2RQSA

3d structure of pin from the psychrophilic archeon cenarcheaum symbiosum (cspin)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
97
structure length
97
Chain Sequence
GPMGSMADKIKCSHILVKKQGEALAVQERLKAGEKFGKLAKELSIDGGSAKRDGSLGYFGRGKMVKPFEDAAFRLQVGEVSEPVKSEFGYHVIKRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Parvulin-like peptidyl-prolyl isomerase
publication title Structure and Dynamics of the First Archaeal Parvulin Reveal a New Functionally Important Loop in Parvulin-type Prolyl Isomerases
pubmed doi rcsb
source organism Cenarchaeum symbiosum
total genus 15
structure length 97
sequence length 97
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13616 Rotamase_3 PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2rqsA00
4TW8A 2M1IA 1FAPA 3PRDA 3WH0A 4IQCA 4DRIA 2M2AA 3IHZA 5HKGA 5DIUA 2FKEA 3KAFA 1QZ2A 3MDYB 1Q6HA 2Y78A 3ODKA 2OFNA 3O5OA 4LAYA 4ODRA 3GPKA 4IQ2A 3VAWA 5HWBA 1B6CA 1D7JA 1FKSA 1FKGA 4DZ3A 4DRNA 5HUAA 1HXVA 2F21A 3RFWA 2XP7A 3O5KA 5HTGA 4ITZA 1D6OA 4JFLA 3UI4A 3KCEA 2MF9A 4BF8A 5HW8A 5DIVA 1QPFA 4MSPA 2KO7A 4FAPA 4U85A 4JFKA 3O5QA 1FKRA 1ZCNA 2L2SA 3FAPA 3O5RA 3O5GA 4IPXA 4ODQA 4GGQA 3O5LA 2MLZA 1J4IA 5I98A 4TYOA 1PINA 2D9FA 2M08A 1FKLA 4O2TA 3UF8A 3O5JA 3O5PA 4G50A 4ODOA 4ODMA 2XP9A 1YW5A 4W9PA 4DRQA 5BXJA 4DRMA 2ZR5A 1QPLA 4DRJA 4DZ2A 3KACA 2DG4A 2ZQTA 2XPAA 1W26A 1BL4A 2XP3A 1NSGA 3KAHA 4DH0A 3H9RB 1FKTA 1KT1A 3KABA 1J4HA 1EYMA 3O5IA 1M5YA 4J4OA 1TCOC 4R0XA 1F40A 2K8IA 2XP5A 1ROTA 2RURA 2LJ4A 2ZQSA 1KT0A 2MLYA 1FKKA 1T11A 2RUCA 4LAWA 1P5QA 3NI6A 1Q6UA 2AWGA 2XP4A 3UI5A 2ZQVA 3KZ7A 1JVWA 2ZQUA 4N19A 4DRKA 2MNTA 4TX0A 1A7XA 2PBCA 2PPOA 3O5MA 4ODLA 3OOBA 4QT2A 2RSEA 2RUDA 2N87A 2PV1A 3UQAA 1FKFA 4ODPA 1D7HA 1ROUA 1Q6IA 3TDBA 4DIPA 1FD9A 2JZVA 2LPVA 4U84A 1FKHA 2RQSA 3KAGA 1EQ3A 3JXVA 3LUOA 4ODNA 1JNSA 4ODKA 4DRPA 3JYMA 2PV2A 4W9QA 1Y0OA 2KGJA 5D75A 2XP6A 2XP8A 1YATA 1C9HA 2MLXA 1FJDA 5HW7A 3IKGA 4G2PA 5DITA 4GIVA 2F4EA 2KE0A 3B7XA 3JYJA 1L1PA 1N1AA 1FKJA 4FN2A 5HT1A 4DROA 4DT4A 1F8AB 2IF4A 3EY6A 3TC5A 4C02B 1BKFA 5GPGA 2RUQA 3PA7A 4TW6A 4JFJA 4W9OA 5HW6A 3CGMA 2LKNA 2KR7A 2ZR4A 2ZR6A 1NMWA 3IKDA 4LAXA 1J6YA 4JFIA 3IK8A 1FKDA 4JYSA 2F2DA 3KAIA 1U79A 4J4NA 3CGNA 4DRHA 1FKIA 1ZK6A 3PRBA 1FKBA 1JNTA 1PBKA 4QIBA 3UI6A 2MPHA 2DG9A 4MGVA 5B8IC 1D7IA 2VN1A 4QT3A 4U86A 3UQIA 1NMVA 2DG3A 2UZ5A 4JFMA 2FAPA 2KFWA 2LGOA 3RGCA 2ITKA 3NTPA 3I6CA 1R9HA 2PV3A 4TW7A 2KI3A 2VCDA 3TCZA 3O5FA 3O5DA 4NNRA 3O5EA 4TNSA 2PPNA 1J4RA 1Q1CA 5J6EA 5HWCA 2PPPA 2Q5AA 2XPBA 3KADA 3UQBA 4LAVA 3NRKA
chains in the Genus database with same CATH superfamily
4MTVA 2A3AA 5HKGA 2DSZA 2EULA 3KAFA 2Y78A 3CHDA 4ODRA 3QOKA 1B6CA 1LQ0A 4R5EA 1FKGA 1SYTA 1LL7A 4Z2KA 3RFWA 5HTGA 1D6OA 4JFLA 3AS2A 4JFKA 2L2SA 3O5GA 4TYOA 4O2TA 3O5PA 5DO2A 2XP9A 4W9PA 4WIWA 3PR9A 4MNMA 1EYMA 3ARQA 2FDMA 2K8IA 2YBTA 3RM8A 1UR8A 1KT0A 2ZQSA 1FKKA 4LAWA 3WL1A 2DSVA 1W1VA 2DPEA 1Q6UA 4ZS6A 2AWGA 1X6LA 2G8ZA 1TFVA 2DSUA 2ZQVA 3KZ7A 4Z2HA 3B9EA 4WK9A 1HKMA 4TX0A 2PPOA 4QT2A 5GQBA 3WD3A 2PV1A 1SR0A 4Z2JA 4ODPA 1D7HA 4P8XA 1W9PA 1FD9A 2RQSA 3KAGA 2DT2A 2PI6A 4DRPA 1Y0OA 2XP6A 3RM4A 1E6RA 1L1PA 2KE0A 3JYJA 1N1AA 1FKJA 4DT4A 3TC5A 4C02B 1BKFA 2ETNA 3CGMA 2LKNA 2ZR6A 3CHEA 4L3NA 4L72B 3KAIA 2P4VA 3CGNA 1FKIA 2WK2A 4QIBA 3UI6A 4MGVA 1D7IA 2AOSA 4URIA 4QT3A 3ARVA 4IT6A 1NMVA 2DG3A 3WL0A 4JFMA 3RGCA 1ZBCA 3I6CA 1EHNA 5HBFA 2Q5AA 2XPBA 3WD4A 5JH8A 1LL6A 3NRKA 4TW8A 1FAPA 3PRDA 2M2AA 2FKEA 1W1PA 1X6NA 3MDYB 4LGXA 5DF0A 1ZL1A 1D7JA 4S3KA 1JNEA 1HXVA 3GU0A 2F21A 2XP7A 4NSBA 3KCEA 1XRVA 5HW8A 4U85A 1FKRA 1WAWA 1ZCNA 4AY1A 3AROA 1HJXA 4GGQA 2MLZA 4NZCA 1ZBWA 1LG2A 2M08A 1LJYA 4G50A 3B8SA 4ODMA 1E9LA 5GPRA 5BXJA 3B9DA 4DRQA 4HBEA 4DRMA 4P8WA 2DG4A 2ZQTA 1W26A 1ZU8A 1BL4A 4Z2IA 1GRJA 1NSGA 3H9RB 1KT1A 1TCOC 3ARUA 3FY1A 2RURA 2MLYA 2RUCA 3NI6A 2B31A 1W9VA 1A7XA 2PBCA 3O5MA 2RSEA 2N87A 1E44A 2LPVA 4U84A 3JXVA 3LUOA 4PTMA 2PV2A 4W9QA 2KGJA 4Z2GA 3BXWA 2XP8A 1C9HA 1LG1A 1FJDA 3ARTA 5HW7A 5DITA 2F4EA 3B7XA 4DROA 4FN2A 3WKZA 1E6NA 3EY6A 1ITXA 1HKJA 5GPGA 3CHFA 1XHGA 4LAXA 3IK8A 1FKDA 4ZPVR 3RM9A 4J4NA 4Q22A 2WM0A 4Z2LA 1FKBA 2DT3A 4UDMA 5B8IC 3CH9A 1W9UA 2DSWA 1HKKA 3UQIA 1WB0A 1NWSA 2ITKA 1R9HA 2PV3A 4TW7A 4WKFA 3W4RA 4NNRA 3O5DA 4TNSA 1J4RA 1IX5A 3ARXA 1ZB5A 2PPPA 2G41A 3WD1A 3AS3A 4MNJA 2M1IA 4MAVA 1E6ZA 4IQCA 4DRIA 3IHZA 4Q7NA 1D2KA 3ARSA 2OFNA 3O5OA 4LAYA 3VAWA 3GPKA 4IQ2A 4WKHA 1FKSA 4DZ3A 3O5KA 4P8VA 4ITZA 5DIVA 1QPFA 2KO7A 4FAPA 1ZBVA 3FAPA 4IPXA 3O5RA 3O5JA 4ODOA 3ARZA 1FFRA 3ARWA 2ZR5A 1QPLA 4DZ2A 3WD0A 2OLHA 2XPAA 1NWTA 2YBUA 2XP3A 3KAHA 3BMBA 1OWQA 1FKTA 1GUVA 4R0XA 3ARRA 1F40A 1NH6A 2XP5A 1ROTA 2LJ4A 3G6MA 1HJWA 5DEZA 3AS1A 2XP4A 1E6PA 1JVWA 2ZQUA 4N19A 2MNTA 4ODLA 4MPKA 3FXYA 2IUZA 3ARPA 4ZPWR 1Q6IA 3G6LA 1FKHA 1JNSA 3JYMA 1JCHB 3ARYA 3PRAA 1YATA 4KQZA 1RD6A 1GOIA 1OGBA 4ML4A 2DT0A 2IF4A 4DWSB 2ESCA 4W9OA 4TW6A 5HW6A 4JFJA 2ZR4A 3IKDA 2A3EA 1W1TA 2F2DA 4MNLA 3ALFA 3PRBA 1EDQA 1JNTA 2MPHA 2DG9A 4QZVB 2DT1A 2VN1A 1LL4A 4U86A 1WNOA 2FAPA 2KFWA 3B9AA 4DWSA 2O9OA 3O5EA 1Q1CA 5J6EA 5HWCA 2WLYA 3UQBA 4LAVA 1HKIA 3WH0A 4KR0B 5DIUA 1QZ2A 1Q6HA 3ODKA 4DRHA 5HWBA 1W1YA 4DRNA 5HUAA 1NWUA 1O6IA 4DWSD 3UI4A 2MF9A 4BF8A 1E15A 3WD2A 4MSPA 2F23A 3O5QA 4ODQA 3O5LA 1K9TA 1J4IA 4XAKA 5I98A 1PINA 1NWRA 2D9FA 1FKLA 1KFWA 3UF8A 2QF8A 1YW5A 3AS0A 4DRJA 3KACA 4HARA 1UR9A 4DH0A 1H0GA 1J4HA 3KABA 3O5IA 1M5YA 4J4OA 2PN0A 3RMEA 3AQUA 1ZBKA 1T11A 3GTYX 4IT4A 1EIBA 1P5QA 1H0IA 3WQWA 3UI5A 4ZPTR 4DRKA 3OOBA 2RUDA 2A3BA 2A3CA 3UQAA 1FKFA 1HJVA 1ROUA 3TDBA 4DIPA 1OGGA 2JZVA 4HBOA 3ALGA 1GPFA 1EQ3A 4ODNA 2O92A 1JNDA 4ODKA 1VF8A 5D75A 3CZ8A 2MLXA 3IKGA 4G2PA 4GIVA 5HT1A 4S3JA 1F8AB 2RUQA 3PA7A 2KR7A 1NMWA 1J6YA 3EIPA 4JFIA 4WJXA 4JYSA 1U79A 1ZK6A 1PBKA 4W5UA 2UZ5A 2LGOA 3CHCA 3OA5A 3NTPA 4DWSC 3TCZA 2KI3A 2VCDA 1FFQA 3WQVA 3O5FA 2B5UB 2PPNA 4P8UA 3WIJA 1CTNA 3KADA 4WKAA 2WLZA 4MNKA
chains in the Genus database with same CATH topology
4MTVA 2A3AA 5HKGA 2DSZA 3KAFA 2Y78A 3CHDA 4ODRA 3QOKA 1B6CA 1LQ0A 4R5EA 1FKGA 1SYTA 1LL7A 4Z2KA 3RFWA 5HTGA 1D6OA 4JFLA 3AS2A 4JFKA 2L2SA 3O5GA 4TYOA 4O2TA 3O5PA 5DO2A 2XP9A 4W9PA 4WIWA 3PR9A 4MNMA 1EYMA 3ARQA 2FDMA 2K8IA 2YBTA 3RM8A 1UR8A 1KT0A 2ZQSA 1FKKA 4LAWA 3WL1A 2DSVA 1W1VA 2DPEA 1Q6UA 4ZS6A 2AWGA 1X6LA 2G8ZA 1TFVA 2DSUA 2ZQVA 3KZ7A 4Z2HA 3B9EA 4WK9A 1HKMA 4TX0A 2PPOA 4QT2A 5GQBA 3WD3A 2PV1A 1SR0A 4Z2JA 4ODPA 1D7HA 4P8XA 1W9PA 1FD9A 2RQSA 3KAGA 2DT2A 2PI6A 4DRPA 1Y0OA 2XP6A 3RM4A 1E6RA 1L1PA 2KE0A 3JYJA 1N1AA 1FKJA 4DT4A 3TC5A 4C02B 1BKFA 3CGMA 2LKNA 2ZR6A 3CHEA 4L3NA 4L72B 3KAIA 3CGNA 1FKIA 2WK2A 4QIBA 3UI6A 4MGVA 1D7IA 2AOSA 4URIA 4QT3A 3ARVA 4IT6A 1NMVA 2DG3A 3WL0A 4JFMA 3RGCA 1ZBCA 3I6CA 1EHNA 5HBFA 2Q5AA 2XPBA 3WD4A 5JH8A 1LL6A 3NRKA 4TW8A 1FAPA 3PRDA 2M2AA 2FKEA 1W1PA 1X6NA 3MDYB 4LGXA 5DF0A 1ZL1A 1D7JA 4S3KA 1JNEA 1HXVA 2F21A 2XP7A 4NSBA 3KCEA 1XRVA 5HW8A 4U85A 1FKRA 1WAWA 1ZCNA 4AY1A 3AROA 1HJXA 4GGQA 2MLZA 4NZCA 1ZBWA 1LG2A 2M08A 1LJYA 4G50A 3B8SA 4ODMA 1E9LA 5GPRA 5BXJA 3B9DA 4DRQA 4HBEA 4DRMA 4P8WA 2DG4A 2ZQTA 1W26A 1ZU8A 1BL4A 4Z2IA 1NSGA 3H9RB 1KT1A 1TCOC 3ARUA 3FY1A 2RURA 2MLYA 2RUCA 3NI6A 2B31A 1W9VA 1A7XA 2PBCA 3O5MA 2RSEA 2N87A 2LPVA 4U84A 3JXVA 3LUOA 4PTMA 2PV2A 4W9QA 2KGJA 4Z2GA 3BXWA 2XP8A 1C9HA 1LG1A 1FJDA 3ARTA 5HW7A 5DITA 2F4EA 3B7XA 4DROA 4FN2A 3WKZA 1E6NA 3EY6A 1ITXA 1HKJA 5GPGA 3CHFA 1XHGA 4LAXA 3IK8A 1FKDA 4ZPVR 3RM9A 4J4NA 4Q22A 2WM0A 4Z2LA 1FKBA 2DT3A 5B8IC 3CH9A 1W9UA 2DSWA 1HKKA 3UQIA 1WB0A 1NWSA 2ITKA 1R9HA 2PV3A 4TW7A 4WKFA 3W4RA 4NNRA 3O5DA 4TNSA 1J4RA 1IX5A 3ARXA 1ZB5A 2PPPA 2G41A 3WD1A 3AS3A 4MNJA 2M1IA 4MAVA 1E6ZA 4IQCA 4DRIA 3IHZA 4Q7NA 1D2KA 3ARSA 2OFNA 3O5OA 4LAYA 3VAWA 3GPKA 4IQ2A 4WKHA 1FKSA 4DZ3A 3O5KA 4P8VA 4ITZA 5DIVA 1QPFA 2KO7A 4FAPA 1ZBVA 3FAPA 4IPXA 3O5RA 3O5JA 4ODOA 3ARZA 1FFRA 3ARWA 2ZR5A 1QPLA 4DZ2A 3WD0A 2OLHA 2XPAA 1NWTA 2YBUA 2XP3A 3KAHA 1OWQA 1FKTA 1GUVA 4R0XA 3ARRA 1F40A 1NH6A 2XP5A 1ROTA 2LJ4A 3G6MA 1HJWA 5DEZA 3AS1A 2XP4A 1E6PA 1JVWA 2ZQUA 4N19A 2MNTA 4ODLA 4MPKA 3FXYA 2IUZA 3ARPA 4ZPWR 1Q6IA 3G6LA 1FKHA 1JNSA 3JYMA 3ARYA 3PRAA 1YATA 4KQZA 1RD6A 1GOIA 1OGBA 4ML4A 2DT0A 2IF4A 4DWSB 2ESCA 4W9OA 4TW6A 5HW6A 4JFJA 2ZR4A 3IKDA 2A3EA 1W1TA 2F2DA 4MNLA 3ALFA 3PRBA 1EDQA 1JNTA 2MPHA 2DG9A 4QZVB 2DT1A 2VN1A 1LL4A 4U86A 1WNOA 2FAPA 2KFWA 3B9AA 4DWSA 2O9OA 3O5EA 1Q1CA 5J6EA 5HWCA 2WLYA 3UQBA 4LAVA 1HKIA 3WH0A 4KR0B 5DIUA 1QZ2A 1Q6HA 3ODKA 4DRHA 5HWBA 1W1YA 4DRNA 5HUAA 1NWUA 1O6IA 4DWSD 3UI4A 2MF9A 4BF8A 1E15A 3WD2A 4MSPA 3O5QA 4ODQA 3O5LA 1K9TA 1J4IA 4XAKA 5I98A 1PINA 1NWRA 2D9FA 1FKLA 1KFWA 3UF8A 2QF8A 1YW5A 3AS0A 4DRJA 3KACA 4HARA 1UR9A 4DH0A 1H0GA 1J4HA 3KABA 3O5IA 1M5YA 4J4OA 3RMEA 3AQUA 1ZBKA 1T11A 4IT4A 1EIBA 1P5QA 1H0IA 3WQWA 3UI5A 4ZPTR 4DRKA 3OOBA 2RUDA 2A3BA 2A3CA 3UQAA 1FKFA 1HJVA 1ROUA 3TDBA 4DIPA 1OGGA 2JZVA 4HBOA 3ALGA 1GPFA 1EQ3A 4ODNA 2O92A 1JNDA 4ODKA 1VF8A 5D75A 3CZ8A 2MLXA 3IKGA 4G2PA 4GIVA 5HT1A 4S3JA 1F8AB 2RUQA 3PA7A 2KR7A 1NMWA 1J6YA 4JFIA 4WJXA 4JYSA 1U79A 1ZK6A 1PBKA 4W5UA 2UZ5A 2LGOA 3CHCA 3OA5A 3NTPA 4DWSC 3TCZA 2KI3A 2VCDA 1FFQA 3WQVA 3O5FA 2PPNA 4P8UA 3WIJA 1CTNA 3KADA 4WKAA 2WLZA 4MNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TW8 A;  2M1I A;  1FAP A;  3PRD A;  3WH0 A;  4IQC A;  4DRI A;  2M2A A;  3IHZ A;  5HKG A;  5DIU A;  2FKE A;  3KAF A;  1QZ2 A;  3MDY B;  1Q6H A;  2Y78 A;  3ODK A;  2OFN A;  3O5O A;  4LAY A;  4ODR A;  3GPK A;  4IQ2 A;  3VAW A;  5HWB A;  1B6C A;  1D7J A;  1FKS A;  1FKG A;  4DZ3 A;  4DRN A;  5HUA A;  1HXV A;  2F21 A;  3RFW A;  2XP7 A;  3O5K A;  5HTG A;  4ITZ A;  1D6O A;  4JFL A;  3UI4 A;  3KCE A;  2MF9 A;  4BF8 A;  5HW8 A;  5DIV A;  1QPF A;  4MSP A;  2KO7 A;  4FAP A;  4U85 A;  4JFK A;  3O5Q A;  1FKR A;  1ZCN A;  2L2S A;  3FAP A;  3O5R A;  3O5G A;  4IPX A;  4ODQ A;  4GGQ A;  3O5L A;  2MLZ A;  1J4I A;  5I98 A;  4TYO A;  1PIN A;  2D9F A;  2M08 A;  1FKL A;  4O2T A;  3UF8 A;  3O5J A;  3O5P A;  4G50 A;  4ODO A;  4ODM A;  2XP9 A;  1YW5 A;  4W9P A;  4DRQ A;  5BXJ A;  4DRM A;  2ZR5 A;  1QPL A;  4DRJ A;  4DZ2 A;  3KAC A;  2DG4 A;  2ZQT A;  2XPA A;  1W26 A;  1BL4 A;  2XP3 A;  1NSG A;  3KAH A;  4DH0 A;  3H9R B;  1FKT A;  1KT1 A;  3KAB A;  1J4H A;  1EYM A;  3O5I A;  1M5Y A;  4J4O A;  1TCO C;  4R0X A;  1F40 A;  2K8I A;  2XP5 A;  1ROT A;  2RUR A;  2LJ4 A;  2ZQS A;  1KT0 A;  2MLY A;  1FKK A;  1T11 A;  2RUC A;  4LAW A;  1P5Q A;  3NI6 A;  1Q6U A;  2AWG A;  2XP4 A;  3UI5 A;  2ZQV A;  3KZ7 A;  1JVW A;  2ZQU A;  4N19 A;  4DRK A;  2MNT A;  4TX0 A;  1A7X A;  2PBC A;  2PPO A;  3O5M A;  4ODL A;  3OOB A;  4QT2 A;  2RSE A;  2RUD A;  2N87 A;  2PV1 A;  3UQA A;  1FKF A;  4ODP A;  1D7H A;  1ROU A;  1Q6I A;  3TDB A;  4DIP A;  1FD9 A;  2JZV A;  2LPV A;  4U84 A;  1FKH A;  2RQS A;  3KAG A;  1EQ3 A;  3JXV A;  3LUO A;  4ODN A;  1JNS A;  4ODK A;  4DRP A;  3JYM A;  2PV2 A;  4W9Q A;  1Y0O A;  2KGJ A;  5D75 A;  2XP6 A;  2XP8 A;  1YAT A;  1C9H A;  2MLX A;  1FJD A;  5HW7 A;  3IKG A;  4G2P A;  5DIT A;  4GIV A;  2F4E A;  2KE0 A;  3B7X A;  3JYJ A;  1L1P A;  1N1A A;  1FKJ A;  4FN2 A;  5HT1 A;  4DRO A;  4DT4 A;  1F8A B;  2IF4 A;  3EY6 A;  3TC5 A;  4C02 B;  1BKF A;  5GPG A;  2RUQ A;  3PA7 A;  4TW6 A;  4JFJ A;  4W9O A;  5HW6 A;  3CGM A;  2LKN A;  2KR7 A;  2ZR4 A;  2ZR6 A;  1NMW A;  3IKD A;  4LAX A;  1J6Y A;  4JFI A;  3IK8 A;  1FKD A;  4JYS A;  2F2D A;  3KAI A;  1U79 A;  4J4N A;  3CGN A;  4DRH A;  1FKI A;  1ZK6 A;  3PRB A;  1FKB A;  1JNT A;  1PBK A;  4QIB A;  3UI6 A;  2MPH A;  2DG9 A;  4MGV A;  5B8I C;  1D7I A;  2VN1 A;  4QT3 A;  4U86 A;  3UQI A;  1NMV A;  2DG3 A;  2UZ5 A;  4JFM A;  2FAP A;  2KFW A;  2LGO A;  3RGC A;  2ITK A;  3NTP A;  3I6C A;  1R9H A;  2PV3 A;  4TW7 A;  2KI3 A;  2VCD A;  3TCZ A;  3O5F A;  3O5D A;  4NNR A;  3O5E A;  4TNS A;  2PPN A;  1J4R A;  1Q1C A;  5J6E A;  5HWC A;  2PPP A;  2Q5A A;  2XPB A;  3KAD A;  3UQB A;  4LAV A;  3NRK A; 
#chains in the Genus database with same CATH topology
 4MTV A;  2A3A A;  5HKG A;  2DSZ A;  2EUL A;  3KAF A;  2Y78 A;  3CHD A;  4ODR A;  3QOK A;  1B6C A;  1LQ0 A;  4R5E A;  1FKG A;  1SYT A;  1LL7 A;  4Z2K A;  3RFW A;  5HTG A;  1D6O A;  4JFL A;  3AS2 A;  4JFK A;  2L2S A;  3O5G A;  4TYO A;  4O2T A;  3O5P A;  5DO2 A;  2XP9 A;  4W9P A;  4WIW A;  3PR9 A;  4MNM A;  1EYM A;  3ARQ A;  2FDM A;  2K8I A;  2YBT A;  3RM8 A;  1UR8 A;  1KT0 A;  2ZQS A;  1FKK A;  4LAW A;  3WL1 A;  2DSV A;  1W1V A;  2DPE A;  1Q6U A;  4ZS6 A;  2AWG A;  1X6L A;  2G8Z A;  1TFV A;  2DSU A;  2ZQV A;  3KZ7 A;  4Z2H A;  3B9E A;  4WK9 A;  1HKM A;  4TX0 A;  2PPO A;  4QT2 A;  5GQB A;  3WD3 A;  2PV1 A;  1SR0 A;  4Z2J A;  4ODP A;  1D7H A;  4P8X A;  1W9P A;  1FD9 A;  2RQS A;  3KAG A;  2DT2 A;  2PI6 A;  4DRP A;  1Y0O A;  2XP6 A;  3RM4 A;  1E6R A;  1L1P A;  2KE0 A;  3JYJ A;  1N1A A;  1FKJ A;  4DT4 A;  3TC5 A;  4C02 B;  1BKF A;  2ETN A;  3CGM A;  2LKN A;  2ZR6 A;  3CHE A;  4L3N A;  4L72 B;  3KAI A;  2P4V A;  3CGN A;  1FKI A;  2WK2 A;  4QIB A;  3UI6 A;  4MGV A;  1D7I A;  2AOS A;  4URI A;  4QT3 A;  3ARV A;  4IT6 A;  1NMV A;  2DG3 A;  3WL0 A;  4JFM A;  3RGC A;  1ZBC A;  3I6C A;  1EHN A;  5HBF A;  2Q5A A;  2XPB A;  3WD4 A;  5JH8 A;  1LL6 A;  3NRK A;  4TW8 A;  1FAP A;  3PRD A;  2M2A A;  2FKE A;  1W1P A;  1X6N A;  3MDY B;  4LGX A;  5DF0 A;  1ZL1 A;  1D7J A;  4S3K A;  1JNE A;  1HXV A;  3GU0 A;  2F21 A;  2XP7 A;  4NSB A;  3KCE A;  1XRV A;  5HW8 A;  4U85 A;  1FKR A;  1WAW A;  1ZCN A;  4AY1 A;  3ARO A;  1HJX A;  4GGQ A;  2MLZ A;  4NZC A;  1ZBW A;  1LG2 A;  2M08 A;  1LJY A;  4G50 A;  3B8S A;  4ODM A;  1E9L A;  5GPR A;  5BXJ A;  3B9D A;  4DRQ A;  4HBE A;  4DRM A;  4P8W A;  2DG4 A;  2ZQT A;  1W26 A;  1ZU8 A;  1BL4 A;  4Z2I A;  1GRJ A;  1NSG A;  3H9R B;  1KT1 A;  1TCO C;  3ARU A;  3FY1 A;  2RUR A;  2MLY A;  2RUC A;  3NI6 A;  2B31 A;  1W9V A;  1A7X A;  2PBC A;  3O5M A;  2RSE A;  2N87 A;  1E44 A;  2LPV A;  4U84 A;  3JXV A;  3LUO A;  4PTM A;  2PV2 A;  4W9Q A;  2KGJ A;  4Z2G A;  3BXW A;  2XP8 A;  1C9H A;  1LG1 A;  1FJD A;  3ART A;  5HW7 A;  5DIT A;  2F4E A;  3B7X A;  4DRO A;  4FN2 A;  3WKZ A;  1E6N A;  3EY6 A;  1ITX A;  1HKJ A;  5GPG A;  3CHF A;  1XHG A;  4LAX A;  3IK8 A;  1FKD A;  4ZPV R;  3RM9 A;  4J4N A;  4Q22 A;  2WM0 A;  4Z2L A;  1FKB A;  2DT3 A;  4UDM A;  5B8I C;  3CH9 A;  1W9U A;  2DSW A;  1HKK A;  3UQI A;  1WB0 A;  1NWS A;  2ITK A;  1R9H A;  2PV3 A;  4TW7 A;  4WKF A;  3W4R A;  4NNR A;  3O5D A;  4TNS A;  1J4R A;  1IX5 A;  3ARX A;  1ZB5 A;  2PPP A;  2G41 A;  3WD1 A;  3AS3 A;  4MNJ A;  2M1I A;  4MAV A;  1E6Z A;  4IQC A;  4DRI A;  3IHZ A;  4Q7N A;  1D2K A;  3ARS A;  2OFN A;  3O5O A;  4LAY A;  3VAW A;  3GPK A;  4IQ2 A;  4WKH A;  1FKS A;  4DZ3 A;  3O5K A;  4P8V A;  4ITZ A;  5DIV A;  1QPF A;  2KO7 A;  4FAP A;  1ZBV A;  3FAP A;  4IPX A;  3O5R A;  3O5J A;  4ODO A;  3ARZ A;  1FFR A;  3ARW A;  2ZR5 A;  1QPL A;  4DZ2 A;  3WD0 A;  2OLH A;  2XPA A;  1NWT A;  2YBU A;  2XP3 A;  3KAH A;  3BMB A;  1OWQ A;  1FKT A;  1GUV A;  4R0X A;  3ARR A;  1F40 A;  1NH6 A;  2XP5 A;  1ROT A;  2LJ4 A;  3G6M A;  1HJW A;  5DEZ A;  3AS1 A;  2XP4 A;  1E6P A;  1JVW A;  2ZQU A;  4N19 A;  2MNT A;  4ODL A;  4MPK A;  3FXY A;  2IUZ A;  3ARP A;  4ZPW R;  1Q6I A;  3G6L A;  1FKH A;  1JNS A;  3JYM A;  1JCH B;  3ARY A;  3PRA A;  1YAT A;  4KQZ A;  1RD6 A;  1GOI A;  1OGB A;  4ML4 A;  2DT0 A;  2IF4 A;  4DWS B;  2ESC A;  4W9O A;  4TW6 A;  5HW6 A;  4JFJ A;  2ZR4 A;  3IKD A;  2A3E A;  1W1T A;  2F2D A;  4MNL A;  3ALF A;  3PRB A;  1EDQ A;  1JNT A;  2MPH A;  2DG9 A;  4QZV B;  2DT1 A;  2VN1 A;  1LL4 A;  4U86 A;  1WNO A;  2FAP A;  2KFW A;  3B9A A;  4DWS A;  2O9O A;  3O5E A;  1Q1C A;  5J6E A;  5HWC A;  2WLY A;  3UQB A;  4LAV A;  1HKI A;  3WH0 A;  4KR0 B;  5DIU A;  1QZ2 A;  1Q6H A;  3ODK A;  4DRH A;  5HWB A;  1W1Y A;  4DRN A;  5HUA A;  1NWU A;  1O6I A;  4DWS D;  3UI4 A;  2MF9 A;  4BF8 A;  1E15 A;  3WD2 A;  4MSP A;  2F23 A;  3O5Q A;  4ODQ A;  3O5L A;  1K9T A;  1J4I A;  4XAK A;  5I98 A;  1PIN A;  1NWR A;  2D9F A;  1FKL A;  1KFW A;  3UF8 A;  2QF8 A;  1YW5 A;  3AS0 A;  4DRJ A;  3KAC A;  4HAR A;  1UR9 A;  4DH0 A;  1H0G A;  1J4H A;  3KAB A;  3O5I A;  1M5Y A;  4J4O A;  2PN0 A;  3RME A;  3AQU A;  1ZBK A;  1T11 A;  3GTY X;  4IT4 A;  1EIB A;  1P5Q A;  1H0I A;  3WQW A;  3UI5 A;  4ZPT R;  4DRK A;  3OOB A;  2RUD A;  2A3B A;  2A3C A;  3UQA A;  1FKF A;  1HJV A;  1ROU A;  3TDB A;  4DIP A;  1OGG A;  2JZV A;  4HBO A;  3ALG A;  1GPF A;  1EQ3 A;  4ODN A;  2O92 A;  1JND A;  4ODK A;  1VF8 A;  5D75 A;  3CZ8 A;  2MLX A;  3IKG A;  4G2P A;  4GIV A;  5HT1 A;  4S3J A;  1F8A B;  2RUQ A;  3PA7 A;  2KR7 A;  1NMW A;  1J6Y A;  3EIP A;  4JFI A;  4WJX A;  4JYS A;  1U79 A;  1ZK6 A;  1PBK A;  4W5U A;  2UZ5 A;  2LGO A;  3CHC A;  3OA5 A;  3NTP A;  4DWS C;  3TCZ A;  2KI3 A;  2VCD A;  1FFQ A;  3WQV A;  3O5F A;  2B5U B;  2PPN A;  4P8U A;  3WIJ A;  1CTN A;  3KAD A;  4WKA A;  2WLZ A;  4MNK A; 
#chains in the Genus database with same CATH homology
 4MTV A;  2A3A A;  5HKG A;  2DSZ A;  3KAF A;  2Y78 A;  3CHD A;  4ODR A;  3QOK A;  1B6C A;  1LQ0 A;  4R5E A;  1FKG A;  1SYT A;  1LL7 A;  4Z2K A;  3RFW A;  5HTG A;  1D6O A;  4JFL A;  3AS2 A;  4JFK A;  2L2S A;  3O5G A;  4TYO A;  4O2T A;  3O5P A;  5DO2 A;  2XP9 A;  4W9P A;  4WIW A;  3PR9 A;  4MNM A;  1EYM A;  3ARQ A;  2FDM A;  2K8I A;  2YBT A;  3RM8 A;  1UR8 A;  1KT0 A;  2ZQS A;  1FKK A;  4LAW A;  3WL1 A;  2DSV A;  1W1V A;  2DPE A;  1Q6U A;  4ZS6 A;  2AWG A;  1X6L A;  2G8Z A;  1TFV A;  2DSU A;  2ZQV A;  3KZ7 A;  4Z2H A;  3B9E A;  4WK9 A;  1HKM A;  4TX0 A;  2PPO A;  4QT2 A;  5GQB A;  3WD3 A;  2PV1 A;  1SR0 A;  4Z2J A;  4ODP A;  1D7H A;  4P8X A;  1W9P A;  1FD9 A;  2RQS A;  3KAG A;  2DT2 A;  2PI6 A;  4DRP A;  1Y0O A;  2XP6 A;  3RM4 A;  1E6R A;  1L1P A;  2KE0 A;  3JYJ A;  1N1A A;  1FKJ A;  4DT4 A;  3TC5 A;  4C02 B;  1BKF A;  3CGM A;  2LKN A;  2ZR6 A;  3CHE A;  4L3N A;  4L72 B;  3KAI A;  3CGN A;  1FKI A;  2WK2 A;  4QIB A;  3UI6 A;  4MGV A;  1D7I A;  2AOS A;  4URI A;  4QT3 A;  3ARV A;  4IT6 A;  1NMV A;  2DG3 A;  3WL0 A;  4JFM A;  3RGC A;  1ZBC A;  3I6C A;  1EHN A;  5HBF A;  2Q5A A;  2XPB A;  3WD4 A;  5JH8 A;  1LL6 A;  3NRK A;  4TW8 A;  1FAP A;  3PRD A;  2M2A A;  2FKE A;  1W1P A;  1X6N A;  3MDY B;  4LGX A;  5DF0 A;  1ZL1 A;  1D7J A;  4S3K A;  1JNE A;  1HXV A;  2F21 A;  2XP7 A;  4NSB A;  3KCE A;  1XRV A;  5HW8 A;  4U85 A;  1FKR A;  1WAW A;  1ZCN A;  4AY1 A;  3ARO A;  1HJX A;  4GGQ A;  2MLZ A;  4NZC A;  1ZBW A;  1LG2 A;  2M08 A;  1LJY A;  4G50 A;  3B8S A;  4ODM A;  1E9L A;  5GPR A;  5BXJ A;  3B9D A;  4DRQ A;  4HBE A;  4DRM A;  4P8W A;  2DG4 A;  2ZQT A;  1W26 A;  1ZU8 A;  1BL4 A;  4Z2I A;  1NSG A;  3H9R B;  1KT1 A;  1TCO C;  3ARU A;  3FY1 A;  2RUR A;  2MLY A;  2RUC A;  3NI6 A;  2B31 A;  1W9V A;  1A7X A;  2PBC A;  3O5M A;  2RSE A;  2N87 A;  2LPV A;  4U84 A;  3JXV A;  3LUO A;  4PTM A;  2PV2 A;  4W9Q A;  2KGJ A;  4Z2G A;  3BXW A;  2XP8 A;  1C9H A;  1LG1 A;  1FJD A;  3ART A;  5HW7 A;  5DIT A;  2F4E A;  3B7X A;  4DRO A;  4FN2 A;  3WKZ A;  1E6N A;  3EY6 A;  1ITX A;  1HKJ A;  5GPG A;  3CHF A;  1XHG A;  4LAX A;  3IK8 A;  1FKD A;  4ZPV R;  3RM9 A;  4J4N A;  4Q22 A;  2WM0 A;  4Z2L A;  1FKB A;  2DT3 A;  5B8I C;  3CH9 A;  1W9U A;  2DSW A;  1HKK A;  3UQI A;  1WB0 A;  1NWS A;  2ITK A;  1R9H A;  2PV3 A;  4TW7 A;  4WKF A;  3W4R A;  4NNR A;  3O5D A;  4TNS A;  1J4R A;  1IX5 A;  3ARX A;  1ZB5 A;  2PPP A;  2G41 A;  3WD1 A;  3AS3 A;  4MNJ A;  2M1I A;  4MAV A;  1E6Z A;  4IQC A;  4DRI A;  3IHZ A;  4Q7N A;  1D2K A;  3ARS A;  2OFN A;  3O5O A;  4LAY A;  3VAW A;  3GPK A;  4IQ2 A;  4WKH A;  1FKS A;  4DZ3 A;  3O5K A;  4P8V A;  4ITZ A;  5DIV A;  1QPF A;  2KO7 A;  4FAP A;  1ZBV A;  3FAP A;  4IPX A;  3O5R A;  3O5J A;  4ODO A;  3ARZ A;  1FFR A;  3ARW A;  2ZR5 A;  1QPL A;  4DZ2 A;  3WD0 A;  2OLH A;  2XPA A;  1NWT A;  2YBU A;  2XP3 A;  3KAH A;  1OWQ A;  1FKT A;  1GUV A;  4R0X A;  3ARR A;  1F40 A;  1NH6 A;  2XP5 A;  1ROT A;  2LJ4 A;  3G6M A;  1HJW A;  5DEZ A;  3AS1 A;  2XP4 A;  1E6P A;  1JVW A;  2ZQU A;  4N19 A;  2MNT A;  4ODL A;  4MPK A;  3FXY A;  2IUZ A;  3ARP A;  4ZPW R;  1Q6I A;  3G6L A;  1FKH A;  1JNS A;  3JYM A;  3ARY A;  3PRA A;  1YAT A;  4KQZ A;  1RD6 A;  1GOI A;  1OGB A;  4ML4 A;  2DT0 A;  2IF4 A;  4DWS B;  2ESC A;  4W9O A;  4TW6 A;  5HW6 A;  4JFJ A;  2ZR4 A;  3IKD A;  2A3E A;  1W1T A;  2F2D A;  4MNL A;  3ALF A;  3PRB A;  1EDQ A;  1JNT A;  2MPH A;  2DG9 A;  4QZV B;  2DT1 A;  2VN1 A;  1LL4 A;  4U86 A;  1WNO A;  2FAP A;  2KFW A;  3B9A A;  4DWS A;  2O9O A;  3O5E A;  1Q1C A;  5J6E A;  5HWC A;  2WLY A;  3UQB A;  4LAV A;  1HKI A;  3WH0 A;  4KR0 B;  5DIU A;  1QZ2 A;  1Q6H A;  3ODK A;  4DRH A;  5HWB A;  1W1Y A;  4DRN A;  5HUA A;  1NWU A;  1O6I A;  4DWS D;  3UI4 A;  2MF9 A;  4BF8 A;  1E15 A;  3WD2 A;  4MSP A;  3O5Q A;  4ODQ A;  3O5L A;  1K9T A;  1J4I A;  4XAK A;  5I98 A;  1PIN A;  1NWR A;  2D9F A;  1FKL A;  1KFW A;  3UF8 A;  2QF8 A;  1YW5 A;  3AS0 A;  4DRJ A;  3KAC A;  4HAR A;  1UR9 A;  4DH0 A;  1H0G A;  1J4H A;  3KAB A;  3O5I A;  1M5Y A;  4J4O A;  3RME A;  3AQU A;  1ZBK A;  1T11 A;  4IT4 A;  1EIB A;  1P5Q A;  1H0I A;  3WQW A;  3UI5 A;  4ZPT R;  4DRK A;  3OOB A;  2RUD A;  2A3B A;  2A3C A;  3UQA A;  1FKF A;  1HJV A;  1ROU A;  3TDB A;  4DIP A;  1OGG A;  2JZV A;  4HBO A;  3ALG A;  1GPF A;  1EQ3 A;  4ODN A;  2O92 A;  1JND A;  4ODK A;  1VF8 A;  5D75 A;  3CZ8 A;  2MLX A;  3IKG A;  4G2P A;  4GIV A;  5HT1 A;  4S3J A;  1F8A B;  2RUQ A;  3PA7 A;  2KR7 A;  1NMW A;  1J6Y A;  4JFI A;  4WJX A;  4JYS A;  1U79 A;  1ZK6 A;  1PBK A;  4W5U A;  2UZ5 A;  2LGO A;  3CHC A;  3OA5 A;  3NTP A;  4DWS C;  3TCZ A;  2KI3 A;  2VCD A;  1FFQ A;  3WQV A;  3O5F A;  2PPN A;  4P8U A;  3WIJ A;  1CTN A;  3KAD A;  4WKA A;  2WLZ A;  4MNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...