3FY1A

The acidic mammalian chitinase catalytic domain in complex with methylallosamidin
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
377
structure length
377
Chain Sequence
YQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNVKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acidic mammalian chitinase
publication title Triad of polar residues implicated in pH specificity of acidic mammalian chitinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 136
structure length 377
sequence length 377
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3fy1A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3fy1A01
4AMCA 2ZX9A 3L4YA 3THCA 4W85A 1WKYA 3OGRA 3L4XA 1MFUA 1TFVA 3SCOA 4GO8A 3AZRA 3TTYA 1UKQA 5A1AA 1KR0A 4GQQA 2J74A 2C8NA 3W37A 5D9MA 2VR4A 4X0NA 3B9AA 2W92A 4D6DA 3UCQA 5CSUA 4HP5A 4URIA 4JHOA 1E6RA 5AC5A 3ZJKA 3KE0A 1E1EA 2JE8A 5DFAA 4BZYA 6A3HA 2X0HA 4TVUA 1WNOA 2WC3A 4AD2A 1W3HA 1B30A 5A8NA 2WSPA 1JG9A 5A6AA 1FH7A 1FFRA 3WQWA 2ZIDA 1SR0A 3MUY1 3MMWA 5IFTA 3GBDA 3VNZA 5GPRA 1FH9A 2ZICA 3NSNA 1BVZA 3VTRA 1HJQA 3CMGA 4PEEA 5E70A 2WNWA 5FOOA 2YLAA 3ARXA 4LX4A 2BY3A 3GNPA 4PTWA 1CGYA 3B9EA 1EIBA 3A3HA 4L4OA 3RMEA 1HJSA 4H41A 1TR1A 1QI2A 4CGTA 4HMDA 1FHLA 2DH2A 3KWXA 4DUWA 3WD2A 4C7DA 5I3DA 1ZBKA 5E6ZA 4MNJA 4AZBA 1UD3A 2ESCA 4P8XA 3AYSA 1NOWA 1HKMA 4JKKA 3II1A 1DWGM 3AROA 1XCWA 1G94A 2FH6A 4JFSA 2QF8A 5I2UA 4DM2A 3VIIA 1PX8A 2D20A 3WDHA 1H1NA 2HVMA 3VX0A 3CO4A 1JZ5A 1Q6CA 4U31A 3M07A 1MQQA 2EO7A 3WDJA 4J27A 1X6LA 5AYIA 3CIVA 4GQRA 4W87A 5BXRA 2D1ZA 3WD1A 1MWOA 2OLHA 1MXGA 2E4TA 2YA1A 3T0BA 2WPGA 1XYFA 1XRVA 2FHFA 4YPJA 4Q7NA 4JFTA 4Z2LA 1N82A 2DSVA 2DIJA 4AZIA 3THDA 4JZ5A 3BCFA 3TA9A 3MUAA 4F66A 2BY2A 3A4AA 4J7RA 1XCXA 2J7BA 1JIBA 3ZM8A 1C91A 5HNNA 1B1YA 2G4FA 3WNKA 3RILA 1I1WA 1OD8A 2ZUWA 2ZXQA 1E55A 4KGJA 1PEZA 1QNSA 1UA7A 4DM1A 3EDFA 3PZVA 4UQ9A 4IPLA 2VT0A 4QDMA 4AWEA 3VD5A 4NZCA 1DWJM 3L4WA 2E0PA 3VU2A 4BQ3A 1E73M 2FGZA 2WZIA 1LG1A 1V3LA 5A94A 3U7VA 1EDTA 1LL6A 4LGXA 3BCDA 4CD6A 1AVAA 3FHQA 2WC7A 3UG3A 4PSPA 4AIEA 3OGVA 4TX6A 1W1VA 1OWQA 3GNRA 2D0GA 2UY3A 3F5JA 3WH5A 3U5UA 2CBJA 3EYPA 1CTNA 1UR8A 1E40A 1BF2A 2V5DA 2ZWZA 3K4DA 3WN6A 4Q22A 4B15A 2VZSA 3J7HA 4W8BA 2YJQA 1KCLA 3WUBA 3OG2A 2E8ZA 3UR7A 2Y4SA 2CKRA 4PTVA 4F8XA 4W8AA 5I78A 3AXIA 3GNOA 1QOXA 3MS8A 4MADA 2D0FA 5I23A 3FHAA 2PF0A 3LPGA 3SUTA 2BS9A 1R86A 3CUHA 4J3VA 3SCVA 5A6KA 2XFYA 1ECEA 1VAHA 4OBSA 3OGSA 4ATLA 3WQVA 3ARVA 2O9OA 5M5DA 4QCFA 3VD9A 1QNRA 3AHVA 4CKQA 3SUSA 5DEZA 3AS0A 2YL5A 3AICA 2OSWA 1EGZA 1PX4A 2WCSA 2FHBA 5I0DA 5DF0A 3AMLA 3BAIA 2UY4A 1C7TA 3GH7A 3O6AA 2GJXB 1Q6DA 5E6YA 1DWIM 2ZUMA 1JZ8A 3N04A 5FIPA 1ZBWA 1JF5A 2XGBA 4NSBA 2CNCA 1JNDA 1AQ0A 3W6MA 4ZENA 3NUKA 1CLXA 5IXEA 4PCSA 1G1YA 2ZWYA 3WH8A 2NSXA 2PWHA 1JD9A 1JL8A 3SCRA 4WSKA 4C7FA 3CUGA 3UESA 2GJPA 4W89A 2DT2A 1XC6A 2WMKA 1E56A 4WKFA 5AC4A 2ZXAA 3VIJA 2X2YA 4UOZA 4M81A 2GFTA 1EQPA 4JCMA 1B2YA 2BXYA 2XSBA 1BHGA 4FMVA 1A3HA 1QHZA 3CZ8A 2NW0A 4LXFA 4D6FA 3ARUA 3M46A 3CHCA 1CGUA 1W9BM 1V0LA 4R5EA 3ARYA 3VKKA 2OYKA 1WE5A 1UH3A 1HXJA 4W88A 4M1RA 1Q4NX 1P6WA 3PHAA 6TAAA 4WKAA 1BG4A 2D23A 4LYPA 3NIYA 3VDHA 3BSHA 4UOJA 2J7FA 2QMKA 4RE2A 5TD4A 1HL8A 4UQAA 4AIOA 4D6CA 1BFNA 1GZJA 9CGTA 3WF1A 1LL7A 1GCYA 4B9ZA 4ZE4A 5A6BA 3DECA 1WO2A 3BMWA 3ARSA 1C8YA 1QI4A 2NT0A 1E15A 1QBBA 5E09A 1CXFA 2ZX7A 1FP8A 4JAWA 3W26A 3CUIA 3RO8A 4WKHA 3G6LA 4ZE5A 2FH8A 1E0VA 5AYBA 1OBAA 3CPUA 5CPTA 2EPLX 4BQ2A 3RCNA 3B8SA 2GJRA 1QVBA 2VCBA 1V02A 2C7FA 3BMVA 2BVTA 1W32A 4MNLA 1V0MA 4V28A 1K9TA 4JFVA 4U2ZA 5CSYA 2YDRA 4OJYA 5HPCA 1E1FA 1UR0A 1WDRA 1UA3A 1E6PA 4F9DA 1EO5A 2DGAA 1BAGA 1B3WA 2EJ1A 1PAMA 4P7NA 5CPSA 1VBRA 2QPSA 4NRRA 5KEZA 3VIMA 1LG2A 3T0AA 3F4VA 1KGXA 3ZMRA 2Y2WA 3VX1A 3HN3A 3OIHA 1KXVA 1V3HA 3AMDA 3VIHA 4D72A 1R85A 1TCMA 1XYZA 4HU8A 3HU7A 3VGGA 4AW7A 4BQ4A 2PC8A 5LA0A 1EOMA 1MW0A 2WAGA 3CHEA 1OT1A 3WNPA 1HP5A 4MNMA 4GI8A 2PBOA 4LYRA 4Z2GA 3F5KA 3WMBA 2WK2A 2WLZA 1VENA 1Y7VA 1W1TA 1CXHA 2Z1KA 3WNNA 1C93A 3MUZ1 3VD7A 1UWTA 4M80A 3K8KA 4RE4A 2WKGA 5FL0A 3OLGA 2G3NA 4P8VA 4MNKA 1K9EA 1OB0A 1WZKA 3K8LA 3WFLA 4CN6A 2XWEA 1XGZA 2CBIA 2UY5A 4HZ7A 3ZQ9A 1V6VA 3W53A 2GUYA 4UTFA 3WBAA 1LF1A 2Y5EA 3WEMA 4J3XA 3W38A 4D6IA 3WBEA 1V6UA 1V6XA 2EPNA 3NYDA 2BV9A 5JBFA 3O2LA 2FDMA 1HT6A 2QMJA 4CCDA 2ZUUA 1XD1A 2DT3A 3VGFA 1CECA 1OGBA 1JDCA 4Z2HA 1IZJA 1ISYA 1CLVA 3NJ3A 3NCOA 3PTMA 3WF0A 4JL2A 4MJ4A 4UQCA 4AD3A 5CXPA 3GXMA 3VVGA 2V3DA 5KZ6A 2OWWA 3N15A 3GXIA 1O6IA 3KEHA 1JAKA 1J0IA 3RJXA 3WF2A 2J75A 3CUFA 5I79A 1FA2A 3PTKA 2PWDA 1V3MA 4H7VA 3W0KA 4H8VA 3E1F1 1G0CA 2E9BA 3WMSA 3VUPA 2XG9A 3EDKA 4RL3A 1ZBCA 1DHKA 3CTTA 8A3HA 1E5NA 4N0RA 4TOQA 3ZSSA 3HMCA 1PZ2A 1UG6A 1MQRA 4CD7A 3ZOAA 4P7OA 4QLLA 1GJWA 2ZXDA 5JH8A 5CG0A 1XSJA 1HVXA 3ZJ8A 4CVUA 1V3KA 3W82A 1CXEA 4QAWA 2EXOA 3WQ5A 3VIFA 1B0IA 2VMFA 5CQ1A 1ZS2A 1QNOA 2WCAA 5EB8A 4CCCA 3AFBA 1GQLA 1HF6A 1UR4A 4HMEA 1BYAA 3SCPA 1GOWA 3BAXA 3TOPA 1NP2A 2Q8XA 2DSUA 5F7UA 1GNXA 1H41A 3AIQA 2CBVA 1I1XA 4E2OA 1QI3A 1LWJA 4JKLA 4H04A 3CZJA 1UKOA 4UQBA 3BLKA 3AXXA 4LPCA 4W8LA 4ZEPA 1JZ4A 1UKSA 3M6DA 2QV4A 5HXMA 1ITXA 2D2OA 2YL8A 3W29A 3PZIA 2WM0A 3W27A 4CD5A 1JXKA 4CD4A 2WLYA 1TA3A 2W61A 3SUWA 2WVUA 2X0YA 4TXEA 1D2KA 2YKKA 3U57A 3ZT5A 2A3EA 5EBAA 3CHFA 1WPCA 5A8MA 1B31A 2CERA 2VZVA 4FLSA 4E8CA 2JF6A 1VEPA 1IV8A 1O7AA 1BTCA 3ARZA 2WVSA 1E70M 3PTQA 3OB8A 4V2XA 4UQDA 1NWRA 1CZ1A 3WUFA 3PZUA 1EDQA 1RP9A 2D22A 2J78A 2O9TA 3DYMA 4P7LA 1J12A 5BCAA 5D9OA 2IXUA 2GDUA 5CZKA 4CN4A 1ESWA 3SCSA 3UETA 1XV8A 5HOSA 4D6GA 1XH0A 3VMNA 3WF3A 2XM2A 2DPEA 1UR1A 1V6WA 4GZJA 4CN1A 1NP0A 2E40A 4CU6A 3UEQA 2EBNA 5M3WA 5D9NA 5HDRA 3VGEA 4AC1X 2BHZA 8CGTA 3N17A 2O9RA 1WB0A 2YBTA 3WELA 5C70A 1W3KA 1XHGA 3LPPA 1W9PA 1ZJAA 3IJ9A 1GHSA 1JF6A 2W4XA 7A3HA 3L2MA 1PX3A 1RH9A 2XYLA 1BLIA 4E8DA 3WIJA 4AIUA 5IHSA 4GZIA 4JL1A 5A6BD 2J79A 3PZGA 4FLRA 5ABHA 1B9ZA 4D1IA 2XVKA 1J9YA 1VFUA 1JZ3A 1JDAA 3WNOA 2ZUNA 4GZEA 2BNJA 1F4HA 1NH6A 4EKJA 2VVNA 1KBKA 1JNEA 1SMDA 4JIEA 4AD4A 3BXWA 4HA4A 3AHTA 5HBFA 4P8WA 1FFQA 4GKLA 3WL0A 5FL1A 1UOKA 2IXVA 3L4VA 5A3HA 5IHRA 2J7DA 1M01A 5E0CA 1UWQA 2WC4A 4D71A 2YL9A 1OGSA 2WMIA 1DP0A 2EPKX 1EDGA 2VCAA 3OBAA 3SURA 4AYSA 2DDXA 3CZKA 2DSWA 3TTOA 4ACYA 1E71M 1L0PA 1WDPA 5CGMA 1ISZA 3AOFA 1CIUA 3VD4A 3PZ9A 3VGHA 3WUEA 2WMGA 5DT7A 5D8WA 3OZPA 5IDIA 4ATWA 1UD5A 5ECUA 1JYVA 3AS2A 2EQDA 1QI0A 2WCGA 1JYWA 1ISVA 3MV01 1ZBVA 2OWXA 1SYTA 4JHZA 3RM4A 1QPKA 2OSYA 3EMZA 1W3LA 5I6SA 2CPUA 3EDJA 2WMJA 1GHRA 4MB3A 3LPFA 1TUXA 1VRXA 2J8GA 4H8UA 3EDDA 2F2HA 1BG9A 1HJUA 4B16A 1S46A 3ZT6A 4HOXA 5A6JA 2VX6A 4M29A 3D5HA 5CPQA 4PUEA 1PPIA 3SUVA 4U2YA 2JEQA 3ARWA 4H2CA 3WFZA 1XH2A 1EHNA 2G8ZA 1H0GA 2YDSA 5A2CA 2J7HA 1R8LA 3WQ4A 2J77A 4Y7EA 1XD0A 1W1YA 2DEPA 3WH6A 2E8YA 1M04A 2E9MA 1H2JA 1DWAM 4EANA 1V02E 1M53A 2WW5A 4M8UA 1UZ1A 1V3IA 4V27A 1JGIA 3BSGA 3D3AA 2XWDA 1UWSA 1HKKA 3PN8A 5BXSA 1DWHM 3IAPA 2MANA 4BCEA 1VJZA 2JIWA 2G3JA 3VO0A 3BAYA 5JBEA 4W7VA 4U5KA 1MFVA 4AEEA 2VX7A 1MXDA 2F61A 5I5RA 1BVNP 2XM1A 3AHYA 1ISWA 4J3TA 1XSIA 4ML4A 4KWUA 2WMFA 3CZGA 3S6TA 2PWFA 3WF4A 4BQ5A 1JFXA 5D4YA 4MB1A 3AHZA 4LYQA 3CLWA 1GPFA 2CYGA 1BYBA 1W9UA 2XHYA 4N42A 1KQZA 2ZX6A 2CESA 5EFDA 4MTVA 4WIWA 2V3FA 5BXPA 1CENA 4YHGA 3T2OA 4FLQA 3VD3A 2Z1SA 1KXTA 1UKPA 4D1JA 3WKZA 5GQBA 1E43A 1BGAA 2QPUA 3BAJA 4F79A 2GVYA 4AZ7A 5BWFA 3QHNA 2CETA 4MAZA 5ABFA 1JZ2A 5FKYA 5CLWA 4D6HA 2AOSA 1H0IA 1HJXA 4ACZA 3TTQA 4KRTA 3GH5A 4A3YA 2A3HA 3QR3A 2OSXA 3RM8A 2HISA 3WEZA 1EH9A 3DHPA 2Y8VA 3IANA 3I3DA 3MMUA 2BXZA 3KL3A 4HPHA 4LQ1A 1B3YA 1UUQA 2WVVA 2XJ7A 3M7SA 3WQ8A 1C7SA 3VM5A 4MPKA 3N12A 3AYRA 4WLCA 1X1NA 4TVCA 1KB3A 4J3SA 1K9DA 2XVGA 3VGBA 2EPMX 1BPLB 3ALGA 5E9AA 4UQEA 3PBGA 3WMCA 3A6OA 1NQ6A 1TG7A 5D8ZA 2XVNA 1E6XM 4W7UA 1E3XA 1VEOA 4DWSA 1I75A 4R27A 3NSMA 1BGGA 5C8BB 1GOKA 1V3JA 2DQXA 1NWUA 3I3EA 5CJ5A 3CUJA 2ZUSA 2X05A 2YBUA 2WXDM 3A47A 3L2LA 4AD1A 2G3MA 1KWGA 3WD4A 1IT0A 3I3BA 3FXYA 3VMOA 5BRPA 1JDDA 2FHCA 1QHOA 2WHLA 4IISA 2VQTA 2PBGA 3OLDA 1E6SM 4CVWA 4IM4A 3DHUA 3CH9A 1OCQA 1UHVA 2GDVA 1W9VA 3CHDA 1KR1A 4FF5A 3AIWA 4JKMA 1FP9A 4WK9A 1J18A 1TA3B 5A2BA 4HZ8A 4PMVA 1GOQA 5GNZA 1VIWA 4OUEA 1DEDA 3QGVA 3GYCA 4AZGA 4PMRA 4TTGA 4AXNA 2EEXA 2VC9A 3PZMA 4FK9A 4OBRA 4XV0A 1V08A 2CIPA 4PRWA 3WH7A 1KXHA 1K6AA 3AI0A 3AIBA 2B31A 5DT5A 1HP4A 3T09A 5I77A 2PB1A 1SMAA 3MV11 4D6EA 2YDQA 4UFLA 1V0NA 3BAKA 1TZ7A 4AZCA 3K4AA 3SEPA 1GOOA 3N13A 3WH9A 1CXLA 3K8MA 2VO5A 3EMCA 3KL5A 1V0KA 3A4WA 3AIVA 5FD0A 1CWYA 1C90A 4IUGA 3L4TA 3ALFA 1XSKA 1OIFA 2XIIA 3EBVA 2VQUA 4PMNA 3FAXA 1JD7A 1E0XA 3IK2A 3S2CA 3AIUA 3VM7A 3K46A 2VRJA 4Z2IA 4KH2A 3W28A 7TAAA 1JFHA 4UR9A 3PZTA 5IFPA 1KXQA 4PMXA 1OIMA 2CITA 4QCEA 2OWCA 2RGLA 2VJXA 3TP4A 1JAEA 2J7CA 2ZXBA 4PMZA 4PMYA 4B3KA 1UH2A 1HIZA 3ECQA 2E3ZA 1KWKA 1H3GA 4PCTA 3VDBA 1GOIA 2O92A 2PI6A 2VVSA 1HKIA 1WZAA 4UCFA 4Z2KA 4DWSC 3UERA 2WBKA 3AXHA 4YN5A 5M17A 4TTUA 2YL6A 2DSKA 5A6SA 2D3NA 4GI6A 3G6MA 1E4LA 4QLKA 1E3ZA 1DTUA 2ZUVA 1SFSA 2BHUA 4PYSA 1OM0A 2DH3A 3HJEA 1CGVA 4HMCA 3ARQA 3SUUA 2DT1A 1U33A 5AY7A 2PWEA 3AS1A 1BSIA 2J7EA 1AMYA 3RM9A 2UY2A 3OLEA 3BLPX 4TX8A 1WDQA 1R87A 1TE1A 2A3CA 4GINA 2A3AA 1HVQA 1IZKA 5JBDA 3N18A 3SCWA 1W9XA 1OD0A 1YHTA 2JFEX 1CPUA 1Q6FA 1GQIA 4GPNA 1UD6A 4GIAA 4UFKA 1R7OA 1TVNA 2VX5A 1ZU8A 1LWHA 2WMIB 4J28A 3SCTA 1GVIA 3GH4A 1MW1A 4TVDA 1A47A 3F5LA 1PIFA 2C0HA 2GK1A 1ISXA 4PMDA 4UFIA 4DUXA 2CHNA 3ZR5A 1JXJA 4EAMA 3N9KA 3WSUA 2W5FA 3GTNA 4K68A 2BVYA 5LA2A 3CZEA 1KGWA 1BYDA 3GZAA 3FY1A 3B9DA 1ODZA 1NWTA 3UR8A 2UWFA 4P7RA 3SCQA 4IPNB 3VGDA 2VCCA 3T08A 2DT0A 2ZOXA 7CGTA 1HJWA 2ZX8A 5ABGA 2VRKA 1G9HA 2J4GA 3AZSA 1RD6A 1EOKA 3W4RA 3BGAA 3MANA 4JCLA 2W67A 3CMJA 3BAWA 2JEPA 2W66A 4PSRA 1C92A 1WCGA 1NARA 4M56A 3N11A 4NI3A 1QI5A 1W1PA 1ITCA 4A4AA 1KBBA 2WWCA 3SCNA 1QW9A 2XFFA 4UZUA 1M03A 1H4PA 4OIFA 4E4PA 4DUVA 2DIEA 1C8QA 2OYLA 4PTXA 4H8HA 3L4ZA 2XIBA 4C7GA 4AD5A 1Z32X 2BVDA 1HN1A 3U5YA 5CLTA 5E0FA 5CGTA 1OGGA 1AQMA 1LQ0A 4XZWA 4P8UA 3MUIA 3MKKA 1QHPA 3ARPA 1UD4A 3MSGA 1PZ3A 3EDEA 5LYRA 1QBAA 4WF7A 2JF7A 3AJ7A 4W93A 4A3HA 4MDOA 3QHMA 4W86A 5A6LA 3NSXA 3AMCA 1HKJA 5A69A 4OKDA 5A8QA 5ABEA 1D7FA 4W5ZA 1EHAA 5BXTA 2XUCA 1JZ6A 2YLLA 1TMQA 4P7QA 3VINA 3VPLA 3AHXA 2WHJA 2F8QA 3AMKA 2J62A 3GDBA 3IJ8A 4M82A 4MB5A 1GORA 1H09A 4M24A 1VBUA 1C3FA 1W91A 2VR5A 2X8RA 1CBGA 3WDPP 3AS3A 1OSEA 2BHYA 4EK7A 4UZSA 3GXDA 3OA5A 1E4NA 1QNQA 1E9LA 3WQ6A 4ZXLA 1E4MM 2YA0A 2D3LA 3AZTA 4AISA 1NOUA 3UG4A 1NOFA 5JIWA 2WHMA 3ZJ7A 3WENA 3EMQA 4MB4A 3ZSTA 4HOZA 2CHOA 1CYGA 1GJUA 1KQYA 2WZHA 5ABFB 1FHDA 4EE9A 1GQJA 4OOZA 1FH8A 1MQPA 1E5JA 4PMUA 5I24A 4FLOA 4DWSD 3WDRA 1V03A 1J10A 4ACZB 2VURA 1PIGA 1B3ZA 4MDPA 3QOMA 3FN9A 4KGLA 2RGMA 4U5IA 3GBEA 1ZB5A 2VZOA 4HTYA 1KCKA 1H5VA 5A8PA 4W5UA 3IAQA 3W81A 4PUDA 3CGTA 2A3BA 2WVVB 4HOWA 1ODUA 3WEOA 4XX6A 4HA3A 1E0WA 4U3CA 3A4XA 3AMGA 3VDCA 3VIPA 5C71A 1QNPA 1CEOA 1B90A 1LL4A 2IUZA 1TVPA 3O9NA 1HNYA 1H11A 2VUYA 4UFHA 4WJXA 3K1DA 5FCZA 3WNLA 2AAAA 1G5AA 5DO8A 2YIHA 4XB3A 2WZEA 3DYOA 1VFMA 1BYCA 2W62A 1RP8A 5BYWA 4CU8A 4DWSB 4BS0A 1V6YA 3UG5A 1VB9A 3DYPA 2V38A 1UD8A 1EA9C 1E6NA 4W84A 3W25A 2WSKA 4PN2A 4AEFA 1VFOA 3VIGA 4S3JA 3VMPA 3FAWA 3NDYA 5GNYA 2VZUA 1H49A 1Q6GA 4PBGA 2CEQA 4MAVA 1J0YA 1EO7A 1QW8A 1PBGA 1MYRA 5A2AA 4W7WA 5A8OA 4AZ6A 2Y24A 4UNIA 4YHEA 2GSJA 4F9JA 2AMGA 4OOUA 1JYNA 3SIMA 3PZQA 1WAWA 1J0KA 1LJYA 3MSDA 3MMDA 4AY1A 3RIKA 4HU0A 1J11A 1HL9A 4U3AA 4KRUA 1GUVA 3POCA 3WDIA 2X1IA 3AIEA 1GQKA 2OYMA 4X9YA 4ZFMA 1JI1A 3WY1A 1OINA 4BF7A 3W6LA 1GONA 4CD8A 1UD2A 1VEMA 5D9PA 1LLOA 2XVPA 3ARRA 1MW2A 3CBWA 2VX4A 1D3CA 1US3A 2YOCA 1E6ZA 3AISA 2VNCA 1UR9A 3MO4A 2V5CA 4GI9A 2D24A 4J3UA 1C8XA 1VF8A 5LA1A 2VTFA 1DWFM 3GXFA 1G01A 4AZCB 3AQUA 3AIRA 4QLJA 1X6NA 1U30A 2QHAA 2WB5A 1KFWA 1CNVA 3OLIA 4B9YA 2EPOA 1NM9A 4BA0A 3KZSA 4GXPA 2WKLA 3WNMA 3WUGA 4UFMA 1B3XA 4AZ5A 3CZLA 3BC9A 5HPOA 3ZR6A 1MW3A 1CGTA 3TTSA 5GNXA 3T2QA 2VI0A 4NRSA 2W91A 4B3LA 2J8FA 4HPGA 3ZO9A 2TAAA 1CGXA 2WWDA 4UOQA 4S3KA 1MVYA 3RDKA 3BH4A 2W63A 1F4AA 2VL4A 4HA1A 5EMYA 1UWIA 1J0JA 1US2A 4KMQA 2WVTA 1RPKA 2DSZA 3PZNA 3LMYA 4MJ2A 3DC0A 5EFFA 1UQZA 1GW1A 2XFRA 1ZL1A 2BY1A 3U7BA 5DMYA 3PZOA 4GO9A 2BFGA 2ZE0A 2JALA 2X09A 1BQCA 3T2PA 3ARTA 1GVYA 1E72M 1JZ7A 1E4IA 5BROA 1HJVA 3JUGA 2NT1A 1W2PA 1EQCA 5JIPA 2ZX5A 3N1AA 4L4PA 1WDSA 3POHA 2WHKA 2VOTA 3VILA 2ZUTA 4XZBA 2GJXA 3TONA 4JFUA 2XTKA 3VIKA 3APGA 3IJ7A 2J47A 4PMQA 3ZJ6A 1AQHA 4TUFA 2G3IA 1UR2A 3L4UA 3WD3A 1CDGA 3T0DA 1UZ4A 3VDAA 1L8NA 4RE3A 1ZJBA 1OT2A 5A6MA 1J0HA 3FNDA 3KL0A 1E6QM 1M7XA 3GM8A 3WDQA 3QOKA 1W2VA 3W24A 2BY0A 3VNYA 2O9PA 2XSAA 4AZHA 3NDZA 4D6JA 2GK1B 4UFJA 6CGTA 4CCEA 1UWRA 2PWGA 4PMOA 2J7GA 1R7AA 1K9FA 4J3WA 4CUCA 4OZOA 1HX0A 4XUYA 2VZTA 3WD0A 3ZT7A 1U2YA 2G41A 1JI2A 2XGIA 4QP0A 2V3EA 1CGWA 1UKTA 1KGUA 2QLYA 2WANA 1CXKA 4X0VA 4ATDA 3VOCA 2D0HA 1GOMA 5JUVA 1EXPA 1UYQA 1Q6EA 4QFUA 2FGLA 1J01A 2VRQA 1CXIA 3FW6A 1NWSA 1WP6A 2WYSA 3LPOA 1B3VA 2JIEA 2YA2A 2XVLA 3MU7A 4JFWA 3RJYA 4NF7A 3OZOA 1UH4A 1W3JA 1W9DM 5BRQA 4WSJA 2E9LA 4U33A 5M03A 1FOBA 2CCRA 2WMHA 3WL1A 2WBGA 2Y8KA 1J0ZA 1XH1A 2CBUA 1UWUA 1WZLA 1WZMA 3SCUA 3VIOA 1YQ2A 2J25A 3QHOA 1VJSA 4Z2JA 4CU7A 2CKSA 5A95A 4ZXOA 4HZ6A 3RPMA 1JYXA 3ZIZA 1PJ9A 2XPKA 2V3GA 4AD0A 1VFFA 4PTMA 1UQYA 2CXGA
chains in the Genus database with same CATH superfamily
3RLUA 3L4YA 1RBLA 3THCA 3PA7A 4GIRA 1ZZMA 1OX4B 1QDSA 3PJWA 1TFVA 3SCOA 3AJXA 4FX7A 4MLRA 3AZRA 2ISSA 3CMFA 4R9XA 5DRIA 1UP2A 1UKQA 5HANA 5A1AA 3BV7A 4HSOA 3W37A 2Q01A 2VR4A 4IFRA 1PHWA 2W92A 4D6DA 1KKRA 4O52A 3T0CA 2PV2A 2JE8A 4Q4RA 4X9SA 5DFAA 4TVUA 1VJIA 2V30A 1GG0A 3QY7A 5A8NA 3EWXA 3GW3A 4JICA 2G50A 4HHLA 4O4VA 4DT4A 3H8AA 4DRHA 2LPVA 5K9XA 3UXDA 3MUY1 1XBXA 3GBDA 2HPMA 2PBCA 5GPRA 4K2SA 1FH9A 1HUVA 1BVZA 4MGGA 1LCOA 3CMGA 4KIRA 4MWAC 3WQFA 4MUPA 4JTGA 3MJMA 4NHVA 4M0XA 4PTWA 4Q33A 4JXCA 2PDIA 2Z2BA 3B9EA 3N6HA 1VIZA 4R7OA 3KVLA 3BPWA 4H41A 3CM4A 3L5LA 3B8IA 1FHLA 2DH2A 4DUWA 4GIYA 1RJRA 5E6ZA 4RDZA 2YW3A 4AVFA 3GR8A 2ESCA 3AYSA 1IHIA 4FX6M 1XCWA 5I3JA 1R2SA 2GQAA 2ZQ0A 3EOLA 4DM2A 2D20A 4Z17A 3WDHA 2PGWA 1H1NA 3VX0A 1YE4A 2OZ3A 3W71A 2YBVA 3GDLA 1OG6A 1Q6CA 3R8RA 2HBXA 4NZ1A 4X61A 3M07A 1MQQA 3M16A 4J27A 5TQLA 5DCBA 3WLMA 2AQVA 2PLMA 4AAJA 3N6QA 2WPGA 4R34A 1XRVA 4RZBA 2ZTJA 3V7PA 4Q8QA 3JYJA 4KCUA 3BL3A 5D2WA 3BCFA 3GW0A 4F66A 3GUWA 3UZWA 1LTDA 2J7BA 1YADA 1C91A 4EPEC 1X7FA 2ZXQA 3MJYA 3ITTA 1QU4A 4RK8A 4UQ9A 2V8ZA 4AWEA 3VD5A 3E74A 2E0PA 4BQ3A 1OCJA 2FGZA 1LG1A 5A94A 2X2GA 3GPKA 1VZWA 4OTKA 2CWXA 4AIEA 3NTPA 4IGSA 4TX6A 1OWQA 1F76A 2FFCA 3F5JA 3AXMA 4FXRA 2CBJA 3KRZA 3DOPA 1UR8A 4HYVA 5FESA 1XYAA 4GACA 4B3ZA 5C55A 3K4DA 4Q22A 3IIXA 2VZSA 1MDRA 4U85A 1TPEA 2CKRA 4F8XA 4L1GA 2XZ9A 3B04A 3UF9A 3PG9A 9RUBA 3AXIA 3CWOX 3GNOA 3S5SA 4MADA 4D8ZA 1QXLA 1W3IA 2HXUA 2PF0A 2DZSA 3QYQA 2ISVA 2BS9A 4NQ1A 1JPIA 3C6CA 4ZL1A 4DO6A 1MI3A 4MJZA 2XFYA 4XKYA 5AECA 3WQVA 2ZTKA 4QCFA 3A22A 4HBEA 1QNRA 4DX3A 5BOOA 3E6EA 4UTUA 3AS0A 4JFLA 3OZYA 3QV8A 3CASA 1TV2A 4ODLA 1O68A 1XBZA 1EGZA 2NV1A 2FHBA 2ZQUA 1Q6HA 1U79A 5I0DA 1EZWA 4I9TA 3TN3A 3ANVA 1LRQA 1GEQA 2ZZ2A 1R2RA 3O6AA 2RFGA 3ZYZA 4YCPA 4XD3A 1TJRA 4ZOEA 5I98A 3T05A 2ZUMA 3N04A 4ENLA 3QGKC 2X30A 5FIPA 4FAMA 5E0KA 4ZENA 3W6MA 2FZDA 4MYXA 4PCSA 1TIMA 2ZWYA 3WH8A 4JTAA 1JD9A 1T11A 3E5BA 4L4MA 1KCXA 2AAMA 1FVPA 2GJPA 4QROA 4YWIA 1I2QA 4JFMA 1AW5A 2WMKA 4HN8A 1EEXA 5AC4A 2ZXAA 3VIJA 2F38A 2X2YA 4UOZA 4M81A 1FKRA 3COTA 4PCPA 4CNPA 4IMCA 3WQCA 4DJDA 4I3GA 1QHZA 4IZGA 5DMNA 5T26A 3NZPA 4DWDA 3ARUA 1LLZA 1GQNA 2ZR4A 3TH6A 1KFCA 3UGVA 4LBRA 3ARYA 1M6JA 5IBXA 4ADUA 4U84A 3NQFA 1S2AA 3UWYA 4M1BA 1DHPA 1HXJA 1M65A 1Q4NX 1P6WA 1M7JA 1GWJA 6TAAA 1GYLA 2EHHA 3BSHA 3ELFA 1LRNA 1R3WA 3G8EA 4RE2A 4TYOA 3L5AA 4AIOA 1BFNA 2VEPA 4F0KA 4C6MA 4NP7A 4B9ZA 3R58A 3P67A 1C8YA 4CNUA 1QK2A 2NT0A 1E15A 1QBBA 1FP8A 3W26A 3A5VA 2X1UA 3P8JA 4WKHA 4KEUA 1OBAA 1NFBA 2I16A 4GX8A 2R9RA 3B8SA 1RK6A 1IX5A 2QAPA 3NZQA 3RG6A 4WCJA 1R9XA 4TO8A 1LBLA 3FJLA 1W32A 4HN4A 1K9TA 4U2ZA 4LANA 5D32A 4PUUA 4B5SA 3O0FA 1UA3A 4M19A 2DY3A 2DGAA 4LEQA 4NRRA 5KEZA 4PH6A 4I5RA 4JPGA 2DG3A 3C2RA 2Y2WA 4WSHA 3VX1A 3OIHA 1KXVA 7TIMA 2HEJA 1N7KA 4D72A 1LUCB 4A8RA 3OTRA 4JTDA 3S2JA 3HU7A 1XDLA 3ZWTA 4AW7A 1EOMA 2UZ9A 1RR2A 3MCOA 1XYMA 3MQTA 3W1TA 1RK5A 1ZAIA 3F5KA 3N34A 3TLQA 3ZLHA 2Z1VA 4QDWA 3W2UA 4L1WA 1CXHA 2Z1KA 3WNNA 3MUZ1 3VD7A 4M80A 2RAGA 3K8KA 3T9PA 2WKGA 2AQWA 2NLYA 4MNKA 1OB0A 3K8LA 1L6SA 3B0XA 3UWUA 1EZ2A 2XWEA 3LN3A 4UDMA 1V6VA 5DLCA 3UJ2A 5JMUA 3WBAA 1DJIA 3W38A 1V6XA 3NNTA 4JHMA 2BV9A 3TYDA 4PR4A 4ZMGA 2QMJA 5EL1A 1KTCA 1XD1A 3LYEA 1WXZA 1QPFA 1G6CA 4JX5A 5BMWA 1QTWA 2ADAA 5B7ZA 2INFA 2XIQA 3HPZA 1A5NC 2GSEA 4UQCA 5CXPA 3UPMA 2JKEA 2KFWA 2V3DA 5KZ6A 2GYIA 3N15A 3F7JA 4ZTYA 1J0IA 1PKYA 3NQDA 3A4JA 1CW2A 3UF8A 2ZZ5A 1VPQA 2V5LA 4O28A 3QN3A 3PTKA 4BI7A 4H7VA 4H8VA 3E1F1 3KP1A 3F2CA 1SZNA 3DBNA 3VUPA 1S3TC 2XG9A 4RL3A 1ZBCA 1A0CA 1DHKA 2AL2A 1O5RA 3W7LA 4FO4A 5MKGB 1E5NA 4AVNA 3S6DA 4QLLA 3TSBA 4FOUA 4IICA 4OT7A 3IIOA 1P1MA 1XSJA 1HVXA 3E2VA 3ZJ8A 4O4WA 1TMLA 3TDFA 4GNVA 5CQ1A 2E5DA 3CC1A 3DENA 5EB8A 4JGDA 3CQHA 3LNPA 3SCPA 3SY5A 1P1XA 4JQAA 3LOTA 1B5TA 2Z29A 1YW5A 1W6TA 1GPWA 4GY0A 4HNUA 3PB2A 3EWZA 4ODNA 3FYYA 1H41A 1Q6OA 3AIQA 2CBVA 4TV5A 5HMSA 3T78A 1TCDA 2QIWA 2VWSA 4WX2A 3HQOA 4HNLA 1UKOA 1QPQA 2YB1A 3WG6A 3W7GA 3K4WA 5C9ZA 4TX0A 1ME8A 1BTMA 4MSSA 4O0KA 1BQGA 1XLGA 2PV3A 1U1HA 2PGEA 3W27A 1JXKA 3FK4A 3RLVA 3SQSA 3TIMA 2A3EA 3BE7A 2TODA 3FIGA 3CHFA 5J5RA 2V5KA 3I6RA 5A8MA 1B31A 2P8CA 1FCBA 3CT2A 3FFSA 3H22A 4G1KA 1TTJA 3QEZA 4GX9A 1VEPA 4A29A 1IV8A 1O7AA 4RV8A 3F2DA 4UIOA 3NR0A 3PTQA 4V2XA 1A50A 2ZA2A 1CZ1A 4UR8A 2D22A 1EL3A 4DJFA 3RRAA 1PTGA 1VLWA 3O5EA 2X41A 5BCAA 3EKLA 4CN4A 3T07A 2PMQA 4IG2A 5HOSA 3BARA 3S2MA 1WXJA 3VMNA 3P3BA 1SZEA 3O06A 3B8WA 4G8TA 5DXYA 5M3WA 3KWSA 5EMUA 3B8DA 4AC1X 4DRKA 4JIRA 3TCSA 2PZ0A 2O9RA 2ACRA 2Y89A 1WB0A 3BZGA 5FF3A 1W3KA 5E9XA 1ZJAA 2DZWA 5BOFA 1FKWA 2W4XA 2Z26A 3LHZA 3SY1A 1RQBA 2GGHA 1XW8A 1XINA 4DJEA 3WIJA 4FNTA 2OTDA 4ZQPA 1F6KA 1ZK6A 4ZOCA 2XVKA 1J9YA 2A2IA 3NQBA 1JDAA 3RR1A 4GZEA 2BNJA 5BW6A 3PULA 3V1PA 3FOKA 4IP4A 2VVNA 4GVHA 3WK1A 3G0SA 4AYGA 4HA4A 4FR1A 7ENLA 3GC2A 2PAJA 4GKLA 2P76A 5FL1A 3L4VA 3ANYA 5A3HA 4XD5A 4IP7A 4ML9A 4QSHA 3I7QA 3PUOA 4DAIA 1UWQA 2YL9A 2WMIA 3AC0A 4H9YA 3OBAA 4UTIA 1J2BA 3ABRA 4D9PA 3PJTA 1FTXA 3LTPA 4ACYA 4W4QA 3EIPA 3AOFA 2X0SA 4PBFA 3OO2A 3GKAA 3VD4A 1FWBC 2J9YA 3NQVA 4QHRA 2WMGA 3RO6A 1Q4WA 2NUWA 5A6TC 5U7SA 2GGJA 3PVFA 2EQDA 3M0LA 4C6LA 1ISVA 4JHZA 3RM4A 1UASA 1TVLA 4S38A 5I6SA 3LENA 3EDJA 2ZQSA 3UJEA 4MB3A 1M41A 3S3GA 1VYRA 4A3RA 1VH7A 4FXFA 2OELA 3ZT6A 4HOXA 4H6EA 3D5HA 2BG5A 2BOFX 1PPIA 4U2YA 3RX4A 5HW6A 2JEQA 2YFOA 1FDJA 6ENLA 4Q32A 4UTJA 1K4HA 1FWFC 5A2CA 3EOUA 1R8LA 1P0NA 4PUJA 3GU2A 2JQXA 2E8YA 4LF1A 9XIMA 2F6XA 3HMJG 3TEVA 4KCTA 1MUWA 4G5DA 1N8FA 1XLFA 1V3IA 4V27A 4GJ1A 2A4AA 4X63A 1DWHM 3W7PA 4BCEA 4N4PA 4WQ6A 2G3JA 1HGYA 2V69A 4PULA 4BKNA 3QPYA 4GVIA 2F61A 4ZZ9A 3D6NA 1VFSA 1ISWA 1AQFA 4EXAA 4GGHA 4LVAA 2V9DA 1JFXA 1S5VA 5D4YA 5FJPA 3O5JA 4MB1A 3UT0A 3TW7A 2A85A 2GGIA 2IPGA 3E0IA 4R3UA 4HIBA 1BL4A 2CYGA 1BYBA 5KITA 4A2SA 3VAVA 3H55A 4N42A 5DITA 2CESA 4MTVA 2P53A 5D2XA 3QMTA 2DW7A 4YHGA 4DRIA 1XRSA 4AY7A 1UKPA 5CJMA 1UBPC 5GQBA 1BGAA 3I6EA 1P0DA 3W1NA 5LNVA 2VFHA 2HZGA 2PF8A 4AZ7A 3KOZA 4MAZA 4C1NB 1IQ8A 3XISA 1W8GA 3TMLA 1I2OA 1MZHA 2XP5A 1SJCA 4IIDA 4D6HA 3PR2A 1A49A 9XIAA 1XICA 4B4HA 2XP6A 3OOBA 2A3HA 4O57A 4IJCA 4H01A 4DRMA 3NDOA 2Y8VA 4W9OA 3I3DA 3KL3A 4HPHA 2B4GA 4IPXA 4LUIA 3QLLA 3HF3A 5B80A 3M7SA 4LVFA 3EXSA 1C7SA 3N12A 4XIMA 3GWQA 1X1NA 3G1RA 1KB3A 4EWJA 2YXGA 1K9DA 1TRIA 3P80A 2GGEA 2CLKA 5E9AA 3B0UX 3V0UA 3DESA 2XVNA 1E6XM 4W7UA 3EGJA 4DWSA 4LCSA 3LSCA 4E5TA 1YX1A 1ADDA 1V3JA 3I3EA 3UCDA 3B4UA 2WXDM 4GG9A 2CLPA 4AD1A 2G3MA 2PLJA 3WLSA 4AC7C 2JGQA 1IT0A 3FXYA 4LRSA 1QHOA 2OEKA 5C9WA 4IISA 2PBGA 3LCWA 2IPWA 4CVWA 2GDVA 3VZYA 3UJFA 1RUSA 2PRHA 2PPOA 4FF5A 1ITQA 4E3VA 3R25A 1TQJA 5LNWA 4K6AA 4GBDA 3DG3A 1KA9F 2ZA1A 4HZ8A 4PMVA 1GOQA 5IBXC 4LCRA 4C1KA 2XPAA 3EWCA 4GH3A 3UQBA 1EUAA 3R10A 1DEDA 3GYCA 5CPLA 1W26A 4LEFA 1AW1A 4AXNA 3R1ZA 2IMRA 1XIBA 1ROTA 4JFKA 1K1DA 3CWNA 6XIAA 4H7ZA 5G2WA 3C56A 4HT3A 1M7OA 1HP4A 3MV11 4D6EA 2AL1A 4EF8A 2E67A 1Q1CA 4DRJA 2YDQA 4WDTA 2HV5A 3BAKA 4G2PA 3HG5A 1TZ7A 3O3RA 1HTIA 2HE5A 3K8MA 3KL5A 1V0KA 5FD0A 2GDQA 1XCFA 1C90A 3G5EA 3ALFA 1IR1A 1XSKA 1OIFA 1ONRA 4GC3A 2VQUA 5LIKX 3CV7A 3EKZA 3PSWA 5T91A 4KH2A 4LUSB 5B7YA 1D6OA 3CUXA 1DJZA 1NDZA 2QJMA 3TW6A 4UR9A 1O4UA 5IFPA 4A21A 4PCFA 1OIMA 2MPHA 4QCEA 4XSMA 1HGWA 2QCHA 2E09A 4ZFCA 5GJMA 2J7CA 4GD0A 4B3KA 5LGXA 1UH2A 4DO4A 3NURA 1KWKA 3GK0A 4V1YA 3VDBA 1GOIA 3CXOA 2BVWA 3W2LA 1S3HA 3TWAA 3D46A 3N14A 5M17A 4TTUA 2YL6A 4US5D 2D3NA 4DRPA 4S2CA 5TF0A 1DTUA 3QZAA 1SFSA 3WJZA 1OM0A 3C0QA 1TO3A 3W75A 3HJEA 5CC5A 3TWBA 3G1VA 3ARQA 4NG3A 3SUUA 2DT1A 1OFAA 1BSIA 2ACSA 3RM9A 3F4CA 3VKJA 3OLEA 4QGCA 4WY0A 3CS2A 1TE1A 2OEMA 3BJSA 4E2VA 3MZ2A 4GINA 1HVQA 3HG2A 3N18A 1F3TA 2XP4A 3TJLA 4MKVA 1CPUA 4DF1A 2FTYA 4DF2A 1KBLA 2V5JA 3LI1A 3W87A 2VX5A 3V1HA 2PDLA 1LWHA 4UTTA 3KOYA 3NPVA 4TVDA 1PIFA 2GK1A 1W5PA 4DUXA 4GQ0A 2IKHA 3N9KA 4EAMA 3WSUA 4Q7BA 2W5FA 4FB7A 2WOQA 3FA5A 2PFHA 4RZ5A 3T7VA 3E0WA 1RCXB 3UR5A 1ODZA 1NWTA 3UR8A 4Y9MA 2PDWA 1QMLA 1NIUA 4IPNB 1A4MA 2ZOXA 1HJWA 3BMBA 7REQA 1Q5MA 2ONEA 1K8YA 3LB0A 3MB9A 2VRKA 1G9HA 1VRDA 3JZUA 3MANA 3CMJA 3BAWA 1P5BA 3KVKA 1DYSA 4PSRA 1MDLA 4M56A 5FF4A 4DXKA 1HZYA 1KBBA 4ERGA 1QW9A 2DZBA 4DNMA 4OIFA 3W7QA 4HMNA 1C8QA 3RCYA 3W1MA 1QR7A 5AHIA 1Z32X 3A21A 2XISA 3WJWA 2P8BA 3ONCA 3AU2A 3M43A 3H6OA 3LM7A 1UJQA 3FVDA 1XIIA 4XZWA 1U1JA 2C79A 3MUIA 1CT5A 2XP3A 1UD4A 3AYVA 5K7JA 2BASA 2PEVA 1PDYA 2HPIA 4QJ1A 5H6HA 5FJRA 5A69A 1JCXA 2L2SA 2BOEX 5ABEA 1D7FA 2CZEA 2Z25A 4NZ4A 3XIMA 4N19A 1JZ6A 3VINA 4P7QA 3FSUA 3AMKA 5HNRA 2VXNA 1D8CA 4CQ8A 4M24A 1W91A 2X8RA 1CBGA 3KOWA 3AS3A 2ALDA 3QR0A 4B5XA 3WH0A 4EK7A 4UZSA 2R1LA 2FPTA 4YTUA 1E4NA 1QNQA 1E9LA 3VC5A 5JU6A 2HS8A 2YA0A 1OFPA 2OQHA 3O5DA 3QSRA 1OHLA 2D3LA 1L1PA 4RXFA 4XAGA 1NOUA 2YCLA 4PUMA 2WHMA 3ZJ7A 4ICCX 1XIDA 2ZA3A 4MB4A 1CYGA 3GDRA 1Q8AA 1Q8JA 5ABFB 4KF1A 2VEFA 2TRSA 1FHDA 4EE9A 1I2NA 4OOZA 1FH8A 4FLOA 1EP1A 4HNOA 3AAMA 3ENLA 4US6A 3QOMA 1EXBA 3FN9A 3PJUA 4AH7A 2RGMA 1NMVA 5DCEA 2VZOA 2BGSA 5H8UA 4HTYA 5A8PA 3IAQA 3ES8A 1VP5A 3MHUA 1LYXA 1FKXA 4XZHA 2OB3A 3N3MA 1P0BA 4DAFA 4R7JA 5AFDA 4L7ZA 4U3CA 1L8PA 1XIEA 2DG4A 5FEWA 5LNRA 3KAOA 3VIPA 3I4EA 3SBFA 4ALDA 4H6RA 1QNPA 1P5QA 1CEOA 1B90A 5AYXA 1HNYA 1GRJA 1H11A 4UFHA 3IPWA 3N3TA 3U2OA 5FCZA 3VOGA 3DHDA 3LMZA 4OWGA 3DYOA 1OYCA 4C6CA 1VFMA 5BYWA 2G96A 3CHVA 1DXFA 2V38A 1UD8A 3G3MA 4W84A 1LLWA 3VIGA 4K1WA 3IVUA 3TC3A 2E7FA 2VZUA 3U0HA 3KTXA 4DJEC 4PBGA 5I3GA 4YNGA 1J0YA 1EO7A 1Q63A 1QW8A 1PBGA 2ASHA 4GVGA 1ZENA 3O05A 2FAPA 3TR9A 5BZAA 3K2GA 4W7WA 4R85A 4UNIA 4F48A 1JCTA 3HQ1A 1AD4A 2PWVA 5MF5A 4NNAA 3MSDA 3DH7A 4N9BA 1HL9A 4U3AA 4KRUA 1GUVA 1GZGA 1B54A 3NQEA 2L5HA 3AIEA 4JTUA 4EOUA 4ZFMA 1EJ7L 1GONA 4CD8A 5EMKA 1C9DA 1LLOA 4LS1A 3KVMA 1H7WA 4DB7A 1BEUA 1XS2A 3KHDA 2YOCA 2EG6A 3AISA 2VNCA 4MWAB 3RF9A 3VE9A 1UR9A 3BOFA 1Y0EA 1EBHA 2D24A 1C8XA 4Z1AA 1AG1O 2VTFA 4IJBA 3EX3A 3U2ZA 3T0TA 1G01A 4H6QA 4AZCB 3AIRA 1KBIA 3O5QA 3MI3A 2QHAA 5GPGA 4S3EA 1AZ2A 3MA8A 5EY5A 1GKQA 1TV7A 1EP3A 2ZFAA 2E77A 2WKLA 3WUGA 3I10A 5HPOA 3LRMA 4J5NA 3G8RA 1CGTA 4ES4A 2QJJA 4LALA 1QPRA 3MSYA 2VI0A 4NRSA 2J8FA 4HPGA 4WXYA 4NNRA 1CGXA 4UOQA 3VXGA 1F9CA 3BH4A 3LHTA 3UY8A 4B2DD 1ZCOA 1RQEA 5EMYA 1J0JA 1EYWA 1ZGDA 4C91A 4KMQA 1YE6A 4Y8EA 2Z6JA 3CPRA 4DNHA 4WHBA 4MJ2A 4LUYA 3TC7A 4RPPA 2W0UA 1ZL1A 4QXIA 2BY1A 4MF4A 4H4IA 3PZOA 4GO9A 1K3UA 2YW4A 2JALA 2X09A 4CQ9A 3GD6A 5BROA 4QNEA 1HJVA 3JUGA 5F2GA 5JIPA 2Y7FA 3N1AA 4L4PA 3GAYA 1WDSA 3POHA 1MNZA 4XZBA 2GJXA 3VIKA 4RPQA 1FKJA 5FJTA 3B06A 3BO9A 5H8PA 4OQVA 1UZDA 3WBYA 3FJ4A 3MO7A 1PZ0A 3WD3A 1CDGA 3GC5A 5CBIA 3W1RA 4RE3A 2EKCA 3L0KA 4XBSA 3KL0A 4K7VA 3O7UA 3BW3A 1M7XA 1L2QA 5HWNA 3EXTA 4EACA 2OLSA 4HNVA 4C65A 3M1ZA 2ZZ4A 1UOZA 3H4WA 2H9AA 3NA8A 4U28A 4D6JA 4X3ZA 2PCQA 4PMOA 2J7GA 4B90A 3LQGA 2YCJA 3GTFA 4J3WA 1NAL1 2ZKMX 1HX0A 3LERA 4XUYA 1FWHC 2ZZ3A 3RX2A 5AVHA 4BEUA 2XN2A 3B0PA 5HWMA 1RA5A 5K3VA 4BEQA 2V3EA 3QZEA 1UKTA 1KGUA 2PV1A 5E93A 4ATDA 2NQ9A 2WSQA 2VHLA 3W1QA 4DZ5A 2ACUA 3I7RA 1UYQA 1PV8A 1QFEA 2VRQA 3M0ZA 3GG8A 5FSEC 2WYSA 1B3VA 3THAA 2JIEA 2YA2A 3W84A 3ZLFA 2XVLA 3GHRA 4JFWA 4QSFA 2DJXA 3CL8A 4L9XA 2RDWA 2GSHA 4AHQA 1W9DM 1XPGA 4WSJA 4AX6A 4L80A 3GVQA 4E6MA 3S5NA 1G4PA 3CK5A 2YFNA 1TPC1 3W2MA 2V0TA 1FOBA 2CCRA 5F1UA 1K03A 3TYCA 4D8LA 4KW2A 3UZJA 2CBUA 3STFA 1JVWA 4XAKA 5HMDA 3TN4A 2JZVA 3R0DA 4Z2JA 5FJIA 4NAEB 1PKMA 4CU7A 3LXAA 4HZ6A 2ISFA 1JYXA 2XPKA 3QM3A 2OODA 1VFFA 4HZMA 1WBJA 3T1GA 2QV5A 4W85A 4LWWA 1WKYA 1ICSA 1R47A 5BOEA 1GZ1A 3MUXA 3NQ8A 1VPXA 2XP8A 4E38A 1KR0A 2D69A 4GQQA 4IGMA 3HGJA 2C8NA 4X0NA 3WLIA 4F0RA 1LDCA 3QV7A 4L72B 4O11A 5CSUA 4HP5A 4URIA 3G1FA 3UY7A 2NZLA 3S9YA 3KE0A 1BKFA 1TMHA 3CB8A 6A3HA 2NXIA 1ZP4A 2WC3A 3LCLA 1DL3A 5D2VA 2NLIA 2Z1WA 5A6AA 2ICSA 1B3OA 3FA4A 1DPMA 3NO1A 4NASA 1SR0A 3MMWA 4CNNA 2OX1A 1RVGA 4H19A 3VNZA 3NSNA 2A6NA 5FOOA 4KCWA 2YLAA 4I7VA 3NYZA 4H9TA 1CGYA 2O4MA 4N7QA 1Z8AA 1HJSA 1FWSA 2REQB 3O6CA 1TR1A 1QI2A 1H63A 3C0SA 4NL1A 2BX7A 2D2JA 1DE5A 1ZBKA 4MNJA 3OVQA 2NVCA 4DRNA 5C5YA 1NOWA 1G4SA 2YX0A 4O1BA 1HKMA 4JKKA 5XINA 5D2YA 1JULA 3AROA 4MYAA 1G94A 3E02A 3EX1A 4JFSA 1JCJA 1VCGA 3H24A 1PX8A 5I07A 2FTPA 3MKVA 2ON3A 4LAZA 3B7XA 3KADA 2PPGA 3CO4A 4LTSA 3WK0A 3P61A 4HARA 3BOLA 3WDJA 1X6LA 1UJPA 3SSZA 1L6YA 3GDKA 1PKLA 3CIVA 3WLLA 4Q4PA 5BXRA 4H00A 3WD1A 2OLHA 2VD8A 3EX2A 3N2OA 3H2EA 3CLMA 1F3WA 3C52A 2FHFA 4IL2A 4Q7NA 4Z2LA 3W02A 1X7IA 2YDAA 1TREA 3TA9A 3BLIA 3UNTA 1JJKA 3A4AA 2PGFA 3BG3A 3QRHA 1BWVA 2FMNA 4DBDA 4YJ5A 3WLRA 4O2TA 4ZCWA 2CC0A 3F4NA 2G4FA 3GVGA 2RHGA 1W56A 3REQB 3RILA 1I1WA 3WNKA 2ZUWA 2NVDA 4D2JA 4KGJA 3OOQA 5AZ1A 3IKGA 4IPLA 2VT0A 1FWEC 1RA0A 4NZCA 5PTDA 3INPA 1X96A 1T99A 4CEXC 5D05A 1DJNA 4XZLX 1V3LA 1Y65A 4TW7A 3BCDA 2CZFA 4CD6A 3P82A 4V33A 1JUEA 1G7UA 1QOPA 4NZJA 4LB4A 3NL3A 3WH5A 4N2YA 3EYPA 1CTNA 4LV9A 1WKDA 1BF2A 4UCGA 2V5DA 2ZWZA 1VBGA 1TPFA 3FGCB 4NJJA 1KCLA 4REQB 2E8ZA 3UR7A 2Y4SA 2QVHA 3HV9A 4NAFB 4W8AA 4GH1A 5D33A 3FLUA 5I78A 1ZP3A 3QSTA 1TELA 3USZA 3ZVHA 4GK8A 1FWCC 1BD0A 4RKAA 2BWGA 1OK4A 2HNEA 4J3VA 4OBSA 3OGSA 1PXGA 3DGRA 3BVJA 3FDKA 3P93A 5M5DA 3MI6A 1YDVA 4BJHA 3AHVA 3SUSA 5DEZA 2WJEA 4NJKA 3G0UA 4KKXA 4UTHA 2OSWA 2NWSA 2A1YA 2N87A 1ZALA 2R91A 2KGJA 3AMLA 3E0LA 4RLIA 4UTMA 4FI4A 4I8DA 3P2VA 1RSCA 4X2RA 1X38A 4YYCA 2BODX 4MWAD 1ZBWA 3T6CA 1JF5A 3ZWSA 4GISA 1AQ0A 3NUKA 4HYRA 4KQZA 4AWUA 4XZNX 3KRSA 3M0YA 1EJWC 1G1YA 3SCRA 2GLKA 1X1OA 4RW3A 3ONBA 4PTDA 3WLJA 3ID7A 1B4KA 2F6UA 3CUGA 3DDMA 3CAQA 1XC6A 5F4XA 1E56A 3JS3A 2QYGA 1WV2A 5D02A 1KRAC 1DJHA 1IE7C 4JCMA 3PPGA 1YTEA 1J6PA 2XSBA 3C3UA 3MDYB 3BJTA 3M5XA 4LXFA 5CEWA 3CU2A 4D6FA 4UNLA 4I7WA 2ATMA 3VKKA 2I17A 1XQKA 1LBMA 3Q94A 4K39A 3SADA 4JN6A 3IGUA 3DKJA 4M1RA 1F05A 3UXLA 2R6OA 1BG4A 2D23A 2D2GA 3VDHA 1KV8A 2DIKA 4XD4A 1J6YA 2IPJA 2J7FA 4YXGA 3OA3A 1M3UA 1F07A 1X8FA 3GU1A 4FXJA 4ERIA 1BKSA 4UQAA 2FB3A 1NFGA 5LKYA 4KQNA 9CGTA 1LL7A 1GCYA 2HVOA 3CPGA 2CZVA 3T8QA 3ARSA 1Q6RA 1S39A 4S3BA 3CUIA 3G6LA 2HWGA 2FH8A 4LYKA 3RCNA 3DC8A 4EIVA 4XBJA 4AHPA 3MY9A 2OZ0A 3BMVA 2BVTA 2IS7A 2OLAA 4DZ3A 4JIHA 3PPFA 1EBGA 4XBKA 1OADA 1V0MA 2IW0A 4V28A 4Y9OA 4LNCA 1KFLA 4ONVA 4JFVA 4PCNA 4Y2WA 2A7RA 1SPQA 3NQAA 1IEIA 2O7SA 2EJ1A 1PAMA 5CPSA 3ITGA 1LG2A 1Q3NA 1KGXA 3FKKA 5FJJA 1IYXA 2WZTA 3SRHA 3NVDA 4HSNA 2B7OA 3RPTA 1EJXC 3VGGA 2HK0A 1MW0A 3CHEA 1OT1A 3WNPA 2LJ4A 1YXYA 4MNMA 1NF7A 2VFDA 2R82A 2EF9A 1GGOA 3E96A 3QFEA 2CFFA 2EG7A 5CAKA 3TW9A 3IKDA 1OX5A 2FLIA 1W1TA 4XAPA 1ZAJA 1C93A 4IIGA 1S2TA 1YXDA 4NNBA 5CGQA 4BWLC 2VD9A 3BANA 2G3NA 3URAA 1K9EA 1WZKA 3OP2A 1ZSXA 4O50A 2WZMA 3WFLA 1QRQA 5C2CA 2DV0A 1OQFA 1YNQA 4IMAA 4HZ7A 4DYKA 2GUYA 1LF1A 2Y5EA 3LBMA 2VFEA 7PTDA 3FX4A 3O2LA 4UNKA 2FDMA 1HT6A 3MP4A 2YZ5A 2Z27A 3NPWA 4A2RA 1A80A 3EXRA 2ZUUA 3URNA 1YKWA 1CECA 4KWOA 2NV2A 1JDCA 1IZJA 2DUZA 1IT8A 2QGYA 1SZGA 4K7YA 4MFEA 3UVIA 3P60A 1CLVA 4NZFA 4MMWA 4MJ4A 4AD3A 3M0KA 3VVGA 2HBVA 2OWWA 2G4JA 3Q45A 4PRRA 4YVXA 3KS5A 1U5VA 2ZR5A 3RJXA 1I0BA 5G4EA 2O56A 4AF0A 3GS6A 2QDGA 2P0IA 1EJSC 2FVKA 4XKMA 3B05A 1FA2A 3PBVA 3PWAA 1V3MA 2B7QA 1AH0A 1K7FA 5I3HA 3W0KA 3H2OA 5G1YA 1G0CA 3VAWA 4JQ1A 4Q7IA 3CTTA 4MUZA 4TOQA 3NTYA 3HMCA 3XINA 1LOLA 4KEMA 1XG4A 4P7OA 5JH8A 4N4QA 3RFAA 3VOFA 4Z42C 3T55A 1CXEA 4QAWA 3KW3A 3ZR4A 2EXOA 2VKZG 3VIFA 4C6PA 2WCAA 4CCCA 1HF6A 1L6WA 4HMEA 1BYAA 2RDXA 3SGZA 1GOWA 2Y88A 3MWCA 3TOPA 1KNWA 2RDTA 2DZPA 1MSSA 3LHYA 4LY4A 3DFYA 3W1LA 2C1HA 1QI3A 1W1ZA 3TR2A 2V6AA 3U4FA 3CZJA 1A5UA 3NPXA 4UQBA 4BF5A 3BLKA 3EWDA 4ZEPA 5C2XA 2LKNA 5HXMA 1IGSA 1J2WA 3IV3A 3PZIA 5JH2A 2FQIA 1PYMA 1XISA 2XH4A 4RJEA 1TA3A 5HUAA 1D2KA 3U57A 3ZT5A 3EWYA 1TKKA 1C9HA 1AFSA 4ROPA 2UV8G 5D30A 3W07A 2E6DA 2VZVA 2V2DA 1MRQA 3R8HA 4E8CA 1V6TA 2DJLA 3GG1A 4XKYB 3WJXA 4DBUA 1MEHA 4XVDA 4HNCA 3ARZA 2AWGA 1E70M 2VFFA 3PZUA 2XPBA 2J78A 1SW3A 2O9TA 1CCWB 3DYMA 4P7LA 1Y0OA 1KRCC 2GDUA 1M9HA 1XP3A 3B0VC 4JN7A 1XV8A 4ZO9A 3HFYA 4R9OA 1YEYA 4CNSA 1XYCA 3WF3A 2XM2A 1UR1A 1V6WA 4GZJA 3DG7A 1NP0A 1UCWA 4C6DA 4EWND 5EMLA 3UEQA 3CV2A 2DU2A 2DG9A 4LVBA 3VKAA 1JCHB 3QY6A 2OT1A 2BHZA 2Y7EA 4MJMA 1MMFA 3N17A 3LU2A 5EBUA 2VN1A 3A3WA 3CGNA 3WX7A 3VNMA 3H23A 3QF0A 2PDFA 3TXZA 3WELA 2YGYA 1XHGA 3LPPA 5LXEA 1N1AA 1W9PA 3IJ9A 4CNTA 1EYMA 3JXVA 3LV6A 3VYLA 2E6AA 3S9ZA 2XYLA 3ATYA 2E6FA 3DAQA 4D1IA 4GBUA 4IMEA 3W22A 3M5ZA 3WNOA 1ZJHA 2ZUNA 3H7VA 3OYZA 4QEHA 1XRTA 1F4HA 4QG8A 1TTPA 1NQKA 3ABSA 5AKQA 1KBKA 1JNEA 1SMDA 2INZA 3GVVA 1US0A 3BXWA 3QVQA 3URQA 4IIBA 1KT1A 4GYJA 4I6KA 3WL0A 1BXCA 3S5YA 1XFBA 1OGSA 1UP3A 4GXMA 3UQNA 4AYSA 4IQDA 4D8AA 4R53A 3TQVA 3R6IA 3CZKA 3E2RA 2F9RA 2Y85A 4US5A 1F6PA 1E71M 1WDPA 4YS1A 1ISZA 4MGVA 4WOQA 1H60A 3BLDA 3SI9A 3PZ9A 3L21A 3WUEA 1Z48A 1HXVA 5D8WA 2CXEA 5DBTA 3OZPA 5IDIA 4ATWA 3CYJA 5ECUA 2O55A 2Y78A 3G1HA 2OWXA 4ZODA 1NMWA 1YPXA 1FJDA 2G37A 4POCA 1N55A 2C13A 6TIMA 1REQA 1GHRA 2MNTA 1RVKA 3LPFA 3SQLA 2J8GA 4H8UA 2XN1A 3EDDA 4YWSA 1BG9A 4B16A 1S46A 5A6JA 2FTWA 2VX6A 4OVXA 1R3VA 3G18A 5LNUA 1RQHA 3SUVA 4Z1DA 3TVAA 2E25A 3ARWA 2E68A 2G8ZA 2PDYA 4PMJA 4ADTA 3ITVA 3W74A 1A5KC 1I60A 3Q2DA 3W7EA 4Y7EA 1XD0A 1VYSX 1EC7A 5REQA 2PTZA 2DEPA 1ZAHA 4O13A 1J5TA 1OF8A 2FB2A 1H2JA 2J6VA 1EJVC 3HPAA 1M53A 1MZRA 2WW5A 1SO6A 1Q6UA 3OG3A 1PTDA 2XWDA 1UWSA 1HKKA 3PN8A 2OFJA 3CEUA 1VJZA 2JIWA 4IOTA 4F2TA 5JBEA 4ODRA 2QT3A 3B0YA 3MC5A 1YXCA 3QKEA 1MXDA 3P5ZA 5I5RA 2IKJA 3AHYA 1POKA 1E9YB 4ML4A 4MY9A 3CZGA 4GABA 1XQLA 2V5BA 1FKFA 3ODKA 4BQ5A 2HNHA 1EPVA 1GPFA 4FHAA 3ISIX 3LLFA 1E1CA 3E38A 2W27A 2XHYA 1TZZA 1G7VA 1KQZA 2C6QA 2ZX6A 4WIWA 1JEZA 3NL2A 1Z3NA 5BXPA 4DBWA 3S8HA 4IX0A 1GVOA 1UPMB 2Z0IA 3OJGA 3VOJA 1PBKA 2PCEA 3QW3A 1W5MA 2Z4GA 2ODOA 5FKYA 1NY1A 4WUIA 1R5YA 1I6NA 3VA8A 3TFXA 3TTQA 5HMFA 4A3YA 1V4YA 4MG4A 3VKBA 4YTTA 4IQCA 3MMUA 4Q4SA 4LQ1A 1U1UA 1H7NA 1P6BA 4WRHA 4UTWA 1OCNA 2AL2B 2HXTA 2XJ7A 3DFQA 4LU0A 5G2HA 3VDGA 2GQ9A 3P62A 3BLOA 3JRKA 3WQ8A 4MPKA 4NT0A 2XSXA 2ZCGA 1B4EA 2AGKA 3AYRA 4J3SA 5CZ0A 2OR2A 1DQWA 3U2CA 3VGBA 1SO3A 1NQ6A 1QPLA 1TG7A 4I8YA 4JQ4A 1U22A 4GJJA 4IFKA 2JK2A 4AQLA 3E12A 1BGGA 3KAHA 1AA1B 3L9CA 3DHFA 1VBJA 3BMXA 4HCHA 4LBSA 2C3ZA 3L66A 3QMRA 3CUJA 3RMJA 2YBUA 3CTLA 3GG7A 3LRKA 3CIWA 1G67A 5JH1A 2IKGA 1KWGA 3NM3A 2QR6A 3WD4A 2D2HA 5BRPA 2VQTA 2F23A 3PAJA 3OLDA 4IM4A 5CBBA 2GUUA 3PNZA 3KBNA 2Q09A 1A3WA 2FZNA 4WK9A 4WJEA 1PWLA 5GNZA 1GOXA 2ZZ1A 4M3PA 1SO4A 4OUEA 4F2BA 3QGVA 4PMRA 3PNUA 2VC9A 4XV0A 1V08A 3IK8A 3WH7A 3MYPA 1KXHA 1K6AA 4O15A 2BZNA 3AI0A 4GNKB 2HDJA 3CQIA 3RPDA 5G4WA 2AKZA 5I77A 2PB1A 3LEPA 1MUMA 4IP5A 1TWZA 2QCCA 1V0NA 1XG3A 3SEPA 1GOOA 2GUBA 5AHMA 3N13A 1KRMA 3THUA 1XLAA 1CXLA 3QFWA 3OYXA 1GVFA 4EPKA 3KDNA 2I56A 3L4TA 3KHJA 4PEKA 2XIIA 4IG2B 5K4ZA 1HW6A 4JTEA 3AIUA 3VM7A 1T40A 4Z2IA 3GAKA 2P0OA 4H9ZA 5I7GA 3DKLA 1UB3A 4LVDA 3RN6A 3WJSA 5FEXA 3TE9A 4HBKA 5E5CA 2OWCA 2RGLA 1J4IA 3JW7A 3PANA 2BGNE 4LAWA 1EJTC 2P50A 2VDIA 5M2FX 1RBAA 1JAEA 4PMZA 3U6WA 4ODKA 4ITZA 3LY0A 1H3GA 2PI6A 2VVSA 1HKIA 4MLJA 4Z2KA 2WBKA 3AXHA 3LGDA 2QCDA 4OGZA 1JCYA 3KUMA 2DSKA 5A6SA 4WJ8A 4GI6A 1WUEA 2YB4A 1U83A 5FSDC 1TB3A 1BKHA 2YYTA 2H8ZA 1LZOA 3GFZA 2DH3A 2EAWA 1EC8A 1CGVA 5CZSA 5AY7A 1U33A 3C2FA 2J7EA 5HJLA 1AMYA 1YBQA 2UY2A 2R14A 4B2DA 4TX8A 2A3CA 1UMYA 2VEIA 1IZKA 4GE8A 5JBDA 1BF6A 3SCWA 1W9XA 4X22A 2EGZA 3UJSA 2QIIA 1PZ1A 3KRUA 1R7OA 1ZY9A 3EPMA 2WMIB 3UR2A 3SCTA 4Q4KA 3OVRA 1MW1A 4H7CA 3SJ3A 3UA3A 2C0HA 4PMDA 1ISXA 4HCLA 4LH8A 4RNFA 4OE7A 5KMYA 3V18A 4K68A 3DERA 4HTBA 3S1UA 3B9DA 3WK3A 3STPA 3SIZA 3VGDA 2DT0A 1UC4A 1GTEA 3IVTA 2ZX8A 3P14A 5ABGA 2VC6A 1DE6A 3LGGA 2A7PA 2P3EA 1GEHA 5CJNA 1EOKA 3W4RA 3WFAA 4JCLA 3EPNA 2WKJA 2ZE3A 3HGRA 3N11A 4F4RA 1W1PA 4A4AA 3SCNA 2WJZA 3U2EA 5CPNA 4N9DA 1H4PA 4G2DA 3UWZA 4ZO8A 3PBWA 4QT3A 4QG9A 1FWJC 4DUVA 2DIEA 5I3KA 2Q6ZA 3L4ZA 4C7GA 1AJZA 2KI3A 2PDHA 3H4GA 2OG9A 3KABA 2NX1A 3U5YA 1RY0A 5CLTA 5E0FA 4GOAA 4GUIA 1LQ0A 3NQMA 3VNJA 4A8LA 2VDHA 3CYVA 4MY8A 3EDEA 3LCHA 2FPYA 4WF7A 3G77A 2PURA 3O5KA 3AJ7A 3QHMA 5A6LA 5EYWA 4WDWA 3M44A 3FDGA 5A8QA 1TV3A 1EHAA 3A9IA 5LGZA 2XUCA 1TMQA 3AHXA 3P6LA 4NX0A 1FX6A 2F8QA 2J62A 2F7FA 5AHNA 4M82A 4MB5A 1YW1A 5KINA 3DI0A 1Y5WA 2XFWA 4PTNA 3C8FA 2ZVIA 2C1IA 1D7JA 1OSEA 3UWWA 3GXDA 3OA5A 3MI2A 1FDZA 4JYFA 1RJPA 3OU8A 4ZXLA 4QM1A 3UG4A 1W17A 1NOFA 5JIWA 3MVIA 4Q3MA 3PBUA 3QTPA 4XK2A 3UI6A 2ZC1A 3ORWA 1EA0A 2WZHA 1TPUA 2NXGA 4PMUA 5I24A 4LAMA 4HGXA 4ZQNA 1DXEA 3ZLGA 2XH2A 1J10A 1PIGA 4MDPA 4ZB5A 4DEFA 2JBMA 4A3UA 3C0LA 1AW2A 1X39A 4QJ5B 1EQ3A 1SSGA 1WOAA 1ZB5A 4CCZA 1H5VA 2E5CA 3WZ0E 4LS0A 4KFOA 3L12A 1E0WA 1OVDA 4XZMX 3A4XA 5C54A 2Z28A 1PVNA 1W1B1 5C71A 1SSDA 2MNRA 4KPLA 1TVPA 3EA2A 2Y61A 3O9NA 2I14A 3GVRA 3WNLA 2AAAA 3UZYA 2WZEA 3MVTA 1RP8A 1W5OA 3W7DA 4DWSB 1EA9C 1E6NA 3EOOA 3W25A 5IRPA 3LG3A 3ZXWA 4B5WA 2CLHA 2BP1A 3FAWA 3WJYA 5AHEA 1BXNA 3GIPA 3GTYX 2H3BA 4FR6A 3EPOA 4U10A 2W6RA 4AZ6A 2QCLA 5L6UA 3VNDA 4XVEA 4YHEA 2GSJA 2AMGA 1JYNA 3SIMA 3O6YX 1WAWA 1J0KA 4AY1A 1NELA 1YNPA 3UI5A 1I4NA 4Q8UA 2C14A 4JY8A 1O66A 3APYA 3POCA 3C8NA 2GQ8A 4Q6JA 3WDIA 2BTMA 3TZNA 4X9YA 3WY1A 1JI1A 1OINA 3W6LA 1UD2A 3CGMA 2XVPA 4DROA 1EWEA 5HINA 1ICPA 3CBWA 1MW2A 2PWUA 1OC5A 4RCXA 1OY0A 1US3A 5JXQA 3NZ1A 1E6ZA 4JTRA 1ICQA 4DXXA 3S83A 3MO4A 4ZR8A 2V5CA 3UZXA 1VF8A 1W1IE 2X40A 1AJ2A 2DQWA 3LCIA 1DWFM 3CEPA 3GXFA 3AQUA 3B40A 1LORA 3B97A 2C16A 1A0EA 1UR3M 1U30A 4B9YA 3STCA 1SUXA 4BA0A 4HNNA 3KZSA 5AYZA 3TN5A 3QV9A 3WNMA 4UFMA 3R94A 4AZ5A 2PPNA 3KCOA 5HAOA 1PYFA 1VQTA 3R89A 3MW7A 4DZ2A 5GNXA 4BHYA 3GY1A 1O12A 2JKPA 3T2QA 4JBRA 2I5GA 2TAAA 4S3KA 3RDKA 3JU2A 1A5MC 2W63A 2Q3RA 2VL4A 1UWIA 3QQWA 3GR4A 4JIPA 2PSNA 4JR5A 4ERAA 1RPKA 1Q7QA 3PZNA 5C9XA 4HKPA 1ITUA 5EFFA 1GW1A 1VCVA 3TXVA 4LW7A 4KEZA 4RR4A 4DQWA 1BQCA 3T2PA 3ARTA 3W23A 1EIXA 4CQDA 1W2PA 3V4BA 1JDFA 1EQCA 1PDZA 2GWNA 2ZX5A 4ZSUA 1B6CA 4L4LA 1A53A 3IJ7A 4PMQA 2BLEA 3ZJ6A 4B5VA 1O94A 1AQHA 4TUFA 3HTWA 1FWDC 1A5LC 3OW1A 1M68A 1X97A 3ANUA 3VDAA 1L8NA 1K7XA 2ETNA 1ZJBA 1J0HA 4M6PA 4RE0A 3FNDA 3WDQA 1QWKA 4GGQA 3M7WA 4LV4A 1GYMA 3VNYA 2O9PA 3BTNA 2I9EA 4IIHA 6REQA 4J4OA 2GK1B 6CGTA 1DQXA 1IGWA 3DFSA 3VI2A 1D3HA 2PA6A 1R7AA 1K9FA 1A5CA 3HQPA 4JX6A 3EAUA 2HJPA 3WD0A 2XIJA 1P6CA 4NU7A 2OEJA 2XGIA 3CO8A 3SY8A 4QP0A 3GFXA 2QCFA 2H3DA 1THFD 4X0VA 1NSJA 7REQB 1K8XA 2B5UB 5JUVA 2TMDA 4O16A 1EXPA 3RLHA 4E4FA 4DO7A 1Q6EA 4QFUA 1E51A 2EG8A 3T8LA 1CXIA 1SU5A 2Y7GA 3FW6A 1KM1A 1WP6A 1PCWA 1JPMA 3B03A 1C9WA 3OZOA 5XIAA 1W3JA 5BRQA 3LHUA 4U33A 1WDWA 1GVRA 2ABBA 1SZFA 5M03A 1AJ0A 2E6YA 3WCZA 3WL1A 2WBGA 1FKKA 3EOSA 4B91A 2XP9A 4Z08A 4HVXA 3DFTA 1UBSA 1T0OA 3KXQA 3QR1A 1O95A 3W85A 1WZMA 4QDPA 3SCUA 3VIOA 4O19A 1XR2A 4C5ZA 1R3RA 3QHOA 2QDHA 1NVMA 4QISA 1UZHA 2WQPA 5FJUA 1AH4A 5A95A 3BLEA 1ZJIA 2DUXA 2XH0A 3KZPA 4HPXA 1FUYA 4PTMA 5HNUA 4IH3A 2CXGA 1YNYA 2ZX9A 4PGLA 4E3TA 2C19A 4ZBCA 1MFUA 4GO8A 1GYNA 3GRIA 1U5JA 4CNOA 4QRNA 3TTYA 6XIMA 1R0MA 3WQGA 2J74A 2ISDA 2Y5JA 2NVAA 4JHOA 3I65A 5AC5A 3ZJKA 1E1EA 2VGGA 3L7RA 4Q8PA 4FNQA 4WD0A 2X0HA 2RUCA 1LP6A 4GJIA 4OV9A 1B30A 3HURA 1SQ7A 4QIBA 2YCLB 4QT2A 1JG9A 4LB3A 1FH7A 3UPWA 1FFRA 3KBWA 1POJA 3ICJA 3WQWA 2ZIDA 5IFTA 1HQTA 3RU8X 2ZICA 3MT1A 4A6GA 3VTRA 4S1FA 3QC3A 3GUGA 4PEEA 2QCNA 3DFOA 1VFHA 4LX4A 4HA0A 5HK4A 4RZ6A 2BY3A 3GNPA 1JPHA 3N9SA 1V77A 5HTGA 1Z44A 3A3HA 3P0WA 3RMEA 1PHQA 4NYYA 4CGTA 4HMDA 3TZFA 3KWXA 4N9EA 4PRTA 3WD2A 4C7DA 3RITA 4AZBA 4S3AA 4Q6XA 3TLLA 4S3GA 3II1A 4WY0F 1DWGM 2FH6A 4IPPA 1GJPA 1SW0A 5D03A 1BRLA 3VNKA 3VIIA 1XFCA 2HVMA 1KCZA 2R1MA 3H2FA 3VKDA 3O6DA 4PL2A 3W76A 1D7HA 2EO7A 2VM8A 1OEPA 3G1YA 1RZMA 3NXFA 1FKBA 4W87A 3ABZA 1MWOA 1HFBA 1R3SA 1XYFA 4YPJA 4LS2A 4JFTA 4FNUA 2DSVA 4K38A 4JZ5A 4H2HA 3KLLA 4J7RA 3GFYA 1VR6A 3SR7A 1EWDA 4DIAA 1VC4A 1JIBA 3HGSA 5HNNA 1DJWA 1B1YA 4EP8C 2Y63A 1ENUA 1PEZA 2NUYA 3UYIA 4TIMA 3EDFA 2O7QA 1XF0A 3PZVA 1DWJM 3L4WA 3E2SA 3W72A 1E73M 2WZIA 2HVNA 3U7VA 4LGXA 1AVAA 3FHQA 2WC7A 5I06A 4IPJA 3UG3A 3KBJA 1F8IA 3GO2A 4PSPA 4K3ZA 5HUOA 3G22A 5DIVA 3GNRA 2D0GA 2UY3A 4XAZA 4TU1A 1E40A 5G5IA 3WN6A 1VHNA 1QUMA 3J7HA 4W8BA 2YJQA 2ZYFA 1R30A 1ZTVA 3OG2A 2VGFA 3S5OA 5CZJA 4Y90A 2OZTA 3QMSA 4S23A 4PTVA 1SW7A 2RJHA 2YYUA 1S2CA 3EEZA 1H51A 1EJRC 3TMQA 1QK0A 3MS8A 2YPIA 5I23A 1H7PA 4C90A 3LPGA 2PP1A 3SUTA 3BURA 1FHUA 3CUHA 3IWPA 4JFIA 5A6KA 1XLMA 1ECEA 3ARVA 2O9OA 3F4WA 1JNTA 1EC9A 5I09A 4E2BA 3PTDA 4HYWA 1AMKA 4FN2A 3I6TA 3S1VA 2YL5A 1G69A 1PX4A 2WCSA 3QW4B 4JFJA 2M1IA 3S9IA 4DN1A 1R3QA 4OHQA 5K4XA 3H12A 1R3TA 3LSBA 2PDBA 1C7TA 2Q02A 2J9XA 3KCEA 1Z69A 4LAOA 3W6YA 3H54A 4C6NA 4IIEA 4GLEA 2GJXB 5E6YA 1DWIM 4JTKA 5CH9A 5DMLA 1JZ8A 2ZDSA 1FY6A 1J5SA 3PBYA 2ISWA 5DELA 1BVWA 3HFTA 4G9PA 3HG3A 4UUIA 2CNCA 3O8AA 4MZ1A 3WQOA 1CLXA 1FWRA 5AYYA 3E3HA 1PE1A 4LUTB 2NSXA 4WSKA 1JCNA 1KM3A 3REQA 3UESA 2PTWA 3V3WA 2DT2A 1DIDA 3GDTA 4O18A 3HPSA 3I68A 4ORIA 2H9AB 4O12A 4WKFA 1VS1A 1IXQA 3GHSA 1EQPA 1B2YA 3MSRA 1A3HA 3CZ8A 5JVLA 3CHCA 3E5PA 1CGUA 1W9BM 4R5EA 5LNSA 5TNVA 1WE5A 3APTA 2VC7A 1UH3A 4W88A 4RDYA 2A79A 3TDBA 1JNSA 3NIYA 1WX0A 4QE5A 4UOJA 4NNCA 3WYZA 3ERPA 2QMKA 4V15A 3LLDA 3O5GA 5TD4A 4D6CA 1GZJA 3O5PA 2WNQA 1O5XA 3W7HA 1GKRA 3BK0A 3DECA 4EX4A 4GUJA 1J8VA 4JX4A 1VBHA 4K37A 3MMTA 5FF0A 1FQ0A 4GUGA 1CXFA 2ZX7A 4JAWA 2C18A 3E49A 3KX6A 3JZEA 3CPUA 4PFMA 4BQ2A 2GJRA 1QVBA 3BLLA 4QJ3B 1QCWA 3GU0A 3TOYA 3VE7A 2C7FA 4JN8A 3H9RB 1TX2A 3W2NA 4MNLA 3O0KA 2DZTA 3IRDA 4OJYA 5HPCA 1FWGC 4KWSA 1WDRA 1AK5A 5DIUA 1EO5A 2I7GA 1BAGA 2HSAA 1B3WA 4LOCA 2GPTA 1A5BA 4P7NA 1PIIA 1TJ0A 1W8SA 1T8XA 3H7UA 5K9CA 4PA8A 2FGBA 4L56A 3MUCA 3W7CA 5LIXX 1P0EA 1V3HA 2X1TA 3AMDA 4FXSA 4Q8WA 4MY1A 4MKNA 1R85A 3A9BA 4J40A 1Q6QA 4HU8A 4IIFA 4HBOA 4O54A 3BGJA 3N9RA 2PC8A 4BQ4A 3IHZA 5LA0A 2GJLA 3TYAA 4GI8A 4LYRA 4PB3A 4IXXA 4GYFA 1K4GA 4GYPA 3UQIA 5CSSA 1BWLA 1Q65A 3S1XA 1VENA 1TUFA 1Y7VA 4DJDC 4KT2A 1L6GA 1UWTA 1H50A 2CWNA 3FJ6A 4RE4A 1TJPA 2V68A 3I4KA 4HCDA 3RNDA 4XQ6A 4PUWA 1NU5A 4ICMA 4RZ4A 4MFDA 4CN6A 2CBIA 1EP2A 1JPDX 2UY5A 3M0MA 3ZQ9A 4UTFA 3QQ0A 4FX8A 5FACA 2I5IA 4IQJA 2NX3A 4XD6A 2A3LA 2XDFA 2QULA 2EPNA 5JBFA 4YYFA 4CCDA 4LAVA 1ZRQA 3LUOA 1HO1A 1T6MA 3IRSA 2DT3A 1V93A 3MYOA 4J4NA 4H1ZA 1LT8A 2EKGA 2XP7A 3AXKA 3W00A 1ISYA 3NJ3A 3NCOA 2GWGA 3WF0A 3OHMB 4Y9NA 3BUVA 3O15A 4J9JA 3GXIA 3KEHA 1JAKA 4B92A 1KFJA 3C61A 2J75A 4G56A 2IQTA 4MVAA 3SSJA 5EPDA 5I79A 1OG0A 2B7PA 3ITOA 2E28A 5HQMA 4DO5A 4JY9A 2E9BA 3EDKA 1IWAA 2GZXA 1DORA 3ZSSA 1I9CB 1O5KA 1F5ZA 1MQRA 1UG6A 1UPPA 4CD7A 3ZOAA 4GHRA 1GJWA 5XIMA 5CG0A 2F84A 4QNWA 2KX9A 5BU9A 1PTAA 5D09A 1V3KA 4J35A 4KBXA 4PE8A 3WQ5A 2PP3A 2VMFA 3N2BA 3QC0A 3KCJA 2YSWA 2ZZ7A 2O0TA 2J13A 2X16A 7XIMA 3MHFA 4P61A 1M5YA 2F2KA 3BAXA 1UC5A 2DSUA 3NM1A 1DJQA 1GNXA 4FZIA 1AODA 5I3IA 1FXQA 5D04C 3IS4A 3S1GA 3V5OA 3TYEA 5HW8A 1QO2A 4JKLA 4H04A 3PB0A 2DZVA 4YVPA 4DI9A 3QKZA 4L5ZA 3AXXA 5D2TA 3ABOA 3R4IA 1VCFA 1UIPA 5I00A 3F2BA 1UIOA 2BBFA 1ITXA 4ZPVR 2D2OA 1G4TA 2YL8A 3W29A 5J6EA 5CC7A 2R1PA 3MCMA 4CD5A 4CD4A 1QT1A 3TX9A 2W61A 5K9DA 5HWJA 4TXEA 5F2LA 4O1FA 4AEOA 5H2ZA 1DXIA 1WPCA 2OGJA 4XZIA 4UR7A 3UNDA 3O5LA 2CERA 1W37A 3ZVHB 4BR1A 2JF6A 3S42A 4QQ3A 2OKOA 1BTCA 4O1DA 2WVSA 1Z7AA 3OB8A 3TCEA 1YDOA 4UQDA 1NWRA 3WUFA 1EDQA 3NZRA 3IGSA 2XINA 2JKAA 2PS2A 1J12A 1W5NA 2IXUA 2OT0A 2A5HA 2CLIA 2VFGA 5TIMA 2FZBA 2QQ6A 5CZKA 3SCSA 3A13A 4XZ9A 4D6GA 1CI1A 1GK8A 3B8TA 2Y70A 2DPEA 3UBPC 1PINA 5CSRA 2KZHA 4RNJA 2Z1BA 2E40A 4CU6A 4ODQA 2EBNA 2QUNA 4MKSA 1RCOB 4FNPA 3WQPA 4IFOA 1KFBA 3DU0A 3VGEA 4A35A 3GLCA 2ACQA 3W7NA 8CGTA 3ABQA 2HRWA 3C86A 4GWEA 2HS6A 5CKSA 2VFIA 5T9CE 5C70A 4UXDA 3O1NA 1JF6A 7A3HA 2RURA 3RU6A 2RUQA 1PX3A 3PG8A 1LQAA 1RH9A 1BLIA 5BU6A 2HK1A 5IHSA 4GZIA 5A6BD 4LRTA 4FLRA 3VCNA 5ABHA 1B9ZA 4IXHA 1VFUA 1YTKA 1JZ3A 3SO7A 5HA7A 1MRAA 3KOFA 1YIXA