4QZVB

Bat-derived coronavirus hku4 uses mers-cov receptor human cd26 for cell entry
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
208
structure length
208
Chain Sequence
TECDFSPMLTGVAPQVYNFKRLVFSNCNYNLTKLLSLFAVDEFSCNGISPDSIARGCYSTLTVDYFAYPLSMKSYIRPGSAGNIPLYNYKQSFANPTCRVMASVLANVTITKPHAYGYISKCSRLTGANQDVETPLYINPGEYSICRDFSPGGFSEDGQVFKRTLTQFEGGGLLIGVGTRVPMTDNLQMSFIISVQYGTGTDSVCPML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptidyl peptidase 4
publication title Bat Origins of MERS-CoV Supported by Bat Coronavirus HKU4 Usage of Human Receptor CD26.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/viral protein
total genus 41
structure length 208
sequence length 208
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.70 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4qzvB02
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4qzvB01
2GHVC 4ZPWR 2DD8S 3D0IE 4L3NA 3D0GE 4ZPVR 3BGFA 3SCJE 4ZPTR 4ZS6A 4L72B 3SCKE 4XAKA 3SCIE 2AJFE 4KR0B 4QZVB 2GHWA 4KQZA 3SCLE 3D0HE 5DO2A
chains in the Genus database with same CATH superfamily
5KFQA 4KAIA 1KLNA 4AUKA 3LWMA 2BJDA 1UA1A 4DEZA 2OMLA 1LXJA 3W5XA 2AJFE 1S1WA 2ROEA 3WD1A 4NLRA 4IG0B 1X7VA 2A0FB 1URRA 2IA6A 4ELTA 3M8WA 2CNNB 2CZ9A 1GEHA 5BJRA 1LWFA 1QTMA 1EYMA 2FJEB 4DL2A 4JFIA 3SZ2A 4X4NA 2PBCA 4FF1A 3I5CA 2I9SA 3PYDA 3VF0B 2VUGA 2F8EX 2OP5A 2DNLA 2YX4A 3KLVA 1ACMB 3EYZA 1U1OA 1RU2A 3HSDA 1CQNA 1T9WA 2G1DA 3K5PA 4BC9A 2GHPA 5BXIA 2LPVA 4ZVOB 1CC8A 4FVCA 3PJXA 3TUJC 5C24A 2APOA 2FC9A 3CNQP 3CC7S 4DWSA 4N5SA 1NSPA 3W9HA 4DV3J 1Y9OA 2A3BA 3MCNA 4NYPA 2CPDA 3FGVA 2JC1A 3D0GE 4WTYA 4GKKJ 1F9EB 2K3KA 1T02A 4KFBA 1IKYA 1VJQA 4ELUA 1MU2A 2AP6A 3MEGA 3I56S 3JAMY 1R3NA 1T9VA 3JQKA 5HQMA 4F04B 4AQYJ 2QA4S 1VMBA 5KFFA 2ESCA 2DISA 2QTWA 2CPHA 1IX5A 1P8GA 2Y8WA 3DNCA 2AW0A 3RBXA 5DRKA 1Q82T 3M8YA 2WLYA 1JXEA 2FUG9 4JFJA 3V4MA 2CPJA 4TW6A 4LF5F 2IAJB 2VJUA 3E01B 3OTCA 3BH7B 4O44B 1LWXA 5IQ6A 1S9GB 4AE5A 2ZZMA 1KOHA 2HHVA 3KLGA 2QYCA 3TDBA 5A0YA 2E9RX 5HMXA 4OLOA 1NM2A 1RWWB 4RWXA 3W9IA 2GMLA 2OFGX 1J6YA 3HKWA 4DR2F 2ZQVA 4KIAA 3AD9C 2K7KA 2IRYA 2DH9A 5CH7B 5JH8A 4O3RA 3H98A 2X1FA 1WHYA 4YB5A 1ZBCA 2ZKTA 3SCKE 1EHNA 3UF8A 4Y34A 3G86A 1FKSA 4CLKA 1KONA 1S12A 2RQKA 4DLGA 1YJVA 4IQ2A 4G1QA 3M2RB 1BUXA 4DL3A 1T03A 3FQKA 3T1HJ 4KBIA 1ZA2B 4F3MA 1LWEA 1SR0A 3B9EA 3ENQA 4DSIA 4Z2IA 1CJTB 2HRUA 1RWUA 1NU4A 1N6QB 1WD6A 3QOKA 1EARA 3RAMA 7AT1B 2VG5B 3ARTA 3BJYA 3QPIA 2FJXA 1DFDA 2P9CA 2VBXA 3UDCA 1NWSA 5EGYA 2M70A 4UDMA 3TO8A 1YTYA 2C2MB 2OD6A 4RW8B 3QRRA 5E2QA 2AGQA 2GJ2A 1M5PC 1YBAA 2AV5A 4MAVA 2R9LA 3M8ZA 1UVIA 2NCKL 4RW4A 2YKNB 2GS8A 5AJ3J 2D3O1 3A3NB 5CCLA 1X5PA 2CQ4A 3NNCA 2KO7A 3RB3A 4PQUB 3A3PB 3ETMA 4HI1A 5B0AA 4ED1A 4DWSC 4ZVRB 5U47A 4ZPDA 3M8PB 2BOPA 4U8YA 1IKWA 1VQ7S 3IG1A 2YWHA 1GMWA 4Y00A 4ETXA 2POKA 2L48A 2D7SA 1S6QB 4CO1A 5JJBA 2E44A 4KKOA 1R89A 4KGZB 4PR6A 2J9DE 1DJ0A 1S5ZA 4ID8A 5GADU 4MNLA 4B9LA 1KT1A 3O3LA 1I94J 2DGVA 2NXUA 2DXFA 2LEAA 1PYSB 3V4IA 1TMJA 2HS0A 2VDHA 3FBFA 1Q79A 3J81j 5HAOA 4BC7A 2WONB 4IH7A 2GFFA 1E6VA 2GMHA 3HVTA 2CQ2A 5G0RA 1JLQB 1T0TV 3DC2A 3OHBA 3CHDA 2BANB 2PFDA 2QFIA 2DXEA 1RP5A 2XLJA 4ZCKA 4LF8F 2CPXA 5EX0A 2M52A 2E66A 4DUYF 5J2MB 1D09B 4DPUA 2FVPA 3GFXA 2UXBF 1HWJA 1SC4B 3BSNA 5HBMB 1ROTA 1VQ8S 3UDEA 3RGIA 2J0WA 4LJMA 2XPAA 2FHJD 1SBRA 3EGZA 2CQIA 3PCOB 3OTOJ 2HIYA 2BKPA 4DR6J 1N5QA 3D9BA 3MM9A 3TUIC 5H9FK 5DGBA 4IPXA 2WOMA 2JL9A 3SEOA 1UCNA 1M5HA 2XC9A 2FZGB 3BO2A 1K0VA 1IXKA 3IWLA 4LF6J 4F7VA 4O4RA 2H5IB 3RBZA 2XLKA 1RT2B 3F56A 3TJ9A 4IH6A 3HSJA 4MNMA 3PA7A 4OZ1A 5C25B 4NE9C 2UXCJ 2O9OA 4NMLA 2MY7A 2DSZA 4NLPA 4OV1A 3VZHA 3KAGA 3QGPA 1PGZA 3UDVA 4KGVB 1HWIA 1N5SA 4TX0A 4TYOA 3Q8SB 2N7YA 3TP2A 3RAQA 1HBUB 2B4PA 3MR3A 2ZWPA 1IBMJ 3DRSA 1T05B 2DD8S 2OIHA 1ZTTA 3MPYA 3R7NB 1RT6A 4CLPA 4X65J 5BR8J 1TFWA 2DVIA 1HYSA 1HD0A 4QPTA 1X5OA 1H38A 1Q6HA 1QE1B 1L3TA 2G2OA 5HATA 5B0FA 3M30B 3G8QA 4CYUB 2NXEA 4J4OA 1RE1B 3MEDB 1JNRB 5I42B 4QR2A 2RUDA 3LA0A 3D1HA 4OYBA 4PRFA 5J2PA 2GO8A 2VG7A 1Y0OA 4ZA1A 1EQ0A 2XYGB 5DQHA 1WHVA 5B0DA 3BPSP 3R97A 1WNEA 3CPWR 3TCZA 4DFJA 4MTPA 2DIVA 4WK3A 2GHWA 1UEKA 6AT1B 3KLIB 3CJTA 1T94A 3BGRA 1ZOTA 4LSZB 4RR5A 3JQJA 3AJ2A 2NSCA 1QPLA 2AIRB 2CZVC 4DV7J 3FSIA 3HD1A 2YNIB 3AS2A 4LF4J 3VAFA 4I6WA 1TU0B 2E5IA 2HVZA 1KBRA 2E29A 3FMWA 4DR1J 2AHOB 4IR9A 4YY3F 1ZM9A 1W7WA 2GV1A 4D3HA 1SH0A 4WP9A 4JYAF 4EMDA 2CJAA 1IR1A 2W1BA 2HAIA 1Y5NB 4UF4A 1KLMA 1RZMA 5LMNF 1WAWA 3NKYA 2ZH7A 4DDFA 3C19A 3O5FA 4JFKA 1Y7PA 3F44A 3KHHA 1DTTB 4IQXA 1R8HA 3KYLA 5KFYA 1CJUB 4K4UA 2HNZA 3E51A 3NCQA 1NDPA 3WX4A 2RUSA 4I1TA 4NA1A 4NA3A 4AYBD 3NWGA 2RRAA 3N28A 1Q78A 3OVAA 2EC0A 3TC5A 1N1AA 1SIZA 1HQ2A 2AF6A 5GADI 3KK1A 3G82B 1NLKL 2KL8A 3T9NA 1X4AA 2QN6B 3NRKA 3BKTA 5EX3A 4DFPA 1UEVA 3HLUA 5T7LA 1D6OA 1U1MA 4B9NA 3RG6A 1J5EF 3NXZA 1H2TZ 3O1LA 2OEMA 2OD4A 4W92B 4LRFA 1LQ9A 1SV5B 2AJ4A 1SJQA 5I3PA 5IM0B 3UD5A 1HR0F 1M5OC 1H72C 3UWTA 4PG6A 2OSQA 3MCMA 4LF9J 4AD6A 2R7TA 3M6VA 1S0VA 4Q45A 4YB6A 4ID5A 1F0XA 3ZNUA 2MZJA 3MOZA 2JFKA 3NEKA 5LM7E 4CI0B 3CCUS 2ZR6A 3NS7B 4WIQA 2DGOA 4M5DA 3ARPA 2ETNA 3VQSA 5DS7A 1QTNB 3EM1A 1D8YA 4GKJJ 3B54A 4DRPA 5CABA 2LKNA 2HMIB 2CQ3A 1RTHA 1WG4A 2R7UA 1EDQA 2Z2LA 3KK3B 3HHNB 4WZQA 3HFKA 4KGMA 2HNYB 3AQOA 4DR7J 3QT8A 3GR0A 3WIVA 2VBYA 2G2YA 3Q23A 2GVDB 1FRXA 1RHUB 1RT5B 4C2MA 3PRAA 2Z0GA 1NDKA 3RW7A 3ZZZA 4Z2HA 1KVJA 4ZLPA 3JSMB 1S6OA 5HW8A 3DOMA 3L7OA 1FHTA 5F0UA 1WI8A 2RKIB 4RL1A 2H54B 4WXWA 4ZJQA 4FF3A 2XP9A 2Z56B 4G1PA 4FNIA 4O4GB 3SDEA 3LAKA 3KG4A 1P5QA 3RM4A 1IQZA 2IYGA 3MR6A 3C16A 4AT1B 3CT9A 4A8KA 4C8ZA 2KI2A 1PKUA 2MJNA 5GAHU 2XBPA 4ENOA 1T9YA 4NLTA 4PUOA 4HKQA 3TOQA 2XMMA 3IBWA 4DMZA 2UUAJ 5KFNA 3CMES 3BR9A 1RTJB 1U6FA 2DCLA 4YHHJ 3VAWA 1SB6A 4WKFA 1Y10A 2UUCJ 2HBZB 1FKOA 1YRTA 2VFTA 4JP8A 1NKCA 5EWFA 3FC9A 4F4YA 1LK5A 2QL9B 3TA1A 4X64F 2OHDA 4QWCA 3C6TA 2IBKA 1X6NA 2WVBA 4ED5A 4DSJA 2F21A 1GRJA 2MHNA 2E1AA 5I3UA 1MG7A 4C9DA 1H6KX 2U1AA 2HS4A 3GTYX 1S76D 1FJGJ 2VU5A 4NA2A 3A13A 2ZFHA 3R7SB 3OL7A 1N34J 4YP3A 1C4AA 4B3OA 1D1UA 3LP0B 2DRAA 1OY9A 2M2BA 2PMHA 1FAPA 3JSYA 1U0SA 2BYCA 2UZAA 4N41A 3RGCA 1I3OB 1PJ5A 1D2KA 2FJBB 1WF2A 4DV3F 2V4QA 2OPPA 4C7QA 4RW6B 1AT1B 5F9NA 1MWQA 4CQ1A 3GONA 1FKGA 3DCAA 4ED7A 1U1LA 3R1HA 2UV8A 2E5GA 5HL7Q 2MHEA 1LOUA 1MMDA 4WU3A 2I5JA 4AQYF 4BHQA 4X62J 1VF8A 4PG5A 3GIKA 3CW2C 2JHEA 2DSWA 4AFFA 3P6YC 4HEA9 1FD8A 4OYOA 3T3FA 2CNOB 1Y4ZB 3ZTOA 3IAS9 3VWSA 9ATCB 4BBYA 3SYZA 3I9ZA 4ZK7M 3GMGA 4QWDA 2W7OA 2G0IA 3H4BA 5K14B 2YX1A 4K5SA 2ZE2B 3PYGA 1FF2A 3MD1A 1PILA 3HXMA 4QWEA 2DNRA 1KFDA 3DLBA 2VV5A 1FNXH 2QG9B 1QSLA 1TUWA 1L1PA 3I0RA 2MKKA 1XR7A 3PRDA 3KLHB 4BCAA 3EGWB 2WM0A 1RHRB 5KFTA 2ZBCA 2FHMA 2VIHA 1Q16B 1X4FA 4C6AA 4P52A 1FE4A 2XO6A 1EX8A 3SFGA 4Z2GA 3KMQA 3E2EA 4X4SA 4IOBA 3H4DA 1OJ4A 5GVQA 2DG4A 3KHRA 2EBEA 1UFKA 1HI0P 3T1HF 3TEGA 3MMAA 4LR8A 5FLXU 4ZVUB 4OZ3A 2VODA 4K4XA 3LANA 3RR7A 4DL0C 3MPUB 1D8ZA 5ETTA 3ENWA 1M5VC 1TL3A 2L9DA 3OPKA 3NAHA 1D7JA 3D0IE 3ISND 3LALA 4C0HA 2JH3A 3AQPA 2FDMA 3PR5B 3IBFB 2YKOA 5LXYA 4L73A 3ICLA 3DLEB 4IR1A 3MM6A 1ROUA 1OPIA 5IT9U 2YKMA 2X3DA 4Z7CA 5D4LA 5AJ3F 2BJ1A 3DM2B 3BS9A 3WDOA 4F3QA 1NK8A 2B4OA 2B43A 4LFBJ 1YBUA 4DX6A 1DHMA 3WD0A 3DGPB 2VQEF 2HWHA 2OGUA 2M08A 3OD2A 3C8YA 2J8SA 5KFXA 4P73A 4KJIA 4ODPA 2XGQA 1PC5A 4DG1A 2Y1LB 1XNRJ 2XI3A 2NPFA 5GAHI 1FX2A 3DRPA 3T5HA 1T9TA 2OO4A 4IUFA 1N33J 4M5HA 1BQMA 2L08A 4BDPA 1QD1A 4OHVA 1TFYA 4RBTA 1IKVB 4EBCA 2F4EA 4QPXA 4OX8A 3WD4A 4ECTA 3SBMA 3RM9A 4DQQA 2H3EB 1BLUA 3TQ1A 3CCVS 5THWA 2QA4G 2MNTA 1N54B 1NK5A 3LOUA 1GMVA 4UZCA 2BR0A 4IG0A 1BHNA 2XHCA 1EKSA 4DX5A 3CHCA 3GU0A 4R5PA 1CJKB 2H65B 3OTOF 2MZ1A 1FRKA 2C28A 5HLFA 5DM7Q 2JEFA 1U1RA 3UQSA 1S10A 4LBPA 3GCXP 2MQOA 3UNGC 2RDDA 4LF6F 1FD2A 2BUNA 1F8AB 3EXCX 1FFSB 4B3SJ 1VBZA 2UXCF 3THVA 3WKZA 4O3OA 2AYEA 5KFHA 3EVWA 3DRRB 3L3CA 4CM2A 1Q7LB 2W9CB 1X0PA 1TL1B 2XY7A 3V6KA 1WC1A 4HLBA 2IPOB 2ROPA 4F67A 2MY8A 3LUOA 4UT4A 2H5JB 1IBMF 3FNNA 4WTOB 3ILOA 1PCAA 3BZQA 4X65F 1NK4A 2QMUB 1REVA 3I87A 4PWUA 3CEDA 1TVRB 2R3VA 3P5BP 1FRIA 1O8BA 3Q22A 4LREA 1IR2A 4JI3J 2OLHA 5KG7A 2AGOA 2ZR5A 3DMJA 1IBKJ 2G41A 2B8QA 4WKHA 1WF0A 5DIUA 4C8LA 2C2ZB 1H2VZ 1X4HA 2IAJA 5KFAA 1KC8T 4I67A 5KTQA 1SIWB 3UDLA 1BD6A 1EAYC 3L09A 3GYNA 5ETMA 4I2QB 2H51B 2B6AB 4J9LA 1B0VA 2GQQA 3DFEA 2O3DA 2XO7A 1LQ0A 2DIUA 4L75A 4U6PA 3KJFB 4RKUC 3W64A 4C3KA 4AXIA 2ZH9A 4DV6J 2B5JB 2M5YA 2N4DA 1PAUB 1TK0A 1LK7A 2PV2A 2LP4A 4XDDA 2BBEA 3OQ2A 4DSKA 2LLZA 4DV7F 1WDTA 4P9SA 3EPIA 3NMRA 3V6HA 3FVYA 3NNAA 5HJXA 3M8QA 2BJEA 3M05A 1D9FA 3KNGA 3NGUA 3FAPA 4ECVA 2VZ9A 4YR2A 3PIPQ 1SJ3P 2EK1A 3TRGA 1YHQS 1H73A 1QLNA 4DU7A 3MEKA 3CSKA 5E33A 2QIFA 2C2DA 5HP1B 1NMWA 2GAGC 4KH1B 2BE9B 2QYGA 4RW7B 4TLQA 2D1CA 1HARA 3TR5A 4ZOSA 2B56A 4DBQA 1A7XA 3TVKA 2GMJA 1FFRA 5E3QA 2B5UB 4WWSA 4QIBA 5LL6d 4RW9A 1U8WA 5HW6A 2C3YA 2M9KA 2YKAA 2C2KB 2GIQA 5DJBA 4QYZJ 3UCUP 2DNOA 3WBZA 4K4VA 1RWMB 3KOAA 2M3DA 2ZKUA 4LQ9A 4Z2JA 3ISZA 5IZHA 3MF5A 2MPUA 4RW8A 2ZDOA 4F4KA 2XMTA 3T5JA 1WB0A 1M1HA 2ROGA 5B09A 2BQ3A 3PO5A 2CDRB 4P8UA 2YKNA 2YWEA 3JSBA 3ZTRA 3CH9A 1VOMA 2AYGA 3LF0A 1HBMA 5DITA 3K8VA 3M32A 1OQ6A 1R31A 2NPIA 2I38A 2PSZA 4W9QA 5T41A 5KFCA 4X84A 3SV3A 2IJNA 2N4CA 1X9WA 2MB0B 1S1WB 4QWAA 1NWTA 4PCQA 2PGCA 1DBDA 3ARRA 1OWXA 2VL1A 3ARZA 5HSPA 2XS5A 4X4TA 3WC2A 1A7GE 1PBAA 2A3JA 4QZVB 4HACA 4LF9F 1LWFB 4B17A 4QT3A 1VQ6S 3QNWB 2EG1A 3GE9A 3ARQA 3N01A 1AB8A 4DLEA 5AE1A 3OVSA 1U2CA 2ACMA 1HBOA 2VB6A 4XAKA 3CJ8A 3OXFA 4USKA 3QATA 4LR7A 3BQ1A 2FQQB 4QW8A 1JLQA 5DEZA 4GKJF 1IWAA 5C24B 2PO4A 1XNQJ 4URSA 5KG2A 4FN5A 4DPXA 3FEZA 4PYDA 2RSEA 5J2MA 4NYOA 1H7XA 2PA3A 4DWSB 4BLGA 4DR7F 5DQIA 5K8NA 1XWLA 4ED2A 2ZR4A 4MYTA 2LQBA 2X3GA 4GMKA 1WC4A 4USMA 1RHJB 3CJKB 4H4MB 2DB1A 4YN3B 1DARA 2XP4A 4KFBB 1MU2B 3MEGB 2V8HA 5KT6A 1AYEA 3QQCD 1HJXA 1VJWA 4RUAA 1KNZA 3R2DJ 4WKAA 4WFAQ 4AL6A 4ES3A 4K50A 3KDOA 1I5OB 2GO9A 4OHYA 2AX0A 1YITS 3QO9A 3BDEA 1RKJA 5C42A 1UFWA 2AEMA 2EXUA 4L76A 4LAVA 4GC7A 2DR8A 3W8GA 2QSWA 4LSNB 4UQTA 2UUAF 2WW4A 3EGVA 3Q2SC 2A3CA 5HROB 3OJUA 2M8DB 2W4CA 1Y3JA 2HHTA 3K59A 1KQSR 2V8VA 4YHHF 2VH7A 4RO0A 5A0YB 4B3MJ 5J1NA 3EDQB 3D6MB 4MKAA 4R8UA 2UUCF 2IM3A 1CJVA 4KH0B 1GAOA 1Z2LA 2EBGA 4DPWA 4NLVA 2KT5A 5L1LA 3TVYA 4TU7A 3UQBA 5F0WA 3NWRA 2IM0A 3RB0A 3VHQA 3Q0AA 3UI6A 1AZSA 4CYUA 1FJGF 2WVCA 1V6HA 2XTJP 2DNNA 3TVZA 1N34F 3HHLD 3VAKA 3OV7A 4ODKA 2YWGA 4K59A 4G1QB 4ZKAA 2XNRA 2WBMA 1Q81T 1Q6UA 2YY3A 4JI0J 2HGLA 2IVYA 3VR1A 2RHQB 4E2FB 3UQAA 4KGKA 5HKGA 2RS2A 4UUXA 3ZZPA 1S0MA 2LGOA 3TJ8A 4X4UA 1VRUB 3KKFA 2L9WA 3OTBA 1VC5A 4OZLA 3WQVA 2K7JA 5IWAJ 3CCES 3EICA 2RDIA 4DRIA 4IFVA 4ZHRA 3ULHA 2CVIA 3UVJA 4C8NA 1PYOB 3SSQA 4PPZA 3UR0A 1Q4RA 1BL4A 4WBFA 1YIJS 5JMNA 2B9EA 3QGIA 5GMDA 4PWDB 4HTJA 2ASYA 2CIMA 4M5NA 4MIBA 5D4NA 4A4JA 2KHCA 3IG1B 2O1PA 3JAMU 1FCAA 2YWWA 1N56A 5J2NA 2ALZA 3G6YA 1W26A 1U47A 4ZN3A 1F5CA 1DTTA 3N5BA 3Q8VA 4KKOB 4ANCA 2VF3A 4FF2A 1U02A 1F3FA 3CMQA 2B0GA 4FYDA 2J6SA 3X1LB 4Q8EA 4DV5F 4I6AA 4PABA 4FBUA 3AD7C 2XMAA 3V4IB 2FB0A 1HNVA 1HWUA 1H0IA 2RD5C 1B99A 3C15A 4NZCA 2RH3A 4MMOA 2HBRB 5KG1A 3FEXB 1RAHB 4IRCA 1HLWA 4WFYA 1GXUA 4FF4A 1B4SA 3PHTA 5J1EA 4IOAQ 1RB0A 2W25A 3P49B 1ITXA 2UVVA 1K47A 1TKZA 1GOIA 1X9MA 5HMYA 2IIHA 2F9JA 2EULA 4N47A 2ZHOA 5HVHA 1FRJA 1LWCB 4IO1A 3O5QA 2WHOA 5SUHA 5LMUJ 2ZBPA 3A8KA 5F3TA 1S0NA 2Z30B 3MM9B 5DZ7A 2WOMB 2RUQA 3CE8A 2ADBA 2OSRA 4USTA 4PXDA 1QUVA 1JB0C 1G4CA 5DF0A 2Q6BA 4HI2A 4NXNF 1U0HA 2RNEA 3MM7A 3I4HX 1QAIA 2HHPA 4RWWA 2CZ4A 4DPOA 2KVIA 3UD4P 4ITZA 1RCXB 1JLFB 4FP9A 8RUCA 4LFBF 3M1VA 3ILLA 1V3SA 1W9PA 4O23A 1HNIA 4DRJA 4RNHA 3PW4A 2QA1A 1NRKA 1FNMA 5EHHA 2HNYA 3K5OA 3ARXA 3PKMA 3P5TL 4ZP6A 1OGGA 3CDEA 2GVDA 1TL4A 5DDQC 4JV2A 1G2EA 3DRSB 1WEYA 1OYEA 1XNRF 2J7WA 1EHWA 1RT6B 4CLZA 1N5VA 1HYSB 1WG5A 1H0GA 3CJ2A 5KFRA 5B0GA 4G2PA 2R7SA 3HM9A 3NGDA 4E8UA 2GIRA 1NPRA 1VRTB 3OSNA 4P8XA 3MOJB 2IJRA 2FVCA 4NNRA 2GZOA 3KFWX 1UVKA 4CH1A 3BSOA 1HD1A 1WC6A 4OLPA 1NK0A 2VG7B 3WZ0A 3C66A 4QR1A 4QT2A 2OPRA 3TW0A 1ZPVA 2OEJA 1KQKA 4Q2LA 3ETOA 5CD4A 3FKBA 4JI8J 1BY9A 2HAFA 2ASLA 1X4EA 4JI2J 5CD4H 1XQIA 2Q5AA 1HBNB 1MROA 3BGRB 3SCJE 1RA6A 2QL5B 2LECA 4JFLA 4FXWA 2RVJA 4DS5A 2OKQA 4DR2J 2VKRA 4Y2IA 1R6YA 2UVRA 4W90B 2D9OA 3J7AN 1KS2A 4LT6A 2BOAA 3MUMP 2CQ1A 1KSPA 2DXDA 3G6LA 3QIDA 2XP3A 3GV7B 1NKBA 1KLMB 3LPYA 2ABYA 3LP0A 1KFWA 4C97A 1NHVA 4PXCA 3U1LA 5DG9A 2OH2A 4QWBA 2DEIA 2VN1A 5I98A 1RCOB 2R7OA 5GAGU 1VLYA 4JUZA 3J7ZT 2DH7A 2HNZB 4IQCA 3ONQA 4WE1B 3DLJA 1T7PA 4HT5A 2GCFA 3W2VA 1U24A 2J8AA 1NSQA 2SXLA 2OUGA 1TAUA 3US5A 2J0SD 3NS6A 5A2QY 3PX6A 2YBVA 4LQ3A 3OHAA 3U02A 4JI3F 1VCTA 4RX6A 2Z4PA 1I51B 3OFGA 3BM7A 2CJYB 4FYYB 3H20A 3H5YA 1W1YA 2KI3A 1R9HA 2J9DA 5T7LB 4U7CA 2W2OP 3PVXA 2AJ1A 2X1BA 4TW7A 3LPEA 4TYBA 1FK9A 1BQXA 3KMSA 1OPZA 4E0DA 2ZE2A 1JJHA 2MSSA 4YQWA 2QLJB 5H9FJ 3CTRA 4DV6F 3T19A 1NB7A 4AL7A 1FWPA 1HNWJ 3R5BA 4CWBA 1FKLA 3IRWP 3KADA 1RTIB 3KUGA 5BYQA 4ID5B 2KZMA 1HKMA 3MFIA 3KLFA 2R8KA 2RE1A 3POTA 4GO5X 2ZM6F 1RI7A 4CRJA 1SCJB 2OI2A 1X6LA 2XULA 2M2AA 1WTBA 3CD0A 4M5DB 3IGNA 3KCEA 1GH8A 3P45B 4L3KA 3EZOA 1LG1A 3G71S 1VQKS 1F9HA 2NR0A 1HXVA 1RTHB 4BF8A 1ULRA 2AX1A 2EFOA 1DQ9A 4UOCA 3ILJA 2HFVA 1FE0A 2OELA 5KG0A 3HULA 5DO2A 2CQCA 1YZ6A 4MKYA 4NWBA 5ETKA 5IV4A 2N3OA 1URNA 5LSOA 2FJDB 3D68A 1UKUA 1SXLA 3DOMB 2JZ5A 3J7Z5 1AFIA 5D15A 3LGNA 7FDRA 1FRHA 1S48A 4WZMA 4N77A 4MK7A 1UETA 2CJ9A 3SDEB 1FTRA 1FNOA 3WIJA 1C1BA 3GV8B 5HVFA 4OHWA 3OA5A 4OJHA 2ZH4A 2E1PA 4PUOB 3IAM9 2V2VA 3Q89A 4JBCA 2FIUA 4DV0J 2X51A 2FY1A 2DT1A 2CA9A 4DS4A 1P27B 2H4WB 4A8XA 2DRBA 4J9VA 3TX8A 2GQCA 3DOLA 1VQ9S 2RQCA 2MQ8A 1FKOB 2N3LA 4ES2A 3WX8A 3R5JB 2B3TB 2VA3A 2H48B 1YZ7A 3EWGA 1YJNS 3H59A 4NRUA 1YK9A 4MTVA 3C6TB 4LF1A 1ZPWX 4ECQA 1GUVA 1IKVA 5I3UB 4WJXA 3GCWP 4I68A 1X4BA 2EPIA 2ZC4A 4LUBA 2IM1A 2G0CA 2XP5A 4U7UK 2VPZB 3HSGA 3D54A 4UOFA 1XNQF 4B3OB 4DZ3A 1S4FA 1FD9A 1QSSA 1S0OA 2GX8A 5CYQB 1VQNS 2YBUA 1OS5A 2KRBA 4U7UD 3LUYA 2ZZTA 2UU9J 1JIHA 4IYQA 4OJGA 4Q2MA 4OYWA 1GPFA 3QWPA 4OI2A 2PMZD 4TNSA 2HGMA 1OSCA 2OPPB 2Y3YA 1W1PA 4F25A 4ECUA 2HQDA 2FZCB 1SKWA 4DN9A 2I5JB 1A6LA 2LYVA 1QY7A 4GRSA 2XB2D 5GAGI 3THPA 2IFXA 4O3PA 2QE5A 1NAQA 1WELA 5K8PA 3H40A 2PIIA 1FKTA 1CQMA 7FD1A 2UV8G 4YY3J 2MF9A 2VPWB 4JYAJ 1XK8A 5KT3A 1UVNA 2ATCB 4OMFG 2NYIA 3DLLQ 3ZZRA 4ED3A 1LJYA 2XYHB 3DRRA 4OZNA 2YQ3A 1RHKB 3KAHA 3VVUA 4ZIWA 2W9CA 4MSPA 2XS7A 1TL1A 4GVBA 5LMNJ 4MFBA 3OTDA 3NI6A 1YI2S 3AS3A 1NH8A 1F3VA 3W4RA 2CQBA 4B3MF 2JEIA 2GVZB 3CC2S 2QO3A 4WFXA 3NP5A 2EFNA 1FKBA 4MGVA 3I0RB 1WOSA 3O5MA 4YEAA 1NH6A 2R7WA 3Q24A 3SCLE 4JV5F 1O51A 1TVRA 4DZ2A 2LXFA 1R0AA 3QJPA 2YNFA 1PG5B 2B51A 1UPPA 3W63A 1ZBVA 1IJEB 1FERA 1HNZJ 1OIAA 4LFCF 5KG4A 5J6EA 3AFGA 3MMAB 2OEKA 2PEHA 1MW7A 4KGXB 4FZVA 5IC4B 3FY1A 3QZ7A 1ELOA 4I2QA 4RUCA 3PW7A 4F4ZA 2B6AA 4NSBA 4DRMA 3ITHA 1N36J 3FFIB 4ZVSB 1GTHA 1TL3B 4NMXA 3HVAA 3QGHA 4B9MA 3C14A 1NJWA 1VIOA 3DXBA 3W62A 3ARYA 1ZZNA 1JLEA 3CJ3A 5IWAF 5H9EK 3MUVP 4DPYA 3PRVA 3S8SA 4OI0A 3GILA 4J9PA 2WSEC 3BO3A 2QZ8A 2YKMB 4S3KA 2Q1LA 5HN0A 1TKTA 4CCHA 2F7VA 2XPBA 2CJQA 4TLRA 2RJZA 1W9UA 1G1XA 4J91A 1FJ7A 1RA7A 1AA1B 5AT1B 5HP1A 3A3OB 4NLYA 4GIVA 4CH7A 4DF8A 1ROFA 2C2EA 1SUQA 4ZPVR 3HF5A 2R2UA 4F8RA 1PC4A 4USVA 1EETA 3DLKA 1N8RT 1S72S 2FD2A 2LQ5A 4DL5A 3W65A 5GAEU 1FX4A 4DG1B 3GFYA 1N0UA 4Q5VA 3DRPB 3A12A 1NWUA 4ZPTR 2DHXA 3NL0A 5KG6A 4EI2A 1JQGA 2XP7A 1BQMB 3FMBA 3CDWA 2BJ3A 5DM6Q 5LOQA 4DZDA 4WYLA 2IM2A 3W8PA 4H54A 2V50A 1YRUA 1RK8A 2HBYB 2F4FA 3WC0A 2JJ4D 1U4BA 2CRLA 5DIVA 3EE3A 4PEOA 2ACYA 5IT0A 1Z2ZA 4W5UA 2OFHX 4WFBQ 4C8KA 3PJWA 3T6BA 5HI7A 3D0HE 4C0OC 2UVUA 2E5LF 1Q8LA 2D74B 3NCRA 2ZUAA 3MCSA 2XMUA 3NGTA 2E1MC 2W8KA 4HHUA 1WKKA 1FVQA 1G7CB 4R5PB 5A8WB 1MLAA 4ZJLA 4DT4A 4TQRA 5LMUF 3HD2A 2AEFA 2G2ZA 4B9VA 5K5MA 1PBUA 2O67A 5HLFB 3QFHA 5IFMA 4LR9A 4DUZJ 4M5MA 2PC6A 2FHJA 2MKHA 4X64J 1NK9A 4ODRA 1JNTA 2LVWA 1DY3A 1JLGA 4IG3B 4HBOA 2VJVA 2MQNA 3AODA 4FVMA 2XMKA 1HPZA 3CCQS 1RWVB 1HI1A 5E3AA 4WCEQ 2ADCA 1FKIA 3I0SA 2VASA 1RXOB 1B3TA 4DSFA 3ZZTA 3IGVA 4DU8A 2KG1A 2QC3A 2JSXA 1N48A 2C2RA 2HQ3A 3DU5A 1MWZA 3CJKA 3QZ8A 4H4MA 4DR4J 3H2LA 1SKSA 3D67A 5LSRA 1REVB 4ITSA 1F5BA 4I2PA 4OFZA 3EIPA 2F63A 3JXVA 3GPKA 2DGWA 4ZCMA 2GC8A 5B0EA 1VQPS 3QAUA 2RQMA 4M5GA 4P8VA 1GXLA 3DMJB 1UJ4A 3JSRA 3PR4A 2OFNA 1C0UB 3VVTA 2ZBRA 3K5MA 1FEHA 1WSRA 3O5LA 4OJ1A 2FYXA 1R0BG 2DNHA 2CJXB 3DRYA 3FK4A 3L7PA 3HZEA 4X4PA 2XP6A 2BZ2A 1U7LA 4DUTA 2CNLB 2LEPA 4CO2A 1TL7B 3N0VA 4LSNA 2CPFA 3GLJA 4HR2A 4JI8F 4WYWA 1XMOJ 4JI2F 3I9V9 5HROA 3GP9A 4UY8T 1WG1A 1M5SA 1HKKA 1C2PA 2P6SA 1YRXA 3MEEB 5BYRA 2FPHX 1ZK6A 4QR0A 1NXIA 4QYRA 4DQIA 2DHSA 5HWBA 4ECXA 1TUGB 1T3NA 2GGPA 1XRVA 2G13A 2EFQA 3OR2A 1NPPA 3D6TB 4CLSA 2B9YA 4IRDA 3M8QB 2OAUA 5ETVA 2JWNA 3MPDA 4K0KJ 2MQPA 5ADZA 2RRBA 1UVMA 4JB8B 2ZNYA 4XK8C 2LJ4A 4J5OA 2QJ3A 1VHIA 4XPCA 3RBEA 4USIA 4ER8A 5KFEA 2AZ1A 3HT3A 3QSYB 1OYDA 4AY1A 3NOCA 2R7RA 1R8BA 5MAOA 4YB1P 3UE2A 5L9NA 1XHGA 3LTOA 4RW9B 2A18A 3CWJA 5E41A 2JVOA 2AWGA 1VRUA 2DHGA 3SSSA 3MUTP 4TN2A 3ILIA 4V1Ak 1HW8A 3AROA 2Y0BB 3EUNA 3W3SA 2J7UA 1VS3A 3KZ7A 5GAEI 2U2FA 3G6MA 3OT9A 4EYHB 3LGMA 2UUTA 4RNOA 3O5IA 4QQBA 2MZSA 1TKDA 4OI1A 2ZH3A 2AQ4A 1HBMB 3M32B 2X1AA 3HZGA 4K4SA 2G4BA 2R2RA 2V63A 2B7BB 3TEHB 1FJCA 4PWDA 4ALZA 4LFAJ 3HJVA 1SL1A 4J37A 3TARA 3FJ2A 1FKDA 5DDOC 2WSFC 3Q8RB 1KVIA 2VQEJ 3SCIE 3BSCA 4NYZA 1PBKA 3M9OB 3QIPA 4IQMA 4QIEA 3D1QA 3H5UA 2MDAA 1HNWF 4WP3A 3CD7A 2LQJA 2D3ZA 4HACB 4UY85 2DSVA 3R7BB 2XCAA 4N19A 2J5AA 4ZITA 2WVDA 3N6LA 3K7RA 2A6OA 3OL8A 4UUWA 4ANEA 2D9PA 3MMBA 1HBOB 2E5HA 1E6YA 4C8MA 2YPYA 1SJ1A 2KXHA 4ILRA 1HJVA 3HDSA 2YX7A 3GPAA 2ZWOA 2B4VA 1RHMB 3UQIA 3I32A 4KV8A 4DN0A 1U48A 3RM8A 1TK5A 4GVLA 1NO8A 1UTAA 3LAMA 1P9YA 3CDAA 2XNQA 1ZB5A 4I69A 4N56A 2I1RA 4DZ6A 1WSVA 3D4JA 3M6WA 1NKEA 4B3RJ 4WFZA 2QMXA 5A6PA 3CJRA 1EJ7L 4DSLA 2DT3A 2N82B 2P9GA 2UVWA 2OMOA 2HWTA 1WORA 1YSJA 3MWBA 1LWCA 1M1GA 1GT8A 2CG8A 3W9JA 4A47A 3K57A 2H9ZA 3DYAA 1OSDA 1N5YA 2R4FA 1SH2A 4DJBA 5ETQA 3QT7A 4NXMJ 3NLCA 3TANA 2B7CB 5CAAA 5FLXY 1AXQA 2ALYB 1IKXA 3PTWA 3IO1A 5CZXA 3QO9B 3IP0A 4R0XA 5C42B 4A8QA 1RT1A 2BX6A 1JLFA 2QV6A 4LAXA 3IM9A 3CGMA 3M7VA 4DV0F 2B9WA 1PSDA 4ILMA 2BXJA 2RSQA 1Z1ZA 2NYHA 3W2WA 4UQGA 1WEXA 2XY5A 5KFSA 3CCWA 5HQLA 4Z37A 2VQFF 3DOKB 3KUEA 4R8UB 4WPAA 4Z2XA 1JLCA 3H5SA 1NPKA 3B7XA 2BJ7A 2HPUA 1CJVB 3GSIA 4KTQA 1AFJA 3ENAA 3ARUA 2FLOA 2JOQA 3MAAA 1YLXA 2J9CA 1YJ7A 2X1GA 4M1KA 4P72A 5F3ZA 5SZTA 2MGZA 3OBIA 3FUYA 1VRTA 1E6NA 1AZSB 2P6TA 4ED0A 4ZP8A 2C1EB 1DAXA 5HWCA 1RAIB 1V9OA 1TCOC 1LV5A 2NUUG 5HW7A 4FYVB 4H4KA 2VFUA 5IQQA 1U49A 1CBKA 1QM9A 4DRNA 4PQAA 3O44A 2UU9F 1RWKB 1QDUB 4CH0S 5KFVA 5FDLB 2BW2A 5FIIA 3IA0A 1GTEA 2F40A 1HBNA 5KFGA 2KJVA 1GMUA 3BREA 3VCDA 3H5XA 1FKFA 5C7PA 2Q79A 1NJYA 1JWWA 2CJBA 2W9AA 3NGRA 4IFVB 4ZHRB 1MN7A 1OMSA 3UVJB 1VI7A 2JVRA 2PDAA 2XGPA 1FVSA 3ZZUA 3LP1A 2A3EA 2E7WA 3AS0A 3EPGA 2JX2A 4ODQA 1U2RA 4OI3A 2HZCA 5HVGA 4DI6A 2F65A 3DDNA 1J5OA 3K2YA 3RB4A 3L7UA 5DGAA 4J9MA 3MR7A 2MKSA 1JMTA 3OUYB 2N7CA 2IDEA 2FAPA 2H5EA 2PI4A 3G2XA 5JVHQ 1T9UA 1SL2A 2HGNA 4JOUA 5J2NB 2WK4A 4FPRA 4CM0A 1M5YA 2VC1A 3IKDA 1SJ4P 5KAKA 2BA9A 5L1IA 3G8SA 2Q43A 2HQFA 3KJQB 2KFNA 1F5AA 2DNQA 3O5DA 1ZL1A 3D66A 4M5LA 4WE1A 1N0VC 3ZFVA 3WD3A 2DT2A 1X60A 1X5SA 5G4DA 3OXLA 1G6BA 2VG6B 1NSAA 4NLUA 1RKIA 4FNHA 1VYAA 1HNVB 1D9AA 4ECWA 2P2CB 1GK8A 5E0OA 2XMVA 2RDJA 2LQ9A 2IHR1 3C15B 4K4YA 1ZS6A 3I55S 4CO0A 5B8IC 3G4SS 1SQGA 4YMEA 5IC6B 2ZBQA 5D6GA 1HNZF 1C1CB 1FT8A 1YW5A 5DDPC 2D3UA 2ZH2A 5EWEA 4I7FA 5J1EB 2GHVC 4DR3J 1HJWA 5KFPA 2OTLS 1FKKA 1RD6A 1C0TA 1TKZB 5J2QA 1JKHA 1R8AA 1XC9A 3JTOA 3NS5A 2Z58B 2IC3A 4J9UE 4RPFA 1N36F 3B4MA 2ZH5A 3Q8PB 4C4WA 4NCBA 3TYTA 2BE2A 1MNEA 3T5LA 1RTIA 4W98A 2PN0A 1VHFA 4OI6A 3P3DA 5M2RA 2Q6CA 5CQGA 4IDKA 4F02A 1U0HB 2CQDA 2PD1A 3MM7B 3IRXA 4L3NA 2HHXA 1YQHA 2OPQA 4ZJOA 1FDDA 2CYYA 2DO0A 4H4KC 1SKUB 3WQPA 4W9OA 1KOOA 1WHWA 2FC8A 3BSAA 3M1VB 2EC2A 1HNIB 4IH5A 1AUSL 4OZ0A 3BBFA 4TY8B 4GC6A 1IM6A 2CKWA 1JJ2R 1UP1A 2MEWA 3UCGA 4HHJA 3QFWA 2KM8C 1FKRA 3DU6A 5GQBA 4R25A 1O0PA 2V8GA 2DR9A 3OL6A 3CO0P 4WKYA 1OQ3A 1ZTWA 1Q7YT 2MSTA 1Y0HA 1VQOS 4IT6A 2MKYA 1WACA 4I4BA 4OI4A 2ZOMA 2DJWA 1R0CB 3GJSB 5DLGA 4QU7A 4O3SA 4Q44A 2ILYA 1K1QA 1RWNB 4KHPF 3O5EA 1UW9A 3HX9A 3H0PA 2A10A 4LF2A 2MZQA 1S6PA 2WAQD 3MM8A 2VD3A 1KRPA 3HJFA 3R5AA 1F9FA 3GIMA 2YH1A 2OPRB 4R5EA 2ASDA 1NK6A 1T11A 4F50A 2H1YA 3PZPA 4CTAB 6FD1A 1YJWS 3RRHA 3KACA 1MROB 2V5HG 5CXTA 2HQGA 3O2IA 3RUBL 3W66A 8AT1B 4MAKA 3SMZA 5FD1A 3SFUA 1RWOB 4DR5J 4F3OA 4USHA 4DUZF 5H1SV 4DQSA 2R2SA 5D0RA 3AQUA 1KHVA 1K0TA 3NGSA 1QVGR 1BWEA 1NBEB 2OJ3A 4KT0C 3MM5A 4OZ5A 4ZVEA 1M90T 3CMAS 2XZWA 3B4DA 3HI9A 2QEXS 2AJQA 3GSDA 2EI5A 4YB7A 5CYQA 2ZH8A 4OYAA 2F23A 3HT0A 3K5NA 4DWIA 1E15A 1FKPA 5B7WA 2BW7A 3D6HB 2F8MA 4M94A 3LP2A 2BQRA 9RUBA 4CIOA 3QRQA 5J1PA 4A8YA 4MNJA 4DR4F 4U84A 2MQQA 1D0EA 3RR8A 3W2VB 2ZOGA 4DV4F 3S1TA 4WK9A 1XMBA 1YKWA 4EFAC 4KHRA 3U27A 1QJHA 2AU0A 1W2BR 3ISNC 2M8HA 2QMWA 4P6QA 4PG7A 2J0QD 5KT7A 3AT1B 3EVOA 1WF1A 1W1TA 5GMKa 4LAWA 2OLWA 1LW2A 4RU9A 1S97A 4KHMA 4Y65A 2UUWA 1FK9B 4P74A 4JI6F 4RBUA 5LSLA 1VC6A 5L39A 2W24A 1XMOF 2BE7D 3PM9A 5KFUA 2LA4A 4P75A 2V6AA 4DFKA 3F73A 1BC6A 2GVZA 4TW8A 3M8SA 3KUHA 3SQGA 1FJDA 3C46A 3FCVA 5I4MA 4DV5J 3KLFB 3ZZYA 3POTB 2YKPA 2DNPA 1B7YB 3B82A 4XDCA 4K0KF 1X4CA 2XMJA 4LIRA 2HLTA 1NWRA 2Y1JA 2ZD1A 3P8BB 3SSRA 1JXVA 3CDBA 2Q3PA 4Q8FA 2GIFA 4OZ2A 2XI2A 2R8GA 1DQAA 3AH6A 1BXNA 2HYIB 3DLHA 4HDHA 3QJJA 3TAMB 1MMNA 4FS2A 1FFWB 4NLOA 3ALFA 3CDUA 4EZ9A 1QSYA 2WW8A 3FXYA 1Y3KA 5C2CA 4C8YA 3LQVA 3FFIA 2HHHF 2CPEA 4URGA 4FXDA 2MLYA 3HVWA 3QRPA 4M8LA 4O0NA 2CPZA 3EXYA 1XN9A 3HHKA 3G96A 4LAYA 2J6TA 4NXNJ 2PV1A 4CLTA 3WH0A 4HL9A 2GJFA 4CLLA 3OTEA 2KXNB 2L41A 1C1BB 3QGGA 2W4DA 4M5KA 4LRBA 2W2NP 4CLUA 3FRYA 3TAPA 2F3JA 2JLGA 4QCLA 4M5IA 2AJ0A 2BRLA 4LFAF 3DDKA 2RS8A 1K44A 2KT3A 2RAQA 3AJ1A 1YBTA 3NG8A 2GAHC 1N5TA 1N4LA 3HFVA 4OHXA 1X4GA 3IWXA 2LA6A 2FJAB 5A2QU 1I6JA 2C3UA 4ZVGA 3CC4S 1ZBWA 2K8GA 3DOLB 3UFCX 2KYXA 1U25A 4U9RA 4ICLB 1L3UA 1RADB 3CCRS 3BEGB 2DNZA 2C3PA 1YJRA 1OWQA 1KD1T 3J80U 2V2ZA 4DCPB 1S1UB 4K4ZA 2E9ZA 2GW8A 5IT4A 4F4XA 3OR1A 3IK8A 1LL4A 2XYPB 4U8VA 1UFLA 5D0GA 1YDLA 3W5ZA 4TY9A 2M4MA 2L9NA 2R7XA 1ZAXA 3L9ZA 4K5RA 3I82A 1K73T 2PN6A 3MI7X 4Y28C 3CO9A 4MIAA 3BH6B 2ZQSA 2DGSA 2HWIA 2A1BA 3QAEA 2R8JA 3J81Y 4WK1A 2W2QP 4B9TA 4F0HA 3BN4A 3PEJA 5E5NA 1UAWA 3Q8QB 4DV1J 4B3RF 4NEZA 4LMZA 1E6RA 5B08A 3CCZA 1J2VA 4LSLA 2C22A 4OQJA 2LCWA 2K3IA 3BF4A 2UZ5A 4FDFA 5F9LA 5A8WA 2MTLA 2YKQA 3Q8UA 1JX4A 4C3LA 2JEGA 1Q5YA 4A48A 3D6FB 2AYBA 1EIYB 3CGIA 1N32F 4RLEA 1S1TA 3CD6S 3M8RA 4NXMF 2KRRA 3VZIA 4AXJA 1UA0A 2HVIA 1UZDA 3CCLS 1L3VA 2FVQA 3KNAA 4OYXA 3GR1A 3PJ9A 2MPHA 2ZJQQ 4KPYA 1BQNB 5JUMA 2HNDB 2DPIA 4IG3A 1RAGB 2Z57B 2CADA 4S3JA 2D9FA 2NXCA 3MD3A 2J0XA 3DHXA 1YGYA 3JQMA 2AJ2A 2V0NA 4GVBB 3CGNA 4MFBB 2WLZA 3UNYA 1FKAF 4OX9J 2HEKA 3VGSA 4FKYA 3OJSA 3HCXA 2YTCA 3UN3A 1TV6B 1Y5LB 4P2FA 2YQ0A 2HIQA 4BWMA 3MR2A 3T5KA 3QMQA 3B8SA 1V3RA 1TK8A 3CCJS 4F2RA 4V19J 4RUHA 2A2CA 2LDYA 4CP5A 3GFHA 3QBCA 2P5VA 1R0AB 3A4TA 8ATCB 2L2SA 3RMEA 1VK3A 1MMLA 2YNFB 3N6MA 2KFWA 1C0UA 3QT6A 2QFJA 3V6DB 2XM3A 1WC0A 2J6UA 3I4PA 1SJFA 2ZH6A 2NS1B 1B7FA 2RURA 1V5IB 2KDOA 4ETZA 1S1VA 2BJ8A 2FDNA 4J9RA 4KE5A 1TL7A 1HHTP 2UP1A 3HHLA 2HQCA 3T1YF 5DETA 4EO6A 1Q5VA 2ZVIA 4ZCLA 3ITHB 5FJ4A 2FLPA 3BR8A 3MEEA 5A76A 3C14B 2JDJA 1G3OA 1UR9A 4CNYA 1JLEB 5A8RA 4LF7J 1FDBA 2WSCC 4GO7X 4X2BA 3D7SB 2ERRA 1X8DA 3VAIA 2W2PP 3MCOA 2ZM6J 4ZP7A 2MXYA 2HVEA 3ZO7A 1TKTB 1ZA1B 4FPIA 1LFWA 4MPKA 3FZ2A 4ILLA 3H9RB 1B70B 2DH8A 1KQFB 3PFEA 4DRKA 4J9SA 4O2TA 3GIRA 3I5BA 3V2UC 1HKJA 1SUQB 1Y00A 4B3TJ 1WC5A 3WIUA 3H2UB 3EDRB 2W9BB 1A9NB 1EETB 1RAJA 3FCHA 3DLKB 1HQUB 1L3SA 2IVMA 3LO3A 1K8AT 5BXJA 5MLCV 2RB7A 1S9EA 4WF9Q 2E7VA 4O3QA 4MIWA 4A46A 5L38A 3OLBA 1HMVB 4CDIA 2XWYA 1ICEB 2QX0A 5B0CA 1ZYQA 3JB9k 1XBWA 1FWKA 3L95X 3R9LA 3GV5B 4B9SA 3R2CJ 5HBFA 3UN2A 3K17A 1ZM3A 2HHQA 4B9UA 4LGXA 2O92A 3PX0A 1HWLA 4J4NA 3M9MB 3FDSA 1KTQA 3MTJA 4DWSD 4RNFA 4DR3F 2CG4A 3O5RA 2Y8YA 2YNGA 3HHEA 1U79A 5K8MA 1XR6A 2FHKA 3B9AA 2V67A 3MURP 2QLWA 3DI6A 2O5DA 4LVOP 1YATA 1TKXB 2QLBB 4Y6IA 4P10A 1VBYA 1M1KT 2CQHA 5KT2A 4DF4A 1JJCB 1NMVA 2FLLA 1V5VA 3O8WA 4PWWA 3T6JA 4EBEA 2DK2A 2FKEA 2QF8A 3KK2A 3K5LA 1JLGB 1FTCA 4YDXA 4PXBA 4R0JA 4P7VA 1FRMA 1PJ6A 1Q8BA 1JNZB 1NJIT 1HPZB 4DCOB 1WEZA 5D4PA 3I5AA 1F2GA 4FN2A 2I8EA 3I0SB 3EX7B 5HQ8A 3QLHA 2M1IA 2LDIA 3CJSA 3HHLC 2XQCA 5F8NA 2YQ1A 1IJFB 1TMMA 2RT3A 3BKFA 4A8FA 3IC1A 3FZBA 5HJYA 2KXFA 2R42A 2HK2A 2IVFB 3UO0A 4D3GA 1LW0A 1FKHA 2V9WA 2M0GB 2VPYB 4I2PB 2DY1A 2RMLA 4Y2MA 2MKIA 2UXDJ 1T95A 4P7TA 1FFQA 4CT9A 3AXKA 5L8RC 2V8DA 2HFOA 4MKBA 2G0JA 1MSWD 3H42A 4B02A 1X31C 2AD9A 1K1SA 4WFNQ 2XZDB 2JZVA 3DHWC 2Z2ZA 2DSUA 2HVHA 1XMQJ 2KVQE 2C2NA 4EU0A 2DYAA 1S59A 5H9EJ 3J7A1 4Y0FA 4TU8A 4YR3A 3HPOA 2AZ3A 3BGFA 2CQPA 3RFWA 3DOKA 2AEJA 1NCLA 1BGXT 1RBLA 1D7IA 2Q66A 4P71A 2GGPB 2KGJA 2VBZA 4DR5F 3OR2B 3WL1A 3D2WA 1VK8A 1Q95G 3MMCA 1W25A 4JV5J 2FTRA 5GPGA 2EFPA 4PYAA 4L72B 4K2XA 2EKYA 3V81A 1H98A 2AYMA 2OTJS 3Q2TC 1U1NA 5KFZA 1TR0A 1GMWD 4P8WA 4DQPA 4LFCJ 1RT3B 3FSYA 4HVZA 3ZTPA 1PO6A 5FDLA 2HW3A 1HW9A 2XG8A 1KVKA 3S01A 1CG2A 2V9KA 3B6BA 3O5JA 2Y9HA 3TWZA 4FXVA 1U09A 1CEZA 1U1QA 5ETOA 2YWKA 3NMAA 4LBHA 4UZBA 3H90A 4LRDA 1J4IA 5HMWA 2BKOA 3CCMS 2E9TA 3O5PA 1H3DA 2GA7A 1JLBA 3IN5A 3OUYA 5HUAA 3I6PA 3FBEA 4NI2A 1B6CA 1GXTA 1VR6A 1T3OA 2GJIA 3LW5C 4NRTA 2DG3A 2HBQB 2R2TA 2JEJA 3CULA 3GFZA 1MWYA 2I0XA 3QIPB 4CLFA 3IS9A 2MKJA 1HFEL 5KFLA 4HARA 2DG9A 2MZRA 2EVZA 1W9VA 3O5GA 1SQEA 4ECSA 4URIA 2BM0A 3M2UA 4OZJA 1M5KC 3TI0A 3W60A 2MZTA 2XSJA 3KHGA 4IOCQ 2XP8A 2KH9A 2VBWA 2M7SA 4ZCIA 2VG6A 4F4AA 1ZBTA 4J9KA 3MMBB 4F4WA 1E6YB 3TZZA 3TAQA 2EG2A 1E6ZA 1UVLA 2V4JA 2BDPA 2ATLA 4KV8B 4KQZA 3MFHA 2W8LA 2VFRA 4KB7A 4C02B 1KQGB 3M2VA 2YXLA 1C1CA 1J27A 1VQYA 2E5LJ 2ZOFA 2K1RB 2RIJA 1EIBA 1HQEA 1LG2A 4I0WA 1DTQA 3R5GA 4JI4J 3CCTA 2MQLA 3TQEA 3DLGA 1UL3A 2ZITA 4NCGB 1A0OB 1O5JA 4I56A 1CS4B 5I3QA 3DYAB 2F4VJ 4YFUA 4ED6A 1N5YB 4ODOA 5D3GA 3UI5A 1TELA 2MYFA 3PEHA 1UWBA 3PY8A 3LWLA 1RAAB 1O6IA 3KHLA 5D0EA 4KO0A 2VKZG 4F26A 3OXGA 2K8IA 1OY6A 4DRQA 1IKXB 3DDIA 4U85A 5IS2A 4RBVA 4Q7AA 2HZAA 3CJ0A 1RT1B 5KFWA 1IUJA 2IYIA 1IBCB 3R6LB 3U1NA 2HFSA 2IA0A 1PINA 1PYTA 2RHSB 4ECYA 2IBOA 3UW1A 1VC0A 4TY8A 3W2WB 4K2JA 2V2QA 1Q53A 1SI9A 4ZPBA 5KFMA 5E3RA 1IBLJ 2MKCA 3JTNA 1JLCB 4BWJA 1RTDA 3WD2A 5CYMB 3EMTA 1RAOA 1SC3B 3MAAB 4GKKF 2QA2A 2MJUA 1R6VA 1JNEA 2HKEA 3WQWA 1NDLA 2MGZB 1WC3A 1KTVA 1H74A 3MAQA 2MLXA 3IHZA 1B0PA 5HK4A 1P1LA 2PI5A 1VBKA 3KJVB 4PZVA 4TU9A 2J7KA 5LT5A 3F41A 4NLGA 3IM8A 4NZ6A 4DV1F 1UJ5A 2IDLA 2DPJA 2VPXB 3U1MA 4XTTA 4CLWA 3ALGA 2PV3A 1GX6A 1X5TA 2HRYA 4BS2A 2HZVA 2WB4A 1NHUA 4CTAA 1NUEA 4DX7A 1UZHA 3GYGA 1WDDA 4QJVA 2KM8B 2H4YB 3ODKA 1LNQA 4MKVA 3W5YA 3N6NA 1W1VA 1P6TA 1RUSA 1GFWB 5KFOA 3IFEA 3VGVA 1R8CA 3PR9A 3NNHA 2WCXA 1RLDA 3KLEB 1QUPA 2CXEA 3LP1B 3VTIA 5E3PA 2NZ4A 4X4VA 2DCUB 5LXRA 4G1IA 4YR0A 3AHPA 1DZ5A 3UI3A 1J5OB 1RT7A 3C6UB 3X3UA 3MR5A 2HS3A 2KHDA 4ED8A 1HL6A 3V6JA 1VDHA 2FHOB 4DV2J 2BVZA 1EP4A 4OX9F 2NXJA 3MHYA 1XTZA 4MJKA 1TAQA 3M6UA 3G6XA 3EZ5A 2IY5B 2LU1A 1TP7A 1PIEA 2WK2A 4Q43A 3PDNA 4F0KA 3JS9A 1SC1B 5CCMA 2ZC3A 2IJFA 3WHIA 5IOLA 4PAAA 4DQRA 5L1JA 1APSA 5KG5A 1SYTA 1UMJA 1JCHB 1FESA 3FCWA 4ODNA 3NBPB 4I7FB 5ETRA 4QOTA 4C11A 4WP8A 2Y1RI 3OFFA 1TZ0A 3UI4A 2R8HA 1C0TB 5J2QB 1JKHB 1TUVA 2RUGA 1ZCNA 5D75A 5E7OB 3VQTA 2IC3B 3GB0A 3HMJG 1REGX 5F8LA 5KFBA 3I96A 4IFYA 1NB2A 4QIGA 3MPVA 2DNKA 2KN4A 4J9QA 4TVAB 1RT4A 2BE2B 4LF7F 1NZ8A 2YBTA 2CJKA 2BJ9A 2YH0A 3HFZB 3JTPA 5KFDA 3BYPA 4LBIA 4IDKB 2CFXA 1S77D 3IRXB 2FVSA 1I94F 1S1XA 1CC7A 1LL6A 2RF2A 2OPQB 2VICA 1FKJA 1SH3A 2D69A 5LJ3Y 4Q0BA 1U1KA 2DT0A 2HFUA 4CO4A 3BBCA 4OYIA 4B3TF 1KWMA 2XY6A 3BBBA 1FXLA 5DDRC 6FDRA 1RACB 4H4OB 2I2YA 4NLXA 2KR7A 2F8HA 3BXWA 3D1OA 4EZ6A 3TAMA 2QRRA 2ZHAA 3ET6B 1V3ZA 4ZMMA 4A8MP 2CWXA 5ETPA 1FDNA 4YDDB 3JYMA 3A1YG 3T1AA 1RLCL 3ZXWA 1CPZA 4N76A 1JLAB 3T41A 4K4WA 2HK3A 1P9QC 5IXUA 3N79A 1TQLA 1VFJA 4TYAA 1B0TA 4DR6F 1CULB 4LVNP 4EEYA 2DBBA 4CZCA 4N7TA 2CUYA 4G3IA 3JXOA 4PG8A 2FJVA 3OOBA 4W9PA 5T14A 1RBAA 4R0EA 5RUBA 4IO9Q 3KTQA 1SVDA 3UR3C 2PE8A 4FYWB 4A8SA 1S6PB 4ECRA 1RTZA 3MM8B 4IRKA 2VOOA 2VOPA 3UN5A 5EDWA 3S7RA 4FS1A 5ETNA 1LL7A 3QJLA 2DGQA 1VQ5S 3ZZ0A 3FQLA 2XLIA 2Y1IA 1IWGA 4M95A 1GX5A 3EVMA 4ES1A 4YUDA 2RU9A 2VQFJ 4WKRA 1UPMB 1WWHA 2K2PA 4JV1A 4ICLA 2ZJPQ 1SC6A 1NJXA 3GG0A 1S1UA 3GIJA 4NEYA 5BR8F 3BDPA 1X4DA 4OV6A 2O66A 2R8IA 3G87A 1CLFA 1U2FA 1Q8IA 3MM5B 1ZBKA 1JXLA 3QWUA 3MDFA 4DROA 1Q1KA 5HO4A 3B9DA 3IXQA 3OL9A 2XSFA 3N5FA 4ZN1A 1VBXA 2RILA 3AJDA 2C2OB 3O5OA 2HHWA 1Q8KA 2ZQTA 4JI1J 1WOOA 2HLUA 3TZYA 1FKPB 1S49A 4Y2AA 4OHZA 3LP2B 1K9TA 4Z7YA 4O0IA 3E01A 2W2MP 4URQU 4Y2CA 4O44A 4XO0A 3R8YA 4DCJB 3FRZA 1S9GA 1C9HA 2ZBIA 3CHFA 4NASA 2YNHB 2DR6A 3RZAA 1D9DA 4M5JA 1HKIA 4OX6A 2HFZA 1RAFB 3HK2A 2F2DA 2UXDF 2LMIA 1E44A 4Q22A 2BM1A 3JYTB 1IN0A 3VV2B 3HP6A 3R1LA 5ETLA 1BQNA 3BQ0A 2QGFB 5L1KA 4LF4F 2HNDA 2YVSA 4C3MA 1KT0A 1LW2B 4DR1F 3H2VE 4EBDA 1JK9B 4ZPCA 3KABA 3PV8A 1FFGB 1EKRA 2DTJA 4HT7A 2PPNA 3K0JA 1XMQF 2C42A 1YVFA 3MECB 5A8KB 3Q86A 4HYKA 2ZDPA 4HTIA 4WXOA 4Q7NA 2WVEA 1GNKA 3M2RA 4MT1A 3MGJA 1VGYA 1TV6A 3AOCA 3SQGB 5CA5A 2F9DA 3BPDA 1CJTA 1N6QA 3THTA 3DN9A 1DLOB 3SXLA 2VG5A 2OPSB 2WZ1A 1DRZA 4DL7A 3SI8A 3ARVA 5AXLA 3CF5Q 3IR5B 3M9NB 1T9XA 2ZD1B 2QT7A 3V6DA 1VQ4S 2VHGA 4QBUA 2RU3A 1KDNA 1U6BA 4PG4A 1FXRA 1FJEB 1TL5A 1Q86T 4ZS6A 3PACA 1PAEX 5CZVA 4PQUA 3AB4B 3RTVA 3CD5A 2CQ0A 4U67Q 1I1GA 3KXDA 3M8PA 1HNXJ 2HHSA 4DIPA 4S0MA 3P4UB 1BKFA 1KP6A 5KT5A 3NGKA 3AS1A 4KR0B 1S6QA 4JI5J 1QAXA 4USJC 2V4RA 1J4RA 1EQ3A 4OYZA 4G6VB 4JI7J 2DHAA 2UUBJ 3CHEA 1UR8A 3VGTA 2G8ZA 1DQ8A 4C98A 3MAHA 3RRKA 3D28A 1FWLA 3GWCA 4OJ3A 1VQSA 2WONA 4N8OA 1QVFR 4WIIA 4X66J 2LXIA 4J90A 5DQGA 2R7QA 3NTPA 1ZM4A 2B4UA 2ZVSA 2JFDA 3HSZA 2BANA 4RJVA 2W9BA 1HQUA 4RNMA 2XMWA 4P2MA 1NEEA 5HBMA 2IMWP 3TJAA 4ZVFA 4JYSA 3MZIA 3FEYB 4ED4A 5D8HB 1HMVA 1IKYB 3OR1B 2KU7A 2EFVA 3FBBA 1JVWA 2MQMA 4ZVQB 3BGLA 4OIXA 4HDGA 4KHPJ 1JJ4A 4I6YA 2KG0A 1YWXA 4EYIB 1FEEA 1RT2A 2DKOB 4NOHA 1U1PA 5C25A 3ZNJ1 3GG1A 2AGPA 2RRNA 4JI4F 5HMZA 4LSLB 3H25A 1WI6A 5AXKA 4UTGA 2FJWA 3HKZD 4XIUA 3VAHA 4KRWA 3E8OA 4PXEA 4GGQA 1IM4A 5IV3A 4EGLA 3OFEA 2F4VF 1TKXA 3KLGB 1HBUA 1RHQB 1S1TB 3MMJA 2KT2A 1NNDA 2P4VA 3A8IA 1T05A 1S57A 3NOGA 2FGOA 3RBDA 2LKZA 1ZAVA 3JYJA 5C2GA 2ITKA 4M63A 3IMQJ 1L3KA 2W01A 3DXSX 3CJ5A 1HHQA 1RABB 4ZDNA 4MH8A 1QE1A 2VA2A 4HH1A 1HHSA 1NHKL 5D4OA 2BQUA 3M30A 2VFSA 3U7JA 3MEDA 1J4HA 4UOGA 3RYLA 5I42A 3PKYA 1Q1CA 1VISA 4C0BA 3CCSS 4U96A 2V69A 1T03B 1OO0B 4CO5A 1IBLF 4I64A 2WRMA 4ZPWR 1LWEB 1SKRA 4IT4A 4NLDA 2E1CA 1AW0A 1RU1A 2XEXA 3TA2A 4DH0A 2AT1B 4HH0A 4DV4J 3KAFA 3KLIA 3T9ZA 2HQIA 5CYJA 1LEOA 3I31A 4U86A 3GQCA 2AOSA 2NLWA 2NQPA 2B8PA 3VAJA 3IR6B 4X62F 2V8PA 4JV0A 5F8HA 4K4TA 5HT1A 2YNIA 2Y0SD 4RW4B 4ODLA 2C3MA 2Y78A 3RJMB 2DGTA 2DR5A 3QT5A 2IRXA 2HG4A 1S1VB 4JI6J 4NLWA 2K06A 1AUDA 3HHLB 3PW0A 2ZEJA 2YPZA 2RUCA 1IKWB 3PIOQ 2VDIA 2IF4A 4V19X 5A8RB 3GJTB 1NDCA 4QIWD 3R5CA 4ECZA 4ZVPB 1CJUA 4KY3A 3J81U 2KFZA 4WU2A 2IRUA 3CZ8A 3AA8A 3O5TB 3UPFA 3GIIA 1H0HB 4DX8H 2PEBA 2ZNZA 1T8EA 1AROP 1YJTA 1E6VB 4MK9A 1MN9A 3N9UC 3AXMA 4RNNA 3HVTB 5G0RB 3ZC4A 3NAIA 3A8EA 1FDAA 1FRLA 3CUNA 4DV2F 3G82A 1ZETA 2EWHA 1RT3A 3EY6A 3GJRB 1S7IA 1S9EB 1WKJA 2IUZA 5E3CA 4HBEA 3AAWB 4PKDB 2HHHJ 5KFIA 2F1FA 2XHWA 1SV5A 4DL6A 1SPBP 2JLEA 2D3OR 2AMCB 5KFKA 1HI8A 4P2SA 5IM0A 2J9EA 1YX2A 4NPOA 3AOBA 4ATNA 1YJ9S 5D78A 2HRTA 3O6QA 3J7YU 2KO1A 2DHHA 4EK2A 5C5JA 1UW4A 2CWKA 2V68A 1QZ2A 4L74A 3BO4A 4DHVA 2V94A 3CIZA 5AE3A 5EWGA 2JRSA 1KEKA 1TFVA 2BEFA 3BYRA 5L9XA 2YNGB 3R3TA 5D77A 5F41A 1UJ6A 2B9XA 3BKUA 4A8OA 2V34A 1NJZA 2CPIA 4PTMA 2CAJA 3TX0A 4RUBA 2HMIA 2VFVA 3DI6B 4J9OA 1Q6IA 3KK3A 4WJBA 3KJNB 4OL8A 4EO8A 2HFNA 4ANDA 1VRQC 1RT5A 3D3CJ 1WUUA 3VALA 5KOXA 5L46A 1KN6A 2DNYA 1XIQA 3CIMA 3JSMA 1RWPB 2GNKA 1N33F 3EGNA 3KK2B 3W7BA 4DXLA 5D0HA 1QPFA 1KKHA 2VONA 2RKIA 4DSEA 5M2UA 4ZLNA 2RQSA 4MYUA 2EK6A 3BGOP 3SV4A 2EEYA 1FXDA 2AKWB 2W4PA 2JC0A 4TNOA 4O4GA 1BE4A 2DNMA 3OVBA 1P1TA 2PPOA 2A2DA 4K7QA 2R7VA 3PG9A 1ZZFA 2K1RA 3H8YA 3QLHB 4PPDA 3G6VA 4O3NA 1IR0A 5J2PB 4LF5J 3NCPA 2KJWA 1VQLS 3QSIA 5K20B 3K89A 3PNIA 1EZZB 5AE2A 3BN7A 4NCGA 3CJQA 1CS4A 1LW0B 1JNSA 2N87A 1RTJA 3PHEA 1R27B 2A6MA 2DO4A 4QU6A 1N32J 1OY8A 3W61A 2LU2A 2D41A 1HA1A 2P9EA 1RGVA 1WOPA 2ZUGA 4NCAA 2PI6A 3ZTQA 5AXNA 3D3BJ 5M2PA 4DPTA 3MPWA 1E9LA 4B3SF 3N4WA 3C2PA 3MTKA 4UOHA 4ZPAA 3PFOA 1XEZA 4FBTA 4NLQA 4NLSA 2FVRA 5IT9Y 3UCZP 1UVJA 3PW2A 2KTQA 4L6V3 4NZ7A 2BACA 2LQ8A 5A6WA 2GQ2A 3TA0A 5CYMA 3IKGA 2DGXA 1S9FA 2HHUA 4RW6A 3EJMA 3MMCB 2PA8D 3KAIA 4LRAA 2WTFA 1VLOA 3OFHA 3P96A 3LGHA 1KFSA 1IQTA 3KWMA 5AXMA 5BYSA 3V81B 2BMBA 2ZJRQ 2CNKB 2CDQA 1RQ0A 3VAMA 3AOAA 3Q8YA 3KJVA 1IBKF 1IVZA 2FGCA 4MNKA 5GPRA 4JI1F 3MDYB 3KK1B 1RISA 3TZXA 3J80Y 2HSEB 4Y2KA 2L3MA 4FKXA 2WBRA 1LFPA 1EQMA 1RYSA 1ITPA 3T1YJ 4F36A 3PYFA 4Z2KA 5K14A 1FO1A 3ADAC 1U6ZA 3Q83A 4X4QA 1X0FA 2E1RA 1N88A 1NK7A 3NY0A 2FZKB 2NUHA 2X7IA 2LFVA 1RAEB 3TZWA 5ITHA 2F5GA 3R6GB 3KLEA 2NSBA 2QLFB 2JLFA 3RB6A 3GYXB 3KLHA 2PT0A 2G9OA 1RYRA 4ZP9A 2O01C 1JLBB 1ZH5A 3C6UA 3C3LA 2M88A 3G6ES 4NI2B 1D7HA 5F8JA 4ZVTB 3D5MA 3PYEA 2DT9A 1LXNA 4CO3A 2CVEA 3J7YI 1KHWA 4LF8J 3I6CA 5KG3A 3IS9B 2RQ4A 4DUYJ 2XS2A 1U8SA 2UXBJ 1Y5IB 2XWXA 1SQFA 3UD3P 2HVDA 2EKNA 3M2UB 3G9CA 1S7HA 5DLFA 1NZAA 2IMOA 3AB2B 4C8OA 4DOZA 2XSJB 3HVRA 4IKAA 3RAXA 1NSGA 1BMQB 1WJ9A 3DRXA 5K8OA 1H7WA 4UW2A 4DL4A 2A3AA 2PPPA 2V4JB 2QLXA 2QL7B 2FLNA 2LXUA 3DLEA 2VCDA 3ZTSA 4USWA 1CTNA 3NBPA 4X4OA 3M2VB 2EW9A 3SQOP 5GMEA 1R8PA 1HWKA 1HQEB 3DM2A 1F2HA 1DTQB 3C16B 5ETSA 5F8MA 2E7XA 3PX4A 3TUZC 3DLGB 1U45A 1F40A 3QYYA 3PXGa 1HNXF 2BRKA 4U95A 1TTHB 1B64A 3DGPA 1WKLA 3OLAA 4P2XA 1XJWB 2E5JA 5D3GB 1K9MT 1F6TA 1QAYA 1UWBB 1JNDA 4JI5F 4OX7A 3KG0A 5DG8A 3BQ2A 4QIFA 4ODMA 3S6EA 3BMBA 3OSPA 4KO0B 4TQSA 4JI7F 2MMYA 4NZ0A 4DFMA 2UUBF 3ZZOA 2Z2MA 2ASJA 4NX9A 3PRBA 3SIPB 4QYZK 1Z4UA 3H7HB 1S99A 4ZIVA 4XPEA 4NL5A 1L5UA 1SL0A 4J7CA 3RRGA 4KC5A 3RU0A 5K9FA 4X66F 1S6UA 3ARWA 1U26A 1VQMS 2B31A 2G1HA 4G50A 4E98A 3F0NA 4Z2LA 4H4OA 1M0SA 1XR5A 3V5RA 4TXSA 1SJRA 2KFYA 2J76E 1EB0A 1RDRA 3ET6A 2JNJA 5DZ6A 4A8WA 2KKHA 2KB2A 3IWNC 1RTDB 4DRHA 1JLAA 4RU2A 3DKDA 3M6XA 2HURA 2DRDA 3TUPA 3BGUA 3ELHA 4FAPA 1CJKA 3NRBA 1N52B 1HIYA 1CULA 2W7AA 5EN1A 5KFJA 4ERDA 4F0MA 1R43A 2ZH1A 1FI4A 4AL5A 4CT8A 5F8GA 1Y11A 3TNVA 3R27A 1F1BB 4EUVA 3A8JA 3EZUA 3WL0A 3DGVA 3OW2R 3CXCR 2MLZA 4ZLJA 1VIXA 5EUHA 4QW9A 2WB1D 4HHHA 4TKTA 3ENVA 1BWVA 3AD8C 3CVKA 2COLA 4ML4A 3BV8A 3R5DA 3CJ4A 2DR7A 3FSXA 3GJQB 3B78A 4KYZA 4LIWA 5KT4A 2DNGA 3K8WA 1ZU8A 1H2UX 2DITA 1QAJA 1RWXB 1D3WA 2KE0A 3MXHP 2KYZA 3GZ7A 1PJ7A 3AA9A 3VGUA 2ILZA 1RT7B 5LJ5Y 1WTFA 3IR7B 4C48A 5JXSA 4ZVHA 2Z2YB 5KOWA 1S79A 2BKNA 4CLYA 1XERA 5DG7A 3CB4A 5F8IA 1EP4B 4OYPA 3K58A 1Q0NA 5JVGQ 1OGBA 1DURA 2CQGA 4JI0F 3HO1A 4X4RA 2ZHBA 1J5EJ 5CHCB 4JFMA 4ELVA 2PMWA 2W7PA 2BV3A 4QIVA 5B0BA 1YJUA 4YOEA 2VC0A 2YNHA 4KSEB 4G65A 4J9NA 4OYMA 1CVJA 2YWFA 5HTGA 1NMEB 2B5JA 1NH7A 2NREA 4LRCA 2EFGA 3PO4A 4F2SA 2FY8A 1HR0J 4WIWA 1X9SA 1C4CA 3KDNA 3AY0A 2LEBA 1UWAA 2CPYA 2XZTB 1HKAA 4ZLLA 3JYTA 3MM6B 2C3OA 3G8TA 3E3XA 3M4XA 1R7IA 3RW6A 4EWTA 1RSCA 4YS2A 1NSKL 4C11B 1W2IA 4RW7A 1WHXA 3B8HA 3MECA 2NZCA 2WVFA 5A8KA 2P8IA 2NXNA 4Y3CA 3HHDA 2QSFA 4KPCA 4IFYB 4USUA 1S4EA 1FA0A 3IBCB 1YG0A 3KG1A 1RT4B 4FYXB 1ZM2A 2XCPA 3W1YC 4CNZA 1CSJA 3L4BC 1UEUA 3VAGA 1DLOA 1O6XA 2PFFB 4K8RA 2ZQUA 2OPSA 2DPEA 1RJJA 2ZZNA 1S1XB 2RF2B 2DY9A 4RZRA 4MK8A 1RBOB 5HANA 1KR4A 4Q0BB 4B08A 3O5KA 3FBCA 2I6WA 2KZZA 2DGUA 1ZAWA 4N8NA 4W4MA 3PW5A 2BABA 1E6PA 3BB5A 2DEJA 1WNOA 1LKZA 2AWZA 3ARSA 1F60B 2V2KA 3LH2S 2Z8QA 1GQEA
chains in the Genus database with same CATH topology
1QM9A 4DRNA 4PQAA 5KFQA 4KAIA 1KLNA 1HJXA 4DQRA 1VJWA 3O44A 2UU9F 4AUKA 4RUAA 5L1JA 1APSA 3LWMA 2BJDA 1KNZA 1UA1A 5KG5A 4DEZA 4CH0S 5KFVA 1SYTA 2OMLA 4WKAA 1LXJA 5FDLB 4WFAQ 4AL6A 1UMJA 2BW2A 2AJFE 1FESA 5FIIA 1S1WA 4ES3A 2ROEA 3WD1A 4NLRA 4IG0B 3IA0A 4K50A 4ODNA 1X7VA 2GO9A 1GTEA 2F40A 3NBPB 1HBNA 1URRA 5KFGA 2KJVA 2IA6A 2AX0A 4OHYA 1YITS 4ELTA 3BREA 3VCDA 3QO9A 3BDEA 1RKJA 4I7FB 3H5XA 1FKFA 5C42A 1UFWA 2Q79A 4QOTA 1NJYA 1JWWA 4LAVA 4C11A 4GC7A 5BJRA 2DR8A 2CJBA 2W9AA 2Y1RI 1LWFA 1QTMA 3OFFA 1EYMA 3UI4A 1TZ0A 2QSWA 4IFVB 1C0TB 2FJEB 4ZHRB 4JFIA 2R8HA 3SZ2A 4DL2A 5J2QB 4X4NA 1JKHB 2PBCA 1TUVA 2RUGA 1ZCNA 4FF1A 3I5CA 2I9SA 5D75A 4LSNB 4UQTA 5E7OB 2UUAF 1VI7A 3VQTA 3VF0B 2IC3B 2JVRA 2PDAA 3GB0A 3HMJG 2XGPA 1FVSA 3Q2SC 3ZZUA 3LP1A 2A3EA 2VUGA 5F8LA 2A3CA 5HROB 2E7WA 2F8EX 3AS0A 5KFBA 3OJUA 2OP5A 2M8DB 2W4CA 3EPGA 1Y3JA 3I96A 2JX2A 4ODQA 1U2RA 2HHTA 4IFYA 2DNLA 2YX4A 4OI3A 3KLVA 3K59A 2HZCA 2V8VA 4QIGA 3MPVA 1KQSR 4YHHF 2VH7A 2DNKA 2KN4A 5A0YB 3EYZA 4J9QA 1U1OA 1RT4A 1CQNA 2BE2B 3DDNA 5J1NA 1J5OA 4MKAA 4LF7F 2G1DA 4R8UA 3K2YA 3K5PA 3RB4A 2YBTA 4BC9A 2GHPA 2CJKA 5DGAA 2UUCF 2LPVA 4J9MA 2MKSA 2IM3A 2YH0A 1JMTA 3OUYB 2N7CA 3JTPA 2FAPA 5KFDA 1CC8A 2H5EA 1GAOA 1Z2LA 2EBGA 4FVCA 2PI4A 3PJXA 3TUJC 5C24A 5JVHQ 4IDKB 2CFXA 1SL2A 2HGNA 4NLVA 2KT5A 4JOUA 5L1LA 5J2NB 1S77D 3TVYA 2APOA 3IRXB 2WK4A 2FVSA 4TU7A 1I94F 4FPRA 1S1XA 1CC7A 3UQBA 2FC9A 5F0WA 1LL6A 2RF2A 1M5YA 2VC1A 2OPQB 2IM0A 3IKDA 1FKJA 1SH3A 3RB0A 4DWSA 1SJ4P 3CC7S 5KAKA 5LJ3Y 4N5SA 4Q0BA 2BA9A 1U1KA 2DT0A 5L1IA 3Q0AA 4CO4A 3G8SA 2Q43A 3UI6A 2KFNA 1F5AA 2DNQA 1FJGF 1Y9OA 2A3BA 1V6HA 2DNNA 3O5DA 4NYPA 2CPDA 3FGVA 3TVZA 1ZL1A 2JC1A 4B3TF 2XY6A 4WE1A 1FXLA 3D0GE 1N0VC 3ZFVA 5DDRC 3WD3A 1N34F 6FDRA 3HHLD 4WTYA 2DT2A 3VAKA 2K3KA 3OV7A 1T02A 1X5SA 4ODKA 5G4DA 4H4OB 4KFBA 3OXLA 4NLXA 2YWGA 2I2YA 1IKYA 1G6BA 2KR7A 2VG6B 4ELUA 4K59A 1MU2A 2AP6A 3MEGA 4G1QB 4NLUA 2F8HA 1RKIA 4FNHA 4ZKAA 3BXWA 3D1OA 2XNRA 3I56S 4EZ6A 3JAMY 2WBMA 3TAMA 1Q81T 1R3NA 1Q6UA 2YY3A 2HGLA 1HNVB 2IVYA 2QRRA 1D9AA 2ZHAA 3VR1A 4ECWA 4ZMMA 1V3ZA 2QA4S 3UQAA 4A8MP 5E0OA 2XMVA 1FDNA 4YDDB 2RDJA 3JYMA 4KGKA 5HKGA 1VMBA 2IHR1 2LQ9A 3A1YG 3T1AA 2RS2A 5KFFA 2ESCA 2DISA 4K4YA 4UUXA 1CPZA 3I55S 4N76A 4CO0A 3ZZPA 5B8IC 2CPHA 1JLAB 3G4SS 1IX5A 1P8GA 4K4WA 3DNCA 2AW0A 4YMEA 5DRKA 1S0MA 1P9QC 5D6GA 1HNZF 5IXUA 2LGOA 1C1CB 1FT8A 3N79A 1YW5A 2WLYA 1VRUB 5DDPC 1JXEA 3KKFA 2L9WA 3OTBA 1VC5A 2FUG9 4OZLA 1TQLA 4JFJA 2D3UA 2ZH2A 1VFJA 4TYAA 5EWEA 4I7FA 5J1EB 1B0TA 3WQVA 3V4MA 2CPJA 4TW6A 2GHVC 2K7JA 4DR6F 4LF5F 3CCES 2RDIA 2IAJB 4LVNP 4EEYA 2DBBA 4DRIA 4CZCA 1HJWA 5KFPA 3E01B 2OTLS 1FKKA 1RD6A 1C0TA 4IFVA 4ZHRA 1TKZB 3OTCA 5J2QA 3ULHA 4X4UA 1JKHA 1R8AA 4G3IA 1XC9A 2CVIA 4PG8A 4O44B 3JTOA 4C8NA 2FJVA 3OOBA 3NS5A 4W9PA 5T14A 2IC3A 5IQ6A 1S9GB 3SSQA 4AE5A 2ZZMA 1KOHA 1N36F 4PPZA 4R0EA 4IO9Q 2HHVA 3KTQA 3B4MA 3UR0A 1Q4RA 2QYCA 3KLGA 3UR3C 1BL4A 2PE8A 4A8SA 2ZH5A 1S6PB 3Q8PB 1YIJS 3TDBA 4C4WA 5A0YA 4NCBA 2E9RX 4ECRA 3MM8B 3TYTA 2BE2A 4IRKA 1MNEA 2VOOA 2VOPA 3QGIA 5HMXA 3T5LA 4OLOA 4PWDB 1RTIA 4RWXA 5EDWA 2GMLA 3S7RA 2OFGX 4FS1A 4HTJA 2ASYA 2CIMA 1VHFA 1J6YA 4OI6A 1LL7A 4MIBA 3QJLA 2DGQA 3P3DA 5D4NA 1VQ5S 5M2RA 3ZZ0A 3HKWA 4DR2F 4A4JA 2KHCA 3FQLA 3IG1B 2O1PA 2XLIA 2Q6CA 5CQGA 4IDKA 4F02A 1FCAA 2CQDA 2Y1IA 2PD1A 3MM7B 1N56A 5J2NA 4M95A 2ZQVA 1GX5A 3IRXA 4KIAA 4ES1A 4YUDA 2ALZA 4L3NA 1W26A 2K7KA 2RU9A 3G6YA 1U47A 1YQHA 2IRYA 2HHXA 2DH9A 4WKRA 2OPQA 5CH7B 5JH8A 1FDDA 2CYYA 1WWHA 2K2PA 1F5CA 4JV1A 4ICLA 1DTTA 2DO0A 3N5BA 4H4KC 4O3RA 3H98A 2X1FA 1WHYA 4W9OA 1ZBCA 4YB5A 2ZKTA 3SCKE 4KKOB 1EHNA 3UF8A 2ZJPQ 1KOOA 1WHWA 2FC8A 3G86A 4Y34A 4FF2A 1SC6A 3BSAA 3M1VB 2B0GA 4FYDA 1FKSA 1NJXA 2J6SA 3GG0A 1KONA 3X1LB 1S1UA 3GIJA 4Q8EA 1HNIB 4DV5F 4I6AA 2RQKA 4IH5A 4DLGA 5BR8F 3BDPA 1X4DA 1YJVA 2O66A 2R8IA 4FBUA 1CLFA 4OZ0A 3V4IB 4IQ2A 4TY8B 4G1QA 4GC6A 3M2RB 4DL3A 1T03A 3FQKA 2CKWA 1JJ2R 1U2FA 1Q8IA 2FB0A 3MM5B 1ZBKA 1JXLA 1HNVA 1HWUA 1H0IA 1UP1A 3QWUA 3UCGA 2RD5C 3MDFA 4HHJA 4KBIA 4DROA 1Q1KA 5HO4A 2KM8C 3B9DA 3IXQA 1LWEA 1SR0A 3B9EA 3ENQA 4F3MA 1FKRA 4DSIA 3OL9A 2XSFA 3DU6A 4Z2IA 4NZCA 1RWUA 1NU4A 2HRUA 3N5FA 2RH3A 4MMOA 5GQBA 4R25A 1O0PA 1WD6A 2V8GA 3FEXB 5KG1A 3QOKA 3RAMA 1VBXA 2DR9A 2VG5B 3ARTA 4WFYA 1GXUA 3OL6A 3QPIA 3BJYA 2RILA 1OQ3A 4WKYA 2FJXA 1ZTWA 1Q7YT 2MSTA 1DFDA 4FF4A 3O5OA 2P9CA 2HHWA 1Y0HA 2ZQTA 2VBXA 2HLUA 3UDCA 1NWSA 1VQOS 4IT6A 5EGYA 1FKPB 1S49A 2M70A 5J1EA 4IOAQ 3TO8A 1YTYA 4Y2AA 4OHZA 1WACA 2W25A 3LP2B 3P49B 4I4BA 2OD6A 4RW8B 4OI4A 2ZOMA 5E2QA 2AGQA 2GJ2A 1M5PC 1ITXA 1K9TA 2UVVA 1YBAA 3E01A 4O0IA 2DJWA 4URQU 1TKZA 2AV5A 1GOIA 5DLGA 1X9MA 4Y2CA 4Q44A 5HMYA 2ILYA 4O3SA 4MAVA 2R9LA 1K1QA 2F9JA 4KHPF 4N47A 4H4KA 3O5EA 4O44A 4XO0A 2ZHOA 3FRZA 1UVIA 1S9GA 4RW4A 1C9HA 2YKNB 1FRJA 1LWCB 2ZBIA 3CHFA 4IO1A 2YNHB 3O5QA 2WHOA 3RZAA 5SUHA 3HX9A 5F3TA 2A10A 2MZQA 1S6PA 2WAQD 1S0NA 1D9DA 1HKIA 5CCLA 4OX6A 3MM9B 3MM8A 2KZZA 2VD3A 1X5PA 2HFZA 2CQ4A 1KRPA 3NNCA 2KO7A 3HJFA 3R5AA 2WOMB 1F9FA 3RB3A 3GIMA 4PQUB 2YH1A 2RUQA 4R5EA 2OPRB 3HK2A 3CE8A 2F2DA 2ADBA 2OSRA 2ASDA 4PXDA 5B0AA 4HI1A 2UXDF 1NK6A 1QUVA 4ED1A 4DWSC 1JB0C 2LMIA 1T11A 4Q22A 4F50A 1Q82T 5U47A 4ZPDA 5DF0A 2BM1A 3M8PB 3PZPA 3JYTB 2BOPA 1IKWA 4CTAB 1IN0A 1VQ7S 3IG1A 2Q6BA 2YWHA 4HI2A 3HP6A 3R1LA 6FD1A 4NXNF 4Y00A 1BQNA 3BQ0A 1YJWS 2RNEA 5L1KA 3RRHA 4ETXA 3MM7A 4LF4F 3KACA 2HNDA 2POKA 1MROB 2V5HG