2RQSA

3d structure of pin from the psychrophilic archeon cenarcheaum symbiosum (cspin)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
97
structure length
97
Chain Sequence
GPMGSMADKIKCSHILVKKQGEALAVQERLKAGEKFGKLAKELSIDGGSAKRDGSLGYFGRGKMVKPFEDAAFRLQVGEVSEPVKSEFGYHVIKRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Parvulin-like peptidyl-prolyl isomerase
publication title Structure and Dynamics of the First Archaeal Parvulin Reveal a New Functionally Important Loop in Parvulin-type Prolyl Isomerases
pubmed doi rcsb
source organism Cenarchaeum symbiosum
molecule tags Isomerase
total genus 15
structure length 97
sequence length 97
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13616 Rotamase_3 PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2rqsA00
3JYMA 2KI3A 1HXVA 4J4NA 1ZK6A 2MLXA 2PBCA 1FKDA 1M5YA 2PPOA 2XPAA 3OOBA 2ZR5A 3IKDA 4J4OA 2FKEA 2PPPA 4ODLA 2XP9A 3JYJA 4ODQA 3KAGA 2LKNA 3NTPA 4LAVA 1PINA 2LJ4A 2PV1A 3UI5A 4G2PA 3VAWA 2RUCA 4JYSA 1QPLA 2XP3A 4DRJA 5DITA 5HUAA 1YATA 2FAPA 5B8IC 5HWCA 1FKIA 2MPHA 1P5QA 4JFIA 1FKFA 1Q1CA 2XP7A 3FAPA 1TCOC 4MSPA 5D75A 3RFWA 4DIPA 2KR7A 4GIVA 4JFLA 4QT3A 2XP5A 5BXJA 2N87A 3KAFA 4TW7A 1Q6IA 4DRKA 1FAPA 2DG4A 3LUOA 3KABA 4IPXA 1EYMA 1QPFA 2ZR6A 2D9FA 2UZ5A 3CGMA 3JXVA 4IQ2A 4ODKA 2RUQA 4DRMA 4ODNA 2OFNA 4NNRA 2ZQUA 3KAHA 1J4RA 2MLYA 4DRNA 4C02B 3NI6A 5HKGA 5HT1A 2XP6A 1FKHA 1YW5A 3TDBA 1FJDA 3KCEA 1JVWA 1W26A 1BKFA 4QIBA 5GPGA 3O5FA 1FKBA 1KT1A 4TW6A 1FKKA 3UI6A 2MNTA 2Q5AA 2L2SA 1Y0OA 3IK8A 2F21A 5DIVA 4O2TA 3I6CA 2F2DA 2RSEA 3H9RB 2KGJA 2ITKA 3TCZA 3UQBA 1FKJA 4U84A 1L1PA 2RURA 2DG9A 4LAXA 3O5MA 1ZCNA 3O5OA 1C9HA 1R9HA 1Q6HA 1J4IA 4DRQA 1EQ3A 1D7HA 1ROUA 4ODRA 1D7IA 1JNTA 3ODKA 5HTGA 2KFWA 2DG3A 4GGQA 3NRKA 3KAIA 4ODMA 3RGCA 3WH0A 3O5QA 2PPNA 4DRHA 3O5KA 4W9QA 2XPBA 1FD9A 2M2AA 4TX0A 2KE0A 1QZ2A 4TW8A 3IKGA 2PV2A 4TNSA 3O5LA 1J4HA 1FKSA 5J6EA 4BF8A 3KACA 1ROTA 3CGNA 4G50A 3PA7A 3PRBA 4JFMA 1A7XA 1D6OA 4LAWA 3UI4A 3KADA 1JNSA 2M1IA 4TYOA 4FN2A 2XP4A 3O5RA 4IQCA 1Q6UA 4JFJA 4W9OA 4QT2A 5HW8A 1PBKA 5I98A 3O5DA 1FKTA 1U79A 3PRDA 4ITZA 4JFKA 3IHZA 3UQIA 5HW6A 4DZ2A 1FKGA 2F4EA 2IF4A 2ZQSA 1NSGA 3MDYB 1BL4A 2LPVA 2K8IA 4ODOA 4DROA 2VN1A 2XP8A 3O5JA 5HWBA 2AWGA 2ZR4A 4DRPA 1J6YA 1NMVA 2RQSA 4FAPA 1B6CA 3UQAA 2LGOA 3O5EA 3O5GA 5DIUA 4ODPA 4DT4A 1FKLA 4MGVA 3B7XA 1T11A 2M08A 2ZQVA 3GPKA 2JZVA 3KZ7A 1NMWA 3EY6A 3O5PA 4LAYA 2RUDA 2Y78A 3O5IA 1F8AB 4W9PA 2KO7A 2ZQTA 2PV3A 1KT0A 3TC5A 4DH0A 2MF9A 4DZ3A 4DRIA 1F40A 4U86A 4R0XA 1D7JA 2VCDA 4N19A 5HW7A 2MLZA 4U85A 1FKRA 1N1AA 3UF8A
chains in the Genus database with same CATH superfamily
3JYMA 2PI6A 3B9EA 4J4OA 1HJXA 1TFVA 2F23A 4ODLA 4ODQA 3KAGA 1PINA 2LJ4A 2PN0A 1LG1A 1NWUA 2FAPA 5B8IC 5HWCA 2XP7A 3RFWA 3AS1A 4JFLA 4QT3A 2XP5A 5BXJA 2N87A 3KAFA 2DG4A 4IPXA 3KABA 2ZR6A 4NNRA 2YBTA 5HKGA 1E6RA 2XP6A 1YW5A 3ARYA 3CHDA 1GRJA 1JVWA 2O92A 1W26A 1BKFA 3O5FA 2MNTA 2Q5AA 2L2SA 1Y0OA 2B5UB 1GUVA 5DIVA 1ITXA 3WD0A 3H9RB 2DSVA 2DG9A 1LL6A 3O5OA 5GQBA 1J4IA 1ROUA 1NWRA 4ODRA 5DEZA 1NH6A 2KFWA 4GGQA 3RGCA 2DT1A 4W5UA 3O5KA 1FD9A 1GPFA 4TX0A 2KE0A 3W4RA 4TW8A 3IKGA 5J6EA 1FKSA 1EHNA 4ZPVR 1A7XA 2FDMA 4LAWA 3KADA 1FFRA 1JNSA 2ETNA 3B9DA 3GTYX 4P8WA 1JCHB 1E44A 3RM8A 1U79A 3IHZA 2K8IA 1GOIA 2VN1A 5HBFA 1NMVA 1W9PA 4MGVA 3KZ7A 4W9PA 2Y78A 4Z2IA 1HJVA 3WQVA 4N19A 4U85A 3G6LA 1HXVA 2PBCA 1FKDA 2FKEA 1WAWA 1W9UA 3ARSA 3CZ8A 2XP9A 4LAVA 1WNOA 1K9TA 1QPLA 2XP3A 2G8ZA 1LG2A 1YATA 3QOKA 4DIPA 4GIVA 4Z2LA 1H0IA 3AS2A 4URIA 4DRKA 1QPFA 3BXWA 4IQ2A 3JXVA 5DO2A 4DRMA 4ODNA 4WIWA 2OFNA 1J4RA 2MLYA 2A3AA 4C02B 4MNKA 1FKHA 1FJDA 3KCEA 4ML4A 2B31A 5GPGA 1KT1A 4TW6A 1FKKA 1ZBWA 2F21A 4O2TA 3I6CA 4MNMA 3UQBA 1FKJA 1L1PA 2RURA 4Q22A 3RM4A 1EQ3A 1D7IA 5HTGA 2DG3A 3NRKA 3WH0A 1E9LA 4DRHA 1LJYA 4W9QA 2XPBA 1XHGA 4TNSA 3WL1A 1OWQA 4G50A 4IT4A 1O6IA 3PA7A 4S3JA 4Z2HA 2OLHA 1D6OA 1LQ0A 3UI4A 5JH8A 2M1IA 4TYOA 2XP4A 3O5RA 4JFJA 4QT2A 1JNDA 1PBKA 4R5EA 1FKTA 2ESCA 2F4EA 2ZQSA 1NSGA 2DSWA 4ODOA 1W1YA 2DPEA 3GU0A 4DRPA 1B6CA 2LGOA 3O5EA 4KR0B 2DT0A 3ALGA 1HKMA 3GPKA 3G6MA 4Z2KA 3B9AA 4LAYA 1F8AB 1SYTA 2KO7A 4DZ3A 4DRIA 1F40A 4U86A 4R0XA 1D7JA 3RMEA 2VCDA 1FKRA 1N1AA 1ZB5A 4MTVA 4J4NA 4HBEA 1UR9A 2MLXA 2PPOA 2XPAA 1CTNA 2LKNA 4NZCA 3FXYA 3UI5A 4P8XA 3WL0A 1W9VA 3WQWA 4DRJA 4MSPA 1NWTA 1P5QA 1ZBVA 1Q1CA 2MPHA 4Q7NA 3FAPA 5D75A 3WD3A 4TW7A 1Q6IA 3ARVA 4WK9A 4AY1A 3LUOA 2D9FA 3CGMA 4ODKA 1XRVA 2RUQA 1ZL1A 3KAHA 3RM9A 3TDBA 3ARQA 4IT6A 3UI6A 3WD4A 1EDQA 3ARPA 4HARA 2RSEA 2KGJA 2ITKA 3WD1A 4U84A 4LAXA 3O5MA 1SR0A 1X6LA 1R9HA 4DRQA 4ZPTR 1JNTA 4ODMA 3O5QA 1ZU8A 1HJWA 2A3CA 1JNEA 2PV2A 4DWSD 3O5LA 1J4HA 1NWSA 4WKFA 3KACA 3CGNA 3AS3A 3PRBA 4JFMA 4L72B 3PR9A 2WK2A 4MAVA 4Z2GA 4L3NA 2A3BA 4FN2A 1Q6UA 1OGGA 5I98A 3AROA 3CH9A 3O5DA 3PRDA 4P8VA 5HW6A 4ZPWR 4DZ2A 3MDYB 5HWBA 3O5JA 2RQSA 4XAKA 1E15A 4DWSB 5DIUA 4ODPA 3ARUA 4DT4A 3ARTA 1ZBCA 1T11A 2JZVA 1NMWA 3EY6A 3O5PA 1EIBA 2RUDA 3O5IA 4MNLA 1RD6A 3TC5A 2EULA 2PV3A 4DH0A 4LGXA 5HW7A 2MLZA 4NSBA 3UF8A 2KI3A 3B8SA 3CHCA 1ZK6A 3OOBA 1M5YA 4WKHA 2ZR5A 3IKDA 2PPPA 4MPKA 5GPRA 3ARZA 3JYJA 3NTPA 2PV1A 4P8UA 1VF8A 4G2PA 3VAWA 2RUCA 4JYSA 2DT3A 2DSZA 1HKIA 1H0GA 1E6NA 3CHEA 4QZVB 2O9OA 5DITA 5HUAA 1IX5A 1FKIA 4WJXA 1LL4A 4JFIA 1FKFA 1TCOC 2KR7A 3FY1A 3PRAA 1ZBKA 1FAPA 1EYMA 2UZ5A 2DSUA 2P4VA 3ARXA 4UDMA 2ZQUA 3ALFA 4DRNA 3ARWA 3BMBA 3NI6A 5HT1A 1D2KA 4QIBA 3CHFA 1FKBA 1W1PA 2QF8A 3AQUA 4KQZA 3IK8A 2AOSA 2F2DA 3WKZA 3TCZA 4HBOA 1ZCNA 1C9HA 1UR8A 1Q6HA 4Z2JA 1D7HA 2WLYA 3ODKA 4DWSA 3KAIA 1OGBA 4MNJA 2PPNA 2M2AA 1E6ZA 1QZ2A 5DF0A 2A3EA 1KFWA 4BF8A 1ROTA 1WB0A 1X6NA 3ARRA 4S3KA 4W9OA 4IQCA 2G41A 3WIJA 5HW8A 1W1VA 1FFQA 4JFKA 4ITZA 3UQIA 1FKGA 2IF4A 4DROA 1BL4A 2LPVA 2IUZA 2XP8A 3OA5A 4DWSC 2AWGA 2ZR4A 3EIPA 1J6YA 1E6PA 4ZS6A 4FAPA 2YBUA 3UQAA 3O5GA 1FKLA 3B7XA 2M08A 2ZQVA 3WD2A 1HKJA 2ZQTA 2DT2A 1KT0A 1W1TA 2MF9A 2WM0A 4PTMA 3AS0A 1LL7A 1HKKA 4WKAA 2WLZA
chains in the Genus database with same CATH topology
3JYMA 2PI6A 3B9EA 4J4OA 1HJXA 1TFVA 4ODLA 4ODQA 3KAGA 1PINA 2LJ4A 1LG1A 1NWUA 2FAPA 5B8IC 5HWCA 2XP7A 3RFWA 3AS1A 4JFLA 4QT3A 2XP5A 5BXJA 2N87A 3KAFA 2DG4A 4IPXA 3KABA 2ZR6A 4NNRA 2YBTA 5HKGA 1E6RA 2XP6A 1YW5A 3ARYA 3CHDA 1JVWA 2O92A 1W26A 1BKFA 3O5FA 2MNTA 2Q5AA 2L2SA 1Y0OA 1GUVA 5DIVA 1ITXA 3WD0A 3H9RB 2DSVA 2DG9A 1LL6A 3O5OA 5GQBA 1J4IA 1ROUA 1NWRA 4ODRA 5DEZA 1NH6A 2KFWA 4GGQA 3RGCA 2DT1A 4W5UA 3O5KA 1FD9A 1GPFA 4TX0A 2KE0A 3W4RA 4TW8A 3IKGA 5J6EA 1FKSA 1EHNA 4ZPVR 1A7XA 2FDMA 4LAWA 3KADA 1FFRA 1JNSA 3B9DA 4P8WA 3RM8A 1U79A 3IHZA 2K8IA 1GOIA 2VN1A 5HBFA 1NMVA 1W9PA 4MGVA 3KZ7A 4W9PA 2Y78A 4Z2IA 1HJVA 3WQVA 4N19A 4U85A 3G6LA 1HXVA 2PBCA 1FKDA 2FKEA 1WAWA 1W9UA 3ARSA 3CZ8A 2XP9A 4LAVA 1WNOA 1K9TA 1QPLA 2XP3A 2G8ZA 1LG2A 1YATA 3QOKA 4DIPA 4GIVA 4Z2LA 1H0IA 3AS2A 4URIA 4DRKA 1QPFA 3BXWA 4IQ2A 3JXVA 5DO2A 4DRMA 4ODNA 4WIWA 2OFNA 1J4RA 2MLYA 2A3AA 4C02B 4MNKA 1FKHA 1FJDA 3KCEA 4ML4A 2B31A 5GPGA 1KT1A 4TW6A 1FKKA 1ZBWA 2F21A 4O2TA 3I6CA 4MNMA 3UQBA 1FKJA 1L1PA 2RURA 4Q22A 3RM4A 1EQ3A 1D7IA 5HTGA 2DG3A 3NRKA 3WH0A 1E9LA 4DRHA 1LJYA 4W9QA 2XPBA 1XHGA 4TNSA 3WL1A 1OWQA 4G50A 4IT4A 1O6IA 3PA7A 4S3JA 4Z2HA 2OLHA 1D6OA 1LQ0A 3UI4A 5JH8A 2M1IA 4TYOA 2XP4A 3O5RA 4JFJA 4QT2A 1JNDA 1PBKA 4R5EA 1FKTA 2ESCA 2F4EA 2ZQSA 1NSGA 2DSWA 4ODOA 1W1YA 2DPEA 4DRPA 1B6CA 2LGOA 3O5EA 4KR0B 2DT0A 3ALGA 1HKMA 3GPKA 3G6MA 4Z2KA 3B9AA 4LAYA 1F8AB 1SYTA 2KO7A 4DZ3A 4DRIA 1F40A 4U86A 4R0XA 1D7JA 3RMEA 2VCDA 1FKRA 1N1AA 1ZB5A 4MTVA 4J4NA 4HBEA 1UR9A 2MLXA 2PPOA 2XPAA 1CTNA 2LKNA 4NZCA 3FXYA 3UI5A 4P8XA 3WL0A 1W9VA 3WQWA 4DRJA 4MSPA 1NWTA 1P5QA 1ZBVA 1Q1CA 2MPHA 4Q7NA 3FAPA 5D75A 3WD3A 4TW7A 1Q6IA 3ARVA 4WK9A 4AY1A 3LUOA 2D9FA 3CGMA 4ODKA 1XRVA 2RUQA 1ZL1A 3KAHA 3RM9A 3TDBA 3ARQA 4IT6A 3UI6A 3WD4A 1EDQA 3ARPA 4HARA 2RSEA 2KGJA 2ITKA 3WD1A 4U84A 4LAXA 3O5MA 1SR0A 1X6LA 1R9HA 4DRQA 4ZPTR 1JNTA 4ODMA 3O5QA 1ZU8A 1HJWA 2A3CA 1JNEA 2PV2A 4DWSD 3O5LA 1J4HA 1NWSA 4WKFA 3KACA 3CGNA 3AS3A 3PRBA 4JFMA 4L72B 3PR9A 2WK2A 4MAVA 4Z2GA 4L3NA 2A3BA 4FN2A 1Q6UA 1OGGA 5I98A 3AROA 3CH9A 3O5DA 3PRDA 4P8VA 5HW6A 4ZPWR 4DZ2A 3MDYB 5HWBA 3O5JA 2RQSA 4XAKA 1E15A 4DWSB 5DIUA 4ODPA 3ARUA 4DT4A 3ARTA 1ZBCA 1T11A 2JZVA 1NMWA 3EY6A 3O5PA 1EIBA 2RUDA 3O5IA 4MNLA 1RD6A 3TC5A 2PV3A 4DH0A 4LGXA 5HW7A 2MLZA 4NSBA 3UF8A 2KI3A 3B8SA 3CHCA 1ZK6A 3OOBA 1M5YA 4WKHA 2ZR5A 3IKDA 2PPPA 4MPKA 5GPRA 3ARZA 3JYJA 3NTPA 2PV1A 4P8UA 1VF8A 4G2PA 3VAWA 2RUCA 4JYSA 2DT3A 2DSZA 1HKIA 1H0GA 1E6NA 3CHEA 4QZVB 2O9OA 5DITA 5HUAA 1IX5A 1FKIA 4WJXA 1LL4A 4JFIA 1FKFA 1TCOC 2KR7A 3FY1A 3PRAA 1ZBKA 1FAPA 1EYMA 2UZ5A 2DSUA 3ARXA 2ZQUA 3ALFA 4DRNA 3ARWA 3NI6A 5HT1A 1D2KA 4QIBA 3CHFA 1FKBA 1W1PA 2QF8A 3AQUA 4KQZA 3IK8A 2AOSA 2F2DA 3WKZA 3TCZA 4HBOA 1ZCNA 1C9HA 1UR8A 1Q6HA 4Z2JA 1D7HA 2WLYA 3ODKA 4DWSA 3KAIA 1OGBA 4MNJA 2PPNA 2M2AA 1E6ZA 1QZ2A 5DF0A 2A3EA 1KFWA 4BF8A 1ROTA 1WB0A 1X6NA 3ARRA 4S3KA 4W9OA 4IQCA 2G41A 3WIJA 5HW8A 1W1VA 1FFQA 4JFKA 4ITZA 3UQIA 1FKGA 2IF4A 4DROA 1BL4A 2LPVA 2IUZA 2XP8A 3OA5A 4DWSC 2AWGA 2ZR4A 1J6YA 1E6PA 4ZS6A 4FAPA 2YBUA 3UQAA 3O5GA 1FKLA 3B7XA 2M08A 2ZQVA 3WD2A 1HKJA 2ZQTA 2DT2A 1KT0A 1W1TA 2MF9A 2WM0A 4PTMA 3AS0A 1LL7A 1HKKA 4WKAA 2WLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JYM A;  2KI3 A;  1HXV A;  4J4N A;  1ZK6 A;  2MLX A;  2PBC A;  1FKD A;  1M5Y A;  2PPO A;  2XPA A;  3OOB A;  2ZR5 A;  3IKD A;  4J4O A;  2FKE A;  2PPP A;  4ODL A;  2XP9 A;  3JYJ A;  4ODQ A;  3KAG A;  2LKN A;  3NTP A;  4LAV A;  1PIN A;  2LJ4 A;  2PV1 A;  3UI5 A;  4G2P A;  3VAW A;  2RUC A;  4JYS A;  1QPL A;  2XP3 A;  4DRJ A;  5DIT A;  5HUA A;  1YAT A;  2FAP A;  5B8I C;  5HWC A;  1FKI A;  2MPH A;  1P5Q A;  4JFI A;  1FKF A;  1Q1C A;  2XP7 A;  3FAP A;  1TCO C;  4MSP A;  5D75 A;  3RFW A;  4DIP A;  2KR7 A;  4GIV A;  4JFL A;  4QT3 A;  2XP5 A;  5BXJ A;  2N87 A;  3KAF A;  4TW7 A;  1Q6I A;  4DRK A;  1FAP A;  2DG4 A;  3LUO A;  3KAB A;  4IPX A;  1EYM A;  1QPF A;  2ZR6 A;  2D9F A;  2UZ5 A;  3CGM A;  3JXV A;  4IQ2 A;  4ODK A;  2RUQ A;  4DRM A;  4ODN A;  2OFN A;  4NNR A;  2ZQU A;  3KAH A;  1J4R A;  2MLY A;  4DRN A;  4C02 B;  3NI6 A;  5HKG A;  5HT1 A;  2XP6 A;  1FKH A;  1YW5 A;  3TDB A;  1FJD A;  3KCE A;  1JVW A;  1W26 A;  1BKF A;  4QIB A;  5GPG A;  3O5F A;  1FKB A;  1KT1 A;  4TW6 A;  1FKK A;  3UI6 A;  2MNT A;  2Q5A A;  2L2S A;  1Y0O A;  3IK8 A;  2F21 A;  5DIV A;  4O2T A;  3I6C A;  2F2D A;  2RSE A;  3H9R B;  2KGJ A;  2ITK A;  3TCZ A;  3UQB A;  1FKJ A;  4U84 A;  1L1P A;  2RUR A;  2DG9 A;  4LAX A;  3O5M A;  1ZCN A;  3O5O A;  1C9H A;  1R9H A;  1Q6H A;  1J4I A;  4DRQ A;  1EQ3 A;  1D7H A;  1ROU A;  4ODR A;  1D7I A;  1JNT A;  3ODK A;  5HTG A;  2KFW A;  2DG3 A;  4GGQ A;  3NRK A;  3KAI A;  4ODM A;  3RGC A;  3WH0 A;  3O5Q A;  2PPN A;  4DRH A;  3O5K A;  4W9Q A;  2XPB A;  1FD9 A;  2M2A A;  4TX0 A;  2KE0 A;  1QZ2 A;  4TW8 A;  3IKG A;  2PV2 A;  4TNS A;  3O5L A;  1J4H A;  1FKS A;  5J6E A;  4BF8 A;  3KAC A;  1ROT A;  3CGN A;  4G50 A;  3PA7 A;  3PRB A;  4JFM A;  1A7X A;  1D6O A;  4LAW A;  3UI4 A;  3KAD A;  1JNS A;  2M1I A;  4TYO A;  4FN2 A;  2XP4 A;  3O5R A;  4IQC A;  1Q6U A;  4JFJ A;  4W9O A;  4QT2 A;  5HW8 A;  1PBK A;  5I98 A;  3O5D A;  1FKT A;  1U79 A;  3PRD A;  4ITZ A;  4JFK A;  3IHZ A;  3UQI A;  5HW6 A;  4DZ2 A;  1FKG A;  2F4E A;  2IF4 A;  2ZQS A;  1NSG A;  3MDY B;  1BL4 A;  2LPV A;  2K8I A;  4ODO A;  4DRO A;  2VN1 A;  2XP8 A;  3O5J A;  5HWB A;  2AWG A;  2ZR4 A;  4DRP A;  1J6Y A;  1NMV A;  2RQS A;  4FAP A;  1B6C A;  3UQA A;  2LGO A;  3O5E A;  3O5G A;  5DIU A;  4ODP A;  4DT4 A;  1FKL A;  4MGV A;  3B7X A;  1T11 A;  2M08 A;  2ZQV A;  3GPK A;  2JZV A;  3KZ7 A;  1NMW A;  3EY6 A;  3O5P A;  4LAY A;  2RUD A;  2Y78 A;  3O5I A;  1F8A B;  4W9P A;  2KO7 A;  2ZQT A;  2PV3 A;  1KT0 A;  3TC5 A;  4DH0 A;  2MF9 A;  4DZ3 A;  4DRI A;  1F40 A;  4U86 A;  4R0X A;  1D7J A;  2VCD A;  4N19 A;  5HW7 A;  2MLZ A;  4U85 A;  1FKR A;  1N1A A;  3UF8 A; 
#chains in the Genus database with same CATH topology
 3JYM A;  2PI6 A;  3B9E A;  4J4O A;  1HJX A;  1TFV A;  2F23 A;  4ODL A;  4ODQ A;  3KAG A;  1PIN A;  2LJ4 A;  2PN0 A;  1LG1 A;  1NWU A;  2FAP A;  5B8I C;  5HWC A;  2XP7 A;  3RFW A;  3AS1 A;  4JFL A;  4QT3 A;  2XP5 A;  5BXJ A;  2N87 A;  3KAF A;  2DG4 A;  4IPX A;  3KAB A;  2ZR6 A;  4NNR A;  2YBT A;  5HKG A;  1E6R A;  2XP6 A;  1YW5 A;  3ARY A;  3CHD A;  1GRJ A;  1JVW A;  2O92 A;  1W26 A;  1BKF A;  3O5F A;  2MNT A;  2Q5A A;  2L2S A;  1Y0O A;  2B5U B;  1GUV A;  5DIV A;  1ITX A;  3WD0 A;  3H9R B;  2DSV A;  2DG9 A;  1LL6 A;  3O5O A;  5GQB A;  1J4I A;  1ROU A;  1NWR A;  4ODR A;  5DEZ A;  1NH6 A;  2KFW A;  4GGQ A;  3RGC A;  2DT1 A;  4W5U A;  3O5K A;  1FD9 A;  1GPF A;  4TX0 A;  2KE0 A;  3W4R A;  4TW8 A;  3IKG A;  5J6E A;  1FKS A;  1EHN A;  4ZPV R;  1A7X A;  2FDM A;  4LAW A;  3KAD A;  1FFR A;  1JNS A;  2ETN A;  3B9D A;  3GTY X;  4P8W A;  1JCH B;  1E44 A;  3RM8 A;  1U79 A;  3IHZ A;  2K8I A;  1GOI A;  2VN1 A;  5HBF A;  1NMV A;  1W9P A;  4MGV A;  3KZ7 A;  4W9P A;  2Y78 A;  4Z2I A;  1HJV A;  3WQV A;  4N19 A;  4U85 A;  3G6L A;  1HXV A;  2PBC A;  1FKD A;  2FKE A;  1WAW A;  1W9U A;  3ARS A;  3CZ8 A;  2XP9 A;  4LAV A;  1WNO A;  1K9T A;  1QPL A;  2XP3 A;  2G8Z A;  1LG2 A;  1YAT A;  3QOK A;  4DIP A;  4GIV A;  4Z2L A;  1H0I A;  3AS2 A;  4URI A;  4DRK A;  1QPF A;  3BXW A;  4IQ2 A;  3JXV A;  5DO2 A;  4DRM A;  4ODN A;  4WIW A;  2OFN A;  1J4R A;  2MLY A;  2A3A A;  4C02 B;  4MNK A;  1FKH A;  1FJD A;  3KCE A;  4ML4 A;  2B31 A;  5GPG A;  1KT1 A;  4TW6 A;  1FKK A;  1ZBW A;  2F21 A;  4O2T A;  3I6C A;  4MNM A;  3UQB A;  1FKJ A;  1L1P A;  2RUR A;  4Q22 A;  3RM4 A;  1EQ3 A;  1D7I A;  5HTG A;  2DG3 A;  3NRK A;  3WH0 A;  1E9L A;  4DRH A;  1LJY A;  4W9Q A;  2XPB A;  1XHG A;  4TNS A;  3WL1 A;  1OWQ A;  4G50 A;  4IT4 A;  1O6I A;  3PA7 A;  4S3J A;  4Z2H A;  2OLH A;  1D6O A;  1LQ0 A;  3UI4 A;  5JH8 A;  2M1I A;  4TYO A;  2XP4 A;  3O5R A;  4JFJ A;  4QT2 A;  1JND A;  1PBK A;  4R5E A;  1FKT A;  2ESC A;  2F4E A;  2ZQS A;  1NSG A;  2DSW A;  4ODO A;  1W1Y A;  2DPE A;  3GU0 A;  4DRP A;  1B6C A;  2LGO A;  3O5E A;  4KR0 B;  2DT0 A;  3ALG A;  1HKM A;  3GPK A;  3G6M A;  4Z2K A;  3B9A A;  4LAY A;  1F8A B;  1SYT A;  2KO7 A;  4DZ3 A;  4DRI A;  1F40 A;  4U86 A;  4R0X A;  1D7J A;  3RME A;  2VCD A;  1FKR A;  1N1A A;  1ZB5 A;  4MTV A;  4J4N A;  4HBE A;  1UR9 A;  2MLX A;  2PPO A;  2XPA A;  1CTN A;  2LKN A;  4NZC A;  3FXY A;  3UI5 A;  4P8X A;  3WL0 A;  1W9V A;  3WQW A;  4DRJ A;  4MSP A;  1NWT A;  1P5Q A;  1ZBV A;  1Q1C A;  2MPH A;  4Q7N A;  3FAP A;  5D75 A;  3WD3 A;  4TW7 A;  1Q6I A;  3ARV A;  4WK9 A;  4AY1 A;  3LUO A;  2D9F A;  3CGM A;  4ODK A;  1XRV A;  2RUQ A;  1ZL1 A;  3KAH A;  3RM9 A;  3TDB A;  3ARQ A;  4IT6 A;  3UI6 A;  3WD4 A;  1EDQ A;  3ARP A;  4HAR A;  2RSE A;  2KGJ A;  2ITK A;  3WD1 A;  4U84 A;  4LAX A;  3O5M A;  1SR0 A;  1X6L A;  1R9H A;  4DRQ A;  4ZPT R;  1JNT A;  4ODM A;  3O5Q A;  1ZU8 A;  1HJW A;  2A3C A;  1JNE A;  2PV2 A;  4DWS D;  3O5L A;  1J4H A;  1NWS A;  4WKF A;  3KAC A;  3CGN A;  3AS3 A;  3PRB A;  4JFM A;  4L72 B;  3PR9 A;  2WK2 A;  4MAV A;  4Z2G A;  4L3N A;  2A3B A;  4FN2 A;  1Q6U A;  1OGG A;  5I98 A;  3ARO A;  3CH9 A;  3O5D A;  3PRD A;  4P8V A;  5HW6 A;  4ZPW R;  4DZ2 A;  3MDY B;  5HWB A;  3O5J A;  2RQS A;  4XAK A;  1E15 A;  4DWS B;  5DIU A;  4ODP A;  3ARU A;  4DT4 A;  3ART A;  1ZBC A;  1T11 A;  2JZV A;  1NMW A;  3EY6 A;  3O5P A;  1EIB A;  2RUD A;  3O5I A;  4MNL A;  1RD6 A;  3TC5 A;  2EUL A;  2PV3 A;  4DH0 A;  4LGX A;  5HW7 A;  2MLZ A;  4NSB A;  3UF8 A;  2KI3 A;  3B8S A;  3CHC A;  1ZK6 A;  3OOB A;  1M5Y A;  4WKH A;  2ZR5 A;  3IKD A;  2PPP A;  4MPK A;  5GPR A;  3ARZ A;  3JYJ A;  3NTP A;  2PV1 A;  4P8U A;  1VF8 A;  4G2P A;  3VAW A;  2RUC A;  4JYS A;  2DT3 A;  2DSZ A;  1HKI A;  1H0G A;  1E6N A;  3CHE A;  4QZV B;  2O9O A;  5DIT A;  5HUA A;  1IX5 A;  1FKI A;  4WJX A;  1LL4 A;  4JFI A;  1FKF A;  1TCO C;  2KR7 A;  3FY1 A;  3PRA A;  1ZBK A;  1FAP A;  1EYM A;  2UZ5 A;  2DSU A;  2P4V A;  3ARX A;  4UDM A;  2ZQU A;  3ALF A;  4DRN A;  3ARW A;  3BMB A;  3NI6 A;  5HT1 A;  1D2K A;  4QIB A;  3CHF A;  1FKB A;  1W1P A;  2QF8 A;  3AQU A;  4KQZ A;  3IK8 A;  2AOS A;  2F2D A;  3WKZ A;  3TCZ A;  4HBO A;  1ZCN A;  1C9H A;  1UR8 A;  1Q6H A;  4Z2J A;  1D7H A;  2WLY A;  3ODK A;  4DWS A;  3KAI A;  1OGB A;  4MNJ A;  2PPN A;  2M2A A;  1E6Z A;  1QZ2 A;  5DF0 A;  2A3E A;  1KFW A;  4BF8 A;  1ROT A;  1WB0 A;  1X6N A;  3ARR A;  4S3K A;  4W9O A;  4IQC A;  2G41 A;  3WIJ A;  5HW8 A;  1W1V A;  1FFQ A;  4JFK A;  4ITZ A;  3UQI A;  1FKG A;  2IF4 A;  4DRO A;  1BL4 A;  2LPV A;  2IUZ A;  2XP8 A;  3OA5 A;  4DWS C;  2AWG A;  2ZR4 A;  3EIP A;  1J6Y A;  1E6P A;  4ZS6 A;  4FAP A;  2YBU A;  3UQA A;  3O5G A;  1FKL A;  3B7X A;  2M08 A;  2ZQV A;  3WD2 A;  1HKJ A;  2ZQT A;  2DT2 A;  1KT0 A;  1W1T A;  2MF9 A;  2WM0 A;  4PTM A;  3AS0 A;  1LL7 A;  1HKK A;  4WKA A;  2WLZ A; 
#chains in the Genus database with same CATH homology
 3JYM A;  2PI6 A;  3B9E A;  4J4O A;  1HJX A;  1TFV A;  4ODL A;  4ODQ A;  3KAG A;  1PIN A;  2LJ4 A;  1LG1 A;  1NWU A;  2FAP A;  5B8I C;  5HWC A;  2XP7 A;  3RFW A;  3AS1 A;  4JFL A;  4QT3 A;  2XP5 A;  5BXJ A;  2N87 A;  3KAF A;  2DG4 A;  4IPX A;  3KAB A;  2ZR6 A;  4NNR A;  2YBT A;  5HKG A;  1E6R A;  2XP6 A;  1YW5 A;  3ARY A;  3CHD A;  1JVW A;  2O92 A;  1W26 A;  1BKF A;  3O5F A;  2MNT A;  2Q5A A;  2L2S A;  1Y0O A;  1GUV A;  5DIV A;  1ITX A;  3WD0 A;  3H9R B;  2DSV A;  2DG9 A;  1LL6 A;  3O5O A;  5GQB A;  1J4I A;  1ROU A;  1NWR A;  4ODR A;  5DEZ A;  1NH6 A;  2KFW A;  4GGQ A;  3RGC A;  2DT1 A;  4W5U A;  3O5K A;  1FD9 A;  1GPF A;  4TX0 A;  2KE0 A;  3W4R A;  4TW8 A;  3IKG A;  5J6E A;  1FKS A;  1EHN A;  4ZPV R;  1A7X A;  2FDM A;  4LAW A;  3KAD A;  1FFR A;  1JNS A;  3B9D A;  4P8W A;  3RM8 A;  1U79 A;  3IHZ A;  2K8I A;  1GOI A;  2VN1 A;  5HBF A;  1NMV A;  1W9P A;  4MGV A;  3KZ7 A;  4W9P A;  2Y78 A;  4Z2I A;  1HJV A;  3WQV A;  4N19 A;  4U85 A;  3G6L A;  1HXV A;  2PBC A;  1FKD A;  2FKE A;  1WAW A;  1W9U A;  3ARS A;  3CZ8 A;  2XP9 A;  4LAV A;  1WNO A;  1K9T A;  1QPL A;  2XP3 A;  2G8Z A;  1LG2 A;  1YAT A;  3QOK A;  4DIP A;  4GIV A;  4Z2L A;  1H0I A;  3AS2 A;  4URI A;  4DRK A;  1QPF A;  3BXW A;  4IQ2 A;  3JXV A;  5DO2 A;  4DRM A;  4ODN A;  4WIW A;  2OFN A;  1J4R A;  2MLY A;  2A3A A;  4C02 B;  4MNK A;  1FKH A;  1FJD A;  3KCE A;  4ML4 A;  2B31 A;  5GPG A;  1KT1 A;  4TW6 A;  1FKK A;  1ZBW A;  2F21 A;  4O2T A;  3I6C A;  4MNM A;  3UQB A;  1FKJ A;  1L1P A;  2RUR A;  4Q22 A;  3RM4 A;  1EQ3 A;  1D7I A;  5HTG A;  2DG3 A;  3NRK A;  3WH0 A;  1E9L A;  4DRH A;  1LJY A;  4W9Q A;  2XPB A;  1XHG A;  4TNS A;  3WL1 A;  1OWQ A;  4G50 A;  4IT4 A;  1O6I A;  3PA7 A;  4S3J A;  4Z2H A;  2OLH A;  1D6O A;  1LQ0 A;  3UI4 A;  5JH8 A;  2M1I A;  4TYO A;  2XP4 A;  3O5R A;  4JFJ A;  4QT2 A;  1JND A;  1PBK A;  4R5E A;  1FKT A;  2ESC A;  2F4E A;  2ZQS A;  1NSG A;  2DSW A;  4ODO A;  1W1Y A;  2DPE A;  4DRP A;  1B6C A;  2LGO A;  3O5E A;  4KR0 B;  2DT0 A;  3ALG A;  1HKM A;  3GPK A;  3G6M A;  4Z2K A;  3B9A A;  4LAY A;  1F8A B;  1SYT A;  2KO7 A;  4DZ3 A;  4DRI A;  1F40 A;  4U86 A;  4R0X A;  1D7J A;  3RME A;  2VCD A;  1FKR A;  1N1A A;  1ZB5 A;  4MTV A;  4J4N A;  4HBE A;  1UR9 A;  2MLX A;  2PPO A;  2XPA A;  1CTN A;  2LKN A;  4NZC A;  3FXY A;  3UI5 A;  4P8X A;  3WL0 A;  1W9V A;  3WQW A;  4DRJ A;  4MSP A;  1NWT A;  1P5Q A;  1ZBV A;  1Q1C A;  2MPH A;  4Q7N A;  3FAP A;  5D75 A;  3WD3 A;  4TW7 A;  1Q6I A;  3ARV A;  4WK9 A;  4AY1 A;  3LUO A;  2D9F A;  3CGM A;  4ODK A;  1XRV A;  2RUQ A;  1ZL1 A;  3KAH A;  3RM9 A;  3TDB A;  3ARQ A;  4IT6 A;  3UI6 A;  3WD4 A;  1EDQ A;  3ARP A;  4HAR A;  2RSE A;  2KGJ A;  2ITK A;  3WD1 A;  4U84 A;  4LAX A;  3O5M A;  1SR0 A;  1X6L A;  1R9H A;  4DRQ A;  4ZPT R;  1JNT A;  4ODM A;  3O5Q A;  1ZU8 A;  1HJW A;  2A3C A;  1JNE A;  2PV2 A;  4DWS D;  3O5L A;  1J4H A;  1NWS A;  4WKF A;  3KAC A;  3CGN A;  3AS3 A;  3PRB A;  4JFM A;  4L72 B;  3PR9 A;  2WK2 A;  4MAV A;  4Z2G A;  4L3N A;  2A3B A;  4FN2 A;  1Q6U A;  1OGG A;  5I98 A;  3ARO A;  3CH9 A;  3O5D A;  3PRD A;  4P8V A;  5HW6 A;  4ZPW R;  4DZ2 A;  3MDY B;  5HWB A;  3O5J A;  2RQS A;  4XAK A;  1E15 A;  4DWS B;  5DIU A;  4ODP A;  3ARU A;  4DT4 A;  3ART A;  1ZBC A;  1T11 A;  2JZV A;  1NMW A;  3EY6 A;  3O5P A;  1EIB A;  2RUD A;  3O5I A;  4MNL A;  1RD6 A;  3TC5 A;  2PV3 A;  4DH0 A;  4LGX A;  5HW7 A;  2MLZ A;  4NSB A;  3UF8 A;  2KI3 A;  3B8S A;  3CHC A;  1ZK6 A;  3OOB A;  1M5Y A;  4WKH A;  2ZR5 A;  3IKD A;  2PPP A;  4MPK A;  5GPR A;  3ARZ A;  3JYJ A;  3NTP A;  2PV1 A;  4P8U A;  1VF8 A;  4G2P A;  3VAW A;  2RUC A;  4JYS A;  2DT3 A;  2DSZ A;  1HKI A;  1H0G A;  1E6N A;  3CHE A;  4QZV B;  2O9O A;  5DIT A;  5HUA A;  1IX5 A;  1FKI A;  4WJX A;  1LL4 A;  4JFI A;  1FKF A;  1TCO C;  2KR7 A;  3FY1 A;  3PRA A;  1ZBK A;  1FAP A;  1EYM A;  2UZ5 A;  2DSU A;  3ARX A;  2ZQU A;  3ALF A;  4DRN A;  3ARW A;  3NI6 A;  5HT1 A;  1D2K A;  4QIB A;  3CHF A;  1FKB A;  1W1P A;  2QF8 A;  3AQU A;  4KQZ A;  3IK8 A;  2AOS A;  2F2D A;  3WKZ A;  3TCZ A;  4HBO A;  1ZCN A;  1C9H A;  1UR8 A;  1Q6H A;  4Z2J A;  1D7H A;  2WLY A;  3ODK A;  4DWS A;  3KAI A;  1OGB A;  4MNJ A;  2PPN A;  2M2A A;  1E6Z A;  1QZ2 A;  5DF0 A;  2A3E A;  1KFW A;  4BF8 A;  1ROT A;  1WB0 A;  1X6N A;  3ARR A;  4S3K A;  4W9O A;  4IQC A;  2G41 A;  3WIJ A;  5HW8 A;  1W1V A;  1FFQ A;  4JFK A;  4ITZ A;  3UQI A;  1FKG A;  2IF4 A;  4DRO A;  1BL4 A;  2LPV A;  2IUZ A;  2XP8 A;  3OA5 A;  4DWS C;  2AWG A;  2ZR4 A;  1J6Y A;  1E6P A;  4ZS6 A;  4FAP A;  2YBU A;  3UQA A;  3O5G A;  1FKL A;  3B7X A;  2M08 A;  2ZQV A;  3WD2 A;  1HKJ A;  2ZQT A;  2DT2 A;  1KT0 A;  1W1T A;  2MF9 A;  2WM0 A;  4PTM A;  3AS0 A;  1LL7 A;  1HKK A;  4WKA A;  2WLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...