3FY1A

The acidic mammalian chitinase catalytic domain in complex with methylallosamidin
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
377
structure length
377
Chain Sequence
YQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNVKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Triad of polar residues implicated in pH specificity of acidic mammalian chitinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Acidic mammalian chitinase
total genus 136
structure length 377
sequence length 377
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3fy1A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3fy1A01
1VF8A 1DWAM 5D9NA 3WEZA 1QHPA 1UOKA 3WQ5A 2VR5A 2WWDA 1OWQA 2VRKA 1QI5A 3BCFA 2DH2A 4BCEA 1XH2A 1J9YA 4JFTA 2DSWA 1GOKA 2G4FA 3NSNA 1N82A 4KRTA 1W3LA 1UWTA 1WDRA 3FAWA 2BY0A 4NRSA 3MUZ1 3ARSA 4AWEA 1WKYA 2J77A 2ZUTA 4DUXA 2EPNA 1KR1A 1HX0A 4PMVA 5C71A 1QOXA 4HA1A 2FHFA 1NOUA 3IK2A 4PMYA 5HPCA 3T0AA 2CITA 1H41A 1QHZA 3SCVA 1LL6A 4MNLA 4P7OA 3GH7A 3NYDA 4EKJA 1BF2A 4HOZA 3AI0A 2BFGA 2VCCA 3WIJA 3ECQA 1DWFM 1B30A 3GBEA 4TTGA 4M1RA 4P7NA 1KBKA 2QF8A 2W61A 2DT3A 1GW1A 4CCCA 4E8DA 5I3DA 1Z32X 1ECEA 3VIIA 3T2QA 4FLSA 2E9MA 2YA1A 1KCKA 2G8ZA 2J25A 3WFZA 1PBGA 1GQIA 3K4DA 1FHLA 4U2YA 2QV4A 2D2OA 4W84A 2EXOA 1G1YA 2VZOA 2Y8KA 1NARA 4IPLA 2J7CA 3SCOA 3FY1A 2CEQA 1OINA 2G3NA 3N04A 1KQYA 3CHDA 4D6CA 1FH8A 1TE1A 1UD2A 1SR0A 3VGDA 3AMKA 4X0VA 1BG4A 1CZ1A 3ZT5A 1VEOA 4HMDA 3BH4A 2IXUA 4DWSD 2W62A 1HIZA 2WMKA 3D5HA 4S3JA 1WE5A 5CLTA 1V0LA 1HJXA 3M6DA 2J8FA 5BXSA 1JYVA 3W24A 5D9MA 4B3KA 4JCLA 4TVDA 1FFRA 3AMLA 4CVWA 1KWKA 2QLYA 3N17A 3L4UA 4MNKA 1I75A 2ZWYA 3CH9A 1H1NA 3DC0A 4CGTA 4PUDA 1M53A 4U5KA 3U57A 4AC1X 2B31A 3D3AA 5KEZA 3VIMA 2D1ZA 1U30A 1EDGA 2ESCA 2W5FA 4C7DA 3WUBA 3SEPA 5BWFA 2X0YA 2BY2A 3T08A 4U5IA 1J0HA 5DEZA 2YL5A 4PSRA 3QHNA 2XGIA 4HPGA 1X6NA 2ZUVA 1W2VA 1JFHA 3VUPA 2FHCA 2V3FA 4JKLA 5M17A 4TX8A 1XSKA 5CSUA 4R27A 1CGTA 2XVNA 2XGBA 4DM1A 3W81A 4J3SA 5M3WA 4DWSC 1DWIM 1YQ2A 4W86A 1FH9A 1NM9A 3OZOA 3THCA 1JIBA 2YJQA 3PZOA 1P6WA 4H8VA 4M56A 1IZKA 2WMIB 3GH5A 1BVZA 1QHOA 3NSXA 4GQRA 1UKOA 3W28A 5CGTA 4EE9A 4GO8A 3GM8A 5I77A 2OSXA 3OLDA 2DSUA 5F7UA 1EGZA 2UY4A 1NWUA 4S3KA 2G3MA 1MFVA 4WJXA 1PZ2A 2HISA 2G3JA 5A6AA 1GQKA 4U3AA 3WDIA 1ISWA 1QBAA 5HXMA 2WC3A 1KGUA 3I3EA 1QPKA 2D20A 2Y8VA 2EPKX 1S46A 1VEMA 4PMQA 2CPUA 1BAGA 1GZJA 1I1WA 1UH2A 3OLIA 5A2CA 5LA1A 4P8XA 4MB3A 4U2ZA 2X05A 4W7UA 5EFFA 3POCA 4URIA 4QLLA 2O92A 3GXDA 1MW0A 4IUGA 1VEPA 1V3HA 4HOXA 3SCQA 1BPLB 2DIEA 4DUVA 5AYBA 4Z2IA 3WF3A 1BYCA 3VX0A 1CPUA 3OGVA 5D4YA 3WNOA 1HKKA 3F5KA 4C7FA 1NQ6A 2OLHA 1JDDA 2V3EA 3WEMA 4MB1A 1ISXA 4AIOA 3AYSA 1WDQA 4Z2KA 3AS0A 1W9XA 2E8YA 3VVGA 4MNMA 1W1TA 1GVYA 2XIBA 1KB3A 5JH8A 1W9VA 3VDHA 9CGTA 4CN1A 3RO8A 3ZOAA 3WFLA 3EMZA 2O9OA 5IFPA 4GZEA 1E1FA 3AIEA 2Z1KA 1OGGA 1AQHA 1DP0A 5E6ZA 3ARYA 4WKHA 4KMQA 1DEDA 1JDCA 1K9EA 3CHFA 3BAIA 3L2LA 1HJQA 3CIVA 1J0IA 3W38A 2YL8A 2YA0A 2WWCA 3MKKA 1V3JA 2PWEA 1OIFA 3BAYA 2UY2A 1XC6A 1ITXA 1C92A 4ATWA 3CZKA 4ZXOA 4E2OA 3ARPA 3VGFA 4U3CA 3RJYA 1XGZA 2A3HA 4V2XA 3BAXA 2DH3A 4Z2JA 2XJ7A 1JZ5A 2XFRA 4H7VA 3K8LA 2YA2A 2PF0A 1KR0A 3SCSA 4FLRA 1NOWA 4NSBA 4QFUA 1E6PA 3CHCA 1QNQA 3OB8A 4PN2A 1C90A 1UR4A 2V5DA 2YBUA 2VOTA 4CN6A 3VNZA 5CZKA 1OT2A 1PJ9A 1WDPA 4OJYA 4NI3A 2Y5EA 3ARRA 3U5UA 3AYRA 4GI9A 4PUEA 4HPHA 4IISA 4LX4A 2PWGA 4PTXA 1XCXA 4LYRA 2WCAA 3II1A 1JL8A 1JNDA 3AIWA 3AHVA 1L0PA 3L4ZA 3WD4A 3ARVA 1XH0A 4ZENA 1E55A 3RDKA 4Z2HA 3VIKA 1UA3A 2JFEX 4PMUA 3WBEA 4HU0A 4TX6A 3VX1A 1JD9A 2YLLA 4JFSA 3L4TA 3PBGA 5EMYA 3WDJA 4F8XA 4HA3A 3KE0A 1UD5A 4XZWA 1VBUA 4UFKA 3WMSA 3S2CA 3PZUA 1IV8A 1BLIA 1ISYA 5I24A 2CETA 1QVBA 5A6MA 1B3VA 4MDPA 2GVYA 1ODZA 1CNVA 1JZ7A 3ARWA 2D23A 1NP0A 3WMBA 4LYPA 4ACZA 5ABEA 1E6QM 2E9BA 3UG4A 3RM4A 2AAAA 5A8MA 1AVAA 4P8UA 1W3JA 3ZO9A 1EQCA 1W3KA 2VQTA 2ZXBA 5JIPA 3EDEA 3A4WA 6TAAA 3O2LA 4HU8A 2Y2WA 3B9AA 1DWJM 5FD0A 4TTUA 3W6LA 4L4OA 4E4PA 1TVNA 4NRRA 2CHOA 1MQRA 1CENA 3BAWA 3U5YA 1E0XA 5I2UA 4YPJA 4UFIA 3CGTA 2WAGA 4UQ9A 1BYAA 1UR2A 1CBGA 3CTTA 4QLJA 1FP9A 3GH4A 2WMGA 4WK9A 1J01A 4PTWA 1E4NA 4AZ7A 3W37A 3RM8A 1MW3A 1QI0A 4Q22A 1B90A 3CUFA 1UD8A 2V3DA 3SUUA 5FCZA 3NDZA 1QW8A 5A6BA 5E09A 4AW7A 3BAKA 3KWXA 2VUYA 3NSMA 3FAXA 5FIPA 1GOIA 3VD9A 3MV01 1MW1A 1W9DM 4JL2A 2J7BA 2X8RA 2GDVA 4Y7EA 1K9FA 4MDOA 3CZGA 1E9LA 1VAHA 3FHQA 1PIGA 5ABHA 1XRVA 3AHTA 1KBBA 2VZUA 4PRWA 3PZMA 1GNXA 1OGSA 4Z2LA 1VRXA 3CMJA 1HP5A 3EYPA 3GNRA 2WLYA 2GJXA 2GDUA 1VJSA 1Q6EA 3WF1A 1DTUA 1KGXA 2VTFA 2NW0A 1ISVA 3FW6A 2CBIA 1BQCA 1E6SM 3AROA 3TP4A 4OZOA 2V5CA 4KWUA 5HPOA 3CLWA 2VZVA 3MV11 5HNNA 4PMNA 3OLEA 3AIBA 1CXKA 3T09A 5IHSA 4PMDA 5I78A 1E72M 1JG9A 3K8KA 2DSKA 1WAWA 4BQ3A 2D3NA 3U7VA 1Q6FA 1PX8A 3OLGA 3VIJA 3RMEA 3W0KA 5IHRA 2EO7A 4MJ4A 4UQAA 2WXDM 1ZBKA 3WDRA 1JNEA 3EMQA 1UR9A 4AZGA 4AD5A 1CGWA 2O9PA 2YDRA 3AXHA 2JEQA 1E70M 2WZHA 3NIYA 1HVQA 2E3ZA 1PX4A 1R7AA 2VVNA 4C7GA 5ABFA 4CD4A 4E8CA 2RGLA 3KL3A 1HT6A 3HMCA 1E71M 4OKDA 3W4RA 4W5UA 3W6MA 2VCAA 3N11A 3AIVA 1J11A 3WL1A 3MUY1 5A3HA 3J7HA 5A1AA 1MVYA 2WMIA 1QNPA 3BXWA 3RPMA 3THDA 3EBVA 4PSPA 1B31A 2WVSA 4JFVA 2VMFA 4M82A 2X0HA 4TXEA 4X0NA 2D3LA 3VGBA 3E1F1 2JF6A 4WKAA 5BYWA 1MYRA 3N1AA 4W8LA 4D1IA 1ZBCA 2AMGA 4M81A 5BCAA 1M7XA 4XV0A 1W9PA 4B9ZA 3WDPP 3O6AA 2VNCA 3KL0A 5TD4A 4N42A 1MW2A 5A95A 4W88A 3K4AA 3BSGA 5AC5A 5CLWA 2WVVA 2VZTA 1OB0A 2E4TA 2C8NA 2GK1A 2OYMA 1H2JA 2J4GA 3JUGA 3SCUA 3ARXA 5HBFA 1VFOA 1V0KA 1KQZA 3UERA 3AIQA 4CKQA 3WQVA 3VTRA 5AY7A 2JIWA 1HJUA 2ZWZA 1UA7A 2QPSA 4NZCA 5C8BB 2WBKA 3A47A 3SCWA 1O7AA 2VR4A 3VIPA 1B0IA 1G94A 1JZ4A 7A3HA 2F2HA 3VM7A 1OGBA 3B9EA 3WH9A 1VFUA 1EO5A 1JI1A 2OWWA 1LJYA 6CGTA 2WB5A 1HF6A 3WELA 3UETA 2BNJA 1UWQA 5D8WA 1EXPA 3CMGA 2OWCA 5HOSA 5M5DA 4JCMA 5AYIA 2PI6A 4LGXA 3VOCA 1QI4A 1V6VA 1WDSA 2F61A 1YHTA 1C3FA 2XTKA 2VC9A 2VL4A 5AC4A 5IXEA 4GQQA 2BHUA 2CHNA 3ZJKA 4JFUA 1TCMA 4PCSA 4GZJA 1JI2A 3IJ8A 5DO8A 1KWGA 2J8GA 1E4LA 1UH4A 3T2OA 5A6KA 3PZGA 3I3BA 5DMYA 2FHBA 2A3BA 1V3LA 3NJ3A 1W2PA 2OSYA 1PEZA 2J7GA 4CD7A 2CNCA 2E40A 3WENA 1EDQA 4PBGA 4D6GA 2E8ZA 1H3GA 1TZ7A 3PZTA 1LWJA 1EHAA 3EDFA 1UH3A 2G3IA 2DQXA 4XUYA 2PWDA 3VKKA 1E6NA 1WPCA 2BY3A 2JF7A 1JZ6A 1XCWA 1ZS2A 2PC8A 1TMQA 2DT0A 1PZ3A 3WQ8A 5BROA 2YDSA 1XH1A 4LXFA 4W89A 1JXJA 3B8SA 1UD4A 4NF7A 3SUSA 3WY1A 4KRUA 4AZ6A 1GVIA 3WDHA 4OBSA 3SCPA 1GOQA 1MXDA 4AZCB 4BA0A 2XFFA 1JYWA 4ACZB 3LPPA 2FDMA 2GJPA 3IANA 2J79A 2ZX8A 4N0RA 1W1PA 1Q6GA 1SYTA 1UQYA 1BGAA 4YHEA 3FHAA 4JHZA 5CSYA 2WK2A 2VCBA 1QI2A 1H11A 1CGXA 2J78A 5BXPA 1LQ0A 1E6ZA 3APGA 2WLZA 2EPOA 2WMHA 3A4AA 4UCFA 5FL0A 1TG7A 3K1DA 1E3ZA 1BG9A 1GOWA 2GK1B 4AISA 1KGWA 1IT0A 4J3XA 5GNXA 1QW9A 3A6OA 3CUJA 5A94A 1B2YA 4W5ZA 5A6SA 5EB8A 1D2KA 4XB3A 4X9YA 3AMDA 1DHKA 1WZAA 2FH8A 1W32A 3WF4A 1MQPA 4HMCA 3VDCA 2NT1A 3WQWA 2QPUA 3UR8A 2RGMA 1CLVA 1TA3A 1JYXA 3PZVA 2ZICA 1VFFA 4AZBA 2O9RA 1Q6DA 3CUGA 2W92A 4TVCA 1NWTA 2XVPA 3GYCA 4QLKA 3BMVA 3ZT7A 3VGHA 2WC4A 1L8NA 3UR7A 2J75A 2ZOXA 2DEPA 3AOFA 2VX5A 1JZ2A 4D1JA 2VRJA 2QMJA 1UHVA 4V27A 3VMPA 1H5VA 5GQBA 4CD5A 1CEOA 1CIUA 2A3AA 3N13A 3BC9A 3QGVA 5LA0A 3WNLA 1BYDA 1WO2A 2ZXQA 3N12A 1MFUA 3RJXA 1UKPA 5I79A 2BY1A 3MANA 1UKSA 2IXVA 1HKIA 3N15A 2BV9A 2VT0A 3VGGA 1RP9A 3RCNA 4MB5A 4HTYA 1MWOA 2W91A 4YN5A 1XYFA 2VRQA 2VURA 5FKYA 2D0FA 3FN9A 1NWRA 1UR0A 1IZJA 3PTQA 5I23A 2WCSA 1K9TA 4ACYA 4D6HA 1W1YA 3UEQA 1JZ3A 2CKRA 2YIHA 3CUIA 3AHXA 3WF2A 1XD0A 3OA5A 1QBBA 4MAZA 1G01A 1V6YA 1CLXA 1K6AA 3EDDA 4UQBA 3PTKA 2D24A 3WD1A 1Y7VA 1J0JA 4TUFA 5JUVA 5D9PA 3WNPA 1E6XM 4AZCA 2F8QA 1Q4NX 1W91A 1E40A 5CPSA 1H4PA 3CZEA 4MB4A 1XSIA 1LLOA 2O9TA 3ZM8A 3ZJ7A 1J0KA 1M04A 4D6DA 1B3ZA 1B3XA 3RM9A 4AXNA 1HKMA 4QAWA 1E43A 4WSKA 3GZAA 3VIFA 4BQ5A 1V02A 3ALFA 1UR1A 3B9DA 4JAWA 1GUVA 1UR8A 3N18A 4UQCA 4DWSB 1BHGA 4HMEA 1HNYA 4UOZA 5A6JA 4CN4A 1HJSA 4PEEA 3K46A 3WSUA 2YLAA 1RP8A 4UFLA 1JGIA 3WL0A 2DIJA 3IAQA 4IPNB 2XSAA 3QHOA 3ZSTA 3VD5A 3ARTA 5GNYA 5FOOA 4CD6A 5CJ5A 3T0BA 6A3HA 3QOMA 1UKQA 3AHZA 7TAAA 2C7FA 5ABFB 3NCOA 1ZJAA 1KXVA 2GUYA 1VFMA 3PHAA 4P8WA 3W29A 4PCTA 5E70A 1V0NA 1W9UA 4J7RA 4BZYA 5E9AA 4GXPA 4D6JA 1M03A 4MAVA 4WLCA 2XVGA 1GPFA 1GHSA 1J0YA 3MS8A 4FK9A 4W7VA 4D6FA 3UCQA 2CIPA 4KGJA 4DUWA 3QR3A 5KZ6A 3AIUA 3M7SA 3L2MA 3UESA 1R8LA 4EK7A 1EOKA 3TONA 1HL8A 3GXMA 1EIBA 3DHUA 1RD6A 1FA2A 5FL1A 3WUFA 1UWRA 5CG0A 1JYNA 2PB1A 1RPKA 2Q8XA 4GI6A 1MXGA 3AQUA 1CGUA 3CZLA 1GONA 1J0ZA 3SCTA 5CXPA 2ZUUA 1UD6A 1HP4A 3VIGA 1V0MA 4P7LA 3TTYA 5E0FA 2CBUA 2Z1SA 3IJ7A 2DDXA 3PZ9A 4W8AA 1KFWA 3WD3A 4AD1A 4FMVA 4W93A 4PMRA 2XVKA 2WHJA 4D72A 3WDQA 1GOMA 4HOWA 2BVTA 5BXRA 1CTNA 4FLOA 2J7EA 4J3TA 1U33A 1ISZA 3HJEA 2OWXA 2FH6A 4JKKA 2VI0A 2ZX6A 1V6WA 4AIUA 1AQMA 3AMCA 1UWUA 1CXEA 1W1VA 4UFMA 1D3CA 2XWDA 3F4VA 2CXGA 2ZIDA 3AZTA 2EJ1A 3WQ4A 1GORA 4CUCA 2ZE0A 4EAMA 2EPLX 4D71A 4F9JA 1TUXA 4LQ1A 4GZIA 3SUTA 4QP0A 3PZNA 3ZIZA 4B15A 3BCDA 1FOBA 1C91A 3IAPA 1V08A 3SURA 1NWSA 1JF5A 2PWFA 2Y4SA 1CXIA 3MUAA 1UZ1A 3WD0A 3TTSA 3WH8A 4ZEPA 4UFJA 1ODUA 3AIRA 2W63A 4UOQA 1CDGA 2XVLA 1FFQA 4DM2A 1CXFA 1KXQA 3PZQA 4PMOA 4WF7A 4PTMA 1HVXA 1UKTA 4B16A 3T2PA 4CVUA 5EFDA 1B3WA 1VENA 1HJWA 2XFYA 1R7OA 2ZX9A 3CUHA 1B9ZA 4GKLA 1OT1A 1LF1A 3SIMA 3VNYA 5E0CA 3S6TA 1UG6A 3EDKA 3SUVA 2BVDA 1KXHA 1V03A 3AMGA 8CGTA 1QNSA 1CGYA 1GCYA 3ARQA 3MU7A 1OCQA 1WZKA 4ZE4A 3BSHA 2D0GA 3ZQ9A 4UTFA 3ZT6A 4B9YA 2BXYA 3AICA 5CPQA 3GBDA 2WZEA 3VDAA 1C8XA 2YKKA 4AZHA 2OYLA 3VU2A 2A3EA 3L4VA 2DT2A 1G0CA 4CCEA 4TOQA 4D6IA 3VPLA 1VJZA 5BXTA 4GIAA 1BSIA 1CWYA 1D7FA 1B3YA 1E0VA 2VX6A 4UNIA 3AISA 1CXHA 1BGGA 5DFAA 2XSBA 2Y24A 3LPGA 2WVUA 4B3LA 4UOJA 3SCNA 4U33A 1EO7A 4H8HA 2CBJA 4HZ7A 1W3HA 2QHAA 4RE3A 4RE4A 3W53A 3QHMA 4XZBA 5BRQA 1ZBVA 3AS1A 1U2YA 5DT5A 1FH7A 3N9KA 4MADA 1JXKA 4HA4A 3ZR6A 1NOFA 1XD1A 1R86A 2J7DA 1UWSA 3AS3A 3OGSA 3K8MA 3PZIA 3VINA 5C70A 3BGAA 4AYSA 4M29A 3RIKA 4CU6A 5A6BD 3KEHA 2J74A 2GSJA 3WQ6A 1F4AA 2CKSA 2WKLA 1A47A 3HU7A 3WF0A 3WUGA 1LWHA 4GINA 4Q7NA 3WEOA 3VD3A 1ZB5A 2WSKA 5D8ZA 2X1IA 2ZUMA 2XYLA 3BAJA 1QNOA 2XM1A 2ZUWA 3DYPA 5CGMA 3IJ9A 2EBNA 2E0PA 4W7WA 2VX7A 4CU8A 2YBTA 1OD0A 3GNOA 2MANA 4A3HA 1BYBA 3WH6A 4WKFA 1GHRA 1V6XA 3DYOA 1PAMA 3VIHA 2WVVB 4Z2GA 2BVYA 3FXYA 4M8UA 3PTMA 1FHDA 4BS0A 3L4WA 5A8OA 4FF5A 1W9BM 1H49A 1J10A 3WNNA 4GPNA 3W26A 1E3XA 1E5NA 3VMOA 4P7RA 4WSJA 2ZUSA 1O6IA 1EQPA 3T0DA 3CBWA 2VX4A 3EDJA 3RILA 1NP2A 1OSEA 2G41A 1WCGA 3LPOA 1SMDA 5JBDA 3WUEA 4BF7A 5DT7A 2V3GA 2WZIA 4AEEA 1A3HA 2WHMA 1HJVA 3MMWA 4AZ5A 5BRPA 1C93A 4AZIA 1JAEA 1PPIA 2WBGA 2WYSA 3G6LA 3VD7A 4AD4A 1BVNP 2J47A 4U31A 1ZU8A 1XYZA 5LYRA 1SMAA 1QI3A 3SUWA 2DPEA 3CZ8A 2XHYA 5A8QA 1LG1A 4WIWA 3GDBA 3CZJA 3GNPA 1CYGA 1WZLA 2DSVA 2PWHA 3WD2A 1XHGA 5GPRA 3ZMRA 4J3UA 3DECA 3ARZA 2XM2A 4UQDA 1BTCA 1JDAA 1E56A 3CPUA 4OOUA 1CGVA 3L4YA 2W4XA 4YHGA 3DHPA 4ZFMA 2JALA 8A3HA 3MMDA 3MSDA 2V38A 4JHOA 3F5LA 3EMCA 3VO0A 3ZJ6A 1US3A 4D6EA 4M24A 2UWFA 2XIIA 4L4PA 1BFNA 2EPMX 3TTQA 5A69A 2PBOA 2D0HA 4HZ6A 1SFSA 5DF0A 4UR9A 2VZSA 4QCFA 1WP6A 4DWSA 3AS2A 1ZJBA 4MJ2A 1G5AA 5A8PA 5A2BA 1C8YA 5IFTA 4H04A 2W67A 2UY5A 1HN1A 1QNRA 2BHYA 4UZUA 4F79A 2WW5A 2TAAA 3AXXA 1V02E 2CCRA 2EQDA 5CPTA 1HKJA 3AZRA 1VBRA 3MO4A 1E5JA 1C7SA 5JBFA 2WKGA 4AIEA 2D22A 1XV8A 3WNKA 1KCLA 3SCRA 1R85A 2VVSA 1PIFA 4RL3A 1GOOA 4MNJA 3BLPX 3WBAA 4ZE5A 3DYMA 1CXLA 4MPKA 1V6UA 5JIWA 4PMXA 3WNMA 2ZXAA 3ZJ8A 3WKZA 3BMWA 5IDIA 2ZX5A 1C7TA 3NUKA 5A6LA 3GTNA 1ZL1A 4ZXLA 5GNZA 1E15A 1C8QA 3UG3A 4JKMA 4W85A 2VJXA 2X09A 4ATLA 2JIEA 1JF6A 3ZSSA 1FP8A 5ECUA 4H2CA 3OGRA 4BQ2A 5JBEA 4LPCA 2WHLA 4OOZA 2FGLA 2WMJA 1OBAA 2ZXDA 1OIMA 5I0DA 1LL7A 1EH9A 2WPGA 4JL1A 4EANA 2PBGA 2XG9A 3MSGA 1VIWA 2BS9A 2EEXA 4QCEA 1UYQA 3TA9A 4JFWA 1E0WA 1H0GA 3L4XA 1OD8A 1V3KA 1EHNA 2X2YA 1XSJA 3VIOA 3ALGA 4XX6A 1E4IA 1H09A 2JE8A 3VILA 2XUCA 1UD3A 1E4MM 1JFXA 2NT0A 2CESA 3AXIA 2OSWA 2JEPA 3MMUA 1MQQA 1WNOA 2IUZA 2OYKA 1J12A 3HN3A 4A3YA 2C0HA 1UWIA 5EBAA 1GQLA 1GQJA 3LPFA 3VDBA 1DWGM 1X1NA 2J7HA 1JD7A 1V3MA 1TR1A 3F5JA 1I1XA 5M03A 3PN8A 1R87A 1K9DA 1M01A 1RH9A 1V3IA 2W66A 3CHEA 2WHKA 4TVUA 5ABGA 1ITCA 3VM5A 4UZSA 1E73M 5HDRA 1E6RA 2XPKA 1OM0A 4KH2A 1E1EA 2E9LA 4OUEA 1TVPA 7CGTA 3CO4A 4F9DA 5CQ1A 1H0IA 1ZBWA 3MUIA 3WH5A 1EOMA 3KL5A 2FGZA 2GFTA 4J3WA 3W25A 2YL9A 2WMFA 3LMYA 4AEFA 2CERA 4P8VA 3ARUA 1DWHM 2WC7A 4AD0A 4M80A 4H41A 2NSXA 1J18A 1EDTA 2GJXB 4JZ5A 5E6YA 3M07A 5I5RA 3A3HA 5A8NA 2HVMA 2YDQA 3VD4A 4UQEA 4CD8A 4CU7A 4PMZA 4BQ4A 2DGAA 3AFBA 1TA3B 3OG2A 3POHA 1NH6A 1F4HA 4KGLA 3NDYA 1GJWA 1CECA 4GO9A 4H8UA 4W87A 1UQZA 1WZMA 3TTOA 4AD2A 1Q6CA 4W8BA 4AY1A 1GJUA 4UFHA 4GI8A 1VB9A 4PTVA 1UZ4A 3AJ7A 3OZPA 4HP5A 2WNWA 3OIHA 4JIEA 5LA2A 2XWEA 4OIFA 4V28A 1JZ8A 3WN6A 1LG2A 2DSZA 2VQUA 4P7QA 4J3VA 2YL6A 4AD3A 5D9OA 2CYGA 4ATDA 4F66A 4K68A 2J62A 2WCGA 3WH7A 3M46A 3AZSA 3I3DA 3W27A 5I6SA 3U7BA 2A3CA 2UY3A 4R5EA 2WANA 3GXIA 1X6LA 1WB0A 4LYQA 2QMKA 4ML4A 3VGEA 4AMCA 1ESWA 4J27A 2VO5A 3A4XA 3AHYA 1PX3A 4MTVA 1US2A 4QDMA 3VMNA 4PYSA 3W82A 2ZUNA 1HL9A 3TOPA 4FLQA 2YOCA 4IM4A 1LL4A 1UUQA 2GJRA 1AMYA 3UG5A 2WVTA 3BLKA 3G6MA 2WSPA 2CBVA 3WMCA 1G9HA 2DT1A 1JAKA 1TFVA 2BXZA 1B1YA 2AOSA 3OBAA 3QOKA 2BHZA 1EA9C 3O9NA 3KZSA 3ZR5A 1AQ0A 4HZ8A 3GXFA 2ZX7A 1HXJA 4J28A 4OBRA 3FNDA 4CCDA 4RE2A 5A2AA 2WM0A 4A4AA 1KXTA 2J7FA
chains in the Genus database with same CATH superfamily
2J9YA 1R38A 4HSOA 2G3FA 3WQ5A 2VR5A 4JTQA 2HWGA 4D8ZA 4DB7A 5HWNA 1QI5A 1Q7ZA 2DH2A 3BCFA 1XH2A 4Q7BA 1J9YA 2D2GA 2DUZA 2XP7A 3TSBA 1XLIA 1PO9A 1UWTA 3UF8A 3TC7A 3ARSA 4AWEA 1O68A 4UMBA 1FWTA 2J77A 3QR0A 1KR1A 4PMVA 1QOXA 4HA1A 4ZOAA 3EAUA 5AZ1A 3IK2A 3DZ1A 1ICSA 3T0AA 4O2TA 3PR9A 1R2SA 1E9ZB 4P7OA 2Q01A 1BF2A 3MP5A 3O6CA 3QQ1A 4OECA 3W7PA 3F4DA 1UUOA 3KCEA 3CAKA 2XIQA 1M1BA 3ECQA 4WGXA 4JTEA 1DWFM 4TTGA 4K36A 4P61A 4Y9MA 4H19A 2QUVA 5HUOA 4IQJA 4P7NA 1M3UA 2V2DA 4QG6A 4G7EA 1GW1A 4CCCA 1A5AA 1J6OA 1PBGA 4POCA 3K4DA 1O5QA 4BWLA 4LEFA 1Q66A 4QS5A 2J7CA 3SCOA 3FVMA 1SPQA 2CEQA 1OINA 3CH0A 4UTWC 2G3NA 3FYPA 3CWHA 1ME8A 2NWSA 3CHDA 3LS9A 4A8NA 4A3QA 3VGDA 3GU1A 1BG4A 3OW1A 3T81A 4JICA 4HMDA 2XISA 4DWSD 4A3UA 3M0KA 3WLKX 5CPLA 4MSPA 5CLTA 1J6PA 1V0LA 4K38A 1HJXA 2J8FA 4L80A 1JYVA 4E2VA 1P0BA 2CZFA 4L5ZA 3W24A 1XIIA 1QWKA 4GYFA 4JCLA 4Q8QA 3AMLA 4IWWA 4KEUA 1T40A 3RAOA 2PRMA 3ZXWA 2HPIA 4WEVX 3U57A 2CLIA 3D3AA 5H8MA 3HMJG 5KEZA 3VIMA 1ITUA 2D1ZA 5F2IA 4KEMA 3GUGA 3XISA 2ESCA 1VYPX 3SEPA 3QEZA 5BWFA 3HG5A 1J0HA 4G1KA 4PSRA 2XGIA 4HPGA 3E3HA 3WO8A 4HCDA 1W2VA 1JFHA 3VUPA 2FHCA 4JKLA 5M17A 1XSKA 1JUEA 1NF7A 4KPLA 3PBMA 1DWIM 1GGOA 1XGDA 2ACRA 3P82A 1FH9A 1YDNA 5CZJA 2VOMA 3OZOA 4M6QA 1F8IA 4UIOA 1XIMA 2QDHA 3C2VA 5JH2A 4LUTA 1BVZA 1ECQA 1QHOA 3DG7A 3VYLA 3W28A 4Q4SA 3B0PA 2ALDA 1FWDC 4I9AA 4LAUA 3GM8A 5I77A 3OLDA 3LV5A 1RCOB 1EGZA 1OCJA 3W86A 4ZB5A 2KI3A 1PZ2A 2OPJA 1UZHA 2Z4GA 1GQNA 4AMAA 1LUCB 3ZLGA 2GGJA 1KGUA 3NNTA 2XIJA 1N2VA 3I3EA 3MP3A 1S46A 1XYAA 4AF0A 5A2CA 1N8FA 5LA1A 2QJGA 2X05A 1LRTA 5EFFA 4BKNA 4URIA 1TV3A 3V0TA 1Y8BA 3UZXA 4IUGA 1VEPA 1EGVA 1V3HA 4HOXA 1A0EA 5AYBA 1K6WA 1QAPA 1ITQA 1FUYA 3S1WA 1HKKA 2F6XA 3F5KA 1ONRA 1NQ6A 3JU2A 3G2GA 5HKGA 6XIAA 3FXGA 3WK1A 3WEMA 4UTUA 4MB1A 1ISXA 1WDQA 4Z2KA 2E8YA 1W9XA 3AYSA 4L9YA 5JH1A 4QIBA 3ZYZA 3QW3A 4CN1A 3RO8A 1KKOA 4JY8A 3E0FA 1LP6A 1EC7A 3GHUA 4BK9A 1OGGA 1WKDA 1DP0A 1VYSX 5E6ZA 2P88A 4WKHA 2BGSA 1JDCA 3BLFA 5GJNA 3E2QA 1IWPA 1ROTA 4DJFA 3L2LA 3B04A 3OJGA 3CIVA 3UXKA 3TMLA 4GGBA 2WWCA 3MKKA 1V3JA 4RXFA 3HPAA 4ZOEA 4KIRA 4EPDC 2UY2A 1C92A 4GGHA 3GG0A 3Q37A 4IQDA 4B4HA 3ATYA 3URAA 2MPHA 4ZXOA 4ASTA 4TX0A 4OU1A 3DAQA 3RJYA 1XGZA 3RF9A 4Z2JA 1IXQA 2XFRA 1PSCA 1IXNA 1KM0A 4PC8A 1NOWA 2WJZA 1H7NA 3SGGA 3PFMA 4AWTA 4HHMA 4PN2A 4QROA 1D3GA 3OQ8A 2YBUA 3E5BA 4I7VA 4CN6A 3VNZA 3WK2A 3R4IA 3PUGA 4OJYA 4NI3A 3IIZA 3ARRA 1IE7C 3AYRA 2INFA 1EYMA 5HANA 3MHUA 3UNTA 2WCAA 4I90A 3QZEA 2FMNA 2YCIX 3AIWA 3AHVA 2PDFA 4LEQA 1F74A 1OCNA 1X39A 3N73A 3UXIA 3RDKA 5L9FA 3VIKA 1UA3A 1K8XA 4PMUA 3COTA 1VIZA 4HU0A 4TW8A 4JFSA 3O0FA 2PD5A 4LUSB 2B7NA 1KNWA 1R3TA 1VBUA 3GDKA 4ODRA 1CB7B 3W1MA 1IV8A 1ISYA 2YPIA 5I24A 1B3VA 2NXIA 4TW6A 2H8XA 3W7QA 1CNVA 5TF0A 2D2JA 3WMBA 3TTEA 2MF9A 5CAKA 4K8HA 3CIWA 5I3FA 1EJUC 2I57A 1JQXA 2CLLA 1KT0A 1TJ2A 3REQB 4LALA 3V75A 3JR2A 2RUDA 1XXXA 3B3DA 3EDEA 3LCHA 5EMKA 1A53A 3S5ZA 2Y2WA 3BJFA 2P1FA 1JPDX 2INEA 3FSTA 5FD0A 3B8UA 4BJHA 4NRRA 4AY7A 6PTDA 4IIFA 2CHOA 3U5YA 4XIMA 1WQ5A 1I0DA 2WAGA 4UQ9A 1UR2A 4RV8A 2PDCA 4U4MA 3GH4A 3MBDA 2BTMA 2WMGA 4XVEA 4WK9A 5DQPA 2OMAA 1F6KA 2DIKA 3LRLA 3NQDA 3KS5A 3R25A 1SM9A 2C18A 2X42A 1QI0A 1EGMA 4OVXA 3A12A 3LSCA 3SDOA 3EY6A 3SUUA 1TRDA 4ECLA 4XKMA 3O15A 1QW8A 5E09A 4GIVA 1R9YA 3OP2A 2ODOA 4O53A 2AWGA 3FAXA 1D7KA 1F05A 2YDAA 3REQA 3SRHA 3VD9A 1FWCC 3MV01 1GKPA 1MW1A 3EX2A 3C8FA 2ZKMX 1XLCA 1M5YA 5D05A 4TU1A 1GJPA 3BW2A 4LB3A 3RFAA 3FHQA 2O56A 2AGKA 3AHTA 2VZUA 1GNXA 4LWWA 1I9CB 4FNPA 3CMJA 3EYPA 1XLBA 2BOGX 2FVLA 1FKHA 4J4NA 1Q6EA 3WF1A 5JXQA 1FY6A 1LT7A 3BCJA 5J04A 3FW6A 4XKYA 5LKYA 4Q32A 2OT1A 4HNVA 4O50A 3TP4A 4DIPA 1EYWA 3CL6A 4MG4A 1GKRA 2VZVA 3V5FA 5D03A 3MV11 1DYSA 5HNNA 3RLUA 1MRAA 2CLHA 3OLEA 3AIBA 3K8KA 1FCVA 1WAWA 3U7VA 4RDYA 1Q6FA 4RR4A 4MVAA 3VIJA 3RMEA 4CQAA 4MF4A 2UV8G 1XDJA 3MTWA 1ZBKA 3PUEA 4MGGA 1JNEA 1A4MA 3T07A 1CGWA 2O9PA 2YDRA 4AD5A 2Q8ZA 3RLHA 4D9PA 1UCWA 1EIXA 2CLFA 4EP8C 4KWWA 1OFRA 4W9TA 3KL3A 5EY5A 2DZWA 2NVAA 4DEFA 3SGUA 3PPHA 1R3YA 4LW7A 3W6MA 2VCAA 2J6XA 4JTSA 3UJRA 1SFJA 1KRBC 3N6JA 3THDA 4ZODA 4PSPA 1W1IE 2BP1A 2JKPA 1OCBA 2B0MA 3QMRA 3DHDA 3HQPA 4QR6A 3OZMA 4NJGA 4WD0A 4TXEA 3LMZA 4K1WA 3QW4B 1FXQA 4WY0A 4JTGA 2JF6A 1MYRA 1ZBCA 2AMGA 3GYEA 3QTPA 4G50A 2ONEA 3W2NA 3UCCA 2OLAA 5A95A 5JU6A 4HA0A 1NELA 2ICSA 5CLWA 3CT2A 4EXQA 4E3TA 5KINA 1AD4A 1FKTA 4DBEA 2IKIA 1H2JA 4C1LA 2J4GA 2XINA 1EC9A 1JVNA 3R8HA 4XO7A 2MNTA 3AIQA 1IEQA 1YW1A 5C7HA 2PGWA 2VEPA 4RK8A 3VTRA 2JIWA 1HJUA 4IFKB 2QPSA 4HBEA 1R2RA 3A47A 2QAPA 3DENA 5CGQA 3VIPA 3ID7A 4PMJA 4YTTA 4GVGA 3AXMA 4DQWA 1X8FA 1OGBA 3BOFA 3QGKC 3KX6A 4AHPA 1F3TA 3APYA 2A7RA 2IKJA 2OWWA 4LAWA 1XDLA 2WB5A 6CGTA 1ONWA 2DZSA 3AUJA 3QV7A 4F2UA 3QN3A 2BNJA 5G1TA 9XIMA 1W3TA 1K70A 4GY0A 3QC0A 1RY0A 3O5KA 3KHJA 1QI4A 1V6VA 4NHVA 4DXXA 4MLRA 3W1XA 5AC4A 5LNWA 1Q6QA 5BU9A 1TCMA 5AC6A 3OBEA 2RH9A 4DT4A 2J8GA 2E6DA 2I5GA 3EIPA 5A6KA 5DMYA 2A3BA 4BI7A 1W2PA 1PEZA 2EHHA 3GPKA 2E40A 3WENA 4D6GA 2ZRZA 3OQEA 3P80A 1TZ7A 1LWJA 2G3IA 4GXMA 2E68A 4XUYA 1QOPA 4DX3A 2PWDA 3RUBL 3VKKA 1E6NA 1RBOB 1ONXA 2BY3A 1JZ6A 1ZS2A 2W9MA 3CPGA 3O5QA 3TMQA 4NNAA 1PZ3A 4OQVA 3TSMA 3C56A 3PRDA 3WY1A 1BVWA 4KRUA 4AZ6A 2V6AA 4HMNA 4NVTA 1VCFA 4OBSA 4MM1A 3A24A 3SSJA 3M0LA 4YJ5A 4ACZB 4XAZA 2EG8A 1ZZMA 3G1DA 1ICPA 2ZX8A 3UWQA 1W1PA 7REQB 1WX0A 4YHEA 5EBUA 2WK2A 2VCBA 3KBVA 1W37A 4HBKA 3TFCA 1GRJA 3G1VA 2ZADA 2Y78A 2FZMA 2WNNA 4UCFA 5FL0A 1BG9A 1GOWA 4J1OA 4GZ7A 1KGWA 1WXZA 2HE8A 4J3XA 3TQVA 1C9DA 4O8RA 1GEQA 3BOLA 1D2KA 1UP3A 4DNHA 4X9YA 1IIHA 1DHKA 1WZAA 2FH8A 3HV8A 3B97A 1MQPA 1X7IA 1CLVA 2P4VA 3IV8A 3M0IA 1JYXA 4YTUA 3PZVA 2ZICA 4AZBA 1K8CA 4LCRA 1YPIA 4GBUA 2XVPA 2P10A 4NNCA 3ZT7A 2A3LA 3W1RA 3NQ2A 1TKKA 2WJFA 4LVGA 1ME7A 4C6CA 4PGLA 1VQTA 1I6NA 1O4UA 1UHVA 3TN4A 4JR5A 4MY1A 4EOUA 3VMPA 5GQBA 1FKWA 6REQB 4Y9OA 4AX7A 1CEOA 5CJNA 3SN1A 2FTYA 1A5SA 1FXPA 3N13A 4KCWA 2WOQA 2H8ZA 1PTDA 2ZXQA 5XIMA 3H21A 1IEXA 4PRTA 2VT0A 3I10A 2W91A 2VURA 2D0FA 3DX5A 3WFAA 1IZJA 3PTQA 2WCSA 2XP6A 1RCXB 4MY9A 3AO0A 5EPDA 2DG4A 1W1YA 3CO8A 3UEQA 4DUOA 3PAOA 1YNYA 5FI8A 1B6CA 4G2PA 4I7UA 5TIMA 1QBBA 3FIGA 3IUIA 1V6YA 3GAYA 3HM7A 3UCDA 3TUUA 3HO8A 2D24A 3WD1A 1Y7VA 1N7KA 1J0JA 3NZRA 4UTJA 1QU4A 3VNJA 3JXVA 1LTDA 2F8QA 4QEHA 1W91A 3IGUA 4O0KA 3BLOA 5GPGA 4ROPA 1LZOA 2AKMA 1BWKA 1XSIA 2O9TA 3ZJ7A 1J0KA 2GUUA 1M04A 1M6JA 3W6YA 3GTIA 2TODA 1EWEA 1HKMA 4QBXA 5I02A 4BQ5A 4ZPVR 1UR1A 1J96A 3STPA 1EJVC 3B9DA 1RAKA 3N18A 2FZBA 2YCLA 4TR9A 2QCLA 3FAPA 4DWSB 4HMEA 3TJXA 5A6JA 3W88A 2HJPA 3K46A 3LLDA 4N4QA 3LENA 4QJ4B 2ZYFA 3M9YA 3T4CA 3ARTA 4X9SA 4GYKA 3V7PA 2QJHA 4JIPA 6A3HA 3T0BA 1FQ0A 1QFEA 1UKQA 2Q5AA 7TAAA 5AVHA 4MOZA 3JRKA 5K9CA 3FLUA 5ENLA 3NCOA 3S9YA 1KXVA 8TIMA 3FJ4A 1ZAJA 3W29A 3MZ2A 2XU2A 4PL2A 3O5RA 2DY3A 1A5MC 3BPWA 5E9AA 1W5PA 4Q4QA 2VM8A 4WLCA 1GPFA 2CIPA 1TRIA 6ALDA 3AIUA 3AC0A 3OG3A 1FKLA 3L2MA 4ZSTA 2F21A 4PUJA 1HL8A 4JTLA 1Z6KA 3KTCA 3HQNA 3WUFA 3GVVA 3B4UA 1EP3A 2PB1A 4GI6A 2Q8XA 3BSMA 3NZQA 4O1CA 3INPA 4CNOA 3TCSA 3BARA 1J0ZA 1P0NA 2ZUUA 2QUNA 4FI4A 3RU6A 3KOWA 3VIGA 1V0MA 4IT6A 5E0FA 2CBUA 2Z1SA 3IJ7A 3PZ9A 3H22A 1TJRA 4NI8A 3HQOA 1BXNA 2V82A 4XAKA 4D72A 2INZA 3WDQA 2H90A 2X1TA 1VLWA 5BXRA 3PRBA 3IJIA 2ON3A 4FLOA 3HJEA 1XBVA 3NQAA 2B7QA 2FH6A 5EKYA 1UWUA 1CXEA 3GDMA 1D3CA 2ZIDA 1XLJA 3AZTA 2EJ1A 1LLZA 4GQGA 4C6OA 1OZMA 1IR1A 4U10A 1AZ1A 2Y7DA 4XUGA 1QJWA 3W71A 4QP0A 1VCGA 3FFSA 3CWOX 3ZR4A 1FOBA 4PB3A 2XFWA 4EF8A 1LBLA 5HQLA 4JD4A 3HB9A 1V08A 4L4LA 2Y4SA 2J9XA 3M0HA 3SAZA 3TTSA 4O0ZA 3R8GA 4UFJA 2ZZ6A 2DZTA 1ODUA 3AIRA 3PG9A 3WMLA 3T8LA 4AIBA 3WLOA 1FFQA 4B16A 3BJTA 3T2PA 2NXHA 4GHRA 1O12A 3KOZA 4EPEC 2ZX9A 3EOUA 4PR4A 4AVOA 1GZ1A 2LKNA 1UG6A 1PHQA 3EX3A 3EDKA 3SUVA 2BVDA 2TRSA 1QNSA 1XINA 3I7SA 1CCWB 1WZKA 3IRSA 4INFA 3ZQ9A 2XP5A 3H2EA 2AKZA 1RA5A 3O05A 4JTAA 4UTFA 3C0QA 5BXJA 2Q3OA 2CZDA 5T26A 1MEIA 4O57A 1KV8A 3VU2A 2ZZ1A 1JPIA 3L4VA 2VGIA 1G0CA 4LUSA 1IWBA 3THUA 4GIAA 1TB3A 1F9CA 1D7FA 1E0VA 4MLJA 4YVPA 3WBXA 3C4UA 3G8EA 2QEZA 2Y24A 3ZZ1A 4AG0A 1YXDA 4YLWA 1W5OA 3B8VA 4UOJA 1UJPA 4HYVA 4HZ7A 4RE3A 1BKSA 1NDVA 5BRQA 2RJGA 3N4EA 2H3BA 4HA4A 3ZR6A 4RLIA 5IBXA 1OK4A 3OGSA 4MWAB 3PZIA 1WOAA 4M29A 3M0XA 1WOBA 4O13A 2J74A 3PC0A 3IGXA 2Y63A 5D04C 3LSBA 4GX8A 4Q7NA 1NQKA 2YX0A 3EEZA 3DYPA 5CGMA 3GNXA 2V69A 1B54A 4WKFA 1GHRA 2Z6JA 1PAMA 1S5MA 4M0XA 4KKXA 3OVQA 1NFGA 2BVYA 3FXYA 1DXFA 4MZ8A 2QCMA 3XIMA 5A8OA 4FF5A 1W9BM 1ZP3A 2QGYA 3LNMA 4KERA 1KFKA 7XIMA 3W3OA 1UROA 4P7RA 2ZUSA 1EQPA 3ZS4A 3G24A 3EDJA 3GTXA 3UR2A 1NP2A 4Q33A 3BJSA 1OSEA 3GIQA 4IUOA 3UWYA 1PYMA 4CNTA 1V5XA 3IACA 2V3GA 2ZRWA 3LCIA 3RU8X 1RUSA 1A3HA 4F0HA 4ODKA 3ZWTA 1C93A 2Y7EA 1IT7A 3F03K 2WYSA 3ITGA 4FNTA 3S5YA 5HAOA 3N3MA 3EWCA 5AB3A 4U31A 1J8VA 3SUWA 2R14A 3CZ8A 2NXGA 2QIIA 5PTDA 2DG3A 1EKOA 5A8QA 4EWND 3GDBA 3CPRA 4DF2A 3GNPA 1WZLA 3UF9A 1DJNA 4UQDA 1BTCA 4NJIA 3OU8A 3LTSA 2FFCA 3DH7A 2VCDA 5G2IA 3L4YA 4PUNA 3W7CA 3RN6A 1QPLA 4YHGA 5I7GA 3MMDA 5LGZA 4IJRA 3N9SA 2BVWA 3GHRA 4L6DA 1OABA 1IWAA 2TYSA 1XRSA 4NAFB 1FKKA 4F4RA 3ELFA 4Z0SA 4HT3A 3VO0A 5RUBA 4FX7A 3CB3A 1NF0A 2UWFA 1F73A 2AQVA 3CL8A 3LRMA 4QNWA 4HZ6A 1EZWA 4L4MA 1SFSA 1IYXA 3NYZA 4UR9A 5DX7A 4DF0A 3LM7A 1MZRA 3E0LA 4DLFA 4Z17A 1WUEA 3NR0A 3RPTA 3EWUA 4ODNA 3LHZA 1C8YA 5IFTA 4YS1A 1VD6A 2UY5A 1P0EA 1HN1A 1XPGA 2BHYA 2PPPA 2BASA 2J88A 2TAAA 3URBA 3MUXA 1K77A 3M0YA 1V02E 1XRFA 5CPTA 1VBRA 4XISA 3MO4A 1E5JA 5HUPA 3NQBA 1C7SA 3NO5A 2WKGA 2Y88A 1UOZA 4K8EA 2D22A 3BDKA 4UTHA 9RUBA 1JCXA 2ADAA 1EA0A 2CLEA 4ZE5A 1CXLA 4MPKA 3F1QA 4JY9A 3NQ6A 2E7FA 4XTDA 4DBUA 5JIWA 4PMXA 1TWZA 3BW4A 3BMWA 2EJAA 4KW2A 1PS9A 5T91A 1H62A 3DKJA 1XYLA 4Z0JA 1AFSA 3PWGA 3NL5A 4QJ1A 2X09A 3GY1A 2JGQA 3IV3A 4GVIA 2JIEA 1TYGA 2WPBA 7ODCA 4X63A 3VKJA 5G1YA 3LLFA 2ACQA 4LPCA 2WHLA 4OOZA 3WQCA 4FEZA 1O1HA 1P4CA 3O5GA 1FWAC 1NEYA 1OBAA 1QDSA 2ZXDA 4DJDD 5HNRA 1KFLA 5I0DA 3VFLA 3LN3A 2XG9A 3S6OA 2PWUA 4IFOA 1VIWA 2BS9A 3W1QA 2ZVRA 3U2ZA 4JFWA 3PPFA 5C9RA 1AL7A 3IWPA 4Q4PA 1SR9A 1HGYA 2FVMA 1P43A 4G5DA 1H09A 1UD3A 2NT0A 2OSWA 3ENLA 4DJFC 5AECA 1MQQA 1WNOA 1X38A 3O06A 1LROA 1J12A 4A3YA 3NDOA 3E0IA 1PKLA 2C0HA 4JQ2A 1KBIA 1YBQB 1DWGM 2PS2A 3V0SA 3BV4A 2VDIA 1JD7A 1V3MA 4JN8A 3N4AA 2ATSA 2R1LA 2QDDA 4K1GA 3WLJA 1K9DA 1KTBA 1A3XA 2FFIA 1V3IA 2OCZA 5DRIA 1JPKA 1ITCA 1A4LA 4E0CA 3VM5A 1RD5A 1UPMB 4CNUA 5HDRA 3KAIA 1E6RA 2XPKA 1OM0A 1JNSA 2E9LA 3BWWA 4O19A 3H2OA 4JX4A 1XCFA 2PDXA 2AL1A 3WH5A 4JBRA 3RNDA 4F40A 1J79A 3W25A 2WMFA 4Q4RA 9XIAA 3WQFA 3ARUA 1IXOA 2WC7A 2TPSA 1A80A 2OEKA 3ZVHB 4H41A 1TR9A 4JZ5A 2HVMA 2YDQA 2PDIA 2IPGA 3WLTA 2PUZA 4CD8A 1SFTA 1Q6IA 4H6RA 2OGYA 2DGAA 3AFBA 3OG2A 3S83A 4H9XA 2OZ3A 3ITCA 3G1XA 3VOGA 3NDYA 1GJWA 4GNVA 1FWSA 1WZMA 3QQWA 1KM6A 3TTOA 2MUCA 4AD2A 3NZPA 4GI8A 1S3HA 3OZPA 5F4SA 4XZMX 3CB8A 2WNWA 3DFOA 4JIEA 4OIFA 1DPMA 1XC4A 4EWJA 4KRZA 4LBSA 3B9NA 5D9OA 4ATDA 1RQHA 3VKCA 3CQKA 3TC3A 3MBFA 4Y9NA 4KQZA 1XIEA 3U7BA 2A3CA 2Y7GA 1XR2A 2QMKA 4LYQA 4C6JA 4ML4A 2A7NA 1ESWA 4J27A 1I2RA 2VO5A 3A4XA 4C02B 2OZ8A 1F3WA 3AHYA 4H9TA 1US2A 3VMNA 4LC8A 4PYSA 1HL9A 3TOPA 3LBCA 2KFWA 1Y65A 3G6MA 2V67A 1DV7A 4H9YA 3A64A 3WMCA 3O07A 4PB5A 2YGYA 3SO7A 4C65A 4ODQA 5K7JA 3DUGA 4B5UA 3S2JA 2BXZA 4DJED 4ZTYA 3QQ0A 3ORWA 1GVQA 3QF0A 3M0ZA 2GPTA 4R7OA 4XVDA 4DBDA 4RX0A 4PODA 3WQPA 3T6CA 2LLEA 4DJFD 5A2AA 3UYCA 1KXTA 5TNVA 3GR4A 4OV4A 2JQXA 5AYYA 2ZQTA 1DWAM 4PBFA 4EVZA 5B80A 1W3NA 1XLHA 4B2DA 2A7PA 2VRKA 3UD6A 1FWHC 1QK2A 4JFTA 4IQLA 2FYMA 1E44A 3NSNA 1ADDA 4US6A 2ZA2A 1WDRA 3E9AA 4YTRA 2IS7A 4K39A 2Y8UA 3NAVA 3WLMA 3PA7A 3NQCA 2EPNA 1YE6A 3CAVA 2PF8A 5BW6A 4UNLA 4PMYA 4DZIA 5KMYA 3R11A 1JDFA 3UZJA 4BEQA 1T11A 4MNLA 2PDBA 2QVHA 3I68A 2DP3A 3GW3A 4E38A 2VCCA 3WIJA 2ABBA 1B30A 3L65A 5DLCA 1KFCA 2DV0A 2DT3A 1EL3A 5I3DA 1Z32X 2VFHA 4FLSA 4OE7A 1TPH1 2G8ZA 2J25A 5BU6A 1UB3A 1GQIA 3JZEA 2QV4A 2D2OA 3R6IA 2PZ0A 3D47A 5FESA 1G1YA 3LLXA 5DXXA 3UBPC 4IPLA 3VXGA 3FY1A 4E2DA 1AH3A 1PZ1A 3VA8A 1Q6HA 2JKEA 1Q1CA 1M7OA 3DBNA 4O17A 1TE1A 1UD2A 5JVLA 5TBOA 2ZR6A 1CZ1A 1VEOA 4WXZA 1R46A 3B9OA 1YXYA 2ZZ3A 2IXUA 2W62A 3B06A 4HVXA 3N4FA 4ZB2A 2Y5JA 5GVJA 1LUCA 1U5VA 5BXSA 5D9MA 4I8YA 4TVDA 3JYMA 2DZUA 3W01A 1GG1A 1H51A 3N17A 2ZZ4A 1Q2SA 1SFLA 7REQA 1JCTA 3L4UA 4MNKA 4FOUA 3DBPA 1H1NA 4BWLC 4AC1X 3UJ2A 2JK2A 2PU1A 3DFQA 3R5EA 1U30A 4GG9A 5AC8A 3QRHA 4C7DA 4FNQA 2PGFA 4N02A 3RGCA 1BEUA 1DIDA 3H7VA 3AU6A 5DEZA 1R3WA 4LS0A 4C5YA 4L72B 3N2OA 2BX7A 2V3FA 1SJDA 3A3XA 2VEKA 3A9IA 3S2MA 3DESA 2E25A 4R27A 2XVNA 1MMFA 1FHVA 2GVGA 4J3SA 2PLKA 5M3WA 4WRHA 2VEFA 3GO2A 4W86A 4X61A 4RNIA 4A3RA 1NM9A 1FWRA 2HEJA 3PZOA 1RCQA 3MT1A 1P6WA 1PIIA 1H7OA 5HMSA 4LANA 1IZKA 3GH5A 3BQ6A 1XLAA 3NSXA 1YADA 1H61A 1UKOA 5CGTA 5J5DA 4LYKA 1RSCA 2OSXA 2X2GA 4S3KA 1MFVA 2X1SA 1YLVA 2I9EA 4JNZA 3TYUA 1D7HA 3CU2A 5JQ9A 1EXBA 3O5IA 1GQKA 1AJ2A 4M6UA 3WJYA 2M1IA 3M7WA 2WC3A 1YTDA 3MSRA 4Q8UA 2FZDA 4LVBA 2EPKX 1VEMA 1BAGA 3W7GA 1I1WA 3OLIA 5CG7A 3P60A 4YCPA 3U4AA 4MB3A 4U2ZA 1SVDA 4W7UA 1SO5A 4QLLA 3GXDA 5D2YA 3PM6A 4YWSA 4QDWA 3M44A 3SCQA 1BPLB 1BYCA 3GNDA 3VX0A 3P61A 3OGVA 1HQTA 4A05A 3WNOA 2MLXA 1B3OA 2QNEA 3CS2A 3NM1A 2YXXA 1W26A 2V3EA 4X2RA 2QUTA 1W1TA 2Q71A 3C3NA 4PFMA 5I3HA 5JH8A 1W9VA 5IBXC 3VK5A 3PWAA 4UWMA 3EMZA 2OX1A 1LRNA 5IFPA 2QCNA 1E1FA 3R10A 4B91A 3EX1A 1AQHA 4LUIA 1L6GA 1SGJA 2GZXA 5C2CA 1B5TA 5CJMA 1Q85A 1NY1A 5CSSA 4HARA 1HJQA 1J0IA 4FIRA 4I9JA 1VRDA 4X22A 2YA0A 1W5NA 2PC4A 2QCDB 5EL1A 3BAYA 1B9BA 1W6TA 2OKOA 1KC7A 4GA8A 4RZBA 3OA3A 3G5EA 3CZKA 3NZGA 2CU0A 5CH9A 1VZWA 5EMJA 2OO6A 1JJKA 1XKYA 4U3CA 4MWAC 1C8VA 2A3HA 1DVJA 2DH3A 3MUCA 1JZ5A 2E6YA 4H7VA 3K8LA 2YA2A 4DZ3A 2PF0A 3ITOA 4NSBA 2YYUA 3W74A 4QFUA 4GJJA 4Y8FA 1QNQA 1WUFA 1XLKA 3OB8A 1UR4A 1W3IA 2CFFA 3MI6A 3NL2A 1MEWA 3UI6A 2YZRA 3ES7A 1EJRC 4BI5A 5AC7A 3GE7A 2Y5EA 3NPXA 4JN6A 4JYEA 3BLEA 5I3GA 3SM0A 4W9QA 5FAJA 1DOSA 5C0QA 1RQBA 4IISA 3KDNA 4Y96A 1XCXA 2R9RA 5F4WA 4JGDA 4C1NB 4IIHA 1JL8A 1NIUA 3TXZA 1L0PA 3L4ZA 1XH0A 4G2DA 4JNYA 3QSRA 2NQJA 4FN2A 1JNTA 3E0VA 3O5PA 3N29A 2V5LA 4R34A 3VX1A 2F9RA 1F40A 4G7FA 3W2UA 4LAVA 1TPC1 1JPHA 3CV7A 4HA3A 4PULA 4XZWA 1S2CA 4UFKA 3IEBA 4OGZA 3S2CA 1L6WA 4W4QA 3RK8A 3NEHA 4MDPA 3QKEA 3V3WA 2DZBA 5HULA 3RX4A 4OT7A 3W02A 3CGMA 4LYPA 3LK6A 4NYYA 2QF7A 4NZ3A 3RM4A 1OX4B 2FB2A 1VBGA 1AVAA 5DCDA 1W3JA 3ZO9A 1EQCA 1W3KA 1SQ7A 3H12A 1CI1A 2V8ZA 3CLMA 3O2LA 4HU8A 3NGJA 3B9AA 4DPQA 4MWAD 2E77A 3CASA 4CQDA 1TVNA 3BLIA 2A85A 1R3VA 4XD6A 2G96A 5F1UA 1MQRA 1CENA 3BAWA 4YPJA 3TLQA 1CBGA 4F0SA 1TTIA 3CTTA 2C79A 2RURA 4ADSA 1FBAA 4LCSA 3T8QA 2NX3A 1MXSA 4ZO7A 1K8YA 5J6EA 1P6BA 2FPTA 3RM8A 4Q22A 6ENLA 2RQSA 4L9ZA 3V4BA 4XIAA 1UD8A 2V3DA 1TPB1 5I07A 1IEVA 4TMBA 2W0UA 4AW7A 3AUOA 5DO2A 2P76A 5FIPA 2Z28A 1W9DM 2X8RA 2HROA 2GDVA 3S1GA 1K9FA 4GD0A 5HR7A 1UC4A 2QCFA 4PUUA 3NOEA 3TWBA 1KBBA 4PRWA 3PZMA 1OGSA 4Z2LA 1HP5A 1D9EA 1U1HA 3JS3A 3L66A 1SW7A 1VJSA 4DO6A 1KGXA 2NW0A 3EKZA 2CBIA 3AROA 3TC5A 1VS1A 1XBZA 4MZYA 4FAPA 2PDMA 3CLWA 3N2MA 2Z0IA 1K03A 4JFKA 1QO2A 3UR5A 1UC5A 2ZTKA 3L67A 1CXKA 3T09A 1NDWA 3SR7A 5IHSA 4B5SA 5I78A 3N25A 4DJDA 4FPSA 2DSKA 3UG8A 3K30A 2QCEA 3STGA 4HSHA 4BQ3A 1H7XA 4IL0A 1VLIA 5MKGB 2VEMA 1PX8A 2KZHA 3O6YX 4MJ4A 2HCVA 2PTDA 4UQAA 3IKDA 2IW0A 2VDGA 3QTGA 2AQOA 3GK0A 2OTDA 2HZGA 1DJGA 1KFJA 4S2BA 1E70M 4C6NA 2I1OA 3M64A 1LM1A 3HJZA 3TNBA 4KR0B 3DDMA 2VVNA 4HPNA 3UZWA 1HT6A 4Z1CA 2P0OA 2PMQA 4EIVA 3W4RA 5H8PA 3MVIA 4W5UA 1YDOA 3GDLA 5A3HA 5HNTA 3O5FA 3LD5A 1MVYA 1QNPA 2IQ0A 5C9UA 4TQTA 4WVXA 4FNUA 4GCXA 4IGNA 2PV3A 4M82A 5E5CA 3HZ3A 4C6EA 2FMOA 4O12A 4QM1A 3T42A 2D3LA 3UGRA 3H2MA 4UTWA 3E1F1 4IMFA 5BYWA 3GZ3A 3SJNA 4G1NA 2FTPA 4C6DA 5C9XA 4F0MA 3CNYA 1W9PA 1G4PA 3WDPP 1GWJA 3DG6A 3PG8A 3N14A 4DXKA 3R0DA 5DCEA 2J9ZA 3FS2A 4IPPA 1UIOA 2VZTA 1OB0A 1DIKA 2XPAA 3O5OA 3S1VA 1UR3M 3LCLA 1MRQA 1QNVA 1RJPA 3OTRA 3U4FA 3OEXA 5JMUA 1V0KA 1KQZA 1UUMA 4CKQA 2NX9A 3W76A 5AY7A 4UMCA 4MWAA 2O4QA 4ZO6A 4NZCA 4H3DA 4S3DA 3N2BA 5C8BB 2HBVA 1QZ2A 1R9HA 1O7AA 2ANUA 3GVWA 3GNNA 1M65A 2WQPA 2C19A 2F2HA 2E5BA 3VM7A 1ZPTA 3B9EA 3MCMA 4H01A 3D0CA 1EO5A 4MYXA 1J4HA 3S2LA 1KRMA 1JI1A 5DXYA 4NILA 3UETA 4A35A 2NUWA 1GYNA 5D8WA 4Q6JA 3VNMA 1EFZA 3TV8A 1EXPA 5CEWA 2QCHA 4NJJA 4A8RA 3FEMA 3UQIA 3QV9A 4JCMA 4LGXA 4S1FA 5I3JA 4IMEA 1YHTA 1C3FA 2C3ZA 2VC9A 1SU5A 2XTKA 4GQQA 3V0UA 1J4EA 4JX5A 4LVAA 2BHUA 2CHNA 3GTFA 4AUBA 4DELA 4GZJA 1EBHA 1JI2A 1KWGA 1CW2A 1E4LA 1UH4A 2AQWA 4TX9A 3I3BA 3DG3A 3EXTA 1B4KA 1V3LA 3NJ3A 3UXLA 2HMCA 1S1RA 4GXWA 1H3GA 1YE4A 4WQ6A 3DI1A 2BGNE 3EDFA 2GWGA 2XH4A 2DQXA 2H9AB 2OODA 5AVNA 4HCHA 5HWBA 1WPCA 1XKJA 1ZGDA 2BSLA 2HBXA 4WDWA 2DT0A 3WQ8A 5BROA 1XH1A 3FJLA 2PDGA 3NFUA 1UD4A 2A79A 2J66A 4NF7A 2NQHA 3O6DA 1MXDA 4RKAA 4AZCB 3ZVHA 1JYWA 5TAOA 1PVNA 3PJWA 2OEMA 3GR7A 5K2ZA 3LPPA 2A6LA 4C6MA 3QPEA 2XIMA 2GJPA 4J35A 4N0RA 1Q6GA 3P74A 3FHAA 1QI2A 2PDPA 4RNJA 4I6KA 1YKWA 4XZIA 1H11A 2PP0A 3GU9A 3ATZA 5BOOA 1E6ZA 3I4KA 2WMHA 1TG7A 3K1DA 1E3ZA 2GK1B 2Q8LA 4AISA 1VHNA 4EAYA 4QS6A 3QY8A 5GNXA 1NSGA 4ALDA 1H63A 1JCYA 2F38A 4W5ZA 5A6SA 5EB8A 4GVHA 1W5QA 1FKFA 1P7TB 2PDJA 3G22A 2G95A 4WHBA 4QT3A 4M7TA 2M2AA 1VFFA 3MB9A 2O9RA 1Q6DA 4TVCA 4FAMA 2Z27A 1UBPC 3AALA 2ZR5A 1EPXA 1GTEA 3VGHA 2WC4A 4DAIA 3UR7A 2DG9A 2J75A 1YYAA 3QBUA 2B5UB 1OZQA 1NSJA 2NVCA 1VFHA 2XPBA 3PANA 1U5JA 4D1JA 1M41A 2QMJA 3USZA 4V27A 3MJYA 4DLMA 1H5VA 3S0CA 4CD5A 4G56A 3S6DA 4QTGA 5FEZA 2A3AA 3I6EA 3U48A 1ZRQA 3WNLA 4K8GA 1R9ZA 3N12A 1DE5A 1UKPA 5I79A 4XQ6A 2BY1A 1UKSA 2ZRUA 4WUIA 1F3EA 4UBPC 4MB5A 3AYTA 1MWOA 3H24A 5FKYA 1VC4A 1ZAHA 2I16A 1EX5A 4JN7A 4V15A 5L6UA 5I23A 2VD9A 4ACYA 2V63A 3P0WA 1DQWA 2P3ZA 2QPXA 1MDRA 5IDZA 4LJ3A 3MDYB 3CUIA 3VZZA 3UPWA 1XD0A 3TKFA 3L0KA 3EDDA 1EWDA 4JPGA 3TQ0A 3D6NA 4O54A 5CPMA 3KZ7A 3TDBA 5KTLA 5JUVA 1F2JA 2X40A 4ZQOA 3PAJA 1AD1A 1NDZA 1E40A 5CPSA 4A6GA 3HG3A 4MB4A 3FVDA 5E1QA 3W1UA 1HKVA 1LLOA 1TV5A 3ANUA 4MPQA 4DO7A 2VWSA 3L0GA 3A4JA 1B3ZA 1B3XA 4HPXA 2VHLA 1S3TC 3RM9A 2Z25A 4QAWA 1E43A 2FPVA 4WSKA 3GZAA 4WY0B 4N19A 4N6FA 1TX2A 2NQLA 1QRQA 4UQCA 3B40A 5HMFA 3WQEA 3BL3A 2DVUA 3EOLA 1BHGA 3P93A 4UOZA 3ERPA 4CN4A 1HJSA 2FIQA 3VOIA 2YLAA 2Z2AA 4XD3A 1RP8A 2CLMA 3IAQA 1K3UA 3LXCA 1RY8A 3PTDA 4GK8A 3A22A 3EB2A 5GNYA 1RXOB 3UJEA 4DROA 3M4HA 2ZZ5A 5T9CE 3T9PA 3THAA 1ZJAA 2GUYA 1VFMA 4P8WA 4GH3A 1T5AA 5E70A 4LFYA 4HKPA 1V0NA 1Y5VA 3CWNA 3PPGA 5EU9A 4D6JA 4MAVA 4RZ6A 1GHSA 1VP5A 3EX6A 1POJA 1TV4A 1O60A 3N2XA 3UCQA 3QR3A 5KZ6A 3SRDA 5E93A 3UESA 1R8LA 2V5BA 5FSEC 3BGGA 2NZLA 3DFNA 1EIBA 1A0CA 3GRIA 3DHUA 1FA2A 1A5OC 5CG0A 2E09A 3CZLA 1GONA 3T0CA 3SCTA 5CXPA 1UD6A 3M5VA 3W7RA 2GOKA 1HP4A 4S3AA 1NTHA 2PBCA 3TTYA 4LCQA 1A5LC 1TPEA 3VCRA 4W93A 4PMRA 4Y2WA 1GOMA 4RDVA 3W23A 4B5XA 1KM1A 4HBOA 3IKGA 1U33A 2XH0A 3GD6A 1FD9A 4LF2A 3CTLA 2ZX6A 3KZPA 1UW9A 3UA4A 2XWDA 3F4VA 4E4FA 2OQHA 1YDYA 3CYVA 4Y90A 3WQ4A 2QVNA 3L23A 1TE6A 4EAMA 3EXRA 3BMBA 4D71A 2B7PA 1UZDA 1S5NA 4GZIA 1HZYA 2VUNA 3SUTA 2F4EA 3WYZA 3PZNA 3BCDA 4RUBA 1XUUA 4E5TA 5D02A 3IAPA 3B0VC 4ZZ9A 4WGHA 2ATMA 3I65A 1JF5A 1LOSA 2PWFA 1ICQA 5MHBA 4IXXA 6XIMA 3KP0A 4ZEPA 3P0XA 1CDGA 2XVLA 2IKGA 1KXQA 2QULA 1O66A 3WQOA 1G7VA 4J4OA 3LV6A 3G1YA 1OT1A 2RFGA 2PDLA 4BFAA 1OK6A 2W27A 5E0CA 3LM3A 2IPFA 3FDKA 1KXHA 1V03A 8CGTA 5FJPA 1CGYA 3KBJA 1GCYA 4HNLA 3FGCB 2BOEX 3ARQA 4BI6A 5AOUA 3MU7A 1SSDA 3BSHA 3U3HA 3TYZA 4DRPA 3ZT6A 3FSUA 4B9YA 4XSMA 2WZEA 1OYCA 4GUJA 1QT1A 3V18A 2YKKA 2FJKA 2OYLA 1GW9A 2RJHA 1ZCOA 4TOQA 4PB4A 1F7BA 4QSHA 3W1PA 1FKXA 1TPVA 2I56A 1B3YA 2VX6A 4XBJA 4Q8TA 2LJ4A 3ONBA 4MY8A 2UZ5A 3LPGA 3OO2A 5CZSA 2WVUA 3KVLA 4TV6A 5C9WA 1KBJA 4U33A 4KWOA 3U6WA 1EO7A 4H8HA 1BRLB 1VR6A 5G2WA 3V36A 3W53A 5AFDA 1EBGA 1X6UA 4UTTA 4NJHA 2Y61A 1S38A 1U5HA 1ZBVA 2V30A 3FX4A 4QISA 1HXVA 1FH7A 3N9KA 2PV1A 4RXGA 2PGEA 1REQA 1XD1A 3IRDA 1TJ0A 1ZP4A 4KFNA 4ZO9A 4IP4A 5M1TA 1R6WA 3K8MA 5C70A 3BGAA 4JIHA 3SQSA 5C2XA 4CU6A 5A6BD 3KEHA 1KKRA 2VC7A 4DZHA 2GL5A 3WQ6A 4NAFA 2CKSA 4FF7A 1U79A 1LQ2A 2OEJA 4LAXA 1H1YA 3DC8A 4GNKB 3WF0A 1A50A 5FEWA 1W31A 3KTXA 4DRMA 3L2IA 1ZB5A 2WSKA 4LUTB 1F8MA 2PSNA 3OVPA 3BAJA 1QNOA 4ZCWA 4MJMA 2XM1A 2WZTA 2EBNA 2VX7A 1JQVA 2GVJA 4LAYA 1EUNA 1LORA 4H6EA 5BMWA 3N19B 1XYCA 1V6XA 1GEHA 4FR6A 3KOXA 2GDQA 3ES8A 4Z2GA 3L68A 4M8UA 1XBXA 4BS0A 4O1AA 3UWZA 2QQ6A 3PNZA 3SECA 1H49A 3WNNA 4KT2A 4GPNA 4FB7A 1E3XA 2RAGA 1KM4A 3NQGA 3DCPA 3T0DA 3KP1A 3PBUA 2VX4A 2FDSA 3DI0A 3LPOA 3T05A 3URQA 5JBDA 3WUEA 4O8AA 2TMDA 3A9BA 5DT7A 2WZIA 1OF6A 4AEEA 2WHMA 3R2GA 4AZ5A 3CC1A 3IIVA 3TK7A 2WBGA 1I2PA 4UC5A 3VD7A 3NTPA 2J47A 3TCEA 5LYRA 5E0KA 1XYZA 1SMAA 3LI0A 2DPEA 1M7PA 4JTFA 2XHYA 3Q2DA 1J6YA 2RDXA 3O5EA 1I45A 1RK6A 3WD2A 4XBKA 2BWGA 3DGBA 3S4TA 3DECA 1B4EA 3ARZA 2R1PA 2XM2A 2X1RA 4S3BA 1CGVA 1J93A 2PDNA 3W73A 3VNLA 2RSEA 3CUXA 3LHVA 4ORMA 4AC7C 4LAZA 2JALA 3IGSA 3LOTA 5F1VA 3LUTA 3ZJ6A 4WSHA 2A6NA 3KVKA 4D6EA 2OB3A 3FDGA 2XIIA 4L4PA 3OODA 1V51A 3W72A 3SY1A 2EPMX 5A69A 3IUDA 3UFYA 4QNEA 2O4MA 1Z44A 3NL3A 2VZSA 3W1NA 2OOGA 4DWSA 3AS2A 4MJ2A 1G5AA 4GIEA 5A8PA 4S2CA 4DO4A 1VYRA 1IHIA 1EUAA 3WQGA 5KZEA 3A5FA 1T7LA 1YTEA 4UZUA 1DJHA 1JRCA 3PNUA 4QEEA 5LHEA 4DAFA 4IPJA 2VGBA 2EULA 3AZRA 1Z8AA 1EB3A 4IIDA 1S39A 5JBFA 3V1HA 1Z9AA 2DORA 1KCLA 2VVSA 3PB2A 4AHOA 3JW7A 3KLKA 2GGIA 3WBAA 4LTSA 3DYMA 2YB1A 4DRKA 1YATA 3EXSA 3WNMA 2ZXAA 1C7TA 2DQWA 2HE5A 3UQNA 4O28A 4HPJA 3G1HA 1E0UA 4DH0A 3GTNA 3S3GA 1ZL1A 3RGTA 1W8GA 4NZ5A 3AYVA 1C8QA 1XI3A 3FYYA 3PULA 4NP7A 2PRLA 4QE1A 2XP3A 1YW5A 3VCCA 1FP8A 5ECUA 5HJXA 3TIMA 3M16A 4JYDA 3D46A 1UP0A 4AU0A 4B4FA 4KWVA 2VEIA 4AXKA 3W7EA 1JCNA 1OQFA 1KBLA 4PH6A 1BF6A 1FKRA 1LL7A 1J5TA 1EH9A 2WPGA 4LVDA 3WQDA 2RKXA 4WZHA 2PBGA 3LERA 3VKAA 4JDBA 4EACA 3LTYA 4QCEA 2KAUC 3S47A 5FF0A 2ZRXA 3F7JA 1FDYA 1OD8A 4IIGA 2UZ9A 1GK8A 4XX6A 2OVLA 4NAEB 2NQZA 3VILA 4A22A 2CESA 3UVAA 2JEPA 3MMUA 3TOYA 1L2UA 3W7OA 2VFIA 3E49A 2IUZA 3S9ZA 2Z1VA 4LSBA 4FO4A 4S3GA 4GQBA 5EBAA 3W87A 1GQJA 3LPFA 3VDBA 2R82A 4RW3A 2REQA 4DNMA 2XZ9A 4PUWA 3BK0A 1T6MA 1TR1A 3F5JA 3V16A 3PN8A 1US0A 3H2NA 1RALA 4M19A 1SJAA 1XIBA 2W66A 3CHEA 2WHKA 3LEPA 3UGVA 3TW9A 3BG3A 3W2MA 1AK5A 5G5IA 3IJLA 3VZXA 3KADA 5DMLA 3V5OA 2Z6IA 3NVTA 1HKWA 3MA8A 3SSZA 1H0IA 3EWWA 3MUIA 4QE4A 4HSNA 4HIBA 3KL5A 1PZ0A 3TZNA 4JIQA 2P5NA 1ADOA 2KR7A 4AD0A 2GJXB 5E6YA 2OZTA 3FEQA 4UQEA 3H23A 2ZC1A 1KV5A 4PMZA 8XIMA 2Y6ZA 1NH6A 4F0RA 4GO9A 3LHUA 5LIUX 1F76A 3SB0A 1TPFA 3RX3A 2QAFA 1Q6CA 2VFGA 4PTVA 1S2WA 4HP5A 2F2DA 4NZ1A 5CPOA 5LA2A 2XWEA 1JZ8A 4HK6A 1MI3A 3WN6A 4P7QA 1KTNA 1DJXA 5I09A 1V93A 3WLHA 1ALDA 4F66A 2PLCA 4K68A 2OJPA 2OLSA 3RMJA 3NQFA 4RNFA 2QCDA 3AZSA 4U84A 4GRSA 2ISFA 3CXOA 1YPXA 2UY3A 3GXIA 1X6LA 2CXEA 2C0AA 2QUUA 1JR1A 4L61A 3HFYA 2D69A 4ZO8A 4B5NA 3TJLA 3IUHA 1PX3A 4MTVA 1T99A 1U22A 5KZDA 3E0WA 4I8DA 4IM4A 4P5UA 4N6EA 3O1NA 4W9PA 1UUQA 1YTKA 1AMYA 4NT0A 1R47A 1CX9A 3DFYA 3FOKA 2VYOA 2ZQ0A 1PBKA 2HRWA 2H9AA 1KA9F 2DT1A 3UNDA 1VHCA 2WSYA 4QGCA 4RPQA 3QOKA 2FQIA 5FF4A 4K3ZA 4JOMA 1UWAA 3ZR5A 1RVGA 3LRKA 3CL7A 2PA6A 1HXJA 4J28A 1XRTA 4OBRA 2PD9A 4ZTXA 3OIXA 2YXGA 4UTTC 4KEZA 2JKAA 4BF9A 1VF8A 3WEZA 1QHPA 3YPIA 1UOKA 1J2BA 4EXAA 1EJ7L 3LCWA 2Z24A 3KBWA 2WWDA 5GJPA 1OWQA 3VC5A 1OFBA 2PV2A 1PKMA 5AZ0A 4AFYA 1KTCA 2DSWA 1GOKA 2G4FA 3HPZA 5LXEA 1N82A 4KRTA 3TFXA 5D2TA 2BY0A 4F3HA 4H83A 3MUZ1 5FACA 1XLFA 2OELA 4DUXA 1HX0A 2FHFA 3UQBA 1KFEA 1XS2A 2W79A 5HW7A 2CITA 1QHZA 3PB0A 1LL6A 1P6CA 4L6OA 4HHPA 4EKJA 3EOSA 1SO3A 4YTSA 2BFGA 5D30A 4NAEA 4O1DA 3GBEA 1D8WA 3EPNA 1BQGA 1KBKA 3HTWA 4IMCA 1JCJA 3VIIA 3M43A 2E9MA 2YA1A 4RDZA 4ZA0A 5EYWA 1TCOC 1UPPA 4IJCA 3WFZA 1RVKA 1OF8A 4U2YA 3CQ0A 3NA8A 3G0UA 4EF9A 2EXOA 3IVTA 3B8DA 4JQ1A 3NXFA 2VZOA 2Y8KA 3RITA 2VP8A 1NARA 4JTIA 3HGRA 3QZAA 3KAFA 5LHFA 3FGCA 3M41A 1FH8A 1JPMA 1SR0A 3AMKA 2Q02A 3W9ZA 2O55A 3BH4A 1LBFA 3CQJA 1L6FA 1JDEA 2VFDA 2WMKA 3UZYA 3D5HA 4S3JA 4C5ZA 2PPNA 3P5ZA 4DXVA 4RJEA 2F6UA 3SGZA 1F3XA 3NPVA 3M1ZA 1FFRA 4MUZA 1KWKA 1BXCA 2QLYA 4O52A 2PDHA 1LQAA 1XDMA 3Q58A 1W54A 1YIXA 5D38A 4ERIA 1IGWA 3DC0A 3KXQA 4CGTA 2LPVA 1M53A 2B31A 3QH2A 1FDZA 4AB4A 1EDGA 4UTLA 1PB0A 2W5FA 4J2MA 3MMTA 3WUBA 1ZUAX 2X0YA 2BY2A 4IMAA 3T08A 4L1WA 3K2GA 3PFRA 3TEVA 3PWIA 3QHNA 2PE4A 1X6NA 1V7YA 4IT1A 2NWRA 4G9PA 4TX8A 4QAIA 1CGTA 2XGBA 1VFTA 4DWSC 2POTA 3N9RA 4UNKA 4UB9A 4DJDC 3THCA 1JIBA 2YJQA 4M56A 1TWSA 3G8RA 1S5VA 4X2PA 4NXKA 4FALA 4FP1A 3NWRA 1TELA 4REQB 4REQA 4P2VA 1DKWA 4DY1A 5I06A 1G69A 3VAVA 5D75A 3P7YA 2DSUA 5F7UA 2XZ7A 1Q65A 5A6TC 2HISA 3ITVA 2G3JA 3QV6A 3VFCA 1DXIA 4QIUA 2BXVA 3S1UA 1XBYA 4ZPWR 1LLWA 5HXMA 4JHMA 3PR2A 4Z1BA 1F6YA 4BHYA 2D20A 2CPUA 1FWNA 4Z1AA 2PDWA 3PK7A 1TZZA 2O7SA 2GVEA 1ONEA 4KCVA 4KIEA 1YMYA 3W7HA 2DIEA 4DUVA 2B4GA 4Z2IA 1V6TA 2XDFA 3B0YA 5DCBA 1CPUA 3E6EA 5D4YA 3GLCA 4O1FA 3B03A 4R7JA 4R9OA 2OLHA 1POKA 4BF5A 3UP8A 3WX7A 1OFAA 2QW5A 3U0HA 3HA1A 2Z7GA 2FJUB 3PJTA 3AS0A 4NL1A 2V2CA 2BG5A 2Y89A 3VVGA 2GGEA 4MNMA 2J27A 2XIBA 1ZK6A 1KB3A 3VDHA 1JCHB 4JFMA 2VXNA 4BEUA 3WFLA 1ZTVA 4B90A 1EEXA 3I4EA 4GZEA 4PCPA 4HTBA 3SRFA 3HPSA 4TNSA 1OC6A 3ARYA 3R43A 1PE1A 4GH1A 3IPWA 1IGSA 3H7RA 4ENLA 3CHFA 3QYQA 3GW0A 3MCNA 1HGWA 2YL8A 1A5CA 3CGNA 2PWEA 5DELA 1QXLA 4R88A 1OIFA 2B81A 4D8AA 1XC6A 1ITXA 4DYEA 6TIMA 4IH3A 3H8AA 4QJ3B 3VGFA 4PUMA 2XJ7A 1KR0A 2XGZA 4FLRA 3S1XA 1EZ2A 3BO9A 1E6PA 3U2EA 1FWGC 1P5QA 4IOTA 1C90A 4QJ5B 1MDLA 4RDWA 2V5DA 1ZCCA 4HJWA 2GLKA 2ZFAA 1OT2A 4JEJA 3MJMA 1OG0A 5CC7A 4GI9A 4HPHA 4CEUC 2PWGA 5CZ0A 2PEVA 5B7ZA 4I5RA 3WD4A 3TROA 1TUFA 5BNKA 3E02A 4V33A 4E3VA 3NQ7A 4IT4A 5E9XA 1JD9A 2YLLA 3L4TA 3KE0A 2YFOA 2L2SA 2J8TA 2VDHA 2NV9A 1BLIA 4LVFA 4XG1A 2CETA 1QVBA 2IQDA 1ODZA 3PSWA 1JZ7A 4CQBA 2D23A 4GABA 2VEGA 1NP0A 3UZZA 2DU2A 2E9BA 2QZRA 3UG4A 4K2SA 4E2BA 5A8MA 2HS8A 4HGXA 1LWIA 4KFPA 4P8UA 4O18A 1XFBA 2VQTA 2ZXBA 4B2DD 3TU9A 4LC6A 3MKVA 1TMLA 4WR3A 3G18A 1DWJM 1MEHA 4E4PA 1J2WA 4FS9A 4N7QA 4AAJA 1Q45A 4RZ4A 4AH7A 5D2XA 4HK7A 2Q6ZA 2CLPA 3QZ6A 5D37A 2PTZA 1T8QA 4LY8A 1FP9A 3Q4DA 1NFPA 4QG8A 5AHLA 4PTWA 1XIGA 1AH4A 2PZNA 4AZ7A 2H6RA 1MW3A 2CWNA 1FKSA 4UTIA 4GIYA 3CUFA 4N9CA 3TSDA 3EA2A 2GSEA 3BICA 4Q8MA 3TAOA 3BAKA 2VUYA 3NSMA 3S8HA 1SO6A 2J13A 1S1PA 3PP7A 3NM3A 2J7BA 4JL2A 4L3NA 2HTMA 2NLIA 5SWUA 3OYXA 2DZPA 1OYAA 1RK5A 4MDOA 3CZGA 3OOBA 3NQEA 3BQ5A 1PIGA 5ABHA 5C7VA 1FWEC 2FGBA 4I5UA 4WJ8A 2HVOA 3DKLA 4NX5A 3ICJA 4G6CA 3VC6A 3GVQA 3OHMB 4O4VA 2VTFA 1KM3A 2WNZA 3THQA 4W9OA 3HGSA 4DWDA 3CAQA 1PV8A 4A21A 1ZHAA 2V5CA 1ZNNA 4IF2A 4FZIA 3MWAA 4JS3A 2D2HA 3PBVA 4PMNA 3W2KA 5KETA 1JG9A 1TPWA 1VGAA 2ASHA 2ZDRA 4JQAA 2ZBTA 4QQUA 2QS8A 4XZNX 5IHRA 5BZAA 2HDJA 5FF3A 4ZVJA 3O63A 1UR9A 3MI3A 2CLKA 3AXHA 1ZFJA 2WZHA 1OADA 3WJXA 4CNNA 2PDQA 2H3DA 1R7AA 2VGFA 2D73A 5ABFA 4CD4A 1E9YB 3B0XA 1XG3A 5G4HC 1H50A 3H70A 2YFNA 4ODPA 3O5DA 3WL1A 3MUY1 4Y8EA 3J7HA 5M2FX 2WMIA 3BG9A 5REQB 1WXJA 3RPMA 2V5KA 3EBVA 1B31A 4X3ZA 3ODKA 3EPMA 3GC2A 1YX1A 2VMFA 1LOQA 1OC7A 1MUMA 5HATA 2PP1A 1R3SA 4X0NA 3GFYA 1W1A1 3LHTA 3ISIX 3VGBA 1I2OA 4LUYA 1UMYA 5F2LA 3H7UA 3N1AA 4W8LA 4M81A 4C91A 2X1UA 5H1WA 1BWVA 5BCAA 1M7XA 4XV0A 3LGDA 3S2NA 5TD4A 3KL0A 1MW2A 4W88A 1K1DA 4XWUA 2E4TA 3HBLA 1VH7A 3B05A 2P8CA 3R94A 3JUGA 3SCUA 4M6PA 5D32A 4C6KA 5HBFA 4DYKA 4WX2A 2AMXA 4G7EB 4XSLA 2A1YA 2P3EA 3WQVA 2FB3A 1K7EA 4H6KA 3EKLA 2WBKA 4XKYB 3O5MA 3KAOA 5A5WA 3SCWA 2G50A 3V1PA 4NYUA 1IEWA 3QFWA 3WJZA 1B0IA 1G94A 4GACA 5FEPA 4L65A 2XIOA 4CQ8A 1QMLA 5MKGA 4QHRA 3WH9A 1VFUA 1VBHA 4DBWA 3TCZA 4QX4A 1TWDA 3A21A 5XIAA 1DIEA 1TIWA 4DI9A 1HF6A 3WELA 4ZQCA 4JIIX 4JFLA 3CMGA 5HOSA 5M5DA 3EA1A 4IGSA 3W7DA 3MVTA 5DIUA 1XGEA 3VOCA 2F61A 1IF2A 4C6PA 5IXEA 2VL4A 3CYJA 3GDTA 4WOZA 5H91A 3ZJKA 2KO7A 4PCSA 3NURA 3IJ8A 3OHIA 2WSQA 2SFPA 2J7GA 4R9XA 4CD7A