2RQSA

3d structure of pin from the psychrophilic archeon cenarcheaum symbiosum (cspin)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
97
structure length
97
Chain Sequence
b'GPMGSMADKIKCSHILVKKQGEALAVQERLKAGEKFGKLAKELSIDGGSAKRDGSLGYFGRGKMVKPFEDAAFRLQVGEVSEPVKSEFGYHVIKRLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Parvulin-like peptidyl-prolyl isomerase
publication title Structure and Dynamics of the First Archaeal Parvulin Reveal a New Functionally Important Loop in Parvulin-type Prolyl Isomerases
pubmed doi rcsb
source organism Cenarchaeum symbiosum
molecule tags Isomerase
total genus 15
structure length 97
sequence length 97
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13616 Rotamase_3 PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2rqsA00
4TW7A 4N19A 2K8IA 3O5JA 2FKEA 2MLXA 3O5QA 1J4IA 1FKTA 2M2AA 5GPGA 3KAGA 1D7HA 1FKIA 2MLYA 3TC5A 1YW5A 1Q6HA 3O5MA 3H9RB 3RFWA 2KE0A 4GGQA 3O5EA 2RSEA 1BL4A 1C9HA 4JFKA 3KAHA 4JFMA 4DRQA 1Q6IA 4W9OA 2M1IA 2PV1A 3LUOA 4G50A 5HTGA 2LKNA 4GIVA 2LPVA 3RGCA 4QT2A 1N1AA 3O5RA 1QPLA 4IQCA 2KGJA 1M5YA 1FKGA 4MGVA 3O5LA 2F4EA 1A7XA 3KABA 4O2TA 4LAYA 2RURA 3JYMA 4ODOA 4LAXA 3MDYB 3NI6A 3NRKA 3O5IA 1L1PA 4BF8A 3TDBA 4ITZA 1Q6UA 2OFNA 2RQSA 1FKJA 5DIVA 4U85A 4DRMA 2D9FA 1EYMA 2ITKA 1FKKA 4ODKA 4DT4A 1T11A 1FKBA 5I98A 5BXJA 4IQ2A 2M08A 2XP7A 2KR7A 3JYJA 2PBCA 2XPBA 5HW6A 3EY6A 3I6CA 1PBKA 2AWGA 4ODLA 3UI4A 5HWBA 2XP5A 4J4OA 3PRDA 1D7IA 1D7JA 1R9HA 5DIUA 1FKSA 3KAIA 4J4NA 4U86A 3UI6A 4FAPA 2PPPA 2MLZA 5B8IC 4FN2A 5HW7A 1QZ2A 1ROUA 3NTPA 3OOBA 1ZCNA 2DG4A 1F8AB 4TNSA 2PV2A 2KFWA 2VCDA 2ZQSA 4C02B 4ODMA 4U84A 3GPKA 1FKHA 3UF8A 1FKFA 4DZ3A 3IKGA 4DIPA 5HT1A 2F2DA 2Q5AA 4LAWA 4DZ2A 3KAFA 3O5PA 4TW6A 4QIBA 4W9PA 1KT1A 3JXVA 2FAPA 3UQIA 1EQ3A 3KCEA 2XP4A 3IK8A 3IKDA 2ZQTA 4DRKA 3UI5A 2KI3A 5HKGA 2PPOA 1FKDA 4DRIA 2XP9A 4JYSA 1J4HA 4NNRA 3ODKA 4R0XA 3O5KA 5D75A 1FD9A 1JNTA 3TCZA 1KT0A 2UZ5A 2MPHA 4TW8A 3UQBA 2PPNA 1P5QA 4TX0A 3O5GA 2ZR6A 2MF9A 3CGNA 1JNSA 2DG9A 2DG3A 4ODPA 2RUCA 2RUQA 4JFLA 4DH0A 4DRPA 2VN1A 1FJDA 1JVWA 3B7XA 3KACA 1NMWA 3O5FA 4MSPA 1Q1CA 2F21A 3WH0A 4IPXA 4DRJA 2ZR4A 4G2PA 1ROTA 1PINA 3O5DA 4ODNA 1B6CA 1FKRA 3PA7A 4DROA 2L2SA 3KADA 1NMVA 5DITA 2XP6A 1FKLA 5HUAA 3UQAA 3IHZA 1YATA 3PRBA 3KZ7A 4DRNA 1D6OA 1J6YA 3FAPA 1F40A 2RUDA 2ZR5A 1W26A 4ODQA 3CGMA 4TYOA 3VAWA 1ZK6A 1TCOC 1QPFA 1Y0OA 2KO7A 2LGOA 4JFIA 1J4RA 4JFJA 4LAVA 1FAPA 5HW8A 2XPAA 3O5OA 2ZQVA 1NSGA 2LJ4A 5J6EA 2IF4A 2XP3A 4ODRA 2XP8A 1HXVA 1U79A 2N87A 4W9QA 2ZQUA 5HWCA 1BKFA 2Y78A 2MNTA 2PV3A 2JZVA 4QT3A 4DRHA
chains in the Genus database with same CATH superfamily
2DT0A 4N19A 4Q22A 3ARYA 1D7HA 2MLYA 4LGXA 2KE0A 3KAHA 1RD6A 4GIVA 1JNDA 1N1AA 3WL1A 1E6RA 1W1PA 4MNKA 2F4EA 1XRVA 4KR0B 1GOIA 4P8VA 4O2TA 2RURA 1W9PA 3GTYX 3MDYB 1WB0A 1E6NA 1L1PA 1XHGA 4BF8A 5GPRA 4ITZA 5DIVA 4U85A 1EYMA 2YBTA 4DT4A 1X6LA 1FKBA 5BXJA 4MTVA 3WQWA 2PI6A 3EY6A 1H0IA 2AWGA 4S3KA 2O92A 1HJWA 1R9HA 1FKSA 1ZL1A 3UI6A 3WQVA 4L3NA 3CH9A 1LL7A 4U84A 3UF8A 3IKGA 3CHEA 2F2DA 4LAWA 3BMBA 1FFRA 2ZQTA 2PPOA 4R0XA 1J4HA 3O5KA 1FD9A 1LG1A 2UZ5A 4TW8A 3WL0A 2DSZA 3CZ8A 4ZPVR 2ZR6A 2MF9A 3CGNA 2DG9A 4ODPA 4DH0A 2RUQA 1FJDA 1LJYA 1JVWA 3B7XA 3KACA 3O5FA 4MSPA 1LQ0A 4G2PA 2P4VA 3ALGA 4P8XA 4DROA 2XP6A 3AS2A 3IHZA 3PRBA 1D6OA 2RUDA 2ZR5A 3AROA 1TCOC 3CHDA 1Y0OA 2KO7A 2DSWA 4LAVA 2LJ4A 5J6EA 1HXVA 2XP8A 2N87A 4W9QA 2WLZA 2ZQUA 1BKFA 4IT4A 5HWBA 2FKEA 1FKTA 3KAGA 1FKIA 3ARPA 1JNEA 3O5MA 3H9RB 1CTNA 2OLHA 4GGQA 3CHFA 2RSEA 1BL4A 1C9HA 1EHNA 2F23A 4WKFA 1X6NA 1Q6IA 4W9OA 1W9UA 2PV1A 4G50A 5HTGA 3B9DA 3RGCA 3GU0A 1QPLA 2A3CA 2KGJA 3RM9A 4DWSA 3KABA 4LAYA 4ODOA 3NRKA 3WD3A 1Q6UA 2RQSA 4L72B 4Z2JA 2AOSA 4P8UA 3PRAA 5JH8A 3AS1A 4DWSD 1H0GA 1NWSA 2M08A 2KR7A 1ITXA 1OGGA 3I6CA 1PBKA 1W1TA 4ODLA 4Z2KA 2FDMA 2XP5A 1WAWA 3QOKA 3PRDA 3KAIA 4Q7NA 4U86A 1LL6A 3WIJA 4FAPA 5B8IC 3OOBA 5HBFA 2PV2A 3RM8A 3CHCA 4AY1A 1FKFA 4DIPA 1D2KA 1SR0A 3B9EA 1FFQA 3O5PA 4W9PA 2FAPA 3UQIA 4MNLA 3IKDA 4MNJA 3UI5A 1HJVA 1FKDA 4DRIA 2XP9A 4JYSA 4HBEA 3ODKA 3TCZA 3ARXA 1P5QA 4TX0A 3O5GA 3B8SA 4DWSB 4W5UA 4S3JA 2VN1A 3WH0A 2ZR4A 4WK9A 1NWRA 1W1VA 4ODNA 2DSVA 2L2SA 5DITA 1VF8A 2DPEA 4DRNA 4QIBA 4JFIA 4WJXA 1J4RA 1ZU8A 1NSGA 3ARRA 2IF4A 4ODRA 1U79A 4Z2IA 2JZVA 4ML4A 5GPGA 4TW7A 2K8IA 1J4IA 1E15A 2M2AA 4PTMA 4HARA 1YW5A 1E6PA 1Q6HA 2ETNA 3O5EA 2O9OA 1KFWA 4DRQA 1JNSA 2M1IA 1NWTA 2DSUA 2LKNA 4IQCA 4WIWA 1M5YA 1W9VA 4MGVA 1A7XA 1OGBA 4LAXA 4MPKA 3NI6A 3O5IA 3TDBA 2OFNA 4DRMA 2D9FA 1FKKA 1OWQA 4ODKA 2G8ZA 1T11A 4XAKA 4NZCA 5I98A 4ZPWR 3JYJA 2XP7A 2PBCA 5DEZA 3WD2A 4J4OA 4Z2HA 1D7IA 3W4RA 1D7JA 5DIUA 4J4NA 1QZ2A 1ROUA 3NTPA 2A3BA 1ZCNA 4TNSA 3RM4A 2ZQSA 3AS3A 4C02B 1FKHA 1KT1A 2A3EA 2IUZA 3ARTA 2XP4A 4DRKA 2KI3A 5HKGA 2QF8A 4NNRA 5D75A 4UDMA 3ARVA 2PPNA 1ZBVA 1E9LA 3RMEA 2DG3A 4Z2LA 2RUCA 4JFLA 1NWUA 2YBUA 1NMWA 2DT2A 4IPXA 4DRJA 3AQUA 2G41A 2B5UB 3O5DA 4HBOA 1GPFA 3PA7A 3FXYA 2WLYA 3ARZA 1JCHB 1FKLA 3ALFA 2B31A 3UQAA 3ARQA 3WD0A 3KZ7A 1J6YA 1F40A 1W26A 4TYOA 1HKIA 2WK2A 4JFJA 2LGOA 5HW8A 4Z2GA 1HKJA 1FAPA 2XPAA 1E44A 2ZQVA 3WKZA 1UR9A 5HWCA 5DO2A 2MNTA 2PV3A 1EDQA 4QT3A 1GRJA 4KQZA 1HKKA 3ARUA 2MLXA 1O6IA 3O5JA 3O5QA 1UR8A 3TC5A 4QZVB 3RFWA 3AS0A 4DWSC 4MNMA 4URIA 4JFKA 4JFMA 3G6MA 1NH6A 3WD4A 3LUOA 2LPVA 2ESCA 4QT2A 3O5RA 1FKGA 3O5LA 2A3AA 4MAVA 3BXWA 3JYMA 2DT3A 1FKJA 1HKMA 4ZPTR 2ITKA 4P8WA 4IQ2A 5HW6A 2XPBA 4IT6A 3UI4A 1ZBKA 3G6LA 1GUVA 2PPPA 2MLZA 4FN2A 5HW7A 4ZS6A 1K9TA 1F8AB 2DG4A 1IX5A 2KFWA 2VCDA 4ODMA 1ZBWA 3GPKA 4DZ3A 5HT1A 1SYTA 2Q5AA 4DZ2A 3KAFA 4TW6A 1TFVA 5GQBA 3JXVA 4NSBA 3EIPA 1EQ3A 3KCEA 3IK8A 4WKAA 1ZB5A 3FY1A 3UQBA 1JNTA 1KT0A 2MPHA 2WM0A 2EULA 3ARSA 1WNOA 1W1YA 4DRPA 1Q1CA 2F21A 3WD1A 4R5EA 1ROTA 1PINA 1B6CA 1EIBA 2DT1A 1FKRA 3KADA 1NMVA 1HJXA 5HUAA 2PN0A 1YATA 1LG2A 3FAPA 3CGMA 3VAWA 1ZBCA 1ZK6A 3B9AA 4ODQA 1QPFA 1E6ZA 3O5OA 3PR9A 4WKHA 3OA5A 1LL4A 2XP3A 5DF0A 2Y78A 3ARWA 4DRHA
chains in the Genus database with same CATH topology
2DT0A 4N19A 4Q22A 3ARYA 1D7HA 2MLYA 4LGXA 2KE0A 3KAHA 1RD6A 4GIVA 1JNDA 1N1AA 3WL1A 1E6RA 1W1PA 4MNKA 2F4EA 1XRVA 4KR0B 1GOIA 4P8VA 4O2TA 2RURA 1W9PA 3MDYB 1WB0A 1E6NA 1L1PA 1XHGA 4BF8A 5GPRA 4ITZA 5DIVA 4U85A 1EYMA 2YBTA 4DT4A 1X6LA 1FKBA 5BXJA 4MTVA 3WQWA 2PI6A 3EY6A 1H0IA 2AWGA 4S3KA 2O92A 1HJWA 1R9HA 1FKSA 1ZL1A 3UI6A 3WQVA 4L3NA 3CH9A 1LL7A 4U84A 3UF8A 3IKGA 3CHEA 2F2DA 4LAWA 1FFRA 2ZQTA 2PPOA 4R0XA 1J4HA 3O5KA 1FD9A 1LG1A 2UZ5A 4TW8A 3WL0A 2DSZA 3CZ8A 4ZPVR 2ZR6A 2MF9A 3CGNA 2DG9A 4ODPA 4DH0A 2RUQA 1FJDA 1LJYA 1JVWA 3B7XA 3KACA 3O5FA 4MSPA 1LQ0A 4G2PA 3ALGA 4P8XA 4DROA 2XP6A 3AS2A 3IHZA 3PRBA 1D6OA 2RUDA 2ZR5A 3AROA 1TCOC 3CHDA 1Y0OA 2KO7A 2DSWA 4LAVA 2LJ4A 5J6EA 1HXVA 2XP8A 2N87A 4W9QA 2WLZA 2ZQUA 1BKFA 4IT4A 5HWBA 2FKEA 1FKTA 3KAGA 1FKIA 3ARPA 1JNEA 3O5MA 3H9RB 1CTNA 2OLHA 4GGQA 3CHFA 2RSEA 1BL4A 1C9HA 1EHNA 4WKFA 1X6NA 1Q6IA 4W9OA 1W9UA 2PV1A 4G50A 5HTGA 3B9DA 3RGCA 1QPLA 2A3CA 2KGJA 3RM9A 4DWSA 3KABA 4LAYA 4ODOA 3NRKA 3WD3A 1Q6UA 2RQSA 4L72B 4Z2JA 2AOSA 4P8UA 3PRAA 5JH8A 3AS1A 4DWSD 1H0GA 1NWSA 2M08A 2KR7A 1ITXA 1OGGA 3I6CA 1PBKA 1W1TA 4ODLA 4Z2KA 2FDMA 2XP5A 1WAWA 3QOKA 3PRDA 3KAIA 4Q7NA 4U86A 1LL6A 3WIJA 4FAPA 5B8IC 3OOBA 5HBFA 2PV2A 3RM8A 3CHCA 4AY1A 1FKFA 4DIPA 1D2KA 1SR0A 3B9EA 1FFQA 3O5PA 4W9PA 2FAPA 3UQIA 4MNLA 3IKDA 4MNJA 3UI5A 1HJVA 1FKDA 4DRIA 2XP9A 4JYSA 4HBEA 3ODKA 3TCZA 3ARXA 1P5QA 4TX0A 3O5GA 3B8SA 4DWSB 4W5UA 4S3JA 2VN1A 3WH0A 2ZR4A 4WK9A 1NWRA 1W1VA 4ODNA 2DSVA 2L2SA 5DITA 1VF8A 2DPEA 4DRNA 4QIBA 4JFIA 4WJXA 1J4RA 1ZU8A 1NSGA 3ARRA 2IF4A 4ODRA 1U79A 4Z2IA 2JZVA 4ML4A 5GPGA 4TW7A 2K8IA 1J4IA 1E15A 2M2AA 4PTMA 4HARA 1YW5A 1E6PA 1Q6HA 3O5EA 2O9OA 1KFWA 4DRQA 1JNSA 2M1IA 1NWTA 2DSUA 2LKNA 4IQCA 4WIWA 1M5YA 1W9VA 4MGVA 1A7XA 1OGBA 4LAXA 4MPKA 3NI6A 3O5IA 3TDBA 2OFNA 4DRMA 2D9FA 1FKKA 1OWQA 4ODKA 2G8ZA 1T11A 4XAKA 4NZCA 5I98A 4ZPWR 3JYJA 2XP7A 2PBCA 5DEZA 3WD2A 4J4OA 4Z2HA 1D7IA 3W4RA 1D7JA 5DIUA 4J4NA 1QZ2A 1ROUA 3NTPA 2A3BA 1ZCNA 4TNSA 3RM4A 2ZQSA 3AS3A 4C02B 1FKHA 1KT1A 2A3EA 2IUZA 3ARTA 2XP4A 4DRKA 2KI3A 5HKGA 2QF8A 4NNRA 5D75A 3ARVA 2PPNA 1ZBVA 1E9LA 3RMEA 2DG3A 4Z2LA 2RUCA 4JFLA 1NWUA 2YBUA 1NMWA 2DT2A 4IPXA 4DRJA 3AQUA 2G41A 3O5DA 4HBOA 1GPFA 3PA7A 3FXYA 2WLYA 3ARZA 1FKLA 3ALFA 2B31A 3UQAA 3ARQA 3WD0A 3KZ7A 1J6YA 1F40A 1W26A 4TYOA 1HKIA 2WK2A 4JFJA 2LGOA 5HW8A 4Z2GA 1HKJA 1FAPA 2XPAA 2ZQVA 3WKZA 1UR9A 5HWCA 5DO2A 2MNTA 2PV3A 1EDQA 4QT3A 4KQZA 1HKKA 3ARUA 2MLXA 1O6IA 3O5JA 3O5QA 1UR8A 3TC5A 4QZVB 3RFWA 3AS0A 4DWSC 4MNMA 4URIA 4JFKA 4JFMA 3G6MA 1NH6A 3WD4A 3LUOA 2LPVA 2ESCA 4QT2A 3O5RA 1FKGA 3O5LA 2A3AA 4MAVA 3BXWA 3JYMA 2DT3A 1FKJA 1HKMA 4ZPTR 2ITKA 4P8WA 4IQ2A 5HW6A 2XPBA 4IT6A 3UI4A 1ZBKA 3G6LA 1GUVA 2PPPA 2MLZA 4FN2A 5HW7A 4ZS6A 1K9TA 1F8AB 2DG4A 1IX5A 2KFWA 2VCDA 4ODMA 1ZBWA 3GPKA 4DZ3A 5HT1A 1SYTA 2Q5AA 4DZ2A 3KAFA 4TW6A 1TFVA 5GQBA 3JXVA 4NSBA 1EQ3A 3KCEA 3IK8A 4WKAA 1ZB5A 3FY1A 3UQBA 1JNTA 1KT0A 2MPHA 2WM0A 3ARSA 1WNOA 1W1YA 4DRPA 1Q1CA 2F21A 3WD1A 4R5EA 1ROTA 1PINA 1B6CA 1EIBA 2DT1A 1FKRA 3KADA 1NMVA 1HJXA 5HUAA 1YATA 1LG2A 3FAPA 3CGMA 3VAWA 1ZBCA 1ZK6A 3B9AA 4ODQA 1QPFA 1E6ZA 3O5OA 3PR9A 4WKHA 3OA5A 1LL4A 2XP3A 5DF0A 2Y78A 3ARWA 4DRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TW7 A;  4N19 A;  2K8I A;  3O5J A;  2FKE A;  2MLX A;  3O5Q A;  1J4I A;  1FKT A;  2M2A A;  5GPG A;  3KAG A;  1D7H A;  1FKI A;  2MLY A;  3TC5 A;  1YW5 A;  1Q6H A;  3O5M A;  3H9R B;  3RFW A;  2KE0 A;  4GGQ A;  3O5E A;  2RSE A;  1BL4 A;  1C9H A;  4JFK A;  3KAH A;  4JFM A;  4DRQ A;  1Q6I A;  4W9O A;  2M1I A;  2PV1 A;  3LUO A;  4G50 A;  5HTG A;  2LKN A;  4GIV A;  2LPV A;  3RGC A;  4QT2 A;  1N1A A;  3O5R A;  1QPL A;  4IQC A;  2KGJ A;  1M5Y A;  1FKG A;  4MGV A;  3O5L A;  2F4E A;  1A7X A;  3KAB A;  4O2T A;  4LAY A;  2RUR A;  3JYM A;  4ODO A;  4LAX A;  3MDY B;  3NI6 A;  3NRK A;  3O5I A;  1L1P A;  4BF8 A;  3TDB A;  4ITZ A;  1Q6U A;  2OFN A;  2RQS A;  1FKJ A;  5DIV A;  4U85 A;  4DRM A;  2D9F A;  1EYM A;  2ITK A;  1FKK A;  4ODK A;  4DT4 A;  1T11 A;  1FKB A;  5I98 A;  5BXJ A;  4IQ2 A;  2M08 A;  2XP7 A;  2KR7 A;  3JYJ A;  2PBC A;  2XPB A;  5HW6 A;  3EY6 A;  3I6C A;  1PBK A;  2AWG A;  4ODL A;  3UI4 A;  5HWB A;  2XP5 A;  4J4O A;  3PRD A;  1D7I A;  1D7J A;  1R9H A;  5DIU A;  1FKS A;  3KAI A;  4J4N A;  4U86 A;  3UI6 A;  4FAP A;  2PPP A;  2MLZ A;  5B8I C;  4FN2 A;  5HW7 A;  1QZ2 A;  1ROU A;  3NTP A;  3OOB A;  1ZCN A;  2DG4 A;  1F8A B;  4TNS A;  2PV2 A;  2KFW A;  2VCD A;  2ZQS A;  4C02 B;  4ODM A;  4U84 A;  3GPK A;  1FKH A;  3UF8 A;  1FKF A;  4DZ3 A;  3IKG A;  4DIP A;  5HT1 A;  2F2D A;  2Q5A A;  4LAW A;  4DZ2 A;  3KAF A;  3O5P A;  4TW6 A;  4QIB A;  4W9P A;  1KT1 A;  3JXV A;  2FAP A;  3UQI A;  1EQ3 A;  3KCE A;  2XP4 A;  3IK8 A;  3IKD A;  2ZQT A;  4DRK A;  3UI5 A;  2KI3 A;  5HKG A;  2PPO A;  1FKD A;  4DRI A;  2XP9 A;  4JYS A;  1J4H A;  4NNR A;  3ODK A;  4R0X A;  3O5K A;  5D75 A;  1FD9 A;  1JNT A;  3TCZ A;  1KT0 A;  2UZ5 A;  2MPH A;  4TW8 A;  3UQB A;  2PPN A;  1P5Q A;  4TX0 A;  3O5G A;  2ZR6 A;  2MF9 A;  3CGN A;  1JNS A;  2DG9 A;  2DG3 A;  4ODP A;  2RUC A;  2RUQ A;  4JFL A;  4DH0 A;  4DRP A;  2VN1 A;  1FJD A;  1JVW A;  3B7X A;  3KAC A;  1NMW A;  3O5F A;  4MSP A;  1Q1C A;  2F21 A;  3WH0 A;  4IPX A;  4DRJ A;  2ZR4 A;  4G2P A;  1ROT A;  1PIN A;  3O5D A;  4ODN A;  1B6C A;  1FKR A;  3PA7 A;  4DRO A;  2L2S A;  3KAD A;  1NMV A;  5DIT A;  2XP6 A;  1FKL A;  5HUA A;  3UQA A;  3IHZ A;  1YAT A;  3PRB A;  3KZ7 A;  4DRN A;  1D6O A;  1J6Y A;  3FAP A;  1F40 A;  2RUD A;  2ZR5 A;  1W26 A;  4ODQ A;  3CGM A;  4TYO A;  3VAW A;  1ZK6 A;  1TCO C;  1QPF A;  1Y0O A;  2KO7 A;  2LGO A;  4JFI A;  1J4R A;  4JFJ A;  4LAV A;  1FAP A;  5HW8 A;  2XPA A;  3O5O A;  2ZQV A;  1NSG A;  2LJ4 A;  5J6E A;  2IF4 A;  2XP3 A;  4ODR A;  2XP8 A;  1HXV A;  1U79 A;  2N87 A;  4W9Q A;  2ZQU A;  5HWC A;  1BKF A;  2Y78 A;  2MNT A;  2PV3 A;  2JZV A;  4QT3 A;  4DRH A; 
#chains in the Genus database with same CATH topology
 2DT0 A;  4N19 A;  4Q22 A;  3ARY A;  1D7H A;  2MLY A;  4LGX A;  2KE0 A;  3KAH A;  1RD6 A;  4GIV A;  1JND A;  1N1A A;  3WL1 A;  1E6R A;  1W1P A;  4MNK A;  2F4E A;  1XRV A;  4KR0 B;  1GOI A;  4P8V A;  4O2T A;  2RUR A;  1W9P A;  3GTY X;  3MDY B;  1WB0 A;  1E6N A;  1L1P A;  1XHG A;  4BF8 A;  5GPR A;  4ITZ A;  5DIV A;  4U85 A;  1EYM A;  2YBT A;  4DT4 A;  1X6L A;  1FKB A;  5BXJ A;  4MTV A;  3WQW A;  2PI6 A;  3EY6 A;  1H0I A;  2AWG A;  4S3K A;  2O92 A;  1HJW A;  1R9H A;  1FKS A;  1ZL1 A;  3UI6 A;  3WQV A;  4L3N A;  3CH9 A;  1LL7 A;  4U84 A;  3UF8 A;  3IKG A;  3CHE A;  2F2D A;  4LAW A;  3BMB A;  1FFR A;  2ZQT A;  2PPO A;  4R0X A;  1J4H A;  3O5K A;  1FD9 A;  1LG1 A;  2UZ5 A;  4TW8 A;  3WL0 A;  2DSZ A;  3CZ8 A;  4ZPV R;  2ZR6 A;  2MF9 A;  3CGN A;  2DG9 A;  4ODP A;  4DH0 A;  2RUQ A;  1FJD A;  1LJY A;  1JVW A;  3B7X A;  3KAC A;  3O5F A;  4MSP A;  1LQ0 A;  4G2P A;  2P4V A;  3ALG A;  4P8X A;  4DRO A;  2XP6 A;  3AS2 A;  3IHZ A;  3PRB A;  1D6O A;  2RUD A;  2ZR5 A;  3ARO A;  1TCO C;  3CHD A;  1Y0O A;  2KO7 A;  2DSW A;  4LAV A;  2LJ4 A;  5J6E A;  1HXV A;  2XP8 A;  2N87 A;  4W9Q A;  2WLZ A;  2ZQU A;  1BKF A;  4IT4 A;  5HWB A;  2FKE A;  1FKT A;  3KAG A;  1FKI A;  3ARP A;  1JNE A;  3O5M A;  3H9R B;  1CTN A;  2OLH A;  4GGQ A;  3CHF A;  2RSE A;  1BL4 A;  1C9H A;  1EHN A;  2F23 A;  4WKF A;  1X6N A;  1Q6I A;  4W9O A;  1W9U A;  2PV1 A;  4G50 A;  5HTG A;  3B9D A;  3RGC A;  3GU0 A;  1QPL A;  2A3C A;  2KGJ A;  3RM9 A;  4DWS A;  3KAB A;  4LAY A;  4ODO A;  3NRK A;  3WD3 A;  1Q6U A;  2RQS A;  4L72 B;  4Z2J A;  2AOS A;  4P8U A;  3PRA A;  5JH8 A;  3AS1 A;  4DWS D;  1H0G A;  1NWS A;  2M08 A;  2KR7 A;  1ITX A;  1OGG A;  3I6C A;  1PBK A;  1W1T A;  4ODL A;  4Z2K A;  2FDM A;  2XP5 A;  1WAW A;  3QOK A;  3PRD A;  3KAI A;  4Q7N A;  4U86 A;  1LL6 A;  3WIJ A;  4FAP A;  5B8I C;  3OOB A;  5HBF A;  2PV2 A;  3RM8 A;  3CHC A;  4AY1 A;  1FKF A;  4DIP A;  1D2K A;  1SR0 A;  3B9E A;  1FFQ A;  3O5P A;  4W9P A;  2FAP A;  3UQI A;  4MNL A;  3IKD A;  4MNJ A;  3UI5 A;  1HJV A;  1FKD A;  4DRI A;  2XP9 A;  4JYS A;  4HBE A;  3ODK A;  3TCZ A;  3ARX A;  1P5Q A;  4TX0 A;  3O5G A;  3B8S A;  4DWS B;  4W5U A;  4S3J A;  2VN1 A;  3WH0 A;  2ZR4 A;  4WK9 A;  1NWR A;  1W1V A;  4ODN A;  2DSV A;  2L2S A;  5DIT A;  1VF8 A;  2DPE A;  4DRN A;  4QIB A;  4JFI A;  4WJX A;  1J4R A;  1ZU8 A;  1NSG A;  3ARR A;  2IF4 A;  4ODR A;  1U79 A;  4Z2I A;  2JZV A;  4ML4 A;  5GPG A;  4TW7 A;  2K8I A;  1J4I A;  1E15 A;  2M2A A;  4PTM A;  4HAR A;  1YW5 A;  1E6P A;  1Q6H A;  2ETN A;  3O5E A;  2O9O A;  1KFW A;  4DRQ A;  1JNS A;  2M1I A;  1NWT A;  2DSU A;  2LKN A;  4IQC A;  4WIW A;  1M5Y A;  1W9V A;  4MGV A;  1A7X A;  1OGB A;  4LAX A;  4MPK A;  3NI6 A;  3O5I A;  3TDB A;  2OFN A;  4DRM A;  2D9F A;  1FKK A;  1OWQ A;  4ODK A;  2G8Z A;  1T11 A;  4XAK A;  4NZC A;  5I98 A;  4ZPW R;  3JYJ A;  2XP7 A;  2PBC A;  5DEZ A;  3WD2 A;  4J4O A;  4Z2H A;  1D7I A;  3W4R A;  1D7J A;  5DIU A;  4J4N A;  1QZ2 A;  1ROU A;  3NTP A;  2A3B A;  1ZCN A;  4TNS A;  3RM4 A;  2ZQS A;  3AS3 A;  4C02 B;  1FKH A;  1KT1 A;  2A3E A;  2IUZ A;  3ART A;  2XP4 A;  4DRK A;  2KI3 A;  5HKG A;  2QF8 A;  4NNR A;  5D75 A;  4UDM A;  3ARV A;  2PPN A;  1ZBV A;  1E9L A;  3RME A;  2DG3 A;  4Z2L A;  2RUC A;  4JFL A;  1NWU A;  2YBU A;  1NMW A;  2DT2 A;  4IPX A;  4DRJ A;  3AQU A;  2G41 A;  2B5U B;  3O5D A;  4HBO A;  1GPF A;  3PA7 A;  3FXY A;  2WLY A;  3ARZ A;  1JCH B;  1FKL A;  3ALF A;  2B31 A;  3UQA A;  3ARQ A;  3WD0 A;  3KZ7 A;  1J6Y A;  1F40 A;  1W26 A;  4TYO A;  1HKI A;  2WK2 A;  4JFJ A;  2LGO A;  5HW8 A;  4Z2G A;  1HKJ A;  1FAP A;  2XPA A;  1E44 A;  2ZQV A;  3WKZ A;  1UR9 A;  5HWC A;  5DO2 A;  2MNT A;  2PV3 A;  1EDQ A;  4QT3 A;  1GRJ A;  4KQZ A;  1HKK A;  3ARU A;  2MLX A;  1O6I A;  3O5J A;  3O5Q A;  1UR8 A;  3TC5 A;  4QZV B;  3RFW A;  3AS0 A;  4DWS C;  4MNM A;  4URI A;  4JFK A;  4JFM A;  3G6M A;  1NH6 A;  3WD4 A;  3LUO A;  2LPV A;  2ESC A;  4QT2 A;  3O5R A;  1FKG A;  3O5L A;  2A3A A;  4MAV A;  3BXW A;  3JYM A;  2DT3 A;  1FKJ A;  1HKM A;  4ZPT R;  2ITK A;  4P8W A;  4IQ2 A;  5HW6 A;  2XPB A;  4IT6 A;  3UI4 A;  1ZBK A;  3G6L A;  1GUV A;  2PPP A;  2MLZ A;  4FN2 A;  5HW7 A;  4ZS6 A;  1K9T A;  1F8A B;  2DG4 A;  1IX5 A;  2KFW A;  2VCD A;  4ODM A;  1ZBW A;  3GPK A;  4DZ3 A;  5HT1 A;  1SYT A;  2Q5A A;  4DZ2 A;  3KAF A;  4TW6 A;  1TFV A;  5GQB A;  3JXV A;  4NSB A;  3EIP A;  1EQ3 A;  3KCE A;  3IK8 A;  4WKA A;  1ZB5 A;  3FY1 A;  3UQB A;  1JNT A;  1KT0 A;  2MPH A;  2WM0 A;  2EUL A;  3ARS A;  1WNO A;  1W1Y A;  4DRP A;  1Q1C A;  2F21 A;  3WD1 A;  4R5E A;  1ROT A;  1PIN A;  1B6C A;  1EIB A;  2DT1 A;  1FKR A;  3KAD A;  1NMV A;  1HJX A;  5HUA A;  2PN0 A;  1YAT A;  1LG2 A;  3FAP A;  3CGM A;  3VAW A;  1ZBC A;  1ZK6 A;  3B9A A;  4ODQ A;  1QPF A;  1E6Z A;  3O5O A;  3PR9 A;  4WKH A;  3OA5 A;  1LL4 A;  2XP3 A;  5DF0 A;  2Y78 A;  3ARW A;  4DRH A; 
#chains in the Genus database with same CATH homology
 2DT0 A;  4N19 A;  4Q22 A;  3ARY A;  1D7H A;  2MLY A;  4LGX A;  2KE0 A;  3KAH A;  1RD6 A;  4GIV A;  1JND A;  1N1A A;  3WL1 A;  1E6R A;  1W1P A;  4MNK A;  2F4E A;  1XRV A;  4KR0 B;  1GOI A;  4P8V A;  4O2T A;  2RUR A;  1W9P A;  3MDY B;  1WB0 A;  1E6N A;  1L1P A;  1XHG A;  4BF8 A;  5GPR A;  4ITZ A;  5DIV A;  4U85 A;  1EYM A;  2YBT A;  4DT4 A;  1X6L A;  1FKB A;  5BXJ A;  4MTV A;  3WQW A;  2PI6 A;  3EY6 A;  1H0I A;  2AWG A;  4S3K A;  2O92 A;  1HJW A;  1R9H A;  1FKS A;  1ZL1 A;  3UI6 A;  3WQV A;  4L3N A;  3CH9 A;  1LL7 A;  4U84 A;  3UF8 A;  3IKG A;  3CHE A;  2F2D A;  4LAW A;  1FFR A;  2ZQT A;  2PPO A;  4R0X A;  1J4H A;  3O5K A;  1FD9 A;  1LG1 A;  2UZ5 A;  4TW8 A;  3WL0 A;  2DSZ A;  3CZ8 A;  4ZPV R;  2ZR6 A;  2MF9 A;  3CGN A;  2DG9 A;  4ODP A;  4DH0 A;  2RUQ A;  1FJD A;  1LJY A;  1JVW A;  3B7X A;  3KAC A;  3O5F A;  4MSP A;  1LQ0 A;  4G2P A;  3ALG A;  4P8X A;  4DRO A;  2XP6 A;  3AS2 A;  3IHZ A;  3PRB A;  1D6O A;  2RUD A;  2ZR5 A;  3ARO A;  1TCO C;  3CHD A;  1Y0O A;  2KO7 A;  2DSW A;  4LAV A;  2LJ4 A;  5J6E A;  1HXV A;  2XP8 A;  2N87 A;  4W9Q A;  2WLZ A;  2ZQU A;  1BKF A;  4IT4 A;  5HWB A;  2FKE A;  1FKT A;  3KAG A;  1FKI A;  3ARP A;  1JNE A;  3O5M A;  3H9R B;  1CTN A;  2OLH A;  4GGQ A;  3CHF A;  2RSE A;  1BL4 A;  1C9H A;  1EHN A;  4WKF A;  1X6N A;  1Q6I A;  4W9O A;  1W9U A;  2PV1 A;  4G50 A;  5HTG A;  3B9D A;  3RGC A;  1QPL A;  2A3C A;  2KGJ A;  3RM9 A;  4DWS A;  3KAB A;  4LAY A;  4ODO A;  3NRK A;  3WD3 A;  1Q6U A;  2RQS A;  4L72 B;  4Z2J A;  2AOS A;  4P8U A;  3PRA A;  5JH8 A;  3AS1 A;  4DWS D;  1H0G A;  1NWS A;  2M08 A;  2KR7 A;  1ITX A;  1OGG A;  3I6C A;  1PBK A;  1W1T A;  4ODL A;  4Z2K A;  2FDM A;  2XP5 A;  1WAW A;  3QOK A;  3PRD A;  3KAI A;  4Q7N A;  4U86 A;  1LL6 A;  3WIJ A;  4FAP A;  5B8I C;  3OOB A;  5HBF A;  2PV2 A;  3RM8 A;  3CHC A;  4AY1 A;  1FKF A;  4DIP A;  1D2K A;  1SR0 A;  3B9E A;  1FFQ A;  3O5P A;  4W9P A;  2FAP A;  3UQI A;  4MNL A;  3IKD A;  4MNJ A;  3UI5 A;  1HJV A;  1FKD A;  4DRI A;  2XP9 A;  4JYS A;  4HBE A;  3ODK A;  3TCZ A;  3ARX A;  1P5Q A;  4TX0 A;  3O5G A;  3B8S A;  4DWS B;  4W5U A;  4S3J A;  2VN1 A;  3WH0 A;  2ZR4 A;  4WK9 A;  1NWR A;  1W1V A;  4ODN A;  2DSV A;  2L2S A;  5DIT A;  1VF8 A;  2DPE A;  4DRN A;  4QIB A;  4JFI A;  4WJX A;  1J4R A;  1ZU8 A;  1NSG A;  3ARR A;  2IF4 A;  4ODR A;  1U79 A;  4Z2I A;  2JZV A;  4ML4 A;  5GPG A;  4TW7 A;  2K8I A;  1J4I A;  1E15 A;  2M2A A;  4PTM A;  4HAR A;  1YW5 A;  1E6P A;  1Q6H A;  3O5E A;  2O9O A;  1KFW A;  4DRQ A;  1JNS A;  2M1I A;  1NWT A;  2DSU A;  2LKN A;  4IQC A;  4WIW A;  1M5Y A;  1W9V A;  4MGV A;  1A7X A;  1OGB A;  4LAX A;  4MPK A;  3NI6 A;  3O5I A;  3TDB A;  2OFN A;  4DRM A;  2D9F A;  1FKK A;  1OWQ A;  4ODK A;  2G8Z A;  1T11 A;  4XAK A;  4NZC A;  5I98 A;  4ZPW R;  3JYJ A;  2XP7 A;  2PBC A;  5DEZ A;  3WD2 A;  4J4O A;  4Z2H A;  1D7I A;  3W4R A;  1D7J A;  5DIU A;  4J4N A;  1QZ2 A;  1ROU A;  3NTP A;  2A3B A;  1ZCN A;  4TNS A;  3RM4 A;  2ZQS A;  3AS3 A;  4C02 B;  1FKH A;  1KT1 A;  2A3E A;  2IUZ A;  3ART A;  2XP4 A;  4DRK A;  2KI3 A;  5HKG A;  2QF8 A;  4NNR A;  5D75 A;  3ARV A;  2PPN A;  1ZBV A;  1E9L A;  3RME A;  2DG3 A;  4Z2L A;  2RUC A;  4JFL A;  1NWU A;  2YBU A;  1NMW A;  2DT2 A;  4IPX A;  4DRJ A;  3AQU A;  2G41 A;  3O5D A;  4HBO A;  1GPF A;  3PA7 A;  3FXY A;  2WLY A;  3ARZ A;  1FKL A;  3ALF A;  2B31 A;  3UQA A;  3ARQ A;  3WD0 A;  3KZ7 A;  1J6Y A;  1F40 A;  1W26 A;  4TYO A;  1HKI A;  2WK2 A;  4JFJ A;  2LGO A;  5HW8 A;  4Z2G A;  1HKJ A;  1FAP A;  2XPA A;  2ZQV A;  3WKZ A;  1UR9 A;  5HWC A;  5DO2 A;  2MNT A;  2PV3 A;  1EDQ A;  4QT3 A;  4KQZ A;  1HKK A;  3ARU A;  2MLX A;  1O6I A;  3O5J A;  3O5Q A;  1UR8 A;  3TC5 A;  4QZV B;  3RFW A;  3AS0 A;  4DWS C;  4MNM A;  4URI A;  4JFK A;  4JFM A;  3G6M A;  1NH6 A;  3WD4 A;  3LUO A;  2LPV A;  2ESC A;  4QT2 A;  3O5R A;  1FKG A;  3O5L A;  2A3A A;  4MAV A;  3BXW A;  3JYM A;  2DT3 A;  1FKJ A;  1HKM A;  4ZPT R;  2ITK A;  4P8W A;  4IQ2 A;  5HW6 A;  2XPB A;  4IT6 A;  3UI4 A;  1ZBK A;  3G6L A;  1GUV A;  2PPP A;  2MLZ A;  4FN2 A;  5HW7 A;  4ZS6 A;  1K9T A;  1F8A B;  2DG4 A;  1IX5 A;  2KFW A;  2VCD A;  4ODM A;  1ZBW A;  3GPK A;  4DZ3 A;  5HT1 A;  1SYT A;  2Q5A A;  4DZ2 A;  3KAF A;  4TW6 A;  1TFV A;  5GQB A;  3JXV A;  4NSB A;  1EQ3 A;  3KCE A;  3IK8 A;  4WKA A;  1ZB5 A;  3FY1 A;  3UQB A;  1JNT A;  1KT0 A;  2MPH A;  2WM0 A;  3ARS A;  1WNO A;  1W1Y A;  4DRP A;  1Q1C A;  2F21 A;  3WD1 A;  4R5E A;  1ROT A;  1PIN A;  1B6C A;  1EIB A;  2DT1 A;  1FKR A;  3KAD A;  1NMV A;  1HJX A;  5HUA A;  1YAT A;  1LG2 A;  3FAP A;  3CGM A;  3VAW A;  1ZBC A;  1ZK6 A;  3B9A A;  4ODQ A;  1QPF A;  1E6Z A;  3O5O A;  3PR9 A;  4WKH A;  3OA5 A;  1LL4 A;  2XP3 A;  5DF0 A;  2Y78 A;  3ARW A;  4DRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...