4QZVB

Bat-derived coronavirus hku4 uses mers-cov receptor human cd26 for cell entry
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
208
structure length
208
Chain Sequence
TECDFSPMLTGVAPQVYNFKRLVFSNCNYNLTKLLSLFAVDEFSCNGISPDSIARGCYSTLTVDYFAYPLSMKSYIRPGSAGNIPLYNYKQSFANPTCRVMASVLANVTITKPHAYGYISKCSRLTGANQDVETPLYINPGEYSICRDFSPGGFSEDGQVFKRTLTQFEGGGLLIGVGTRVPMTDNLQMSFIISVQYGTGTDSVCPML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bat Origins of MERS-CoV Supported by Bat Coronavirus HKU4 Usage of Human Receptor CD26.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/viral protein
molecule keywords Dipeptidyl peptidase 4
total genus 41
structure length 208
sequence length 208
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.70 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4qzvB02
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4qzvB01
2AJFE 3SCIE 4ZPVR 4KR0B 4KQZA 4L72B 2GHWA 3SCLE 4ZPTR 3SCJE 4ZPWR 4ZS6A 4XAKA 5DO2A 4L3NA 3D0HE 4QZVB 3BGFA 3D0GE 3SCKE 2DD8S 2GHVC 3D0IE
chains in the Genus database with same CATH superfamily
2BOAA 1WC0A 4J90A 5SUHA 2BOPA 1MG7A 5L39A 3DDNA 5D3GA 2E1MC 2X3DA 1H98A 2QEXS 4X4OA 1PGZA 3X1LB 4MJKA 4OYZA 4B3OB 3W9HA 3G2XA 3THPA 5C42B 3AQUA 3NAHA 3OTOF 3MAHA 2M2AA 5LMNF 4MAVA 3IXQA 2EBEA 4RW6A 5AE3A 3GQCA 2P6SA 3CNQP 1KKHA 1MWZA 3CCZA 1ZETA 2EFVA 4EZ9A 2U2FA 5KFTA 1YJ9S 4IQXA 5ETOA 2W8KA 4MT1A 5ETKA 5LSOA 4LSLB 5J2MA 3V4IB 2J9DE 1X9MA 2DXFA 5HP1A 4DV4F 3KNAA 4DR7F 2P9EA 2DGOA 2WVCA 3MM8B 1HJVA 2DB1A 5KG4A 4RBTA 3PO4A 2VODA 3G9CA 5F8MA 4OL8A 4CTAB 1XMQF 4AY1A 3MCSA 4ECWA 2AGPA 1S0VA 2EFOA 5H9FJ 1M1GA 5B0BA 3L3CA 4Z2IA 1X4BA 1JKHA 5A2QU 3IR7B 3MAQA 1N5TA 4ODNA 3F73A 2R7SA 1T9VA 3MR2A 3MR6A 5L1KA 4O3SA 1VRUB 2B31A 2PPOA 1TKXB 2NXJA 1H73A 3S7RA 1N5SA 1RTIB 1VS3A 2CPZA 3R5GA 5I3QA 1NK7A 1ZU8A 1S1UA 4JI3J 2B8PA 1YBAA 1ZA2B 2IYGA 5ETRA 2IIHA 3AB4B 5HATA 5A0YB 5E2QA 2CQ3A 2V69A 4PKDB 4DSJA 3OHAA 1CJUB 2ESCA 2L3MA 3TJAA 2XMAA 3HK2A 4ED5A 2GMJA 5DZ7A 1RZMA 4DRIA 3R5JB 4M5JA 5D15A 4OJ1A 2RH3A 1U6BA 1EAYC 2N3LA 3RAMA 2AEFA 2WVBA 4P8XA 3MMCB 3BV8A 5C7PA 4I2QB 1FERA 1EHNA 1O0PA 1X5TA 4NYPA 5HTGA 4Q2LA 4UZBA 3IN5A 4F3QA 1R7IA 1SI9A 5HAOA 1G3OA 4YB6A 2RE1A 4Q5VA 4DRQA 2R2RA 1QAJA 4GKJJ 4WFZA 4L72B 1A6LA 5C2CA 1HNXJ 1V3SA 1NWTA 3R5DA 4DQQA 4JI4J 1UJ5A 2CFXA 4LF4F 3MM6A 3M4XA 5A8KA 1TKTB 1FX2A 3FY1A 5HSPA 2KU7A 4LSNA 1NM2A 2XSFA 4ICLA 1VF8A 3M30A 1HYSA 1R43A 4KPYA 2JVOA 3GFHA 3VGVA 3KHLA 3RR7A 2B4UA 2Y9HA 1WF1A 3O5QA 3MOJB 5D3GB 1T9TA 1JX4A 1RT5B 2FY8A 5BR8F 3MMAA 1EETA 1X8DA 3KAHA 4WJXA 1ZM9A 1JNRB 3A13A 1HBUA 4LF5J 4FF3A 3DGPB 3DOKA 1W1YA 1ZBVA 3D54A 2YH1A 4DZDA 1MU2B 3UCGA 4L73A 1REVA 2CQHA 4F0MA 1R8CA 2M70A 2KT5A 1TFVA 1GEHA 2I9SA 2IVMA 3U1LA 4CT9A 1FKDA 2J0WA 5AJ3F 3AA8A 3OTDA 3SMZA 2ZM6J 1FKSA 1LJYA 3CO9A 4PXDA 5BJRA 4A8XA 4GKJF 2LDYA 4M5NA 4DN0A 4OZ2A 4K4UA 2XTJP 5IXUA 2KXHA 1FNOA 3PTWA 2ZBCA 3CULA 1JXVA 4TYOA 2M2BA 4M94A 2OEKA 4B3SJ 4QYZJ 2AJQA 4ED0A 4KJIA 2MZRA 4JFLA 2O1PA 3CCRS 5LM7E 5LT5A 3IRXA 1PILA 1YZ6A 3THTA 1FX4A 5I4MA 2M8DB 1A7GE 2YXLA 1LW2A 4WWSA 2EFGA 3KUGA 4KV8B 4CNZA 3GILA 5KG5A 3BJYA 5DG7A 4MMOA 5B0FA 5DLGA 2HBRB 4LFCF 5E3RA 4YB5A 1YHQS 3WD0A 1QPLA 1C0TB 4M5DB 2E5GA 2MQLA 4GVBB 1SC1B 2J9DA 1FXRA 1FAPA 3U7JA 5L9NA 1E6PA 1NK5A 3B7XA 3CCLS 4JV2A 4MIBA 3T6BA 5A0YA 5IS2A 4X65J 2V6AA 4BS2A 3NY0A 2EG1A 3HULA 3PNIA 4IYQA 3TZXA 2MMYA 4NCBA 2QG9B 1ZB5A 4FYXB 3R7SB 2GVDB 2WB4A 3R7NB 1VRUA 2QFIA 3PEJA 1EZZB 1REGX 2DNKA 2J7KA 2W25A 2AMCB 2W4DA 4GO5X 3LP1B 4L3KA 1RT3A 2F21A 1HI1A 2N7YA 2OPRA 5K8OA 3HHNB 4W9QA 2V2ZA 2MKYA 3KKFA 1EP4A 2UUWA 3DKDA 4CIOA 2K7KA 1I3OB 5DLFA 1VQ8S 2VFRA 5KFCA 1Q81T 1AYEA 3E01A 5CHCB 4GVLA 2WONA 1YG0A 1WNEA 5K8MA 3WC0A 5HK4A 3OHBA 3ADAC 3LF0A 3MD1A 4JFIA 4H54A 4A4JA 3FSIA 4LFBF 3B9EA 3NXZA 2BX6A 3K5MA 4Q0BA 5ETQA 3UNYA 4DLGA 3G82B 3IBFB 2HSEB 3C16A 1Z4UA 3TUIC 1TAUA 1XR5A 2Y3YA 4ECXA 3VVTA 1NSPA 2KI2A 3CMAS 5J2QB 3TA1A 3IS9A 4ZCMA 1RBAA 2B4VA 3AFGA 3KLGB 1HWIA 4IR1A 1EJ7L 4GC6A 3OFGA 1NMEB 4CDIA 1GXTA 4TU9A 3SSSA 4OZNA 1F60B 3CUNA 1TMMA 2RAQA 3H4DA 1Q6HA 2ZH7A 2VQEF 3DLKB 1IBCB 4X62J 2IHR1 4DFMA 1HWUA 3PEHA 3BYRA 3P3DA 1HWLA 2G9OA 1ZAWA 5EUHA 5E7OB 4WK3A 1GMWA 4PG5A 4ZP8A 2YKPA 1U48A 3EE3A 4DV5J 1IBKF 1WOPA 2JWNA 1MMLA 2E1RA 3D3BJ 2QLBB 4WKHA 2FHKA 4NA1A 4UT4A 4TY9A 3H40A 3VV2B 3MMBA 4AQYF 2DNQA 2Y8YA 2UUCF 2HVEA 4IQMA 5L1IA 2KRRA 2BYCA 2F63A 3SCLE 4NWBA 1JJHA 4DEZA 1IKVB 2J0QD 4GKKF 1RDRA 2D74B 3DRPA 4EU0A 2UUBJ 4DV6F 4B3TF 2UV8G 5AXKA 2VJUA 5KFPA 2QGFB 1Q79A 4NSBA 2VFUA 3M2VB 4MK9A 3VAKA 1I94F 3ILOA 2W9CA 1W7WA 2HWTA 1J5OB 1JLBB 2FZCB 3HSJA 2R7UA 4WIIA 1YI2S 4RNMA 4QU7A 1OSCA 3O5IA 4M1KA 4M5MA 2FZGB 3AQOA 3NCPA 1S57A 1EIBA 4MFBA 4DR3J 3TP2A 4E2FB 2YKMB 1EYMA 1Q1KA 3MTJA 4KBIA 2MLZA 3SXLA 3TUPA 2UXCF 2QL5B 2XSJB 4DX6A 3JYTB 1CG2A 5DDOC 1R0BG 4YOEA 1QDUB 3BO4A 1UWBB 4P2FA 2ROGA 1RWKB 2HFSA 4IOBA 4EK2A 2O01C 3G87A 3THVA 1WDTA 4IFYB 3MM7A 3GG1A 2W4CA 4P75A 1WI8A 5D75A 5J1PA 2HIQA 1K1SA 3IWNC 2ZBQA 1FRKA 3FKBA 1ZS6A 5HL7Q 2WK2A 3Q8RB 2CQ2A 1RAEB 3Q2TC 1EQ3A 2E5IA 4NYZA 3MUTP 2B4PA 1RISA 2VFTA 3EPIA 4DV3J 2E9TA 3MZIA 5CABA 1SUQB 1K8AT 4NXNF 3VAJA 4KT0C 2BE2A 3LWMA 5E3CA 1EB0A 2VA3A 4WU2A 3W63A 3MECB 1F3VA 3B54A 3SCKE 2L41A 1NJZA 3M9MB 4NCGA 3TEHB 3KHRA 3PA7A 3K5OA 4LAWA 4P7VA 3FEXB 4TLRA 1SV5B 3GWCA 4G1QB 4Y6IA 2B7CB 2B9WA 3UN2A 3G6ES 4ECSA 5DIVA 4PWDB 3Q86A 4OZ5A 4Y65A 4DR6F 4F3MA 1DQ8A 4O44B 3QSYB 3T9ZA 1A9NB 3DM2B 3LP2B 2CDRB 3PYEA 3GTYX 1P9YA 4PXCA 4QR2A 2KTQA 2RNEA 4Y28C 4USIA 1KFDA 3AQPA 3WHIA 4CH0S 2IMWP 1S6PB 2ZBRA 4RUBA 2QN6B 4YHHF 3M6XA 1S9GB 4HYKA 2VL1A 2UV8A 3M8SA 1NSGA 2KH9A 4AQYJ 5C25A 2CVIA 1S1XB 1FFQA 2QE5A 4KGXB 1PINA 1FE4A 4KSEB 1RTJA 5F0UA 4DQRA 2DCUB 4AUKA 1K44A 1G6BA 3HHDA 4R0JA 2CPHA 2UXBJ 1RD6A 1H7WA 2I8EA 3HKZD 3IBWA 5KFOA 4WZMA 1U49A 1CJVB 1TUVA 1N36J 1CVJA 1WD6A 1H2VZ 1NEEA 1UEKA 1FJEB 1X6NA 2KFWA 1WNOA 1ROUA 1GFWB 1LFWA 2WSFC 2PIIA 4ZVFA 3QJLA 1FWLA 2R7VA 3I0RA 2HNDB 2QFJA 4LGXA 4BF8A 2DH8A 1PAEX 3AJ2A 3BS9A 2AZ1A 1RT7B 2GQ2A 4DH0A 4HEA9 2HWIA 2V68A 2HHQA 3CD7A 4K0KF 2C3OA 3CCTA 3BH7B 3HMJG 1EDQA 1NJYA 4ZN3A 2MEWA 1JVWA 1V5VA 2C2MB 1WAWA 1OPZA 1SIZA 3BH6B 3KXDA 4IH5A 4Q2MA 1HWJA 2VFVA 3B8HA 3VZHA 1S6OA 1BQNA 3NGDA 4DR1J 2RRAA 3CB4A 2QT7A 2GV1A 3BGFA 3EVMA 1ZTTA 4WU3A 2H4YB 3VALA 5KFLA 4JFMA 1HKKA 2E7WA 4KE5A 4JI6F 4EZ6A 3O5GA 1ROTA 4IPXA 2DO4A 2VC0A 3MM5A 3R1LA 2WSEC 1DZ5A 1ZK6A 2U1AA 4QR0A 3FCWA 1RQ0A 2ZHOA 1KR4A 2JZ5A 5HBMB 1VQ7S 3QIPB 2FVSA 3P6YC 2NYHA 3LP2A 1TTHB 4LRCA 4ENOA 3RMEA 3RM4A 2CG8A 4C0OC 2BW2A 2CAJA 2COLA 3F56A 4WYLA 3ILIA 2CPJA 2F2DA 3CJSA 1FRHA 1VJQA 2QMXA 1W9UA 2RB7A 4PQAA 4ANEA 5KFKA 2FLPA 3B82A 1B6CA 4U9RA 5KT2A 2JEGA 3I0SA 3NGRA 2OELA 3W65A 4DHVA 2R8HA 2R7RA 3RAXA 3G96A 3C6UA 3ILLA 1EIYB 3DU6A 3O5PA 2O5DA 4TN2A 3V6JA 4FS2A 2BMBA 4UUXA 2PEHA 3F44A 2YX4A 4DPYA 3TQ1A 2YKQA 4LFAF 1BHNA 3HZEA 2B9EA 3H2UB 4HR2A 2YPZA 4FYDA 1FDDA 3BBCA 2G1HA 2BE9B 4DR5F 2IC3A 3M32A 4F67A 3GJSB 3QZ8A 2HMIB 2JSXA 1NH8A 2HQ3A 2Y1RI 3PCOB 4TNOA 1UKUA 1HWKA 2ZBIA 3FCVA 4TY8B 3E3XA 2UVWA 1R8HA 1RWNB 1JLEB 2E5JA 1Y11A 2KHCA 3EJMA 4IFYA 1DBDA 2MQPA 3FGVA 2EC0A 1RTZA 2HAIA 1CC8A 3K89A 4DRJA 2DCLA 5CYMB 2BVZA 3CC7S 3FMWA 2F8HA 3ZZ0A 1WORA 2DT9A 4DCJB 2MQQA 1XMOF 2PO4A 2XP8A 4JI2J 3SIPB 1B4SA 4B9UA 1M5YA 1FE0A 5DITA 4NLWA 1HFEL 1U8WA 4WP9A 2RUQA 5HJYA 4MNKA 4ED1A 1K9TA 5HI7A 2ZQTA 2ZR5A 4QZVB 1KP6A 3FVYA 3BGOP 1RU2A 3MTKA 1UTAA 2AGQA 2KVIA 2QYCA 3OXGA 4C3KA 4DFJA 2O92A 4LR8A 2BQRA 2HHWA 2HGNA 1G7CB 4J9LA 3NEKA 1U1KA 1RYRA 3PW0A 5D0EA 2VQFF 2AWZA 3DRPB 3ODKA 3IP0A 4K59A 4J9NA 2CJBA 1C1BA 2IJRA 5KFIA 2FLLA 1F2GA 3HT3A 3HJFA 4HVZA 2BM0A 2YWKA 4FNIA 1W25A 2JLGA 1HNVA 2YX7A 2FLOA 1HNZJ 4QU6A 4YY3F 3QGPA 2W7OA 2YNHA 3DCAA 3JS9A 4RW4B 1SQGA 1P8GA 2DEIA 3W60A 4MIWA 4ZOSA 1FFGB 4DV2J 5BXJA 2LVWA 3RB4A 1JLAA 1EETB 3KG1A 2RKIB 2KI3A 6FDRA 1VRTB 3GIMA 2MNTA 1D9FA 4DQPA 3IKDA 4MNLA 1HW9A 2CXEA 2NS1B 3L7OA 1TR0A 1CBKA 1WSRA 4P7TA 5B0CA 5A8WA 2B5JB 2LA6A 1RWOB 2AKWB 3H8YA 2OFNA 3U27A 2V63A 2VDIA 4F04B 3ET6B 2WM0A 3PJ9A 4F0KA 4P2SA 1E6VA 5KFEA 1NCLA 4DL2A 4URSA 5HROA 2JVRA 2YQ1A 4FDFA 3KYLA 2ZJPQ 3K0JA 2G13A 1JCHB 1ZYQA 2CG4A 1SL1A 1UVMA 1TV6A 1HD0A 2O67A 1VBXA 2D1CA 4LR7A 2QYGA 5FD1A 4DDFA 3OSNA 4I2QA 4RW7B 4DL7A 2EI5A 3LGHA 2VKZG 1UZHA 5KFYA 1T03A 4AL5A 1AW0A 2AEJA 2HGLA 2ZDOA 1RAAB 1UEUA 1D6OA 1WEXA 2H65B 2IJNA 2NLWA 3G86A 2YKAA 4KHMA 2AX1A 4TLQA 3BDEA 3BKTA 1J27A 2FJAB 4WXWA 1UJ4A 2HVDA 4C0BA 3ZZOA 2KYXA 2GO9A 2JH3A 4NLXA 2HYIB 3EYZA 5L1LA 3CD5A 2CJQA 2AV5A 4WE1A 1SH2A 3GIJA 1S6UA 4FBUA 4QOTA 4HACA 3MFHA 3ISND 2UUTA 5IM0B 3RUBL 1H74A 2BJ1A 3DLLQ 1RCXB 2BQ3A 2D69A 2IVFB 1NZAA 3GJQB 4M5DA 2XCPA 3IRWP 5CQGA 3Q0AA 2OI2A 3MR3A 3NMRA 3GYNA 2X51A 3G6LA 4A8QA 4B3MF 4C8YA 4JYSA 4UTGA 2DGUA 2DPEA 1CJKA 1VIOA 3PX4A 4ELVA 2AJ1A 2ZQUA 3MM8A 4RUCA 3NI6A 2XWXA 5KFFA 2Y1JA 3UFCX 4NLGA 2FC9A 4MIAA 5KFJA 3QBCA 1RAGB 3O5FA 5HP1B 4ITSA 3IA0A 4W5UA 2F9DA 2HVZA 3QAUA 2KFZA 5FLXY 1WC1A 2IM2A 1RWWB 4IKAA 2XMJA 5D0HA 2RIJA 2IAJB 4FF1A 1F1BB 1HNVB 3ZC4A 2ZFHA 3MEEB 4ODQA 2AX0A 3CPWR 4JI5F 4HL9A 5KFVA 4DUTA 5HUAA 4N7TA 3MFIA 3EGNA 5LJ5Y 1BQMB 2W7AA 5E5NA 5FIIA 5IQQA 3VHQA 4B3OA 1YBTA 1NWUA 2J6SA 2C2ZB 1W2IA 1ZOTA 3LUYA 3OTEA 2XZWA 4J4OA 2MQNA 3H98A 4CLWA 1QTMA 4PWWA 2ZJQQ 1JWWA 3FBFA 3MMAB 5D4NA 3OXFA 1K47A 2FB0A 5H1SV 3US5A 2PGCA 1K1QA 3RGIA 1M5SA 1E6ZA 3MM5B 8AT1B 4ZIWA 3JYTA 3PVXA 3M7VA 1W2BR 2CQBA 2YQ3A 3DDIA 4ATNA 4ECYA 2W9AA 1RT6A 4ILRA 3CDWA 3DMJA 2EEYA 1D7JA 1S99A 2H5IB 1RWUA 2RRNA 3GLJA 4S3JA 4OQJA 3LOUA 1FESA 4OHVA 1S72S 4JUZA 1DARA 1BMQB 1I51B 1I1GA 2L9DA 2CADA 1JJ4A 1TQLA 8ATCB 3EMTA 3CHDA 1TELA 4OIXA 3D1HA 5HO4A 3NNCA 4N77A 1RBLA 4ZIVA 2KG1A 2D9FA 3WKZA 3OV7A 3N6LA 1RKJA 1QVGR 5IT9Y 1VBZA 1E44A 1Z2ZA 2Q1LA 4OJ3A 4ZJOA 3AA9A 4O3QA 3G6YA 3CCUS 1M5PC 2AU0A 3DLEB 4HLBA 3BKUA 3BSNA 1SQEA 4L75A 1C1CA 2EXUA 2ZQSA 2XI2A 2YWHA 2A6MA 4DMZA 2JL9A 5JUMA 1U2CA 3M8QB 2CUYA 2ZHAA 2FAPA 2RILA 2DPJA 1F9HA 1HQEB 2XULA 3R7BB 5HANA 1OY8A 2EBGA 4I6WA 2CQCA 3MEDB 1MMDA 3A1YG 4NYOA 2RQCA 3RBEA 4DSKA 2DGSA 3DOMB 1HR0F 4X64F 1CJUA 1R8PA 2YPYA 3C6UB 3R2CJ 2NSCA 4KH1B 2DSVA 2YNIA 2VBZA 3OTBA 2PI4A 5THWA 3ZZPA 3EX7B 3PFOA 2DR5A 1FFSB 1S1UB 3Q8UA 3H25A 1T9WA 4LF8J 1FI4A 2CVEA 4IH7A 2HLUA 1S6PA 4H4OB 4I7FA 2PFFB 1RB0A 4UOCA 3KLGA 4PZVA 5K14A 2AWGA 2KFYA 2L2SA 1UVLA 4DPXA 2K8IA 3VGTA 3KLHA 1TL7B 3NKYA 4JV1A 1WHYA 2AYEA 5RUBA 4CLTA 4DR4J 1P9QC 3T5KA 1LW0B 3QJPA 2D3ZA 2KT3A 2FHOB 3CDUA 1UWAA 2P9GA 3DI6B 4ZVUB 3QRQA 1EHWA 5KOWA 1N54B 3GCXP 2KXNB 1YITS 4IUFA 2HBQB 4G1QA 3BO2A 2F4VJ 2KYZA 2VPZB 4I56A 1FKIA 4ODRA 2X1BA 4CRJA 1IXKA 1J2VA 2DR6A 3BN4A 4A8YA 2HFVA 2DG4A 2OPSA 1ITPA 2RD5C 5D78A 2LA4A 4DV1J 4P9SA 3OW2R 3HI9A 1PSDA 3SFUA 4C8OA 4X2BA 5D8HB 4I64A 2GIQA 3M8QA 4RWWA 1WG4A 3MDYB 2BJDA 2HQIA 2P9CA 4ZPVR 2HQFA 5B0AA 5DQHA 3OLBA 2P8IA 3OVSA 1S76D 4NLPA 4RR5A 3HFZB 3RR8A 1CULB 2WZ1A 2ZOMA 3UVJA 3UI4A 1U2RA 2GQQA 4USWA 1NSAA 1J4HA 1FWKA 4DU7A 4K4SA 1FD8A 3UDCA 3P8BB 2AGOA 1WKLA 3OFEA 3OLAA 3QWPA 3AROA 3CGMA 1XR7A 4OLOA 5HMZA 2ADBA 4QIGA 3QOKA 2OFHX 4PXBA 4RPFA 4U8VA 4RU9A 3H5XA 1H3DA 1XQIA 3K2YA 2E5HA 4FNHA 2QLFB 3CXCR 3CT9A 3O2IA 5J1EA 4PCQA 4O2TA 5KFMA 1WTBA 1L3UA 1S9FA 1OYEA 1U09A 4K50A 5KFWA 2CPDA 5J1EB 2XS2A 3HPOA 2D3OR 1CEZA 2YTCA 4F4KA 4U8YA 1V3ZA 2XHWA 2UZ5A 1JJ2R 4X4VA 1DTQA 4TW8A 3C14A 3PJWA 3T5LA 4U84A 2W9CB 4GRSA 3KOAA 3N0VA 5CYMA 5B8IC 2MZSA 4LBHA 2CJ9A 3Q8SB 2H4WB 3M6VA 3I96A 1S6QB 3FXYA 1VQMS 5JJBA 2XLJA 3FRYA 1WC4A 2MQOA 1HPZA 2ILZA 4EBCA 3HJVA 2IYIA 4DZ6A 4TU7A 1MROA 3D4JA 1FT8A 3TO8A 2LEBA 1SH0A 5KT3A 4DCOB 4W4MA 2X1AA 2ASDA 2HMIA 1I6JA 3MEEA 3N6NA 2OMOA 4OX9J 1RHMB 2C2NA 5L9XA 1URRA 4H4KA 2ZKTA 3WIVA 3T1YF 1SL2A 3RZAA 1HBUB 1AFJA 4AXIA 2OPSB 4DL3A 2VF3A 3CW2C 3I4PA 3MPYA 3JYJA 1T05B 2OSQA 4CI0B 3AXKA 4UF4A 4EGLA 5KFAA 1P1TA 1OPIA 2EKYA 3PRVA 2B6AB 3MF5A 4U85A 2HS4A 1Q82T 2BDPA 2N87A 2KB2A 2CZ9A 2RSEA 2CQPA 2Z57B 1IR1A 4S3KA 2LYVA 5FDLA 3KCEA 3RRGA 1YJUA 3R1HA 1NSQA 2VPYB 1L3KA 4I68A 4DV7J 1XMBA 4IDKA 1SYTA 3G71S 4JB8B 2KM8B 5KG1A 2H5JB 4B3SF 1HMVB 4NLOA 3ZFVA 3BQ1A 4CZCA 2QA2A 1S97A 2RQ4A 4JFJA 2IBKA 4DV0F 3VTIA 1WELA 1HHSA 1N5YA 2F8MA 4ZCIA 2XP6A 2XP9A 4KGZB 1JLGA 1HI8A 4F4WA 4FS1A 2WHOA 2V8PA 3H5SA 1M5OC 2PPPA 1T95A 1VBKA 3DOMA 3M8PB 3E01B 1D7IA 1VC6A 3BSOA 4HDGA 4F4XA 3CJ3A 1SB6A 4RUHA 2VA2A 1HQEA 4C4WA 4WJBA 1JLFA 1WOOA 3ETMA 1FHTA 2DNMA 3PHEA 1XNQJ 2E29A 5DF0A 4EWTA 5IV4A 1N0UA 3R9LA 2OD4A 3DRSA 1YQHA 2DNRA 2ACMA 3M8WA 1NK6A 2RT3A 4AYBD 1NWSA 2CIMA 3GCWP 3IG1B 4EBDA 1FKPA 1ITXA 1LWEA 4KH0B 1Y0OA 3A8JA 3TRGA 2P4VA 3WD2A 5K8PA 3T3FA 4K4TA 1E6VB 1Y7PA 2ZVIA 3WZ0A 1S77D 3WIJA 3OL6A 1T8EA 2MPHA 5JH8A 1LWCA 2J8AA 4CO0A 5SZTA 1T7PA 4W90B 4HI1A 3UCUP 3B8SA 1Q1CA 2BEFA 1JNEA 1JK9B 4WK1A 4XO0A 3TI0A 3EGVA 4CO4A 3EZUA 2H48B 1ICEB 4OI2A 2E5LF 1ZH5A 3P5BP 3RB3A 4HBOA 4DRNA 2PMHA 2XMMA 2LKNA 3WQPA 5HVHA 1QSYA 5DRKA 4JV0A 3U02A 2ZZNA 1GX5A 4CLKA 2QX0A 1N6QA 1GPFA 2EULA 4DWSD 1FDBA 1MN9A 3V4IA 1XIQA 2DGVA 4ML4A 1F3FA 3C16B 5CZXA 5D0RA 1HNIB 4A8WA 1NZ8A 4P72A 5BYSA 2DNYA 3ARUA 5HKGA 4ZVGA 1WC3A 4HBEA 2GGPB 4QIEA 4YP3A 1BQMA 3GV7B 4ZPWR 1UW9A 4Q0BB 3I5CA 4YS2A 3JSMA 1VQ6S 2NREA 4WKFA 1DTTB 4Y0FA 3ARSA 2FHJD 5I98A 2ZVSA 3IAM9 1NHVA 3W1YC 1BY9A 1KLMA 2GQCA 5C24B 5HQ8A 1U1RA 2PEBA 1X4AA 5F8JA 3DGVA 3ITHB 3LUOA 5F3ZA 3DOKB 1HJWA 2WVFA 3QLHB 2VONA 4NZ6A 1KQSR 2H9ZA 3CJQA 1HA1A 4MK7A 5I42B 3GIIA 4ECRA 1IBKJ 1VQ9S 2J6TA 2CZVC 2VG6B 1APSA 1FKOB 2OKQA 5GADU 2BJEA 3I6CA 3KK2A 4QIFA 1J4RA 1OJ4A 3G8QA 1IBMF 5F8LA 1B7YB 1WHVA 4ETXA 4ZP7A 2DTJA 2XGQA 2UUBF 4X4RA 1IKWA 4CNYA 2K3IA 4V1Ak 1IBLJ 3W7BA 2UXDJ 4HH1A 5CCLA 1ZTWA 3AXMA 1FD9A 1LL4A 3BSAA 2OTJS 1E9LA 1HKIA 3I82A 3HLUA 5ETSA 3OOBA 5L38A 2CPYA 1N32J 3IC1A 1IWAA 1SJFA 3VVUA 3L7PA 2WTFA 4G6VB 2GAHC 1EARA 3R5BA 1RACB 3AD8C 1WEYA 1VC0A 4NXMF 3J7A1 1N33J 3QAEA 1JXEA 2F8EX 4ZLNA 4LF7J 4DWSB 4DBQA 4ALZA 2G0CA 3A8IA 2IUZA 2VOOA 2QIFA 4O3PA 4P73A 2C1EB 5E41A 1AXQA 3BBFA 5DIUA 4QQBA 2LU1A 3DLGB 2CA9A 2VUGA 4MYTA 1MSWD 4Q8EA 1BC6A 1Q78A 2O3DA 2XY6A 3SSRA 3MEGA 3EM1A 4Y3CA 1D9DA 1X4FA 2YH0A 3IAS9 3ZTPA 4PUOA 1X6LA 3I4HX 4LIWA 1CLFA 2XBPA 1Q6IA 4GIVA 4DRKA 1R8BA 2B51A 2MTLA 4MH8A 5HMXA 3D2WA 2ZH4A 3TARA 2FJWA 4IRCA 2QZ8A 1D0EA 1REVB 3JB9k 1VQKS 4ZCKA 5KG6A 3WD1A 3ARQA 1MU2A 3DXSX 2WRMA 4ZVRB 5FLXU 4YR2A 5JVHQ 1FKOA 1QD1A 2NXUA 3JSRA 4OV1A 1U1NA 2A3AA 4Z37A 2M08A 1JNTA 2HG4A 3I55S 5HW8A 3AT1B 3N5FA 2IJFA 1N88A 1FJCA 2DY1A 3FEYB 5CD4A 3PZPA 3K59A 3HX9A 5IT0A 1D3WA 2CQ4A 4RWXA 2P6TA 4JBCA 2QSWA 3FFIB 5IWAJ 2CQGA 2DKOB 4F36A 2XGPA 1TKTA 2RS2A 2Q66A 2B8QA 3IS9B 4NRUA 1NWRA 3RW7A 2BM1A 4TQRA 1KWMA 3CDEA 3KLVA 1QLNA 3GPKA 2GGPA 1JLAB 3EDRB 4F4YA 2PA8D 3KWMA 5B0EA 4KQZA 1U45A 1SH3A 1PC5A 1VK8A 2VDHA 3HDSA 4OJGA 3ZTOA 4RBUA 1IKYA 1RAJA 4ZPTR 1XN9A 4ZP9A 2CJKA 2R7XA 7FDRA 3V81B 3RYLA 1O51A 5CXTA 1TKZA 4ZPBA 4P74A 3K5PA 1C1BB 2R7WA 3KJVA 3CJ2A 3D1QA 2VV5A 3EIPA 3D6HB 3NOGA 2WONB 4LRBA 2WCXA 4TNSA 1Z1ZA 2KRBA 2PT0A 4FVCA 4LF9F 2Z2MA 3W8PA 4F2RA 3QT5A 4Z7YA 2YVSA 2ZHBA 2LP4A 1BE4A 4O3RA 2WLYA 3ENAA 2ZQVA 4LAXA 3HHLD 2C28A 1NK0A 2DR8A 4FBTA 3LP1A 3QLHA 2XNRA 2VU5A 1RHKB 2ZNZA 5C25B 1FKPB 2JEFA 2I5JB 2ZM6F 2BABA 2E9ZA 3TCZA 1WHXA 4XPCA 3IWXA 5M2RA 2I6WA 2VC1A 2GAGC 1S4EA 2E1PA 2EFNA 2C3YA 4RNHA 1Q16B 3SBMA 3OBIA 2JC1A 1J5EF 2SXLA 2MDAA 4D3HA 3G6XA 3SDEB 4IRDA 5DM7Q 1T9UA 3NOCA 2X1GA 1KTQA 4U7CA 3BGRA 3K58A 2JRSA 3D67A 3GJTB 5CA5A 4DX7A 1Q7LB 1FKTA 5B0DA 5EDWA 3WC2A 4AE5A 2Z4PA 2QL9B 1VHFA 4DR1F 2L48A 4PWDA 1LW2B 1JLGB 2ZH5A 1OGGA 1UP1A 3GR1A 3UCZP 3IRXB 2IDEA 3ELHA 2PA3A 4ZN1A 4DFKA 5C5JA 2YKNA 5B7WA 2XNQA 4USUA 4LSLA 4O0NA 4M5KA 1C0UB 4YR0A 2M1IA 4CLZA 5KFQA 1UW4A 1WF0A 2OLHA 5F41A 4EYIB 3PV8A 1R0AB 2V50A 3P5TL 2VG5A 1FXDA 3JXOA 4B9LA 1RUSA 4RL1A 2FVCA 3QWUA 1U47A 2R8GA 2M5YA 3QJJA 1BWEA 1IKWB 2W1BA 3ALGA 1HBMB 4NNRA 3EUNA 4ODMA 3OL7A 4ECQA 3HVAA 3PX0A 3ZZRA 3P4UB 4I1TA 2HURA 2CQ0A 5DM6Q 3WDOA 1VI7A 2IA6A 1C2PA 5EN1A 1FF2A 2DNHA 2FQQB 5LJ3Y 1FA0A 4ECZA 3S1TA 3K5NA 1W9PA 3PR9A 4KGKA 4DPWA 4F25A 2R7TA 1LNQA 3W62A 5I42A 2W2PP 3KADA 1CJTB 3AS3A 2CQDA 3M8ZA 2W2MP 3M6WA 2XSJA 4LR9A 5CCMA 3HSGA 1S7HA 3WIUA 3LQVA 2Z30B 5IZHA 3HM9A 1KLMB 1Y5IB 4LFBJ 4ZK7M 1NNDA 3DN9A 4ILLA 4LIRA 1WOSA 4DOZA 1SL0A 4J4NA 1DQ9A 1C4AA 2HHPA 2C22A 2VFSA 4B9TA 1GNKA 1FKKA 1MROB 1S1TB 4ZKAA 1AUDA 3T41A 2CNLB 2HEKA 2I1RA 4OMFG 4XDCA 3FC9A 3JAMY 4IG3A 4WTOB 1N4LA 1TFYA 1XBWA 4IT4A 1Q0NA 2H3EB 2HNZB 2JNJA 3M2VA 3N4WA 5KFBA 5T14A 3FZ2A 5E0OA 1CS4A 5KG7A 4DU8A 2FVRA 2GVZA 1NHUA 1F5CA 1HBOA 1TL3B 2LDIA 2ADCA 2PI5A 4Q7NA 3LA0A 1LK5A 4OZLA 5IC6B 4IQCA 3J7ZT 1Y5NB 2HHHJ 4NX9A 2H54B 3MMBB 2Q3PA 1X9SA 2ILYA 2RF2A 4NI2B 3TEGA 3UR3C 5CYJA 5KFGA 2YBTA 2F65A 4IO1A 4JYAF 1S79A 4TXSA 3SZ2A 1FD2A 3EVOA 2MKHA 2R3VA 1LWCB 4WP8A 2DXEA 2HWHA 3MCOA 3QGGA 3IHZA 2M88A 1HKAA 3OJSA 5E3AA 4K4VA 1LWFA 2BA9A 1A0OB 3CO0P 5KFHA 1HNXF 1X5SA 4M5HA 8RUCA 4URGA 2XS7A 1W26A 4A8KA 3AS0A 3WD3A 4EFAC 2MF9A 2F4FA 2AP6A 5LMUJ 3PKYA 1MWQA 4X4QA 1RTIA 4U67Q 2XMUA 1RT4B 1NSKL 2G0JA 2M7SA 4YUDA 1JNDA 1NKBA 3KACA 4KKOB 1VHIA 5J2NB 4DV2F 2ASLA 1IKYB 2DGWA 3FQKA 4KY3A 3EGZA 1CS4B 2PC6A 3MPDA 4C8KA 2BE7D 4WXOA 4KYZA 2LECA 2HNZA 4EMDA 4UY8T 4LF2A 1KNZA 3M8PA 1KQGB 4LF6F 1UR9A 1XERA 2XMTA 2Q43A 3HHLA 2F40A 3CF5Q 1YJWS 4DR2F 3RW6A 2DHHA 4FPIA 1ZPVA 1WDDA 4RW9B 1WKKA 4URQU 1WI6A 2FHMA 1L1PA 2E1AA 5G0RA 4Y34A 1KBRA 3NL0A 1UVNA 2YNGA 3B4MA 5T7LA 1S5ZA 4LREA 1S59A 4MK8A 2FTRA 4QCLA 1GXLA 5HMWA 5DDRC 4RLEA 3TX0A 4YR3A 1PKUA 4IDKB 5HJXA 5IV3A 2C2DA 2W2NP 2DT1A 3CCWA 3MI7X 4X66J 2H5EA 1L3TA 2LKZA 3NGTA 2Y8WA 4YDXA 3AD9C 3SYZA 3VQSA 4N8OA 3ISZA 4I6AA 1R0CB 4OZ1A 3C66A 4DX8H 2JFKA 2MJUA 1UA1A 4AD6A 4B08A 1Q7YT 2QMWA 3V4MA 2WOMB 1LOUA 1KHVA 1HD1A 3IGNA 1S1WA 4L3NA 4CP5A 1JQGA 2XWYA 1RAOA 2F7VA 2QV6A 1RBOB 3DLGA 1FDNA 3SFGA 3W66A 1U79A 1ZPWX 1NDCA 2IBOA 3GFZA 5AE1A 1C1CB 3OUYA 4DWSA 3NRKA 1P5QA 2IM1A 1O5JA 5L1JA 1NHKL 4DR6J 1Q4RA 1RU1A 4C98A 3PW7A 3LO3A 4E98A 3AS2A 3UF8A 4YB1P 2OGUA 4N19A 3CWJA 3DRRA 1KLNA 2D41A 2CJAA 1PJ5A 5D0GA 4ZHRA 4LF5F 4FZVA 2V9KA 2RDDA 3BSCA 3MAAA 4M5GA 3JSYA 2E1CA 4KHPF 1G4CA 2DIUA 4CM0A 3SCJE 2CJXB 5AXLA 5HQLA 4PRFA 3A12A 4LVNP 2DJWA 2ZD1B 1JIHA 4DQIA 3HXMA 4FYYB 3PY8A 4TW6A 3O5JA 1Y00A 3DMJB 3OTOJ 2KM8C 3U1MA 3KK2B 2ERRA 4QJVA 3O5TB 3H7HB 2C2EA 1NPRA 2AW0A 5A2QY 4USHA 5GAHI 2FVQA 2UXBF 4PG6A 3GP9A 3CHEA 3DU5A 3G6MA 4Z2JA 2HNYA 2IRXA 1WEZA 3NBPB 5EWGA 1U7LA 3W4RA 1H2UX 1RT5A 3QPIA 4QPXA 3Q22A 1ZM2A 5JXSA 2HQCA 4DX5A 1RHQB 2DGXA 2PV1A 1TCOC 1SJ4P 1OO0B 4X4NA 4U86A 2DIVA 2MJNA 3QYYA 4JI5J 5IFMA 2F23A 2HS0A 4JP8A 4KO0A 2HKEA 3SI8A 3T1HJ 1T3OA 1BL4A 3UI6A 3FZBA 1DTTA 4DG1B 3OVBA 4HARA 1RSCA 1NK8A 3JSMB 2DNZA 3ENQA 4U95A 3PX6A 3MM6B 3GPAA 2DSWA 1NXIA 2CNOB 3AJ1A 2XLKA 4K0KJ 3OR1B 5KFSA 3CJ4A 3VQTA 4NLYA 3HVWA 4LBIA 3KMQA 3T1AA 3RB0A 2MHNA 2J7WA 4J9OA 4M63A 3AD7C 1KFWA 1SR0A 3GYXB 1HW8A 2D9PA 4MPKA 3RBZA 1VQPS 2V9WA 3OFHA 1J4IA 2UUAJ 2KR7A 3ALFA 2CWXA 3DOLA 4JI3F 1T94A 4NZ7A 3UO0A 2RUCA 3HHLB 1WB0A 2QSFA 4QIWD 4DQSA 2XS5A 3BXWA 3HVTB 3DI6A 3QRPA 3PRAA 2BJ7A 1HJXA 3JQJA 1RCOB 1TP7A 2VASA 3D9BA 3NS7B 5GMEA 1AT1B 3R97A 4FKXA 5U47A 1EP4B 4G1IA 2MB0B 1KVIA 5LL6d 4Q22A 3HSZA 1RT3B 2OPRB 2N4DA 2GX8A 3LP0A 5DDQC 1KOHA 2KKHA 3BO3A 4KR0B 3IR6B 4DV3F 4KFBB 1BUXA 3IM8A 4RW8B 4YEAA 4H4OA 2ZOGA 1FNMA 1TAQA 1X4CA 1DLOA 2NCKL 2WB1D 2WW8A 4I7FB 4DV4J 1U1OA 4CLUA 2B7BB 2QC3A 2I5JA 1D09B 2M3DA 4LRFA 3UQSA 2EFPA 3V2UC 2HFZA 4MTVA 4PABA 4CO2A 4DZ2A 4GC7A 4RU2A 1XNRF 3R6GB 1XMQJ 5IT4A 2LFVA 2PSZA 2C3MA 1PIEA 1HR0J 5LOQA 3P96A 3MEDA 4OHZA 2X1FA 3VAMA 5F9LA 4DR5J 5J2PA 1PYOB 4S0MA 1V5IB 2JZVA 2HS3A 1S12A 2DSUA 1Y10A 3BYPA 4K7QA 4B9SA 1YJTA 1KT1A 3W9IA 5FJ4A 2LEAA 3HT0A 3S6EA 5KT4A 1KONA 3W64A 1LK7A 1OY6A 2D9OA 1FTCA 3NGUA 3GIKA 1N5YB 3EY6A 4O4GB 3PR5B 4JV5J 2DHSA 2QMUB 1TL1B 1ZBTA 2LU2A 4ZVSB 4C0HA 1QY7A 3HHEA 1UMJA 3WL0A 2F3JA 4C7QA 9RUBA 3FBBA 3L9ZA 3VWSA 4CO1A 5KG2A 4KPCA 4M95A 2LCWA 1HMVA 2KO7A 4WP3A 4Q45A 4DRPA 3NNAA 3DHXA 5ETPA 1Q8LA 1AZSA 5E3QA 2ZH8A 1X9WA 1S0OA 4DUZF 3CSKA 2DVIA 2M0GB 4DG1A 1QZ2A 3K8WA 2OUGA 3IBCB 3KFWX 4DL6A 4W9PA 4WZQA 1GK8A 2V8GA 1GMVA 2QTWA 4E8UA 5A8WB 4ZVTB 3KJQB 2FGCA 3ZTQA 2XC9A 2OMLA 1KVKA 2VG6A 3DFEA 3BQ2A 1YTYA 3K17A 1ZL1A 1NUEA 2A3EA 2KJVA 1RLCL 2OEMA 4CO5A 3KHHA 3ZNUA 2GHVC 5F3TA 2AD9A 3CJ5A 1C4CA 1RE1B 4RW4A 4XIUA 2R2UA 1S7IA 2ZOFA 2RMLA 1QE1A 1H6KX 2Z2YB 3UWTA 3RBDA 2I38A 1M0SA 1SJRA 2GZOA 4LSNB 4NLDA 5DG8A 2FJDB 4DF8A 2OO4A 4ZVEA 4BWJA 2GHWA 4DCPB 1HNZF 5A8KB 3J7YI 1T0TV 1ZA1B 2BANA 5GVQA 2MSSA 4BLGA 4NLRA 1YK9A 1S49A 2G2ZA 2DRDA 1UCNA 4OYWA 2NSBA 4DRMA 4TX0A 5GAEI 2IAJA 1SPBP 3MEKA 4USVA 1F5AA 1HNIA 3QQCD 2LQBA 4UUWA 4C8MA 3O3LA 1R89A 1WF2A 5F9NA 4K4YA 2DHAA 3TR5A 4BC7A 4ITZA 1GQEA 1R31A 2BRKA 1DTQB 1OQ3A 2D3UA 3C14B 1WC6A 2K2PA 3R27A 4O4GA 1DJ0A 3CVKA 3W2WB 5LSRA 5JMNA 1SKWA 2PDAA 3POTA 2XYPB 4E0DA 3WD4A 4ERDA 3FJ2A 2XP4A 1X31C 4XDDA 1DY3A 1CJKB 1OS5A 2ASJA 1FCAA 4RNNA 1NH7A 3TVZA 2IRUA 5F8NA 1ZM3A 3ARYA 3MUVP 3RFWA 3BGRB 3HHLC 1R27B 3TA0A 3PYDA 1N34F 1QUPA 4NL5A 1YJVA 4R5PA 4O4RA 4DIPA 3OR2A 5GQBA 1YX2A 3KDNA 4BWMA 5IQ6A 2MPUA 4NEZA 1CTNA 1T3NA 2AJ4A 3AOAA 3DHWC 4USJC 3KLHB 4OX7A 2VG7B 2PMZD 4LQ3A 4QWAA 2QF8A 3QT7A 4OX9F 3M05A 4KFBA 2ZH9A 2G2YA 2QL7B 3F41A 2NR0A 5GPRA 2HRYA 1JKHB 2Y78A 4H4KC 4X4TA 4N76A 1X4EA 2XP3A 3DYAB 4BHQA 4DUYF 4JI7J 2ZUAA 1Y5LB 1X0FA 1TL4A 3Q83A 7FD1A 2RDJA 3HVTA 2DT0A 1H7XA 2WBRA 2EW9A 2Y0BB 4KRWA 4B9MA 4B17A 1EKRA 2VZ9A 2R4FA 1BQXA 5EHHA 2VQEJ 1YDLA 3RM8A 3KAIA 1S9EA 2BJ3A 3DDKA 4YDDB 2DH7A 1R3NA 3NGSA 2E66A 4U96A 4CLYA 4JI1J 4B3RJ 3JQKA 4ECVA 1Q8KA 1U0SA 1SC4B 1R9HA 2KDOA 1LW0A 1RAHB 4ED7A 2AT1B 3CCVS 1NBEB 1NDLA 4FN2A 2LQ5A 2GJIA 1F6TA 2XY5A 1N6QB 2EK6A 3LH2S 4B3MJ 1VYAA 1LQ0A 1CSJA 2V2QA 2AHOB 3M1VB 4LFAJ 4ZLLA 3B4DA 4FN5A 6FD1A 5HQMA 2ZH3A 3QO9A 4MTPA 2NXEA 3ENVA 1RT4A 4P52A 5FDLB 4LBPA 2N3OA 3J81U 3QZ7A 3CHFA 3TQEA 1U1LA 2ITKA 4NMXA 4O3NA 4PYAA 4CM2A 3R8YA 4CYUB 2O66A 5EX0A 3UD4P 2J0SD 4QT3A 2WAQD 4PQUB 1MLAA 3QMQA 3SV4A 1MMNA 2YNFB 1HXVA 1LG1A 2XYHB 1UFKA 2J76E 1AA1B 1NDKA 2BW7A 2EC2A 3MM9B 1HL6A 3O6QA 4OLPA 4TKTA 4JI0F 4WIQA 4DWSC 2YNHB 4OYMA 3CZ8A 1JLCB 2OPPB 4Q44A 3D6TB 3HFVA 3S01A 1FJGF 4DWIA 4CLFA 3DLBA 2HNDA 1KRPA 4LSZB 3PRBA 4PWUA 2PFDA 4NASA 5ADZA 5B08A 1YJ7A 4OX6A 2OTLS 4PUOB 4BBYA 2FPHX 2RSQA 1H38A 1PYTA 1RT2A 1UFWA 3O5EA 1F9FA 2DNLA 2NUUG 3MAAB 5K9FA 2ZR6A 1S6QA 1X4DA 4CQ1A 5A8RB 2ABYA 3MCMA 4X4SA 2JHEA 3RTVA 4AL6A 1RTHA 2W9BB 2LXUA 3M8RA 2JEIA 3M2RA 3TANA 2R8KA 3D66A 3ARPA 2HAFA 3MGJA 4JI8J 4DV5F 4J9PA 1SKSA 1U24A 4ELTA 3V6DB 1S9GA 2CDQA 3FK4A 3SEOA 3IFEA 4U7UD 1RT1B 2JX2A 3GONA 4QIBA 4FYVB 4DL0C 2C3PA 2V5HG 2HIYA 2VBXA 1XC9A 4GKKJ 2B0GA 1OGBA 4D3GA 1C9HA 1O6IA 1LWXA 2CPXA 3KK3B 3C6TB 3H5YA 1RHRB 2A18A 2IM0A 2ZBPA 1RHJB 1U25A 3Q2SC 4K4XA 3KNGA 4DF4A 2JDJA 1M1HA 2GIFA 3H5UA 4N8NA 1U0HA 1KQKA 4A46A 2RU3A 1IKXA 1QJHA 3HO1A 3PR4A 2CPFA 1SV5A 2PE8A 1FKJA 3TDBA 4DR3F 2HVIA 3UDLA 3O5RA 2ZUGA 2E7XA 3CJKB 3TJ9A 2QA4G 2B43A 3NG8A 3IM9A 3MD3A 3NS6A 2DT2A 4WKYA 2ZZTA 2N82B 3D0HE 1VR6A 2VCDA 1FFRA 1RKIA 2LJ4A 1VISA 1IX5A 4J7CA 3J81Y 2DNPA 1F9EB 1VQYA 4ZVOB 2Q6BA 2E44A 5IOLA 3CJKA 3WX4A 4A47A 3JTPA 2V67A 3DRYA 2DR7A 3DLHA 4YHHJ 3OA5A 5BYQA 1QTNB 1YZ7A 2ZKUA 1PJ6A 4MNJA 2BXJA 2DHXA 2X3GA 3SSQA 5KFUA 3TUJC 3Q23A 3C15B 3SQGA 1XJWB 1HPZB 4PXEA 1HYSB 1HI0P 2WK4A 4OI0A 4IFVA 1GTEA 1IQZA 2HVHA 3C8YA 1KQFB 4MKVA 3CDBA 1S0MA 2K8GA 2HHUA 3E51A 1KTVA 4J9UE 3ARTA 4J5OA 2O9OA 3QFWA 4PTMA 5HBMA 1TL7A 3TZWA 4C9DA 1FXLA 2A2CA 4V19X 3EPGA 1G1XA 4NLQA 5KAKA 2R2TA 1PO6A 2F4VF 2YKMA 4LF7F 4FF2A 2MSTA 2ZC3A 1RAIB 2NXCA 2B5UB 2YWGA 3FSYA 3W2VA 2RDIA 3ZZUA 5EWEA 3KTQA 1X4GA 1NJIT 1LWFB 4ANDA 5F8HA 3KLFB 1J5OA 5C2GA 1N8RT 1RTHB 2W01A 3QATA 2DXDA 2UU9F 2MYFA 2RJZA 3I9ZA 4ZVPB 3MPUB 1HNWJ 2K3KA 1LG2A 3IG1A 3CCJS 4ILMA 3NLCA 4R25A 1HQUB 2ZEJA 3KMSA 3PFEA 3UVJB 1XTZA 4DPTA 3DRSB 2DNNA 3J7Z5 3QSIA 3ZZZA 3VF0B 2CPIA 3V81A 2DRBA 1FKRA 4YMEA 2LQ9A 4ZLPA 4QIVA 1S48A 2W2OP 5HW6A 2XQCA 4CCHA 4RUAA 4UY85 1YLXA 4K4WA 3EVWA 3ETOA 3WL1A 2B9YA 1IN0A 4X65F 3KLFA 2M8HA 3F0NA 1KEKA 3NP5A 1N1AA 2Z8QA 1KSPA 4PQUA 3O5OA 1S1XA 1SKUB 2ATLA 4LRAA 5ETMA 1FWPA 4G2PA 3FFIA 3CIMA 5DJBA 1V9OA 2BKPA 3NWRA 2B5JA 5ITHA 1YJRA 3MWBA 3HP6A 1RWXB 2FZKB 2OPQB 4UOHA 2H51B 3BZQA 2XG8A 3H59A 2PN6A 3IO1A 4YFUA 2KG0A 2WSCC 1QAYA 5HW7A 3I5BA 3UDEA 3ENWA 2J8SA 1AROP 3R5AA 4NRTA 1K9MT 3UQIA 1W1PA 4P8UA 2C42A 1NMVA 3BKFA 2XPAA 3G82A 4O44A 4Y2MA 4FYWB 4ES1A 2FDNA 2XLIA 1LV5A 3T19A 4DSEA 1YGYA 2EWHA 2GNKA 2VIHA 4FAPA 4PG7A 5KTQA 3LGNA 2EK1A 3TNVA 3VGUA 4EBEA 4A8SA 2FLNA 3R5CA 4G1PA 2L08A 1PYSB 1LXNA 2XPBA 1VK3A 2OAUA 2AIRB 1XMOJ 3PKMA 2FJEB 2IRYA 2KO1A 3W5ZA 3OQ2A 4P2MA 5CD4H 1UL3A 3TOQA 3BN7A 4F3OA 2OSRA 4J9KA 4X62F 1UETA 1U6FA 3D7SB 4Y2IA 1KHWA 4N5SA 2RRBA 2HZVA 2QA1A 3VGSA 2UVRA 5D4PA 3N28A 2ZH6A 1QAXA 5F8IA 4U6PA 2A1BA 2XMVA 1XR6A 1UVJA 1X60A 3MXHP 1FEEA 4X64J 1W1VA 1UA0A 4IOAQ 1E6YB 3RB6A 4LF4J 1FKAF 3MPVA 2FUG9 5H9EK 2N4CA 4MFBB 4KV8A 1NH6A 2FKEA 1KS2A 3IWLA 2JC0A 4OZ0A 4TY8A 2BR0A 2EPIA 2KN4A 2GS8A 4DV6J 4B3TJ 3CMQA 2VPXB 4C2MA 4USTA 3TVKA 5AXNA 3AOBA 1JLBA 3W2WA 3M2RB 1VC5A 2RQKA 4Z2HA 2F4EA 4UDMA 1IM4A 2W24A 5GMDA 3TAMB 4R8UB 2KL8A 2UZAA 4TU8A 1XNQF 3L95X 4UOFA 2V34A 3I87A 4HTIA 2JLFA 2VB6A 3J7YU 3H2VE 4EYHB 3PW4A 4GMKA 4GGQA 3TX8A 2MZ1A 1CULA 3I0SB 3PG9A 4OZ3A 5KFNA 3M9NB 1FRXA 1GT8A 3BGLA 3GMGA 3L09A 3VZIA 4V19J 2FIUA 1EQMA 2BACA 1JNZB 1PCAA 3HVRA 5HBFA 3D5MA 2OEJA 5K8NA 5KFZA 2VPWB 2ROPA 3W8GA 3RJMB 1AB8A 1VLOA 3ET6A 3PDNA 4ZP6A 1XHGA 1RGVA 2OPQA 2QRRA 3ZO7A 2E5LJ 1AUSL 2CWKA 3TYTA 6AT1B 4ED2A 3B9DA 1T9YA 2KT2A 4MKYA 4K8RA 2DISA 3QO9B 4F50A 3H0PA 2XEXA 1YRUA 2FC8A 1FRIA 4OV6A 3EWGA 4PEOA 4AFFA 2RKIA 3HF5A 4QWEA 4LFCJ 3PIOQ 2ZH1A 1DAXA 3CCMS 3CD0A 4HT5A 3M9OB 3TAPA 3W61A 3PW5A 4GO7X 2HK3A 1N56A 1ZBWA 3IKGA 5IM0A 1UAWA 2Z2ZA 3NCQA 4B02A 4C11A 2F5GA 1TL1A 4HHUA 4DT4A 3KJNB 4OI4A 2YKOA 1FKHA 2HQGA 2W2QP 4ODPA 3PJXA 1E6RA 2CNNB 5EX3A 2MQMA 5DO2A 2YNIB 3AB2B 4CO3A 4AT1B 1V6HA 2NYIA 3GG0A 4C6AA 5D6GA 4DJBA 5HT1A 3NWGA 4RO0A 3ARXA 2LGOA 1QM9A 5J2PB 3E2EA 2W7PA 1FRLA 4CH1A 2PV2A 2J0XA 1PG5B 1Y4ZB 4G3IA 4R8UA 1F5BA 5DQGA 4BDPA 1N5VA 4ID5A 4U7UK 2FDMA 2Q6CA 5LMNJ 1T11A 3QT6A 3ISNC 3O1LA 3V6KA 3CC4S 4WKAA 3A3NB 3W2VB 5LXRA 3LGMA 3O44A 1TV6B 1NDPA 3I31A 4WCEQ 1IBLF 5ETVA 4K4ZA 4HKQA 1OWQA 1UVKA 1X0PA 3Q8YA 3EGWB 2ZZMA 4LRDA 1PAUB 5HMYA 4YQWA 4R5EA 4PAAA 4ODOA 4RZRA 3Q8PB 1N36F 1F2HA 2VOPA 1QSLA 1O6XA 5M2UA 2V8HA 3E8OA 1N52B 3DM2A 3I9V9 4NXMJ 2MY8A 1B99A 1NLKL 2J9EA 2XMWA 4BCAA 5LSLA 5GMKa 1Q53A 2DT3A 3UQBA 4Z2KA 3AH6A 1GMWD 1SC6A 3X3UA 2V0NA 1K0VA 2GMHA 1R6YA 2CKWA 3KJFB 3Q8VA 1M5KC 4MKAA 4RNFA 3ITHA 3TWZA 2YX1A 2R8IA 4TW7A 3A3OB 2MZTA 2PD1A 4KB7A 1WG5A 3KLEB 5H9FK 4IRKA 3GFXA 1BGXT 1MW7A 2K7JA 2R42A 2ZC4A 2RU9A 4FVMA 4HHHA 4Y2KA 4J9MA 2BQUA 4C8ZA 1G2EA 2FGOA 4JI6J 4I4BA 3M2UA 3MUMP 4LAYA 4TVAB 1ZAVA 3ILJA 1NU4A 1U6ZA 4DSFA 2HHXA 1X5OA 5A6PA 5L8RC 1FKLA 1Z2LA 2X7IA 1UR8A 2YBUA 3BR9A 3KG0A 3N6MA 4KAIA 2KFNA 1VRQC 1X4HA 3CHCA 1ZBKA 3UD3P 2I2YA 3VCDA 2XYGB 3LWLA 2XZDB 3CE8A 4L74A 2A6OA 1T02A 2YY3A 3OFFA 4A8MP 1WJ9A 4MYUA 4PPZA 2Q5AA 2NPIA 3GIRA 4KGMA 5KT5A 3VAIA 4FKYA 4DSIA 5I3UA 2ZD1A 3IGVA 3W5XA 5KOXA 5M2PA 2XY7A 3PO5A 3OL9A 3KG4A 4UQTA 3QNWB 2UXCJ 2CNKB 4DPOA 5J6EA 2C3UA 4AL7A 3BDPA 2LXIA 4EO6A 3PIPQ 1LWEB 5A8RA 2QO3A 3N5BA 4OYIA 5ETLA 1DQAA 3PHTA 4TQSA 1RT2B 4ZPCA 4W92B 1VQ4S 2DO0A 1TKDA 2Z0GA 1YKWA 3C2PA 2G8ZA 1WACA 2APOA 3SQOP 2AEMA 3RAQA 4LF8F 2ETNA 2DG3A 5CZVA 4CH7A 3TAQA 2A10A 4ID5B 2VJVA 2DYAA 1VMBA 1F0XA 4NE9C 3GZ7A 1GUVA 4JI2F 3RGCA 1EQ0A 1PBKA 3NMAA 2VN1A 2QJ3A 1Y9OA 4QR1A 3I56S 1DFDA 1RTJB 1U02A 1U8SA 5A6WA 3AOCA 3FBEA 5KFXA 4F4AA 3MCNA 7AT1B 3T1HF 1T03B 3NRBA 1NK9A 4LMZA 2HFNA 4FF4A 1SBRA 3AS1A 2D7SA 3GSDA 1TK8A 1YW5A 1DLOB 1TMJA 4Z2GA 1B70B 1URNA 2NUHA 3JTOA 1S4FA 3AY0A 4FXWA 4I0WA 5HVFA 3T6JA 1SIWB 4EUVA 3BPDA 4ID8A 2ZNYA 4NEYA 4NLUA 1PBUA 5HROB 3QRRA 5J2QA 1N5QA 2MKSA 4A8FA 4A48A 3ZTRA 1DURA 3S8SA 2VQFJ 1OQ6A 1VFJA 2LLZA 5K14B 5BXIA 2D3O1 3O5KA 4JI4F 3D6MB 4CTAA 2UUAF 2WW4A 1FKFA 2ZWOA 2HHTA 2RS8A 2V8VA 4IG0A 3H20A 1RK8A 3EZOA 2B3TB 2JFDA 3WH0A 3VAWA 3O8WA 5D77A 3WBZA 4YY3J 1T05A 1BQNB 2GC8A 3FNNA 5GPGA 1IBMJ 4LJMA 1S1VB 1QUVA 1BWVA 3HSDA 4C97A 1LL7A 3MECA 3VAGA 1H0IA 2YQ0A 2F1FA 5BR8J 3DYAA 2HZAA 2R7OA 2JJ4D 4K5RA 4TYAA 1W1TA 1WTFA 1RT7A 2ZDPA 2LXFA 1M90T 1BLUA 1LL6A 3NS5A 3TC5A 2DBBA 2KVQE 3DLEA 3DNCA 2GVDA 3PYFA 4TYBA 1NKCA 4M5LA 1SKRA 2GO8A 3BGUA 2DEJA 3HD2A 5AJ3J 1K73T 3OR2B 1U1PA 4FP9A 1GXUA 3EZ5A 3RRHA 1ZM4A 2GMLA 3C6TA 4DV1F 3DLJA 3OJUA 3KAFA 4ZITA 1HLWA 1VQSA 2BJ9A 1P6TA 4LF1A 3BMBA 4ODLA 3BBBA 1RT6B 3CCSS 2XO7A 1H0HB 1E6YA 1HIYA 1U26A 1LQ9A 1WSVA 1B0TA 2DK2A 2OP5A 1Q5VA 2AJFE 3FCHA 3GFYA 3POTB 3UN5A 2UVVA 2FJVA 2E9RX 3TA2A 2AJ2A 2RQMA 1CQMA 2IA0A 1NJXA 2W9BA 2GVZB 3A8EA 1VOMA 2HZCA 2YBVA 3MOZA 2MGZB 4JFKA 2ZH2A 3VAFA 1FRMA 2GHPA 3GE9A 4IG3B 1QAIA 4OYAA 2HHHF 2CJYB 3C15A 3SQGB 1CQNA 4N47A 2BANB 4IOCQ 3Q89A 3QGIA 4WTYA 2XO6A 2L9NA 1FDAA 4O0IA 2GFFA 2ROEA 2WBMA 2OFGX 2HRUA 1UVIA 3CD6S 3EDQB 3M8YA 1FFWB 5F0WA 3O5LA 4MGVA 2JOQA 5MAOA 3KLEA 1U1MA 2UP1A 4W9OA 5DZ6A 2HHVA 4DZ3A 1OSDA 1SVDA 1D7HA 3RU0A 1LXJA 3H9RB 1JMTA 2IFXA 2B9XA 2XZTB 3MM9A 2M52A 4HI2A 1S1WB 4L76A 3U1NA 1SUQA 4ZJLA 1U1QA 4X84A 2RVJA 2HFOA 5T41A 1EKSA 1GTHA 1Y0HA 3NGKA 1E6NA 1ACMB 2A3JA 1OIAA 3D28A 3DLKA 3LAMA 3UW1A 1ELOA 3W9JA 4RX6A 1IKXB 3D3CJ 4Y2AA 3ZNJ1 4CYUA 5CAAA 2DPIA 2A3CA 3DXBA 1OYDA 4ZJQA 1DRZA 1OY9A 2A2DA 2P5VA 2MKKA 4FXDA 2GJFA 3KAGA 3FUYA 3QIPA 3ULHA 3KK3A 4URIA 1L3SA 4I2PA 2DRAA 4NLTA 1RLDA 1IR0A 1GAOA 3AAWB 1YVFA 1NPKA 4WYWA 2DY9A 3HCXA 3R3TA 1WHWA 3J81j 3C46A 2F9JA 2PMWA 5G0RB 4P8VA 2CPEA 4K2XA 4HACB 3ZXWA 2DR9A 1IQTA 4QBUA 2ATCB 5GAEU 2IM3A 4F0HA 4G65A 2JEJA 4WBFA 4WE1B 4WPAA 4H4MB 3NAIA 3NCRA 4DV0J 1J5EJ 4JI1F 4MAKA 2XP5A 3MHYA 1LEOA 2DHGA 2Z56B 3N79A 1HHQA 2XMKA 3D0IE 3ONQA 4OFZA 2W4PA 2J6UA 2GIRA 3QIDA 4MSPA 2PI6A 1HBNB 1TVRB 3K8VA 3PM9A 3SCIE 3V5RA 3JTNA 3L4BC 1IWGA 2MLXA 1YRTA 2R2SA 4DROA 3M6UA 2WVEA 1PBAA 3HD1A 3LANA 4QWBA 2MZQA 4P71A 4RW7A 2VICA 3FEZA 2DGQA 2YWWA 2LEPA 1J6YA 3B78A 5HWCA 1JLCA 2OPPA 3FSXA 2ZJRQ 4DL5A 1NJWA 1VBYA 1N48A 3H42A 2UUCJ 4DSLA 1CPZA 3CDAA 2RQSA 1EX8A 3CCQS 3T5JA 4C02B 3I6PA 4OX8A 4LAVA 3UQAA 2IVYA 4PYDA 1UPMB 4R5PB 4Y2CA 4OYOA 1WKJA 1FTRA 2POKA 3KLIB 3GV5B 1VQNS 3W5YA 2BJ8A 3O5MA 4OJHA 1SJ1A 1I94J 2C2OB 5I3UB 1VQOS 2CYYA 4WKRA 4Q7AA 4USMA 4DR7J 3D0GE 2HK2A 2BKNA 4QWDA 4I67A 3UN3A 4K2JA 3BF4A 2W8LA 2AYBA 4B3RF 5E3PA 2WVDA 4NMLA 4ZDNA 2PPNA 3UI3A 5GAGI 1XWLA 3OL8A 3G4SS 1GMUA 1VRTA 5DDPC 1HBOB 1RABB 1TL3A 4R0EA 3CCES 3BQ0A 2NZ4A 4RNOA 3G8SA 4DL4A 2G41A 2E7VA 3TVYA 1UFLA 2RURA 3WQVA 2A3BA 1H2TZ 3M2UB 1S1TA 4ED3A 1VGYA 2AOSA 4XAKA 2HQDA 4ZLJA 2DSZA 1BKFA 1JLQB 3PW2A 1VQ5S 4Z7CA 2CRLA 3VAHA 5AT1B 4C11B 4ELUA 1NRKA 3DRXA 1ZZFA 5KT6A 1QE1B 5EGYA 4WFAQ 4M5IA 2M4MA 4USKA 3EXYA 4LUBA 4UQGA 4KC5A 1JB0C 4CLPA 1YJNS 4JI0J 4FXVA 4K5SA 4P2XA 1KT0A 1ZZNA 4C8LA 1FO1A 2Y0SD 3CJ8A 2DD8S 2DITA 1H0GA 4PR6A 3V6HA 1M5VC 3RM9A 2XP7A 2J5AA 1FJGJ 5GAGU 4DFPA 1KOOA 3FMBA 4HHJA 4M8LA 1WUUA 2RHQB 1NK4A 1TK5A 2AYGA 2HW3A 3ARWA 1U0HB 4ICLB 5MLCV 1RA6A 2R7QA 1TU0B 1UEVA 1SQFA 2MY7A 3BEGB 2ZE2A 4LQ9A 3JXVA 4XTTA 3GV8B 2KE0A 1U4BA 4CLSA 4KHRA 4EI2A 2FHJA 2Y1LB 4HDHA 2QA4S 3TJ8A 4DPUA 5ETTA 4N41A 1TFWA 2HLTA 1KD1T 1KN6A 5HN0A 3AHPA 1PJ7A 2L9WA 3D1OA 3EXCX 3KUEA 3OTCA 1JLEA 3PRDA 2HBZB 2ALYB 4DN9A 1TUGB 3JAMU 3OVAA 1TK0A 3KK1B 4MNMA 4JOUA 3V6DA 4I69A 4WFYA 4OHXA 4OYPA 3MMCA 4X4UA 2IC3B 5DEZA 3A8KA 3M32B 2XB2D 1Q8IA 3IR5B 3JQMA 5D4LA 3FQLA 1A7XA 3FDSA 4QW8A 1HQ2A 2MXYA 1HARA 1UPPA 1YSJA 4QYRA 3TW0A 4DI6A 1RA7A 1Q86T 2N7CA 3CMES 2MKCA 4ES3A 4J9SA 3SDEA 1NB2A 2QLJB 5IWAF 3J80U 1GX6A 5DQIA 4HTJA 2R9LA 4DR2J 1XNRJ 1N33F 3P45B 4UOGA 5GADI 5HWBA 3MURP 1MWYA 2NZCA 3OT9A 3ZTSA 1NMWA 2AYMA 4NA3A 4RW8A 2NQPA 4AXJA 1GRJA 2OD6A 2V2VA 3AODA 4ANCA 1VQLS 1D8YA 4P6QA 3H4BA 4F4ZA 2KZMA 1SCJB 2RUSA 1KC8T 3ARZA 2B56A 2VBWA 2YNGB 4R0XA 3UDVA 1RWMB 4P8WA 1WC5A 3FAPA 4NLSA 4ZMMA 3G8TA 4OYBA 4JV5F 1XEZA 5AXMA 3B9AA 1RP5A 3OSPA 2HGMA 4ZVQB 2IDLA 2YWEA 1S10A 3QGHA 3DC2A 4QPTA 4NZ0A 4P10A 2PN0A 3FRZA 2MKIA 1ZCNA 2MKJA 4PPDA 3H2LA 3O5DA 2R8JA 3LTOA 2BKOA 2GCFA 5J2MB 2P2CB 3PYGA 4Y00A 3CEDA 3CJRA 1RJJA 4CWBA 1B3TA 1D1UA 1Y3KA 3PXGa 4CLLA 2HFUA 3KUHA 4I6YA 2DNOA 1FKGA 4ZS6A 1S9EB 4PG8A 5KT7A 3AJDA 3NNHA 4WK9A 1V3RA 3HKWA 3I0RB 4A8OA 5C42A 3ZZYA 2ZR4A 1JXLA 1VDHA 4QT2A 5JVGQ 2C2RA 4KO0B 4XPEA 1HQUA 4F7VA 3GB0A 4ZPDA 4DV7F 2ASYA 2BV3A 4ZPAA 3TZYA 4NLVA 1CJVA 3K5LA 2PV3A 3TAMA 3UE2A 1B64A 5J1NA 2MZJA 3K7RA 1YRXA 3KLIA 1IJFB 3H90A 3UPFA 1HNWF 2RUDA 1KDNA 1FK9B 4WFBQ 1YWXA 1NPPA 3KJVB 3G6VA 5H9EJ 4WIWA 1FKBA 2VG7A 1RXOB 3CH9A 3W3SA 2DH9A 3GR0A 2GJ2A 1R6VA 2QLWA 1RYSA 3C3LA 4J9RA 5DGBA 4GVBA 5ETNA 2ACYA 3NTPA 1C0TA 1R8AA 2YWFA 5DG9A 2V4QA 3R2DJ 1K0TA 1HBNA 1TVRA 1KVJA 1YATA 2DG9A 2WLZA 1RAFB 4O23A 1MNEA 5K20B 4C48A 2IPOB 4EO8A 5D4OA 3RRKA 4J91A 4OI6A 2B4OA 2EG2A 4H4MA 3UI5A 1RADB 2CZ4A 2OLWA 1Q5YA 3DOLB 1L3VA 2VKRA 1X7VA 4OI3A 4ZVHA 1D8ZA 5IT9U 1PC4A 1X5PA 4B9NA 4X4PA 1M1KT 2LMIA 2VH7A 4Q43A 2V2KA 5HVGA 3CC2S 1MN7A 1Q95G 1QPFA 1B0PA 2BE2B 3BR8A 4L6V3 1N34J 2FD2A 1B7FA 4I2PB 1CJTA 3MPWA 1BD6A 4RW6B 2HHSA 2WOMA 3KDOA 5E33A 2PBCA 2AF6A 2ZE2B 3MR7A 4J9QA 4NOHA 3CJTA 1QSSA 1F40A 3RBXA 3WQWA 1ZAXA 1RTDA 2B6AA 3I5AA 1NKEA 1RTDB 2FYXA 3MM7B 1Q6UA 1WG1A 3SV3A 1VIXA 4PG4A 3DGPA 1QVFR 5G4DA 1BXNA 4DUYJ 5DETA 4CT8A 1VCTA 3CIZA 5HLFB 2VG5B 3I32A 3OXLA 3OD2A 2HNYB 2OHDA 3NBPA 4KGVB 2GW8A 4RKUC 3J80Y 4ER8A 2EVZA 3JSBA 4WFNQ 4B9VA 4F2SA 3P49B 1C0UA 4G50A 1O8BA 3BREA 1XK8A 2CQIA 1I5OB 4MKBA 2YKNB 1M5HA 1DHMA 2Z58B 3M30B 4BC9A 2BBEA 2DNGA 5C24A 2J9CA 1IR2A 3RG6A 3ZZTA 1JLQA 2KXFA 3HHKA 4RW9A 1SXLA 5F8GA 4LF9J 2IF4A 3LW5C 1AZSB 5KG0A 4WFXA 3UD5A 5I3PA 2Y1IA 3CJ0A 3K57A 1YIJS 1SC3B 3BM7A 5A76A 1FRJA 3C19A 3TUZC 3UR0A 4ZHRB 3LALA 1L5UA 1LKZA 4N56A 1U2FA 1Q8BA 2C2KB 4FPRA 5KFDA 4KKOA 1TZ0A 2A0FB 1IKVA 2K06A 3MMJA 5J2NA 2LQ8A 9ATCB 2MQ8A 4J9VA 1FJDA 2Q79A 3FBCA 3CGNA 1SJ3P 2BUNA 2NXNA 1HKMA 2XCAA 4UW2A 2V4RA 2UXDF 4Z2XA 2LPVA 2JLEA 2VHGA 1N32F 2V4JA 1TL5A 3CTRA 1ZBCA 2OIHA 4ZCLA 5EWFA 3A4TA 3MR5A 1P27B 3MDFA 3T1YJ 1IUJA 1NAQA 2V4JB 1XRVA 2XI3A 4LF6J 2V8DA 3VR1A 2ZWPA 4YB7A 5CYQA 1RHUB 1UJ6A 2RF2B 3D6FB 4Z2LA 4DUZJ 2K1RA 1ULRA 4YN3B 3IK8A 3WX8A 3ARRA 1TKXA 2LQJA 1FVQA 4IT6A 1TKZB 3QT8A 5GAHU 4JYAJ 4C3MA 3M1VA 3LP0B 4OZJA 5BYRA 1FJ7A 2AZ3A 4W98A 1JLFB 3Q8QB 1NO8A 3BB5A 5CH7B 4NZCA 1IJEB 5T7LB 3TZZA 3KZ7A 4OYXA 4O3OA 4DLEA 3KABA 1WWHA 4IFVB 2G2OA 4JI8F 4DS4A 1FNXH 4F26A 3J7AN 2CQ1A 4X66F 1S1VA 2ZITA 4QW9A 2M9KA 2NPFA 2UVUA 4OHYA 4DS5A 4NPOA 2Z2LA 1OMSA 4LVOP 5LMUF 4UZCA 4NCGB 4IG0B 2H1YA 2KGJA 1UZDA 2G0IA 2XHCA 1E15A 4ZA1A 5L46A 2IY5B 3PACA 4IO9Q 2QLXA 3B6BA 3EICA 4ECTA 4IH6A 3T9NA 3GU0A 3HFKA 1RI7A 4DXLA 3OR1A 1D9AA 3GYGA 4XK8C 1IVZA 4ODKA 3N01A 2EKNA 1HHTP 1KFSA 2OJ3A 5B0GA 4IQ2A 1VLYA 3IMQJ 2VD3A 2G4BA 2K1RB 3QFHA 2BRLA 3T5HA 4IR9A 5CYQB 5IC4B 4KTQA 4C3LA 3BPSP 2OH2A 2FVPA 2KJWA 1HBMA 1OWXA 5KG3A 2BZ2A 4KIAA 5LXYA 5DGAA 1SJQA 1UWBA 2RHSB 3MEGB 1S0NA 3GJRB 1TUWA 3CGIA 1R0AA 4KHPJ 4HH0A 3D68A 1F8AB 2FY1A 1RWPB 2HRTA 1RT1A 1RWVB 5K5MA 4NCAA 2KHDA 4NI2A 4QWCA 1H72C 1Y3JA 4EEYA 4NXNJ 2GA7A 2I0XA 3R6LB 1VJWA 2HBYB 1GH8A 2MLYA 3ICLA 3LPEA 2EFQA 4C8NA 2ALZA 3GSIA 3KK1A 1T9XA 2FJXA 2AJ0A 4F8RA 4HT7A 5B09A 2XM3A 3LPYA 3UNGC 4LT6A 1IM6A 2FJBB 2V94A 2MGZA 1NB7A 3DRRB 2RUGA 4J37A 1D2KA 4ED6A 4JI7F 1HKJA 2IMOA 4DRHA 2G1DA 3HZGA 3N9UC 3LAKA 3OPKA 4OI1A 1JJCB 4ED8A 1AFIA 1GOIA 3ARVA 1YBUA 2DGTA 4RBVA 3OUYB 4OHWA 2MHEA 2KZZA 4F02A 4NA2A 3A3PB 4ETZA 4WF9Q 1CC7A 4Q8FA 1B0VA 4QYZK 1FEHA 4DR4F 3L7UA 1JNSA 2AQ4A 3KHGA 3JYMA 4RJVA 2J7UA 4ES2A 1FK9A 1N0VC 2HPUA 3Q24A 1FVSA 2YNFA 5DS7A 5AE2A 2UU9J 4ECUA 5HLFA 1LFPA 5KFRA 1P1LA 4ED4A 1ROFA 1W9VA 2VBYA
chains in the Genus database with same CATH topology
2BOPA 5SUHA 5D3GA 5L39A 3DDNA 2E1MC 1H98A 2QEXS 4X4OA 1PGZA 3X1LB 4MJKA 4B3OB 3THPA 5C42B 3AQUA 3NAHA 3OTOF 3MAHA 2M2AA 5LMNF 4MAVA 3IXQA 2EBEA 4RW6A 5AE3A 3GQCA 2P6SA 1MWZA 3CCZA 1ZETA 2EFVA 4EZ9A 2U2FA 5KFTA 1YJ9S 4IQXA 2W8KA 5J2MA 3V4IB 5LSOA 4LSLB 1X9MA 2J9DE 5HP1A 4DV4F 3KNAA 4DR7F 2P9EA 2DGOA 3MM8B 1HJVA 2DB1A 5KG4A 4RBTA 3PO4A 3G9CA 5F8MA 4OL8A 4CTAB 1XMQF 4AY1A 3MCSA 4ECWA 2AGPA 1S0VA 2EFOA 5H9FJ 5B0BA 3L3CA 4Z2IA 1X4BA 1JKHA 3F73A 3IR7B 3MAQA 1N5TA 4ODNA 2R7SA 3MR2A 3MR6A 5L1KA 4O3SA 2B31A 1VRUB 2PPOA 1TKXB 3S7RA 1N5SA 1RTIB 1VS3A 2CPZA 1NK7A 1ZU8A 1S1UA 1YBAA 2IYGA 3AB4B 5A0YB 5E2QA 2CQ3A 4PKDB 4DSJA 3OHAA 2ESCA 2L3MA 3HK2A 4ED5A 2GMJA 4DRIA 4OJ1A 2RH3A 1U6BA 2N3LA 3RAMA 4P8XA 3MMCB 4I2QB 1FERA 1EHNA 1O0PA 1X5TA 4NYPA 5HTGA 4Q2LA 3IN5A 1TKDA 4F3QA 1R7IA 1SI9A 2R2RA 1G3OA 4YB6A 2RE1A 4Q5VA 4DRQA 1QAJA 4WFZA 4L72B 1A6LA 1V3SA 1NWTA 3R5DA 4DQQA 1UJ5A 2CFXA 4LF4F 3MM6A 3M4XA 5A8KA 1TKTB 3FY1A 2KU7A 4LSNA 2XSFA 4ICLA 1VF8A 3M30A 1HYSA 1R43A 4KPYA 2JVOA 3GFHA 3RR7A 3KHLA 2B4UA 1WF1A 3O5QA 3MOJB 5D3GB 1JX4A 1RT5B 5BR8F 3MMAA 1EETA 1X8DA 3KAHA 4WJXA 1ZM9A 1JNRB 4FF3A 1HBUA 3DOKA 1W1YA 1ZBVA 3D54A 2YH1A 1MU2B 3UCGA 1REVA 2CQHA 1R8CA 2M70A 2KT5A 1TFVA 2I9SA 2IVMA 3U1LA 4CT9A 1FKDA 2J0WA 5AJ3F 3AA8A 3OTDA 3SMZA 1FKSA 1LJYA 3CO9A 4PXDA 5BJRA 4A8XA 2LDYA 4DN0A 4K4UA 5IXUA 2KXHA 1FNOA 2ZBCA 3CULA 4M94A 4TYOA 2M2BA 4QYZJ 2AJQA 4ED0A 4KJIA 2MZRA 4JFLA 2O1PA 5LT5A 3IRXA 1PILA 3THTA 5I4MA 2M8DB 1A7GE 1LW2A 4CNZA 2EFGA 4KV8B 3GILA 3BJYA 5DG7A 4MMOA 5B0FA 5DLGA 4LFCF 5E3RA 4YB5A 1YHQS 3WD0A 1QPLA 1C0TB 4M5DB 2E5GA 2MQLA 2J9DA 1FXRA 1FAPA 3U7JA 5L9NA 1E6PA 1NK5A 3B7XA 3CCLS 4JV2A 4MIBA 3T6BA 5A0YA 5IS2A 4BS2A 4IYQA 2EG1A 3PNIA 4NCBA 2MMYA 1ZB5A 2WB4A 1VRUA 3PEJA 2DNKA 2J7KA 2W25A 2W4DA 4GO5X 1NJYA 3LP1B 1RT3A 2F21A 1HI1A 2N7YA 2OPRA 5K8OA 3HHNB 4W9QA 3KKFA 5DLFA 3E2EA 1EP4A 2UUWA 4CIOA 2K7KA 1VQ8S 2VFRA 5KFCA 1Q81T 3E01A 5CHCB 2WONA 1YG0A 1WNEA 5K8MA 3WC0A 3OHBA 3LF0A 3MD1A 4JFIA 4H54A 4A4JA 3FSIA 4LFBF 3B9EA 3K5MA 4Q0BA 4DLGA 3TUIC 1Z4UA 1TAUA 1XR5A 4ECXA 2KI2A 3CMAS 5J2QB 3TA1A 3IS9A 2B4VA 3KLGB 1HWIA 4IR1A 3OFGA 1GXTA 4TU9A 3SSSA 4OZNA 1F60B 3CUNA 3H4DA 2ZH7A 2VQEF 1Q6HA 3DLKB 2IHR1 4DFMA 1HWUA 3PEHA 3P3DA 1HWLA 2G9OA 1ZAWA 5EUHA 5E7OB 4WK3A 4PG5A 4ZP8A 2YKPA 1U48A 1IBKF 2JWNA 4DSKA 1MMLA 2E1RA 4NA1A 3H40A 4WKHA 2FHKA 4AQYF 4TY9A 3MMBA 2DNQA 2UUCF 5L1IA 4IQMA 2KRRA 2BYCA 3SCLE 4DEZA 4NWBA 1JJHA 1IKVB 2J0QD 4GKKF 1RDRA 2D74B 3DRPA 4EU0A 4DV6F 4B3TF 2UV8G 5AXKA 5KFPA 3VAKA 1Q79A 4NSBA 2VFUA 3M2VB 4MK9A 1I94F 2W9CA 1J5OB 2HWTA 1JLBB 2R7UA 4WIIA 1YI2S 4RNMA 4QU7A 1OSCA 3O5IA 4M1KA 3AQOA 3NCPA 1EIBA 4MFBA 3TP2A 2YKMB 1EYMA 1Q1KA 3MTJA 4KBIA 2MLZA 3SXLA 2UXCF 2XSJB 3JYTB 1CG2A 5DDOC 4YOEA 3BO4A 1UWBB 2ROGA 4IOBA 2O01C 3THVA 4IFYB 3MM7A 3GG1A 2W4CA 1WI8A 5D75A 5J1PA 2HIQA 1K1SA 3IWNC 1FRKA 3Q8RB 5HL7Q 2WK2A 2CQ2A 1EQ3A 2E5IA 4NYZA 3MUTP 2B4PA 1RISA 2VFTA 3EPIA 2E9TA 3MZIA 1SUQB 1K8AT 4NXNF 3VAJA 4KT0C 2BE2A 3LWMA 5E3CA 2VA3A 4WU2A 3MECB 3SCKE 2L41A 1NJZA 3M9MB 4NCGA 3KHRA 3PA7A 3K5OA 4LAWA 4P7VA 3FEXB 4TLRA 1SV5B 3GWCA 4G1QB 4Y6IA 2B7CB 2B9WA 3G6ES 4ECSA 5DIVA 4PWDB 4Y65A 4OZ5A 4DR6F 4F3MA 1DQ8A 4O44B 3T9ZA 1A9NB 3DM2B 3LP2B 4PXCA 4QR2A 2KTQA 2RNEA 4USIA 1KFDA 3AQPA 4CH0S 1S6PB 4HYKA 4YHHF 3M6XA 1S9GB 2VL1A 2UV8A 3M8SA 1NSGA 2KH9A 5C25A 2CVIA 1S1XB 1FFQA 2QE5A 4KSEB 1PINA 1FE4A 5F0UA 1RTJA 4DQRA 2DCUB 4AUKA 3HHDA 1G6BA 4R0JA 2CPHA 4WZMA 1RD6A 1H7WA 2I8EA 3HKZD 3IBWA 5KFOA 1U49A 1TUVA 1WD6A 1H2VZ 1NEEA 1FJEB 1X6NA 2KFWA 1WNOA 1ROUA 1LFWA 4ZVFA 2WSFC 2PIIA 3QJLA 2R7VA 3I0RA 2HNDB 2QFJA 4LGXA 2DH8A 4BF8A 3AJ2A 3BS9A 4HEA9 1RT7B 2GQ2A 4DH0A 2HWIA 2HHQA 3CD7A 4K0KF 2C3OA 3CCTA 3HMJG 1EDQA 1JVWA 4IH5A 4Q2MA 1WAWA 1OPZA 1SIZA 4Y2MA 3ULHA 4Z37A 3NGDA 1HWJA 2VFVA 3B8HA 3VZHA 1S6OA 1BQNA 2RRAA 3CB4A 2QT7A 2GV1A 3BGFA 1ZTTA 4WU3A 3VALA 5KFLA 4JFMA 1HKKA 2E7WA 4KE5A 4JI6F 4EZ6A 3O5GA 1ROTA 4IPXA 2DO4A 2VC0A 3MM5A 3R1LA 2WSEC 1DZ5A 1ZK6A 2U1AA 4QR0A 1RQ0A 2ZHOA 1KR4A 2JZ5A 5HBMB 1VQ7S 3QIPB 2FVSA 3P6YC 3LP2A 3RMEA 3RM4A 4C0OC 2BW2A 2COLA 3F56A 4WYLA 2CPJA 2F2DA 1FRHA 2RB7A 2QMXA 1W9UA 5KFKA 4PQAA 2FLPA 4JI1F 3B82A 1B6CA 4U9RA 5KT2A 2JEGA 3I0SA 2R8HA 4DHVA 2R7RA 3RAXA 1CVJA 3G96A 3C6UA 3DU6A 3O5PA 2O5DA 4TN2A 3V6JA 4FS2A 4UUXA 2PEHA 3F44A 2YX4A 3TQ1A 2YKQA 4LFAF 3HZEA 3H2UB 4FYDA 1FDDA 4DR5F 2IC3A 3M32A 4F67A 2HMIB 3QZ8A 2JSXA 1NH8A 2HQ3A 2Y1RI 4TNOA 1HWKA 1UKUA 2ZBIA 4TY8B 2UVWA 3E3XA 1R8HA 2E5JA 1JLEB 2KHCA 4IFYA 1DBDA 2MQPA 3FGVA 2EC0A 2HAIA 1CC8A 5CYMB 4DRJA 2DCLA 2BVZA 3CC7S 3FMWA 2F8HA 3ZZ0A 2DT9A 2MQQA 1XMOF 2PO4A 2XP8A 1M5YA 1FE0A 5DITA 4NLWA 1HFEL 2RUQA 4ED1A 4MNKA 1K9TA 5HI7A 2ZQTA 2ZR5A 4QZVB 3FVYA 3MTKA 2AGQA 2KVIA 2QYCA 3OXGA 4C3KA 2O92A 2BQRA 2HHWA 2HGNA 1G7CB 4J9LA 1U1KA 1RYRA 3PW0A 2VQFF 2AWZA 3DRPB 3ODKA 4K59A 4J9NA 2CJBA 1C1BA 5KFIA 2FLLA 1F2GA 3HT3A 3HJFA 4HVZA 2BM0A 2YWKA 4FNIA 1W25A 2JLGA 1HNVA 2YX7A 2FLOA 4QU6A 4YY3F 3QGPA 2W7OA 2YNHA 3DCAA 4RW4B 1QLNA 1P8GA 4MIWA 4ZOSA 3RB4A 5BXJA 2LVWA 4FBUA 1JLAA 1EETB 3KG1A 2RKIB 2KI3A 6FDRA 1VRTB 3GIMA 2MNTA 1D9FA 4DQPA 3IKDA 4MNLA 1HW9A 2NS1B 3L7OA 1TR0A 4P7TA 5B0CA 5A8WA 2B5JB 2LA6A 3H8YA 2OFNA 3U27A 2WM0A 4P2SA 1E6VA 5KFEA 4DL2A 5HROA 4URSA 2JVRA 2ZJPQ 3KYLA 3K0JA 2G13A 1ZYQA 1SL1A 2CG4A 1UVMA 1TV6A 1HD0A 2O67A 1VBXA 2D1CA 5FD1A 3OSNA 4I2QA 4RW7B 4DL7A 2EI5A 1AW0A 2VKZG 5KFYA 1T03A 4AL5A 2ZDOA