2RQSA

3d structure of pin from the psychrophilic archeon cenarcheaum symbiosum (cspin)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
97
structure length
97
Chain Sequence
GPMGSMADKIKCSHILVKKQGEALAVQERLKAGEKFGKLAKELSIDGGSAKRDGSLGYFGRGKMVKPFEDAAFRLQVGEVSEPVKSEFGYHVIKRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Parvulin-like peptidyl-prolyl isomerase
publication title Structure and Dynamics of the First Archaeal Parvulin Reveal a New Functionally Important Loop in Parvulin-type Prolyl Isomerases
pubmed doi rcsb
source organism Cenarchaeum symbiosum
molecule tags Isomerase
total genus 15
structure length 97
sequence length 97
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13616 Rotamase_3 PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2rqsA00
1BL4A 3PRBA 1KT0A 4LAVA 1FKIA 3FAPA 2F21A 4DRIA 4TW7A 4ODNA 4DRQA 4G2PA 2PV1A 2ZQSA 3I6CA 2ZR5A 3CGMA 3O5EA 3O5IA 4DROA 2XP5A 1N1AA 1QPFA 4NNRA 1TCOC 2M2AA 1BKFA 1Q6UA 3NI6A 2FAPA 2ZQTA 5HW8A 1NMWA 1PBKA 4W9QA 2MLZA 1FAPA 2Y78A 3JXVA 5HW7A 2F2DA 2RUDA 3KAIA 2KI3A 2L2SA 2MPHA 3O5FA 4JFJA 1B6CA 3MDYB 3O5RA 4IQ2A 3WH0A 2RSEA 3VAWA 3CGNA 4MGVA 3O5OA 4ITZA 2IF4A 5HTGA 4O2TA 1FKGA 2RURA 4LAWA 1JNSA 3UQIA 4DRNA 2PPOA 4DRKA 3GPKA 1KT1A 3UF8A 1EQ3A 4ODLA 4U86A 1FKFA 4JFLA 4DZ2A 3IKGA 1C9HA 5DIVA 1D6OA 3KCEA 3KAHA 1FKHA 3O5DA 5B8IC 3B7XA 1HXVA 3KZ7A 5DITA 4DZ3A 2PV2A 4QT2A 3IKDA 2M1IA 1FKLA 1D7JA 4TX0A 4IPXA 1FKKA 3NTPA 2DG4A 3PRDA 3OOBA 4DT4A 4U84A 1FKBA 3TCZA 2RUCA 1A7XA 5BXJA 2XP8A 4TW6A 2JZVA 3O5LA 4IQCA 2XP7A 1J4RA 3KAGA 3RGCA 4R0XA 2MF9A 1T11A 1FKJA 4ODPA 5HT1A 4JFKA 1F8AB 1JVWA 4JFIA 2XPBA 3PA7A 1FKTA 4LAYA 1J6YA 3O5GA 2ZR4A 3O5QA 3ODKA 2AWGA 4QIBA 3IK8A 1Q1CA 5GPGA 4ODRA 4W9PA 1FJDA 2VCDA 4DH0A 4ODKA 1D7HA 1Y0OA 3EY6A 4FN2A 4LAXA 4N19A 2M08A 1YATA 4JYSA 2KO7A 4DRMA 3KACA 2LKNA 5D75A 1P5QA 2LJ4A 2VN1A 2KE0A 2LGOA 4G50A 1FD9A 1FKRA 3IHZA 3UI4A 4C02B 1R9HA 1ZK6A 4DRHA 4GGQA 3UI6A 2Q5AA 5J6EA 2KFWA 2XPAA 3KAFA 4J4OA 4DIPA 3H9RB 3UQBA 1YW5A 2ZQVA 5HKGA 5I98A 3KABA 2F4EA 2MLXA 2XP3A 1NSGA 2N87A 3O5JA 2PPNA 1ZCNA 1J4IA 4W9OA 4QT3A 1QPLA 1JNTA 1Q6IA 4JFMA 3O5MA 2ZQUA 4MSPA 3O5PA 3RFWA 4FAPA 5DIUA 1ROTA 4J4NA 2RUQA 1L1PA 1FKDA 2LPVA 2XP6A 4ODQA 4ODOA 1D7IA 4U85A 4TW8A 3TC5A 1FKSA 3UI5A 2PV3A 2DG9A 4TYOA 2FKEA 2ITKA 3O5KA 4BF8A 2XP9A 1NMVA 4DRJA 2MLYA 1Q6HA 2UZ5A 2OFNA 1PINA 3NRKA 1F40A 4TNSA 2PBCA 1J4HA 1ROUA 2DG3A 3UQAA 5HWBA 2XP4A 2ZR6A 1W26A 3LUOA 5HWCA 1EYMA 1U79A 2KR7A 3KADA 3TDBA 3JYMA 1M5YA 2MNTA 4ODMA 2KGJA 4GIVA 2RQSA 4DRPA 5HW6A 2K8IA 1QZ2A 3JYJA 2D9FA 5HUAA 2PPPA
chains in the Genus database with same CATH superfamily
1KT0A 3W4RA 3FAPA 4DRIA 4ODNA 2OLHA 2DSVA 3ARVA 4NNRA 1TCOC 2PI6A 1BKFA 1Q6UA 2ZQTA 5HW8A 1NMWA 4P8XA 3RM8A 4ZPVR 3MDYB 3WD2A 4IQ2A 2RSEA 4P8WA 3ARZA 5HTGA 1FKGA 2RURA 1RD6A 3B9EA 1ZBWA 1OGBA 1LQ0A 4JFLA 2DSWA 3KCEA 4UDMA 1FKHA 1LG2A 3B7XA 4MNKA 2DSZA 2M1IA 2DG4A 3RM4A 3CHEA 2O92A 2RUCA 5BXJA 1GOIA 2XP8A 3OA5A 2JZVA 3O5LA 1W9UA 5DEZA 3ARXA 4R0XA 4LAYA 4JFIA 1LG1A 3O5QA 1ZBCA 2VCDA 4ODKA 1Y0OA 3G6MA 3EY6A 4N19A 4Z2IA 1HJVA 4JYSA 3WL1A 2VN1A 2KE0A 2YBUA 3ARWA 1OWQA 1SR0A 2O9OA 3UI4A 1R9HA 4GGQA 4WJXA 1IX5A 1WAWA 4DIPA 1W1YA 3WD0A 2A3CA 2ZQVA 5HKGA 4NZCA 3RMEA 2PPNA 3AS3A 4W9OA 1Q6IA 3O5MA 3WD4A 2ZQUA 4Z2JA 4FAPA 5DIUA 3AS1A 4P8VA 3B9DA 2DSUA 4KQZA 2WK2A 1NH6A 1JNEA 1NMVA 1Q6HA 2UZ5A 3QOKA 1F40A 2DG3A 5GQBA 3WQWA 3G6LA 4MNLA 1EIBA 1EYMA 1M5YA 4ODMA 2KGJA 4Z2GA 2G8ZA 2RQSA 5HUAA 3NI6A 3JYJA 1BL4A 3PRBA 1NWSA 3WD1A 3AS2A 4TW7A 3ARTA 4G2PA 2PV1A 2ZQSA 1QPFA 2M2AA 2FAPA 1FAPA 1JNDA 3CHDA 2KI3A 2MPHA 3WH0A 1B6CA 1E6NA 3GU0A 3O5OA 1W1TA 5DO2A 4ITZA 2EULA 4R5EA 1JNSA 1ITXA 2PPOA 4DZ2A 1C9HA 4DWSD 3O5DA 1ZBKA 2ETNA 5B8IC 1HXVA 1ZB5A 1E9LA 3KZ7A 5DITA 4QT2A 3ALGA 1FKKA 3OOBA 4MNMA 4DT4A 4DWSC 1E44A 1WNOA 4WKAA 3KAGA 3RGCA 4ODPA 1T11A 4Z2HA 2XPBA 2A3BA 1J6YA 4QIBA 1XRVA 3IK8A 1Q1CA 4WIWA 5GPGA 4DH0A 4FN2A 4LAXA 2DT1A 4P8UA 2LKNA 5D75A 1TFVA 5DF0A 1W1PA 1FKRA 3IHZA 3UI6A 2Q5AA 5J6EA 2XPAA 3UQBA 1O6IA 1YW5A 4WKFA 1X6LA 3ARSA 2MLXA 2XP3A 3WKZA 1NSGA 2N87A 4MAVA 4HBEA 1K9TA 4QT3A 1NWUA 1JNTA 3RFWA 1ROTA 3AROA 4J4NA 1L1PA 1FKDA 2LPVA 4ODQA 4L3NA 4TW8A 1FKSA 2PV3A 3CHCA 2XP9A 4DRJA 4ZS6A 1J4HA 3PRAA 3WL0A 4HBOA 2ZR6A 3AQUA 2F23A 1U79A 3KADA 4WK9A 3TDBA 3RM9A 4QZVB 3EIPA 4GIVA 4DRPA 2K8IA 4WKHA 2PPPA 2AOSA 1W9PA 4XAKA 1FKIA 2F21A 4DRQA 1HKJA 2ZR5A 3O5EA 3O5IA 2XP5A 1N1AA 3B8SA 3BXWA 3ARYA 1X6NA 2MLZA 2Y78A 3JXVA 5HW7A 2RUDA 3KAIA 2L2SA 2B31A 4LAWA 5JH8A 3UQIA 4DRNA 4DRKA 1KT1A 4ODLA 1FKFA 3ALFA 4ML4A 4MNJA 1D6OA 4PTMA 3KAHA 4IT6A 1ZL1A 1HKMA 1D7JA 4TX0A 4IPXA 3NTPA 1H0GA 4U84A 3ARUA 3TCZA 1E6ZA 4S3JA 1A7XA 1E15A 1GRJA 4HARA 4IQCA 1J4RA 4W5UA 1CTNA 4IT4A 5HT1A 2MF9A 1FKJA 1H0IA 4ZPTR 3AS0A 1F8AB 1W9VA 3PA7A 2DT0A 1UR9A 3ARPA 4NSBA 2DPEA 2P4VA 3ODKA 3WIJA 2AWGA 1KFWA 4Q22A 4ODRA 1LL4A 1D7HA 2IUZA 1YATA 2KO7A 3KACA 1P5QA 2WM0A 2LJ4A 4G50A 3ARQA 4C02B 1HJWA 4DRHA 2KFWA 4MTVA 4J4OA 3H9RB 1JCHB 1GUVA 1E6PA 2PN0A 2F4EA 3KABA 1ZCNA 1J4IA 1ZU8A 3B9AA 4JFMA 1UR8A 3O5PA 2XP6A 1D7IA 3CZ8A 2DG9A 4TYOA 2FKEA 2ITKA 4BF8A 3FY1A 1PINA 2YBTA 4TNSA 2PBCA 1ROUA 3BMBA 4Q7NA 2XP4A 5HWCA 1E6RA 2KR7A 4MPKA 4DWSA 2D9FA 1VF8A 4DWSB 4LAVA 2A3EA 3I6CA 3CGMA 4DROA 1LJYA 2DT3A 1PBKA 4W9QA 1LL7A 2F2DA 4JFJA 3O5FA 3O5RA 3VAWA 3CGNA 4MGVA 1EDQA 2IF4A 4O2TA 1HKKA 1HKIA 1LL6A 3GPKA 3UF8A 1EQ3A 4KR0B 4U86A 3CH9A 2WLYA 3IKGA 5DIVA 5GPRA 1HJXA 3FXYA 2B5UB 3CHFA 4DZ3A 3WQVA 2PV2A 4AY1A 4Z2KA 2FDMA 3IKDA 1FKLA 3PRDA 4ZPWR 1FKBA 3PR9A 4TW6A 2XP7A 1SYTA 1NWRA 4JFKA 1JVWA 1FKTA 3O5GA 2ZR4A 4URIA 4W9PA 1FJDA 1FFRA 1FFQA 2M08A 1OGGA 2G41A 4DRMA 4S3KA 2DT2A 2LGOA 4Z2LA 1FD9A 1GPFA 2A3AA 1ZK6A 3KAFA 1W1VA 5I98A 3O5JA 1WB0A 1XHGA 1QPLA 4MSPA 2WLZA 2RUQA 1D2KA 4ODOA 4U85A 3TC5A 3ARRA 3GTYX 4L72B 3UI5A 1NWTA 3O5KA 2MLYA 2QF8A 2OFNA 3NRKA 3WD3A 4LGXA 3UQAA 5HWBA 1EHNA 3LUOA 1W26A 5HBFA 3JYMA 2MNTA 2ESCA 1ZBVA 5HW6A 1QZ2A
chains in the Genus database with same CATH topology
1KT0A 3W4RA 3FAPA 4DRIA 4ODNA 2OLHA 2DSVA 3ARVA 4NNRA 1TCOC 2PI6A 1BKFA 1Q6UA 2ZQTA 5HW8A 1NMWA 4P8XA 3RM8A 4ZPVR 3MDYB 3WD2A 4IQ2A 2RSEA 4P8WA 3ARZA 5HTGA 1FKGA 2RURA 1RD6A 3B9EA 1ZBWA 1OGBA 1LQ0A 4JFLA 2DSWA 3KCEA 1FKHA 1LG2A 3B7XA 4MNKA 2DSZA 2M1IA 2DG4A 3RM4A 3CHEA 2O92A 2RUCA 5BXJA 1GOIA 2XP8A 3OA5A 2JZVA 3O5LA 1W9UA 5DEZA 3ARXA 4R0XA 4LAYA 4JFIA 1LG1A 3O5QA 1ZBCA 2VCDA 4ODKA 1Y0OA 3G6MA 3EY6A 4N19A 4Z2IA 1HJVA 4JYSA 3WL1A 2VN1A 2KE0A 2YBUA 3ARWA 1OWQA 1SR0A 2O9OA 3UI4A 1R9HA 4GGQA 4WJXA 1IX5A 1WAWA 4DIPA 1W1YA 3WD0A 2A3CA 2ZQVA 5HKGA 4NZCA 3RMEA 2PPNA 3AS3A 4W9OA 1Q6IA 3O5MA 3WD4A 2ZQUA 4Z2JA 4FAPA 5DIUA 3AS1A 4P8VA 3B9DA 2DSUA 4KQZA 2WK2A 1NH6A 1JNEA 1NMVA 1Q6HA 2UZ5A 3QOKA 1F40A 2DG3A 5GQBA 3WQWA 3G6LA 4MNLA 1EIBA 1EYMA 1M5YA 4ODMA 2KGJA 4Z2GA 2G8ZA 2RQSA 5HUAA 3NI6A 3JYJA 1BL4A 3PRBA 1NWSA 3WD1A 3AS2A 4TW7A 3ARTA 4G2PA 2PV1A 2ZQSA 1QPFA 2M2AA 2FAPA 1FAPA 1JNDA 3CHDA 2KI3A 2MPHA 3WH0A 1B6CA 1E6NA 3O5OA 1W1TA 5DO2A 4ITZA 4R5EA 1JNSA 1ITXA 2PPOA 4DZ2A 1C9HA 4DWSD 3O5DA 1ZBKA 5B8IC 1HXVA 1ZB5A 1E9LA 3KZ7A 5DITA 4QT2A 3ALGA 1FKKA 3OOBA 4MNMA 4DT4A 4DWSC 1WNOA 4WKAA 3KAGA 3RGCA 4ODPA 1T11A 4Z2HA 2XPBA 2A3BA 1J6YA 4QIBA 1XRVA 3IK8A 1Q1CA 4WIWA 5GPGA 4DH0A 4FN2A 4LAXA 2DT1A 4P8UA 2LKNA 5D75A 1TFVA 5DF0A 1W1PA 1FKRA 3IHZA 3UI6A 2Q5AA 5J6EA 2XPAA 3UQBA 1O6IA 1YW5A 4WKFA 1X6LA 3ARSA 2MLXA 2XP3A 3WKZA 1NSGA 2N87A 4MAVA 4HBEA 1K9TA 4QT3A 1NWUA 1JNTA 3RFWA 1ROTA 3AROA 4J4NA 1L1PA 1FKDA 2LPVA 4ODQA 4L3NA 4TW8A 1FKSA 2PV3A 3CHCA 2XP9A 4DRJA 4ZS6A 1J4HA 3PRAA 3WL0A 4HBOA 2ZR6A 3AQUA 1U79A 3KADA 4WK9A 3TDBA 3RM9A 4QZVB 4GIVA 4DRPA 2K8IA 4WKHA 2PPPA 2AOSA 1W9PA 4XAKA 1FKIA 2F21A 4DRQA 1HKJA 2ZR5A 3O5EA 3O5IA 2XP5A 1N1AA 3B8SA 3BXWA 3ARYA 1X6NA 2MLZA 2Y78A 3JXVA 5HW7A 2RUDA 3KAIA 2L2SA 2B31A 4LAWA 5JH8A 3UQIA 4DRNA 4DRKA 1KT1A 4ODLA 1FKFA 3ALFA 4ML4A 4MNJA 1D6OA 4PTMA 3KAHA 4IT6A 1ZL1A 1HKMA 1D7JA 4TX0A 4IPXA 3NTPA 1H0GA 4U84A 3ARUA 3TCZA 1E6ZA 4S3JA 1A7XA 1E15A 4HARA 4IQCA 1J4RA 4W5UA 1CTNA 4IT4A 5HT1A 2MF9A 1FKJA 1H0IA 4ZPTR 3AS0A 1F8AB 1W9VA 3PA7A 2DT0A 1UR9A 3ARPA 4NSBA 2DPEA 3ODKA 3WIJA 2AWGA 1KFWA 4Q22A 4ODRA 1LL4A 1D7HA 2IUZA 1YATA 2KO7A 3KACA 1P5QA 2WM0A 2LJ4A 4G50A 3ARQA 4C02B 1HJWA 4DRHA 2KFWA 4MTVA 4J4OA 3H9RB 1GUVA 1E6PA 3KABA 2F4EA 1ZCNA 1J4IA 1ZU8A 3B9AA 4JFMA 1UR8A 3O5PA 2XP6A 1D7IA 3CZ8A 2DG9A 4TYOA 2FKEA 2ITKA 4BF8A 3FY1A 1PINA 2YBTA 4TNSA 2PBCA 1ROUA 4Q7NA 2XP4A 5HWCA 1E6RA 2KR7A 4MPKA 4DWSA 2D9FA 1VF8A 4DWSB 4LAVA 2A3EA 3I6CA 3CGMA 4DROA 1LJYA 2DT3A 1PBKA 4W9QA 1LL7A 2F2DA 4JFJA 3O5FA 3O5RA 3VAWA 3CGNA 4MGVA 1EDQA 2IF4A 4O2TA 1HKKA 1HKIA 1LL6A 3GPKA 3UF8A 1EQ3A 4KR0B 4U86A 3CH9A 2WLYA 3IKGA 5DIVA 5GPRA 1HJXA 3FXYA 3CHFA 4DZ3A 3WQVA 2PV2A 4AY1A 4Z2KA 2FDMA 3IKDA 1FKLA 3PRDA 4ZPWR 1FKBA 3PR9A 4TW6A 2XP7A 1SYTA 1NWRA 4JFKA 1JVWA 1FKTA 3O5GA 2ZR4A 4URIA 4W9PA 1FJDA 1FFRA 1FFQA 2M08A 1OGGA 2G41A 4DRMA 4S3KA 2DT2A 2LGOA 4Z2LA 1FD9A 1GPFA 2A3AA 1ZK6A 3KAFA 1W1VA 5I98A 3O5JA 1WB0A 1XHGA 1QPLA 4MSPA 2WLZA 2RUQA 1D2KA 4ODOA 4U85A 3TC5A 3ARRA 4L72B 3UI5A 1NWTA 3O5KA 2MLYA 2QF8A 2OFNA 3NRKA 3WD3A 4LGXA 3UQAA 5HWBA 1EHNA 3LUOA 1W26A 5HBFA 3JYMA 2MNTA 2ESCA 1ZBVA 5HW6A 1QZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BL4 A;  3PRB A;  1KT0 A;  4LAV A;  1FKI A;  3FAP A;  2F21 A;  4DRI A;  4TW7 A;  4ODN A;  4DRQ A;  4G2P A;  2PV1 A;  2ZQS A;  3I6C A;  2ZR5 A;  3CGM A;  3O5E A;  3O5I A;  4DRO A;  2XP5 A;  1N1A A;  1QPF A;  4NNR A;  1TCO C;  2M2A A;  1BKF A;  1Q6U A;  3NI6 A;  2FAP A;  2ZQT A;  5HW8 A;  1NMW A;  1PBK A;  4W9Q A;  2MLZ A;  1FAP A;  2Y78 A;  3JXV A;  5HW7 A;  2F2D A;  2RUD A;  3KAI A;  2KI3 A;  2L2S A;  2MPH A;  3O5F A;  4JFJ A;  1B6C A;  3MDY B;  3O5R A;  4IQ2 A;  3WH0 A;  2RSE A;  3VAW A;  3CGN A;  4MGV A;  3O5O A;  4ITZ A;  2IF4 A;  5HTG A;  4O2T A;  1FKG A;  2RUR A;  4LAW A;  1JNS A;  3UQI A;  4DRN A;  2PPO A;  4DRK A;  3GPK A;  1KT1 A;  3UF8 A;  1EQ3 A;  4ODL A;  4U86 A;  1FKF A;  4JFL A;  4DZ2 A;  3IKG A;  1C9H A;  5DIV A;  1D6O A;  3KCE A;  3KAH A;  1FKH A;  3O5D A;  5B8I C;  3B7X A;  1HXV A;  3KZ7 A;  5DIT A;  4DZ3 A;  2PV2 A;  4QT2 A;  3IKD A;  2M1I A;  1FKL A;  1D7J A;  4TX0 A;  4IPX A;  1FKK A;  3NTP A;  2DG4 A;  3PRD A;  3OOB A;  4DT4 A;  4U84 A;  1FKB A;  3TCZ A;  2RUC A;  1A7X A;  5BXJ A;  2XP8 A;  4TW6 A;  2JZV A;  3O5L A;  4IQC A;  2XP7 A;  1J4R A;  3KAG A;  3RGC A;  4R0X A;  2MF9 A;  1T11 A;  1FKJ A;  4ODP A;  5HT1 A;  4JFK A;  1F8A B;  1JVW A;  4JFI A;  2XPB A;  3PA7 A;  1FKT A;  4LAY A;  1J6Y A;  3O5G A;  2ZR4 A;  3O5Q A;  3ODK A;  2AWG A;  4QIB A;  3IK8 A;  1Q1C A;  5GPG A;  4ODR A;  4W9P A;  1FJD A;  2VCD A;  4DH0 A;  4ODK A;  1D7H A;  1Y0O A;  3EY6 A;  4FN2 A;  4LAX A;  4N19 A;  2M08 A;  1YAT A;  4JYS A;  2KO7 A;  4DRM A;  3KAC A;  2LKN A;  5D75 A;  1P5Q A;  2LJ4 A;  2VN1 A;  2KE0 A;  2LGO A;  4G50 A;  1FD9 A;  1FKR A;  3IHZ A;  3UI4 A;  4C02 B;  1R9H A;  1ZK6 A;  4DRH A;  4GGQ A;  3UI6 A;  2Q5A A;  5J6E A;  2KFW A;  2XPA A;  3KAF A;  4J4O A;  4DIP A;  3H9R B;  3UQB A;  1YW5 A;  2ZQV A;  5HKG A;  5I98 A;  3KAB A;  2F4E A;  2MLX A;  2XP3 A;  1NSG A;  2N87 A;  3O5J A;  2PPN A;  1ZCN A;  1J4I A;  4W9O A;  4QT3 A;  1QPL A;  1JNT A;  1Q6I A;  4JFM A;  3O5M A;  2ZQU A;  4MSP A;  3O5P A;  3RFW A;  4FAP A;  5DIU A;  1ROT A;  4J4N A;  2RUQ A;  1L1P A;  1FKD A;  2LPV A;  2XP6 A;  4ODQ A;  4ODO A;  1D7I A;  4U85 A;  4TW8 A;  3TC5 A;  1FKS A;  3UI5 A;  2PV3 A;  2DG9 A;  4TYO A;  2FKE A;  2ITK A;  3O5K A;  4BF8 A;  2XP9 A;  1NMV A;  4DRJ A;  2MLY A;  1Q6H A;  2UZ5 A;  2OFN A;  1PIN A;  3NRK A;  1F40 A;  4TNS A;  2PBC A;  1J4H A;  1ROU A;  2DG3 A;  3UQA A;  5HWB A;  2XP4 A;  2ZR6 A;  1W26 A;  3LUO A;  5HWC A;  1EYM A;  1U79 A;  2KR7 A;  3KAD A;  3TDB A;  3JYM A;  1M5Y A;  2MNT A;  4ODM A;  2KGJ A;  4GIV A;  2RQS A;  4DRP A;  5HW6 A;  2K8I A;  1QZ2 A;  3JYJ A;  2D9F A;  5HUA A;  2PPP A; 
#chains in the Genus database with same CATH topology
 1KT0 A;  3W4R A;  3FAP A;  4DRI A;  4ODN A;  2OLH A;  2DSV A;  3ARV A;  4NNR A;  1TCO C;  2PI6 A;  1BKF A;  1Q6U A;  2ZQT A;  5HW8 A;  1NMW A;  4P8X A;  3RM8 A;  4ZPV R;  3MDY B;  3WD2 A;  4IQ2 A;  2RSE A;  4P8W A;  3ARZ A;  5HTG A;  1FKG A;  2RUR A;  1RD6 A;  3B9E A;  1ZBW A;  1OGB A;  1LQ0 A;  4JFL A;  2DSW A;  3KCE A;  4UDM A;  1FKH A;  1LG2 A;  3B7X A;  4MNK A;  2DSZ A;  2M1I A;  2DG4 A;  3RM4 A;  3CHE A;  2O92 A;  2RUC A;  5BXJ A;  1GOI A;  2XP8 A;  3OA5 A;  2JZV A;  3O5L A;  1W9U A;  5DEZ A;  3ARX A;  4R0X A;  4LAY A;  4JFI A;  1LG1 A;  3O5Q A;  1ZBC A;  2VCD A;  4ODK A;  1Y0O A;  3G6M A;  3EY6 A;  4N19 A;  4Z2I A;  1HJV A;  4JYS A;  3WL1 A;  2VN1 A;  2KE0 A;  2YBU A;  3ARW A;  1OWQ A;  1SR0 A;  2O9O A;  3UI4 A;  1R9H A;  4GGQ A;  4WJX A;  1IX5 A;  1WAW A;  4DIP A;  1W1Y A;  3WD0 A;  2A3C A;  2ZQV A;  5HKG A;  4NZC A;  3RME A;  2PPN A;  3AS3 A;  4W9O A;  1Q6I A;  3O5M A;  3WD4 A;  2ZQU A;  4Z2J A;  4FAP A;  5DIU A;  3AS1 A;  4P8V A;  3B9D A;  2DSU A;  4KQZ A;  2WK2 A;  1NH6 A;  1JNE A;  1NMV A;  1Q6H A;  2UZ5 A;  3QOK A;  1F40 A;  2DG3 A;  5GQB A;  3WQW A;  3G6L A;  4MNL A;  1EIB A;  1EYM A;  1M5Y A;  4ODM A;  2KGJ A;  4Z2G A;  2G8Z A;  2RQS A;  5HUA A;  3NI6 A;  3JYJ A;  1BL4 A;  3PRB A;  1NWS A;  3WD1 A;  3AS2 A;  4TW7 A;  3ART A;  4G2P A;  2PV1 A;  2ZQS A;  1QPF A;  2M2A A;  2FAP A;  1FAP A;  1JND A;  3CHD A;  2KI3 A;  2MPH A;  3WH0 A;  1B6C A;  1E6N A;  3GU0 A;  3O5O A;  1W1T A;  5DO2 A;  4ITZ A;  2EUL A;  4R5E A;  1JNS A;  1ITX A;  2PPO A;  4DZ2 A;  1C9H A;  4DWS D;  3O5D A;  1ZBK A;  2ETN A;  5B8I C;  1HXV A;  1ZB5 A;  1E9L A;  3KZ7 A;  5DIT A;  4QT2 A;  3ALG A;  1FKK A;  3OOB A;  4MNM A;  4DT4 A;  4DWS C;  1E44 A;  1WNO A;  4WKA A;  3KAG A;  3RGC A;  4ODP A;  1T11 A;  4Z2H A;  2XPB A;  2A3B A;  1J6Y A;  4QIB A;  1XRV A;  3IK8 A;  1Q1C A;  4WIW A;  5GPG A;  4DH0 A;  4FN2 A;  4LAX A;  2DT1 A;  4P8U A;  2LKN A;  5D75 A;  1TFV A;  5DF0 A;  1W1P A;  1FKR A;  3IHZ A;  3UI6 A;  2Q5A A;  5J6E A;  2XPA A;  3UQB A;  1O6I A;  1YW5 A;  4WKF A;  1X6L A;  3ARS A;  2MLX A;  2XP3 A;  3WKZ A;  1NSG A;  2N87 A;  4MAV A;  4HBE A;  1K9T A;  4QT3 A;  1NWU A;  1JNT A;  3RFW A;  1ROT A;  3ARO A;  4J4N A;  1L1P A;  1FKD A;  2LPV A;  4ODQ A;  4L3N A;  4TW8 A;  1FKS A;  2PV3 A;  3CHC A;  2XP9 A;  4DRJ A;  4ZS6 A;  1J4H A;  3PRA A;  3WL0 A;  4HBO A;  2ZR6 A;  3AQU A;  2F23 A;  1U79 A;  3KAD A;  4WK9 A;  3TDB A;  3RM9 A;  4QZV B;  3EIP A;  4GIV A;  4DRP A;  2K8I A;  4WKH A;  2PPP A;  2AOS A;  1W9P A;  4XAK A;  1FKI A;  2F21 A;  4DRQ A;  1HKJ A;  2ZR5 A;  3O5E A;  3O5I A;  2XP5 A;  1N1A A;  3B8S A;  3BXW A;  3ARY A;  1X6N A;  2MLZ A;  2Y78 A;  3JXV A;  5HW7 A;  2RUD A;  3KAI A;  2L2S A;  2B31 A;  4LAW A;  5JH8 A;  3UQI A;  4DRN A;  4DRK A;  1KT1 A;  4ODL A;  1FKF A;  3ALF A;  4ML4 A;  4MNJ A;  1D6O A;  4PTM A;  3KAH A;  4IT6 A;  1ZL1 A;  1HKM A;  1D7J A;  4TX0 A;  4IPX A;  3NTP A;  1H0G A;  4U84 A;  3ARU A;  3TCZ A;  1E6Z A;  4S3J A;  1A7X A;  1E15 A;  1GRJ A;  4HAR A;  4IQC A;  1J4R A;  4W5U A;  1CTN A;  4IT4 A;  5HT1 A;  2MF9 A;  1FKJ A;  1H0I A;  4ZPT R;  3AS0 A;  1F8A B;  1W9V A;  3PA7 A;  2DT0 A;  1UR9 A;  3ARP A;  4NSB A;  2DPE A;  2P4V A;  3ODK A;  3WIJ A;  2AWG A;  1KFW A;  4Q22 A;  4ODR A;  1LL4 A;  1D7H A;  2IUZ A;  1YAT A;  2KO7 A;  3KAC A;  1P5Q A;  2WM0 A;  2LJ4 A;  4G50 A;  3ARQ A;  4C02 B;  1HJW A;  4DRH A;  2KFW A;  4MTV A;  4J4O A;  3H9R B;  1JCH B;  1GUV A;  1E6P A;  2PN0 A;  2F4E A;  3KAB A;  1ZCN A;  1J4I A;  1ZU8 A;  3B9A A;  4JFM A;  1UR8 A;  3O5P A;  2XP6 A;  1D7I A;  3CZ8 A;  2DG9 A;  4TYO A;  2FKE A;  2ITK A;  4BF8 A;  3FY1 A;  1PIN A;  2YBT A;  4TNS A;  2PBC A;  1ROU A;  3BMB A;  4Q7N A;  2XP4 A;  5HWC A;  1E6R A;  2KR7 A;  4MPK A;  4DWS A;  2D9F A;  1VF8 A;  4DWS B;  4LAV A;  2A3E A;  3I6C A;  3CGM A;  4DRO A;  1LJY A;  2DT3 A;  1PBK A;  4W9Q A;  1LL7 A;  2F2D A;  4JFJ A;  3O5F A;  3O5R A;  3VAW A;  3CGN A;  4MGV A;  1EDQ A;  2IF4 A;  4O2T A;  1HKK A;  1HKI A;  1LL6 A;  3GPK A;  3UF8 A;  1EQ3 A;  4KR0 B;  4U86 A;  3CH9 A;  2WLY A;  3IKG A;  5DIV A;  5GPR A;  1HJX A;  3FXY A;  2B5U B;  3CHF A;  4DZ3 A;  3WQV A;  2PV2 A;  4AY1 A;  4Z2K A;  2FDM A;  3IKD A;  1FKL A;  3PRD A;  4ZPW R;  1FKB A;  3PR9 A;  4TW6 A;  2XP7 A;  1SYT A;  1NWR A;  4JFK A;  1JVW A;  1FKT A;  3O5G A;  2ZR4 A;  4URI A;  4W9P A;  1FJD A;  1FFR A;  1FFQ A;  2M08 A;  1OGG A;  2G41 A;  4DRM A;  4S3K A;  2DT2 A;  2LGO A;  4Z2L A;  1FD9 A;  1GPF A;  2A3A A;  1ZK6 A;  3KAF A;  1W1V A;  5I98 A;  3O5J A;  1WB0 A;  1XHG A;  1QPL A;  4MSP A;  2WLZ A;  2RUQ A;  1D2K A;  4ODO A;  4U85 A;  3TC5 A;  3ARR A;  3GTY X;  4L72 B;  3UI5 A;  1NWT A;  3O5K A;  2MLY A;  2QF8 A;  2OFN A;  3NRK A;  3WD3 A;  4LGX A;  3UQA A;  5HWB A;  1EHN A;  3LUO A;  1W26 A;  5HBF A;  3JYM A;  2MNT A;  2ESC A;  1ZBV A;  5HW6 A;  1QZ2 A; 
#chains in the Genus database with same CATH homology
 1KT0 A;  3W4R A;  3FAP A;  4DRI A;  4ODN A;  2OLH A;  2DSV A;  3ARV A;  4NNR A;  1TCO C;  2PI6 A;  1BKF A;  1Q6U A;  2ZQT A;  5HW8 A;  1NMW A;  4P8X A;  3RM8 A;  4ZPV R;  3MDY B;  3WD2 A;  4IQ2 A;  2RSE A;  4P8W A;  3ARZ A;  5HTG A;  1FKG A;  2RUR A;  1RD6 A;  3B9E A;  1ZBW A;  1OGB A;  1LQ0 A;  4JFL A;  2DSW A;  3KCE A;  1FKH A;  1LG2 A;  3B7X A;  4MNK A;  2DSZ A;  2M1I A;  2DG4 A;  3RM4 A;  3CHE A;  2O92 A;  2RUC A;  5BXJ A;  1GOI A;  2XP8 A;  3OA5 A;  2JZV A;  3O5L A;  1W9U A;  5DEZ A;  3ARX A;  4R0X A;  4LAY A;  4JFI A;  1LG1 A;  3O5Q A;  1ZBC A;  2VCD A;  4ODK A;  1Y0O A;  3G6M A;  3EY6 A;  4N19 A;  4Z2I A;  1HJV A;  4JYS A;  3WL1 A;  2VN1 A;  2KE0 A;  2YBU A;  3ARW A;  1OWQ A;  1SR0 A;  2O9O A;  3UI4 A;  1R9H A;  4GGQ A;  4WJX A;  1IX5 A;  1WAW A;  4DIP A;  1W1Y A;  3WD0 A;  2A3C A;  2ZQV A;  5HKG A;  4NZC A;  3RME A;  2PPN A;  3AS3 A;  4W9O A;  1Q6I A;  3O5M A;  3WD4 A;  2ZQU A;  4Z2J A;  4FAP A;  5DIU A;  3AS1 A;  4P8V A;  3B9D A;  2DSU A;  4KQZ A;  2WK2 A;  1NH6 A;  1JNE A;  1NMV A;  1Q6H A;  2UZ5 A;  3QOK A;  1F40 A;  2DG3 A;  5GQB A;  3WQW A;  3G6L A;  4MNL A;  1EIB A;  1EYM A;  1M5Y A;  4ODM A;  2KGJ A;  4Z2G A;  2G8Z A;  2RQS A;  5HUA A;  3NI6 A;  3JYJ A;  1BL4 A;  3PRB A;  1NWS A;  3WD1 A;  3AS2 A;  4TW7 A;  3ART A;  4G2P A;  2PV1 A;  2ZQS A;  1QPF A;  2M2A A;  2FAP A;  1FAP A;  1JND A;  3CHD A;  2KI3 A;  2MPH A;  3WH0 A;  1B6C A;  1E6N A;  3O5O A;  1W1T A;  5DO2 A;  4ITZ A;  4R5E A;  1JNS A;  1ITX A;  2PPO A;  4DZ2 A;  1C9H A;  4DWS D;  3O5D A;  1ZBK A;  5B8I C;  1HXV A;  1ZB5 A;  1E9L A;  3KZ7 A;  5DIT A;  4QT2 A;  3ALG A;  1FKK A;  3OOB A;  4MNM A;  4DT4 A;  4DWS C;  1WNO A;  4WKA A;  3KAG A;  3RGC A;  4ODP A;  1T11 A;  4Z2H A;  2XPB A;  2A3B A;  1J6Y A;  4QIB A;  1XRV A;  3IK8 A;  1Q1C A;  4WIW A;  5GPG A;  4DH0 A;  4FN2 A;  4LAX A;  2DT1 A;  4P8U A;  2LKN A;  5D75 A;  1TFV A;  5DF0 A;  1W1P A;  1FKR A;  3IHZ A;  3UI6 A;  2Q5A A;  5J6E A;  2XPA A;  3UQB A;  1O6I A;  1YW5 A;  4WKF A;  1X6L A;  3ARS A;  2MLX A;  2XP3 A;  3WKZ A;  1NSG A;  2N87 A;  4MAV A;  4HBE A;  1K9T A;  4QT3 A;  1NWU A;  1JNT A;  3RFW A;  1ROT A;  3ARO A;  4J4N A;  1L1P A;  1FKD A;  2LPV A;  4ODQ A;  4L3N A;  4TW8 A;  1FKS A;  2PV3 A;  3CHC A;  2XP9 A;  4DRJ A;  4ZS6 A;  1J4H A;  3PRA A;  3WL0 A;  4HBO A;  2ZR6 A;  3AQU A;  1U79 A;  3KAD A;  4WK9 A;  3TDB A;  3RM9 A;  4QZV B;  4GIV A;  4DRP A;  2K8I A;  4WKH A;  2PPP A;  2AOS A;  1W9P A;  4XAK A;  1FKI A;  2F21 A;  4DRQ A;  1HKJ A;  2ZR5 A;  3O5E A;  3O5I A;  2XP5 A;  1N1A A;  3B8S A;  3BXW A;  3ARY A;  1X6N A;  2MLZ A;  2Y78 A;  3JXV A;  5HW7 A;  2RUD A;  3KAI A;  2L2S A;  2B31 A;  4LAW A;  5JH8 A;  3UQI A;  4DRN A;  4DRK A;  1KT1 A;  4ODL A;  1FKF A;  3ALF A;  4ML4 A;  4MNJ A;  1D6O A;  4PTM A;  3KAH A;  4IT6 A;  1ZL1 A;  1HKM A;  1D7J A;  4TX0 A;  4IPX A;  3NTP A;  1H0G A;  4U84 A;  3ARU A;  3TCZ A;  1E6Z A;  4S3J A;  1A7X A;  1E15 A;  4HAR A;  4IQC A;  1J4R A;  4W5U A;  1CTN A;  4IT4 A;  5HT1 A;  2MF9 A;  1FKJ A;  1H0I A;  4ZPT R;  3AS0 A;  1F8A B;  1W9V A;  3PA7 A;  2DT0 A;  1UR9 A;  3ARP A;  4NSB A;  2DPE A;  3ODK A;  3WIJ A;  2AWG A;  1KFW A;  4Q22 A;  4ODR A;  1LL4 A;  1D7H A;  2IUZ A;  1YAT A;  2KO7 A;  3KAC A;  1P5Q A;  2WM0 A;  2LJ4 A;  4G50 A;  3ARQ A;  4C02 B;  1HJW A;  4DRH A;  2KFW A;  4MTV A;  4J4O A;  3H9R B;  1GUV A;  1E6P A;  3KAB A;  2F4E A;  1ZCN A;  1J4I A;  1ZU8 A;  3B9A A;  4JFM A;  1UR8 A;  3O5P A;  2XP6 A;  1D7I A;  3CZ8 A;  2DG9 A;  4TYO A;  2FKE A;  2ITK A;  4BF8 A;  3FY1 A;  1PIN A;  2YBT A;  4TNS A;  2PBC A;  1ROU A;  4Q7N A;  2XP4 A;  5HWC A;  1E6R A;  2KR7 A;  4MPK A;  4DWS A;  2D9F A;  1VF8 A;  4DWS B;  4LAV A;  2A3E A;  3I6C A;  3CGM A;  4DRO A;  1LJY A;  2DT3 A;  1PBK A;  4W9Q A;  1LL7 A;  2F2D A;  4JFJ A;  3O5F A;  3O5R A;  3VAW A;  3CGN A;  4MGV A;  1EDQ A;  2IF4 A;  4O2T A;  1HKK A;  1HKI A;  1LL6 A;  3GPK A;  3UF8 A;  1EQ3 A;  4KR0 B;  4U86 A;  3CH9 A;  2WLY A;  3IKG A;  5DIV A;  5GPR A;  1HJX A;  3FXY A;  3CHF A;  4DZ3 A;  3WQV A;  2PV2 A;  4AY1 A;  4Z2K A;  2FDM A;  3IKD A;  1FKL A;  3PRD A;  4ZPW R;  1FKB A;  3PR9 A;  4TW6 A;  2XP7 A;  1SYT A;  1NWR A;  4JFK A;  1JVW A;  1FKT A;  3O5G A;  2ZR4 A;  4URI A;  4W9P A;  1FJD A;  1FFR A;  1FFQ A;  2M08 A;  1OGG A;  2G41 A;  4DRM A;  4S3K A;  2DT2 A;  2LGO A;  4Z2L A;  1FD9 A;  1GPF A;  2A3A A;  1ZK6 A;  3KAF A;  1W1V A;  5I98 A;  3O5J A;  1WB0 A;  1XHG A;  1QPL A;  4MSP A;  2WLZ A;  2RUQ A;  1D2K A;  4ODO A;  4U85 A;  3TC5 A;  3ARR A;  4L72 B;  3UI5 A;  1NWT A;  3O5K A;  2MLY A;  2QF8 A;  2OFN A;  3NRK A;  3WD3 A;  4LGX A;  3UQA A;  5HWB A;  1EHN A;  3LUO A;  1W26 A;  5HBF A;  3JYM A;  2MNT A;  2ESC A;  1ZBV A;  5HW6 A;  1QZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...