2RQSA

3d structure of pin from the psychrophilic archeon cenarcheaum symbiosum (cspin)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
97
structure length
97
Chain Sequence
GPMGSMADKIKCSHILVKKQGEALAVQERLKAGEKFGKLAKELSIDGGSAKRDGSLGYFGRGKMVKPFEDAAFRLQVGEVSEPVKSEFGYHVIKRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Dynamics of the First Archaeal Parvulin Reveal a New Functionally Important Loop in Parvulin-type Prolyl Isomerases
pubmed doi rcsb
source organism Cenarchaeum symbiosum
molecule tags Isomerase
molecule keywords Parvulin-like peptidyl-prolyl isomerase
total genus 15
structure length 97
sequence length 97
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13616 Rotamase_3 PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2rqsA00
1NMWA 1F40A 4U86A 4DRMA 1BL4A 3RGCA 3KCEA 3TDBA 4DRPA 4QT2A 3GPKA 5J6EA 1PBKA 3KACA 1F8AB 3O5KA 2N87A 3UQIA 1Q6HA 2Y78A 2XP7A 4MSPA 4ODPA 5D75A 1YW5A 3JYMA 2RSEA 3CGNA 4LAYA 4R0XA 2RUCA 3H9RB 4U85A 4TW7A 1L1PA 3B7XA 1ROUA 2D9FA 1QZ2A 4ODKA 2XP5A 4ODMA 2LKNA 4DZ3A 3IKGA 1FKJA 1HXVA 3NRKA 4ITZA 4DRHA 3KAIA 1FKIA 1W26A 4LAVA 3UI4A 4JYSA 2LJ4A 4DRQA 4MGVA 2ZQTA 5HTGA 3O5EA 5HWBA 3EY6A 3UQBA 1QPFA 1M5YA 3VAWA 4DRIA 1FKHA 3IHZA 1Q6IA 2PV2A 3O5GA 4IQ2A 1P5QA 3MDYB 3KABA 3O5PA 1NSGA 2MF9A 4N19A 3UI6A 2LPVA 2KFWA 5BXJA 1FKDA 4DRNA 2ZQVA 2JZVA 3KADA 1PINA 4JFLA 5DIUA 3KAGA 1D7JA 1FKFA 3OOBA 1JNTA 4TX0A 1D6OA 1QPLA 2FKEA 4QT3A 2IF4A 5DIVA 2F21A 4ODRA 1C9HA 3PA7A 2VN1A 2VCDA 1T11A 1J4IA 5HKGA 4LAXA 2PPPA 1FAPA 1Y0OA 2K8IA 1TCOC 1FKRA 1FKGA 2Q5AA 4JFJA 2ZR4A 4DIPA 3NTPA 1NMVA 4GGQA 2RQSA 4J4OA 1FKLA 3NI6A 3O5IA 3I6CA 3TC5A 4DH0A 3LUOA 1FKTA 2DG4A 3FAPA 4O2TA 2MPHA 4TYOA 4BF8A 1FKKA 1BKFA 4LAWA 3PRBA 3O5LA 4W9QA 1KT0A 1D7HA 2PV1A 3KAHA 4IQCA 4ODQA 2MLYA 3JYJA 2ZR5A 3IKDA 1FD9A 2L2SA 5DITA 1Q1CA 1JNSA 1A7XA 4G50A 3WH0A 2KGJA 2RUDA 4TW6A 1FKSA 4DROA 4U84A 3RFWA 5GPGA 1U79A 2XPBA 2XP3A 2XPAA 4JFKA 4FN2A 4C02B 3UQAA 2KR7A 4ODNA 3O5DA 2F4EA 4W9OA 2M2AA 1Q6UA 1J4RA 5B8IC 2KI3A 1ZK6A 1ROTA 4IPXA 3JXVA 3PRDA 2ZQSA 2RUQA 2F2DA 1J6YA 3O5QA 3O5FA 4JFMA 4FAPA 2MLZA 2OFNA 4QIBA 2XP8A 2PPOA 1N1AA 2FAPA 2PPNA 3O5JA 4GIVA 4J4NA 1B6CA 2ZR6A 3CGMA 3KZ7A 1EYMA 4JFIA 2ZQUA 4NNRA 2MLXA 2DG3A 3O5OA 4ODOA 3UF8A 4DRJA 5HW7A 1FJDA 3TCZA 1EQ3A 2LGOA 2ITKA 2UZ5A 5I98A 1YATA 2XP4A 3ODKA 5HW8A 2AWGA 1JVWA 1D7IA 2KO7A 3IK8A 4ODLA 3O5RA 4G2PA 1R9HA 4W9PA 4TNSA 4TW8A 4DZ2A 2PV3A 2KE0A 2PBCA 5HT1A 1KT1A 2MNTA 2RURA 3O5MA 3UI5A 2M1IA 4DRKA 2XP9A 2XP6A 5HW6A 5HWCA 1ZCNA 2M08A 4DT4A 3KAFA 1FKBA 2DG9A 1J4HA 5HUAA
chains in the Genus database with same CATH superfamily
1NMWA 1NWUA 3ARVA 4DRMA 1F40A 3KCEA 3TDBA 1HKIA 2Y78A 1HKJA 3ALGA 3G6MA 5D75A 5GQBA 4LAYA 4R0XA 2RUCA 3CHEA 2D9FA 4ODKA 4DZ3A 2A3CA 3NRKA 4ITZA 4DRHA 3CH9A 1KFWA 3OA5A 1FFQA 4AY1A 2LJ4A 5HWBA 1QPFA 3AQUA 4KR0B 1UR8A 3VAWA 3O5GA 3WD4A 2MF9A 3AROA 4N19A 1W1VA 4DRNA 2JZVA 2O92A 3KAGA 1D7JA 1D6OA 1QPLA 4QT3A 4DWSC 2G41A 1W1YA 2IF4A 2F21A 3EIPA 2B5UB 1C9HA 2VCDA 4L72B 1Y0OA 2K8IA 2Q5AA 3NTPA 1LG1A 4J4OA 1FKLA 1WB0A 1EDQA 3ARTA 4DWSA 3NI6A 1GPFA 1NWSA 2MPHA 4BF8A 3BMBA 1BKFA 3ALFA 4ML4A 3KAHA 2PV1A 1IX5A 3WL0A 2ZR5A 3B9DA 1JNSA 1A7XA 3WH0A 3WD3A 4TW6A 1HKMA 2XPAA 4FN2A 4HBOA 2KR7A 3CHCA 4W9OA 5B8IC 1ROTA 3W4RA 2WK2A 3JXVA 1RD6A 2WM0A 2RUQA 2MLZA 2FAPA 4J4NA 2ZR6A 4NNRA 2ZQUA 3UF8A 2DG3A 3GU0A 1D2KA 2ITKA 3ARPA 3ODKA 2KO7A 1JVWA 1D7IA 4G2PA 1R9HA 4TNSA 4UDMA 3RM8A 1W1TA 4MNJA 2RURA 5GPRA 4S3KA 5HW6A 5HWCA 2DSVA 1FKBA 4U86A 4Z2GA 4WJXA 4Z2LA 4DRPA 4QT2A 4ZS6A 3KACA 3UQIA 4ZPVR 1YW5A 3JYMA 4R5EA 3CGNA 4Z2KA 1HJXA 1ROUA 3IKGA 1FKJA 1HXVA 1WNOA 4JYSA 3CZ8A 4MGVA 3O5EA 3EY6A 4W5UA 3WKZA 1M5YA 4DRIA 2WLYA 1Q6IA 3MDYB 1EHNA 3O5PA 3UI6A 2KFWA 5BXJA 4WKHA 1FKDA 4JFLA 3KADA 2PI6A 3BXWA 1FKFA 4P8WA 3FXYA 2OLHA 4TX0A 2DT2A 2P4VA 5DIVA 1TFVA 1ZB5A 4ODRA 1E6PA 3PA7A 2VN1A 1T11A 1J4IA 4LAXA 1E9LA 1FAPA 1OGGA 2ZR4A 4DIPA 1NMVA 2RQSA 2O9OA 3O5IA 2A3AA 2DG4A 3B8SA 4WKAA 4IQCA 4P8VA 1OWQA 1E6RA 3IKDA 1XRVA 1W9VA 3AS2A 4NZCA 3RMEA 2RUDA 4U84A 1U79A 4ODNA 3O5DA 2M2AA 4LGXA 1J4RA 4WK9A 1JNDA 1ZBVA 2F2DA 4WKFA 4JFMA 3FY1A 2OFNA 2PPNA 1JNEA 4ODOA 4DRJA 2LGOA 1HKKA 2IUZA 5I98A 2AWGA 4ODLA 2DT1A 3O5RA 1NH6A 2PV3A 1K9TA 5JH8A 4P8UA 4MAVA 1KT1A 2XP6A 1ZCNA 2M08A 1E6NA 4PTMA 4MPKA 1BL4A 5HBFA 3WD2A 3RGCA 1PBKA 3ARRA 1F8AB 4Z2HA 1CTNA 4L3NA 1SR0A 4MSPA 3CHDA 4ODPA 4DWSB 2ETNA 2RSEA 3H9RB 4U85A 1L1PA 4TW7A 3B7XA 1QZ2A 5DF0A 4S3JA 1H0GA 1GOIA 4LAVA 1EIBA 5DEZA 4HBEA 1UR9A 1FKHA 3IHZA 1W9UA 3ARXA 2A3BA 3KABA 4XAKA 3WD0A 2LPVA 3WQWA 2YBTA 1PINA 4IT4A 1JNTA 2FKEA 4Q22A 4URIA 5HKGA 4GGQA 4MNKA 3I6CA 4DH0A 3LUOA 1FKTA 1NWRA 3FAPA 3PRAA 1E15A 2DSWA 4TYOA 4MNMA 4LAWA 2MLYA 4IT6A 2L2SA 2YBUA 1Q1CA 4ZPTR 2ESCA 2KGJA 1SYTA 1FKSA 4DROA 3RFWA 1WAWA 3ARZA 4MTVA 5GPGA 4Q7NA 4JFKA 1X6NA 1ZBKA 2KI3A 1LQ0A 4Z2IA 1E6ZA 4IPXA 4DWSD 2ZQSA 1W1PA 1J6YA 4FAPA 2B31A 3WL1A 2PPOA 1B6CA 3CGMA 3KZ7A 5HW7A 1E44A 1FJDA 3TCZA 2UZ5A 3ARYA 2XP4A 1LL4A 1NWTA 3IK8A 4W9PA 2DSUA 4TW8A 4DZ2A 2WLZA 1ITXA 4NSBA 3UI5A 3KAFA 4P8XA 3O5FA 3ARWA 3RM4A 3B9AA 2EULA 4HARA 3RM9A 3GPKA 5J6EA 3O5KA 2N87A 1Q6HA 3WQVA 2XP7A 4MNLA 3AS3A 4Z2JA 1O6IA 2DSZA 2XP5A 4ODMA 2LKNA 1OGBA 3KAIA 1FKIA 1W26A 3UI4A 4ZPWR 4DRQA 3QOKA 2ZQTA 1H0IA 5HTGA 3UQBA 2FDMA 1GRJA 1JCHB 3GTYX 2PV2A 3ARUA 4IQ2A 1P5QA 2F23A 2AOSA 1NSGA 2ZQVA 5DIUA 2PN0A 3AS0A 1ZBCA 1ZBWA 1ZU8A 2A3EA 3OOBA 1XHGA 3B9EA 2PPPA 1TCOC 1FKRA 1FKGA 1ZL1A 2DT3A 4JFJA 3WIJA 1LJYA 4KQZA 4WIWA 3TC5A 4O2TA 3ARQA 1FKKA 3CHFA 3PRBA 3O5LA 4W9QA 1KT0A 1D7HA 4ODQA 5DO2A 3JYJA 1FD9A 5DITA 1HJWA 4G50A 3ARSA 2XPBA 2XP3A 4C02B 3UQAA 1VF8A 2F4EA 2DPEA 1HJVA 1Q6UA 1LG2A 1ZK6A 4QZVB 3PR9A 2DT0A 3PRDA 3AS1A 1LL6A 3O5QA 4QIBA 2XP8A 3O5JA 1N1AA 1GUVA 4GIVA 4JFIA 1EYMA 2MLXA 3O5OA 1LL7A 1EQ3A 2G8ZA 1YATA 5HW8A 3G6LA 2QF8A 3WD1A 1X6LA 2KE0A 2PBCA 5HT1A 2MNTA 3O5MA 2M1IA 4DRKA 2XP9A 1W9PA 4DT4A 2DG9A 1J4HA 1FFRA 5HUAA
chains in the Genus database with same CATH topology
1NMWA 1NWUA 3ARVA 4DRMA 1F40A 3KCEA 3TDBA 1HKIA 2Y78A 1HKJA 3ALGA 3G6MA 5D75A 5GQBA 4LAYA 4R0XA 2RUCA 3CHEA 2D9FA 4ODKA 4DZ3A 2A3CA 3NRKA 4ITZA 4DRHA 3CH9A 1KFWA 3OA5A 1FFQA 4AY1A 2LJ4A 5HWBA 1QPFA 3AQUA 4KR0B 1UR8A 3VAWA 3O5GA 3WD4A 2MF9A 3AROA 4N19A 1W1VA 4DRNA 2JZVA 2O92A 3KAGA 1D7JA 1D6OA 1QPLA 4QT3A 4DWSC 2G41A 1W1YA 2IF4A 2F21A 1C9HA 2VCDA 4L72B 1Y0OA 2K8IA 2Q5AA 3NTPA 1LG1A 4J4OA 1FKLA 1WB0A 1EDQA 3ARTA 4DWSA 3NI6A 1GPFA 1NWSA 2MPHA 4BF8A 1BKFA 3ALFA 4ML4A 3KAHA 2PV1A 1IX5A 3WL0A 2ZR5A 3B9DA 1JNSA 1A7XA 3WH0A 3WD3A 4TW6A 1HKMA 2XPAA 4FN2A 4HBOA 2KR7A 3CHCA 4W9OA 5B8IC 1ROTA 3W4RA 2WK2A 3JXVA 1RD6A 2WM0A 2RUQA 2MLZA 2FAPA 4J4NA 2ZR6A 4NNRA 2ZQUA 3UF8A 2DG3A 1D2KA 2ITKA 3ARPA 3ODKA 2KO7A 1JVWA 1D7IA 4G2PA 1R9HA 4TNSA 3RM8A 1W1TA 4MNJA 2RURA 5GPRA 4S3KA 5HW6A 5HWCA 2DSVA 1FKBA 4U86A 4Z2GA 4WJXA 4Z2LA 4DRPA 4QT2A 4ZS6A 3KACA 3UQIA 4ZPVR 1YW5A 3JYMA 4R5EA 3CGNA 4Z2KA 1HJXA 1ROUA 3IKGA 1FKJA 1HXVA 1WNOA 4JYSA 3CZ8A 4MGVA 3O5EA 3EY6A 4W5UA 3WKZA 1M5YA 4DRIA 2WLYA 1Q6IA 3MDYB 1EHNA 3O5PA 3UI6A 2KFWA 5BXJA 4WKHA 1FKDA 4JFLA 3KADA 2PI6A 3BXWA 1FKFA 4P8WA 3FXYA 2OLHA 4TX0A 2DT2A 5DIVA 1TFVA 1ZB5A 4ODRA 1E6PA 3PA7A 2VN1A 1T11A 1J4IA 4LAXA 1E9LA 1FAPA 1OGGA 2ZR4A 4DIPA 1NMVA 2RQSA 2O9OA 3O5IA 2A3AA 2DG4A 3B8SA 4WKAA 4IQCA 4P8VA 1OWQA 1E6RA 3IKDA 1XRVA 1W9VA 3AS2A 4NZCA 3RMEA 2RUDA 4U84A 1U79A 4ODNA 3O5DA 2M2AA 4LGXA 1J4RA 4WK9A 1JNDA 1ZBVA 2F2DA 4WKFA 4JFMA 3FY1A 2OFNA 2PPNA 1JNEA 4ODOA 4DRJA 2LGOA 1HKKA 2IUZA 5I98A 2AWGA 4ODLA 2DT1A 3O5RA 1NH6A 2PV3A 1K9TA 5JH8A 4P8UA 4MAVA 1KT1A 2XP6A 1ZCNA 2M08A 1E6NA 4PTMA 4MPKA 1BL4A 5HBFA 3WD2A 3RGCA 1PBKA 3ARRA 1F8AB 4Z2HA 1CTNA 4L3NA 1SR0A 4MSPA 3CHDA 4ODPA 4DWSB 2RSEA 3H9RB 4U85A 1L1PA 4TW7A 3B7XA 1QZ2A 5DF0A 4S3JA 1H0GA 1GOIA 4LAVA 1EIBA 5DEZA 4HBEA 1UR9A 1FKHA 3IHZA 1W9UA 3ARXA 2A3BA 3KABA 4XAKA 3WD0A 2LPVA 3WQWA 2YBTA 1PINA 4IT4A 1JNTA 2FKEA 4Q22A 4URIA 5HKGA 4GGQA 4MNKA 3I6CA 4DH0A 3LUOA 1FKTA 1NWRA 3FAPA 3PRAA 1E15A 2DSWA 4TYOA 4MNMA 4LAWA 2MLYA 4IT6A 2L2SA 2YBUA 1Q1CA 4ZPTR 2ESCA 2KGJA 1SYTA 1FKSA 4DROA 3RFWA 1WAWA 3ARZA 4MTVA 5GPGA 4Q7NA 4JFKA 1X6NA 1ZBKA 2KI3A 1LQ0A 4Z2IA 1E6ZA 4IPXA 4DWSD 2ZQSA 1W1PA 1J6YA 4FAPA 2B31A 3WL1A 2PPOA 1B6CA 3CGMA 3KZ7A 5HW7A 1FJDA 3TCZA 2UZ5A 3ARYA 2XP4A 1LL4A 1NWTA 3IK8A 4W9PA 2DSUA 4TW8A 4DZ2A 2WLZA 1ITXA 4NSBA 3UI5A 3KAFA 4P8XA 3O5FA 3ARWA 3RM4A 3B9AA 4HARA 3RM9A 3GPKA 5J6EA 3O5KA 2N87A 1Q6HA 3WQVA 2XP7A 4MNLA 3AS3A 4Z2JA 1O6IA 2DSZA 2XP5A 4ODMA 2LKNA 1OGBA 3KAIA 1FKIA 1W26A 3UI4A 4ZPWR 4DRQA 3QOKA 2ZQTA 1H0IA 5HTGA 3UQBA 2FDMA 2PV2A 3ARUA 4IQ2A 1P5QA 2AOSA 1NSGA 2ZQVA 5DIUA 3AS0A 1ZBCA 1ZBWA 1ZU8A 2A3EA 3OOBA 1XHGA 3B9EA 2PPPA 1TCOC 1FKRA 1FKGA 1ZL1A 2DT3A 4JFJA 3WIJA 1LJYA 4KQZA 4WIWA 3TC5A 4O2TA 3ARQA 1FKKA 3CHFA 3PRBA 3O5LA 4W9QA 1KT0A 1D7HA 4ODQA 5DO2A 3JYJA 1FD9A 5DITA 1HJWA 4G50A 3ARSA 2XPBA 2XP3A 4C02B 3UQAA 1VF8A 2F4EA 2DPEA 1HJVA 1Q6UA 1LG2A 1ZK6A 4QZVB 3PR9A 2DT0A 3PRDA 3AS1A 1LL6A 3O5QA 4QIBA 2XP8A 3O5JA 1N1AA 1GUVA 4JFIA 4GIVA 1EYMA 2MLXA 3O5OA 1LL7A 1EQ3A 2G8ZA 1YATA 5HW8A 3G6LA 2QF8A 3WD1A 1X6LA 2KE0A 2PBCA 5HT1A 2MNTA 3O5MA 2M1IA 4DRKA 2XP9A 1W9PA 4DT4A 2DG9A 1J4HA 1FFRA 5HUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NMW A;  1F40 A;  4U86 A;  4DRM A;  1BL4 A;  3RGC A;  3KCE A;  3TDB A;  4DRP A;  4QT2 A;  3GPK A;  5J6E A;  1PBK A;  3KAC A;  1F8A B;  3O5K A;  2N87 A;  3UQI A;  1Q6H A;  2Y78 A;  2XP7 A;  4MSP A;  4ODP A;  5D75 A;  1YW5 A;  3JYM A;  2RSE A;  3CGN A;  4LAY A;  4R0X A;  2RUC A;  3H9R B;  4U85 A;  4TW7 A;  1L1P A;  3B7X A;  1ROU A;  2D9F A;  1QZ2 A;  4ODK A;  2XP5 A;  4ODM A;  2LKN A;  4DZ3 A;  3IKG A;  1FKJ A;  1HXV A;  3NRK A;  4ITZ A;  4DRH A;  3KAI A;  1FKI A;  1W26 A;  4LAV A;  3UI4 A;  4JYS A;  2LJ4 A;  4DRQ A;  4MGV A;  2ZQT A;  5HTG A;  3O5E A;  5HWB A;  3EY6 A;  3UQB A;  1QPF A;  1M5Y A;  3VAW A;  4DRI A;  1FKH A;  3IHZ A;  1Q6I A;  2PV2 A;  3O5G A;  4IQ2 A;  1P5Q A;  3MDY B;  3KAB A;  3O5P A;  1NSG A;  2MF9 A;  4N19 A;  3UI6 A;  2LPV A;  2KFW A;  5BXJ A;  1FKD A;  4DRN A;  2ZQV A;  2JZV A;  3KAD A;  1PIN A;  4JFL A;  5DIU A;  3KAG A;  1D7J A;  1FKF A;  3OOB A;  1JNT A;  4TX0 A;  1D6O A;  1QPL A;  2FKE A;  4QT3 A;  2IF4 A;  5DIV A;  2F21 A;  4ODR A;  1C9H A;  3PA7 A;  2VN1 A;  2VCD A;  1T11 A;  1J4I A;  5HKG A;  4LAX A;  2PPP A;  1FAP A;  1Y0O A;  2K8I A;  1TCO C;  1FKR A;  1FKG A;  2Q5A A;  4JFJ A;  2ZR4 A;  4DIP A;  3NTP A;  1NMV A;  4GGQ A;  2RQS A;  4J4O A;  1FKL A;  3NI6 A;  3O5I A;  3I6C A;  3TC5 A;  4DH0 A;  3LUO A;  1FKT A;  2DG4 A;  3FAP A;  4O2T A;  2MPH A;  4TYO A;  4BF8 A;  1FKK A;  1BKF A;  4LAW A;  3PRB A;  3O5L A;  4W9Q A;  1KT0 A;  1D7H A;  2PV1 A;  3KAH A;  4IQC A;  4ODQ A;  2MLY A;  3JYJ A;  2ZR5 A;  3IKD A;  1FD9 A;  2L2S A;  5DIT A;  1Q1C A;  1JNS A;  1A7X A;  4G50 A;  3WH0 A;  2KGJ A;  2RUD A;  4TW6 A;  1FKS A;  4DRO A;  4U84 A;  3RFW A;  5GPG A;  1U79 A;  2XPB A;  2XP3 A;  2XPA A;  4JFK A;  4FN2 A;  4C02 B;  3UQA A;  2KR7 A;  4ODN A;  3O5D A;  2F4E A;  4W9O A;  2M2A A;  1Q6U A;  1J4R A;  5B8I C;  2KI3 A;  1ZK6 A;  1ROT A;  4IPX A;  3JXV A;  3PRD A;  2ZQS A;  2RUQ A;  2F2D A;  1J6Y A;  3O5Q A;  3O5F A;  4JFM A;  4FAP A;  2MLZ A;  2OFN A;  4QIB A;  2XP8 A;  2PPO A;  1N1A A;  2FAP A;  2PPN A;  3O5J A;  4GIV A;  4J4N A;  1B6C A;  2ZR6 A;  3CGM A;  3KZ7 A;  1EYM A;  4JFI A;  2ZQU A;  4NNR A;  2MLX A;  2DG3 A;  3O5O A;  4ODO A;  3UF8 A;  4DRJ A;  5HW7 A;  1FJD A;  3TCZ A;  1EQ3 A;  2LGO A;  2ITK A;  2UZ5 A;  5I98 A;  1YAT A;  2XP4 A;  3ODK A;  5HW8 A;  2AWG A;  1JVW A;  1D7I A;  2KO7 A;  3IK8 A;  4ODL A;  3O5R A;  4G2P A;  1R9H A;  4W9P A;  4TNS A;  4TW8 A;  4DZ2 A;  2PV3 A;  2KE0 A;  2PBC A;  5HT1 A;  1KT1 A;  2MNT A;  2RUR A;  3O5M A;  3UI5 A;  2M1I A;  4DRK A;  2XP9 A;  2XP6 A;  5HW6 A;  5HWC A;  1ZCN A;  2M08 A;  4DT4 A;  3KAF A;  1FKB A;  2DG9 A;  1J4H A;  5HUA A; 
#chains in the Genus database with same CATH topology
 1NMW A;  1NWU A;  3ARV A;  4DRM A;  1F40 A;  3KCE A;  3TDB A;  1HKI A;  2Y78 A;  1HKJ A;  3ALG A;  3G6M A;  5D75 A;  5GQB A;  4LAY A;  4R0X A;  2RUC A;  3CHE A;  2D9F A;  4ODK A;  4DZ3 A;  2A3C A;  3NRK A;  4ITZ A;  4DRH A;  3CH9 A;  1KFW A;  3OA5 A;  1FFQ A;  4AY1 A;  2LJ4 A;  5HWB A;  1QPF A;  3AQU A;  4KR0 B;  1UR8 A;  3VAW A;  3O5G A;  3WD4 A;  2MF9 A;  3ARO A;  4N19 A;  1W1V A;  4DRN A;  2JZV A;  2O92 A;  3KAG A;  1D7J A;  1D6O A;  1QPL A;  4QT3 A;  4DWS C;  2G41 A;  1W1Y A;  2IF4 A;  2F21 A;  3EIP A;  2B5U B;  1C9H A;  2VCD A;  4L72 B;  1Y0O A;  2K8I A;  2Q5A A;  3NTP A;  1LG1 A;  4J4O A;  1FKL A;  1WB0 A;  1EDQ A;  3ART A;  4DWS A;  3NI6 A;  1GPF A;  1NWS A;  2MPH A;  4BF8 A;  3BMB A;  1BKF A;  3ALF A;  4ML4 A;  3KAH A;  2PV1 A;  1IX5 A;  3WL0 A;  2ZR5 A;  3B9D A;  1JNS A;  1A7X A;  3WH0 A;  3WD3 A;  4TW6 A;  1HKM A;  2XPA A;  4FN2 A;  4HBO A;  2KR7 A;  3CHC A;  4W9O A;  5B8I C;  1ROT A;  3W4R A;  2WK2 A;  3JXV A;  1RD6 A;  2WM0 A;  2RUQ A;  2MLZ A;  2FAP A;  4J4N A;  2ZR6 A;  4NNR A;  2ZQU A;  3UF8 A;  2DG3 A;  3GU0 A;  1D2K A;  2ITK A;  3ARP A;  3ODK A;  2KO7 A;  1JVW A;  1D7I A;  4G2P A;  1R9H A;  4TNS A;  4UDM A;  3RM8 A;  1W1T A;  4MNJ A;  2RUR A;  5GPR A;  4S3K A;  5HW6 A;  5HWC A;  2DSV A;  1FKB A;  4U86 A;  4Z2G A;  4WJX A;  4Z2L A;  4DRP A;  4QT2 A;  4ZS6 A;  3KAC A;  3UQI A;  4ZPV R;  1YW5 A;  3JYM A;  4R5E A;  3CGN A;  4Z2K A;  1HJX A;  1ROU A;  3IKG A;  1FKJ A;  1HXV A;  1WNO A;  4JYS A;  3CZ8 A;  4MGV A;  3O5E A;  3EY6 A;  4W5U A;  3WKZ A;  1M5Y A;  4DRI A;  2WLY A;  1Q6I A;  3MDY B;  1EHN A;  3O5P A;  3UI6 A;  2KFW A;  5BXJ A;  4WKH A;  1FKD A;  4JFL A;  3KAD A;  2PI6 A;  3BXW A;  1FKF A;  4P8W A;  3FXY A;  2OLH A;  4TX0 A;  2DT2 A;  2P4V A;  5DIV A;  1TFV A;  1ZB5 A;  4ODR A;  1E6P A;  3PA7 A;  2VN1 A;  1T11 A;  1J4I A;  4LAX A;  1E9L A;  1FAP A;  1OGG A;  2ZR4 A;  4DIP A;  1NMV A;  2RQS A;  2O9O A;  3O5I A;  2A3A A;  2DG4 A;  3B8S A;  4WKA A;  4IQC A;  4P8V A;  1OWQ A;  1E6R A;  3IKD A;  1XRV A;  1W9V A;  3AS2 A;  4NZC A;  3RME A;  2RUD A;  4U84 A;  1U79 A;  4ODN A;  3O5D A;  2M2A A;  4LGX A;  1J4R A;  4WK9 A;  1JND A;  1ZBV A;  2F2D A;  4WKF A;  4JFM A;  3FY1 A;  2OFN A;  2PPN A;  1JNE A;  4ODO A;  4DRJ A;  2LGO A;  1HKK A;  2IUZ A;  5I98 A;  2AWG A;  4ODL A;  2DT1 A;  3O5R A;  1NH6 A;  2PV3 A;  1K9T A;  5JH8 A;  4P8U A;  4MAV A;  1KT1 A;  2XP6 A;  1ZCN A;  2M08 A;  1E6N A;  4PTM A;  4MPK A;  1BL4 A;  5HBF A;  3WD2 A;  3RGC A;  1PBK A;  3ARR A;  1F8A B;  4Z2H A;  1CTN A;  4L3N A;  1SR0 A;  4MSP A;  3CHD A;  4ODP A;  4DWS B;  2ETN A;  2RSE A;  3H9R B;  4U85 A;  1L1P A;  4TW7 A;  3B7X A;  1QZ2 A;  5DF0 A;  4S3J A;  1H0G A;  1GOI A;  4LAV A;  1EIB A;  5DEZ A;  4HBE A;  1UR9 A;  1FKH A;  3IHZ A;  1W9U A;  3ARX A;  2A3B A;  3KAB A;  4XAK A;  3WD0 A;  2LPV A;  3WQW A;  2YBT A;  1PIN A;  4IT4 A;  1JNT A;  2FKE A;  4Q22 A;  4URI A;  5HKG A;  4GGQ A;  4MNK A;  3I6C A;  4DH0 A;  3LUO A;  1FKT A;  1NWR A;  3FAP A;  3PRA A;  1E15 A;  2DSW A;  4TYO A;  4MNM A;  4LAW A;  2MLY A;  4IT6 A;  2L2S A;  2YBU A;  1Q1C A;  4ZPT R;  2ESC A;  2KGJ A;  1SYT A;  1FKS A;  4DRO A;  3RFW A;  1WAW A;  3ARZ A;  4MTV A;  5GPG A;  4Q7N A;  4JFK A;  1X6N A;  1ZBK A;  2KI3 A;  1LQ0 A;  4Z2I A;  1E6Z A;  4IPX A;  4DWS D;  2ZQS A;  1W1P A;  1J6Y A;  4FAP A;  2B31 A;  3WL1 A;  2PPO A;  1B6C A;  3CGM A;  3KZ7 A;  5HW7 A;  1E44 A;  1FJD A;  3TCZ A;  2UZ5 A;  3ARY A;  2XP4 A;  1LL4 A;  1NWT A;  3IK8 A;  4W9P A;  2DSU A;  4TW8 A;  4DZ2 A;  2WLZ A;  1ITX A;  4NSB A;  3UI5 A;  3KAF A;  4P8X A;  3O5F A;  3ARW A;  3RM4 A;  3B9A A;  2EUL A;  4HAR A;  3RM9 A;  3GPK A;  5J6E A;  3O5K A;  2N87 A;  1Q6H A;  3WQV A;  2XP7 A;  4MNL A;  3AS3 A;  4Z2J A;  1O6I A;  2DSZ A;  2XP5 A;  4ODM A;  2LKN A;  1OGB A;  3KAI A;  1FKI A;  1W26 A;  3UI4 A;  4ZPW R;  4DRQ A;  3QOK A;  2ZQT A;  1H0I A;  5HTG A;  3UQB A;  2FDM A;  1GRJ A;  1JCH B;  3GTY X;  2PV2 A;  3ARU A;  4IQ2 A;  1P5Q A;  2F23 A;  2AOS A;  1NSG A;  2ZQV A;  5DIU A;  2PN0 A;  3AS0 A;  1ZBC A;  1ZBW A;  1ZU8 A;  2A3E A;  3OOB A;  1XHG A;  3B9E A;  2PPP A;  1TCO C;  1FKR A;  1FKG A;  1ZL1 A;  2DT3 A;  4JFJ A;  3WIJ A;  1LJY A;  4KQZ A;  4WIW A;  3TC5 A;  4O2T A;  3ARQ A;  1FKK A;  3CHF A;  3PRB A;  3O5L A;  4W9Q A;  1KT0 A;  1D7H A;  4ODQ A;  5DO2 A;  3JYJ A;  1FD9 A;  5DIT A;  1HJW A;  4G50 A;  3ARS A;  2XPB A;  2XP3 A;  4C02 B;  3UQA A;  1VF8 A;  2F4E A;  2DPE A;  1HJV A;  1Q6U A;  1LG2 A;  1ZK6 A;  4QZV B;  3PR9 A;  2DT0 A;  3PRD A;  3AS1 A;  1LL6 A;  3O5Q A;  4QIB A;  2XP8 A;  3O5J A;  1N1A A;  1GUV A;  4GIV A;  4JFI A;  1EYM A;  2MLX A;  3O5O A;  1LL7 A;  1EQ3 A;  2G8Z A;  1YAT A;  5HW8 A;  3G6L A;  2QF8 A;  3WD1 A;  1X6L A;  2KE0 A;  2PBC A;  5HT1 A;  2MNT A;  3O5M A;  2M1I A;  4DRK A;  2XP9 A;  1W9P A;  4DT4 A;  2DG9 A;  1J4H A;  1FFR A;  5HUA A; 
#chains in the Genus database with same CATH homology
 1NMW A;  1NWU A;  3ARV A;  4DRM A;  1F40 A;  3KCE A;  3TDB A;  1HKI A;  2Y78 A;  1HKJ A;  3ALG A;  3G6M A;  5D75 A;  5GQB A;  4LAY A;  4R0X A;  2RUC A;  3CHE A;  2D9F A;  4ODK A;  4DZ3 A;  2A3C A;  3NRK A;  4ITZ A;  4DRH A;  3CH9 A;  1KFW A;  3OA5 A;  1FFQ A;  4AY1 A;  2LJ4 A;  5HWB A;  1QPF A;  3AQU A;  4KR0 B;  1UR8 A;  3VAW A;  3O5G A;  3WD4 A;  2MF9 A;  3ARO A;  4N19 A;  1W1V A;  4DRN A;  2JZV A;  2O92 A;  3KAG A;  1D7J A;  1D6O A;  1QPL A;  4QT3 A;  4DWS C;  2G41 A;  1W1Y A;  2IF4 A;  2F21 A;  1C9H A;  2VCD A;  4L72 B;  1Y0O A;  2K8I A;  2Q5A A;  3NTP A;  1LG1 A;  4J4O A;  1FKL A;  1WB0 A;  1EDQ A;  3ART A;  4DWS A;  3NI6 A;  1GPF A;  1NWS A;  2MPH A;  4BF8 A;  1BKF A;  3ALF A;  4ML4 A;  3KAH A;  2PV1 A;  1IX5 A;  3WL0 A;  2ZR5 A;  3B9D A;  1JNS A;  1A7X A;  3WH0 A;  3WD3 A;  4TW6 A;  1HKM A;  2XPA A;  4FN2 A;  4HBO A;  2KR7 A;  3CHC A;  4W9O A;  5B8I C;  1ROT A;  3W4R A;  2WK2 A;  3JXV A;  1RD6 A;  2WM0 A;  2RUQ A;  2MLZ A;  2FAP A;  4J4N A;  2ZR6 A;  4NNR A;  2ZQU A;  3UF8 A;  2DG3 A;  1D2K A;  2ITK A;  3ARP A;  3ODK A;  2KO7 A;  1JVW A;  1D7I A;  4G2P A;  1R9H A;  4TNS A;  3RM8 A;  1W1T A;  4MNJ A;  2RUR A;  5GPR A;  4S3K A;  5HW6 A;  5HWC A;  2DSV A;  1FKB A;  4U86 A;  4Z2G A;  4WJX A;  4Z2L A;  4DRP A;  4QT2 A;  4ZS6 A;  3KAC A;  3UQI A;  4ZPV R;  1YW5 A;  3JYM A;  4R5E A;  3CGN A;  4Z2K A;  1HJX A;  1ROU A;  3IKG A;  1FKJ A;  1HXV A;  1WNO A;  4JYS A;  3CZ8 A;  4MGV A;  3O5E A;  3EY6 A;  4W5U A;  3WKZ A;  1M5Y A;  4DRI A;  2WLY A;  1Q6I A;  3MDY B;  1EHN A;  3O5P A;  3UI6 A;  2KFW A;  5BXJ A;  4WKH A;  1FKD A;  4JFL A;  3KAD A;  2PI6 A;  3BXW A;  1FKF A;  4P8W A;  3FXY A;  2OLH A;  4TX0 A;  2DT2 A;  5DIV A;  1TFV A;  1ZB5 A;  4ODR A;  1E6P A;  3PA7 A;  2VN1 A;  1T11 A;  1J4I A;  4LAX A;  1E9L A;  1FAP A;  1OGG A;  2ZR4 A;  4DIP A;  1NMV A;  2RQS A;  2O9O A;  3O5I A;  2A3A A;  2DG4 A;  3B8S A;  4WKA A;  4IQC A;  4P8V A;  1OWQ A;  1E6R A;  3IKD A;  1XRV A;  1W9V A;  3AS2 A;  4NZC A;  3RME A;  2RUD A;  4U84 A;  1U79 A;  4ODN A;  3O5D A;  2M2A A;  4LGX A;  1J4R A;  4WK9 A;  1JND A;  1ZBV A;  2F2D A;  4WKF A;  4JFM A;  3FY1 A;  2OFN A;  2PPN A;  1JNE A;  4ODO A;  4DRJ A;  2LGO A;  1HKK A;  2IUZ A;  5I98 A;  2AWG A;  4ODL A;  2DT1 A;  3O5R A;  1NH6 A;  2PV3 A;  1K9T A;  5JH8 A;  4P8U A;  4MAV A;  1KT1 A;  2XP6 A;  1ZCN A;  2M08 A;  1E6N A;  4PTM A;  4MPK A;  1BL4 A;  5HBF A;  3WD2 A;  3RGC A;  1PBK A;  3ARR A;  1F8A B;  4Z2H A;  1CTN A;  4L3N A;  1SR0 A;  4MSP A;  3CHD A;  4ODP A;  4DWS B;  2RSE A;  3H9R B;  4U85 A;  1L1P A;  4TW7 A;  3B7X A;  1QZ2 A;  5DF0 A;  4S3J A;  1H0G A;  1GOI A;  4LAV A;  1EIB A;  5DEZ A;  4HBE A;  1UR9 A;  1FKH A;  3IHZ A;  1W9U A;  3ARX A;  2A3B A;  3KAB A;  4XAK A;  3WD0 A;  2LPV A;  3WQW A;  2YBT A;  1PIN A;  4IT4 A;  1JNT A;  2FKE A;  4Q22 A;  4URI A;  5HKG A;  4GGQ A;  4MNK A;  3I6C A;  4DH0 A;  3LUO A;  1FKT A;  1NWR A;  3FAP A;  3PRA A;  1E15 A;  2DSW A;  4TYO A;  4MNM A;  4LAW A;  2MLY A;  4IT6 A;  2L2S A;  2YBU A;  1Q1C A;  4ZPT R;  2ESC A;  2KGJ A;  1SYT A;  1FKS A;  4DRO A;  3RFW A;  1WAW A;  3ARZ A;  4MTV A;  5GPG A;  4Q7N A;  4JFK A;  1X6N A;  1ZBK A;  2KI3 A;  1LQ0 A;  4Z2I A;  1E6Z A;  4IPX A;  4DWS D;  2ZQS A;  1W1P A;  1J6Y A;  4FAP A;  2B31 A;  3WL1 A;  2PPO A;  1B6C A;  3CGM A;  3KZ7 A;  5HW7 A;  1FJD A;  3TCZ A;  2UZ5 A;  3ARY A;  2XP4 A;  1LL4 A;  1NWT A;  3IK8 A;  4W9P A;  2DSU A;  4TW8 A;  4DZ2 A;  2WLZ A;  1ITX A;  4NSB A;  3UI5 A;  3KAF A;  4P8X A;  3O5F A;  3ARW A;  3RM4 A;  3B9A A;  4HAR A;  3RM9 A;  3GPK A;  5J6E A;  3O5K A;  2N87 A;  1Q6H A;  3WQV A;  2XP7 A;  4MNL A;  3AS3 A;  4Z2J A;  1O6I A;  2DSZ A;  2XP5 A;  4ODM A;  2LKN A;  1OGB A;  3KAI A;  1FKI A;  1W26 A;  3UI4 A;  4ZPW R;  4DRQ A;  3QOK A;  2ZQT A;  1H0I A;  5HTG A;  3UQB A;  2FDM A;  2PV2 A;  3ARU A;  4IQ2 A;  1P5Q A;  2AOS A;  1NSG A;  2ZQV A;  5DIU A;  3AS0 A;  1ZBC A;  1ZBW A;  1ZU8 A;  2A3E A;  3OOB A;  1XHG A;  3B9E A;  2PPP A;  1TCO C;  1FKR A;  1FKG A;  1ZL1 A;  2DT3 A;  4JFJ A;  3WIJ A;  1LJY A;  4KQZ A;  4WIW A;  3TC5 A;  4O2T A;  3ARQ A;  1FKK A;  3CHF A;  3PRB A;  3O5L A;  4W9Q A;  1KT0 A;  1D7H A;  4ODQ A;  5DO2 A;  3JYJ A;  1FD9 A;  5DIT A;  1HJW A;  4G50 A;  3ARS A;  2XPB A;  2XP3 A;  4C02 B;  3UQA A;  1VF8 A;  2F4E A;  2DPE A;  1HJV A;  1Q6U A;  1LG2 A;  1ZK6 A;  4QZV B;  3PR9 A;  2DT0 A;  3PRD A;  3AS1 A;  1LL6 A;  3O5Q A;  4QIB A;  2XP8 A;  3O5J A;  1N1A A;  1GUV A;  4JFI A;  4GIV A;  1EYM A;  2MLX A;  3O5O A;  1LL7 A;  1EQ3 A;  2G8Z A;  1YAT A;  5HW8 A;  3G6L A;  2QF8 A;  3WD1 A;  1X6L A;  2KE0 A;  2PBC A;  5HT1 A;  2MNT A;  3O5M A;  2M1I A;  4DRK A;  2XP9 A;  1W9P A;  4DT4 A;  2DG9 A;  1J4H A;  1FFR A;  5HUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...