2RQSA

3d structure of pin from the psychrophilic archeon cenarcheaum symbiosum (cspin)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
97
structure length
97
Chain Sequence
GPMGSMADKIKCSHILVKKQGEALAVQERLKAGEKFGKLAKELSIDGGSAKRDGSLGYFGRGKMVKPFEDAAFRLQVGEVSEPVKSEFGYHVIKRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Dynamics of the First Archaeal Parvulin Reveal a New Functionally Important Loop in Parvulin-type Prolyl Isomerases
pubmed doi rcsb
source organism Cenarchaeum symbiosum
molecule tags Isomerase
molecule keywords Parvulin-like peptidyl-prolyl isomerase
total genus 15
structure length 97
sequence length 97
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13616 Rotamase_3 PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2rqsA00
1FD9A 4LAWA 4ODRA 4W9PA 1F40A 3KCEA 3O5PA 1P5QA 3JYJA 4TW7A 2KGJA 5DITA 4JFLA 4DROA 2ZQTA 2ZQUA 4G2PA 2XP7A 4TNSA 3O5RA 4DRHA 2VCDA 1W26A 2ZQSA 1EQ3A 1Y0OA 1QPFA 3O5DA 2AWGA 4DZ2A 2KE0A 2FKEA 5HW8A 1FKRA 2LKNA 4JYSA 2ZR5A 2RQSA 1YATA 1N1AA 2KFWA 2PV3A 5HUAA 1PINA 1EYMA 3MDYB 4J4OA 2LPVA 4G50A 1FKHA 2D9FA 2RSEA 3UQIA 3O5OA 5HWCA 2F4EA 1ROUA 2RURA 4ODMA 5BXJA 3O5QA 3O5KA 1M5YA 2XP6A 1FKFA 1T11A 3NRKA 3RGCA 4DRPA 2DG9A 2ZQVA 3PRBA 1D7JA 4ODQA 3KAFA 4ODLA 1FJDA 4IQ2A 1TCOC 2MLYA 3PRDA 4DRMA 3TDBA 3IKGA 2KO7A 4LAYA 1JNSA 3CGMA 3NTPA 4ODNA 5DIVA 1J4RA 1D7IA 1QZ2A 4TW6A 3O5IA 5DIUA 3O5JA 4MSPA 3UQAA 1FKGA 2ITKA 3WH0A 4BF8A 1FKDA 3IHZA 3KABA 1J4IA 1NMWA 3RFWA 2PV2A 1QPLA 4JFKA 1FKTA 4U86A 4U85A 3TC5A 3UF8A 5HTGA 1KT1A 2PPOA 3KACA 2FAPA 4O2TA 2VN1A 2RUQA 1NMVA 4LAXA 1BL4A 1Q6HA 2N87A 3I6CA 2M2AA 1FKKA 2MNTA 3IK8A 4GIVA 3IKDA 3KAIA 4DRIA 3UI6A 1KT0A 4QT3A 1Q1CA 1F8AB 2JZVA 2KI3A 2ZR6A 4JFJA 3LUOA 4ITZA 4JFMA 4TX0A 4DIPA 4R0XA 2OFNA 1YW5A 2XP8A 2XP4A 4TYOA 3O5LA 5D75A 1HXVA 4FAPA 2RUDA 5HWBA 1D6OA 1FKSA 3O5EA 1J4HA 4DZ3A 4FN2A 2XP9A 2M08A 3H9RB 1B6CA 2F2DA 2MLXA 3EY6A 2PBCA 4GGQA 4J4NA 3KZ7A 4IQCA 4QT2A 2LJ4A 2K8IA 2L2SA 3FAPA 1U79A 3KADA 3JXVA 4QIBA 4DRNA 1FKJA 1C9HA 3KAGA 4ODPA 2MPHA 3PA7A 4ODOA 5HW7A 5I98A 3O5GA 2MF9A 5HW6A 2MLZA 2M1IA 1FAPA 2Y78A 3OOBA 2KR7A 1D7HA 3GPKA 4N19A 4W9QA 5J6EA 4TW8A 5B8IC 4U84A 1J6YA 5GPGA 2IF4A 2PPPA 2Q5AA 1L1PA 1Q6IA 4NNRA 3O5FA 1FKBA 2PV1A 3O5MA 4MGVA 1R9HA 4ODKA 1JVWA 1Q6UA 3ODKA 1A7XA 1FKIA 1ZCNA 1PBKA 2XPBA 3JYMA 4LAVA 5HKGA 2ZR4A 2RUCA 3UI4A 4DH0A 4DRKA 3KAHA 4C02B 1FKLA 3VAWA 5HT1A 3CGNA 1ROTA 3B7XA 4DRQA 4DT4A 1ZK6A 4DRJA 4W9OA 2XP5A 3UI5A 3NI6A 4JFIA 1JNTA 2LGOA 3UQBA 1NSGA 2DG4A 2DG3A 1BKFA 2F21A 2PPNA 2UZ5A 4IPXA 3TCZA 2XP3A 2XPAA
chains in the Genus database with same CATH superfamily
1LL4A 1GOIA 4W9PA 5DO2A 4MPKA 3PRAA 1SYTA 2ZQTA 3O5RA 1OGGA 4WIWA 2ZQSA 3PR9A 1IX5A 1O6IA 2KE0A 5HW8A 1FKRA 1XRVA 5DEZA 2ZR5A 1YATA 2KFWA 4W5UA 2G8ZA 1FFRA 2LPVA 1E6PA 1NWSA 2D9FA 3ARTA 4Z2GA 3O5OA 2F4EA 1ROUA 3O5QA 2DSZA 2IUZA 1NWTA 1ZBVA 4ZPVR 4ODLA 3AS3A 4DRMA 4LAYA 4MTVA 1GPFA 4ODNA 1J4RA 1D7IA 1QZ2A 1W1PA 3RM4A 3O5JA 3UQAA 4BF8A 2DSWA 3IHZA 5JH8A 5GQBA 3ALGA 1UR9A 1KT1A 2PPOA 3AS2A 3I6CA 2M2AA 3KAIA 3CHDA 4NZCA 4TX0A 4DIPA 3ALFA 4R0XA 1JCHB 3WQWA 2RUDA 1FKSA 4DWSB 4DZ3A 1WAWA 2FDMA 3EY6A 3W4RA 2B5UB 2K8IA 2LJ4A 1FKJA 5HW7A 3PA7A 1KFWA 2MF9A 1SR0A 5HW6A 3B8SA 2M1IA 2DSVA 5J6EA 4URIA 3WKZA 1W1TA 4Z2HA 2Q5AA 2WLYA 1L1PA 2F23A 1FKBA 3O5MA 1EHNA 2P4VA 1PBKA 1GUVA 4P8VA 3UI4A 4UDMA 4DRKA 3KAHA 1W1YA 2O92A 3WD3A 4MNLA 4Q7NA 4ZS6A 1ZK6A 2DT3A 3UI5A 3BMBA 5DF0A 4JFIA 1JNTA 3UQBA 3B9AA 4ODRA 4MNKA 4WKAA 1F40A 3O5PA 1P5QA 4TW7A 2DT2A 4DROA 1WB0A 2ZQUA 2XP7A 3ARPA 2OLHA 3RM9A 4LGXA 2AOSA 1LQ0A 3AS0A 2AWGA 2LKNA 4JYSA 1EYMA 4PTMA 4ML4A 1FKHA 2RSEA 5HWCA 5HBFA 1FKFA 1OGBA 1T11A 4DRPA 2ZQVA 3KAFA 1NWUA 1FJDA 3ARWA 1ZBCA 1JNSA 3CGMA 2ETNA 4DWSD 3O5IA 3RM8A 2YBUA 3G6MA 2ITKA 3WH0A 3RFWA 2PV2A 4P8UA 4U86A 4U85A 3TC5A 3UF8A 3ARYA 2RUQA 1NMVA 1BL4A 2N87A 4GIVA 1FKKA 3ARSA 3UI6A 4QT3A 1Q1CA 1F8AB 2KI3A 2ZR6A 4JFJA 4ITZA 3O5LA 1E6RA 2A3CA 3GU0A 3O5EA 1J4HA 4S3JA 3H9RB 2MLXA 4GGQA 3WD1A 3FAPA 1U79A 3JXVA 4QIBA 4DRNA 2MPHA 2A3AA 3QOKA 2MLZA 2Y78A 2DSUA 4N19A 4QZVB 4TW8A 1E15A 5GPRA 2PPPA 4WKHA 2PV1A 4ODKA 2QF8A 1A7XA 1FKIA 3JYMA 5HKGA 3GTYX 2ZR4A 2RUCA 5HT1A 4DWSA 1LJYA 3BXWA 3NI6A 4Z2JA 1HKMA 2DG3A 1FD9A 4LAWA 1HJWA 4L3NA 2KGJA 5DITA 2DT0A 1JNEA 4DRHA 2VCDA 1W26A 1EQ3A 1Y0OA 1QPFA 4DZ2A 3ARQA 2FKEA 1H0GA 4DWSC 4NSBA 2ESCA 2RQSA 1N1AA 4P8XA 3WL1A 5HUAA 3MDYB 4J4OA 1W9PA 2DPEA 4ODMA 3WD0A 1LL7A 3ARVA 4IT4A 2XP6A 1E6ZA 1XHGA 2DG9A 1D7JA 4ODQA 2WM0A 4L72B 1WNOA 3PRDA 2KO7A 5DIVA 3FXYA 1JNDA 1VF8A 4MSPA 1HKKA 1W9UA 1FKGA 4ZPTR 1FKTA 3CHCA 3KACA 2FAPA 2VN1A 3ARRA 1X6LA 3IKDA 3RMEA 1KT0A 1HXVA 1YW5A 2XP8A 2XP4A 4FAPA 5HWBA 1D6OA 1LG1A 2PN0A 2WLZA 2XP9A 4AY1A 1B6CA 4J4NA 4KQZA 4QT2A 2L2SA 1X6NA 4ZPWR 3KAGA 4Q22A 4ODOA 3O5GA 1FAPA 1LG2A 3OOBA 2KR7A 3OA5A 3GPKA 4W9QA 4HBOA 3WD4A 4U84A 4Z2LA 3WL0A 1J6YA 1ZL1A 4NNRA 1RD6A 4MGVA 1ZBWA 1R9HA 2G41A 4LAVA 2WK2A 4IT6A 4DH0A 4C02B 3VAWA 1W9VA 3CGNA 1ZU8A 1EDQA 3B7XA 4DT4A 2A3BA 4W9OA 2XP5A 3EIPA 2LGOA 1NSGA 2UZ5A 4IPXA 3RGCA 3PRBA 3B9DA 4Z2IA 1GRJA 2XPAA 4R5EA 4TNSA 4WK9A 3KCEA 3JYJA 2PI6A 3FY1A 1NWRA 4JFLA 4G2PA 1ZB5A 1W1VA 3ARUA 1ZBKA 3O5DA 4S3KA 2A3EA 3WD2A 2PV3A 1PINA 3ARZA 1H0IA 4G50A 3UQIA 2RURA 4MAVA 5BXJA 1HKIA 1TFVA 3O5KA 1NH6A 1M5YA 3NRKA 4HBEA 4WJXA 4IQ2A 1TCOC 2MLYA 4HARA 3TDBA 3IKGA 3NTPA 4TW6A 1CTNA 1LL6A 5DIUA 2YBTA 3CHFA 1FKDA 3KABA 1J4IA 1NMWA 3ARXA 3G6LA 1QPLA 4JFKA 5HTGA 4O2TA 3CHEA 4LAXA 1E44A 1Q6HA 2MNTA 3IK8A 4DRIA 3AS1A 2JZVA 4JFMA 3LUOA 2OFNA 4TYOA 3WIJA 2O9OA 5D75A 1UR8A 4FN2A 4XAKA 1E9LA 2M08A 2F2DA 3WQVA 2PBCA 4P8WA 3KZ7A 1HKJA 4IQCA 3KADA 1C9HA 1ITXA 3CZ8A 4ODPA 1FFQA 5I98A 2B31A 3B9EA 1K9TA 1D2KA 1HJXA 1D7HA 5B8IC 1HJVA 4MNMA 3AROA 4Z2KA 5GPGA 2IF4A 4MNJA 1E6NA 1Q6IA 3O5FA 1JVWA 1Q6UA 3ODKA 1ZCNA 2XPBA 1OWQA 1FKLA 4KR0B 1ROTA 4WKFA 1EIBA 4DRQA 2EULA 2DT1A 4DRJA 3CH9A 2DG4A 3TCZA 1BKFA 2F21A 2PPNA 2XP3A 3AQUA
chains in the Genus database with same CATH topology
1LL4A 1GOIA 4W9PA 5DO2A 4MPKA 3PRAA 1SYTA 2ZQTA 3O5RA 1OGGA 4WIWA 2ZQSA 3PR9A 1IX5A 1O6IA 2KE0A 5HW8A 1FKRA 1XRVA 5DEZA 2ZR5A 1YATA 2KFWA 4W5UA 2G8ZA 1FFRA 2LPVA 1E6PA 1NWSA 2D9FA 3ARTA 4Z2GA 3O5OA 2F4EA 1ROUA 3O5QA 2DSZA 2IUZA 1NWTA 1ZBVA 4ZPVR 4ODLA 3AS3A 4DRMA 4LAYA 4MTVA 1GPFA 4ODNA 1J4RA 1D7IA 1QZ2A 1W1PA 3RM4A 3O5JA 3UQAA 4BF8A 2DSWA 3IHZA 5JH8A 5GQBA 3ALGA 1UR9A 1KT1A 2PPOA 3AS2A 3I6CA 2M2AA 3KAIA 3CHDA 4NZCA 4TX0A 4DIPA 3ALFA 4R0XA 3WQWA 2RUDA 1FKSA 4DWSB 4DZ3A 1WAWA 2FDMA 3EY6A 3W4RA 2LJ4A 2K8IA 1FKJA 5HW7A 3PA7A 1KFWA 2MF9A 1SR0A 5HW6A 3B8SA 2M1IA 2DSVA 5J6EA 4URIA 3WKZA 1W1TA 4Z2HA 2Q5AA 2WLYA 1L1PA 1FKBA 3O5MA 1EHNA 1PBKA 1GUVA 4P8VA 3UI4A 4DRKA 3KAHA 1W1YA 2O92A 3WD3A 4MNLA 4Q7NA 4ZS6A 1ZK6A 2DT3A 3UI5A 5DF0A 4JFIA 1JNTA 3UQBA 3B9AA 4ODRA 4MNKA 4WKAA 1F40A 3O5PA 1P5QA 4TW7A 2DT2A 4DROA 1WB0A 2ZQUA 2XP7A 3ARPA 2OLHA 3RM9A 4LGXA 2AOSA 1LQ0A 3AS0A 2AWGA 2LKNA 4JYSA 1EYMA 4PTMA 4ML4A 1FKHA 2RSEA 5HWCA 5HBFA 1FKFA 1OGBA 1T11A 4DRPA 2ZQVA 3KAFA 1NWUA 1FJDA 3ARWA 1ZBCA 1JNSA 3CGMA 4DWSD 3O5IA 3RM8A 2YBUA 3G6MA 2ITKA 3WH0A 3RFWA 2PV2A 4P8UA 4U86A 4U85A 3TC5A 3UF8A 3ARYA 2RUQA 1NMVA 1BL4A 2N87A 4GIVA 1FKKA 3ARSA 3UI6A 4QT3A 1Q1CA 1F8AB 2KI3A 2ZR6A 4JFJA 4ITZA 3O5LA 1E6RA 2A3CA 3O5EA 1J4HA 4S3JA 3H9RB 2MLXA 4GGQA 3WD1A 3FAPA 1U79A 3JXVA 4QIBA 4DRNA 2MPHA 2A3AA 3QOKA 2MLZA 2Y78A 2DSUA 4N19A 4QZVB 4TW8A 1E15A 5GPRA 2PPPA 4WKHA 2PV1A 4ODKA 2QF8A 1A7XA 1FKIA 3JYMA 5HKGA 2ZR4A 2RUCA 5HT1A 4DWSA 1LJYA 3BXWA 3NI6A 4Z2JA 1HKMA 2DG3A 1FD9A 4LAWA 1HJWA 4L3NA 2KGJA 5DITA 2DT0A 1JNEA 4DRHA 2VCDA 1W26A 1EQ3A 1Y0OA 1QPFA 4DZ2A 3ARQA 2FKEA 1H0GA 4DWSC 4NSBA 2ESCA 2RQSA 1N1AA 4P8XA 3WL1A 5HUAA 3MDYB 4J4OA 1W9PA 2DPEA 4ODMA 3WD0A 1LL7A 3ARVA 4IT4A 2XP6A 1E6ZA 1XHGA 2DG9A 1D7JA 4ODQA 2WM0A 4L72B 1WNOA 3PRDA 2KO7A 5DIVA 3FXYA 1JNDA 1VF8A 4MSPA 1HKKA 1W9UA 1FKGA 4ZPTR 1FKTA 3CHCA 3KACA 2FAPA 2VN1A 3ARRA 1X6LA 3IKDA 3RMEA 1KT0A 1HXVA 1YW5A 2XP8A 2XP4A 4FAPA 5HWBA 1D6OA 1LG1A 2WLZA 2XP9A 4AY1A 1B6CA 4J4NA 4KQZA 4QT2A 2L2SA 1X6NA 4ZPWR 3KAGA 4Q22A 4ODOA 3O5GA 1FAPA 1LG2A 3OOBA 2KR7A 3OA5A 3GPKA 4W9QA 4HBOA 3WD4A 4U84A 4Z2LA 3WL0A 1J6YA 1ZL1A 4NNRA 1RD6A 4MGVA 1ZBWA 1R9HA 2G41A 4LAVA 2WK2A 4IT6A 4DH0A 4C02B 3VAWA 1W9VA 3CGNA 1ZU8A 1EDQA 3B7XA 4DT4A 2A3BA 4W9OA 2XP5A 2LGOA 1NSGA 2UZ5A 4IPXA 3RGCA 3PRBA 3B9DA 4Z2IA 2XPAA 4R5EA 4TNSA 4WK9A 3KCEA 3JYJA 2PI6A 3FY1A 1NWRA 4JFLA 4G2PA 1ZB5A 1W1VA 3ARUA 1ZBKA 3O5DA 4S3KA 2A3EA 3WD2A 2PV3A 1PINA 3ARZA 1H0IA 4G50A 3UQIA 2RURA 4MAVA 5BXJA 1HKIA 1TFVA 3O5KA 1NH6A 1M5YA 3NRKA 4HBEA 4WJXA 4IQ2A 1TCOC 2MLYA 4HARA 3TDBA 3IKGA 3NTPA 4TW6A 1CTNA 1LL6A 5DIUA 2YBTA 3CHFA 1FKDA 3KABA 1J4IA 1NMWA 3ARXA 3G6LA 1QPLA 4JFKA 5HTGA 4O2TA 3CHEA 4LAXA 1Q6HA 2MNTA 3IK8A 4DRIA 3AS1A 2JZVA 4JFMA 3LUOA 2OFNA 4TYOA 3WIJA 2O9OA 5D75A 1UR8A 4FN2A 4XAKA 1E9LA 2M08A 2F2DA 3WQVA 2PBCA 4P8WA 3KZ7A 1HKJA 4IQCA 3KADA 1C9HA 1ITXA 3CZ8A 4ODPA 1FFQA 5I98A 2B31A 3B9EA 1K9TA 1D2KA 1HJXA 1D7HA 5B8IC 1HJVA 4MNMA 3AROA 4Z2KA 5GPGA 2IF4A 4MNJA 1E6NA 1Q6IA 3O5FA 1JVWA 1Q6UA 3ODKA 1ZCNA 2XPBA 1OWQA 1FKLA 4KR0B 1ROTA 4WKFA 1EIBA 4DRQA 2DT1A 4DRJA 3CH9A 2DG4A 3TCZA 1BKFA 2F21A 2PPNA 2XP3A 3AQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FD9 A;  4LAW A;  4ODR A;  4W9P A;  1F40 A;  3KCE A;  3O5P A;  1P5Q A;  3JYJ A;  4TW7 A;  2KGJ A;  5DIT A;  4JFL A;  4DRO A;  2ZQT A;  2ZQU A;  4G2P A;  2XP7 A;  4TNS A;  3O5R A;  4DRH A;  2VCD A;  1W26 A;  2ZQS A;  1EQ3 A;  1Y0O A;  1QPF A;  3O5D A;  2AWG A;  4DZ2 A;  2KE0 A;  2FKE A;  5HW8 A;  1FKR A;  2LKN A;  4JYS A;  2ZR5 A;  2RQS A;  1YAT A;  1N1A A;  2KFW A;  2PV3 A;  5HUA A;  1PIN A;  1EYM A;  3MDY B;  4J4O A;  2LPV A;  4G50 A;  1FKH A;  2D9F A;  2RSE A;  3UQI A;  3O5O A;  5HWC A;  2F4E A;  1ROU A;  2RUR A;  4ODM A;  5BXJ A;  3O5Q A;  3O5K A;  1M5Y A;  2XP6 A;  1FKF A;  1T11 A;  3NRK A;  3RGC A;  4DRP A;  2DG9 A;  2ZQV A;  3PRB A;  1D7J A;  4ODQ A;  3KAF A;  4ODL A;  1FJD A;  4IQ2 A;  1TCO C;  2MLY A;  3PRD A;  4DRM A;  3TDB A;  3IKG A;  2KO7 A;  4LAY A;  1JNS A;  3CGM A;  3NTP A;  4ODN A;  5DIV A;  1J4R A;  1D7I A;  1QZ2 A;  4TW6 A;  3O5I A;  5DIU A;  3O5J A;  4MSP A;  3UQA A;  1FKG A;  2ITK A;  3WH0 A;  4BF8 A;  1FKD A;  3IHZ A;  3KAB A;  1J4I A;  1NMW A;  3RFW A;  2PV2 A;  1QPL A;  4JFK A;  1FKT A;  4U86 A;  4U85 A;  3TC5 A;  3UF8 A;  5HTG A;  1KT1 A;  2PPO A;  3KAC A;  2FAP A;  4O2T A;  2VN1 A;  2RUQ A;  1NMV A;  4LAX A;  1BL4 A;  1Q6H A;  2N87 A;  3I6C A;  2M2A A;  1FKK A;  2MNT A;  3IK8 A;  4GIV A;  3IKD A;  3KAI A;  4DRI A;  3UI6 A;  1KT0 A;  4QT3 A;  1Q1C A;  1F8A B;  2JZV A;  2KI3 A;  2ZR6 A;  4JFJ A;  3LUO A;  4ITZ A;  4JFM A;  4TX0 A;  4DIP A;  4R0X A;  2OFN A;  1YW5 A;  2XP8 A;  2XP4 A;  4TYO A;  3O5L A;  5D75 A;  1HXV A;  4FAP A;  2RUD A;  5HWB A;  1D6O A;  1FKS A;  3O5E A;  1J4H A;  4DZ3 A;  4FN2 A;  2XP9 A;  2M08 A;  3H9R B;  1B6C A;  2F2D A;  2MLX A;  3EY6 A;  2PBC A;  4GGQ A;  4J4N A;  3KZ7 A;  4IQC A;  4QT2 A;  2LJ4 A;  2K8I A;  2L2S A;  3FAP A;  1U79 A;  3KAD A;  3JXV A;  4QIB A;  4DRN A;  1FKJ A;  1C9H A;  3KAG A;  4ODP A;  2MPH A;  3PA7 A;  4ODO A;  5HW7 A;  5I98 A;  3O5G A;  2MF9 A;  5HW6 A;  2MLZ A;  2M1I A;  1FAP A;  2Y78 A;  3OOB A;  2KR7 A;  1D7H A;  3GPK A;  4N19 A;  4W9Q A;  5J6E A;  4TW8 A;  5B8I C;  4U84 A;  1J6Y A;  5GPG A;  2IF4 A;  2PPP A;  2Q5A A;  1L1P A;  1Q6I A;  4NNR A;  3O5F A;  1FKB A;  2PV1 A;  3O5M A;  4MGV A;  1R9H A;  4ODK A;  1JVW A;  1Q6U A;  3ODK A;  1A7X A;  1FKI A;  1ZCN A;  1PBK A;  2XPB A;  3JYM A;  4LAV A;  5HKG A;  2ZR4 A;  2RUC A;  3UI4 A;  4DH0 A;  4DRK A;  3KAH A;  4C02 B;  1FKL A;  3VAW A;  5HT1 A;  3CGN A;  1ROT A;  3B7X A;  4DRQ A;  4DT4 A;  1ZK6 A;  4DRJ A;  4W9O A;  2XP5 A;  3UI5 A;  3NI6 A;  4JFI A;  1JNT A;  2LGO A;  3UQB A;  1NSG A;  2DG4 A;  2DG3 A;  1BKF A;  2F21 A;  2PPN A;  2UZ5 A;  4IPX A;  3TCZ A;  2XP3 A;  2XPA A; 
#chains in the Genus database with same CATH topology
 1LL4 A;  1GOI A;  4W9P A;  5DO2 A;  4MPK A;  3PRA A;  1SYT A;  2ZQT A;  3O5R A;  1OGG A;  4WIW A;  2ZQS A;  3PR9 A;  1IX5 A;  1O6I A;  2KE0 A;  5HW8 A;  1FKR A;  1XRV A;  5DEZ A;  2ZR5 A;  1YAT A;  2KFW A;  4W5U A;  2G8Z A;  1FFR A;  2LPV A;  1E6P A;  1NWS A;  2D9F A;  3ART A;  4Z2G A;  3O5O A;  2F4E A;  1ROU A;  3O5Q A;  2DSZ A;  2IUZ A;  1NWT A;  1ZBV A;  4ZPV R;  4ODL A;  3AS3 A;  4DRM A;  4LAY A;  4MTV A;  1GPF A;  4ODN A;  1J4R A;  1D7I A;  1QZ2 A;  1W1P A;  3RM4 A;  3O5J A;  3UQA A;  4BF8 A;  2DSW A;  3IHZ A;  5JH8 A;  5GQB A;  3ALG A;  1UR9 A;  1KT1 A;  2PPO A;  3AS2 A;  3I6C A;  2M2A A;  3KAI A;  3CHD A;  4NZC A;  4TX0 A;  4DIP A;  3ALF A;  4R0X A;  1JCH B;  3WQW A;  2RUD A;  1FKS A;  4DWS B;  4DZ3 A;  1WAW A;  2FDM A;  3EY6 A;  3W4R A;  2B5U B;  2K8I A;  2LJ4 A;  1FKJ A;  5HW7 A;  3PA7 A;  1KFW A;  2MF9 A;  1SR0 A;  5HW6 A;  3B8S A;  2M1I A;  2DSV A;  5J6E A;  4URI A;  3WKZ A;  1W1T A;  4Z2H A;  2Q5A A;  2WLY A;  1L1P A;  2F23 A;  1FKB A;  3O5M A;  1EHN A;  2P4V A;  1PBK A;  1GUV A;  4P8V A;  3UI4 A;  4UDM A;  4DRK A;  3KAH A;  1W1Y A;  2O92 A;  3WD3 A;  4MNL A;  4Q7N A;  4ZS6 A;  1ZK6 A;  2DT3 A;  3UI5 A;  3BMB A;  5DF0 A;  4JFI A;  1JNT A;  3UQB A;  3B9A A;  4ODR A;  4MNK A;  4WKA A;  1F40 A;  3O5P A;  1P5Q A;  4TW7 A;  2DT2 A;  4DRO A;  1WB0 A;  2ZQU A;  2XP7 A;  3ARP A;  2OLH A;  3RM9 A;  4LGX A;  2AOS A;  1LQ0 A;  3AS0 A;  2AWG A;  2LKN A;  4JYS A;  1EYM A;  4PTM A;  4ML4 A;  1FKH A;  2RSE A;  5HWC A;  5HBF A;  1FKF A;  1OGB A;  1T11 A;  4DRP A;  2ZQV A;  3KAF A;  1NWU A;  1FJD A;  3ARW A;  1ZBC A;  1JNS A;  3CGM A;  2ETN A;  4DWS D;  3O5I A;  3RM8 A;  2YBU A;  3G6M A;  2ITK A;  3WH0 A;  3RFW A;  2PV2 A;  4P8U A;  4U86 A;  4U85 A;  3TC5 A;  3UF8 A;  3ARY A;  2RUQ A;  1NMV A;  1BL4 A;  2N87 A;  4GIV A;  1FKK A;  3ARS A;  3UI6 A;  4QT3 A;  1Q1C A;  1F8A B;  2KI3 A;  2ZR6 A;  4JFJ A;  4ITZ A;  3O5L A;  1E6R A;  2A3C A;  3GU0 A;  3O5E A;  1J4H A;  4S3J A;  3H9R B;  2MLX A;  4GGQ A;  3WD1 A;  3FAP A;  1U79 A;  3JXV A;  4QIB A;  4DRN A;  2MPH A;  2A3A A;  3QOK A;  2MLZ A;  2Y78 A;  2DSU A;  4N19 A;  4QZV B;  4TW8 A;  1E15 A;  5GPR A;  2PPP A;  4WKH A;  2PV1 A;  4ODK A;  2QF8 A;  1A7X A;  1FKI A;  3JYM A;  5HKG A;  3GTY X;  2ZR4 A;  2RUC A;  5HT1 A;  4DWS A;  1LJY A;  3BXW A;  3NI6 A;  4Z2J A;  1HKM A;  2DG3 A;  1FD9 A;  4LAW A;  1HJW A;  4L3N A;  2KGJ A;  5DIT A;  2DT0 A;  1JNE A;  4DRH A;  2VCD A;  1W26 A;  1EQ3 A;  1Y0O A;  1QPF A;  4DZ2 A;  3ARQ A;  2FKE A;  1H0G A;  4DWS C;  4NSB A;  2ESC A;  2RQS A;  1N1A A;  4P8X A;  3WL1 A;  5HUA A;  3MDY B;  4J4O A;  1W9P A;  2DPE A;  4ODM A;  3WD0 A;  1LL7 A;  3ARV A;  4IT4 A;  2XP6 A;  1E6Z A;  1XHG A;  2DG9 A;  1D7J A;  4ODQ A;  2WM0 A;  4L72 B;  1WNO A;  3PRD A;  2KO7 A;  5DIV A;  3FXY A;  1JND A;  1VF8 A;  4MSP A;  1HKK A;  1W9U A;  1FKG A;  4ZPT R;  1FKT A;  3CHC A;  3KAC A;  2FAP A;  2VN1 A;  3ARR A;  1X6L A;  3IKD A;  3RME A;  1KT0 A;  1HXV A;  1YW5 A;  2XP8 A;  2XP4 A;  4FAP A;  5HWB A;  1D6O A;  1LG1 A;  2PN0 A;  2WLZ A;  2XP9 A;  4AY1 A;  1B6C A;  4J4N A;  4KQZ A;  4QT2 A;  2L2S A;  1X6N A;  4ZPW R;  3KAG A;  4Q22 A;  4ODO A;  3O5G A;  1FAP A;  1LG2 A;  3OOB A;  2KR7 A;  3OA5 A;  3GPK A;  4W9Q A;  4HBO A;  3WD4 A;  4U84 A;  4Z2L A;  3WL0 A;  1J6Y A;  1ZL1 A;  4NNR A;  1RD6 A;  4MGV A;  1ZBW A;  1R9H A;  2G41 A;  4LAV A;  2WK2 A;  4IT6 A;  4DH0 A;  4C02 B;  3VAW A;  1W9V A;  3CGN A;  1ZU8 A;  1EDQ A;  3B7X A;  4DT4 A;  2A3B A;  4W9O A;  2XP5 A;  3EIP A;  2LGO A;  1NSG A;  2UZ5 A;  4IPX A;  3RGC A;  3PRB A;  3B9D A;  4Z2I A;  1GRJ A;  2XPA A;  4R5E A;  4TNS A;  4WK9 A;  3KCE A;  3JYJ A;  2PI6 A;  3FY1 A;  1NWR A;  4JFL A;  4G2P A;  1ZB5 A;  1W1V A;  3ARU A;  1ZBK A;  3O5D A;  4S3K A;  2A3E A;  3WD2 A;  2PV3 A;  1PIN A;  3ARZ A;  1H0I A;  4G50 A;  3UQI A;  2RUR A;  4MAV A;  5BXJ A;  1HKI A;  1TFV A;  3O5K A;  1NH6 A;  1M5Y A;  3NRK A;  4HBE A;  4WJX A;  4IQ2 A;  1TCO C;  2MLY A;  4HAR A;  3TDB A;  3IKG A;  3NTP A;  4TW6 A;  1CTN A;  1LL6 A;  5DIU A;  2YBT A;  3CHF A;  1FKD A;  3KAB A;  1J4I A;  1NMW A;  3ARX A;  3G6L A;  1QPL A;  4JFK A;  5HTG A;  4O2T A;  3CHE A;  4LAX A;  1E44 A;  1Q6H A;  2MNT A;  3IK8 A;  4DRI A;  3AS1 A;  2JZV A;  4JFM A;  3LUO A;  2OFN A;  4TYO A;  3WIJ A;  2O9O A;  5D75 A;  1UR8 A;  4FN2 A;  4XAK A;  1E9L A;  2M08 A;  2F2D A;  3WQV A;  2PBC A;  4P8W A;  3KZ7 A;  1HKJ A;  4IQC A;  3KAD A;  1C9H A;  1ITX A;  3CZ8 A;  4ODP A;  1FFQ A;  5I98 A;  2B31 A;  3B9E A;  1K9T A;  1D2K A;  1HJX A;  1D7H A;  5B8I C;  1HJV A;  4MNM A;  3ARO A;  4Z2K A;  5GPG A;  2IF4 A;  4MNJ A;  1E6N A;  1Q6I A;  3O5F A;  1JVW A;  1Q6U A;  3ODK A;  1ZCN A;  2XPB A;  1OWQ A;  1FKL A;  4KR0 B;  1ROT A;  4WKF A;  1EIB A;  4DRQ A;  2EUL A;  2DT1 A;  4DRJ A;  3CH9 A;  2DG4 A;  3TCZ A;  1BKF A;  2F21 A;  2PPN A;  2XP3 A;  3AQU A; 
#chains in the Genus database with same CATH homology
 1LL4 A;  1GOI A;  4W9P A;  5DO2 A;  4MPK A;  3PRA A;  1SYT A;  2ZQT A;  3O5R A;  1OGG A;  4WIW A;  2ZQS A;  3PR9 A;  1IX5 A;  1O6I A;  2KE0 A;  5HW8 A;  1FKR A;  1XRV A;  5DEZ A;  2ZR5 A;  1YAT A;  2KFW A;  4W5U A;  2G8Z A;  1FFR A;  2LPV A;  1E6P A;  1NWS A;  2D9F A;  3ART A;  4Z2G A;  3O5O A;  2F4E A;  1ROU A;  3O5Q A;  2DSZ A;  2IUZ A;  1NWT A;  1ZBV A;  4ZPV R;  4ODL A;  3AS3 A;  4DRM A;  4LAY A;  4MTV A;  1GPF A;  4ODN A;  1J4R A;  1D7I A;  1QZ2 A;  1W1P A;  3RM4 A;  3O5J A;  3UQA A;  4BF8 A;  2DSW A;  3IHZ A;  5JH8 A;  5GQB A;  3ALG A;  1UR9 A;  1KT1 A;  2PPO A;  3AS2 A;  3I6C A;  2M2A A;  3KAI A;  3CHD A;  4NZC A;  4TX0 A;  4DIP A;  3ALF A;  4R0X A;  3WQW A;  2RUD A;  1FKS A;  4DWS B;  4DZ3 A;  1WAW A;  2FDM A;  3EY6 A;  3W4R A;  2LJ4 A;  2K8I A;  1FKJ A;  5HW7 A;  3PA7 A;  1KFW A;  2MF9 A;  1SR0 A;  5HW6 A;  3B8S A;  2M1I A;  2DSV A;  5J6E A;  4URI A;  3WKZ A;  1W1T A;  4Z2H A;  2Q5A A;  2WLY A;  1L1P A;  1FKB A;  3O5M A;  1EHN A;  1PBK A;  1GUV A;  4P8V A;  3UI4 A;  4DRK A;  3KAH A;  1W1Y A;  2O92 A;  3WD3 A;  4MNL A;  4Q7N A;  4ZS6 A;  1ZK6 A;  2DT3 A;  3UI5 A;  5DF0 A;  4JFI A;  1JNT A;  3UQB A;  3B9A A;  4ODR A;  4MNK A;  4WKA A;  1F40 A;  3O5P A;  1P5Q A;  4TW7 A;  2DT2 A;  4DRO A;  1WB0 A;  2ZQU A;  2XP7 A;  3ARP A;  2OLH A;  3RM9 A;  4LGX A;  2AOS A;  1LQ0 A;  3AS0 A;  2AWG A;  2LKN A;  4JYS A;  1EYM A;  4PTM A;  4ML4 A;  1FKH A;  2RSE A;  5HWC A;  5HBF A;  1FKF A;  1OGB A;  1T11 A;  4DRP A;  2ZQV A;  3KAF A;  1NWU A;  1FJD A;  3ARW A;  1ZBC A;  1JNS A;  3CGM A;  4DWS D;  3O5I A;  3RM8 A;  2YBU A;  3G6M A;  2ITK A;  3WH0 A;  3RFW A;  2PV2 A;  4P8U A;  4U86 A;  4U85 A;  3TC5 A;  3UF8 A;  3ARY A;  2RUQ A;  1NMV A;  1BL4 A;  2N87 A;  4GIV A;  1FKK A;  3ARS A;  3UI6 A;  4QT3 A;  1Q1C A;  1F8A B;  2KI3 A;  2ZR6 A;  4JFJ A;  4ITZ A;  3O5L A;  1E6R A;  2A3C A;  3O5E A;  1J4H A;  4S3J A;  3H9R B;  2MLX A;  4GGQ A;  3WD1 A;  3FAP A;  1U79 A;  3JXV A;  4QIB A;  4DRN A;  2MPH A;  2A3A A;  3QOK A;  2MLZ A;  2Y78 A;  2DSU A;  4N19 A;  4QZV B;  4TW8 A;  1E15 A;  5GPR A;  2PPP A;  4WKH A;  2PV1 A;  4ODK A;  2QF8 A;  1A7X A;  1FKI A;  3JYM A;  5HKG A;  2ZR4 A;  2RUC A;  5HT1 A;  4DWS A;  1LJY A;  3BXW A;  3NI6 A;  4Z2J A;  1HKM A;  2DG3 A;  1FD9 A;  4LAW A;  1HJW A;  4L3N A;  2KGJ A;  5DIT A;  2DT0 A;  1JNE A;  4DRH A;  2VCD A;  1W26 A;  1EQ3 A;  1Y0O A;  1QPF A;  4DZ2 A;  3ARQ A;  2FKE A;  1H0G A;  4DWS C;  4NSB A;  2ESC A;  2RQS A;  1N1A A;  4P8X A;  3WL1 A;  5HUA A;  3MDY B;  4J4O A;  1W9P A;  2DPE A;  4ODM A;  3WD0 A;  1LL7 A;  3ARV A;  4IT4 A;  2XP6 A;  1E6Z A;  1XHG A;  2DG9 A;  1D7J A;  4ODQ A;  2WM0 A;  4L72 B;  1WNO A;  3PRD A;  2KO7 A;  5DIV A;  3FXY A;  1JND A;  1VF8 A;  4MSP A;  1HKK A;  1W9U A;  1FKG A;  4ZPT R;  1FKT A;  3CHC A;  3KAC A;  2FAP A;  2VN1 A;  3ARR A;  1X6L A;  3IKD A;  3RME A;  1KT0 A;  1HXV A;  1YW5 A;  2XP8 A;  2XP4 A;  4FAP A;  5HWB A;  1D6O A;  1LG1 A;  2WLZ A;  2XP9 A;  4AY1 A;  1B6C A;  4J4N A;  4KQZ A;  4QT2 A;  2L2S A;  1X6N A;  4ZPW R;  3KAG A;  4Q22 A;  4ODO A;  3O5G A;  1FAP A;  1LG2 A;  3OOB A;  2KR7 A;  3OA5 A;  3GPK A;  4W9Q A;  4HBO A;  3WD4 A;  4U84 A;  4Z2L A;  3WL0 A;  1J6Y A;  1ZL1 A;  4NNR A;  1RD6 A;  4MGV A;  1ZBW A;  1R9H A;  2G41 A;  4LAV A;  2WK2 A;  4IT6 A;  4DH0 A;  4C02 B;  3VAW A;  1W9V A;  3CGN A;  1ZU8 A;  1EDQ A;  3B7X A;  4DT4 A;  2A3B A;  4W9O A;  2XP5 A;  2LGO A;  1NSG A;  2UZ5 A;  4IPX A;  3RGC A;  3PRB A;  3B9D A;  4Z2I A;  2XPA A;  4R5E A;  4TNS A;  4WK9 A;  3KCE A;  3JYJ A;  2PI6 A;  3FY1 A;  1NWR A;  4JFL A;  4G2P A;  1ZB5 A;  1W1V A;  3ARU A;  1ZBK A;  3O5D A;  4S3K A;  2A3E A;  3WD2 A;  2PV3 A;  1PIN A;  3ARZ A;  1H0I A;  4G50 A;  3UQI A;  2RUR A;  4MAV A;  5BXJ A;  1HKI A;  1TFV A;  3O5K A;  1NH6 A;  1M5Y A;  3NRK A;  4HBE A;  4WJX A;  4IQ2 A;  1TCO C;  2MLY A;  4HAR A;  3TDB A;  3IKG A;  3NTP A;  4TW6 A;  1CTN A;  1LL6 A;  5DIU A;  2YBT A;  3CHF A;  1FKD A;  3KAB A;  1J4I A;  1NMW A;  3ARX A;  3G6L A;  1QPL A;  4JFK A;  5HTG A;  4O2T A;  3CHE A;  4LAX A;  1Q6H A;  2MNT A;  3IK8 A;  4DRI A;  3AS1 A;  2JZV A;  4JFM A;  3LUO A;  2OFN A;  4TYO A;  3WIJ A;  2O9O A;  5D75 A;  1UR8 A;  4FN2 A;  4XAK A;  1E9L A;  2M08 A;  2F2D A;  3WQV A;  2PBC A;  4P8W A;  3KZ7 A;  1HKJ A;  4IQC A;  3KAD A;  1C9H A;  1ITX A;  3CZ8 A;  4ODP A;  1FFQ A;  5I98 A;  2B31 A;  3B9E A;  1K9T A;  1D2K A;  1HJX A;  1D7H A;  5B8I C;  1HJV A;  4MNM A;  3ARO A;  4Z2K A;  5GPG A;  2IF4 A;  4MNJ A;  1E6N A;  1Q6I A;  3O5F A;  1JVW A;  1Q6U A;  3ODK A;  1ZCN A;  2XPB A;  1OWQ A;  1FKL A;  4KR0 B;  1ROT A;  4WKF A;  1EIB A;  4DRQ A;  2DT1 A;  4DRJ A;  3CH9 A;  2DG4 A;  3TCZ A;  1BKF A;  2F21 A;  2PPN A;  2XP3 A;  3AQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...