3FY1A

The acidic mammalian chitinase catalytic domain in complex with methylallosamidin
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
377
structure length
377
Chain Sequence
b'YQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNVKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acidic mammalian chitinase
publication title Triad of polar residues implicated in pH specificity of acidic mammalian chitinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 136
structure length 377
sequence length 377
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3fy1A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3fy1A01
3KZSA 4PMUA 1N82A 3WD3A 3SCTA 4M80A 4F79A 4P8VA 2XWEA 3SCRA 2V3DA 1TMQA 3CZ8A 1M53A 2DGAA 4JFWA 3AHYA 1WDRA 2EBNA 3CUHA 2YDSA 1BGGA 1MQPA 3K4DA 3GXFA 2WMFA 1PX4A 1TUXA 2ZX9A 2WVUA 3ZQ9A 2YDQA 3TONA 2DQXA 1ESWA 3VGHA 4ACZB 2FHCA 4D6GA 4JFSA 2CBUA 4W89A 1KCKA 4H41A 1HXJA 4HPGA 1A47A 2VUYA 1PJ9A 1RH9A 4JFUA 2WWDA 1V6VA 2JEPA 3WF2A 4M8UA 3W6MA 5M3WA 1KWKA 1NARA 3ZO9A 3NSXA 4S3KA 2ZX7A 1E1FA 1C91A 2J25A 3L4WA 3GNRA 4AY1A 4J3TA 4E8DA 4PTVA 2YDRA 3IK2A 3AS0A 4N42A 4XV0A 4F9JA 2W92A 3SCQA 4M29A 3AYSA 2GDVA 5DT5A 5I24A 1WAWA 1A3HA 3CUFA 1H11A 1H49A 1RP8A 1HJXA 4OBRA 2VRJA 1NM9A 1MFVA 3FNDA 3IJ7A 1QNRA 1V6XA 1JZ6A 1BHGA 2ZUVA 1JDAA 2BY1A 2QMKA 1RP9A 2CXGA 2J7FA 1GCYA 1FH8A 1HKJA 5CQ1A 3B9EA 4AZIA 1Q6CA 5HOSA 1CBGA 3SUVA 4YN5A 2FHFA 1CXFA 2V38A 2WMIA 1WZKA 1EDGA 1QI0A 1VIWA 1GW1A 4NI3A 2J7DA 1UUQA 4DM2A 2IXVA 4LYQA 1UQZA 2AAAA 5I23A 2YOCA 4HA1A 2WBKA 2W4XA 2WANA 3MANA 5D9MA 1OIFA 1KWGA 2W67A 2VURA 2XSAA 3WNNA 1XRVA 1EIBA 5BRPA 3AS1A 2D3NA 3DC0A 4QLJA 2A3CA 3MU7A 3L4XA 2W63A 1E72M 4NSBA 2D1ZA 1W3HA 1CDGA 4UTFA 3BMVA 2ZIDA 3L2LA 1NQ6A 1KXVA 4FLQA 2J75A 2DT1A 3K8MA 1OT1A 2Y2WA 2YBUA 3ZMRA 1OIMA 4CUCA 1BSIA 3PTQA 1HKKA 1E3ZA 3ZR6A 1Q4NX 3WQWA 3OGVA 4PMVA 1C8XA 3HMCA 4Z2JA 4P7LA 1LWJA 1V3MA 2VMFA 5A8PA 1GOOA 4KWUA 4UFJA 3AFBA 2WSKA 4H04A 1E4MM 3K8KA 2PWHA 1UR1A 5FL0A 4E4PA 5HPOA 2UY4A 2VCAA 1IT0A 4LX4A 1C7TA 3SUWA 1OGBA 3WH7A 7TAAA 3GDBA 4AIOA 3L4UA 1UOKA 3SCPA 3MUAA 3RDKA 1JZ3A 2QF8A 3VIFA 2EPNA 1CYGA 3T0AA 3W26A 5GNZA 1UZ1A 4ACZA 2DIJA 2DSKA 3EBVA 1F4AA 2XGBA 1J0HA 2F61A 2J7CA 2EQDA 4CCDA 4TOQA 4UQAA 4J3SA 4W8LA 2XVPA 2O9PA 2C8NA 3BGAA 2V3FA 5JBDA 3M6DA 5JUVA 2WPGA 2CCRA 3AZTA 3CO4A 2J8GA 1H1NA 2NT0A 2OSYA 1H5VA 1W2PA 4X9YA 3WD4A 4JKMA 1W3KA 5I77A 1E70M 5DF0A 3W37A 3WUBA 3B9AA 3EDFA 6CGTA 3AHVA 1U2YA 1WPCA 1J11A 2BHZA 2VTFA 5LA2A 1AQMA 3EYPA 4GIAA 2CYGA 1UHVA 3ARTA 2QV4A 3NSNA 1Y7VA 1BPLB 2Y8VA 2GJXB 3MMDA 5DO8A 5E9AA 1JZ4A 2W66A 3AOFA 3AIBA 4J28A 2VZVA 3AS3A 2CERA 1V02E 2VO5A 3MMWA 1BG4A 1HF6A 4XZWA 1KXQA 2WWCA 4OIFA 3EMQA 5I79A 1QBBA 4D6DA 2EXOA 1M04A 3GZAA 1EXPA 1GHRA 2VX5A 1I75A 4LXFA 1I1XA 1V3JA 3QOKA 5JH8A 1YQ2A 4UQEA 4BA0A 4W5ZA 1ISWA 1R8LA 3CZKA 3FW6A 1UKTA 4ATWA 3AMGA 2PWFA 4JFTA 4UOJA 3KEHA 1UKQA 1FHDA 1FH9A 3OLGA 1UD4A 5BROA 3VU2A 3K8LA 4CD4A 2F8QA 1QI5A 2E8YA 4D72A 4GO8A 2O9OA 1JI2A 1HJQA 5FKYA 3OLIA 3EMZA 3WMSA 5ECUA 2VCCA 1FOBA 3CBWA 3BAYA 2DPEA 3A6OA 8CGTA 3CZGA 4MTVA 3WH8A 1HT6A 3T2PA 1W9XA 2WLYA 5FIPA 2DIEA 1C3FA 2WHLA 3VIJA 2XVKA 4UFHA 2X09A 5HPCA 2PWGA 3AISA 5IDIA 1TFVA 2XJ7A 3VIGA 2UY2A 3CUJA 2XVNA 4AWEA 1E73M 4W88A 4HA4A 4BQ2A 3AIVA 1NWSA 1KQZA 1MYRA 1CEOA 3II1A 1WB0A 5GNXA 1US3A 5CLTA 5A2BA 5A3HA 1BTCA 3PZTA 4P7RA 4JFVA 1X6LA 2Y5EA 3TTSA 2JIWA 3ARVA 2C7FA 1E3XA 2FDMA 5AYBA 3UERA 2XWDA 2RGMA 3GH7A 4H8HA 5IFPA 3AZSA 1Q6DA 2JIEA 4TTGA 2GDUA 4HU0A 3SUUA 1E6ZA 4ATDA 4MNMA 5A6JA 1B30A 1B0IA 1EH9A 1KR1A 4PBGA 2J7BA 4HTYA 3ZIZA 3W38A 2XIBA 1W1TA 1DWGM 3BAXA 4MNJA 1E0WA 1JDCA 1WE5A 1SFSA 1EO7A 1FH7A 3ARSA 3M46A 2VJXA 1W9VA 2G41A 4HOZA 3AIWA 1V6YA 1GOQA 1PZ2A 2VR4A 3RO8A 4KRUA 1C7SA 1ZBVA 1UR2A 2QLYA 3VVGA 1CLXA 4PRWA 4AD5A 3OB8A 4PMZA 5EB8A 3VIMA 4BCEA 1H0GA 1OM0A 1NWRA 3KE0A 4PUDA 2VQUA 1PIFA 3WD0A 1K6AA 4CD8A 2Z1SA 4TVCA 1FFQA 1WNOA 5IHRA 5BWFA 1H3GA 3W6LA 4CGTA 7CGTA 4A4AA 4JZ5A 5KZ6A 1W1PA 3AIUA 1JGIA 2WC3A 3AICA 1CENA 5FL1A 1JZ5A 1CLVA 2CPUA 4JAWA 1CXLA 4CN6A 1AMYA 2GJXA 4QP0A 4HOWA 2G4FA 5A6SA 1UA3A 1EDTA 3EDDA 1JYVA 3N1AA 3WNKA 4P7NA 3PZGA 4AZHA 1B2YA 1E0XA 3WUGA 3GXIA 1E55A 4PMQA 1GHSA 2OYKA 3MO4A 1CGVA 2UWFA 1TE1A 4DWSC 2DT2A 3ARRA 2HISA 3MSGA 2JF7A 1XSIA 3AQUA 2XVLA 1UWUA 4UOQA 4WSKA 5FCZA 2WKGA 4L4PA 3B9DA 1W2VA 2E3ZA 1K9TA 2X0YA 1XH2A 3IAPA 4C7FA 1UH4A 3U57A 4MB4A 4UQBA 4M56A 3QHNA 2VQTA 4W86A 1HIZA 1QVBA 3CLWA 1PAMA 4PMNA 2WCGA 1OD0A 3FAXA 1NP0A 3WH9A 5A8QA 1AQ0A 3GNPA 3ZT5A 2D22A 3PZNA 1NWUA 4AD1A 1H09A 2ZX8A 1CGUA 2D3LA 1WCGA 3T09A 1XGZA 4OOUA 5AC5A 4UOZA 1DEDA 3AROA 3E1F1 3VMNA 3WNMA 3AS2A 4UFIA 5E6ZA 2D20A 3IJ9A 3ZOAA 1EGZA 5AY7A 4MADA 1MFUA 3WDQA 2X1IA 2DT3A 1G5AA 1UYQA 3ZJKA 1JXJA 1V3HA 3UG5A 1CGTA 4WK9A 1LLOA 4PCTA 5E6YA 1GQJA 1OWQA 1V3KA 1L8NA 3UR7A 2ZUMA 4AISA 7A3HA 1KBKA 4URIA 1JF6A 2A3EA 2FH6A 1EHAA 2ESCA 2PBOA 5CXPA 5DFAA 3ZJ7A 4F8XA 1D7FA 4J7RA 1HP4A 1ITCA 2BS9A 1EA9C 2D0HA 4DM1A 3BLKA 1J0KA 2GUYA 5A6LA 3WF1A 2AOSA 2BFGA 4V2XA 1WKYA 3OLEA 2XG9A 4W7WA 1JL8A 4CCCA 2V5CA 4JHZA 4KMQA 2XYLA 1NP2A 1B90A 3L4YA 4PMYA 4AMCA 2FHBA 4AXNA 2YL8A 4AD2A 5ABFB 4DWSB 2WC7A 4WKFA 1GJWA 3MMUA 1DP0A 1UWSA 1WZAA 2ZWYA 8A3HA 4U33A 3GM8A 3W82A 2WB5A 1RPKA 3AHXA 1VEMA 2ZUSA 4ZE4A 3SCUA 2VNCA 4AIUA 5A8NA 2CEQA 1OSEA 3T2QA 5CG0A 2WKLA 5CLWA 2WBGA 1GOKA 1E6SM 5CGTA 5D9NA 3GXDA 1DWFM 3VPLA 1FHLA 2GFTA 4MB3A 3WNLA 3G6MA 1X1NA 5D4YA 2EJ1A 1UR9A 4P8XA 3NCOA 1GPFA 3KL3A 1PX3A 3VIHA 1JNEA 4CCEA 2A3HA 1UD6A 3N04A 2C0HA 2E9MA 5BXTA 1X6NA 3U5UA 3BAWA 3ECQA 3NSMA 3AMCA 2VRKA 2E9BA 1KCLA 4GZJA 3SCSA 2YLLA 1VAHA 2WZIA 2D24A 2YKKA 2VVNA 1R7AA 3M07A 4HZ7A 3RM8A 1FP8A 4V27A 3BLPX 3MV11 1JYXA 4RE3A 5E70A 3WQVA 1E56A 3PZ9A 1BQCA 4KGJA 1UD5A 4GI8A 3BAIA 4CN4A 2EPOA 5CPSA 4D6EA 2PC8A 1W9PA 1GOMA 3GTNA 3UR8A 3PZUA 4E8CA 1EDQA 5A1AA 3U7VA 1QHPA 1VF8A 3AZRA 2BY2A 1ISYA 1EOMA 4W7UA 3PTMA 1R86A 2WMJA 1VFOA 2F2HA 3IJ8A 1UWTA 2OLHA 3VINA 3W29A 3NUKA 1UH3A 3WF3A 2BXZA 1CECA 2ZXDA 5I78A 1LJYA 3VGFA 1XV8A 3OIHA 2TAAA 3THCA 3VX0A 3DYPA 2GJRA 2VRQA 2VL4A 4ZE5A 1DWIM 2ZUUA 3N11A 3BCDA 3I3BA 1MW2A 3S2CA 3VDHA 1KFWA 1VBUA 1UQYA 3FN9A 4TVDA 4KRTA 1XH1A 3GYCA 2D2OA 2J8FA 2W61A 4W7VA 3IAQA 3AXXA 2JF6A 4EAMA 1BVNP 3VM5A 1YHTA 2XM2A 1UR4A 1J18A 3OLDA 5A95A 1D3CA 5TD4A 1NH6A 1UKOA 4HMDA 3UETA 1GNXA 4MAZA 3U7BA 4Z2KA 3LMYA 2CIPA 1MQRA 4IISA 3AIRA 3ARXA 1DWAM 4QCEA 6TAAA 1C8YA 2OWCA 3D5HA 3ZT6A 3MSDA 3TTYA 1HKIA 3LPGA 1E4LA 3TOPA 1BYCA 3L4TA 1H4PA 4H7VA 4U2ZA 5ABFA 4DWSA 1C92A 5BXPA 1K9EA 3WENA 1LG1A 1KB3A 2WVSA 3OZPA 4Q7NA 3CZLA 1CXEA 3WFZA 3CH9A 3WMCA 4PTMA 1IZKA 2J7GA 1J10A 2QPSA 3POCA 3LPFA 4GZIA 3WKZA 4UR9A 4D6CA 1ECEA 1C93A 1G1YA 4ZENA 1H2JA 4MDPA 4WSJA 4CU7A 1XYZA 5CGMA 2OYMA 3AMLA 2WHMA 2V5DA 1BVZA 5C70A 1O6IA 4HZ8A 1OGGA 2BY3A 1Z32X 3WSUA 1EOKA 4PYSA 4AZ6A 3VDAA 1FA2A 2VC9A 1IV8A 3HU7A 3BCFA 4Z2IA 3VD4A 5CJ5A 3FHQA 4CVUA 2FGZA 1B1YA 4AZBA 4CD7A 1H0IA 2O9TA 1B9ZA 1JZ8A 2OSWA 2PWDA 4ZEPA 3OZOA 3RJYA 2ZX6A 3N17A 4R27A 2G8ZA 2WNWA 3QR3A 1K9FA 3S6TA 1E6NA 1E71M 3PZMA 3BXWA 6A3HA 4UQ9A 2VZUA 1JNDA 1J0IA 4TXEA 3UG4A 1HJSA 1CWYA 3WUEA 3UG3A 4MJ2A 5FD0A 3WF4A 1OD8A 3CHDA 4PTWA 3N12A 2AMGA 4FK9A 1XYFA 1IZJA 5EFFA 3W24A 3WD2A 3WH6A 3VNYA 1KR0A 1JZ7A 1LL4A 1UH2A 5GPRA 4CVWA 5AC4A 2Q8XA 4GZEA 2OSXA 2YJQA 1VFUA 3SIMA 3FY1A 1V3LA 3K46A 5EBAA 4QLLA 2E4TA 5ABHA 1BYDA 2X05A 5GQBA 1QNSA 4GI9A 1ZJAA 4PCSA 1MXDA 3I3EA 3UEQA 3GNOA 4R5EA 1KGUA 2VZSA 3RIKA 3OA5A 3WEMA 4ZXOA 4Y7EA 3N13A 4PTXA 2VR5A 2YA2A 4N0RA 1CXKA 2XIIA 1RD6A 2W5FA 4J3UA 2BY0A 4M24A 4P7QA 1XD1A 1LG2A 1E6PA 5LYRA 4JKKA 2NW0A 4EANA 1UWRA 3RILA 1GOIA 2CESA 1GONA 4M82A 2ZWZA 3GBDA 3DYMA 5LA0A 1Q6FA 1QW8A 2UY5A 3VIPA 3O6AA 1VRXA 3W81A 3WEZA 1J0YA 2BV9A 4JL2A 5D9PA 4MPKA 2DT0A 4W87A 3ALGA 5D8ZA 4AEEA 1Q6EA 3T2OA 1VFMA 2BVTA 1TCMA 4PSPA 4KGLA 1J12A 3UESA 1ZBWA 1W3LA 3PN8A 1NOFA 2FH8A 2BVYA 3DHPA 1UR8A 2PWEA 1E4NA 3MS8A 3K4AA 4XZBA 4AZCB 2CBJA 3QHOA 2YA0A 4MDOA 1M01A 1HL8A 1OBAA 3EMCA 3WEOA 3BSGA 1L0PA 1TZ7A 3GH4A 1JAEA 1E5NA 4J3WA 3VGGA 3RM9A 2EPLX 4PMOA 4TTUA 4PMDA 4ML4A 1HN1A 1CPUA 2GVYA 4IUGA 2W91A 3ZSSA 2OWXA 4D6JA 5GNYA 4LYPA 1TG7A 1B3ZA 4QLKA 3NIYA 3VO0A 4HU8A 1TR1A 5D8WA 3FXYA 2QPUA 3VGDA 1UKPA 2ZXBA 3KWXA 4D1IA 1CZ1A 3TTOA 4U5IA 3K1DA 2V3EA 4Q22A 4B9YA 1D2KA 1G94A 2VT0A 3NYDA 2NSXA 1DWJM 2PI6A 4GO9A 4Z2HA 4TX6A 3L4ZA 5E09A 3CZEA 1JFHA 1GZJA 3MKKA 1ZBKA 1PZ3A 4FLOA 2J78A 3F4VA 1VFFA 3WL1A 2DSVA 2XVGA 2DEPA 4CKQA 1VJSA 2BVDA 1QW9A 3OGSA 4RE2A 3VMOA 3RPMA 4OZOA 4JKLA 1HP5A 1GQKA 2XHYA 2WVVB 1B31A 2E9LA 3PZOA 5A2AA 2O92A 4JL1A 3T0BA 3WUFA 1LL6A 2D0FA 4OBSA 4MNLA 4X0VA 4AW7A 3O9NA 2EEXA 3PHAA 3WFLA 3ALFA 4W93A 4HA3A 3AMDA 3L2MA 3WBAA 2VCBA 4UQCA 3POHA 1QNPA 2CBIA 3DYOA 3ARWA 5HBFA 1W3JA 2XFYA 3CGTA 3MUZ1 3WMBA 1VJZA 3AXHA 5A6KA 1QOXA 1XSKA 4TUFA 4DWSD 1UA7A 4LQ1A 1BFNA 2VX6A 2DSZA 2NT1A 1QNOA 2XM1A 3L4VA 5A6AA 4PMRA 1MVYA 5CPQA 1JXKA 2ZX5A 3CTTA 1US2A 1WDSA 3SUTA 5HDRA 1CGXA 3SCVA 1V0MA 9CGTA 1MXGA 3EDKA 2RGLA 5CSUA 2DH2A 2VOTA 4UNIA 2E8ZA 3APGA 1CGYA 1HKMA 3A4WA 2XPKA 3VIKA 3SEPA 1UG6A 3RM4A 1V08A 4H8UA 4CU6A 2WM0A 3WQ4A 3ZJ8A 2X0HA 1WP6A 4AZ5A 3OG2A 1V3IA 1UKSA 2WMHA 2V3GA 5ABGA 5LA1A 4FF5A 1CGWA 5HNNA 1XD0A 1LQ0A 1R85A 4B3KA 4NF7A 4CD6A 4TVUA 1PBGA 3VILA 3AHTA 1OB0A 1AQHA 3WL0A 2J62A 1ODZA 3KL5A 3SCWA 3U5YA 4UZUA 3GXMA 4HMEA 1BG9A 3RJXA 4UCFA 3NJ3A 4EK7A 4AZCA 3MUY1 2VZOA 1G01A 1NWTA 1JYNA 3VDBA 1CIUA 3SCOA 3GBEA 3F5LA 3AMKA 4GQQA 2G3MA 2CITA 4MJ4A 1NOUA 4UFKA 4IM4A 2WVTA 1W32A 3VD7A 5JIPA 2ZE0A 3PZVA 4FLSA 4CD5A 2WAGA 1I1WA 1EQCA 2DSUA 3ARZA 4MNKA 1ZS2A 3PTKA 3W4RA 4WLCA 1GQLA 3VTRA 1V6UA 3WELA 2WMGA 1BLIA 1MW3A 4PUEA 3VD5A 1HJVA 4UQDA 3FHAA 5M5DA 3A4AA 3WNOA 3WDIA 4ATLA 2PF0A 1F4HA 4PSRA 4C7GA 2PB1A 1W9BM 4HMCA 2J79A 4D6FA 1E43A 1U33A 3M7SA 1FP9A 3KL0A 4V28A 4LYRA 4J3XA 3WQ8A 2D23A 3AHZA 3CIVA 3CHFA 2YIHA 3MUIA 5ABEA 3QGVA 3PZIA 1CXIA 4OUEA 3SURA 5HXMA 4WJXA 4D1JA 4IPNB 3TP4A 5C8BB 1OT2A 1EHNA 1E4IA 2YA1A 4WIWA 4XX6A 1JAKA 3HN3A 2VX7A 1P6WA 2X2YA 3VGBA 2WVVA 4GPNA 2PBGA 1V0KA 4K68A 5D9OA 3N18A 3CUGA 4C7DA 4RE4A 4QDMA 1E1EA 1VB9A 4FMVA 2XUCA 4QAWA 2QHAA 2VZTA 3AJ7A 1M03A 3SCNA 3TA9A 2VX4A 1V6WA 5M17A 3F5JA 2Y24A 4AIEA 1E15A 5I2UA 1TVPA 3T0DA 1LL7A 5A69A 1JFXA 2G3NA 1WZMA 4JCLA 2E0PA 3WNPA 2ZXAA 2EPMX 3NDZA 4M81A 1O7AA 2MANA 4GQRA 2GJPA 2GK1B 1JG9A 1GVIA 4UFMA 1AVAA 4Z2LA 4DUVA 2WHKA 1JD9A 1NOWA 3OGRA 4OJYA 1C8QA 4JHOA 3PBGA 1G0CA 4BQ4A 3WQ6A 1W9UA 4NRRA 4E2OA 1JZ2A 1XCWA 5E0CA 1SMDA 2IXUA 3GH5A 5A2CA 1BF2A 4L4OA 4JCMA 4QCFA 5A6BA 4CN1A 4D6IA 1J9YA 3BMWA 2WK2A 1SYTA 4B15A 3WH5A 1U30A 1BAGA 3BSHA 3G6LA 1MW0A 1PX8A 2JEQA 4OKDA 2J7HA 3OBAA 1HJUA 3F5KA 5C71A 5FOOA 1J0JA 1J01A 3WQ5A 3W0KA 1B3WA 3VD3A 4P7OA 4D71A 1BYBA 4H2CA 4WKAA 3WDHA 5CSYA 5I6SA 4S3JA 5CZKA 1ISXA 1CXHA 2OYLA 1B3VA 4GKLA 1W1VA 1W9DM 2WSPA 4F9DA 5KEZA 1ODUA 3AIEA 1JYWA 5BYWA 1ZU8A 4TX8A 4LGXA 1SMAA 4NZCA 2BHUA 1UD2A 4U5KA 2ZUTA 3N15A 3ARUA 4KH2A 5A94A 1JI1A 3EDJA 2CHOA 1C90A 2IUZA 1R7OA 1R87A 1EO5A 2DDXA 2WHJA 2YL9A 2XFRA 1VBRA 1E0VA 1OGSA 1E6XM 2Z1KA 1M7XA 2E40A 2ZXQA 1DHKA 1MW1A 3JUGA 1ITXA 2VI0A 5BXRA 2WYSA 4UZSA 4CU8A 2CNCA 1ZB5A 4D6HA 3W27A 3O2LA 1ISZA 1KGXA 3AYRA 1VEPA 1E9LA 3A47A 4U3AA 2CKRA 1TA3B 3MV01 3ZR5A 1WO2A 3BAJA 1VENA 1UR0A 2YBTA 3CHEA 2XSBA 4JIEA 4PN2A 1GJUA 1WDPA 2UY3A 2GSJA 4B9ZA 1QBAA 1V0NA 5E0FA 3B8SA 3VDCA 4NRSA 2XGIA 1H41A 4FLRA 3VUPA 1UWIA 1UZ4A 1SR0A 3CHCA 5DEZA 2A3AA 3CMGA 2CETA 1VEOA 2FGLA 5I5RA 2J74A 4MB1A 4W85A 1HVQA 1GQIA 3AI0A 2B31A 4P8WA 3VGEA 4H8VA 3BH4A 2YL5A 3ZM8A 1PPIA 4W84A 2BHYA 3DHUA 3LPOA 4AD0A 3W53A 1GORA 4RL3A 1MQQA 1ZL1A 4HP5A 5BCAA 1W91A 1Q6GA 1E6RA 2Y4SA 4BZYA 4YPJA 2JFEX 5I0DA 2Y8KA 2WLZA 3J7HA 1LF1A 3I3DA 1EQPA 3A4XA 1UD3A 1KXTA 5BXSA 2QMJA 3VIOA 3THDA 4WKHA 2CKSA 3CPUA 4UFLA 4DUXA 3ZT7A 5CPTA 3NDYA 5EFDA 1KXHA 1OCQA 1B3YA 4AEFA 5DMYA 2O9RA 4EKJA 1DTUA 4J27A 3EDEA 4M1RA 2WMKA 3BC9A 2WXDM 3CUIA 5EMYA 3VMPA 4EE9A 1CNVA 1JDDA 1B3XA 1BYAA 4GINA 1QPKA 3RCNA 2GK1A 1V03A 4PMXA 2CHNA 1WZLA 1HNYA 1QHZA 4WF7A 1XC6A 4AD3A 1ZJBA 2J7EA 2J4GA 5IFTA 1PIGA 3AXIA 3VOCA 4XB3A 1CTNA 1TVNA 5AYIA 3VM7A 1WDQA 3VIIA 4AZ7A 1E5JA 4MB5A 2BXYA 1LWHA 4AD4A 1QHOA 4IPLA 1V02A 3W28A 1HJWA 2WZHA 2A3BA 3WN6A 3D3AA 1PEZA 3CMJA 2J47A 4Z2GA 2YL6A 4AZGA 1ISVA 1MWOA 1J0ZA 2EPKX 1QI4A 3QHMA 3VX1A 2XTKA 4ZXLA 1XCXA 1JD7A 4B16A 5A6MA 1W1YA 4ACYA 4GI6A 3QOMA 1S46A 4ZFMA 2YLAA 3WDRA 4W8BA 5A8MA 2OWWA 4W8AA 3ARYA 4AC1X 3VD9A 3AIQA 3BAKA 3VKKA 1GOWA 4J3VA 1BGAA 1DWHM 2BNJA 2HVMA 4GXPA 2W62A 2WCSA 2WMIB 2WC4A 1KBBA 1KQYA 2WCAA 3RMEA 3WD1A 2JALA 4X0NA 2CBVA 1HVXA 5F7UA 3N9KA 3T08A 3WBEA 1QI2A 4XUYA 2DSWA 3DECA 1JIBA 5JIWA 4AYSA 4U3CA 1KGWA 2G3IA 4A3HA 3ARQA 3LPPA 3PZQA 2ZOXA 4YHGA 3SUSA 1GUVA 1FFRA 4P8UA 4PEEA 4A3YA 1G9HA 5IHSA 5DT7A 2D0GA 5JBEA 3ZSTA 3CZJA 3TTQA 4U31A 4F66A 1HX0A 1QI3A 1TA3A 4U2YA 1XH0A 4HOXA 1UWQA 2WW5A 4QFUA 2EO7A 1ZBCA 1XHGA 1E40A 5IXEA 3WY1A 2JE8A 3WF0A 3A3HA 2G3JA 4MAVA 3WDPP 2XFFA 4LPCA 4BF7A 1UD8A 4HZ6A 4BQ3A 4B3LA 5I3DA 3FAWA 2ZUNA 3IANA 2J77A 4YHEA 3ZJ6A 4DUWA 1XSJA 1K9DA 3VNZA 4BS0A 5A6BD 4HPHA 3HJEA 2ZICA 3WIJA 4BQ5A 2ZUWA 2WZEA 1JF5A 3ARPA 1QNQA 3W25A 5A8OA 5BRQA 1OINA 2VVSA 1E6QM 3WDJA 5M03A 1HL9A 2X8RA 4W5UA 1GVYA 3UCQA 5JBFA 4OOZA 1V0LA 2DH3A
chains in the Genus database with same CATH superfamily
4PMUA 1N82A 3M6YA 3MSRA 3KBNA 3MUXA 2XWEA 4M3PA 3SCRA 3S47A 4XG1A 3KAGA 3GDMA 2DY3A 4AHOA 1TMQA 3SRDA 2EAWA 3HGSA 2DGAA 4JFWA 3BLOA 3K4WA 3R43A 1WDRA 4FSAA 2WO5A 3USZA 3KVJA 3PRDA 4DO7A 1NFPA 3W76A 2ZX9A 2WVUA 4H4IA 3BJSA 1UPMB 1YE6A 4C6PA 3MZNA 3C2FA 4DJDA 5H8PA 1KCKA 3LCGA 4LUTA 2C1HA 4EPKA 3T8LA 3GXPA 4G6CA 4JFUA 4ERGA 5BW6A 9XIMA 1V6VA 3NA8A 2HBVA 4I5XA 2MLZA 1KTCA 3GG0A 4FXJA 4M8UA 3IJ6A 1KWKA 4LNYA 2PGWA 4Y8EA 5U4NA 5D33A 3L4WA 3PS7A 3O5LA 3GNRA 3UXAA 4J3TA 4QT3A 1JCYA 3IK2A 1XLBA 3N4FA 2W92A 4O4VA 5CZTA 4JR5A 4M29A 3AYSA 3TTEA 4DYEA 2PODA 1FWCC 4BI7A 1H11A 1H49A 2OQLA 2VRJA 1NM9A 4KKXA 1YEYA 4JYFA 1BHGA 2ZUVA 5I3GA 2QMKA 1QPLA 2J7FA 3SM0A 2HNHA 1GCYA 3OA3A 4UC5A 1B3OA 2INEA 2VEGA 3V3WA 3VKAA 5LIKX 1GGOA 3QPYA 1FAPA 5HOSA 3SUVA 3GK0A 1CXFA 2V38A 3LI0A 3KP1A 3G1FA 3JR2A 3UI5A 1UUQA 4PC8A 3TC6A 3M0IA 3GUWA 2NQHA 2FZMA 5I23A 2WANA 4OTKA 5D9MA 1GYNA 1OIFA 1PINA 5AN7A 2XH0A 1K7XA 2REQA 3WNNA 4LT9A 4A21A 2R1PA 1EIBA 2D3NA 1J93A 1XLMA 2A3CA 1BSLA 2GGHA 2V2CA 3MU7A 2W63A 4YCOA 3M0YA 1E51A 4JIIX 3RG6A 1CDGA 3DBNA 4IF2A 3RYSA 2PN0A 2WJZA 4GC3A 3KACA 4ODQA 1W6TA 2IQTA 2D2GA 2Y2WA 2YBUA 3KLLA 3OVQA 2Z2AA 4G2PA 3O5RA 3OU8A 3AU2A 3L65A 2I17A 3PTQA 3VNLA 3QGAC 4Z1CA 3ZR6A 4NILA 3OGVA 1G69A 1W3NA 4PMVA 3R8RA 3HMCA 4E3VA 3F4DA 1LWJA 3Q2DA 4WXZA 2CFFA 1IYXA 2VMFA 5A8PA 1GOOA 4DRJA 2HPMA 3AFBA 5FL0A 5HPOA 2VCAA 2QJGA 4PCNA 3B05A 2QF7A 4H83A 2P50A 3AYTA 4LX4A 4F0KA 2O7QA 3SUWA 1OGBA 3WH7A 4X63A 7TAAA 4RK8A 1UOKA 1HW6A 2I5GA 4HHPA 3MUAA 1LDCA 2GUUA 1IE7C 3TEVA 3DBPA 3WK2A 5H91A 3T0AA 1TELA 4BHYA 3CAVA 4XZLX 4ACZA 4IWWA 4C6DA 1S2CA 2XGBA 5HJLA 2F61A 3IVSA 4CCDA 4TOQA 1KFLA 4PCPA 3BGAA 3VKBA 2V3FA 5HMDA 2WPGA 4RNFA 5CSRA 3AZTA 3CO4A 3QW4B 2J8GA 1H1NA 2OMAA 1JCNA 1S2UA 1W3KA 5DF0A 4GVIA 3PUOA 3ZLHA 5CBIA 4K8HA 5D2XA 1WPCA 3AJXA 4JN7A 5K4ZA 3EYPA 3KBMA 5D30A 4BJHA 3O6YX 4YTQA 1BPLB 3MMDA 5E9AA 1WUEA 1JZ4A 1AODA 3AOFA 1GVEA 4ZB2A 1V02E 5K9CA 3H54A 4G9PA 4WOZA 4GNVA 4XZWA 5I79A 1M04A 3R11A 2FB2A 1JVWA 2WNQA 3NO3A 1AZ2A 7ODCA 5F2MA 1J4RA 4RZ6A 4LXFA 2HV5A 2G50A 5JH8A 1YQ2A 3W22A 1DQUA 5GJNA 3RX3A 4JIQA 3APYA 2XN1A 4ZR8A 4NZJA 4Z1DA 3JXVA 1UKQA 1FH9A 1UD4A 3VU2A 1A5SA 2HNEA 4XVDA 4K39A 2F8QA 3GQYA 2OKOA 1JI2A 3OLIA 3O6DA 5ECUA 1ONEA 3GSMA 1JCXA 3CBWA 3BAYA 4NP7A 1IIHA 4NUWA 2PLJA 2ZZ4A 1W9XA 2WLYA 2XFWA 6PTDA 1YXCA 3IIVA 4IX0A 4O18A 5HPCA 2VWSA 2WJFA 3AISA 2QULA 5IDIA 2B81A 1MEIA 4LVGA 2XVNA 2JKPA 4ZSTA 2Y7EA 1NY1A 2PV2A 1EC8A 1JRBA 5D05A 1KQZA 2V82A 2VFHA 4JEJA 3OQ8A 1CEOA 3II1A 4GH1A 3SJ3A 1ENUA 3AXMA 3RR4A 4LAOA 2H3BA 1EJTC 1U22A 4WY0B 3PZTA 2PF8A 2F6XA 3W87A 3TTSA 3C4UA 4IIHA 2I57A 5AYBA 1X1ZA 4FHAA 1DJNA 3AZSA 2PSNA 1Q6DA 4LY4A 4HU0A 3SUUA 1E6ZA 5A6JA 4LUIA 1OHLA 3ONBA 4GYKA 3W2KA 3W38A 2XIBA 1DWGM 2PP1A 1OCBA 2GLKA 4MNJA 5HUPA 1SFSA 2ZZ1A 1OX6A 2VJXA 1HO1A 2G41A 3AIWA 3QMSA 4LAWA 4FNPA 2VR4A 3W72A 5FF4A 4K8EA 1VFHA 4NNCA 3JVAA 1Z6KA 4OU1A 3H4WA 1AD1A 4H7CA 4DXKA 1ZUAX 3OB8A 3L7RA 1O1HA 1EQ3A 2HROA 3E2QA 3MI6A 4K3ZA 1TTQA 2R14A 4JFIA 3KE0A 1OFPA 3WD0A 1R30A 1YDNA 5A6TC 4CD8A 2Z1SA 4TVCA 3VKDA 3G1VA 1EYMA 3L0KA 2VFDA 5BWFA 3FGCA 2X2GA 2DVXA 3BVJA 1JDFA 5LNWA 3EX6A 5T91A 5C9UA 3TA6A 1TJ2A 2WC3A 1W1A1 3G3MA 5FL1A 1JZ5A 2CPUA 1Z42A 4LC8A 3UA4A 1AMYA 2GJXA 4GCAA 1G6CA 4WQ6A 3CC1A 2RHGA 1JYVA 5KINA 3N1AA 2R94A 4AX7A 5G4HC 1QXLA 5LNUA 1E0XA 3WUGA 4PMQA 4IFOA 2NWRA 3UWVA 2QAFA 5CBJA 2DZPA 3LB0A 2PDHA 3MO4A 1CGVA 1W5OA 4HNOA 2DT2A 4DRKA 2Z27A 1H1ZA 4HGXA 4IQJA 2JF7A 4QE1A 3HPFA 2VC7A 3UWYA 4BI6A 2XVLA 2RH9A 4WSKA 4FX8A 4M6VA 5TF0A 4ZA0A 2WKGA 1OY0A 5DXYA 2E3ZA 1XH2A 1KRAC 4Q7IA 4NNBA 1QZ2A 4AWSA 1HIZA 1NVMA 3WK3A 4RR4A 3LGDA 2WCGA 3P60A 4Q8OA 5MF5A 4FX6M 5M2FX 2PEVA 2D22A 3L5LA 3PZNA 3PC0A 3QV9A 4F4RA 3M0JA 4GJ1A 3QF0A 1QOPA 2FFCA 1XGZA 3W1XA 1XGEA 4UOZA 1DEDA 3I4EA 4G7EB 1T6MA 4HK7A 3KXQA 3IJ9A 3ZOAA 1T5AA 4L5ZA 1G5AA 2GPTA 4O1BA 5HJYA 3GVGA 1LLOA 4N2YA 4R88A 3MJMA 1GQJA 3VCRA 1OWQA 1L8NA 4Q4RA 4AISA 3G1SA 3KBWA 7A3HA 3WLNA 4Z42C 2G95A 4CEXC 4JYEA 2IPWA 3QMRA 1IR1A 3MC5A 4F0LA 1MO0A 2QVHA 3ZJ7A 1C9HA 4F8XA 4M6UA 4UR8A 1ITCA 4O11A 3GDRA 5A6LA 1GT8A 2E1WA 3GDTA 4GIEA 4QJ3B 4W7WA 3NO1A 5J04A 1NP2A 1B90A 4AMCA 1KM2A 1QT1A 2F6KA 2PDCA 3UBPC 5ABFB 4DWSB 2WC7A 3K30A 5C2XA 1OF6A 1FXQA 4AC7C 4XAGA 2ZWYA 2BWGA 3W1NA 1KM1A 4PUJA 2WB5A 3AHXA 1FWEC 1VEMA 4TW8A 3C0QA 2GGEA 5A8NA 2PDPA 3MVIA 1EX5A 1I45A 4LNCA 3AWOA 1GOKA 1E6SM 3UI4A 3CV6A 3VOHA 1FHLA 4DBUA 4GUFA 5I02A 1SZEA 4GIVA 2EJ1A 4DVOA 1UR9A 4P8XA 3CV2A 4AVOA 3OEXA 2J9YA 5EBUA 3HO8A 3AU6A 4LANA 4PGLA 3W1PA 1G7VA 1YKWA 2C0HA 3H4XA 4PTNA 5AC6A 2VWTA 2ZQTA 1X6NA 5BXTA 3M9YA 3NSMA 1YATA 1EGMA 3UXKA 4QHRA 4GZJA 4YYCA 3D47A 4OV4A 2YLLA 4FEZA 4TR9A 1VAHA 2BGNE 4NX5A 3TE9A 2VVNA 3QVQA 4HZ7A 1FP8A 3R1ZA 4RE3A 3WQVA 1E56A 3NYZA 5U7SA 3BJTA 1BQCA 4KGJA 3UWWA 3BAIA 1TPEA 1O5XA 3INPA 2C79A 3GTNA 4HNLA 1PKMA 3L23A 4FX7A 1RBOB 1QHPA 5G4EA 3BW3A 2V8ZA 1ISYA 1EOMA 1NQKA 3HFTA 1QO5A 1YW1A 3BOFA 4FF7A 4DRIA 1TWSA 4W7UA 5DY3A 3PTMA 1EJ7L 1JPKA 3AWNA 1LTDA 3UF9A 1UWTA 4LUSA 3GLCA 4XD3A 2OLHA 4IIDA 1P0DA 4KEUA 3ME3A 4FOJA 3NUKA 1UH3A 3WF3A 2BXZA 2PFHA 2ZXDA 2TAAA 3NQ8A 3W7HA 2VRQA 1FHUA 1DWIM 4F0SA 1PCWA 3I3BA 3FIGA 4KT2A 1EX1A 5FEWA 3S2CA 3GVRA 1EXBA 3VDHA 1S2VA 1Y65A 3GYCA 2IPJA 1PIIA 4LBSA 3F4NA 3AXXA 5E0KA 4EAMA 2QDDA 4GOAA 4P61A 2PU0A 4GX9A 3A5VA 3VM5A 4XKMA 4O52A 2XM2A 2NQJA 1D3CA 5CAKA 1Q66A 4MAZA 3MW7A 4H1ZA 4GGQA 2OXNA 3LMYA 4YMZA 3Q37A 1PO9A 1SO6A 1ZCOA 2CLHA 4IGSA 4QCEA 4IGNA 6TAAA 4DEFA 3HGJA 3TTYA 1E4LA 1BYCA 1OG6A 5DX7A 3L4TA 3S4TA 1H4PA 4LTSA 4C6JA 2Z0IA 3S42A 1C92A 4DAIA 1OG0A 7TIMA 2WVSA 3M64A 3OZPA 4X60A 3W7MA 4D2JA 1FBAA 1OCJA 4TW7A 3QGKC 1CXEA 3PWGA 4YVPA 2ACRA 2E67A 4L65A 2OOFA 4ICMA 1KV5A 5FAJA 2QPSA 3DEQA 2EG8A 3UZZA 4JQ2A 4GZIA 1RY8A 4N4PA 4DRPA 3A9BA 4UR9A 7PTDA 3GU1A 2AQVA 4L56A 4RCXA 1H2JA 4CU7A 2IF4A 3D3FA 2WHMA 1I2QA 2O56A 1XBXA 5C70A 1O6IA 4HZ8A 2NLIA 1RK5A 2F6UA 4LWWA 4AZ6A 1QMLA 1AL8A 1O68A 1TO3A 4LAMA 2DZSA 3LK6A 2J88A 4OBTA 3QLLA 1J4HA 4C02B 3BCFA 3QKZA 4MOZA 4CVUA 4DI9A 1B1YA 3B04A 3H7VA 1YTDA 5HMSA 1ZGDA 4MPQA 4CD7A 2OSWA 4ZEPA 2XPBA 3VI2A 2G8ZA 3TN4A 3QR3A 4NJJA 1F6KA 3RU8X 3TJXA 2NQ5A 4A2RA 2WSRA 3UG4A 3UXLA 1MEWA 1CWYA 3WUEA 1OCNA 1OC5A 1YBQA 3WF4A 1NMWA 1OD8A 3CHDA 2F9RA 2A4AA 1B4EA 3N12A 5AHEA 3E74A 3W24A 3QV7A 3VNYA 1DKWA 1UH2A 2V81A 3UJRA 4CVWA 5AC4A 2Q01A 3ITLA 2YJQA 4PZVA 3S5NA 3G18A 1PKYA 3O16A 1XFCA 5EBAA 4ZS6A 4WD0A 3N4EA 3U2CA 4PCSA 1MXDA 2A6NA 1GVOA 1WOAA 5KTLA 3KHJA 1FDJA 2B7QA 1HZYA 1VYPX 3CK5A 2C1IA 2VEKA 4IQLA 4PTXA 3GO2A 2YA2A 1M5YA 2AWGA 2YDAA 1RD6A 4JQ1A 3SQMA 4J3UA 1JVNA 4M24A 1IIGA 1XD1A 1LG2A 3LCXA 1E6PA 6ENLA 4JKKA 1YPIA 1TREA 4EANA 2X42A 1UWRA 1M5WA 1GOIA 1GONA 3PBUA 2ZWZA 1A49A 4DRNA 1HTIA 1Y0EA 2UY5A 3QJAA 5I03A 3MBDA 1VRXA 1J0YA 3ORWA 4JL2A 5D9PA 3NFUA 1EYWA 2ICSA 1RXOB 1Q6EA 5G1YA 1VFMA 1F74A 2RUQA 1TCDA 3B0YA 3H2AA 5CZJA 5DCEA 2BVYA 3LHWA 2PWEA 5GPGA 4XZBA 4UMBA 3QHOA 4YYFA 3EWWA 3QSTA 2E77A 1HL8A 4JIPA 4FA3A 1RALA 1W8GA 1L0PA 4EWND 4C1NA 2GGIA 2HTMA 2J13A 3H2OA 3UGRA 3CU2A 2EPLX 3G8RA 1BWVA 9XIAA 3C2VA 4ML4A 3IJDA 6TIMA 1WXJA 3IJQA 3GR7A 3KVKA 3ZSSA 1JDEA 1TG7A 1MNZA 3CNYA 1B3ZA 3NIYA 3VO0A 4HU8A 3S9YA 3VGDA 2F21A 1GOXA 3KWXA 3QPZA 3W7PA 5C0QA 3EWXA 4BF8A 2X1TA 2NSXA 1D8WA 4YCPA 3IRSA 4GO9A 3FSUA 1RZMA 1JFHA 1GZJA 3N6JA 5HAOA 3T4WA 1ZBKA 2J78A 3APTA 3F4VA 4INFA 4ADTA 5B7YA 1MZRA 5T26A 3WL1A 5KETA 4PUNA 3Q45A 4F0HA 1A5MC 4NI8A 3LTYA 3OGSA 4GX8A 2OZ8A 5E9XA 3NQ2A 3M0LA 2KE0A 2OU4A 1B31A 5LIUX 2E9LA 4F0RA 3LHVA 5A2AA 2EGZA 4A35A 3IIOA 1GEHA 4O0QA 4KQNA 4WXYA 3S9ZA 3EX2A 5FACA 2D0FA 3FDKA 2LPVA 3IKDA 2EEXA 3PHAA 4AU0A 4IT4A 3VZXA 5KZDA 3SJNA 2VCBA 3OZYA 3OIXA 3POHA 3WZ0E 3M5XA 3ARWA 4KCWA 5HBFA 3UPWA 2XFYA 3CGTA 1TKKA 4H6EA 3DFPA 1QAPA 1XSKA 5G1MA 2NUXA 2YW3A 3MYPA 4IMFA 1LUCB 3ZZ1A 3L4VA 1MVYA 3FA5A 2ZX5A 3CTTA 1US2A 3IARA 5HDRA 3NTYA 5CSUA 2RGLA 3M4HA 4J4KA 4R34A 4WY0A 2E8ZA 3APGA 1CGYA 1YNQA 3G1XA 1HKMA 3A4WA 2R6OA 4H8UA 3QR0A 2Y63A 3ZJ8A 1KFKA 4AZ5A 3OG2A 4G1KA 4R7WA 3RRAA 3CQHA 4REQB 4FF5A 2OR2A 1CGWA 2PLCA 4NG3A 3O3RA 5BOEA 4NF7A 1KKRA 1T0OA 4LCRA 4TVUA 2KI3A 4UB9A 4P5UA 1PYMA 3P0XA 4EVZA 1FCBA 3GAYA 1N2VA 3LM3A 3KL5A 3SCWA 3VOGA 5JQ9A 2IMRA 3GXMA 2BODX 1K8YA 4HMEA 3S0CA 1BG9A 4UCFA 2Z7KA 3G1AA 4NAFB 1IEIA 5FF2A 3F5LA 3AMKA 2KFWA 4GFIA 4QG9A 1NOUA 4XAFA 3WO8A 4IM4A 2WVTA 3TNOA 4HHMA 1ROTA 2ZE0A 3PZVA 4DBEA 3KLKA 3IVTA 1UP2A 3S1XA 3GR8A 3C8NA 1XRSA 1DOSA 1EQCA 3GNDA 4MNKA 3K13A 3KHDA 1XJBA 3PTKA 3ITXA 4V1YA 5AZ1A 3TV8A 4WLCA 1GQLA 3W02A 2A0NA 1MW3A 5I06A 2H9AB 2ZA3A 3HG4A 3R0DA 4NAEB 4HYWA 1F40A 4S2BA 2OT0A 2V9DA 3TAKA 4D6FA 2VOMA 3LI1A 1UZDA 3IUHA 4J3XA 4KRZA 1Y5VA 3GXTA 3CHFA 1VH7A 3KOFA 3MUIA 5ABEA 4WSHA 3QGVA 4LS0A 4OUEA 1O5KA 3P5ZA 4WJXA 1QW7A 2VR2A 3PAJA 2ITKA 3VAWA 3W1AA 3O63A 1ZRQA 4AAJA 1XGDA 2YA1A 1JGMA 4AF0A 3U48A 4ODNA 1OYCA 2WVVA 1FX6A 3M0VA 4NJHA 2PBGA 3DAQA 1OFBA 1V0KA 5D9OA 4C7DA 4MSPA 1QJWA 1UIOA 2QIIA 2QHAA 1X7IA 3URQA 3NQDA 1TRIA 4TV6A 3SCNA 3DG3A 4LVDA 1V6WA 3TN5A 5M17A 4XSLA 1A5UA 4AIEA 2R1LA 3KAFA 3HB9A 4WOQA 2PP3A 5A69A 3NQBA 2E0PA 3WNPA 3WJWA 1VR6A 3UXIA 2MANA 2HS8A 2GK1B 2WHKA 2WJEA 3MCNA 2BDQA 3I7QA 4AMAA 1N55A 3PBGA 1F8IA 4YVVA 2W3ZA 1W9UA 3O5FA 3LNMA 3SY1A 4Y96A 3GIPA 2W27A 5FJUA 2WNNA 4ODPA 1YMYA 1GRJA 3ISIX 4QCFA 5AVNA 3PULA 2FYMA 4GQ0A 1EZWA 3W7KA 3DU0A 3O5OA 1SYTA 2KR7A 1XWYA 4B15A 1GKQA 2PRMA 3BSHA 4LAUA 1MW0A 3GDLA 3QY6A 3K1GA 4UR7A 3OBAA 4IMAA 1HJUA 3F5KA 3T0CA 4U85A 1YLVA 3M5VA 1OZQA 4Q8VA 4D71A 4H2CA 3FEQA 3WDHA 1DVJA 5I6SA 3N2OA 3VNIA 3AIEA 1RJPA 3E3HA 1ZU8A 3ITYA 4TX8A 1ICPA 1SMAA 4JX5A 4PUUA 4YVXA 1UD2A 3G1RA 2A79A 3N15A 4KH2A 3STFA 1K8ZA 3VABA 2NUWA 4EX4A 5A94A 3BLLA 2DDXA 3UFYA 1A53A 1VJIA 4GGBA 3F03K 3M5YA 3JUGA 3RFWA 1EPXA 3H8AA 2A3LA 2VDHA 2CNCA 4D6HA 3W27A 4HYRA 3QY7A 1QPQA 3I6CA 1VEPA 2PDLA 2WJDA 1W3TA 5BOOA 1UR0A 4ZCWA 2YBTA 4G1NA 1QNVA 4PN2A 4PB4A 2GSJA 5FAGA 1V0NA 4LOCA 3MHFA 3FAPA 1PHWA 2CZEA 3PPHA 2ZC1A 5DEZA 1OC7A 2OZTA 4MB1A 3UGVA 3BO9A 3GNNA 2LLEA 1F3EA 2BHYA 3NQ7A 3W53A 5PTDA 3TFXA 1GORA 1X6UA 1E9ZB 3IK8A 4LVBA 4L7ZA 2ONEA 1SSDA 1R3SA 1KT0A 1E6RA 3KRZA 2Y4SA 2XP5A 4BZYA 2Y8KA 5C55A 3E12A 3GG1A 1LF1A 1K03A 1EQPA 1P6BA 3IIPA 4LS2A 3VUSA 4Y9OA 1UD3A 2Y5JA 2A1YA 4MZYA 3ZVIA 5BXSA 3V0UA 3VIOA 3THDA 1Q6OA 4UFLA 4Y9NA 3U4AA 3S5ZA 4JTRA 4Q8MA 4WDTA 1OCQA 3OG3A 3TCSA 1B3YA 2O9RA 4EKJA 1DTUA 3FLUA 3BC9A 3UZYA 2WXDM 3LSCA 1O95A 4IMGA 1B54A 2GQ3A 1BYAA 3N6HA 3KTXA 3W7EA 2VP8A 1Q6QA 2IW0A 3C2RA 3P7YA 1JR1A 1QHZA 2PWVA 4PL2A 3UZ5A 2X1UA 4AD3A 5BRBA 2Q6ZA 4HHLA 1EEPA 3JZEA 3STGA 1SU5A 1TVNA 5AYIA 3VM7A 3WJZA 5J5DA 2WM1A 3VIIA 2YW4A 3PRBA 3C6CA 1LRQA 1PZ1A 1DQWA 3NM3A 3P5YA 2I16A 2WZHA 4K1WA 4Y9PA 3WN6A 3E0VA 3KM8A 1X39A 4AWTA 1WKDA 5CPMA 3UR5A 1IXOA 1MWOA 4F3HA 1J0ZA 3O0KA 1JUBA 3DG6A 1BQGA 3LMZA 4YTTA 3WQPA 2ZQSA 1Z69A 2HCVA 1KM6A 4ZFMA 2KGJA 2R1KA 4AH7A 4DRSA 1I4NA 5EGRA 4W8BA 1MZHA 3K5XA 4E2BA 1RVKA 4H9VA 3CHVA 4IX2A 4XKYB 1LYXA 1ME8A 1PYFA 4Q4PA 5LSMA 2CZVA 2BNJA 4PB3A 3KBSA 2WOQA 1XDJA 1XICA 2AKMA 3B7XA 4XSMA 4FIRA 4QR6A 2WCAA 3WD1A 3GTYX 1S5TA 4KFPA 1HVXA 2GSEA 1JUKA 3EOOA 2ON3A 1QI2A 3EWZA 5JIWA 1XLKA 4A3HA 3NL3A 2DV0A 3EPNA 1FFRA 1OFRA 2F7FA 3LBOA 4NL1A 2D0GA 4HU4A 3ZSTA 3CZJA 2RURA 3GRIA 3LRMA 3W7QA 4C6FA 2Z26A 4HOXA 3RPDA 2WW5A 1ZBCA 1E40A 4FZIA 4JTIA 1ADOA 3H22A 4AG0A 4E6MA 4LPCA 4E8GA 1UD8A 4XBSA 1KRCC 5I3DA 2Z1XA 3DH7A 3IANA 4HPJA 4PUWA 1VRDA 5HMEA 3LHUA 3O07A 2FQIA 4GWEA 1QNQA 4NZ4A 3GZ3A 1IT7A 3T40A 5A8OA 1OINA 3WDJA 1E6QM 4JBRA 3CL6A 3K2GA 2V6AA 2J27A 4OOZA 2PDUA 1XI3A 1V0LA 1Y5XA 3LUTA 4GYJA 4F79A 4M80A 4P8VA 2TSYA 4WHBA 3W74A 3CZ8A 3E49A 4H9TA 3MCOA 1X96A 1FCUA 3GVVA 4LRSA 3GXFA 2WMFA 1PX4A 3RAOA 1TUXA 2NQLA 1FWBC 3OVGA 2GSHA 5D09A 2YDQA 1ESWA 3EX4A 4D6GA 4K8GA 2CBUA 3HZ3A 1EL3A 3VC5A 4H41A 2DZTA 1HXJA 3CUZA 4H6QA 3T05A 3NDOA 1A47A 2VUYA 2OFJA 4Z1BA 1QASA 5FF3A 5LNVA 1ZALA 3B0UX 1RH9A 3GFXA 3T78A 4UUIA 1R2TA 1B6CA 5M3WA 1U1UA 4JIRA 1NU5A 3NSXA 4GUJA 2ZX7A 1E1FA 2YZRA 4FNUA 4M7SA 4ZBCA 4NJKA 1LOQA 3FX4A 4IPXA 4NYYA 1POJA 2DZVA 2YDRA 1D3HA 4N42A 3RLHA 4F9JA 2PDNA 3SCQA 2Y6ZA 1Z48A 2GDVA 4CQ9A 1WAWA 1A3HA 3T44A 3CPGA 4OBRA 1VHCA 1V6XA 1JZ6A 4NZ1A 4E38A 4DX3A 1TX2A 1W5MA 2K8IA 1JDAA 3H2FA 1XR2A 1RP9A 3EPOA 3KX6A 4GYFA 2PDGA 3CWOX 4HK5A 3P84A 2UBPC 5KITA 4GH3A 4AZIA 3OP2A 1V4YA 5J8LA 1NDWA 2FHFA 5FSDC 3QMTA 2QEZA 4QSFA 2FKPA 4UMCA 3ITOA 4GNKB 3G0XA 3B8TA 2J7DA 3NZPA 4O0ZA 2Y85A 2IXVA 3T6CA 4LYQA 2AAAA 4HA1A 3FVDA 1Q6UA 2ALRA 1IEQA 5LZLA 1MDLA 5FJTA 1D7HA 1M7JA 4XZHA 1XLHA 4AY7A 1U5VA 2C1GA 1YNYA 1O5QA 1Q63A 3FCPA 1E72M 3QBUA 4NSBA 3FJNA 3T81A 1PKNA 5I7GA 3OODA 1DYSA 1R0MA 2DT1A 3WQFA 4EPBC 4EXBA 1BSIA 1XYMA 2EF9A 3GB6A 3WQWA 5LNRA 4IQ2A 3SAZA 4MWAC 1RCQA 3RMJA 2R82A 4Z2JA 2OGJA 1UR3M 3MP5A 4EXQA 3N3TA 3CV7A 2XISA 1T8QA 4KWUA 1LUCA 4MHBA 1W5PA 3OOQA 1ICSA 4H04A 2PWHA 1SJAA 4JX6A 3BDKA 1QPRA 5B80A 1MEHA 4LEQA 3WMLA 2DUZA 3H2NA 5HW6A 2ZRVA 3GDBA 4NY2A 3TUUA 3L4UA 3SCPA 4MYXA 4DN1A 2HVOA 3VIFA 2EPNA 1VYSX 3EWDA 3YPIA 5DANA 4REQA 4YTSA 4YIWA 4DXVA 4HBKA 2Y0FA 2DSKA 1EJUC 4I3GA 2PPOA 1J0HA 2ETNA 4J3SA 4W8LA 1SQ7A 4BFAA 4K36A 4WZHA 2C8NA 4IJCA 5JBDA 1FXPA 2OQYA 4EF8A 3DFNA 5JUVA 4BWLC 3N3MA 3O5MA 1DJGA 1WV2A 2OSYA 1OK6A 2R24A 1PHQA 2VFGA 2BLEA 4NAFA 5I77A 3S5SA 3CO8A 2CW6A 2QAPA 2DVTA 3M0ZA 6CGTA 1R9YA 2VENA 1H7RA 1U2YA 1V77A 2BHZA 1GPWA 1UHVA 1TJRA 1YRRA 3ARTA 3LZ3A 3ZVHB 1K70A 1XPGA 2E6FA 2DZUA 3AIBA 4J28A 3MI3A 2A2IA 2VZVA 2CERA 4DNMA 2RDXA 2VO5A 3MMWA 1EWDA 4OVXA 1HF6A 3R6IA 3KP0A 4D6DA 3IV8A 2BZNA 4A3RA 1EXPA 1GHRA 4CNNA 2VX5A 1ONXA 5HW8A 1R3QA 1SSGA 3QOKA 4UQEA 1S5VA 1P7TB 4W5ZA 1ISWA 5HANA 1R8LA 3ITGA 4B5XA 5HWCA 1UKTA 4ATWA 1QK2A 1F07A 2PWFA 2QNEA 1K7EA 1RLCL 3OLGA 5XIAA 1A5LC 4CD4A 2XP8A 2PGEA 2E8YA 1BF6A 1BKHA 4DQWA 1BXBA 4KQZA 3GR4A 4C6BA 1PS9A 1OC6A 5FKYA 4MG4A 3EMZA 2FPTA 2VCCA 2ZR6A 1FOBA 4GZ7A 3O5PA 3A6OA 4MTVA 4AB4A 3F4CA 5H8MA 4ZQOA 4O28A 1YIXA 5FIPA 3TU9A 3USBA 1FKBA 5EMLA 3KAIA 2BXVA 4HMNA 2XVKA 4UFHA 2FZ9A 2PWGA 5CC6A 4JTLA 1RV8A 4L1XA 3VIGA 3G1DA 2NXIA 3CUJA 3HM7A 1TJPA 3SRKA 1E73M 3NURA 4XIMA 4QAIA 3KZ7A 1MYRA 3CAKA 1FHVA 1XLDA 3OZMA 5GNXA 3EKZA 4DYKA 2M08A 4DBWA 1LZOA 3SY8A 4HPNA 4P7RA 5DMLA 2C7FA 1E3XA 5CG7A 3UERA 2XWDA 4H8HA 4EWJA 4NNAA 1GTHA 4LAXA 1VHNA 5AHFA 3H2MA 1I8JA 3GXNA 4ZSUA 2GDUA 4EPDC 5FI8A 4QS5A 4NQ1A 1KCZA 1B0IA 1SZFA 4HTYA 3ZIZA 1JDCA 1NF0A 1THFD 2QV5A 1FH7A 3NAVA 1GOQA 1RJQA 1PZ2A 2EKCA 1FDYA 3FDGA 3C56A 3UG8A 3V36A 1C7SA 1JPDX 5F4SA 1KBJA 2I1OA 1QU4A 1TIMA 3VIMA 2CLEA 2GVGA 2MUCA 1NWRA 2A21A 4PUDA 4Z0JA 3UI6A 3W7RA 5IHRA 2QDEA 1IZCA 1OFAA 3KCJA 3B8UA 1H3GA 3L66A 4E0CA 3S1UA 1AH3A 2VGBA 4HBOA 4FS9A 5DRIA 5HNUA 3UCDA 1CLVA 4CN6A 1CXLA 1LRNA 1Q8AA 4IFKA 4BI5A 1WUFA 4QP0A 2G3FA 2QUVA 2FPYA 2CLMA 2DG3A 1EDTA 1DQXA 3PZGA 3LM7A 1AW5A 2UWFA 3P2VA 4IP5A 3FKRA 4MWAA 4I8YA 1XSIA 3RLGA 1YTEA 1UWUA 3Q67A 4QZVB 3B9DA 2QCDA 5ECVA 1W2VA 2X0YA 1K9TA 4C7FA 4CQBA 1S1PA 1FWNA 1KTBA 3BG5A 3RO6A 2VQTA 4IICA 3CLWA 2F2KA 3WG6A 2QGHA 1OD0A 3IGHX 1NP0A 2OT1A 3HQNA 1F3TA 1AQ0A 3WLHA 3WBXA 1R2RA 4UTKA 4AD1A 1MRQA 3L0GA 2VGGA 1H09A 4IG2B 2SFPA 2HMCA 4IJBA 3ZXWA 2BBFA 2E1DA 3EEZA 4XD6A 5AC5A 4DZ3A 2OKTA 1KT1A 2DORA 4J5NA 4UFIA 4TW6A 2ABAA 1CX9A 4MADA 1MFUA 5BU9A 1CGTA 2J6XA 2RUDA 2FJKA 1V3KA 4Q3MA 2L5HA 1ITUA 1YXDA 4N19A 3HA1A 1C9DA 3DFSA 1V51A 2PDQA 3WX7A 3VNMA 5D03A 1EHAA 4ES4A 4PULA 4ZOAA 1D7FA 1HGYA 5H8UA 3S2NA 1EA9C 2D0HA 1FKKA 3GFYA 4RDVA 1K8XA 2AOSA 1WKYA 3L68A 2FMOA 2V5CA 4JHZA 3F4WA 4DJEA 4Y90A 1KA9F 3KRUA 4S38A 1O66A 1UBSA 3HPXA 1FY6A 4I90A 2M2AA 4JDBA 1NDZA 4KWVA 1LQ2A 3PNUA 5DMMA 1UWSA 1B4KA 2PPPA 1MUCA 3OJGA 3GM8A 4LU0A 5K9DA 2ISFA 2BMBA 3DESA 1RCXB 2ZUSA 4HD5A 4AIUA 1OJXA 5TAOA 3MTWA 3PJWA 1VKFA 2HQAA 5KZMA 1YNPA 1DWFM 2YZ5A 3T55A 3RNDA 3B06A 4QEEA 3WNLA 1ZK6A 1R6WA 1EC7A 5D4YA 1F9CA 1A4MA 3NCOA 6XIAA 2ZZ5A 4HSHA 1JULA 1TR9A 2XP7A 3PPGA 4DUOA 1IEVA 3CQJA 4I7UA 3TSDA 5C5YA 2X7VA 3PUGA 1ZFJA 3U5UA 1H7NA 1SZGA 3BAWA 4XKYA 2Z25A 1KFJA 1K77A 1EIXA 2NVCA 1DXIA 3E0LA 3WQOA 1KNWA 1R7AA 3H12A 3RM8A 3H7UA 4V27A 4UXDA 3BLPX 1JYXA 2PP0A 2CLPA 4N4QA 3S2MA 1FWFC 4JDYA 5CZSA 3KVMA 4GI8A 4KEMA 3U2OA 1EF2A 4UTHA 1PDZA 4IP7A 1GVFA 4TYOA 4L6DA 2ZVIA 3PZUA 3UR8A 4E8CA 3UPBA 5A1AA 3UQNA 5C54A 2AL2A 1TWDA 3IJ8A 1S39A 1FKDA 1CW2A 2G0WA 3DXIA 3H21A 6ALDA 1RBLA 3VINA 2HS6A 5AHNA 4LB4A 1A80A 3NTPA 4GGHA 1CECA 3OIHA 3MKCA 3QY8A 4H3DA 4W9OA 3DYPA 2YX0A 1F05A 2ZRXA 3LUOA 3PFRA 1KFWA 4EIVA 3S46A 3V5CA 2J8FA 1BKFA 3GC4A 1DJHA 4LV4A 2Q71A 4YWIA 4WDUA 2PU1A 4O54A 1T96A 2JF6A 1VZWA 2DUXA 1TMHA 3HQPA 4F2UA 2P8CA 1HKWA 1UR4A 2P3ZA 3OOBA 1KM3A 3GC2A 2F84A 1AD4A 1NH6A 4HMDA 4KWSA 3UT0A 5GVJA 4O0KA 1AJ0A 4YJ5A 4MKNA 1GNXA 1LT7A 1T7LA 3V1HA 2BSLA 4IISA 8XIAA 1C8YA 1JJKA 3RPTA 3TW9A 4JNMA 4MUPA 3D5HA 3ZT6A 1Q7MA 1HKVA 4NASA 4H7VA 1OEPA 1GK8A 4RPQA 4J35A 2JGYA 4L1GA 5LIXX 3UWZA 4GVHA 1FWWA 3WFZA 4JFKA 3CH9A 3ZLGA 4ZOEA 1H1YA 4Z08A 1J10A 3PR9A 2QJNA 1IT8A 1L6GA 4D6CA 3TAOA 1C93A 2PRLA 4DNHA 1QWKA 3DGRA 5JH1A 2V5DA 1TWZA 1Z32X 4C6OA 4PYSA 3OVPA 2WZMA 4R7OA 3VDAA 1FA2A 2KZHA 3LXAA 1IV8A 1EUNA 3BL3A 3VD4A 2VM8A 3VDGA 5CJ5A 3FHQA 2FGZA 4A6GA 1W0MA 1B9ZA 1JZ8A 2PWDA 3N17A 4LC6A 4R27A 1R5YA 1IEWA 2HSAA 1R9ZA 4RZ5A 4F0MA 2VZUA 1J0IA 1PTDA 1HJSA 3S2LA 3UG3A 4PTWA 3A5FA 1SO4A 4NYUA 1S5MA 4PRTA 3WD2A 1DJXA 2W6RA 4XIAA 2XZ9A 1GVRA 3MO7A 1XG3A 5IRPA 1SJCA 2OSXA 3NZ1A 5FF0A 3SIMA 1A3XA 1XS2A 1Y0OA 5HUAA 2ZTJA 3K46A 3B03A 4WJEA 4DJDD 3EPMA 5ABHA 4D8LA 2X05A 4JN8A 1KRBC 3W7NA 2X30A 4GI9A 3GTXA 2QGYA 3D6NA 4QJ1A 4BKNA 3EWBX 3UEQA 2QCCA 3RIKA 1PWLA 1P0KA 2OFNA 1NELA 3N13A 5JVLA 3OQEA 1AH4A 3GTHA 1QPFA 2W5FA 4UTMA 3VOJA 1BRLA 1GQNA 2BY0A 4NU7A 5LYRA 3TLQA 3TJLA 4DWDA 4JXCA 4H9UA 5REQB 3RILA 4RDWA 4MY1A 1ONRA 1Q6FA 3NNTA 4ZZ9A 1QOQA 1TUFA 1FWIC 4RX0A 2BV9A 1H7OA 3T07A 2NV2A 2NUYA 3TH6A 3C3NA 3LCLA 3ALGA 3BV7A 4W87A 3R89A 1C29A 1GKRA 2ZRUA 1TCMA 1U79A 1J12A 3UESA 4KWWA 1IX5A 3PN8A 3M5ZA 3KW3A 1DL3A 5C6MA 4Z1AA 1DXEA 2ACUA 2FH8A 3VE9A 1YW5A 1QR7A 4KF1A 3VOFA 1N7KA 2YA0A 3CT7A 4JFJA 3C2EA 1OBAA 3CIXA 3WEOA 2V5LA 4RV8A 5DCDA 2NV1A 1TZ7A 1NDYA 5MKGB 1JAEA 1E5NA 1QCWA 3L21A 5CCZA 4XZMX 3RM9A 3HOJA 4JTEA 4PMOA 4TTUA 2POZA 4PMDA 4HT3A 3KUMA 2B0MA 2MLXA 5JMUA 2GVYA 4U84A 4O53A 4ITZA 4IUGA 3PUDA 2OWXA 4ZQCA 5HULA 4LYPA 2VCDA 3QM3A 3C52A 3ZLFA 3ZVHA 5C9WA 1ZHAA 5CPOA 2OEJA 3FXYA 2QPUA 4W9PA 5EYWA 1UKPA 3PK7A 4KWOA 2XH7A 3ABOA 4D1IA 1CZ1A 2LJ4A 4DLMA 2FB3A 2V3EA 3LEPA 5F2LA 4US5D 2VC6A 2YGYA 4L9ZA 1XKJA 1D2KA 1G94A 3LERA 1EJWC 4WR3A 1VLIA 1T8XA 1F7BA 2VT0A 3NYDA 3WLPA 3URBA 4Z2HA 3TC3A 1ELSA 3XIMA 1P7TA 5E09A 5TBOA 3CXOA 1TV5A 1TZ9A 2XIOA 2GGGA 2QQ6A 4IMCA 2XVGA 2OX4A 1XRFA 4WDWA 3C0LA 3HG5A 4Q4KA 4JKLA 1GQKA 2VDIA 3P93A 1XLIA 1FKHA 3NZGA 2OLSA 1WX0A 2C91A 4L6HA 4E5TA 1LL6A 2RJGA 3CWHA 4OBSA 2UV8G 4ODMA 4MNLA 3E0WA 4AYGA 3O9NA 4MKSA 4W93A 1XQLA 3AMDA 1IXPA 3WBAA 5HQLA 3W75A 1U83A 2CBIA 5E93A 2VEFA 2DG4A 2XIQA 1W3IA 3OBEA 3UQBA 1TV3A 4D9PA 4FNTA 1ZCCA 4DWSD 3NXLA 4LQ1A 5DMNA 2FFIA 4UTWC 1QNOA 4DI8A 2XM1A 5A8GA 5B8IC 5CPQA 1I60A 3M43A 1JXKA 2P8BA 3SUTA 1V0MA 4S2CA 2RQSA 1AZ1A 2VOTA 3B9OA 2XPKA 2F23A 3ABQA 1FWTA 3SEPA 1UG6A 4CU6A 3UYCA 3GX9A 4IIFA 3QFWA 4QG6A 1WP6A 3GHSA 1NSGA 1NFBA 1V3IA 3UJSA 2V3GA 5HNNA 3M44A 1SR9A 3M0KA 4AIBA 3DERA 1K4GA 3AHTA 2BGQA 4QXIA 1XDMA 1TPVA 4S3FA 2Q3RA 3U5YA 4UZUA 3HQOA 4MIMA 3PBWA 3NJ3A 4EK7A 3TDBA 4AZCA 4N6EA 3KTSA 1SGJA 1NWTA 3VDBA 2EG7A 3URNA 2G3MA 2CITA 3R0UA 3QKEA 1MXSA 1XLJA 4MJ4A 4UFKA 3VD7A 3BLEA 1W56A 3DGBA 4MVAA 1BXCA 3PAOA 4I8DA 1KBIA 2WAGA 1I1WA 1H61A 3CASA 5D2WA 2DSUA 3T42A 3H4GA 5AYYA 2X16A 3W4RA 4KR0B 1SO3A 1CB7B 1IGWA 3W85A 1A0DA 1BEUA 4B3ZA 4PUEA 4KERA 3EA3A 3UZXA 2ACQA 2IKJA 2ISWA 4L72B 4UQDA 3I4KA 4PR4A 3A4AA 3WNOA 3WDIA 4ATLA 3S8HA 2PF0A 1F4HA 4QT2A 3N2CA 1PCKA 1P5BA 1RY0A 2PB1A 4LUJA 4HMCA 1FWAC 2J79A 1AQFA 4E3TA 5DXXA 2BOGX 3WQ8A 3A22A 2D23A 1R3VA 4HSNA 3EXSA 3IRDA 3LBMA 4ZO6A 1XL9A 4FB7A 3PZIA 1G67A 1CXIA 1OX4B 3U0HA 2PDXA 5C8BB 3GKFA 3N29A 4CQCA 4GBUA 4WIWA 3HN3A 1P6WA 2X2YA 1IGSA 1R47A 3SIZA 4N9EA 2QDGA 4WY0F 4K68A 3R4IA 2YXXA 3N18A 2J24A 4RE4A 2A7NA 1O4UA 4QDMA 4MGVA 2Q5AA 2XUCA 3PPFA 2PDBA 3R13A 1DE5A 2Z24A 1XQKA 2VX4A 3CIWA 1TRDA 4ZTXA 1RQHA 4F40A 2Y24A 1JFXA 2G3NA 4O14A 1X38A 3B0VC 3SGUA 2E5DA 3WJXA 4PL1A 2ZVRA 1XIIA 1JG9A 1GVIA 3Q65A 4DUVA 3O0FA 1NOWA 3BUVA 3OGRA 3BPWA 1C8QA 1GEQA 4RE0A 2XP4A 4BEUA 2RUSA 2QCFA 3SY5A 3PJXA 3SN4A 2H8XA 3WQ6A 4NRRA 4E2OA 3TNBA 1JZ2A 4L4OA 3S83A 3IVUA 6REQB 2GWNA 4D6IA 4XO7A 3M47A 1RHCA 1UZHA 3WH5A 4IQEA 3G6LA 2ZFAA 1XIMA 4G7FA 3S3GA 1VYRA 1W5QA 1P1MA 1ZSXA 4OQVA 3HG3A 1S5WA 1J0JA 3CWNA 1J01A 4B91A 3ANUA 3W0KA 1MDRA 4JQ3A 4MM1A 4WKAA 2XPAA 1FWDC 3F2BA 1ISXA 3NQVA 3KTCA 1B3VA 1W1VA 4IQCA 2A5HA 4F2TA 3L0NA 3ABZA 5BYWA 3LD5A 1LORA 4S3GA 3BICA 4LGXA 3HF3A 1VD6A 2HDJA 3KS5A 3WFAA 2BHUA 3I6EA 4NX0A 4NZ5A 2QJIA 3ARUA 1RJRA 1JI1A 4J9JA 1O94A 2IUZA 1O12A 2OJPA 3CAWA 2ISVA 4I5RA 1OYAA 1E6XM 3N2MA 3T7VA 2E40A 1RBAA 4M0XA 1ITXA 2VI0A 5BXRA 2WYSA 2D69A 4UZSA 5DIUA 5HINA 1QPNA 1MI3A 3UW6A 1JCLA 2ZYFA 1YDVA 2PV3A 2PCQA 1ISZA 4UTWA 3AYRA 5IBXC 1E9LA 3A47A 4U3AA 2CKRA 3MV01 2NXHA 3QLDA 3ZR5A 5RUBA 4DO6A 1VENA 4CNPA 2XSBA 1QDSA 2I56A 4JIEA 4DB7A 2CHRA 1WDPA 2E28A 1QBAA 4GD0A 1DJQA 4YWSA 3VDCA 2XGIA 2Z2UA 1KFEA 4FLRA 4RV3A 3ZR4A 3MHUA 1XW8A 4GMEA 2A3AA 3CMGA 2CETA 5I5RA 3EAUA 4PE8A 1ZQ5A 3E5BA 4W85A 1HVQA 1GQIA 4HTBA 3AI0A 4IZGA 5MHBA 1Q2RA 4H8VA 3ZM8A 4W84A 7XIMA 4RL3A 1MQQA 4PBEA 5J5RA 2W79A 4J40A 5BCAA 2CLOA 3VNJA 4YPJA 4UWMA 3J7HA 4G8TA 1EUAA 2QMJA 3E2RA 5GJMA 1AH0A 1LOSA 3NO5A 3QN3A 2BTMA 4O1EA 1V5XA 1KXHA 1FDZA 1TPUA 4AEFA 2FZBA 4J27A 3TZFA 3OHMB 4I9MA 3VMPA 4ZQMA 1L8PA 3UJFA 3REQA 3O5QA 4PMXA 2CHNA 3LY0A 3TIMA 2OO6A 1QPOA 1WZLA 2PPGA 4WF7A 1XC6A 3A3WA 1EYEA 1WXYA 2ZRWA 4A8LA 2J7EA 4QTGA 1PIGA 3AXIA 1XDLA 1YXYA 4N9DA 3LENA 1CTNA 1DIOA 1POKA 3EX3A 3A21A 4MB5A 3DC8A 4IPLA 1V02A 3W28A 5EMUA 2PPNA 4LCQA 2H90A 1TPC1 1PEZA 2HXTA 3D3AA 3O5JA 3CMJA 1Y5WA 3DI1A 1ISVA 2BVWA 4HCDA 1UP3A 1QI4A 4FPSA 4ZXLA 3AC0A 1KM4A 3CQ0A 3BW4A 2Z4GA 1XCXA 3ZS4A 4GYPC 4XISA 2XN2A 2VD9A 4D8ZA 1W1YA 4ACYA 4RPPA 4GI6A 3QOMA 1S46A 1QWGA 4WJ8A 4Q4QA 1W17A 4UTJA 5A5WA 1DJZA 2OWWA 1VC4A 3ARYA 4HN4A 4QIUA 3TLLA 1XP3A 4AC1X 3AIQA 1XPYA 8TIMA 3BAKA 4ALDA 2AMXA 3IGXA 3M0XA 1Q85A 4JTSA 1KQYA 4X0NA 4S3DA 4JIHA 5EL1A 2P3EA 5F7UA 2C15A 3N9KA 1P6CA 4NXKA 4XUYA 4AYSA 4LS1A 3ARQA 4JTQA 4YHGA 5BU6A 3WYZA 3W1LA 1G9HA 3Q58A 4ODRA 1DTNA 3UR2A 3TMQA 4GBDA 1IWBA 1HX0A 1TA3A 1XH0A 4LAZA 3P81A 4I9TA 4KESA 2EO7A 1XHGA 5HR7A 3WY1A 3MI2A 3SQLA 3UYIA 1R3TA 4GY0A 2XFFA 4G56A 4BF7A 4BQ3A 4MYAA 5XIMA 2PGRA 3ZJ6A 1A4LA 5A6BD 4KW2A 2C14A 3EWCA 3IGUA 3NL5A 5D38A 3KCLA 3HPSA 3ARPA 4N02A 4JOMA 2ZADA 3RU6A 5BRQA 4C6NA 3DI0A 3LTPA 1FQ0A 3UCQA 2CLFA 5G2HA 5CBBA 3KZSA 3LOTA 2KX9A 1EB3A 3WD3A 3W2JA 2RDUA 4KEVA 2V3DA 2WQDA 2PDWA 3A64A 3NXFA 3AHYA 5REQA 2EBNA 3CUHA 2YDSA 1Q5MA 3KDNA 3K4DA 3IIXA 1VGAA 3UY8A 3ZQ9A 5C2CA 5EMKA 3TONA 4ASTA 1AK5A 4ORMA 4CEUC 4ACZB 5AC8A 4GY1A 2OVLA 5D75A 1B5TA 4HA0A 4K38A 4C6MA 4W89A 3LLDA 4DRHA 5ABTA 1ZP4A 4NIRA 4M19A 1PJ9A 3WF2A 1NARA 4C6IA 3ZO9A 4JHMA 4S3KA 3PSVA 2E25A 2J25A 3TYDA 1TTPA 3W7OA 1GVQA 3NVTA 3NQ6A 5D2TA 5IBXA 1LROA 1DE6A 3G2GA 4JTCA 4XV0A 3AS0A 1REQA 3H23A 5MKGA 4TU1A 5IM51 2HBXA 4LUYA 5DT5A 2YCJA 2FVLA 3CUFA 4IL2A 3MWAA 2NV9A 4I6VA 3V5FA 3EA2A 2X41A 3CEUA 2OODA 3CL7A 1B9BA 4DBSA 3QW3A 4RUBA 1M9HA 2BY1A 2OCZA 3B40A 1CLKA 3EA1A 3QZEA 3VCCA 2CXGA 3O05A 3PANA 2QYGA 1T99A 1LRTA 5CQ1A 1Q6CA 1RQBA 4FNQA 2JK2A 1CBGA 3W70A 4YN5A 3FOKA 1EC9A 4FIQA 1GJPA 3EB3A 3SFKA 4DLFA 2QKFA 2WMIA 1VIWA 3O5KA 4NI3A 4O4WA 4DM2A 4O10A 1UQZA 1ADSA 4ADSA 2PGFA 1AJZA 1KWGA 4HJFA 4A05A 4X9SA 2ZR4A 2HWGA 3PWIA 3PJTA 4H6KA 4O17A 5BRPA 3AS1A 3JRKA 3DHFA 1ZTVA 2RKXA 3MJYA 4M6QA 4DO4A 3GKAA 3QXBA 3UWEA 2C3ZA 4MZ1A 2D1ZA 1W3HA 2GL5A 2Z1BA 3I68A 4TIMA 4UTFA 3BMVA 2FVMA 1QATA 3L2LA 1NQ6A 3MVTA 1KXVA 1A5CA 4FLQA 5AZ0A 3TZNA 4ZQPA 1OT1A 3EKGA 1OIMA 3PNZA 1W8SA 1L2QA 4BEQA 2YCIX 4DPQA 3V7PA 1T11A 1C8XA 1P48A 1CCWB 4H00A 2TODA 3VNDA 4P7LA 2C19A 2WSKA 1E4MM 2R1NA 1UR1A 1TB3A 5JXQA 3BW2A 1I2OA 3BQ5A 1XC4A 1IT0A 4GYPA 3N25A 2CZFA 3TJ4A 4CNUA 2G4JA 1NAL1 4AIOA 1XKYA 6XIMA 2PZNA 4O1DA 4H6RA 1XLGA 4RKAA 3A4JA 1CYGA 1ECQA 5FEXA 3JS3A 4IIEA 2GDQA 3TR9A 3N2XA 3EBVA 5F1UA 5G1TA 1GYMA 1J8VA 2XVPA 1C8VA 3V16A 5C9RA 1KW1A 3H6OA 2JKAA 1W2PA 4X9YA 1P1XA 1XBYA 4JKMA 3FGCB 4R33A 2CLLA 3W37A 3WUBA 3PA7A 3N4AA 2B5UB 4ILSA 3AHVA 4AHQA 3LN3A 1J11A 2VTFA 5LA2A 4EACA 2NQZA 1AQMA 4PRRA 4GIAA 5F2IA 3WQEA 1AUSL 4XO6A 2QV4A 3NSNA 2GJXB 4DJDC 1XFBA 3MY9A 3AS3A 2V2HA 4B4FA 5TIMA 1E0TA 1BG4A 3W7JA 3U2ZA 4Y8FA 2P4VA 4IMEA 2QR6A 1VS1A 5H2ZA 1FKRA 2F4EA 3GZAA 4Y6GA 2QJJA 1I1XA 1V3JA 3ITCA 3PB0A 4JTFA 3LCWA 1KFCA 1JPHA 1X7FA 3G22A 3LHZA 2VXNA 3CZKA 3FW6A 1J2WA 3HPAA 4HNCA 2GUBA 4JFTA 1FHDA 3K8LA 4TMBA 1QI5A 2JKEA 4D72A 4ZL1A 4GO8A 4C65A 3NM1A 4YTUA 2XSXA 3QYSA 4QEHA 1OX4A 1OVDA 1W1ZA 2DPEA 8CGTA 1Q8JA 4GABA 4PFMA 4LV9A 3CZGA 3QV8A 2ANUA 1E1CB 1HT6A 4FNRA 4FOKA 8XIMA 4GUGA 1WYIA 4QQUA 1C3FA 2WHLA 3VYLA 4H01A 3VIJA 3BE7A 2X09A 3B0PA 4JQAA 2O4MA 3CAQA 3FJ6A 4OV9A 1A5AA 1J79A 4BQ2A 4WRHA 2CZ5A 3AIVA 3IIZA 1WXZA 3DN5A 2ZDSA 3GG8A 1UP0A 1ZENA 5AHLA 1US3A 4Z0SA 2I9UA 3QPEA 5CLTA 5A2BA 3LCHA 3A13A 4PA8A 4CQDA 2DP3A 5HUOA 1X6LA 1FKJA 1P0EA 1XIBA 2JIWA 3W6YA 3MYOA 1SJBA 2FDMA 4EAYA 2RGMA 4R3UA 3UNTA 4L9XA 1GKPA 5IFPA 4ZTYA 2NQ9A 2BB0A 4LY8A 2JIEA 3FYYA 4TTGA 4ATDA 4MNMA 1A0EA 1XLFA 4A29A 4DIAA 1EH9A 1R3RA 1TYGA 3BV4A 2J7BA 3QQ0A 1W1TA 3STPA 3BAXA 3C0JA 1G4TA 1EO7A 3VXGA 3ARSA 3M46A 3TC7A 1K8CA 1V6YA 3NEHA 4ZQNA 1R3YA 4JICA 4KRUA 1UR2A 2PCEA 2QLYA 1QTWA 3VVGA 1TIWA 1CLXA 3IV3A 4JGDA 2VFIA 3BURA 3O06A 4YNGA 3SZ8A 4AD5A 1F76A 1P5QA 2V2DA 1H0GA 1OM0A 4GFSA 5HWJA 2LGOA 2KAUC 1VPQA 1PIFA 1K6AA 3MP3A 4Q4OA 1VBGA 1WNOA 3F2DA 4DZAA 2BG5A 2A7RA 4CGTA 3PBYA 4R53A 5KZ6A 4NXSA 3KOYA 3P74A 4LAKA 3AIUA 2W9MA 3IJLA 3EB2A 1JGIA 3RITA 1CENA 4JAWA 4BF5A 4OHQA 4HOWA 3S9IA 4X61A 2G4FA 3S6DA 3W7GA 4B2DD 5A6SA 2RJHA 2Z2BA 2YCEA 3ABSA 4GQBA 1B2YA 3P82A 1EEXA 1LOLA 4FN2A 1TQJA 4ZO7A 1H7PA 1X98A 3E0IA 1V79A 4DWSC 3ARRA 2HISA 2VFEA 4GCXA 1DV7A 1FCVA 3HMJG 2PLMA 3ZWSA 3RCYA 3GFZA 2X1SA 3EOLA 1U5HA 3JYJA 4UOQA 1Q1CA 5FCZA 2YXGA 3IAPA 3W71A 4NHVA 2D73A 3FXGA 4UQBA 3THAA 2RDTA 1SUXA 4RXGA 1UBPC 3COTA 1QVBA 4XQ6A 3GHUA 4JYSA 2Z7GA 3FAXA 2IKHA 4LUSB 3WLQA 3Q4DA 3E96A 3DFOA 3NPWA 3GNPA 1TJ1A 1NWUA 4J2PA 5EMMA 3FV9A 3TROA 4L6OA 5K3VA 4NJIA 1WCGA 3T09A 4OOUA 3SDOA 3AROA 5HT1A 1Z89A 1UJPA 4DH0A 3CJPA 2EULA 3AS2A 3V0TA 1ZZMA 1V7YA 1FKSA 3T8QA 5AY7A 1K4HA 3WDQA 2X1IA 3OBKA 3CLMA 3HURA 1JXJA 1V3HA 4RZ4A 3UG5A 4PODA 4H9YA 3ZFHA 4IT1A 3UR7A 5H1WA 4HN8A 2ZUMA 4YU1A 1J6YA 3E9AA 4URIA 3TFCA 2FH6A 3UU0A 2W0UA 2PBOA 5CXPA 1TPB1 3T0TA 1QFEA 3BZJA 2BS9A 4Q8QA 4DM1A 4ZOBA 2GUYA 3WF1A 2FIQA 4WEVX 4UCGA 3O5DA 3OLEA 2XG9A 4CCCA 1CB2A 1Z44A 4KMQA 2XYLA 2CC0A 3L4YA 3VKCA 2FHBA 3BG3A 1KM5A 2Q3OA 4QITA 4AD2A 2B7PA 4AVFA 4AXKA 4LALA 1WOBA 1WDWA 8A3HA 4QISA 2OGYA 4GISA 5AFDA 3W82A 1RPKA 1A50A 4ZE4A 3SCUA 1P43A 1JPMA 3MP4A 2J66A 1V7AA 2CZDA 2QPXA 4KCTA 3V4BA 4XWUA 4JD4A 3LRLA 3T2QA 5CG0A 5CLWA 3KABA 4GNJA 1E0UA 5CGTA 5D9NA 3GXDA 2VC5A 3VPLA 4XD5A 1B57A 1XIDA 2YCKX 3EOEA 3E6EA 1X1NA 3P3BA 5FEPA 1MMFA 3R8HA 3WLIA 1GPFA 3KL3A 3MKVA 4QQ3A 1PX3A 4KEZA 1JNEA 3A3XA 4CCEA 2A3HA 5LKYA 3KCEA 2B7OA 1VPYA 2ATMA 3W73A 3N04A 2E9MA 2AGKA 4XZIA 1ZLPA 3RLUA 2E9BA 2QJMA 3RCMA 1KCLA 4KIRA 4OFCA 2WZIA 1O5RA 5D04C 3M07A 1F73A 3FA4A 3MV11 4QS6A 2FGBA 2Y70A 5TQLA 1UD5A 4YL2A 3ID7A 2V67A 1YBQB 4D6EA 1Z7AA 3NGFA 2VYOA 3SB0A 3UXDA 2D2HA 3U3HA 1EDQA 2O0TA 4FXRA 4US6A 4WGHA 4XAPA 3U7VA 4JFMA