA 3CCRS 1BQMB 4GO5X 2MY8A 2PI4A 3RTVA 2AP6A 5SZTA 3WDOA 2CQ1A 4M1KA 4WFZA 1R27B 3RYLA 1G7CB 3MECB 3J7ZT 1XNQF 3IXQA 3AJ2A 4J9QA 5E3PA 3BGRB 4FF3A 5J1EB 1JLAB 1BQNB 1KHWA 4DV7F 2VD3A 3Q8QB 5C42B 3O5GA 5KT3A 3A1YG 6FDRA 5LMNF 4RU9A 2AV5A 4HTIA 4FXDA 2E44A 3TAQA 2XMKA 4HDHA 4NL5A 4RW8A 1Y4ZB 4YHHF 2R8IA 4NYOA 3N6LA 2YNGB 2Z2MA 3V6HA 4JI1F 1U47A 4I7FA 2RKIB 1HBUA 3NRBA 3RM8A 4Z2HA 2P9EA 4F4KA 4PWDB 1JLAA 1BQNA 1R6YA 4USIA 1TVRA 1PC4A 4B02A 1NMWA 2ROPA 4TYAA 3JYTB 4Q7NA 2EFVA 4DR1F 2AX0A 4GKKF 2XSFA 2EG2A 3CDUA 2DT3A 4ZHRB 4OLOA 2R8HA 2IVMA 1IQTA 1DARA 2YNGA 3FEXB 4DHVA 1XK8A 4FVMA 2N3OA 2F2DA 1XR6A 3KMQA 3ARUA 1HXVA 2EFNA 4O44A 1Q82T 1ZBWA 2FVPA 2BABA 2VG6A 4FZVA 2Q5AA 3DHXA 2X1GA 1NK0A 2L3MA 4LAYA 1FDDA 2RJZA 2M3DA 4N76A 1ZU8A 4J4OA 3HZEA 4K2XA 2HVHA 2JEFA 1BLUA 1P27B 2BJDA 2N7CA 2BOPA 4IR9A 1D0EA 4BF8A 1N52B 4JFMA 1QUVA 2RF2A 4HVZA 4DSFA 1VC5A 3LUYA 1QPLA 4DL2A 3OUYB 2XNRA 1T8EA 1P8GA 2GQCA 1LWEB 2KN4A 2MHNA 1N5TA 1XN9A 3K2YA 1F0XA 2ZQTA 1XWLA 1APSA 3G4SS 3MDFA 3RR8A 2DTJA 2BJEA 4TU8A 2MZRA 1IN0A 3T6JA 2R2SA 4ML4A 2GQQA 4BHQA 1JLCA 3H20A 1HW8A 3U27A 2WONA 3C6TA 4QIVA 3SCLE 3OUYA 2JSXA 2VC0A 5CZVA 4CO3A 2C2EA 2FVRA 4C2MA 3MM7B 3R5BA 2K2PA 3OR2A 2NUHA 4UUXA 5DLGA 3TI0A 2PMHA 4Q2LA 2KRRA 2MKCA 3CCSS 4AE5A 3JAMY 2LJ4A 3MUTP 3NCQA 2QEXS 3VR1A 3KHGA 2RDIA 4KB7A 5HMYA 2CJQA 1LW2A 3CTRA 1JVWA 4ZHRA 1UVNA 4AL7A 1XRVA 3I0RA 4ETXA 4TQRA 3IR5B 4MNMA 2CRLA 2UUCF 2V4JB 2IAJB 5EX0A 3WD3A 1UL3A 3CF5Q 1ZAVA 4NZCA 2QLWA 3DRPA 3I5AA 5JXSA 3VWSA 4B17A 2R7RA 3T9NA 1XNRF 2R2TA 3LGNA 4HDGA 1Q81T 3R5CA 3NG8A 4C0OC 5B0BA 2WW8A 3KLFB 3K57A 3OLAA 1DTQA 2ZZNA 2FC9A 2HFZA 2R7TA 1YRTA 4KKOB 1GUVA 4D3HA 3HF5A 3HFKA 1PBKA 1RWUA 4FAPA 1ZM4A 3FEZA 1FO1A 2J8AA 3BR8A 4ICLA 4M8LA 1HBMB 2VFVA 2XZWA 3GFXA 1FKPA 2HMIB 4YMEA 4IQCA 3LALA 1N6QB 2L08A 1SR0A 4F4XA 2KJVA 2ZC4A 4OFZA 5G0RA 5KG1A 2ZH3A 3NNHA 2MQPA 3NMAA 2PN6A 4JUZA 1C1CA 1TK0A 2R8GA 2P6SA 3KFWX 5CYMA 1VS3A 2CPEA 4Y2MA 2OP5A 1X5SA 4OI2A 2XULA 4B9LA 3N6NA 3IKGA 4UOCA 1CQMA 2JJ4D 3SFUA 1DLOA 1S9EA 2PMZD 1S48A 5A8WB 4Q2MA 2A18A 2E66A 2WSCC 2AU0A 4ODRA 5KFEA 1Y5NB 1B6CA 2XMWA 3DYAB 2GO8A 3R5DA 2CPFA 3IWXA 4KT0C 1Y00A 1RT6B 2OPPA 4ZP7A 2BA9A 2CJKA 3MMBA 2AGQA 4TN2A 3RAMA 1WAWA 4FYDA 3DXBA 3BSCA 1JNTA 2EPIA 3KOAA 3KAHA 1Q16B 3G9CA 2MPUA 2RD5C 2APOA 3T19A 4NX9A 4R0JA 1FT8A 3WD2A 3OBIA 1QE1B 1SXLA 2MKHA 3I4HX 4PPDA 4Z2GA 1NU4A 3WD0A 2KXFA 1SUQA 2MXYA 4TLRA 1URRA 2C2DA 1SKRA 2ZH6A 4KV8A 3OXGA 3OSPA 3DRSB 3V2UC 5A8KA 3MMJA 3FFIB 1KQGB 1LG2A 4FVCA 1N4LA 2FVSA 4W90B 1FKOB 1UMJA 2YKQA 1TKZB 2AJ0A 3T5KA 5HROB 3QPIA 3POTA 4K4YA 2KYZA 2DR5A 1IUJA 1HNIB 2BW2A 4MTPA 3MDYB 1SH0A 2M7SA 1H2UX 1S1TA 4OQJA 1REVB 3IGVA 5J2MA 4DQQA 2VOOA 2KHDA 2FKEA 2PE8A 1UWBA 3DDKA 2FPHX 3P3DA 4QR2A 5EWEA 3GV8B 1ZTWA 2MKSA 4MYUA 5HT1A 2OH2A 3JYTA 5KT4A 4J9LA 3TAPA 5KG4A 4TW8A 2KT2A 2E5IA 4FNIA 1S9FA 3HHLA 1H0HB 4CO1A 4WE1B 3AS3A 2FJDB 2ZNYA 3MM6B 4DT4A 2EFQA 5IFMA 3BO4A 1WWHA 4LF8F 4W9QA 4ERDA 3TCZA 3G6YA 2R7SA 1EIBA 1NJWA 1TKTA 1WEXA 4NA1A 1U45A 1E6VA 1RT6A 2RS2A 2LCWA 2XEXA 4ECXA 2HNYA 2XP8A 2HHUA 3M2RA 3V5RA 3OL9A 3KHLA 4ZPAA 2D9PA 4LSNB 5ADZA 1TL1A 1K73T 4U67Q 4NCAA 5GAGU 5IQ6A 4MAVA 3DFEA 2R7WA 1AW0A 4TU7A 1CC8A 4Y2AA 1HARA 3EPIA 2WBMA 3CCZA 4WXOA 3LAKA 1VIXA 3N28A 3GIIA 3BSNA 2QT7A 3RZAA 4UY8T 5T14A 3QJLA 1RJJA 3O5OA 2OTJS 2G9OA 4PXDA 1RI7A 2LPVA 2OLHA 2XLIA 4IO9Q 4FS1A 1YJWS 4QWDA 4WU3A 2VB6A 4XIUA 1N5YB 1HNIA 3L7PA 4QU7A 3ARWA 2HLUA 5D4PA 4K4ZA 1YBAA 3FZ2A 4OV1A 5EWFA 4RNHA 3HPOA 4DRQA 5FDLB 1RKIA 5T7LA 5HLFA 2ZC3A 2VPZB 1QSLA 1SV5B 5GVQA 2KFYA 2XY6A 2VG6B 2YNFB 5LSOA 1JXEA 1KOOA 2KI3A 2LDYA 4HHJA 3UWTA 4ECYA 2O66A 3NGDA 4NLTA 4Z2XA 5T7LB 3M8SA 3T1HF 2BRLA 3R1LA 1FF2A 3FMBA 1S1UA 4F3MA 4K4WA 4ILLA 3HM9A 5CYJA 4H54A 5J2NB 3MF5A 4ZA1A 1IBKF 2MLZA 3OR2B 2PSZA 2RSQA 3DRYA 3T9ZA 2HRYA 3BM7A 4OZLA 5KG6A 2C3MA 3HXMA 1YSJA 4R8UB 4DN9A 4KO0B 2JLEA 3I87A 5EX3A 2G4BA 3CJ3A 1L5UA 2WM0A 5IWAF 4DQPA 2EFGA 3QWPA 2M2BA 3ODKA 3RW7A 3BGFA 5F8JA 3FDSA 3GZ7A 4X4OA 2Z4PA 2IVFB 2WCXA 5DM7Q 3HVRA 5KFDA 1T95A 1VQSA 5F8IA 2HHHF 3LPYA 1G1XA 3CD6S 5J2PB 4NLXA 1H2TZ 2GW8A 5B0FA 3CPWR 2F8HA 4YR2A 4WZQA 4X4SA 2XC9A 4KFBA 1UJ5A 4DX8H 5BXJA 4X65F 3KADA 1A7GE 4DPOA 5CA5A 5DITA 3PIPQ 4DQSA 4LF5F 4ODNA 4GIVA 3BQ0A 3AY0A 4YY3F 1W1YA 2FUG9 4H4OA 3SQGA 2DJWA 2W7PA 3TUZC 4MYTA 4Z2LA 3PO5A 3B9DA 4ZVEA 3CO9A 3PJWA 4KFBB 4OZ1A 3FVYA 1LG1A 3NS6A 1HKIA 3DMJA 3L3CA 5A6WA 4DFPA 5E3RA 5K8NA 3KAFA 3VAWA 2JC0A 2D7SA 2ZJRQ 5I3UA 2JOQA 2XCPA 3FSIA 2RRBA 3K5MA 1JLQB 1UVIA 2UVWA 2ESCA 2BE2A 1M5HA 5KFTA 4NLPA 4OX8A 3V4IB 1ZH5A 3ITHB 4GKJF 2O01C 4KE5A 3MMAA 1QUPA 3CCTA 5L9XA 3HP6A 3NNCA 2B5JA 1VQ4S 3AS1A 5B8IC 5HW7A 4LQ9A 4TNOA 4RNOA 4B3TF 1HBMA 3ISZA 5EWGA 2MGZB 4QIBA 4UW2A 1ZM9A 1JXLA 2CQCA 4DF4A 2QA2A 4WK1A 3K5OA 3Q23A 3M2UA 3DOMA 4XPCA 3PDNA 3JTNA 2GHVC 4NOHA 3AROA 2ZBIA 3MURP 2FJEB 3SSSA 1ZAWA 1KOHA 2Z8QA 4JI6F 3EGNA 3TR5A 3RB6A 1X4DA 3TO8A 2YNIB 5KFIA 2ZBCA 3CDAA 1ROTA 4RZRA 2BQ3A 3AQPA 4C8ZA 1S6PA 4B9TA 2DSZA 2XNQA 1KVIA 4C8OA 1TFVA 3M30B 3KHRA 1FD8A 3DYAA 3K58A 1KQSR 4ELVA 5KFSA 2J9EA 2QA4S 3PW2A 2M52A 1T94A 1P1LA 4IT4A 3DLLQ 2R8JA