3FY1A

The acidic mammalian chitinase catalytic domain in complex with methylallosamidin
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
377
structure length
377
Chain Sequence
YQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNVKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acidic mammalian chitinase
publication title Triad of polar residues implicated in pH specificity of acidic mammalian chitinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 136
structure length 377
sequence length 377
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3fy1A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3fy1A01
1J0ZA 2EEXA 1B30A 3VX1A 1US3A 2CYGA 3WUFA 2XVKA 1WZKA 3N13A 5CQ1A 4AZCB 1BYCA 3PTQA 1AVAA 4ATWA 3N1AA 1US2A 3GH4A 2XVGA 1EHAA 3K4DA 1GORA 1R7OA 3AXHA 3I3EA 1VJSA 2QMJA 3CBWA 1M04A 2ZWZA 2W67A 3M46A 5GNXA 1J0JA 1J11A 1UWTA 4MB4A 2HISA 4OIFA 1AMYA 1CXEA 3M6DA 4IISA 1BYDA 1QNOA 1W91A 1LL6A 5D9PA 3WL0A 3W38A 1HJQA 4HMEA 2VVNA 3S6TA 4HA3A 1FP9A 4UZSA 4KGLA 3ZJ7A 2ZX9A 3A6OA 3FY1A 2VTFA 1W3JA 1UG6A 3VDAA 4B9YA 1VFFA 1JXKA 3OLIA 3MV11 1DP0A 1E6SM 3PZIA 1MW3A 4F79A 4UFKA 4AWEA 1L8NA 4W7VA 1BVNP 1HKKA 2B31A 3UETA 1R8LA 4WKAA 1F4AA 1UA7A 1H11A 1W9DM 2VC9A 5DEZA 4MAZA 5EMYA 1E5JA 1PZ2A 3AZSA 2XYLA 3UG5A 3OLGA 2O9OA 2TAAA 4MJ2A 2Y24A 2A3EA 7TAAA 3WUBA 2WZHA 4J3TA 4UQBA 4AISA 4ATDA 1J0YA 5GQBA 2V5DA 1KR1A 1E70M 2DT2A 1E43A 2Z1KA 2WANA 3QGVA 3BGAA 1B3VA 1FH9A 2YDQA 4X0VA 4XUYA 3WH9A 3NIYA 3AISA 1BYAA 2DT1A 3QOMA 3U7BA 4A3YA 1KXHA 3ARSA 3K8KA 1XHGA 2BVTA 2XSAA 2WLYA 5IHRA 1UKPA 4JCMA 2CNCA 2X8RA 3WDJA 1GOKA 1HL8A 3O2LA 4CGTA 1O6IA 2CKSA 5A8PA 3AIRA 1ZBKA 2CCRA 4P7RA 3DYPA 2DT0A 1C8YA 4MJ4A 3NJ3A 1XD1A 5HXMA 3F5LA 1UWQA 5HPCA 5DT7A 4W5ZA 2EBNA 2CBJA 3GXMA 3PBGA 4HPGA 1KCKA 3TONA 2VX7A 1PX4A 1B1YA 5ABFA 4W8BA 1DWGM 2ZXBA 4OZOA 2BHUA 1AQ0A 5GPRA 2CXGA 1ITXA 1XH1A 2OWXA 3DYMA 4YHEA 4J3UA 4D6IA 5M3WA 2NSXA 4WIWA 4ZEPA 1BPLB 1B2YA 1QI0A 1E4LA 3SUUA 2VCCA 2BHZA 5CPSA 1JF6A 1I1XA 4HMDA 2JIWA 3OG2A 5E0FA 2WPGA 4FMVA 1GQIA 4JFWA 2WHLA 4GI8A 2DSZA 1Q6CA 3AMKA 3AS2A 4U5IA 2JALA 2XIIA 1WDPA 1ISWA 1XSJA 3ARRA 3W0KA 2BXYA 2VR4A 3SCQA 2J78A 3UERA 1V02E 1X1NA 1GJWA 1SFSA 2RGLA 2WW5A 2PC8A 2J8GA 5BXSA 3B9DA 3M7SA 4ACZB 1CTNA 1BAGA 1EA9C 4UTFA 1EOKA 3DC0A 3CHCA 1J9YA 1Q6FA 2VRJA 3J7HA 1QHPA 4MDPA 1WZAA 1NOFA 3PZGA 4EKJA 1ZBCA 2XWDA 1CGVA 2YDSA 1C93A 1MQRA 2BY3A 1V6XA 2J7FA 3FW6A 2ZUTA 1J10A 1GOOA 4PCSA 1CBGA 4CU6A 2JF7A 3SCWA 4CVWA 2VURA 2VVSA 3WQ5A 2F61A 1OM0A 4AYSA 1MXGA 1E72M 5JH8A 4GQRA 4D6DA 4PMDA 1FOBA 1OD8A 3VKKA 3NYDA 4DWSC 4LX4A 4JKKA 3N04A 1JYXA 3AIEA 1BSIA 3ARPA 3EMQA 3BH4A 2XGIA 2F2HA 4J27A 5LA0A 4JHOA 2C8NA 1LQ0A 1LWHA 2PWGA 1EHNA 1E73M 3IK2A 4PMVA 4Z2GA 4AZHA 4MNLA 1CZ1A 4D72A 5CGMA 3WQ6A 2VX4A 2WBGA 1WO2A 2ZUSA 1BGAA 3IJ8A 1UD5A 3WDRA 3TTSA 4B9ZA 1UR2A 1XSIA 3PZUA 5GNZA 2EPMX 2YL8A 4OOUA 4GPNA 2W63A 1OIMA 3L4XA 1JD7A 3VUPA 3LPOA 2GSJA 1CYGA 2EXOA 4GI9A 4AZGA 3IANA 4HOWA 3CZJA 3NSXA 5FL1A 3OLDA 7CGTA 1H0IA 1FFQA 1V6YA 5A6BA 1RH9A 3VILA 4CD6A 2WHKA 2XFFA 4MB5A 1QNSA 2WM0A 2WHJA 4ACYA 4AIOA 4UQEA 1DWHM 2FHFA 1CDGA 4JKMA 4GO9A 2V3FA 2FH6A 4UQDA 2W91A 3WDIA 4V27A 3CHEA 4M29A 2E9LA 5CZKA 4TTUA 1XRVA 4H7VA 2VCBA 3BAIA 1V6WA 4LPCA 3FHAA 3F5JA 5AC4A 1GQLA 2CBUA 3WF1A 3SIMA 3VD4A 3VDHA 3ZSTA 1CXIA 1LWJA 2ZUMA 3W37A 3W26A 3VIMA 3VIJA 4CKQA 2EJ1A 3ZIZA 3OGSA 1Q4NX 5A2AA 3WD3A 1KGUA 1C90A 1R86A 5C8BB 4JHZA 3RJXA 4CD7A 5FL0A 2WBKA 1E0VA 5JIPA 3FNDA 3B9EA 1ISYA 4PTVA 4PYSA 2PI6A 1KB3A 1G5AA 4P7QA 1RP8A 1W9BM 1UKTA 1PPIA 2CESA 4J28A 2XWEA 2WLZA 3AMLA 5A6BD 1QNQA 1B3XA 2E8YA 1V03A 1BHGA 1UD6A 1RPKA 1MQPA 3F4VA 3W53A 3AS1A 2WMFA 3WH8A 3NSNA 1PAMA 3PZOA 1R85A 2FHBA 4D6EA 1JGIA 5CJ5A 2PB1A 4QDMA 3QHOA 2CITA 1BTCA 5KEZA 5AYIA 1WDQA 3FN9A 2W5FA 3FHQA 2O92A 4XX6A 3VGBA 1OSEA 1QW8A 2WZEA 2X0YA 4UNIA 1LL4A 1VFOA 4D6JA 3RM9A 1CGYA 3NUKA 3VIKA 5I6SA 4D1IA 4OBRA 2XM1A 4AC1X 1CLVA 2DSUA 3ZSSA 4W84A 2YLLA 2D0FA 4XV0A 3SUTA 4QCEA 4H2CA 2YL9A 3L4YA 4MB3A 4CCEA 4WKFA 3BSGA 2VX5A 2ZUNA 3OGRA 2GJRA 1UA3A 1AQMA 1XH2A 4AD3A 4D6HA 2DT3A 4DWSB 2WZIA 1D2KA 3CUJA 1FFRA 3PN8A 4PMZA 4PSPA 2BHYA 5D9OA 1M03A 1MYRA 1ZJAA 1V6VA 1VAHA 4PBGA 5A6JA 1UR9A 4PMXA 2J74A 5C70A 1UQYA 3FAXA 3UR8A 1OT1A 3WD4A 1E6RA 2PWDA 2YDRA 4U2ZA 4ZXOA 5BROA 4TVCA 2OLHA 2ZX8A 2DEPA 1HX0A 3EDDA 1VBRA 1OGSA 2D0GA 2W66A 5CGTA 1EIBA 4AZIA 5AY7A 3PZ9A 2G3JA 3VM5A 3E1F1 2XVLA 1JNDA 5F7UA 4K68A 5DF0A 2DSWA 3BMVA 4UOJA 3L2MA 3EDJA 2D1ZA 1W9VA 4FLOA 5E0CA 2W92A 1UR0A 2JF6A 1CPUA 4TX6A 3PZNA 3RJYA 4ZXLA 2WMJA 4BCEA 1BGGA 1H0GA 2VX6A 1GVYA 1KXTA 1QW9A 2J4GA 1ZL1A 1MXDA 1E6ZA 3W82A 3ZT5A 1NWUA 5DFAA 3WUEA 1WDSA 3EDEA 4W8LA 1E71M 3AYSA 1EDTA 1TA3A 3WSUA 4QLJA 3N11A 3WNKA 4AD0A 1OINA 1GOIA 1E6QM 3T09A 5CSUA 1EQPA 4PMUA 4CU7A 1M53A 3MSDA 1UWIA 1G9HA 1HJSA 2X2YA 3WMSA 5A6AA 4UOZA 3ZJKA 2W61A 4BS0A 3CIVA 3RILA 1TFVA 3FAWA 1GVIA 1YQ2A 1JDCA 3WFZA 2YJQA 1VEMA 2QHAA 3PZVA 1EDQA 1H2JA 4F9DA 1PX3A 1V0MA 2X09A 2JEQA 5JBFA 1P6WA 4NZCA 3WMCA 4F9JA 3UEQA 2WWCA 1OCQA 3AICA 3S2CA 1E6NA 1B90A 1J0HA 2WNWA 3II1A 1SMAA 3K8MA 3OA5A 4XZBA 1QI4A 4TVDA 1JF5A 2CBVA 1JNEA 4WSKA 3RIKA 1I75A 2FGZA 3WEMA 3UG3A 1PZ3A 2VZVA 2DQXA 2A3AA 1TUXA 1BG4A 3VPLA 1UKSA 3MV01 4GZEA 4A3HA 1B3ZA 3VMNA 1KGWA 3WQWA 1GW1A 4KMQA 5GNYA 2BY1A 1FHDA 3MS8A 1O7AA 4PUDA 2GDUA 4FK9A 4M82A 4KRTA 3ZT6A 1E3XA 4HOXA 1WDRA 4PN2A 3WENA 3GDBA 3WEZA 4S3KA 4E4PA 3MMWA 2IUZA 3BAJA 3GH5A 2XVNA 4IUGA 1HVQA 1E1FA 3CUFA 1V3LA 4TVUA 2CEQA 5DO8A 2DPEA 4ZENA 4DM2A 1V02A 3PHAA 4E8DA 3PZQA 3CZGA 1LL7A 3CHDA 5M03A 4UR9A 1KCLA 3A3HA 3GZAA 3VD5A 3POCA 3U5YA 4W86A 1QNRA 4UQAA 1E5NA 1VRXA 2FH8A 4UQ9A 4N0RA 2WVSA 3MUZ1 1PIFA 3PZTA 3SCNA 2DGAA 1ZJBA 3GH7A 2WVVA 2VL4A 2Y5EA 1ECEA 2XFYA 2OYLA 5HPOA 4CN4A 4LXFA 4NF7A 4J3WA 1D7FA 1ZU8A 5A1AA 4GZIA 5BWFA 3EYPA 4EAMA 4JFTA 2ZXAA 1CXKA 2NW0A 4BA0A 1NP2A 3EBVA 3HU7A 4KGJA 1GOQA 3WF3A 3POHA 3VD7A 5I0DA 1J0IA 5IFTA 4URIA 5HOSA 2WK2A 3GM8A 4AZ5A 2VZOA 1UKQA 2YA2A 5E70A 1TA3B 2E9BA 1PIGA 2J75A 4UFIA 2YOCA 1HP4A 2D3LA 3MMUA 2D24A 1CIUA 2IXVA 3SUWA 3CHFA 1G0CA 1QHOA 4P7LA 2D0HA 5JBDA 1IZJA 4AW7A 4GZJA 4H04A 1C92A 3FXYA 4AZBA 1DWIM 3NDYA 3W29A 2GK1A 4MDOA 3VIIA 3VD3A 3CTTA 3GNRA 3MMDA 3MSGA 1SR0A 1GOMA 4M56A 1QPKA 1MVYA 4U3CA 2J62A 1UWUA 3DYOA 3BAYA 4UFHA 3AFBA 3AHTA 1CECA 3VIHA 2JE8A 4FLQA 3WFLA 4GO8A 3L4WA 4QFUA 3CPUA 3WDHA 3ALGA 2QPUA 3WDPP 3ARYA 5D8ZA 3VGEA 1WPCA 2YBUA 2A3CA 2WXDM 2WYSA 4YN5A 2GJPA 4KRUA 2WCSA 1CWYA 2ZOXA 2Y8KA 4W7UA 1M7XA 5I77A 5HBFA 1EDGA 1LJYA 1WZLA 5A2BA 1RP9A 2VRQA 1EGZA 3IJ7A 4AEFA 3UG4A 4CD4A 2QV4A 3VIGA 1JZ7A 3O9NA 4HMCA 1E9LA 1UWRA 4F8XA 1FHLA 4PMYA 4X0NA 4U5KA 1ISZA 3EMZA 1BG9A 1NOUA 4R5EA 5A8MA 5A8OA 1M01A 2WMIA 1E1EA 1W9PA 3AQUA 4PTWA 5A8NA 3VX0A 4BQ5A 1F4HA 3CLWA 1U2YA 1RD6A 4MTVA 6TAAA 1HIZA 1C7TA 1XC6A 1GHRA 1OB0A 1GOWA 3VGGA 2ZIDA 2ZXDA 1KGXA 1C3FA 3WQ4A 7A3HA 1JZ5A 5ABGA 1DEDA 1E15A 5ABEA 1V6UA 1VJZA 4W85A 4UFMA 4EANA 2HVMA 4AY1A 3SURA 2VCAA 4AIUA 4MADA 4V28A 5E09A 1EH9A 3N18A 5EFDA 1E4IA 2D23A 1QVBA 4Z2KA 3A4XA 1IT0A 1X6NA 3WF4A 5EB8A 4IPLA 3AROA 1UD8A 2JEPA 2NT1A 4CCCA 2WKLA 1UZ1A 4MAVA 3AMDA 2D2OA 2VR5A 5BXTA 1VEPA 2D22A 5CG0A 1HKMA 1QHZA 3VVGA 5D9MA 1UR1A 2XJ7A 4JZ5A 5E6YA 3HN3A 3L4UA 3BLKA 2UY4A 5KZ6A 2VT0A 4J7RA 1WP6A 3W24A 2QPSA 2VZUA 1R87A 1K9TA 2BVYA 2G3MA 2AOSA 3VU2A 5C71A 2XG9A 5FIPA 8A3HA 3VGHA 5A69A 3ZT7A 1NM9A 1E0WA 4IPNB 2WVUA 1FH8A 1EO5A 3WQ8A 3D3AA 4W89A 5A6MA 2CBIA 1W3LA 4W87A 1ZBVA 5ABFB 1MFVA 4LYPA 2E4TA 1R7AA 3OZOA 4PMRA 3W81A 4HZ8A 3THCA 1CGUA 1IV8A 3WMBA 1ESWA 2J47A 2GDVA 4HTYA 4XB3A 1H41A 3BLPX 1TR1A 3GXFA 4HP5A 3G6LA 4P8XA 3F5KA 1CGWA 2Y8VA 2UWFA 2ZWYA 4W88A 3T2OA 3ARZA 3ZJ8A 1EO7A 2WC4A 2QMKA 2XM2A 3WQVA 2WCAA 3KEHA 2J25A 1QNPA 5I78A 4BZYA 1JIBA 1B3YA 1ZB5A 2VRKA 3BC9A 6CGTA 4P8WA 5HNNA 1CNVA 2W4XA 4B3KA 5HDRA 1W2VA 1HVXA 5E9AA 1JZ4A 3VIPA 2WAGA 4OOZA 4WKHA 1B3WA 3VO0A 1UD4A 4B15A 1A3HA 3OZPA 2PWHA 3WD1A 1WE5A 1CXLA 4GKLA 2OSXA 3ARUA 3APGA 1DWAM 1FA2A 2XGBA 3VM7A 4DM1A 3EMCA 4NSBA 4BF7A 1UQZA 2ZX6A 3AMCA 3IJ9A 3A4AA 4U3AA 2CIPA 1JAEA 2G4FA 2J77A 4HZ7A 1ITCA 1BFNA 4WF7A 1OGBA 4L4OA 3DHPA 5M17A 4MNMA 1CXFA 4DUVA 4YHGA 4BQ4A 4EK7A 2F8QA 4JFUA 1UH3A 4J3VA 2O9TA 2VI0A 3LPGA 1PEZA 4M80A 3G6MA 1SMDA 1H09A 2V5CA 1JI2A 1WNOA 2JIEA 3RO8A 1GJUA 4N42A 5EBAA 1KBKA 2XFRA 3OGVA 3VNZA 2DSKA 2J7GA 1KFWA 1KQZA 2WMIB 5A8QA 4J3XA 3TTOA 1EXPA 3K4AA 4HZ6A 1ISXA 1V3JA 1ODZA 2EPNA 4U31A 4CUCA 2Z1SA 2EPKX 3CUGA 4MNKA 2VO5A 1JI1A 1WKYA 3QR3A 2XVPA 3BCDA 1UOKA 1NOWA 3WKZA 1VFMA 1K9EA 2BXZA 5LA1A 1QOXA 4JAWA 2G41A 3M07A 4H8HA 1HP5A 4ATLA 3SCUA 1UR4A 1V3HA 3CUHA 3RM8A 1W1PA 1BLIA 3OB8A 1TG7A 2XPKA 4QLLA 1DHKA 4F66A 4J3SA 4ML4A 4DUXA 3NSMA 3AZRA 5BCAA 3AYRA 2ZX7A 5CXPA 2CPUA 1WCGA 3VDBA 3W6LA 3I3BA 4E8CA 1JZ8A 2YL6A 4NRSA 3WNPA 4BQ2A 3ECQA 3WELA 4AD1A 1XV8A 2C7FA 5A94A 1GQJA 1HN1A 1CEOA 1HXJA 2X05A 1CXHA 3AIWA 1CLXA 2VQUA 4W8AA 4B16A 2BV9A 1CGTA 4AEEA 2WKGA 2V3DA 5ECUA 3I3DA 4HA1A 4HOZA 4PUEA 3RM4A 1XGZA 1PJ9A 3EDKA 3DHUA 1GCYA 3QHMA 1MW2A 2ZUVA 1JDAA 4D6GA 3VIFA 3VINA 4JCLA 1KQYA 2Q8XA 1JDDA 1Q6EA 2DIEA 4AIEA 2X1IA 5BRQA 2RGMA 4P8UA 1W3HA 2OYKA 1XYZA 1JYVA 3ALFA 2OWCA 3CH9A 5I79A 2MANA 4H8UA 4JKLA 1V0LA 1J01A 3MUIA 1TVNA 4TXEA 5CPQA 3ZJ6A 1G94A 4Q22A 4JL1A 1HJWA 2BY2A 3QOKA 5IXEA 1CGXA 1MW0A 3U7VA 1W1TA 5A6SA 3WIJA 1IZKA 4WLCA 2VJXA 1W1YA 1L0PA 1TE1A 1DWFM 3AIUA 3AXXA 3W27A 2G3IA 1MQQA 1HNYA 4DUWA 2J7CA 4PSRA 1HF6A 2WMKA 4ACZA 3KL5A 4LYQA 1LG1A 1VIWA 2BFGA 2ZICA 1GQKA 4CD8A 8CGTA 4GXPA 1E4MM 2VZTA 3ZQ9A 1W9UA 1DWJM 3RPMA 2PBOA 1VF8A 5I5RA 1VB9A 1VENA 1B31A 1J0KA 1JL8A 2ZX5A 5ABHA 5E6ZA 5DT5A 1E6PA 2J8FA 4PRWA 1G1YA 2GVYA 1MFUA 2CHNA 1WZMA 2FGLA 1BVZA 3WH5A 4PMQA 1KBBA 4Y7EA 1XYFA 4CD5A 4QCFA 3TP4A 3LPPA 3K46A 1ODUA 2UY2A 2EO7A 3W6MA 4C7GA 1JZ2A 4HA4A 3CO4A 3VD9A 2BNJA 4UCFA 1U33A 2WVTA 3BXWA 4HPHA 1NWSA 2J7HA 5BXPA 4L4PA 1W9XA 3UCQA 3CGTA 3VOCA 3K8LA 3T0AA 1OBAA 3SUVA 1HKIA 1EOMA 3SCTA 4JFSA 1E3ZA 2E9MA 3OBAA 3WNMA 3MUAA 3ARVA 3WBEA 2E8ZA 1UHVA 2YA0A 3VMPA 1V0NA 1XCWA 1K9FA 1G01A 3OIHA 2YIHA 3ARWA 4TTGA 2YLAA 4D71A 3BAKA 3CMJA 3WY1A 4U33A 2CETA 3U5UA 5BYWA 3WNLA 4AZ6A 1HL9A 3KE0A 4Z2LA 3W4RA 3AOFA 4EE9A 4GQQA 1W32A 5JUVA 2FDMA 5D4YA 3TTYA 1W1VA 2QLYA 1E56A 2YA1A 3HMCA 9CGTA 1JZ6A 3ZMRA 3CZLA 2O9PA 4H41A 2XHYA 4HU0A 2WSPA 4P8VA 4R27A 1C8QA 1I1WA 5JBEA 4PEEA 2GFTA 2DH2A 3D5HA 2E40A 2WMHA 2CERA 3QHNA 1PX8A 1NARA 1V3MA 4AMCA 2DSVA 2NT0A 3AS0A 1A47A 1GHSA 3T2QA 1KWKA 4GI6A 4WJXA 4TX8A 3AS3A 5A95A 3NCOA 1BQCA 3WNOA 5I3DA 2WSKA 3T2PA 1JXJA 3VIOA 3ZR6A 1UR8A 1LG2A 3ZO9A 3L4ZA 2O9RA 3AJ7A 1OD0A 1OWQA 4WSJA 5A6LA 4NI3A 2GJXA 4LYRA 2ZXQA 3GNPA 2V3EA 1Q6GA 2VQTA 4Q7NA 3T08A 1V3KA 4XZWA 1JAKA 2DDXA 1V0KA 3WH7A 3EDFA 2DH3A 5FKYA 2VOTA 1VFUA 2YL5A 3ZM8A 3B9AA 2E0PA 5DMYA 1V08A 4C7DA 4OKDA 3IAQA 3GXIA 4RL3A 4UFLA 2W62A 2QF8A 2Y4SA 2WC7A 3K1DA 3GTNA 1JD9A 2CKRA 3HJEA 4X9YA 2V38A 2Y2WA 3CMGA 1UUQA 2G8ZA 4C7FA 1NP0A 3IAPA 5AYBA 1K6AA 3AHZA 1ZBWA 1KXVA 3L4TA 4ZFMA 1HJVA 4Z2IA 1C7SA 2WC3A 1WAWA 4RE4A 2X0HA 3AZTA 1UH4A 1EQCA 4DWSA 5IFPA 3LMYA 3GBEA 3N9KA 1GZJA 1GONA 4LGXA 3SCPA 2EPOA 1H4PA 3WL1A 2G3NA 3UR7A 3ARTA 1TZ7A 2GUYA 5A2CA 4S3JA 2WWDA 3MU7A 3UESA 1KWGA 1HJXA 1NWTA 2JFEX 4GIAA 4B3LA 4OBSA 2UY3A 3VMOA 5D8WA 1E6XM 1VBUA 5FOOA 5CLWA 1WB0A 4ZE5A 3AIVA 4TUFA 3L4VA 3WUGA 4A4AA 1QI2A 4WK9A 3ZR5A 1C91A 3TTQA 3CZ8A 3AIQA 5TD4A 3SCRA 3WH6A 1Y7VA 3SCVA 2D3NA 2WVVB 1Z32X 3OLEA 2EQDA 4CCDA 3KZSA 1X6LA 4PTXA 1UD3A 3WN6A 5CPTA 1H49A 2BVDA 3CZKA 4AD4A 3KL3A 2ESCA 1GUVA 1GNXA 1QBBA 5D9NA 4D6FA 4DWSD 5I24A 5JIWA 4AD2A 2C0HA 4BQ3A 4Z2JA 1S46A 4QLKA 6A3HA 2PWEA 3PZMA 5A6KA 4IM4A 1BYBA 3PTKA 1UYQA 2WB5A 4M81A 1E4NA 2J79A 1JYWA 2OSYA 2YKKA 3B8SA 3N12A 4PMNA 4W7WA 1OGGA 2J7BA 3ARQA 1UZ4A 3GXDA 1XH0A 2DIJA 3VTRA 2XSBA 4FF5A 4UOQA 4AZCA 4PTMA 2A3HA 3BSHA 3U57A 2AMGA 2XTKA 5CSYA 3VGDA 4NRRA 2J7EA 2XUCA 2VNCA 1YHTA 3THDA 1KR0A 3BCFA 4V2XA 3SEPA 4M24A 3WD0A 1E40A 4U2YA 2GK1B 1FP8A 4ZE4A 3WBAA 1TVPA 4AXNA 1XSKA 1OIFA 4FLRA 4P7OA 1KXQA 3VDCA 3MUY1 4FLSA 3BAXA 2A3BA 4W5UA 2GJXB 5IDIA 5LYRA 3MKKA 3O6AA 3W25A 2FHCA 1HT6A 3RMEA 3L2LA 4PCTA 1NH6A 1JG9A 2XIBA 4M1RA 1W3KA 2WMGA 1N82A 5EFFA 4E2OA 2CHOA 3W28A 1MW1A 1OT2A 1J18A 2WHMA 1BF2A 4KH2A 1U30A 3MANA 2ZUUA 4P7NA 2VUYA 4H8VA 1JFHA 3GBDA 1UH2A 5CLTA 1V3IA 4UFJA 1FH7A 5I2UA 1GPFA 1B9ZA 3WD2A 1B0IA 2PBGA 4MB1A 3AHYA 4HU8A 4MPKA 1UWSA 3T0DA 1HJUA 3N17A 2ZE0A 3VNYA 1PBGA 2UY5A 1JFXA 2BY0A 2VMFA 4PMOA 3JUGA 1K9DA 1TCMA 3AHXA 1LF1A 3SUSA 4CVUA 3GNOA 4RE2A 1H5VA 1MWOA 2OSWA 1LLOA 4AD5A 3SCSA 2EPLX 2V3GA 1E55A 1TMQA 3AIBA 4CU8A 1D3CA 3BMWA 3RCNA 3SCOA 5FD0A 3AI0A 1QI5A 4LQ1A 3VGFA 4JFVA 1UKOA 5AC5A 1Q6DA 1NWRA 3AHVA 4JL2A 3NDZA 3AXIA 1XD0A 2OYMA 2D20A 4YPJA 1UD2A 1E0XA 1DTUA 5I23A 4MNJA 1VEOA 4OJYA 2PWFA 4GINA 1ISVA 1QI3A 3WF2A 5M5DA 2E3ZA 4UZUA 4Z2HA 3KL0A 5A3HA 3LPFA 3WDQA 2AAAA 3CUIA 4CN1A 2OWWA 1JZ3A 3A4WA 1J12A 3WF0A 3WEOA 3GYCA 4KWUA 3CZEA 4W93A 3DECA 3BAWA 5FCZA 4QP0A 1SYTA 4RE3A 3A47A 1JYNA 2VZSA 4AZ7A 3AMGA 4TOQA 2WCGA 3ARXA 3KWXA 1HKJA 1H3GA 5BRPA 3PTMA 3RDKA 3TOPA 3TA9A 5LA2A 4D1JA 5IHSA 1C8XA 2ZUWA 3MO4A 1NQ6A 4OUEA 2J7DA 1XCXA 3N15A 3T0BA 1QBAA 2BS9A 5BXRA 3WNNA 4JIEA 4CN6A 1CENA 1AQHA 2PF0A 2IXUA 4M8UA 1W2PA 4UQCA 3ZOAA 2YBTA 1H1NA 4QAWA 4D6CA 1ZS2A
chains in the Genus database with same CATH superfamily
2EEXA 3EX4A 3VX1A 1US3A 2XVKA 3N13A 1XQLA 5G2HA 3W7EA 5HMEA 1ZPTA 2QIIA 4ATWA 4LVDA 3GH4A 3W1PA 1R7OA 2V30A 4B2DA 5TIMA 5C55A 2R1PA 4HNUA 4XTDA 2QJMA 4UBPC 5H8MA 1R2SA 2CWNA 3CBWA 4GNKB 4DBEA 2M08A 5GNXA 5DMLA 2CLHA 3GTYX 4L1GA 3BOXA 1MSSA 3BLEA 4AMAA 4IISA 5REQB 3HG5A 2E28A 5D32A 1QOQA 3DUGA 4MFDA 1W91A 1LL6A 4LT9A 2VVNA 2A4AA 4QT3A 1A0DA 4UZSA 4KGLA 4AX7A 2VTFA 1FCQA 3TQKA 2YR1A 3MV11 1E6SM 1L8NA 2F21A 4YCOA 2YCEA 1EA0A 3CT2A 3GHTA 3I7QA 1R8LA 2PTXA 4WKAA 4PCFA 2C15A 1PCKA 4C5ZA 1A4LA 1OC5A 1EEPA 4LUJA 5JVLA 3G1YA 1W17A 3HPXA 2ZA2A 1FKWA 2YCJA 3ABRA 4J3TA 2G97A 2DVTA 3GHSA 4RZBA 4XBJA 3QF0A 1E43A 3QGVA 4ZGYA 1U1UA 1TV4A 3NIYA 3L7RA 1EJRC 1KBIA 1A0EA 4YNGA 3N2XA 1RK6A 3RAOA 1OEPA 2GWNA 4A3YA 4IFKA 4UTTA 4M1BA 2QEZA 4DHGA 5AC6A 1UKPA 1VS1A 4JCMA 2CNCA 3GDLA 2QJIA 3O2LA 2CKSA 5LIUX 1Q6HA 1VBHA 4DBWA 1Y5VA 3TDBA 2CCRA 4P7RA 3DYPA 1C8YA 2QNEA 3F5LA 1VYPX 4R3UA 2P10A 1P48A 1UWQA 1NFBA 2OVLA 5HPCA 4W5ZA 2PDKA 4QTGA 3PBGA 4L1XA 3EEZA 1PIIA 1UBPC 1XIGA 3GWQA 2XIJA 1EXBA 2CXGA 1IHIA 2GPTA 3L21A 2QCNA 2C14A 4YHEA 3QBUA 4J3UA 5M3WA 1M9HA 1BPLB 1B2YA 5CPSA 3FV9A 3DKLA 3JRKA 2JIWA 3KADA 3G18A 3LCXA 4WXZA 2WNNA 4GI8A 1G7UA 1Q6CA 4S23A 2WQDA 1ISWA 3W0KA 1FWTA 1P5BA 1TWIA 2J78A 1V02E 4OVXA 2RGLA 1J8VA 3PB2A 2PDMA 3N2TA 2ITKA 2J8GA 1WQ5A 3LN3A 3UJFA 3F7JA 4O1DA 2DU2A 3B9DA 2VELA 3M7SA 5B7ZA 2A7NA 5DMNA 5HW8A 2NUXA 1DE5A 1EWDA 3HJZA 1Q6FA 3CQ0A 3J7HA 1QHPA 8XIAA 1DJIA 1EX1A 4WY0F 4EKJA 1ZBCA 4QSFA 4FXFA 1MNSA 1OVDA 3FW6A 5G4WA 4J3ZA 3UYCA 3TN3A 3M0MA 1OCNA 2XU2A 3SCWA 2VURA 4FNRA 3TJ4A 4IIHA 4GJIA 1OM0A 5DCEA 1MXGA 5HW6A 1TPFA 3D47A 4HPNA 2J9YA 4QROA 1PO9A 2GUUA 3AIEA 3QYQA 3VE9A 1VFLA 4LVFA 1BSIA 3ARPA 3FVMA 2F2HA 2W27A 4UMAA 4J27A 1YPFA 5LA0A 3CWOX 1LQ0A 3R89A 1LWHA 3IK2A 1EHNA 4FP1A 4L7ZA 4PMVA 3JYJA 4LS0A 4MNLA 4D72A 2AMXA 3BJSA 4H19A 4RPPA 1WO2A 1GTHA 4V1XA 2FVMA 4OV9A 1UR2A 3EA2A 4U28A 3T44A 1H1ZA 6REQA 3VUPA 1U22A 2GSJA 1QU4A 1PS9A 3D0CA 2QCFA 5CG7A 4AZGA 5FI8A 4O11A 5FF3A 3M44A 3JZEA 1O5KA 4WQ6A 3DG3A 3EAUA 4KEZA 1V6YA 3EXTA 3M64A 3QR0A 3O63A 1VH7A 2A2IA 4IFKB 3QQ0A 4CD6A 2WM0A 3C3UA 4ACYA 1KT0A 4UQDA 4KRZA 2W91A 4LAYA 1DVJA 3CHEA 2PODA 3DHDA 5CZKA 2GDQA 3C3NA 1XRVA 2HRWA 3W7MA 4DAFA 2Y88A 3KS6A 1MEHA 2IPGA 1SM9A 3TJIA 1FKHA 1PVNA 3VD4A 2OQLA 3VDHA 4TQTA 1SW0A 4FI4A 3W26A 5GJPA 2EJ1A 4IPJA 4B3ZA 4HSHA 4US5A 3WD3A 1G67A 1R86A 5C8BB 5DXYA 4LS2A 4CD7A 1LBFA 1E0VA 3L9CA 3FNDA 1H7PA 4HNTA 3B9EA 2CLKA 5LHEA 1EC7A 3T40A 2ZZ4A 1UKTA 1PPIA 2HMCA 3OVRA 4AIBA 2WLZA 2DG4A 1O5XA 2PLKA 3E2SA 3Q58A 1Q6UA 5A6BD 1AZ1A 3BL3A 3STEA 2E8YA 1WBHA 3A3WA 1RCOB 2X7WA 4XZLX 2WMFA 4MWAD 1PAMA 2DY3A 3OVGA 3BV4A 4G5DA 5EKYA 4D6EA 1EYWA 3JXVA 1OK4A 1JGIA 4GHRA 5CJ5A 3BJFA 3DENA 4QDMA 3HBLA 3MQTA 1BXCA 1EBHA 2PLJA 1FHUA 4PB4A 1JPDX 3MHUA 4NT0A 5KEZA 1WDQA 3FHQA 4JS3A 4ICMA 5B8IC 4E2BA 1UW9A 2O92A 3VGBA 1W1IE 1QW8A 3RFWA 3LXAA 3LLXA 4KQNA 2PPPA 3HFYA 2FTWA 3RCMA 3RM9A 4WZHA 3G5EA 3GIPA 4OBRA 1JCHB 3RPDA 4UTUA 1OYAA 2QUMA 3LG3A 4REQA 1Z8AA 2BXVA 4PRTA 2ISDA 1CLVA 3N19B 3W1RA 2DSUA 2Q3RA 4WDXA 4QCEA 4MMWA 1RJRA 3L4YA 5RUBA 4B5UA 1XP3A 3ITLA 2Y8UA 3PWAA 3VABA 2GJRA 4YTRA 1XH2A 4AD3A 1IR1A 2WZIA 4KS0A 4PMZA 1GGOA 4FX8A 4EXAA 3WJZA 2BHYA 5D9OA 3GKFA 2TRSA 5K3VA 1UR9A 3N2CA 2JKAA 5F1VA 3PPCA 3B7XA 3IIOA 2OZ0A 2ZX8A 3CXOA 3HQOA 1FWEC 2D0GA 1UASA 1O1ZA 2W66A 5F4SA 4AZIA 2V63A 3QMRA 4G1NA 1TREA 3KZPA 1Z7AA 4DJEC 4HNVA 2DSWA 3ITCA 4JFMA 3NQMA 3L2MA 2D1ZA 4C6PA 5E0CA 1XF0A 1DIKA 3IWPA 4LW7A 1CPUA 3Q67A 1BXNA 1FWCC 4ZXLA 2VX6A 4XAFA 2CLEA 2ETNA 3R43A 1QW9A 1RR2A 2EG6A 4FEZA 1WKEA 2ASHA 2IQ0A 4LH8A 3W82A 3RFAA 3E0FA 1NWUA 3WUEA 4LF1A 3LB0A 3LK6A 1LT8A 4KIRA 2PGWA 3R8HA 3VKJA 3DBPA 1EDTA 3REQA 1FWFC 1TX0A 3N11A 4UDMA 4Z0JA 1JVNA 1CCWB 2HE5A 3TN5A 4A29A 3T05A 4FR1A 3C5QA 5CSUA 5D2WA 4XAPA 3IVTA 1OHLA 4GUGA 1M3UA 3WK0A 3BW4A 2OU4A 3KHDA 1A5LC 1G9HA 1QTWA 3ZLGA 2W61A 4BS0A 4MGVA 4YXGA 2F6UA 4DZ3A 3A23A 3VNMA 5ECVA 1H2JA 3B4UA 2X09A 2MLXA 1OFPA 1P6WA 4NIRA 4U86A 2QCMA 2QQ6A 4NZ3A 4K37A 2WNWA 1SMAA 1QI4A 4H9VA 4E3TA 3RIKA 3UWWA 1I75A 3B04A 5G1YA 1WXJA 3UG3A 4LALA 3AJXA 4HK5A 1CW2A 4NP7A 3DI1A 2XN0A 2NV9A 4QG8A 3CJPA 3R1ZA 3BCJA 4FALA 2H3BA 4LAMA 3UA3A 4KMQA 1A5OC 2BY1A 1HL2A 1XRTA 1FHDA 4U4MA 2A6NA 4FK9A 3MI6A 4KRTA 4PN2A 3OVQA 4DRHA 1GVQA 4UTMA 3QSTA 3VNLA 4NXKA 2HWGA 3BAJA 1ZK6A 4LWWA 3GH5A 1TZ9A 1DL3A 4REQB 4MM1A 3KRZA 2DPEA 3NGFA 5BXJA 1AJZA 1WKFA 3NOEA 1V02A 1PZ1A 3MWAA 4QEEA 3CZGA 3SO7A 4QISA 3U2EA 1M5YA 3CHDA 4FAMA 3A3HA 4F3HA 3U5YA 1EWEA 2HJPA 4W86A 2C91A 3EKLA 2FH8A 4UQ9A 4F2UA 3IRDA 5KINA 4RNFA 1J5TA 4HPJA 3PSVA 4GISA 4NZ5A 5K7JA 5IM51 2E6FA 4XTIA 5HWCA 1TV7A 4YTUA 3TC7A 3OPSA 2REQA 4UTTC 3SCNA 3GB6A 2HCVA 2PA6A 4JTEA 1TPB1 5CC5A 2Y5EA 2XFYA 2OYLA 5HPOA 4LXFA 4J3WA 4H9ZA 4ERGA 4QITA 3OU8A 3MYOA 3ABXA 4GZIA 4EAMA 2ZXAA 3ZZ1A 1DOSA 2IQDA 3HU7A 4O8RA 1P5QA 4IGSA 3WF3A 1NELA 4AB4A 3QY8A 1MZRA 3SECA 1J5SA 3PAJA 3UFYA 2L2SA 5LNSA 1A5AA 4LS1A 2VZOA 4FHAA 3EKGA 2FPTA 3REQB 4US6A 1V93A 4UFIA 4R0XA 1HP4A 4UR8A 2RJHA 2D24A 2VDIA 3VDGA 1SO4A 1TTIA 4JTDA 1F8MA 1IZJA 4AW7A 3BLIA 4H04A 4DBUA 4LNYA 4O12A 5DLCA 4ASTA 3NDYA 3ZR4A 2GK1A 3VIIA 2VGBA 3QY6A 3VD3A 3DFOA 4ZS6A 1B4EA 3BICA 4G50A 1QPKA 3AHTA 3NXFA 4J35A 2WJFA 4JTLA 1CECA 1Y0EA 3VIHA 3VFLA 3LRLA 4GO8A 2FJKA 3L4WA 3VKCA 1X1OA 4PCPA 4Z1AA 4LAWA 2Z27A 3ANYA 7REQB 2GOKA 1LTDA 3VGEA 3GU1A 1U5HA 3MDYB 4K7VA 2WCSA 3S9IA 4LANA 1O5QA 2Y8KA 3TDFA 4XZMX 5KITA 2GGHA 2DG3A 3MC5A 2E67A 3TR2A 1LJYA 3QPZA 1Y5XA 1HXVA 2NQ9A 4M6QA 2VRQA 5CAKA 1EGZA 4AEFA 1FKLA 4NYUA 3LGEA 4XD4A 1A0CA 4O15A 3CMFA 1YW1A 3O9NA 1XFCA 4F8XA 1FHLA 3EMZA 1BG9A 1GEQA 2I16A 3FDKA 4TU1A 4R5EA 3MZNA 5A8OA 1TJ0A 3S9ZA 1XIMA 3AQUA 3MJYA 3T8QA 5A8NA 2LKNA 3QGAC 3L66A 3PFMA 3GU0A 3UZWA 3BGJA 3S42A 4ZQCA 3BW2A 4MTVA 5D04C 3VZXA 1C7TA 4C6EA 4MSSA 3TH6A 1BF6A 1QW7A 4FOUA 3A5VA 2X1RA 1US0A 1M41A 1RCXB 3WQ4A 2GOUA 4NNCA 1VD6A 5ABEA 1V6UA 5C2XA 1IE7C 3SURA 2VCAA 1G69A 3LV5A 3KP0A 4MZ1A 4JX5A 1I9CB 5A8GA 2NWSA 1R9YA 1XG3A 4RX0A 2REQB 2JEPA 2NT1A 2WKLA 2VR5A 5BXTA 1Q6QA 3EOEA 3TROA 3UU0A 3M0YA 2UBPC 4QEHA 1BWKA 1AH3A 1TUFA 3PUGA 1KM2A 5E6YA 3L4UA 3NQBA 3BLKA 4AU0A 1WP6A 1DQUA 2VZUA 4EPEC 3UCDA 2ZQVA 3W73A 3NQFA 5BOEA 4IPNB 1FH8A 3E0VA 3JS3A 3D3AA 3MSRA 5ABFB 4S3BA 3ZLFA 4HZ8A 3THCA 3GIYA 2QUVA 3FYYA 1K7EA 1ENUA 3NPUA 1X8CA 1POKA 1OFOA 3BLPX 4IL2A 3GXFA 2VGGA 1D7IA 4JY9A 4EVZA 2G5WA 4Q8MA 4DNHA 4GFIA 4C6DA 1JPKA 4JIHA 5CJMA 2OCZA 3GXTA 4X22A 1S5MA 1DBTA 1NVMA 7XIMA 1H7NA 3F4DA 3MI3A 2J25A 2O56A 3S47A 4BZYA 5TF0A 1B3YA 4RJEA 3BC9A 2XFWA 1TV5A 4IMAA 3GX9A 3WQCA 2W4XA 3HGOA 3S1VA 4B3KA 4RNJA 4OOZA 4LY8A 4WKHA 3VO0A 1FWGC 5H8PA 4MLJA 1D7KA 3U9IA 3ZWTA 3OZPA 4O57A 3MVTA 3GVRA 1CXLA 2OSXA 3C52A 4KCVA 4DM1A 2GJLA 5LIXX 1B6CA 3E6EA 1W1ZA 1TMLA 1N55A 3AMCA 2Z1XA 1BVWA 1Q3NA 3KXQA 3A4AA 1O60A 1S5WA 3NA8A 3LOTA 3ZXWA 1KW1A 1ITCA 1BFNA 3P6LA 4DRKA 3DHPA 4MNMA 4DUVA 4BQ4A 1AH4A 2F8QA 4JFUA 3STPA 1F3XA 4J3VA 2O9TA 5J5DA 4KFNA 4M80A 3TNBA 1H09A 2V5CA 1MO0A 4JX4A 5EBAA 3VNKA 1KBKA 4XD6A 5D37A 3VNZA 2DSKA 3W83A 3S1XA 3TTOA 2HXTA 4WD0A 4ZL1A 2EPNA 1FHVA 4N9EA 1SZRA 1L6YA 2QUTA 2P53A 2Z1SA 2V8ZA 3VCNA 2SFPA 3UWQA 2VO5A 1ZCCA 3PG8A 1WKYA 2XVPA 1J96A 4NVTA 3WKZA 2OJPA 1VFMA 3R4IA 1K70A 3FKRA 1JPMA 1PINA 3P8IA 4JQ1A 3O5QA 4AF0A 5FACA 1YDOA 4Z1CA 1BLIA 2H8XA 1RBOB 1TG7A 2YBVA 4F66A 4DUXA 1TQJA 4POCA 3HPAA 3C86A 1B5TA 3M41A 3VOJA 2TODA 1JZ8A 1O94A 2YL6A 3A24A 4BQ2A 3G0UA 1PKYA 1ZAIA 4G6CA 1DPMA 1E9ZB 2X05A 4Y2WA 4W8AA 3O5LA 1VPYA 2PDFA 4UTLA 1BXBA 4Q8UA 3MKCA 3OHIA 5EMKA 4HOZA 3S5YA 1PJ9A 3EDKA 4S3DA 3QHMA 1JDAA 4YVVA 3VINA 2QVHA 4JCLA 5XINA 1JDDA 2J6VA 4NG3A 2ZVIA 1Q6EA 5HJLA 3USZA 1O95A 2G0WA 3NO5A 1A5BA 3C2OA 1JYVA 1DXEA 1KBLA 5FA5A 2MANA 4GYFA 4Z17A 4RXFA 3MUIA 4FNQA 2OGYA 2CLFA 3ZJ6A 2DZPA 3UI5A 4ODMA 3W1AA 1PWLA 3ONCA 3NWRA 5IXEA 2HBXA 1CGXA 4WDUA 3NL6A 3WIJA 1BL4A 1PTAA 3BG5A 1DWFM 1ZZMA 2PTYA 2GYIA 1H1YA 2G3IA 2CFFA 4ADTA 4EWJA 1VIWA 4LBSA 1RY8A 3UPMA 3H2NA 3N73A 5G1TA 4CD8A 4GXPA 4N4QA 2VZTA 3S2MA 1DWJM 2PBOA 4C6QA 1UUMA 1KTCA 1B31A 1JL8A 3V16A 4G1KA 1KC7A 2J8FA 5AKQA 1G1YA 3NQEA 3GVWA 5FJUA 3IJQA 3B0VC 1WZMA 1BVZA 5AFDA 1XYFA 1GVEA 1F76A 3K46A 1G4PA 1JZ2A 3CO4A 1U33A 2WVTA 4HPHA 2HROA 4JEQA 2GQ8A 5CC6A 3CGTA 3VOCA 4BK9A 3K8LA 3UI4A 3T0AA 2PV3A 1FKIA 3UWZA 1BEUA 4A22A 1PWMA 3L23A 1QWKA 4GCXA 1AMKA 4JFSA 3LUOA 1UZDA 1PXGA 4YYCA 1F6YA 2BGNE 2E8ZA 3TMLA 1M7PA 1EX5A 5TBOA 2KR7A 4HKPA 3ARWA 2XH2A 4ML9A 2EGZA 1FTXA 2OKTA 2RQSA 3BAKA 4YIWA 1AD1A 3UVIA 5LNVA 2R82A 3W88A 2J27A 2X41A 2YXGA 1ZAJA 3V4BA 3W7OA 4EXBA 4EE9A 4GQQA 4C6BA 3SW6A 4H6RA 1TPEA 4A8LA 4EPDC 1YATA 3CYJA 3Q37A 1YNQA 1W1VA 4GKTA 9CGTA 2YA1A 3HMCA 3CZLA 2O9PA 1FAPA 1R3QA 1D3GA 4PR4A 2Q09A 4ZZ9A 4R27A 1C8QA 5JBEA 2ZR6A 1XIIA 2WMHA 4Q8OA 1PX8A 3PF3A 1F3TA 4HN8A 1GHSA 3T2QA 1S2WA 4RDWA 4WJXA 4TX8A 2KGJA 1Q63A 3D46A 1F74A 5I3DA 2WSKA 4L65A 4NU7A 1ZGDA 4UXDA 3LHVA 1HG3A 3VIOA 3O5DA 2Q5AA 1YBQA 4U84A 1OWQA 3GUWA 5A6LA 1EC9A 4L61A 3NZPA 4NI3A 3B0YA 3CM4A 4YU1A 2VQTA 4Q7NA 3ATZA 3W86A 4NNRA 3L65A 4X2PA 3WJSA 5HUOA 2MUCA 3O5JA 1SR9A 4IH3A 2DDXA 1KM5A 1V0KA 1OZMA 2PC4A 4XBSA 4QGCA 4Y8EA 3WZ0E 4LV9A 3I7SA 3PB0A 1VFUA 3B9AA 5XIMA 1FWNA 1P43A 1W8SA 1V08A 2DJLA 3ORWA 4C7DA 3KOWA 3IAQA 1JNSA 3VKBA 4IGHA 3TUUA 2DVUA 2Y4SA 3K1DA 1DJNA 4HYVA 2VFHA 5EYWA 3W07A 3CMGA 2G8ZA 4C7FA 2OMAA 4WR3A 3P61A 1P0NA 2EULA 3AHZA 1ZBWA 3SIZA 4ZFMA 1EP1A 2WC3A 3LI0A 5I00A 3Q45A 3AU6A 5H91A 1UH4A 4X60A 2PDUA 4FX6M 4RK8A 3V0UA 3LMYA 4GVFA 3T78A 4LGXA 2VHLA 1YRRA 3UQAA 1R3YA 1MZHA 3WL1A 4LC6A 1PKNA 4FOKA 3DGBA 2P5NA 1LRQA 2WWDA 1FXPA 2JFEX 3I10A 4GIAA 4UTJA 4ZPWR 2J13A 3VMOA 1XINA 4DZAA 1WB0A 1IZCA 5FEXA 1KKOA 1ZQ5A 3ZS4A 4LUTA 2HBVA 3NZRA 4PUUA 2X1TA 3CZ8A 3AIQA 4LC8A 2IS7A 4S3EA 5J04A 2LPVA 1TWSA 3WH6A 1Y7VA 4NY2A 4TO8A 3A9IA 3SCVA 3OBEA 1MUCA 1YW5A 1TCOC 4FSAA 3KZSA 4RPQA 4A8IA 1EZ2A 3T07A 4LCRA 3QY7A 5L9FA 4NAEB 1OF8A 3CZKA 3KL3A 1EYMA 4HIBA 4D6FA 4DWSD 5JIWA 1ZRQA 4HBOA 2E25A 3WLIA 2C0HA 3TLQA 2GQAA 1KFLA 4DQWA 4DI8A 1EJVC 4GABA 3O07A 4QG6A 1BYBA 2PPNA 3WX7A 1UYQA 4M81A 3W9ZA 1EQ3A 1X8FA 4PE8A 4GK8A 4L72B 2YKKA 3N12A 4HARA 1JCTA 2PEVA 2QGYA 1UZ4A 3GXDA 1LZOA 3DBNA 3VTRA 1ZFJA 3GG7A 5AC7A 5LGXA 4UOQA 1A80A 2DZAA 2EG8A 2R14A 5CSYA 2O0TA 1GJPA 2J7EA 3SRHA 2HS8A 2A3LA 3KVLA 7ENLA 3FXGA 4XD5A 4U2YA 2B4GA 1FP8A 2R1KA 4DXXA 3WQGA 1KO0A 1FWDC 1FCUA 1OIFA 4FLRA 1YBQB 4DIAA 4J2PA 3OA3A 2LGOA 3BAXA 3G0SA 5FEPA 4W5UA 3GTXA 4L5ZA 3MBDA 5LYRA 4L6HA 3MKKA 4GIRA 4P5UA 2FHCA 3L2LA 4LVBA 1JG9A 1Z89A 1HKVA 3M43A 4M1RA 1W3KA 2WMGA 5EFFA 1X6UA 1WXZA 1S2UA 4P7NA 2VUYA 1UC4A 3H7UA 1TTQA 1R30A 1FH7A 4KCWA 2ZKMX 5I2UA 3GR8A 3KCEA 3N17A 3KZ7A 4WXYA 4G8TA 2UY5A 4B91A 1JFXA 1XPGA 1DJZA 4PMOA 2R6OA 1K9DA 4S3GA 3I68A 5I3HA 2HPIA 2POTA 2Z2UA 3SUSA 4JFJA 1JUKA 3DFSA 2WJZA 4RE2A 1H5VA 2PGRA 1MMFA 2XIMA 1OX5A 1M5WA 3SCSA 2V3GA 1DYSA 4M51A 3AIBA 1D3CA 1KFKA 3RCNA 4V15A 5ENLA 4O13A 3NAVA 1NWRA 3AHVA 4JL2A 4MKNA 4A2SA 3GVQA 3GS6A 2D20A 1R2TA 2PSNA 3NURA 2PWFA 3WF2A 1DJHA 3STGA 3HFTA 3LHUA 4UZUA 2E6YA 3KL0A 4GVGA 1AW2A 3LPFA 4OECA 3TOYA 3K13A 5CEWA 1J12A 1A53A 1CT5A 4LB3A 1JDFA 2X1SA 5DN1A 4LRSA 4QP0A 4AHPA 2VZSA 4TOQA 1IWPA 3ARXA 3LTPA 1H3GA 3PTMA 4JTCA 3TN6A 3VCCA 3OO2A 3KWSA 1BSLA 3ITGA 5LA2A 4D1JA 2CLIA 4ICCX 4OUEA 4PZVA 2VDGA 5BXRA 3WLTA 3EWZA 3MW7A 1CENA 3H23A 2POZA 1T5AA 3BLLA 2PF0A 2BZNA 4ADSA 2YW3A 4ES4A 4WEVX 1XIJA 4F0KA 2Q02A 3GR4A 3R2GA 2PFHA 3TW7A 5K9XA 4MZYA 2X40A 1WZKA 4OWGA 3G77A 3S5OA 3PTQA 1TJRA 4QBXA 1JDEA 3SRKA 4L4MA 5JU6A 3O15A 3K4DA 1Q4WA 1GORA 3MY9A 2OPJA 2XZ9A 4FNPA 3AXHA 2Z00A 2ISFA 3CT7A 2G95A 3FEQA 2JGYA 1M04A 2W67A 3M46A 2NQHA 3G3DA 1J11A 5AN7A 1UWTA 4MB4A 2HISA 4OIFA 1AA1B 4I3GA 3DKJA 4B5SA 3M6DA 4AHQA 1BYDA 3GDMA 1QNOA 3U3HA 2MF9A 5D9PA 3W38A 1HJQA 2CZEA 3NQ6A 1BD0A 4XO6A 4XAYA 4XKMA 3NQCA 1SJAA 2EG7A 1W3JA 3ITVA 3VDAA 2PCEA 2BASA 4B9YA 4DELA 4E4UA 3LS9A 3W1QA 3CHVA 1MW3A 3UGRA 1N8FA 2AL1A 1P4CA 1OK6A 3UR2A 4FZIA 3G1FA 1CI1A 4OHQA 3RX4A 4MFEA 3WQFA 4QXIA 5CPOA 1F4AA 1H11A 4MAZA 4AWSA 2A7PA 4EPBC 2C71A 2Y24A 2A3EA 5KMYA 2FKEA 4QZVB 4U85A 3WUBA 3LCWA 1NF0A 2TPSA 1AL8A 4DF1A 2V5DA 2PUZA 1KR1A 3B8VA 5HQLA 3H7RA 5DITA 1SSDA 2XH4A 1FH9A 3CQJA 4J4KA 3I65A 4JN7A 4YVPA 4ZO8A 5HNRA 1BYAA 3U7BA 1HTIA 4H8NA 4IG2A 2XZ7A 1VZWA 1XHGA 4MG4A 2BVTA 2XSAA 4M19A 4C6MA 2WLYA 5IHRA 1GVFA 4UTIA 2X8RA 1HL8A 1R3VA 2ACQA 3NYZA 3UR5A 1ZP4A 3GD6A 1PZ0A 1LDCA 3EEGA 5HUAA 1UB3A 1N8WA 4P61A 4FN2A 1OFEA 4LBUA 2EBNA 2CBJA 3TNOA 3IGHX 2V5KA 5I7GA 2VX7A 1PX4A 1GVOA 1XICA 4LUYA 3CL7A 2VENA 1Q1CA 1QT1A 1QJWA 1DWGM 3W7NA 4EX4A 2BHUA 1G4TA 5EU9A 1YKWA 3EOLA 1ITXA 3EWWA 5FJPA 2OWXA 2DZVA 4RUBA 3RCYA 4D6IA 2NSXA 1QI0A 3SUUA 1PHQA 1KRCC 4ZO6A 3THUA 3TN4A 4FS9A 3OG2A 4IMGA 1XYAA 3DEQA 4PBFA 1GQIA 3TXVA 2WHLA 4HPXA 3V75A 2DSZA 3NPVA 3AS2A 3I6EA 5HWJA 3P5ZA 2VR4A 3LSBA 3O5IA 3U2ZA 4DRQA 3GTHA 1GJWA 2PP0A 2ATSA 2WW5A 3BQ5A 1XLHA 4HNCA 2INEA 1H5YA 1FCVA 4ZQPA 1EOKA 1NDVA 2JZVA 4XAZA 1I2RA 4GVHA 1NOFA 1J4HA 3EXSA 3PZGA 1JVWA 3CPRA 1CGVA 2YDSA 3T4CA 4MZ8A 2J8TA 3K5XA 1MQRA 4YJ5A 4TW7A 2ZUTA 3QV6A 1A5NC 4CU6A 4BEUA 2JF7A 3UZ5A 4CVWA 2QCEA 2FTPA 2F61A 3RRAA 1UIPA 4GQRA 4CQAA 5C9WA 1OD8A 4LX4A 4JKKA 3TYBA 3N04A 1JYXA 2QDHA 4E2DA 3EMQA 3BH4A 1P7TB 2XGIA 4JHOA 3B03A 5FJTA 4B4FA 2YGYA 3U48A 1E73M 2Y85A 1VKFA 5CGMA 1V7YA 3ITTA 3THAA 1XQKA 2VX4A 1EGMA 8TIMA 5CZTA 1BGAA 1OYCA 1GW9A 3TTSA 4JOMA 2D9FA 1RLDA 3PZUA 5GNZA 2FVKA 4HSNA 5CPNA 2DJXA 2YL8A 4HQVA 1OIMA 3L4XA 1JD7A 3EX1A 1JCMP 1YYAA 1A5CA 3LPOA 4ITZA 4DI9A 3PANA 2NV1A 3AXMA 1NY1A 3WK2A 3CIWA 5T26A 4GQBA 2C6QA 5FL1A 1GVSA 7CGTA 4JNMA 3OYXA 2CXEA 3AO0A 3CAQA 3VCRA 1O4UA 3W84A 3E2RA 4DX3A 1UBSA 4MVAA 2P76A 4IG2B 2XFFA 4Y9OA 2GJNA 4LTSA 2WHJA 3L0KA 1DWHM 2FHFA 1G4SA 3KACA 4GO9A 2R94A 2FH6A 3Q2DA 1IT7A 3E0LA 2R1LA 3ONBA 4M29A 3LGDA 2GUBA 4UTKA 4LPCA 3FHAA 2EF9A 3LSCA 4QR6A 3BG9A 3WF1A 3SIMA 1JULA 3EZ4A 4KWSA 3CK5A 2HSAA 3ZSTA 2IKHA 4GBDA 3VIJA 4A8RA 4AEOA 2Z1VA 1XLFA 5A2AA 1C90A 3RJXA 3ZFHA 3EWXA 5FL0A 3N4AA 5JIPA 4NJGA 1P6CA 4LVGA 2DP3A 2ZQ0A 3NM3A 1TVLA 1EB3A 4HHLA 5EBUA 4PYSA 2P3EA 2PI6A 2EJAA 3QPYA 1G5AA 4P7QA 2CESA 4K8GA 1IXOA 3HB9A 3AMLA 3FLUA 3WLOA 1QNQA 1BHGA 1UD6A 1RPKA 3KRUA 2OQYA 3F4VA 1XKYA 5CBBA 1XX1A 2A7RA 3NSNA 1JEZA 3UJEA 4ODLA 3JZUA 4I7UA 4IX0A 5LHFA 4HK6A 3QV7A 3URNA 1VC4A 4O0KA 2QDDA 2OODA 5BOOA 3FN9A 1MXSA 3P8JA 4XX6A 4BI7A 1KTBA 1OSEA 1CX9A 4NJIA 2X0YA 4J40A 4FB7A 3W7GA 4M7SA 4IP7A 4UNIA 3E12A 3QW3A 5I07A 2RDTA 4RZ5A 3VIKA 5I6SA 4D1IA 4F0SA 3YPIA 3W2LA 4BWLA 1KNWA 1QK2A 4Q8NA 3ZSSA 2YLLA 2D0FA 4H2CA 3HF3A 1ROUA 4DVOA 4WKFA 1JUEA 1AQMA 4IQ2A 4D6HA 4DWSB 2V5LA 2NXHA 3LZ3A 4PSPA 1M03A 3NZQA 1VAHA 2I56A 4PBGA 1NU5A 4FO4A 3NO1A 3H8AA 3MPGA 5C70A 3G1VA 1UQYA 3UR8A 1M68A 1HX0A 2DUAA 1XWYA 4K6AA 1EIBA 3QZEA 3CH0A 4CNUA 3RYSA 2X0SA 4WX2A 3PZ9A 4GGHA 1TIWA 2XVLA 3H53A 3KW3A 5DQPA 3FKKA 2E1DA 1ML1A 4K68A 4DJDA 5DF0A 3BMVA 4UOJA 3EDJA 3QC3A 4FLOA 2W92A 1ELSA 1UR0A 2I14A 2JF6A 4TX6A 4TNSA 3GAYA 1MI3A 2ZTKA 1H0GA 3E9AA 4N4PA 1GVYA 3SQSA 2J4GA 2ZC8A 1WDDA 1ZL1A 2V67A 1DIOA 2OXNA 3NL3A 3ZT5A 4EWND 3P67A 1J6PA 4GNJA 1S39A 2DVXA 1OADA 4W8LA 1E71M 3AYSA 5C9RA 1TA3A 1S1PA 2F4EA 3WSUA 4H6QA 5E93A 3WNKA 4KEUA 2HK0A 3SRDA 4GUIA 4AD0A 3MB9A 1MNZA 2P0IA 4CU7A 1M53A 2X2YA 3VE7A 5A6AA 4K1GA 3RILA 3MZ2A 1OABA 3FAWA 1YQ2A 1JDCA 2VR2A 4XVDA 3WFZA 2YJQA 1S2AA 3PZVA 1SZFA 2QHAA 1EDQA 1ONXA 2JEQA 4IICA 3TCEA 5JBFA 3W3OA 3W2NA 4NZCA 5MKGA 4F9JA 2CZFA 2VFFA 4DXKA 2WWCA 3STCA 1OCQA 3AICA 1HUVA 3W76A 1J0HA 4XZBA 4LAZA 3LHTA 2PDYA 4WSKA 2OKOA 1PDYA 2FGZA 2HPMA 2VZVA 4N02A 4Z0SA 5LNRA 4KWOA 2A3AA 1F2JA 3WJXA 1UKSA 5C0QA 5KZDA 4UR7A 3U2CA 3MV01 1KFBA 1TJPA 4Q4OA 3RNDA 4UTHA 1T96A 3V36A 1FY6A 5GNYA 3MS8A 1O7AA 3VAVA 4PUDA 2Y5JA 3OQ8A 4NX5A 3EOUA 4BFAA 3ZT6A 3C2EA 4JNYA 3WENA 3KOXA 3HV8A 3WEZA 1ZAHA 4BKNA 4ODKA 1AJ2A 3LCHA 3MMWA 3TW6A 3CV2A 4A3UA 2XVNA 4L64A 4O0QA 3R58A 1E1FA 3CUFA 1Q6IA 1W5NA 3IGXA 1D8CA 1R38A 4DM2A 3PHAA 3O5MA 1I60A 3W02A 3BJTA 4IZGA 1KM1A 5IRPA 1LL7A 1SGJA 5CKSA 5M03A 3GHRA 3USBA 3WYZA 3I4EA 2FAPA 2WVSA 3T6CA 5EMLA 2HTMA 4KESA 1QATA 3M47A 2J24A 3LHZA 3O8AA 2QAPA 2DGAA 3KRSA 4YLWA 3MUXA 2QCGA 1REQB 3R7MA 3KBWA 1SPQA 4HD5A 3S5ZA 2NQJA 3M5XA 1ZU8A 5A1AA 4B92A 3DXIA 5LIWX 1PKLA 2VEIA 2NW0A 2OZTA 3GQYA 2VFGA 3FK4A 4KGJA 4F0LA 4GUJA 3K1GA 1SJCA 4S3FA 3M0JA 3FVDA 3D3FA 3MUCA 5IFTA 4O1EA 3SJ3A 4URIA 4DY1A 4GLEA 5HOSA 3EIPA 3RMJA 1N8IA 3GM8A 4PUJA 2YA2A 5E70A 3BGGA 3N2OA 1TA3B 2C3ZA 3RPTA 3H4WA 2D3LA 2ABBA 3MMUA 3PWIA 4S2BA 2WJEA 1CIUA 3CHFA 5JBDA 1QHOA 2D0HA 3R0KA 4GZJA 3FXYA 1YEYA 3AC0A 3W29A 3S1UA 2I9UA 3MSGA 3KAFA 3LI1A 3GPKA 1A49A 4U3CA 3DYOA 5AHMA 4R7WA 5C9UA 3C2RA 2TYSA 3QFWA 5MKGB 4JTSA 2QJGA 2QPUA 4IT6A 3OEXA 3P7YA 3JYMA 5D8ZA 1KTNA 2Y78A 8RUCA 4XUGA 2WXDM 2WYSA 4YN5A 1CWYA 1XIHA 2ZC1A 2ZOXA 4G7EA 4W7UA 1S5NA 4PFMA 1V79A 4Q4QA 1WZLA 2VUNA 1J2BA 1RP9A 3LU2A 1OFQA 4CD4A 1ALDA 3Q94A 4HMCA 4NX0A 1XYLA 3R94A 1FKGA 4PMYA 4DO6A 1AQFA 3E74A 1IXQA 1F3EA 1KCZA 4WCJA 1LBLA 1E1EA 4AVFA 3N29A 1R9XA 4Q7BA 3VX0A 5FJRA 3B8DA 1ZCOA 1LM1A 1AL7A 4LAUA 4CQCA 3S46A 2PBCA 1TRDA 2FB2A 1GHRA 2GZXA 5E9XA 3N34A 4RNIA 2HV5A 1GOWA 1VIZA 4NQ1A 4KIEA 2ZIDA 1KGXA 1G4EA 7A3HA 2PU0A 4W85A 4ZB0A 4UFMA 2YCKX 5D05A 3HQ1A 3KBJA 4V28A 4KF1A 2PDJA 3N18A 5EFDA 2QUNA 1VJIA 2D23A 1QVBA 3TJLA 3A4XA 1X6NA 3GTFA 3AROA 4TX9A 1QAPA 2FZ9A 4DLMA 4DZHA 3W7RA 4WGHA 4CCCA 4I5RA 4MAVA 3AMDA 2B7OA 3CC1A 3BURA 5CG0A 3DHFA 1EJXC 4XZNX 2MNTA 5D9MA 5HJYA 1YLVA 1UR1A 3UWYA 4MF4A 3NQGA 5HTGA 4IT1A 3HN3A 2X16A 5KZ6A 2RUCA 1WOAA 4J7RA 1RAKA 3W24A 3AU2A 2BVYA 2G3MA 1NFGA 4FIRA 5A69A 3UA4A 5I02A 3EX3A 1E0WA 4LAOA 3SZ8A 5A6MA 2CBIA 3GRIA 1NEYA 1J93A 4L4LA 1ZBVA 1MFVA 1R7AA 3OZOA 3T55A 1Q6OA 3D6NA 1W6TA 3NOYA 4R9XA 4HCLA 2GDVA 4HTYA 1TR1A 1Z3NA 4HP5A 3W7DA 4P8XA 4KCTA 2Y8VA 3PC0A 3IK4A 1KKRA 4Y8FA 2ZWYA 1XYCA 3T2OA 3ARZA 4L3NA 3WQVA 1LLZA 4DH0A 2V9DA 2WKJA 3LZ5A 1FDYA 5HMDA 1JIBA 1R47A 2QZRA 1ZB5A 6CGTA 1GOXA 3RO6A 2DUXA 4O0ZA 5HNNA 3GSMA 3BTNA 5DIUA 2RH9A 4ODNA 2WAGA 1H7OA 1ONEA 1RZMA 1A3HA 3RLVA 2IPJA 2PWHA 3WD1A 1E0TA 5BW6A 5REQA 3B8IA 1KV5A 3ARUA 1XLLA 1FA2A 4Q3MA 3VM7A 3M0VA 2Y89A 4PBEA 4G7EB 3R25A 1JAEA 1X96A 4BI5A 4HZ7A 4W9QA 4WF7A 1OGBA 2Q8ZA 2G3FA 5M17A 3HM7A 4YHGA 5F2IA 4EK7A 1QPLA 3FEMA 4I6KA 4U10A 2VI0A 3LPGA 5I06A 3NZGA 4PUKA 3LEPA 4O1CA 4HJFA 3GVGA 2JIEA 3RO8A 1GJUA 4EP8C 4ZCWA 2NSOA 1H61A 1KFWA 4I9AA 4J3XA 1OFRA 1VLWA 4JNZA 1EXPA 4HZ6A 3M5ZA 1ISXA 1ZUAX 1V3JA 4A8NA 3VK5A 4JICA 2FMNA 1C9DA 4MNKA 2GGJA 3L5LA 3DFQA 5K4XA 3TJXA 1IYXA 1UOKA 3PNZA 3EWCA 4XK2A 4AUBA 4DLFA 1PCWA 1R3WA 2BXZA 5DY2A 4QT2A 5F1UA 2G41A 3KVJA 3W7KA 1HP5A 5AVHA 4NZ1A 3SCUA 1UR4A 3CPGA 1MUWA 2NVDA 3CUHA 4DJDC 4G56A 3WQEA 3RM8A 2RFGA 2XPKA 5BCAA 3AYRA 2ZX7A 3TV8A 5PTDA 1WCGA 3VDBA 3I3BA 3NQ8A 1NTHA 3E96A 3ECQA 1VHCA 3WELA 1XV8A 1HN1A 3H2CA 3AIWA 4HVXA 1CLXA 2VQUA 3H4GA 3SQLA 4DT4A 1CGTA 3V1HA 2V3DA 3MBFA 3UJ2A 2CZ5A 3DHUA 1MW2A 2ZUVA 4D6GA 3CLMA 4UMBA 2A85A 5DIVA 3W2UA 2RGMA 1W3HA 1U5VA 1XYZA 1UCWA 5I09A 3L5AA 3ALFA 1LOLA 1VQTA 5I79A 4FIQA 5AVNA 1J01A 1TVNA 2GVJA 1VRDA 4JBRA 5CBIA 4JL1A 4L9XA 2BY2A 3GNNA 2R9RA 1MW0A 4N2YA 4WLCA 2VJXA 2H9AB 3KCOA 1W1YA 5DY3A 3EB4A 5CZJA 3NEHA 3DC8A 3AIUA 3N3MA 3Q65A 3PK7A 1MQQA 4C91A 2UZ9A 4QX4A 4PSRA 3E49A 3GYEA 2HQAA 1ZJIA 4LU0A 2X1UA 3F4NA 4C6CA 3RU8X 2CLPA 2R91A 3ZQ9A 2J88A 4CEXC 1KD0A 2GQ9A 3TXZA 1AW1A 3VI2A 5I5RA 3L0NA 4ZO7A 1Z41A 3NEVA 3B40A 5E6ZA 1PBKA 1XDJA 1XC4A 3LQLA 1MFUA 1ME8A 2CHNA 2FGLA 2XH0A 3LLFA 1KBBA 3ELFA 3IGSA 1YNYA 9XIAA 4Y9NA 4CD5A 2YZRA 3TE9A 1ZLPA 1VCFA 3LPPA 2UY2A 4QNEA 3B0XA 3G1RA 3R11A 4BJHA 2BNJA 3LCIA 2F6KA 3CYVA 3ES7A 2DZWA 2L5HA 3KBSA 3NQVA 3M4HA 5BXPA 2MLZA 3VZZA 4K36A 1UROA 3CEPA 3LA4A 1W3TA 2DW6A 4IQJA 3SUVA 1HKIA 1EOMA 4JQ4A 4H4IA 2VD9A 3SCTA 1GQNA 4BY3A 3WNMA 3OQEA 3ARVA 5D03A 4DWDA 3LBCA 1XCWA 3OHMB 3BOLA 4AVOA 1D7JA 3SN0A 2OO0A 2PPGA 1QO5A 3OIHA 5AECA 4ONVA 4IWWA 1S3TC 4TTGA 3TIMA 2YLAA 1XG4A 5DCDA 1XKJA 4NASA 1V6TA 3WY1A 3U5UA 5FJOA 4QHRA 3BW3A 1BKHA 2TSYA 4UCGA 3TKFA 1F6KA 3KE0A 3INPA 5AHEA 3W4RA 3T9PA 1Q8AA 4O28A 1W32A 4AAJA 4EOUA 5D4YA 1DQWA 4IMDA 3TTYA 2V82A 3PR9A 1E56A 2ANUA 4Z42C 1JZ6A 3ZMRA 3QQWA 1EGVA 2XHYA 4HNOA 4AWUA 2HNEA 3BK0A 4PEEA 2GFTA 1HKWA 3OODA 3D5HA 1GEHA 2CERA 5AHNA 1AFSA 3O5EA 1NARA 1V3MA 4AMCA 2DSVA 3R5EA 5KZEA 2NT0A 4B5VA 4IT4A 4H1ZA 3H2FA 4GI6A 3KCJA 4DXVA 3BOFA 5A95A 2V6AA 5AOUA 1Q13A 1YXDA 1BQCA 3WNOA 3B97A 2AQOA 3NTPA 1UR8A 3KVMA 3ZO9A 4C6LA 1EP2A 2O9RA 1QWGA 4N9BA 3O06A 2GJXA 2ZXQA 4JIIX 4IIDA 3GXPA 1V3KA 1QPNA 3WLJA 1JAKA 7ODCA 3EDFA 3LM7A 4RDYA 6TIMA 1H62A 1NDZA 4PTNA 1OCJA 2P50A 5M1TA 1V7AA 3W7LA 4ZOCA 2YL5A 2NXGA 2E0PA 5HR7A 1TB3A 1ADOA 1H7RA 1UMYA 3MMTA 3B4YA 4IQEA 3MKVA 2Z26A 1L6GA 1HO1A 3VXGA 4RL3A 4UFLA 1N2VA 3DOPA 3GTNA 2CKRA 4X2RA 3W1LA 4X9YA 3W7QA 2V38A 5LXXA 1OYBA 1UUQA 3AWOA 3HGSA 3IAPA 4Y6GA 4AH7A 3IUIA 3G2GA 4RV8A 3O5OA 4QDPA 1UPPA 5HMFA 2X0HA 4C02B 5F4WA 1EQCA 4ZTYA 4D9PA 1P0BA 3FYPA 1GZJA 3S6OA 1RK5A 1D9EA 3E2VA 1LORA 2NQZA 1H4PA 3R8GA 4HN4A 4H7ZA 3VYLA 3H22A 5A2CA 4NI8A 2VGFA 2PRMA 3QPEA 2EAWA 3CU2A 1KWGA 2GSEA 2I17A 2HK1A 4B3LA 1E6XM 1NMVA 4ENLA 2ZQUA 3P80A 5LIKX 3IJIA 1QI2A 4EPKA 4OQVA 1C91A 1VFSA 3TTQA 3CEUA 3ITOA 3ZWSA 2PLCA 2GVGA 3GDRA 3F03K 2WVVB 3MCNA 1X6LA 4DZIA 3OTRA 4PTXA 3H2MA 5EMUA 1DTNA 1U1HA 2E68A 1GNXA 1QBBA 5D9NA 3RX3A 4UNLA 1ZJHA 4ZQMA 3CQHA 1JCLA 1LBMA 2XP3A 1S46A 3KAGA 3IJLA 6A3HA 2PWEA 5AZ1A 1A5SA 3ME3A 5A6KA 3UJSA 4IM4A 3QMSA 2J79A 5F2MA 3B8SA 3AUJA 3P5YA 2J7BA 5HKGA 4LAKA 4PTDA 3TR9A 1XH0A 2ZTJA 4HYWA 2XSBA 1RHCA 1TKKA 4Y96A 4DBDA 2A3HA 3FA3A 2AMGA 3KDNA 1ONWA 4G9PA 5TAOA 2AKMA 2VN1A 4NNBA 4NRRA 4Q33A 1IR2A 2VNCA 1NQKA 1YHTA 3THDA 3ZVHA 1KR0A 4V2XA 4M24A 2HXUA 4JFKA 1TVPA 1L6SA 5DX7A 3UY8A 4AXNA 4EAYA 4K8EA 1X97A 4P7OA 1KXQA 3UW6A 3GNXA 1XL9A 2GJXB 3COTA 5IDIA 1UP0A 3O6AA 1HT6A 1RJQA 3HPFA 4XVEA 4IX2A 3LY0A 2XIBA 4JTGA 4ZPTR 3U2OA 1JUBA 5D2TA 3WMLA 4Q4KA 1Z6KA 2CHOA 3N25A 1MW1A 3RX2A 1U30A 1ZY9A 2ZRVA 5G4HC 4GY1A 4H8VA 3GBDA 3GDTA 2C1GA 1DJGA 1P1XA 2OX4A 1ITUA 4RZ6A 1B0IA 4WDTA 1PDZA 2OZ8A 1CB7B 4IIGA 3VNYA 1OJXA 1AG1O 4L6DA 3WJWA 3IIXA 2BLEA 4MWAE 3PULA 4ODRA 4RE0A 2YW4A 3LHWA 1K02A 3QEZA 4CQDA 3SY5A 4YTTA 1KV8A 2OSWA 4RZ4A 1Q2RA 4O2TA 4NNAA 2EPLX 3EX6A 3QN3A 4GYPA 3F2CA 4CU8A 4B90A 4HSOA 3VGFA 1F40A 1Q6DA 3S83A 4ZB2A 1FWBC 4TR9A 4XIMA 2OYMA 4PGLA 4YPJA 2E5BA 1DTUA 4HCHA 4NL1A 1DJYA 2Z4GA 2ZA3A 1ISVA 2ZRYA 2E3ZA 3GG1A 2IF4A 2HE8A 1KCXA 5CPMA 2ODOA 4H9MA 5A3HA 4EACA 2K8IA 2AAAA 1LUCA 4GOAA 2OWWA 5FJJA 3RF9A 3JW7A 4IFRA 4DYKA 3GYCA 1XJBA 3P74A 3K4WA 2A5HA 2RAGA 4KWUA 4W93A 3DECA 2QW5A 2EKCA 2HZGA 4Z1YA 2F84A 4GI4A 3FJ6A 1HKJA 5BRPA 4O50A 1VYSX 4F0MA 3R79A 3TOPA 3CL8A 2H8ZA 1DV7A 4INFA 5IHSA 3GLCA 4H9YA 5G2IA 3MO4A 3TW9A 1VPXA 4JY8A 1FJDA 1SW7A 3N15A 2NVAA 4G2DA 1QBAA 4K38A 1LQ2A 3IVUA 1FKRA 3WNNA 4CCZA 1F8IA 2PGEA 4CN6A 4MKSA 1AQHA 3NL5A 4M8UA 5E5CA 5D2YA 1GKRA 3IKGA 3TYZA 3GZ3A 4KFPA 5J6EA 2PDIA 2J9ZA 4QAWA 4D6CA 4HB7A 1RV8A 4ODPA 4PUMA 1W54A 4DJED 5D09A 1AVAA 4JDYA 3C2FA 1K7XA 4JD4A 3ZVHB 1P0EA 2XVGA 3IPWA 1EFZA 2YCLA 5K2ZA 3I3EA 4F2TA 1VJSA 2QMJA 7REQA 1F07A 1VP5A 2FZNA 3NQAA 4F0HA 3PJXA 5KZMA 4RDVA 1AMYA 3C0JA 2YXOA 4GH1A 5CC3A 4F48A 2RURA 3WL0A 1EF2A 4WY0A 3S6TA 4AVNA 4S3CA 4W9TA 1FP9A 3ZJ7A 4DZ5A 4EF8A 3A6OA 1VHNA 3FY1A 3VZYA 5EA9A 1VFFA 3MP3A 1JXKA 3OLIA 3HTWA 1QCWA 1WDWA 1DP0A 3PZIA 2I57A 1W5PA 4LJ3A 3FSTA 4W7VA 1OC7A 4UNKA 4ZODA 3P82A 1BVNP 4RNHA 1HKKA 4H6EA 2ACSA 2XP7A 5EMYA 4GFSA 3MJMA 1RXOB 3UNDA 1I2QA 1E5JA 3HV9A 1QMLA 3UG5A 3ABOA 4B2DD 2O9OA 2TAAA 4MJ2A 4DO5A 1PYMA 4GBUA 4GGBA 3LCLA 2WZHA 4AISA 4ATDA 2PS2A 3LXCA 2DT2A 1ZHAA 1EC8A 2WANA 4AG0A 4I5XA 5HQEA 1GKPA 2ISWA 1CLKA 1B3VA 4X0VA 4GCAA 1ZENA 3G1HA 2DT1A 3QOMA 5I3GA 3WJYA 3ARSA 3EX2A 2ZRWA 3WDJA 1GOKA 1MUMA 4XAKA 3HURA 3QZAA 1ADDA 1ZBKA 2Z28A 3T1GA 4A05A 1LUCB 2VDHA 2B81A 4MJ4A 1XD1A 4E8GA 5HXMA 3N6JA 1R46A 5JMUA 4FNTA 1I0BA 1GKQA 1SJBA 4O16A 3TZFA 1B1YA 1EPVA 5ABFA 4GD0A 3QKZA 4PRRA 2ZXBA 4OZOA 3EGJA 4ZB5A 5GPRA 3DI0A 2MNRA 1JCJA 2NXIA 1XH1A 3A3XA 1K8ZA 3KLLA 1K03A 2G4JA 1E4LA 5AZ0A 3SJNA 2YDAA 3BLFA 5BZAA 2BHZA 1I1XA 4HMDA 5I3KA 2WPGA 3E5PA 3MI2A 4IIEA 4JFWA 2CHRA 4JQAA 3M16A 4U5IA 1SZEA 2XIIA 1WDPA 3ATYA 4GXWA 2WV8A 3SCQA 3UERA 1X1NA 2ZZ1A 5T8GA 2PC8A 4JHMA 3W6YA 1SJDA 3FAPA 1TV3A 5BXSA 4KWVA 3GW0A 2BMBA 2NUYA 4ACZB 2YCLB 1BAGA 1EA9C 6XIMA 3EPNA 2JBMA 1H60A 4O54A 1J9YA 3E38A 1ICQA 1WZAA 1PHWA 4H01A 4LSBA 3A4JA 3MP5A 1J4RA 4LAVA 2J7FA 1JPHA 2RDUA 1WX0A 1V51A 2Z2BA 4TX0A 3EOSA 1GOOA 5JH2A 1CBGA 4WY0B 2WSQA 2VVSA 3WQ5A 4GX8A 4FXJA 2FPYA 4AYSA 1E72M 2P1FA 4D6DA 4PMDA 4R34A 1FOBA 3VKKA 4GH3A 2I7GA 2J66A 4HNNA 4ZQNA 1FWAC 1ZSXA 4HHHA 3A5FA 3IEBA 4Z2GA 5HAOA 4AZHA 3N14A 2WBGA 1XFBA 3PJUA 3IJ8A 3W74A 3WDRA 1AZ2A 2ALRA 4B9ZA 4OOUA 4GPNA 2QDEA 3S1WA 4GI9A 4PMJA 2CC0A 3IANA 4HOWA 3CZJA 6ALDA 3NSXA 4C1NA 2XSXA 1YPXA 3N4FA 4YTQA 1FFQA 4C65A 5A6BA 3QRHA 1RH9A 2CZDA 2D73A 3AYTA 1QNSA 4IMFA 2B7QA 4KEMA 4MWAA 4UQEA 1Q8JA 2UV8G 3WDIA 3O5GA 1D7HA 2BODX 3CQKA 4J1OA 4IJRA 1KFEA 4TTUA 2YFNA 3W7PA 1EKOA 4JTFA 3BAIA 4EF9A 2WSYA 3PRAA 5AB3A 1O5RA 1GYNA 3ENLA 3WBWA 1CXIA 1LWJA 2ZUMA 4H6KA 3ZIZA 1TRIA 2LLEA 1Q4NX 4JN8A 3UGVA 2O7QA 2AGTA 4K2SA 3KP1A 3TEVA 1J4IA 1NSGA 1EUNA 5KETA 3LRMA 1EJUC 5CAHA 3R13A 1KB3A 5HR6A 1DJQA 1W9BM 4DYEA 1KA9F 1IQ8A 3OOBA 2DQWA 3LLDA 5A6TC 1T8QA 2C18A 5BOFA 5AHLA 1V03A 3M0ZA 2D69A 1MQPA 1EIXA 3CAWA 3AS1A 3WH8A 4HNLA 1L2QA 3BZGA 3JU2A 4NXSA 3TTEA 3PZOA 4V1YA 2KI3A 1YMYA 5LSMA 2FHBA 1Q66A 5C2GA 4GJ1A 4RCXA 5DBUA 2PB1A 1W8GA 3NI6A 1L2UA 1Y5WA 2KFWA 2B7PA 2CITA 1BTCA 1NDYA 2PWVA 2MPHA 3CV7A 2W5FA 3TSMA 4GX9A 3H12A 2WZEA 4D8LA 5M2FX 1QXLA 4V33A 4Q7IA 2VYOA 4US5D 1CGYA 3S0CA 3W22A 2X30A 3UNTA 2XM1A 2F23A 2PE4A 4ZQOA 2A1YA 4W84A 4XV0A 3QGKC 3SUTA 1SO3A 4JIPA 1DHPA 4MB3A 2Z6IA 4I9TA 1TQXA 4CCEA 2VX5A 3OGRA 3O3RA 3WLQA 1TMHA 1L6FA 5FF7A 5K4ZA 2DT3A 1NIUA 3CUJA 3PN8A 3PRBA 2FIQA 1MYRA 1ZJAA 1IGSA 5A6JA 4GYPC 3GAKA 3FIGA 3TYUA 1JRBA 1OT1A 4ZXOA 4U2ZA 5HANA 5BROA 2OLHA 2DEPA 1VBRA 4DRPA 3K2GA 1C9HA 2PDPA 3DIPA 5CGTA 4MIMA 1TV2A 3LGGA 3H24A 5AY7A 3C8NA 3VM5A 3E1F1 4I8YA 3ABSA 1MEIA 5F7UA 3NG3A 4NAFA 5GJMA 4I6VA 4LEQA 4BCEA 2INZA 4C1NB 4R88A 3C0LA 3E0WA 1IEWA 1MXDA 3O1NA 4WDWA 1E6ZA 4MWAB 5DFAA 4ROQA 1WKDA 2BGSA 3QC0A 4FF7A 3EDEA 1IEQA 2AKZA 2QJNA 4EIVA 3PA7A 1XS2A 4GACA 4QLJA 1BKSA 1U83A 3O5KA 4XAGA 5LGZA 1OINA 2QCCA 3LTYA 4Y9MA 3VC5A 3NM1A 2VEPA 1SZNA 3SSJA 4ODOA 1EJWC 2PV2A 3SI9A 3MSDA 2VEKA 4H3DA 3R12A 4ZOAA 3T81A 1IEXA 1HJSA 3V1PA 2JK2A 4UOZA 4WJ8A 3CASA 5D38A 3CIVA 1TFVA 1FWJC 3F4WA 4HA0A 4H9TA 1VEMA 1X7IA 4GY0A 2TMDA 4F9DA 1PX3A 3A21A 2NZLA 4GY7A 2BDQA 5EMJA 3VC6A 5D33A 3WMCA 4C1KA 3UEQA 1F3WA 4GC4A 3SY8A 2ZDRA 1B90A 4BI6A 3II1A 1AH0A 3K8MA 2XP8A 3OA5A 4TVDA 2PCQA 2CBVA 1JNEA 1EP3A 5DO2A 2JKPA 3GG0A 3TWBA 1POJA 1LRNA 4HJWA 2Z24A 1TUXA 1T8XA 4XWUA 1BG4A 4E2VA 2Z6JA 4J9JA 4J5NA 1KGWA 3IJ6A 1F7BA 4IIFA 2YSWA 3DU0A 3GC4A 3EPOA 3OBKA 2GDUA 4QE1A 1I2NA 3E3HA 1JQXA 1GZGA 2RDWA 1E3XA 1WDRA 1QO2A 3KS5A 4HBKA 3W2MA 3T7VA 1M6JA 3RU6A 4S3KA 4E4PA 2OEJA 2IUZA 5CGQA 4PEKA 4M3PA 3R8RA 4QSHA 2W79A 4IUGA 1HVQA 2RUSA 1V3LA 2D2GA 2XIQA 3P0WA 4TVUA 3P2VA 1IXNA 4PC8A 3LCFA 4ZENA 4Q8VA 1WV2A 4IXXA 4UMCA 1V8EA 3UQBA 2Z1BA 3RGTA 2Y1HA 1TE6A 4UR9A 2QIWA 3GZAA 4C5YA 3VD5A 1KFJA 1EL3A 3PUDA 4IUOA 1VRXA 1P6BA 3PP7A 4N0RA 1R3TA 1PE1A 1PIFA 3PZTA 4D2JA 1ECQA 1XBYA 3NR0A 3GH7A 3WLKX 2VL4A 1ECEA 4NZJA 3DFYA 1UC5A 1WXYA 1D7FA 3PAOA 1W0MA 4NAFB 1TZZA 4NAEA 4J4NA 3FGCA 2RUQA 4FNSA 4JFTA 1OQFA 5FF4A 1CXKA 4QJ1A 3AUOA 1NP2A 1R2RA 4KT2A 1L6WA 2V81A 5I0DA 1ICPA 5E1QA 1J0IA 2O55A 3WO8A 3MO7A 4OV4A 2KAUC 3E5BA 3V5CA 2DZSA 1ICSA