3FY1A

The acidic mammalian chitinase catalytic domain in complex with methylallosamidin
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
377
structure length
377
Chain Sequence
YQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNVKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Acidic mammalian chitinase
publication title Triad of polar residues implicated in pH specificity of acidic mammalian chitinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 136
structure length 377
sequence length 377
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3fy1A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3fy1A01
4QLLA 3ARSA 1H2JA 4H7VA 1J9YA 1K9FA 3T2QA 3CZJA 1WZAA 4MB3A 2GDVA 4WKFA 3VNZA 2ZUVA 1NARA 1CTNA 4CN1A 2VO5A 3ZT5A 4KGJA 3CHEA 4S3KA 1TG7A 3VINA 2NSXA 4GINA 3DC0A 2C0HA 2XM2A 2XFRA 4GO9A 1J0HA 1DWGM 1X6LA 3PZGA 2WC3A 2EJ1A 3ARTA 4H41A 2E40A 1UWRA 4ZENA 1KWGA 3WD0A 1M01A 2A3CA 4W84A 5JH8A 1WDRA 3THDA 3WEMA 5A2BA 1R86A 2D1ZA 4OBSA 2A3AA 2ZXQA 1HKIA 4MDPA 1UWTA 1W91A 2OYMA 4TX6A 2VC9A 4PYSA 1XRVA 1RD6A 1BYBA 3PBGA 5CGTA 1EHNA 3AYSA 2OWXA 1WNOA 2FDMA 2ZX9A 4U3AA 5A69A 1UKPA 4UFJA 3T0DA 3VVGA 3ZJ7A 1HF6A 1H09A 1G1YA 5A2CA 4CVUA 1H4PA 5A8PA 1GQLA 1MXDA 2CXGA 1E15A 4HMDA 1OT1A 1EOKA 1FHDA 3BLKA 1QBBA 1C3FA 1LG2A 3G6MA 3WSUA 4CCCA 1I75A 4Y7EA 3AXIA 2XVGA 2O9OA 5M03A 5LA1A 4C7DA 3SUSA 4MB5A 1WKYA 2XPKA 4LXFA 4J3XA 3WN6A 2RGLA 4CKQA 3VD9A 1E6RA 4ATDA 3MKKA 5CLTA 4U2ZA 5A8NA 3J7HA 2ZIDA 1UR4A 3AZSA 1JDDA 3MUAA 3PTMA 2O9PA 2WC7A 4NZCA 1OD0A 4W86A 2WHKA 1US3A 1XYFA 3WDHA 2X05A 4FLRA 2VZUA 3VO0A 2A3BA 3L4WA 1JZ5A 3BCDA 3N17A 5HBFA 3PZMA 4J28A 4PUEA 1LWJA 4N0RA 4CU8A 1G0CA 3AIBA 3MV01 5HPOA 4AIEA 4E8CA 3BGAA 3A3HA 3ARVA 3KL0A 2WCGA 1SMAA 1BG4A 4MAVA 4CD4A 3AZRA 2Y5EA 5JUVA 4HMEA 1NQ6A 2DDXA 2VX5A 5BWFA 5F7UA 4H8VA 2CNCA 1V6VA 4C7FA 1B31A 1R7AA 2CBJA 2E9LA 1NH6A 1XD0A 3PZTA 3W27A 3WUBA 4ZFMA 2D3NA 2XG9A 1GOQA 3CUFA 2W62A 4X9YA 1KB3A 2PF0A 4JAWA 1V0LA 2AAAA 5DO8A 3N9KA 1E4IA 2GDUA 2DGAA 1S46A 2O9TA 2CBUA 1V6YA 5E70A 2VQTA 4HPGA 3BMWA 4ACZA 3AHXA 3AMKA 1QW9A 1UZ1A 1E4NA 1OT2A 4PRWA 3S6TA 4D6DA 4F66A 1DTUA 2CEQA 5LYRA 1VENA 4PMZA 1JXKA 1K6AA 1M04A 1UUQA 1QNQA 3HU7A 3I3EA 5IHRA 1HP5A 5GNYA 3M07A 1CGVA 4ZE5A 1E73M 2ZUTA 1UD3A 1H5VA 1JFXA 3A4XA 2BS9A 2D20A 1BFNA 2XVKA 3BSGA 3AI0A 3VGFA 5EB8A 2O92A 2VX7A 5IDIA 1MFVA 2D23A 4P7OA 1B3XA 4LX4A 3NDZA 2E0PA 3N04A 2ESCA 3N11A 1LQ0A 2WC4A 3T0AA 4CCDA 2YBUA 2W67A 1C90A 1GVIA 4U2YA 1HJXA 4AD4A 1W9XA 5FD0A 5HNNA 1J10A 1WDPA 2PWEA 1JZ6A 2UY5A 1TFVA 1J0IA 5I6SA 2VOTA 3L2LA 3NSMA 1PZ2A 3VIFA 5GPRA 1MXGA 1ZBWA 1PEZA 3II1A 1W3LA 4J3WA 1XCXA 2BVTA 3BSHA 1IT0A 1TVNA 1CLXA 2ZUUA 3SUUA 1BYAA 2E3ZA 2QV4A 3KZSA 2WB5A 2W63A 1DHKA 1N82A 1V3KA 1WP6A 2VVNA 2ZUNA 2W66A 1UQYA 3VILA 4CU7A 2V38A 4RE4A 1UG6A 4AZHA 2J25A 5A6BA 2J78A 7A3HA 1JL8A 1VBRA 2XGIA 1GHSA 3WBAA 3OZPA 3WMCA 3GTNA 3M7SA 1B3YA 3PN8A 2TAAA 1HL8A 2D22A 2J7CA 2WMIA 1VAHA 2DT2A 1GUVA 1HKJA 4AZGA 1JZ8A 3ALFA 2EPKX 4F79A 3RCNA 3WIJA 4M82A 2E4TA 3KEHA 4AIOA 1QOXA 1WZLA 4MTVA 2J62A 1HJQA 3W53A 2EPOA 1BGAA 2DSZA 5A6JA 3RDKA 1KQYA 3QOKA 1FP8A 2WPGA 3CZEA 5I79A 1GJWA 1EDTA 1UA3A 4MNLA 3BAYA 5E09A 1WB0A 4E2OA 1V08A 1A3HA 2NW0A 1GNXA 2YA1A 5FKYA 4AZ6A 1PAMA 1V02A 1CGTA 3W26A 5IHSA 1V3HA 1GOMA 4UZUA 4BQ2A 4XZBA 2WM0A 1D3CA 1HJUA 1QVBA 1JFHA 1KR1A 3W29A 2J47A 1VEOA 1DWAM 2QHAA 3WKZA 1FP9A 3GNRA 1RPKA 3MMDA 2Q8XA 2WMFA 3KL3A 3QGVA 1VJSA 1K9DA 4RE3A 3VM5A 4D71A 1E5NA 4NRRA 2XSBA 4DWSA 2JF7A 2YDRA 4HZ7A 1W3KA 2YIHA 3WH9A 4DM2A 5CGMA 3AXHA 3W4RA 1CDGA 1W2PA 3VIPA 1MQRA 1WZMA 3TONA 2E9MA 3SEPA 1E43A 3AIWA 1WZKA 1W9UA 1UR2A 1MQPA 2XVNA 4PSPA 2VZVA 1KQZA 3ZR5A 2CPUA 1UR1A 1FH7A 2PI6A 2F2HA 1E71M 4GZJA 3MU7A 1MW1A 2VRJA 1E9LA 1CECA 2DSWA 1TA3B 1UHVA 1UWQA 5KEZA 3POHA 3ECQA 1TE1A 3VKKA 3EBVA 3AHYA 3MMWA 4WK9A 3PZQA 3QR3A 3UERA 5FL1A 4NRSA 1KGUA 5EMYA 1E0VA 3WNLA 2CKRA 4ZE4A 5M17A 2GK1A 4W8LA 3RJXA 3UEQA 4AWEA 1Q6FA 4V28A 3VD7A 3AISA 2J4GA 4JHOA 1E0WA 4DUVA 3FXYA 3U5YA 4ZXLA 2OSWA 4BQ3A 3T2PA 3OZOA 3VIMA 1F4HA 3ZIZA 3AIUA 3SCPA 2F8QA 3VOCA 4TUFA 1QNRA 2GJXA 3W24A 5ABFA 2ZX8A 2BY0A 3GNPA 4OJYA 3VIHA 2J7EA 4A3HA 3AMDA 1B3WA 3NJ3A 3UETA 3IAPA 3DYMA 2VUYA 2WW5A 1WDSA 3AXXA 2ZX5A 1I1WA 1G9HA 4PCSA 4LYRA 4AZ5A 1Q6DA 1NWRA 1C93A 3AIRA 4MJ4A 3RM8A 4BQ4A 1EIBA 4E4PA 1ZBVA 2XHYA 4LYQA 5I2UA 1V6XA 1JIBA 4W5ZA 2PBOA 1W3HA 4Z2LA 5A1AA 2XYLA 2BFGA 2X09A 2D24A 3DYOA 4UTFA 4UZSA 2XIIA 3ZMRA 2YA2A 4IUGA 2DIJA 2BXZA 5A95A 3ARWA 1UZ4A 3WH8A 1KXTA 4AD3A 1GORA 4J3SA 4Z2IA 4IISA 3B9AA 1J0KA 3NSNA 3WDJA 3VU2A 1B90A 1TR1A 3N18A 3WL1A 1JF5A 1HVQA 1H3GA 1GONA 1QI3A 3ZOAA 1XYZA 1SMDA 4JKLA 4M81A 4QP0A 5LA0A 2AMGA 2YKKA 3WQWA 4F9DA 3A4AA 2XSAA 4XB3A 3LPOA 1ISXA 1MW3A 4B9ZA 3THCA 3QOMA 5A3HA 2WK2A 4U3CA 1NP0A 4BA0A 3WD4A 2BNJA 4W5UA 4U33A 1FH8A 3ZJ6A 4HZ8A 2DQXA 3L4ZA 4M1RA 3A6OA 3W28A 1D7FA 2Y8KA 3BH4A 2NT0A 3RM9A 1VBUA 5ABHA 1GPFA 2JALA 3HMCA 1RP9A 4GQRA 5IFTA 3MUIA 2FHCA 2GUYA 4W7VA 5A6BD 1OSEA 3CHCA 1CXLA 5DT7A 4F8XA 3VTRA 4UFKA 1JF6A 4LYPA 4R27A 1V3LA 2Y2WA 4UQCA 1BTCA 4AMCA 1HIZA 5BXRA 1B3ZA 2QF8A 3L4YA 1KBKA 1IZJA 3MUY1 4ATWA 4B3LA 1B9ZA 1J18A 4D6CA 3AQUA 1MFUA 2QPUA 3PZUA 4MJ2A 3WFZA 1R85A 2J7BA 3AOFA 4JIEA 1EXPA 3T2OA 4AZ7A 3IAQA 3OB8A 4MNMA 1JDAA 1OB0A 1ZJBA 1E6SM 3VGEA 5GNXA 1HJWA 2YA0A 3EMZA 3VD3A 4UFLA 4AD1A 1UKSA 4GO8A 4ACYA 5AC4A 4H8UA 2VRKA 2DT3A 3OGVA 3WH5A 3ZJ8A 4FK9A 1G01A 3UESA 4Z2JA 4YHGA 3WEZA 1AQMA 1GOOA 1DP0A 3WUEA 1E6ZA 3WF1A 3WFLA 5BXTA 4HA1A 4A4AA 3ARYA 3VGDA 2J8FA 2QMKA 3CLWA 1B30A 3ZT7A 3WF2A 3QHMA 4H04A 3WDQA 1CLVA 3GXIA 5DMYA 2CBIA 1Q6GA 3K1DA 3M6DA 3CUGA 5I5RA 2WVTA 1BYDA 2JF6A 1V0KA 4FLOA 2WVSA 4LGXA 1E40A 1TZ7A 1E55A 3LMYA 2WBGA 5AY7A 2VQUA 2NT1A 1VFUA 1XHGA 3FHAA 1BVZA 5CPSA 1O6IA 1JXJA 9CGTA 4EKJA 3SCNA 1ESWA 3ZSSA 4JCLA 3CPUA 3T09A 1JYWA 4N42A 4EANA 4CU6A 1TCMA 2QLYA 1H0GA 3RILA 2YLLA 1UKTA 4OOZA 5A6MA 3LPGA 4ACZB 1U33A 3GZAA 4ZEPA 1QHPA 3MSDA 2EPNA 2V5DA 3CMJA 4DWSD 2WWCA 2ZE0A 3I3DA 2ZXAA 1EOMA 1B2YA 5CPTA 3WF3A 2VZTA 2DT1A 1LJYA 4JKMA 2CITA 4XUYA 4AZCA 4UOZA 2IXUA 2GJRA 4IPNB 4W87A 3FHQA 4WF7A 3WD3A 1CXHA 2D2OA 2CKSA 3CUJA 1C91A 1BF2A 1JZ4A 1JDCA 1CXEA 3EDEA 1UA7A 1KXQA 4W7UA 4L4PA 1HNYA 2BY3A 3U7BA 2VTFA 1BSIA 3VIKA 5E6YA 2YL9A 3WQVA 1EQCA 1UH3A 4ZXOA 1HKKA 4JFTA 2BV9A 4WJXA 3WQ8A 4IM4A 3B9DA 4TTUA 4KMQA 3EDDA 2XGBA 3WH6A 4PTVA 1E6NA 1J0ZA 4TVDA 2BHUA 3OGSA 2BXYA 3RM4A 4AIUA 3VPLA 1CXFA 3W38A 5A8OA 1C8XA 2G4FA 3SIMA 3UG4A 4WKAA 3CMGA 4X0NA 3BAIA 4D6EA 1XH1A 3OLIA 4BS0A 2VNCA 3OG2A 3KL5A 1ZJAA 2ZOXA 2YL6A 1YQ2A 3WDIA 2YBTA 3ARRA 1HJSA 4OKDA 4UQ9A 3W25A 1O7AA 3WMBA 1PZ3A 2GSJA 1EGZA 2WMIB 1OINA 5IXEA 1KBBA 4XX6A 4PTXA 3PTQA 3WH7A 3GXMA 5DEZA 2PBGA 1EDGA 2XVPA 4QDMA 1CENA 4RE2A 1GZJA 1B3VA 1VB9A 5JBFA 4Q7NA 1ZL1A 1V3JA 1MW2A 2VX6A 1E4MM 3NDYA 4NSBA 4KH2A 2ZWZA 2ZWYA 1U2YA 4J3VA 4GZIA 3WQ6A 1BVNP 5D9MA 2X2YA 3WNNA 1W3JA 4D72A 4UQBA 3ZQ9A 1FHLA 5ECUA 4EAMA 4JZ5A 1CEOA 5D8WA 3VDAA 3U5UA 4CUCA 4KRUA 1H1NA 1QI0A 2FGLA 2CERA 5C71A 1W1YA 3L4TA 2QMJA 2CYGA 3ARZA 4JL1A 1AQ0A 3B8SA 4LQ1A 3ZR6A 1E0XA 1H11A 1JZ3A 4GQQA 1W9BM 3AHTA 4XV0A 2ZX6A 1V6UA 3WDRA 1E1EA 3TP4A 1GQIA 2G3IA 5I0DA 3MV11 1W1PA 1JAEA 4WLCA 1JNDA 1J11A 2WAGA 3GBDA 2A3HA 4M80A 3CZKA 2YL5A 2G41A 4U5KA 3EDKA 1E4LA 1QPKA 1PX4A 3TOPA 2VR5A 1PJ9A 3VD5A 1V3MA 4UFMA 3O6AA 2Z1KA 3GH4A 4ATLA 2J75A 3ZSTA 4P8WA 2YDSA 4KWUA 1R87A 2CIPA 2WHJA 1QI4A 5A6LA 3F5JA 3AHVA 1W1TA 5ABGA 1GQJA 1UOKA 3NUKA 3T0BA 4AISA 4TTGA 2DH3A 3F5LA 4J7RA 3SCUA 3K8MA 3VD4A 4W89A 3WMSA 3ARQA 3O9NA 1HP4A 4W8BA 1X6NA 4D6IA 1UKQA 2EQDA 4JFWA 1HJVA 3AROA 4GXPA 1D2KA 2HISA 4QCFA 4PBGA 4ML4A 1GQKA 3WNOA 3TTYA 1HN1A 5I3DA 3GBEA 5BYWA 2VCCA 2WSPA 1FOBA 4HPHA 4WIWA 3BC9A 3VM7A 4AEFA 3VDCA 5FL0A 2ZXBA 2VCAA 2ZUWA 1UD5A 3MSGA 2XFFA 2GK1B 4M24A 3SCSA 4DM1A 2ZXDA 1GCYA 4GI9A 1E6PA 4U5IA 5BXSA 3VMOA 1HXJA 2XWEA 4QAWA 4CVWA 3VMNA 3CGTA 2EEXA 3VX0A 5DT5A 1ODZA 3WD2A 5D9NA 1M03A 2WSKA 1QHOA 6TAAA 3WUFA 4AD5A 2VJXA 3WNMA 3BAKA 2GJXB 3WBEA 4E8DA 1R7OA 3WQ5A 2WYSA 1EO7A 3DHUA 3EDFA 4AXNA 1C92A 4JL2A 4P8XA 3CUIA 1CPUA 4URIA 5D9PA 4U31A 1GOKA 1ZBCA 1VFMA 2V3GA 2WMGA 4W93A 5E6ZA 1GJUA 3SCOA 3VGGA 3KWXA 4CN6A 1JAKA 2DSVA 1SR0A 1Y7VA 1HT6A 2E8YA 3WENA 4A3YA 1CGUA 2ZUSA 2WVVA 5M3WA 4M8UA 1LLOA 1E3ZA 4CD6A 3A4WA 2VRQA 2WZIA 4M56A 3HN3A 1ZS2A 4PMQA 2W5FA 4AEEA 4GI8A 2WKLA 5DF0A 3PZNA 4PMYA 2Y24A 4IPLA 5TD4A 2WXDM 8A3HA 1E3XA 1LF1A 2G3JA 3ZM8A 4P8VA 3DYPA 3L4XA 3PZIA 2FH8A 2CHOA 4W88A 3FY1A 4EK7A 3K46A 3EDJA 1DWIM 1Q6CA 3UR8A 3OLEA 4PUDA 3FAXA 1OIMA 4MNKA 1E6QM 4DUXA 1B0IA 5BROA 4KRTA 5E9AA 1C7TA 1SYTA 7CGTA 4MB1A 1IZKA 4FLQA 1CXIA 3W82A 1UD6A 1CWYA 1HL9A 3WELA 4QLJA 5A6SA 4P7QA 1P6WA 3AMLA 1G5AA 2G8ZA 2BVDA 4PTMA 1B1YA 2CETA 3RPMA 2IXVA 4HTYA 2A3EA 1NWSA 2PWGA 1W9PA 1C8QA 2W61A 1G94A 3NYDA 5E0CA 3W6MA 1RP8A 1TA3A 3FNDA 4K68A 1ZBKA 3VNYA 4JFVA 4HZ6A 4CD8A 3VIJA 3O2LA 3VGHA 1EQPA 4D1JA 1XD1A 4Q22A 5CJ5A 5CLWA 2XIBA 2WNWA 4QLKA 5M5DA 4PEEA 1TMQA 2X1IA 4D6FA 1PBGA 1QHZA 5I77A 2XJ7A 4B15A 3PZ9A 5CZKA 1GOIA 1GHRA 4UQDA 2D0FA 4OUEA 4FLSA 4AD2A 1W9DM 4W8AA 3AHZA 2YL8A 4X0VA 4XZWA 1JZ7A 1M7XA 2AOSA 1YHTA 2DSKA 2XTKA 1KFWA 1EDQA 4V27A 3BCFA 1MQQA 1OGBA 1VEPA 5E0FA 2WLYA 3CZGA 5AYBA 1BGGA 2PWHA 3TTQA 1XSKA 1KXVA 5FIPA 3FW6A 2JEQA 4HP5A 2WANA 4C7GA 1XGZA 3I3BA 1PX8A 3LPPA 2WHMA 4WSKA 1U30A 1LL7A 3W6LA 4UFIA 4HU8A 3AIEA 4FMVA 1CIUA 3UR7A 3WF4A 1L8NA 1MYRA 1NOUA 3AIVA 2IUZA 3IJ7A 4GI6A 3GXDA 1UWIA 4J3UA 4AY1A 5JBDA 3HJEA 4YN5A 1JZ2A 3N1AA 3GM8A 2VVSA 3AS1A 3W0KA 1WO2A 4YPJA 2E8ZA 4AW7A 1X1NA 5CXPA 3IJ9A 4JCMA 4PMRA 1EH9A 3VMPA 2GJPA 1NOFA 3L4UA 5HPCA 3ARUA 1PX3A 5IFPA 2QPSA 1FA2A 1HX0A 4YHEA 1NWUA 2WZEA 2GFTA 3K4DA 2JE8A 4AZIA 5CQ1A 3BAJA 1W1VA 3ARXA 5AYIA 2VURA 3M46A 4MAZA 2F61A 1DEDA 4W7WA 1DWFM 2PWFA 3PHAA 3N12A 4F9JA 1BHGA 1AQHA 4AZCB 2D0GA 1UD4A 4V2XA 2EPMX 1ISYA 4OIFA 3JUGA 3AICA 4DUWA 3NCOA 6CGTA 3N15A 1XCWA 2CESA 2JIEA 1AMYA 3ALGA 5DFAA 3AIQA 3SCRA 3CH9A 1R8LA 2CHNA 2GVYA 2VZOA 2G3NA 1J0JA 1XV8A 1TVPA 1LWHA 2WLZA 2RGMA 1W2VA 3AMGA 3AZTA 2UWFA 3L4VA 2CCRA 1ZB5A 5A94A 1ITCA 1NM9A 1OCQA 2OLHA 1UQZA 1GW1A 2YDQA 4TX8A 2J7DA 2FGZA 2DH2A 4EE9A 2D0HA 5JBEA 3CBWA 1E5JA 2V3DA 4S3JA 1CGWA 3IK2A 4HA3A 1E6XM 1BLIA 1J0YA 3CTTA 1KWKA 1MWOA 3UCQA 1ISZA 4PMNA 5EBAA 3OIHA 3PTKA 4R5EA 1LG1A 3S2CA 3VIIA 4L4OA 2DIEA 2PWDA 3F5KA 4TOQA 1QI5A 1XC6A 4Z2HA 3BLPX 1LL6A 2Y4SA 3B9EA 1HKMA 1E56A 4P7RA 1XH0A 3WF0A 3BAXA 3CHFA 2FHBA 3G6LA 1CYGA 3UG5A 3SUTA 1XSIA 5D9OA 4NI3A 1JYXA 1QNOA 1ODUA 3ZJKA 1H49A 1EHAA 4BQ5A 3VIGA 3WL0A 2B31A 3CHDA 1V0MA 2O9RA 1UKOA 2V3EA 5BCAA 3UG3A 2W91A 1FFQA 4GPNA 5AC5A 4M29A 1OBAA 4CD5A 2VR4A 1BYCA 2WKGA 3K8KA 4PCTA 1UYQA 3AMCA 2WWDA 2DEPA 5JIPA 2JEPA 2ZX7A 1PIFA 4UOJA 3D5HA 4CN4A 3MUZ1 2YLAA 3FAWA 5I23A 3GH5A 4PN2A 1WE5A 3WD1A 1AVAA 1UR8A 5A6KA 1BG9A 2PB1A 1VIWA 3WNKA 4AC1X 3BMVA 3RO8A 2VMFA 4UNIA 1KGWA 7TAAA 4WSJA 1WCGA 3VDBA 3MS8A 1L0PA 4JHZA 4PSRA 4B9YA 5CSYA 3TA9A 1JI2A 4CGTA 1V03A 2ZUMA 1VRXA 2YJQA 1BPLB 5EFFA 1E70M 3DHPA 5D8ZA 2EO7A 1SFSA 3AFBA 1E72M 1CZ1A 2W4XA 4OZOA 1IV8A 1EA9C 2W92A 2WMKA 2MANA 4D6GA 2ZICA 2J7FA 1TUXA 2J7GA 5FCZA 5I24A 5HDRA 3DECA 5A2AA 2UY3A 3APGA 4PMUA 5BRPA 4P7LA 3MANA 2OSXA 3POCA 1OM0A 2XFYA 2XWDA 4MPKA 4H2CA 3TTOA 3A47A 4NF7A 1UH2A 1KXHA 4UR9A 3W37A 3AS0A 3WUGA 3KE0A 2VT0A 1QBAA 3AYRA 1C7SA 3QHNA 5KZ6A 5A6AA 4UQEA 4B16A 2HVMA 4HOXA 3WDPP 4Z2KA 2VZSA 3TTSA 2J7HA 2V5CA 4BCEA 2VX4A 1DWHM 2UY4A 1ECEA 3WNPA 3OGRA 3NSXA 2OYKA 4UOQA 5A8QA 5CG0A 4UCFA 2CBVA 1Q4NX 3U7VA 4W85A 3SCWA 1KGXA 4DWSB 1CXKA 1FH9A 5C70A 2BY1A 2VL4A 2DT0A 1BQCA 4TXEA 6A3HA 1DWJM 3OBAA 2EXOA 1JD7A 4J3TA 1HVXA 1VFOA 3AS3A 1JYNA 4Z2GA 5LA2A 4HOWA 5GNZA 3BAWA 3SUVA 3ARPA 5CPQA 5ABEA 2XM1A 5BXPA 3AS2A 4RL3A 1ISVA 4QCEA 1W32A 3K4AA 1CNVA 3GH7A 3VX1A 4MADA 1V02E 3CZLA 1C8YA 5BRQA 3VUPA 1A47A 4PMXA 3RJYA 1OWQA 4OBRA 3OLGA 1XH2A 4JFUA 4LPCA 1UD2A 1US2A 2XVLA 2YOCA 2J79A 3LPFA 1OGGA 2WVVB 2X8RA 3L2MA 2PC8A 3CUHA 1Q6EA 3ZO9A 1BAGA 1NWTA 1XSJA 2OSYA 3GNOA 1LL4A 4BZYA 2C7FA 5JIWA 3NIYA 5D4YA 3OLDA 2WCSA 2XUCA 2EPLX 1MW0A 3SCVA 4FF5A 3SUWA 4P8UA 1M53A 2G3MA 2WBKA 1GOWA 3K8LA 1J12A 1QW8A 3VGBA 1Z32X 2EBNA 3IANA 1J01A 2OWWA 3EMQA 1VEMA 3QHOA 1JD9A 3VDHA 1UWSA 5ABFB 5FOOA 3GYCA 3PZVA 1ITXA 2D3LA 4UQAA 4HMCA 1V0NA 5I78A 1WAWA 2VI0A 5GQBA 4TVUA 3EYPA 1V6WA 1UD8A 4CCEA 1RH9A 1KCKA 2WZHA 4QFUA 3N13A 4D1IA 2J8GA 1I1XA 2BHZA 2UY2A 1GVYA 2WMJA 4J27A 4GIAA 3WY1A 3W81A 1EO5A 1OD8A 5EFDA 1VFFA 4AYSA 1ZU8A 1OGSA 1V3IA 2E9BA 2X0HA 3CZ8A 1NOWA 4GKLA 3OA5A 1QNPA 5CSUA 2DSUA 1PIGA 3MMUA 1JI1A 3AJ7A 4H8HA 2FHFA 4OOUA 2Y8VA 2BY2A 1W9VA 1KCLA 4JFSA 4MNJA 4PMVA 1H41A 1CGXA 4HA4A 3RIKA 1F4AA 1UR0A 2FH6A 2J77A 1JNEA 4B3KA 4DWSC 4UFHA 2WMHA 1JGIA 5HOSA 1CBGA 3GXFA 2X0YA 3EMCA 4D6JA 4AD0A 1MVYA 3SURA 4CD7A 4HOZA 1UH4A 4TVCA 1JG9A 4MDOA 2OYLA 1QNSA 3E1F1 1OIFA 4PTWA 3F4VA 5HXMA 2JIWA 4PMDA 4HU0A 1K9TA 3GDBA 3VIOA 1UWUA 2DPEA 1E1FA 2JFEX 4JKKA 3FN9A 5C8BB 4PMOA 3MO4A 3SCQA 1K9EA 3WEOA 4KGLA 3PZOA 1UR9A 2J74A 3ZT6A 1JYVA 1WDQA 4MB4A 3CO4A 4WKHA 2VCBA 3RMEA 1VF8A 1ISWA 2BVYA 2WCAA 1KR0A 3IJ8A 2Z1SA 2C8NA 1WPCA 3D3AA 4AZBA 4BF7A 1PPIA 1QI2A 8CGTA 1H0IA 4P7NA 1CGYA 3BXWA 3U57A 2WHLA 2OWCA 1VJZA 5A8MA 1NP2A 1FFRA 3T08A 2WVUA 3WQ4A 3CIVA 4D6HA 4GZEA 2BHYA 2V3FA 3SCTA
chains in the Genus database with same CATH superfamily
4RNJA 3QMRA 3B9OA 1XLGA 1LOQA 1H2JA 2G0WA 1J9YA 2Y63A 4US5A 3UNDA 2GDVA 4ZOEA 1U1UA 2ZUVA 1ENUA 5BOFA 3ZLGA 3GC5A 3CHEA 3PUOA 3N2CA 3BG3A 3PAJA 2NSXA 1Y5XA 4QM1A 3RYSA 4Q4OA 2XH7A 3DC0A 2GYIA 3W2NA 1R46A 4O13A 4OQVA 3N2OA 3P5ZA 4NILA 3RU6A 4DZ3A 5JMUA 1OC7A 4PB3A 1F7BA 4GO9A 1ITQA 3N2BA 2E1WA 2WC3A 4NZ5A 1FKRA 1E9IA 4MY8A 1DJIA 1KWGA 2BASA 3WD0A 3MKCA 3GFZA 1SJAA 1M01A 4GKTA 3KFTA 4LAKA 3B0PA 4JTGA 4DRPA 5A2BA 1XIEA 1J4RA 2TRSA 2ZXQA 1HKIA 4MDPA 4TX6A 2VC9A 5C0QA 5AYYA 1R30A 2OZ0A 2NV9A 1BYBA 3PBGA 1EHNA 3VA8A 2P1FA 3F2CA 1WNOA 2FDMA 4U3AA 3N6HA 4UFJA 3U3HA 1T41A 2DZBA 3ITTA 1RVKA 4DQWA 3BJFA 5D05A 2E1DA 1H09A 2C1IA 3E0WA 1G1YA 4MWAD 1LBLA 1PTDA 4W9OA 4HMDA 1FHDA 1XJBA 3BLKA 3GG7A 1AG1O 3GIQA 4KCWA 3CYVA 4Y7EA 4NHVA 3W01A 4J4KA 1Q1CA 2INEA 4LXFA 2RGLA 2TMDA 5D2WA 1EJTC 1DL3A 3MTWA 4GIEA 3J7HA 1K02A 3PULA 3VABA 2O9PA 1MMFA 5XINA 4MOZA 1VZWA 4NZCA 3L0NA 4JTKA 1XYFA 4JTRA 3PAOA 1VJIA 4FLRA 1TZ9A 3L4WA 4ZQRA 1WKEA 3HA1A 1XDLA 3PZMA 3MZ2A 3QMTA 1TPH1 1T7LA 1M7JA 5HPOA 3BQ5A 5HMEA 4AIEA 4E8CA 3BGAA 5FF2A 3A3HA 3KL0A 1WDDA 5DELA 1R3VA 4ZQPA 4CD4A 2YCLB 2VFHA 2CLOA 3FA3A 1REQA 4JFMA 2DDXA 1K8XA 1P48A 1KM6A 5F7UA 1KLYA 4H8VA 2BDQA 3O5JA 5EBUA 1EP2A 3B4YA 1XD0A 3WUBA 1GOQA 1UBSA 3LX9A 3JVAA 1KRBC 3XINA 2F6UA 1KB3A 3TW6A 4DAFA 1S46A 3ZVHB 1YXYA 2CBUA 3LUTA 1QW9A 2IPJA 4Z1CA 1DTUA 4DYKA 5LYRA 2MNRA 2DVTA 1DJZA 1OC6A 1UUQA 1QNQA 4PUNA 4ORIA 1XLEA 2EG6A 3MI6A 2GL5A 3PFMA 2BS9A 3HPSA 2D20A 2XVKA 3VGFA 3LTYA 3W1LA 1CT5A 3IJLA 1JDEA 4LX4A 3NDZA 1NDWA 1KM3A 1SSGA 3N11A 4IMAA 3T0AA 5HJXA 3WLSA 2W67A 4U2YA 1R38A 2HK0A 5C7HA 3O0FA 1CX9A 3USZA 1WDPA 2NXGA 1AFSA 3MP5A 5G4EA 1TFVA 3CAKA 3OHIA 5I6SA 2DG3A 1S3HA 1PZ2A 4RLIA 3T0CA 4NL1A 4IMDA 1JCLA 1ZBWA 2PU1A 3II1A 3LXBA 3QTGA 3VCRA 4GE8A 3FDGA 1BYAA 4Z1DA 2JKAA 3MI3A 3TQ0A 2WB5A 3QXBA 3KTSA 2W66A 2IKJA 1UQYA 4E2BA 4RE4A 5A6BA 4REQA 4S23A 5DCEA 3LBCA 1U1HA 2YB1A 4ZO6A 3FEQA 3O6CA 1M7PA 1RLDA 2P3ZA 3QF0A 1HL8A 1XDJA 1H7WA 1GUVA 2NWSA 1VFHA 3UCCA 4AMAA 3CHVA 1QWKA 3CM4A 1VHCA 1NQKA 3FV9A 3IARA 4M82A 4AIOA 1QOXA 5HJYA 2J62A 3W53A 3KVJA 3F4NA 3UI5A 4R33A 5A6JA 1PE1A 4TX9A 1KQYA 4U10A 3QOKA 4X2RA 3SQMA 1EDTA 3NZGA 3CQKA 3BAYA 4HPNA 2X41A 2VC7A 4LT9A 2YA1A 1PHWA 4A35A 3QTPA 3FYOA 1UPPA 1V3HA 2Y62A 4AFYA 4R3UA 4XZBA 5IBXC 3PS7A 3ZWTA 5HQEA 4XAFA 3PWAA 2ATSA 3R10A 1A5CA 2QAPA 3TCSA 1XUUA 3WKZA 2C15A 3NO5A 3KL3A 3WK3A 2DG9A 2QCDA 4RE3A 3WK2A 5AZ1A 4NRRA 2PDGA 4MZYA 2YIHA 2PDBA 4QHRA 2BOGX 1CDGA 3PBWA 1FWSA 1MQRA 3B8IA 4UTLA 4WGXA 1EC8A 3ATYA 3EIPA 2VYOA 3FA4A 3EOUA 5DMMA 3KOYA 4CQDA 3AIWA 1YDVA 1MQPA 2XVNA 4S39A 2VZVA 1KQZA 4A22A 3IUHA 2QXWA 4JTUA 4M6QA 2F2HA 1OFPA 1TA3B 1UWQA 1LT8A 4EP8C 4GBUA 3EX2A 1DJWA 4IL2A 3VKKA 6XIMA 4WK9A 1JPKA 4DT4A 2HQAA 3HV9A 1VLWA 3CPRA 4S3BA 1EJXC 4UMCA 1KGUA 5EMYA 3RLVA 4ZE4A 3RJXA 3QZEA 2D73A 1S38A 1DPMA 1Q6FA 3KTXA 4NZ4A 3VD7A 3AISA 2J4GA 1YW5A 3TCZA 4NNBA 1JUEA 3U5YA 1W56A 3CNYA 3E0LA 3P60A 3G1FA 3QZAA 3VIMA 1F4HA 1IIHA 3SAZA 2WSRA 3MP4A 4UWMA 1SU5A 5ABFA 4ZQNA 3EB3A 4WR3A 1O66A 2VKZG 1TTJA 4GVGA 1PS9A 3AMDA 3NJ3A 3DYMA 2WW5A 4MYAA 3CPGA 3GTIA 1SJCA 4OHQA 3TYBA 3VZYA 4AZ5A 4EXBA 4C1NB 3RR4A 4H19A 4K39A 3WLIA 1IXOA 1EZ2A 2NV2A 3O6YX 4JOMA 4W5ZA 3N2XA 9XIMA 3LCFA 3H2NA 3ITLA 3UJRA 5CKSA 5C9RA 4DH0A 4IUGA 2DIJA 1JCMP 3ARWA 1TZZA 3DI0A 5C2GA 1GORA 3TSDA 1Q63A 5HWBA 3B9AA 2CW6A 2VGGA 4LF1A 3NSNA 3ES8A 4FHAA 2PDIA 3C2YA 3NWRA 3WDJA 4EXAA 3IUIA 1HVQA 1BKHA 4NZJA 3VCNA 3N14A 1TCDA 3KBJA 4ZB2A 4JKLA 3M0ZA 2ZRZA 3QQ0A 1KT1A 5CZSA 3LPOA 2MPHA 4B9ZA 4U3CA 1NP0A 4WDWA 3CEPA 4A3UA 5I3IA 2VWSA 1P43A 4ZVJA 3ZJ6A 5JU6A 4HZ8A 4Q4SA 3RR1A 3LG3A 3BGJA 2ACRA 3L4ZA 1PB0A 3E9AA 3LGEA 3MDWA 3TN5A 2Z29A 2Y8KA 4W9PA 3ABXA 5HQLA 2PV2A 3HMCA 1RP9A 4W7VA 3KOWA 4FX8A 1OSEA 3CHCA 3B8WA 3N73A 5DT7A 4UCGA 3CS2A 1BQGA 3V0UA 3EEGA 1S5TA 3D6NA 4EACA 2QF8A 3MUCA 4R88A 4B3LA 1MFUA 3AXMA 3PG9A 1LORA 3EX1A 3AOFA 4JIEA 1FDJA 1EXPA 1U5VA 2AKMA 2FDSA 4XKYB 4MNMA 3W86A 1OF6A 1JDAA 1OB0A 3VD3A 4Y9NA 5FJTA 2OTDA 5AC4A 4LAXA 2ABBA 4L80A 4Q8OA 1W3NA 1Y65A 3UESA 3NXLA 1SO4A 3SGUA 1DP0A 1EIXA 4HA1A 1AL7A 3S42A 1B30A 3CXOA 3QHMA 2V68A 5T8GA 3R8RA 3WDQA 5DMYA 3M6DA 4F2UA 2WPBA 1BYDA 2JF6A 4JIIX 4LGXA 1LUCA 2QDGA 3SADA 1E55A 2VQUA 1VFUA 5CPSA 1A80A 3ZSSA 3PPFA 4DRIA 7REQA 2BWGA 1VP5A 4ALDA 4EANA 1TCMA 3L9CA 2QLYA 4R34A 4FA3A 3RILA 3QY7A 4OOZA 2PCEA 3LPGA 2PPNA 4ACZB 3GZAA 3OW1A 1A5AA 4LV9A 4ZEPA 1E1CB 2EPNA 4DWSD 1ZZMA 4LAUA 3PPGA 3R0DA 1Y5WA 2C13A 3P2VA 3EWWA 3O0KA 1B2YA 3W71A 3UF8A 1LJYA 1O12A 3NXFA 4UOZA 4JTDA 5HUOA 2WJFA 3WLKX 1VYSX 3WD3A 2Y5SA 1XW8A 1IEXA 1JDCA 1BWVA 4DJFA 2W3ZA 3KZPA 4L4PA 1EPVA 1FKWA 3VNMA 1D3GA 1UZDA 4JIQA 4D8LA 2QZRA 4FIQA 1R6WA 3LD5A 3SSJA 1HKKA 1AMKA 4ZCWA 3EOEA 4U28A 4TTUA 1E6NA 4GIRA 1NJJA 4LC6A 3G1SA 3OGSA 5HWNA 4MLJA 3H9RB 2JKEA 1UZHA 3W38A 5EMKA 3SIMA 3MMTA 3NQGA 5G4WA 4ODLA 3JR2A 1WQ5A 2HVNA 4NX5A 1ZJAA 4HT3A 3W2MA 3V7PA 3ARRA 4R7OA 2V67A 2FPYA 4O8AA 1O7AA 3G1XA 1PZ3A 2B7QA 2WMIB 4E6MA 1RBOB 4IHCA 1P0KA 3PTQA 2QCEA 3WH7A 3M0MA 5DEZA 2PBGA 4UXDA 4DXVA 3EX4A 1VFLA 1B3VA 1VB9A 4KWSA 4Q7NA 5JBFA 4Y8FA 3B0YA 1T5AA 4DZIA 3H4WA 3DBPA 1JPMA 3NDYA 3P82A 4F0KA 1U2YA 2ISWA 4J3VA 3ISIX 4GFIA 3WNNA 1W3JA 4DHGA 2B7NA 1FCQA 5ECUA 4EAMA 3I7RA 3NO3A 2X7VA 3MBDA 3U5UA 4FX7A 2PRLA 3T8QA 1QI0A 2FGLA 1D8CA 5C71A 4MY1A 2KI3A 1RQHA 4JL1A 4AF0A 1AQ0A 2YCIX 3K5XA 3DG7A 3B8SA 3O5GA 3T0TA 1YNYA 1H11A 1JZ3A 1ME7A 3NQDA 5F4XA 1V6UA 3IHZA 4QITA 3MV11 3LN3A 1Q8AA 3EGJA 1JNDA 3H24A 2F21A 2TSYA 1FUYA 2D9FA 3RCMA 5J8LA 1PTGA 4M80A 3FGCA 4PE8A 1UJQA 1XPGA 1FVPA 3H23A 4KIEA 3QVQA 3UZZA 4DUOA 1V3MA 4UFMA 2JQXA 1D7HA 4CNTA 1MZHA 5BOEA 2J75A 5KZMA 4P8WA 1NDZA 1QI4A 2JBMA 3I4EA 4L1WA 5J5RA 3S5YA 4Z0JA 4L56A 3ONCA 4MWAA 3VD4A 3SCUA 4ROQA 3WMSA 3CWNA 1X6NA 3HFYA 2IPGA 1HJVA 1XDMA 1YKWA 4C6IA 4PBGA 1HW6A 3GWQA 3MDYB 3QYQA 3IACA 1FOBA 1G6CA 4HPHA 4NI8A 4G7EB 2FZDA 4AEFA 4NZFA 1W8GA 3VDCA 3PA7A 4FF7A 2ZUWA 1UD5A 3SCSA 1E0TA 4M24A 3JU2A 3GXTA 1GCYA 1RVGA 3BWWA 3W1NA 2UZ9A 4LWWA 4Z17A 2Z7GA 1S3TC 4QTGA 1O68A 3IJIA 5D9NA 1M03A 4A8IA 4BHYA 2WSKA 1QHOA 2PAJA 4AD5A 1FJDA 3WNMA 1QO5A 1A7XA 3W1QA 3E74A 1YYAA 3ITXA 3TXZA 5I98A 3H6OA 2HTMA 3WQ5A 2BLEA 4AXNA 3Q67A 4L1GA 2PDMA 2XP3A 1CPUA 4URIA 3JXVA 1JPDX 1GOKA 1U79A 1ZBCA 3JZEA 1NFPA 4W93A 5E6ZA 1OQFA 4NAEA 4JYSA 1F3WA 4C6MA 3W1TA 1G7UA 5CC6A 4M5PA 5C54A 1R5YA 1HT6A 4JY8A 2LPVA 4F0SA 2PDXA 2HK1A 4LRSA 2WVVA 2NVCA 3BW3A 4BF5A 3GXPA 3R12A 3EA3A 3C2OA 5EL1A 2HPMA 1OYBA 3A4WA 1DKWA 4B5VA 3EX6A 2BODX 2HE5A 4JQ3A 4V33A 5JQ9A 2J66A 4EAYA 5HNTA 4AHPA 3FAPA 2FKEA 4PMYA 2Y24A 2WXDM 2G3JA 1M41A 2IQDA 3MHFA 4O1AA 4DRHA 2VXNA 5KITA 1FWCC 1VGAA 1XYMA 1OIMA 2NQZA 1K8ZA 4MNKA 1E6QM 2Z1BA 3FIGA 4DUXA 5BROA 1GOXA 4KRTA 3USBA 2UBPC 3L23A 3S9IA 4P61A 4MB1A 2ZKMX 3W82A 4ZQMA 4QLJA 3TQKA 3BUVA 1QTWA 4P7QA 3KAIA 1I0BA 1Y0OA 3O5PA 2BVDA 2CETA 2AQWA 6REQB 2BP1A 4PTNA 1NWSA 2PWGA 1W9PA 1C8QA 4KETA 1G94A 3NYDA 1W1ZA 5E0CA 3W6MA 3M0KA 4F4RA 4K68A 5BWAA 2XH0A 1EGVA 3APYA 1EQPA 3OG3A 4K2SA 1XD1A 2QUNA 1DE6A 5HR6A 5CLWA 4GX8A 2EG8A 2XIBA 4PEEA 4E3VA 2BBFA 3UD6A 1PBGA 3Q65A 1QZ2A 1GHRA 1R3RA 4JTAA 1W9DM 1H60A 5DLCA 3LUOA 3UZ5A 4J5NA 4O19A 4F40A 2XTKA 1KFWA 4V27A 2VHLA 3WG6A 1OFBA 1MQQA 1OGBA 5K4XA 3CZGA 5AFDA 3DGBA 2PWHA 1Z41A 3R0KA 3TTQA 3REQA 1X98A 5FIPA 3FW6A 3O15A 4L5ZA 5DXXA 4WY0A 3M47A 3AUJA 4DO6A 4I7UA 3ONBA 2Q3OA 1Q6UA 1JVNA 3W7PA 5KZEA 1U30A 3UWUA 4WEVX 1W5OA 1GTHA 4HPXA 5JBDA 1WXYA 3N4FA 1BRLA 2Z6JA 3AS1A 2PC4A 1QUMA 1YPFA 4YPJA 4AW7A 5CXPA 1G4EA 1XGEA 4GUJA 4JCMA 1NMVA 4ZPTR 2OVLA 2R1LA 3OZMA 3G77A 2J9YA 1HX0A 3B8UA 4K37A 1NWUA 2WZEA 2GFTA 3GRIA 3K4DA 4IIBA 5LNRA 4ZPWR 2XH2A 2NX1A 1RA0A 1W1VA 5C6MA 1IYXA 1F6YA 3ARXA 3NM1A 4QNEA 1I45A 5LSMA 2F61A 4F9JA 5EA9A 2QS8A 3W7CA 4IX2A 3GHSA 4V2XA 2X2GA 1UBPC 4AY8A 1ISYA 3B03A 1REQB 2GGJA 2E5CA 1M5YA 4DUWA 3LB0A 3ALGA 2V30A 2CHNA 5LIYX 3V75A 3KRBA 3NAVA 4UTTC 2VZOA 2G3NA 4LUSA 1W17A 1CB2A 1RY0A 3AMGA 3W7QA 4EIVA 2XN1A 2CCRA 4QBXA 1NM9A 4RR4A 3DG6A 4NVTA 2OLHA 1GW1A 2RKXA 4TX8A 2P8CA 3T1GA 4EE9A 1F05A 3CBWA 4S3JA 2YYUA 2HJPA 4HA3A 2DZVA 3O5KA 1BLIA 1J0YA 2Y88A 2ZZ5A 5D03A 5TAOA 3RG6A 1Z7AA 4W4QA 4EF9A 3PTKA 3GTHA 4ZSUA 4WZHA 3VIIA 4KQNA 7ODCA 2PWDA 2QF7A 3F5KA 4ZOAA 4QE4A 4NASA 1RBLA 1E56A 3BAXA 1XLFA 2FHBA 1XC4A 4C5ZA 3G6LA 1XGDA 4ICCX 3PF3A 4UMBA 1V0MA 3CHDA 4ILSA 2V3EA 2C71A 1MEWA 4JFJA 2W91A 1FFQA 4GPNA 1IEQA 3FSUA 2QNEA 1OBAA 2M08A 4IWWA 4IQJA 2WKGA 3K8KA 1UYQA 3PTDA 3AMCA 4B5WA 1J5SA 2CLPA 1S1RA 1TELA 4CN4A 5ECVA 3FAWA 4PN2A 4O52A 3O5LA 2PB1A 3O05A 4XIAA 5AC6A 2CWNA 2VMFA 1VD6A 1T11A 4TV5A 2H3BA 4UNIA 3GDKA 1O5XA 2QUTA 3VDBA 3MS8A 3VNIA 4JHZA 2REQA 4O14A 3HGSA 3NQCA 1JI2A 1V03A 1BPLB 3DHPA 3DBNA 3KTCA 1JCNA 4Y6GA 1PHQA 2EO7A 1SFSA 2G96A 3LXAA 1FBAA 1GKQA 2ETNA 3ORWA 5XIAA 3RLUA 3KRSA 2WMKA 1OCJA 2MANA 3VAWA 1WOAA 2J7GA 5FCZA 1HQTA 5HDRA 1SVDA 2CZ5A 3U2ZA 3FEMA 4LUIA 1L9WA 1FWRA 3APGA 2OSXA 3POCA 3TDFA 1R3YA 3IEBA 3UYIA 1VH7A 1DIOA 1KXHA 3MCOA 3VNJA 1H7NA 5HK4A 3AYRA 3BGGA 4XQ6A 5C9XA 4Q8PA 1C7SA 3VNLA 2IF4A 5KZ6A 4UQEA 1R9ZA 3GNXA 1WBHA 4JY9A 1K7FA 2OGYA 3G1HA 4IT4A 4XO7A 2MF9A 2HVMA 2ZTJA 3WDPP 1PL9A 3V35A 2V5CA 2VX4A 1DWHM 3OBKA 1RCXB 3MYPA 2UY4A 3PM6A 3PWIA 1SZNA 3WNPA 3NSXA 3TC5A 2OYKA 4PFMA 2CC0A 3JW7A 2CBVA 4UR8A 4WHBA 1SFLA 2YW3A 3PP7A 5FI8A 1FH9A 2VL4A 2DT0A 3TV8A 3G22A 3T05A 4ZQCA 4FNRA 1HGWA 1TPB1 1UROA 1FRBA 5HMSA 3U48A 1JYNA 4Z2GA 3CYJA 4HOWA 4GI4A 5CPQA 2YZ5A 4HHMA 3FCPA 2VEFA 3ITOA 4IQCA 3M5XA 5TF0A 1OX4B 2ISVA 5EKYA 3GH7A 3W2JA 4MADA 4GQGA 3RLGA 4DEFA 4PMXA 1A49A 3QH2A 5H1WA 1I2OA 1YNQA 4OBRA 1I4NA 1LOLA 4A2RA 5EU9A 4XZNX 1UD2A 2XVLA 2YOCA 5GPGA 1KFEA 3CUHA 1O4UA 1LL4A 2ASHA 3R2GA 2IS7A 4QISA 3UXAA 5D4YA 2J8TA 5J04A 1O95A 3L68A 3SUWA 3VUSA 4J35A 1Z32X 4AVNA 3WLJA 3IANA 3LLFA 2OO6A 4JQAA 5ABFB 4NNRA 2VDGA 2D3LA 5LXXA 1BKSA 4HMCA 1PDYA 8TIMA 1B5TA 1WAWA 5GQBA 4EOUA 3TDBA 4CCEA 2FFIA 1KCKA 2WZHA 3R89A 4QE5A 3CWHA 1BWKA 5HW8A 3RCYA 3V4BA 3W6YA 1RQBA 1S2TA 4ADTA 2I5GA 3MVTA 4ZSTA 1Q5MA 1XLDA 1ZU8A 4JTIA 1JPHA 3M5YA 2DUZA 1LYXA 2X0HA 3NDOA 3UT0A 1KTBA 3T78A 3I68A 2A2IA 4GKLA 3OA5A 4UTHA 5CSUA 1XWYA 5F1UA 3GTXA 3HQPA 4F3HA 2OKTA 1FXPA 3MMUA 1HZYA 2V2HA 1SZGA 2FHFA 4HSNA 4OOUA 5K9XA 2PEVA 4AWUA 3T40A 4N9BA 1NAL1 1X1OA 4CQ9A 2WNZA 1T99A 1NVMA 4MNJA 1CGXA 1F4AA 4QG6A 3EWXA 3RFAA 2SFPA 4DNHA 1I2RA 2YCEA 5HOSA 3M16A 2PDYA 2X0YA 3EEZA 1JULA 1QR7A 1ZSXA 1EYWA 4YWSA 4CD7A 4O10A 1CI1A 1UH4A 1AUSL 2F2DA 3E1F1 3PRDA 3EKLA 3A3WA 3G5EA 3F4VA 5HXMA 3G1RA 2FZMA 1G67A 1I8JA 4YTQA 1M7OA 1ZNNA 2HDJA 1N8FA 4JKKA 3WYZA 3FJ4A 1IWPA 1DQXA 2A6LA 3FN9A 1NF7A 4XBJA 1EPXA 4K36A 3PZOA 5H91A 3KAHA 1UR9A 2Z4GA 3UY8A 3XIMA 4YMZA 1JYVA 2A79A 3NPWA 3BK0A 3CO4A 4XD6A 3UJSA 1ISWA 2WCAA 3AALA 3SQSA 4ROPA 1PKMA 2V69A 3D3AA 2X30A 1P0EA 3G2GA 3EWBX 1H0IA 4J1OA 1CGYA 3BXWA 3IJDA 3U57A 3IRDA 2XSXA 2HMCA 1FKBA 3WQ4A 3CIVA 3IIVA 4C6QA 4D6HA 4UTJA 3VZZA 1TWWA 3BPWA 3HB9A 3LI1A 1W37A 4GRSA 4QLLA 4ZO8A 3UBPC 2PS2A 4YS1A 3HF3A 1FXQA 4WKFA 3VNZA 4L4MA 2A7PA 1W1IE 4CN1A 3ZT5A 4JNMA 3NTYA 2ACUA 1TG7A 4Z08A 3VINA 4O1DA 3MSRA 5HTGA 1LTDA 1XLBA 4FAPA 4IP7A 1HKWA 4FR1A 1GYNA 1TTQA 2Y1HA 2C0HA 3CV1A 2XFRA 3FA5A 4EPKA 1DWGM 3AYTA 3KP0A 5K9DA 5KSWA 1TO3A 1W54A 3P61A 3QPEA 2EJ1A 3ARTA 3PRAA 4H41A 1QOPA 3L0KA 2E40A 1UWRA 1ZTVA 4W84A 2PN0A 1WDRA 2EG7A 4HIBA 1R86A 2D1ZA 4OBSA 1TR9A 3M0VA 3S1UA 5KZDA 3BMXA 1W91A 3E12A 4KRZA 4V1XA 4PYSA 5I09A 3MKVA 1XRVA 2NVDA 1RD6A 3UR5A 4YLWA 1X97A 4DY1A 3AYSA 2OWXA 2ZX9A 4N9CA 4QJ4B 3UZJA 3M5ZA 4K8GA 1HF6A 2BX7A 3A12A 3HZ3A 1L6WA 3IKDA 4LNCA 4O1CA 5AVNA 4CVUA 4PMJA 4YXGA 3TJ4A 1OT1A 1EOKA 4LVBA 1JUBA 1I75A 3AXIA 3UCDA 2XVGA 2O9OA 3UPWA 1T8XA 3SDOA 5AVHA 1TCOC 2QJNA 3HQNA 3QV7A 3NZ1A 4U2ZA 5A8NA 2ZIDA 2XDFA 4A3QA 1AW2A 1JDDA 3MUAA 3PTMA 4XSMA 5E0KA 2WC7A 2WHKA 3KLKA 1DV7A 3WDHA 3O5DA 1F9CA 2E6YA 2GJLA 1Y5VA 3Q2DA 4Q4PA 4QGCA 3U9IA 1FWFC 5HBFA 4JFIA 3NNTA 1YLVA 4PUEA 1LWJA 2FZ8A 3AXKA 3TK7A 5HR7A 1PCKA 2VGIA 4LU0A 3ARVA 4POCA 1SMAA 4KBXA 1Q4WA 4MAVA 3KLLA 1VCVA 4GUGA 4C7FA 1V6VA 3NL5A 2AL2B 5I00A 3ITCA 2V82A 1NH6A 1XBVA 3SRFA 4H9TA 1A5MC 4ZFMA 3RK8A 2D3NA 4NG3A 4X9YA 2PF0A 2X16A 2PA6A 2VUNA 5G1YA 2K8IA 5AHEA 5I07A 2AL1A 1V6YA 1RUSA 4HK6A 2VQTA 4HPGA 3BMWA 4J2PA 3UJ2A 1E4NA 1K7EA 2NXHA 4B2DA 4D6DA 4G9PA 3KVMA 2QJIA 2ZZ2A 1K6AA 4GYFA 3I3EA 1L8PA 4R7JA 3W83A 3ITVA 2GGHA 1HP5A 2CLLA 3M07A 1CGVA 1YXCA 1UD3A 2CLIA 2FKPA 5AZ0A 4OWGA 1JFXA 1BFNA 2VENA 3AI0A 4PL2A 3DHFA 1U5JA 2O92A 2YZRA 4P7OA 3LHVA 2GOUA 3GR8A 1A5BA 3FGCB 2VEKA 4BFAA 2ESCA 2WC4A 4CCDA 2YBUA 1C90A 1D8WA 4DYJA 1TRDA 1QPOA 4JICA 1PKLA 2Z1VA 1B6CA 1DIDA 3VYLA 3N34A 5HNRA 1XIDA 3PNZA 2KX9A 3L2LA 3NSMA 3VIFA 1TKKA 1RK5A 1Q6RA 1MXGA 3M43A 3S2MA 4J3WA 3G24A 4NJHA 2BVTA 1TVNA 1DXIA 1CLXA 2Q5AA 4MWAB 2XPAA 2ZUUA 3CIXA 3SUUA 3T6CA 3TZFA 2E3ZA 3HQ1A 2QV4A 2DJXA 4Q6JA 1V3KA 4IUOA 2VVNA 1LDCA 2V38A 1TIMA 1SGJA 2J78A 3JYJA 4FOKA 2RDXA 1GHSA 1H63A 3OZPA 3WMCA 3MC5A 1TTIA 1WXZA 1VFSA 3C2VA 3PSWA 3OYXA 4US5D 1U22A 1MI3A 2J7CA 3QN3A 3G0XA 3CEUA 2DT2A 5AYXA 4IF2A 2NLYA 4AZGA 1JZ8A 3ALFA 4F79A 2H8ZA 4LUYA 4WQ6A 2PLCA 4D2JA 2GGIA 3MY9A 2QYGA 1RJRA 4H01A 4L9XA 2GLKA 4NNAA 2E4TA 4JX4A 4M3PA 2ZA1A 2EPOA 2W6RA 2DSZA 4GABA 2B7PA 1EJWC 3CZEA 4HYWA 1GJWA 5FF4A 4ZTXA 2FB3A 5LIUX 2CLHA 1UA3A 1WB0A 5B80A 5JVLA 5LNVA 1J2WA 4MWAE 9XIAA 1EBGA 3H21A 2NW0A 3RU8X 3LCXA 4GBDA 2RQSA 4UDMA 4MG4A 4AZ6A 2LLEA 1V02A 4Q8TA 3OYZA 2HWGA 1CGTA 4LFYA 3W26A 2R1MA 3GB6A 1GOMA 4UZUA 3IK8A 4QZVB 2P10A 1XR2A 3EWDA 3PB2A 2QJHA 2WM0A 3N2MA 1FKLA 4DIPA 1OG6A 4GJ1A 1JFHA 1KR1A 1K77A 1JNTA 5CSSA 4WCJA 3W29A 1LQ2A 5U4NA 3DFOA 5FSEC 3DFYA 4WJEA 3MMDA 2WMFA 3VDGA 4C6KA 1DBTA 4DJDA 4EPEC 5LNSA 1VJSA 4M6PA 1K9DA 4Q6XA 2AGKA 2JF7A 4UNKA 4HZ7A 3EOOA 2ZRXA 5DO2A 3N6JA 4DM2A 5CZ0A 4GUIA 4OU1A 3L5LA 3W4RA 3VIPA 1W2PA 4O4WA 1WZMA 1XUZA 2MUCA 4BF8A 1OYCA 3BE7A 1AD4A 1TWZA 4IG2A 4PSPA 2J13A 4A6GA 4MPQA 1OX6A 1FH7A 2FJUB 3UXKA 4JTJA 3N4AA 4GZJA 3W22A 1SQ7A 3MU7A 2DSWA 1TQJA 3DUGA 1TE1A 1XLJA 3EBVA 3AHYA 3MMWA 3UI6A 3ZXWA 2ZVRA 4LV4A 1E0VA 1QPFA 5M17A 2C91A 4W8LA 1QMLA 1JR1A 1RAKA 5LIKX 2EKCA 4V28A 4LANA 4PB5A 8RUCA 3CT7A 2WQDA 3K4WA 4DO7A 3GC4A 1XQLA 2OSWA 1KA9F 3PJXA 2R24A 4HCDA 2GUBA 4K8EA 5FA5A 3TH6A 2GJXA 3W24A 3MI2A 2ZX8A 1MRAA 1TX2A 1Q7QA 1TB3A 2V9DA 3VIHA 1SJDA 2J7EA 4NU7A 4DF2A 2QDDA 2PDCA 1ZAJA 3UETA 4GH1A 3H8AA 3NPVA 1XLLA 1VS1A 1WDSA 5D30A 4WY0B 2NQ9A 1OCBA 1G9HA 4PCSA 1IGSA 3T4CA 1DXEA 2PURA 4DIAA 4HNOA 4E4PA 1EIBA 1ZBVA 4LYQA 3GU2A 2KR7A 5TQLA 1TVLA 2PBOA 4TNSA 4HJFA 4HN8A 4Z2LA 4I9MA 5A1AA 4AVOA 2BFGA 2QGHA 2G5WA 4WXYA 3DYOA 4UTFA 4L72B 3IS4A 5C55A 2YA2A 1XKYA 3ZZ1A 5A95A 4DI8A 1UZ4A 3DX5A 1KXTA 4Z2IA 2GSEA 2NLIA 1XCFA 2Y5JA 3D47A 3VK5A 5B7YA 5XIMA 1TE6A 1JF5A 2PTYA 3EX3A 1GONA 2E25A 4JXCA 3ZOAA 4P2VA 1GPWA 4F9DA 1MW3A 2Q8ZA 4S1FA 5A3HA 4XVEA 2WK2A 3M1ZA 4BA0A 3WD4A 3TWBA 1SFJA 4F2TA 2E6AA 3SZ8A 2NUYA 3LCHA 2QDEA 1FH8A 1KM5A 3WLNA 1Q7ZA 1TV4A 2P3EA 3ENLA 3ME3A 4U4MA 4M1RA 3W28A 2CU0A 3UNTA 3UA4A 3V5CA 3HURA 3BH4A 2NT0A 3RM9A 1VBUA 1QATA 2ZYFA 2PP1A 4AG0A 3UJEA 4LUSB 2FHCA 5A6BD 4YTUA 4ITZA 4F8XA 1JF6A 4LYPA 4DJEA 4R27A 1V3LA 2Y2WA 2FMOA 3LV6A 4XK2A 1HIZA 3ERPA 4BKNA 3DFNA 2PP0A 1V7AA 3MUY1 1RSCA 3H53A 1J18A 2CZEA 4GHRA 4XTIA 1A5UA 3PZUA 2J7BA 3W76A 3T2OA 2PGFA 2V5BA 2R91A 2HNEA 3SRDA 3OEXA 3O63A 1X8FA 2FQIA 3VC5A 1E6SM 4H8NA 1HJWA 2OKOA 2DG4A 4KWVA 4UFLA 4IFKB 2ZRVA 2DZSA 4GO8A 1GEHA 4H8UA 2YGYA 4XZ9A 4AEOA 5DRCA 3ZJ8A 2VFEA 4TYOA 2EF9A 4YHGA 1QFEA 2WOQA 3G1AA 2R8WA 1ICSA 1R47A 2DZAA 1GYMA 2FZBA 2QMKA 1SZFA 2BZNA 1XLIA 4B92A 4H83A 3B8DA 1Q6GA 1E9YB 3TJXA 3CUGA 3UI4A 5I5RA 1E40A 5CPOA 2ISFA 1WKDA 3LMYA 2WBGA 5AY7A 1S5MA 4EKJA 3SCNA 1ESWA 1ONWA 1IZCA 3CPUA 2DZTA 3T09A 3V16A 1H0GA 2RUQA 3Q58A 1YXDA 4C1KA 4G6CA 4NXSA 3NQEA 2PP3A 4PTDA 1TJ1A 1RLCL 1XIFA 3BV7A 4G2PA 1HO1A 3I3DA 1EA0A 2E77A 5CPTA 1S2AA 4ERGA 1BXBA 3N19B 3BJTA 4AZCA 2IXUA 2GJRA 4IPNB 1QO2A 3M5VA 3B3DA 4WF7A 2IKIA 2D2OA 2ONEA 1C91A 3A4JA 4TW8A 1CXEA 1EGMA 2F38A 2YXGA 1YRRA 4JX5A 1UA7A 1KXQA 1QWGA 4MFEA 3GQYA 2BY3A 4M7SA 3ES7A 3YPIA 1IIGA 3H4XA 3N9RA 3MZNA 1LP6A 3VIKA 4NXKA 1W5MA 4ZMGA 1XG3A 3WQVA 2YL9A 1KM2A 4IGNA 4E8GA 4WJXA 3TQVA 5I3HA 3COTA 1D7JA 2PDKA 4KMQA 3EDDA 3THUA 1J0ZA 1ROUA 2DU2A 3WQFA 7ENLA 1RCOB 3BTNA 4AIUA 3VPLA 5A8OA 3RNDA 2NVAA 1C8XA 3QQ1A 2G4FA 3QY8A 3LM7A 1LLWA 1G7VA 2M2AA 1XH1A 3OLIA 3BG9A 1IR2A 2ZOXA 2YL6A 1VKFA 3WDIA 2RDWA 5BOOA 3STGA 3GSMA 4RW5A 4FEZA 1DXFA 2GSJA 3FK4A 7TIMA 1KBBA 3O8AA 3LRMA 1ADSA 2I5QA 4PTXA 4Q8NA 2CXEA 2TPSA 1CENA 4GUFA 1EJ7L 2Z25A 4DBSA 1ZL1A 1V3JA 1MW2A 3LS9A 1Q6LA 3TN6A 1OFRA 3GDRA 1E4MM 2FTPA 3FJNA 3M6YA 4WDUA 4DZAA 4GZIA 5AC8A 3WQ6A 5E9XA 2VOMA 4QROA 1THFD 2X2YA 1H7OA 3W1XA 3S1XA 4O54A 2YFOA 2KGJA 4JZ5A 1JVWA 3GVRA 2OOGA 3WLQA 3V0TA 3L4TA 1N2VA 2OQHA 3KW3A 2QMJA 2CYGA 4K38A 2Q09A 3CAQA 3B40A 4GXWA 2B4GA 1H1ZA 5IBXA 3R1ZA 3I6CA 4QXIA 1W9BM 3AHTA 3N6QA 4GWEA 4N9DA 1FWWA 3GAKA 4E0CA 1ZCCA 4KS0A 1GQIA 2G3IA 4DROA 1AA1B 2ZRYA 3O6DA 2BGSA 1W1PA 3P14A 5G5IA 4GJJA 1VLIA 2WAGA 3KRUA 1MSSA 1U5HA 2OXNA 1LLZA 3CZKA 2P8BA 3OVGA 2G41A 4BY3A 4U5KA 1X7IA 2VR5A 4UTMA 2B7OA 3VD5A 2OELA 3GR4A 1UP3A 1XLMA 3GH4A 2BGQA 3GDTA 1OFAA 1YE6A 4OECA 3C8FA 5DMLA 2PF8A 3ZSTA 1AW1A 2CIPA 3EPMA 3DKJA 4L65A 5A6LA 4QIUA 3F5JA 1PBKA 3BLIA 2G37A 4ZGYA 3NUKA 1CB7B 3MCNA 4J7RA 3O9NA 1AL8A 4W8BA 4D6IA 1UKQA 3TLLA 2XIMA 4GXPA 1LROA 1D2KA 1GQKA 4RDZA 2Q8LA 3TTYA 3SFKA 1HN1A 1Q7MA 3GR7A 4GD0A 5BYWA 1Z3NA 2VCCA 3M0YA 1IHIA 2OFJA 2QJMA 3B06A 4FNTA 5D2XA 5CH9A 2ZXBA 4PCPA 2VCAA 3W07A 3HPFA 2GK1B 1E6PA 5BXSA 3BMBA 1V79A 4NP7A 1HXJA 4FAMA 3LERA 3IVTA 2A6NA 1I0DA 2RFGA 3WUFA 2VJXA 1UJPA 3SQLA 5LXEA 3BURA 3V18A 1F07A 3JZUA 2R1KA 4JTQA 3RN6A 5ENLA 1JPIA 3Q37A 4P8XA 3CUIA 1GT8A 5REQA 5D9PA 5BNKA 2HRWA 1GJUA 1VHNA 2AAMA 1J4EA 4L7ZA 1JAKA 2DSVA 1D7KA 3DFPA 2XIQA 1Y7VA 1WA3A 4IPJA 4M8UA 1E3ZA 5HMFA 2VRQA 2R14A 5T91A 2FVKA 1AH0A 3D0CA 4M56A 4N19A 1M1BA 3HN3A 4PMQA 2R1NA 1LWIA 2W5FA 4MHBA 4O15A 4AEEA 2WKLA 5DF0A 3KCLA 1FKSA 1KFKA 1EKOA 4BI7A 1GK8A 3DYPA 2VEPA 3P0XA 3FY1A 1YEYA 3K46A 1S39A 2RH9A 4L4LA 1XIBA 4PZVA 1Q6CA 3UR8A 3FAXA 3BLEA 5HUAA 1XFCA 1TV3A 1M9HA 4DB7A 4LAYA 5C2CA 3H26A 5E9AA 1SYTA 3QSRA 1IZKA 1CXIA 2NUXA 3EKGA 3CK5A 4XZMX 3WELA 3CGNA 2X1SA 4RW3A 5A6SA 4QNWA 1XBYA 1W5QA 2G8ZA 4H6EA 1EYEA 4PTMA 4I5UA 3TU9A 2IXVA 3PUDA 2W61A 1O5QA 3DN5A 3FNDA 4XBKA 1ZBKA 3VNYA 4JFVA 4HZ6A 4CD8A 1GZ1A 2ADAA 3VGHA 3WLTA 2F9RA 3DGRA 1GTEA 4V1YA 5BW6A 2Y7EA 3F4CA 4QLKA 3P3BA 5M5DA 1Q6QA 3MO7A 2X1IA 1QHZA 1NMWA 4NX0A 3T44A 4B15A 2IPFA 3PZ9A 1B54A 3IUDA 3JS3A 4HK5A 4FLSA 3S1VA 4AD2A 5F2GA 3O5QA 2RJHA 3B9NA 4W8AA 1J8VA 5LGXA 3NQ6A 4X0VA 4XZWA 2FMNA 1JZ7A 2OFNA 1NIUA 4QEHA 1EDQA 2OQLA 3DC8A 4UTIA 3BCFA 1BEUA 4G1KA 3NI6A 3LU2A 2YX0A 5AYBA 1BGGA 4Q8UA 1IX5A 3NQBA 5LIWX 4C7GA 1XGZA 2X42A 3SSZA 5FF0A 4UTWC 3SN4A 1A4MA 2WHMA 3TA6A 3GUGA 4WSKA 4O17A 4PUUA 3NL3A 4HU8A 3AIEA 1CIUA 3UY7A 1EYMA 3V1PA 1ZRQA 2XP8A 4X2PA 1JDFA 1T96A 4PFHA 1UWIA 4J3UA 4AY1A 3HJEA 1AJ2A 1ZUAX 3KBNA 3LNPA 4QR6A 2XN0A 3N1AA 3C8NA 3FKKA 2AWGA 3TYCA 3W0KA 2C18A 2E8ZA 1X1NA 1P0DA 1H62A 4PMRA 1KM4A 2ITKA 3EXTA 4I5XA 1M65A 3PBVA 3ARUA 5IFPA 3MT1A 5FSDC 2QPSA 4LUTB 1UIOA 2QCGA 4H9MA 4XD5A 4YHEA 4YIWA 2J88A 2DY3A 4RUBA 3ZLHA 5CQ1A 3S6OA 4DWDA 3VNDA 2H3DA 3LI0A 3PNUA 4HMNA 2ACQA 1YIXA 4E3TA 4Q4KA 1XM3A 1XISA 2Z6IA 5HQMA 3M46A 3H7UA 3EXSA 1DEDA 3PHAA 4JYDA 3N12A 1BHGA 3UJFA 1AQHA 4X9SA 4HQVA 3CAVA 2JKPA 1VCFA 1QAPA 3R7MA 3E38A 3NTPA 2JIEA 3SCRA 1SO5A 3DESA 2HXUA 1YDOA 2LKNA 3L7RA 1TVPA 4IJBA 1VQTA 2WLZA 1XPYA 5IM51 2ICSA 1YBQB 2UWFA 1UP0A 4GC4A 4DJEC 1ZB5A 1BXCA 2DZUA 1UQZA 1OADA 2DUXA 1A0DA 2DH2A 3LGGA 1E5JA 4AHOA 3WJYA 3NZQA 1E6XM 1PKNA 3G3DA 3CB3A 1KWKA 3W75A 1UUMA 2PD5A 3MB9A 3W1RA 3H2EA 5EBAA 4R5EA 4JTLA 3S2CA 1XYBA 3W7OA 3C0JA 3EWYA 4TOQA 2PLKA 4YWIA 2GVLA 4Z2HA 2Y4SA 3WQPA 5SWUA 3UVAA 1HKMA 4I7VA 4AXKA 2PDJA 4P7RA 3DAQA 3CHFA 2YXXA 3QY6A 2WJDA 4IOTA 3WK1A 4ZFCA 1XF0A 3SUTA 1NFGA 3E0VA 4NI3A 1JYXA 1QNOA 2GOKA 1EHAA 3ITGA 3WL0A 2O9RA 2DVUA 4E2DA 3DFTA 2B5UB 4EPBC 2QW5A 3I4KA 4ERIA 5DITA 3O5FA 1BYCA 1MRQA 5HWMA 3WFAA 3TROA 3FLUA 3ODKA 3SIZA 4PCTA 2JGQA 1QNVA 3I65A 4ADUA 2VD8A 5JIPA 5DBUA 1PIFA 4UOJA 1Q65A 3D5HA 1SZRA 3D3FA 1WE5A 1KO0A 1AVAA 3SECA 4IPXA 1VIWA 2I56A 2ON3A 4R0XA 7TAAA 1S2CA 5T9CE 4GIVA 3E2RA 3O06A 1L0PA 4GQ0A 4LVAA 1PDZA 4B9YA 3LHUA 5CSYA 3TA9A 1VRXA 2ZADA 1JQVA 5EFFA 1E70M 4RZ5A 3G1YA 1LCOA 3W70A 4YNGA 3E2VA 3BQ6A 4QS5A 3ATZA 1B3OA 5DIVA 1A5OC 2W92A 3KS6A 3Q45A 4OBTA 2P0OA 2ZICA 5LGZA 1ZALA 4IZGA 4KWOA 1L6YA 1AJZA 3DECA 4LC8A 2I7GA 5BRPA 3GFYA 1MEHA 4P7LA 4RNHA 4C6JA 3MANA 4D9PA 1OM0A 3R4IA 3ZVHA 3AUOA 3NGJA 4MPKA 3A47A 2DZPA 3NL6A 2FLIA 3TAOA 3H2AA 1RJPA 4DRNA 4B5UA 2VT0A 1QBAA 4LSBA 3TEVA 4AIBA 3DIPA 1SO6A 4MKNA 1W5NA 4WX2A 1H1YA 2ZQSA 5A6AA 2HXTA 3NEVA 1F40A 4Z2KA 3TTSA 1FWGC 4BCEA 4KW2A 1N8WA 3LTPA 2PV3A 1TPVA 4HA0A 3W1AA 4YVXA 3OGRA 5A8QA 5CG0A 2BGNE 4HN4A 4W85A 3SCWA 3VNKA 4C6OA 4FIRA 5C70A 4FB7A 3A13A 4JEJA 1JEZA 6A3HA 1DWJM 4JQ1A 3QW4B 1JD7A 1MEIA 4CEXC 3HM7A 4TV6A 4J3TA 1BL4A 5D2YA 3IVSA 5LA2A 3F03K 1DJYA 5GNZA 2R9RA 3BAWA 3SUVA 2XM1A 3PWGA 3AS2A 1ISVA 3W88A 5FJJA 3PFRA 5RUBA 3VX1A 1V02E 1H7XA 4JNYA 3TYZA 3CUZA 3HG3A 3CZLA 4HNNA 4LTSA 3VUPA 1A47A 3V5FA 4AVFA 1OWQA 3OLGA 4MM1A 4Z0SA 4N02A 4LPCA 3LPFA 3L2MA 2CWXA 1XSJA 2P50A 2C7FA 4QDPA 3E6EA 4MSPA 3OLDA 2XUCA 2YCKX 3RHGA 1M53A 2HNHA 3CL6A 3BICA 1GOWA 3K8LA 1J12A 4K7YA 3NO1A 1J01A 4IMFA 3EMQA 1VEMA 3QHOA 1UWAA 3VDHA 3QQWA 4FALA 4ZS6A 1S5VA 4LB3A 4PRRA 3RMJA 2CLFA 3OQ8A 5FOOA 4UQAA 4G2DA 3CAWA 2DP3A 3K30A 5I78A 4JIRA 2WV8A 5G1TA 3RRAA 1EZWA 3TTEA 4TVUA 3RLHA 2Y7DA 3EYPA 2XP6A 1V6WA 8XIMA 3PUGA 2POTA 1RH9A 2YPIA 4QFUA 3N13A 1TX0A 1ICQA 4KF1A 2TYSA 1QXLA 3AWOA 1IQ8A 2UY2A 1H50A 4XAKA 4GIAA 4C02B 5EFDA 3CLMA 3P5YA 3WQCA 3GNNA 4W9QA 1ZY9A 4QG8A 1O60A 3AWNA 1NOWA 4BWLC 3UWZA 2DSUA 1MNSA 1JI1A 2E7FA 1VRDA 2AGTA 4GK8A 1P6CA 4IICA 1W31A 5FJOA 1AJ0A 1OC5A 2FH6A 5HINA 4CQCA 1Q66A 2FAPA 1Z44A 3EPNA 4MZ1A 4DWSC 3KHDA 1WUEA 3RO6A 1CBGA 4JGDA 5CZTA 3HIJA 4AD0A 1SW3A 3SURA 4U84A 4HOZA 4R9OA 3TYAA 1QNSA 1EBHA 3L2IA 4PMDA 1GVRA 2C16A 1J6YA 3VIOA 3GDBA 3W85A 5C8BB 4PMOA 2GWGA 3LRKA 5CC7A 4KGLA 1KRMA 4GFSA 3BZJA 2J74A 4K1GA 3TNBA 3FDKA 3O16A 2VCBA 2DV0A 3U2EA 3KADA 3U2CA 3NRKA 2BVYA 1EL3A 3IJ8A 3MBFA 3C2FA 4DAIA 4GG9A 4H9UA 3PPHA 1WPCA 3AAMA 4K3ZA 2C19A 2C0AA 2MLXA 2OWCA 1NP2A 1FFRA 3D46A 1TPFA 4CNPA 5KTLA 2NXIA 2IKGA 2V3FA 2NV1A 4EWND 3ARSA 3LNMA 1XIJA 1RA5A 1K9FA 3NZPA 4MB3A 2VFIA 3LBOA 1FCBA 1NARA 1XI3A 1CTNA 4GNJA 1R9YA 1VR6A 1D3HA 1A5SA 4C1NA 2QJJA 3K1GA 3EOSA 1FKDA 1IT8A 1QDSA 1AD1A 4GINA 4WXZA 2PFHA 3WH0A 4C6DA 3H2OA 2EGZA 4H6KA 3B04A 3GUWA 3LK6A 4UTTA 4OUIA 4MJZA 4HBEA 3PZGA 4LALA 2H9AA 5TBOA 2VCDA 2IQ0A 3W3OA 1ELSA 4PL1A 3GPKA 3GU1A 2POZA 4XZLX 5LHFA 1GWJA 1N8IA 2V2CA 3TYEA 3GYEA 2PU0A 3WEMA 5I3KA 4KKXA 4GVFA 2PBCA 1W26A 2OYMA 3DI1A 3S47A 5CGTA 1DQWA 3VKBA 3PBUA 1OVDA 4KERA 3URNA 5K9CA 1Y0EA 1LBFA 1A50A 4TU1A 3T0DA 3JYMA 3VVGA 3ZJ7A 4XAPA 1S5WA 1E44A 2OZTA 4LRTA 3U0HA 2WO5A 1ZFJA 3QZ6A 4Q33A 1GQLA 1E15A 3F4DA 1V7YA 3M41A 1C3FA 1LG2A 3G6MA 3WSUA 1IR1A 2DQWA 4PA8A 5M03A 5LA1A 3SUSA 1WKYA 2NQLA 2XPKA 2RUSA 4J3XA 3B0UX 3MDUA 1L2QA 4ATDA 5CLTA 3QR0A 1YATA 2DORA 1QOQA 4W9TA 3AZSA 4HU4A 3CASA 4W86A 1I9CB 3OA3A 2X05A 4V15A 2Q3RA 4XKYA 1EJVC 1JZ5A 4O16A 1TWSA 3N17A 4JD4A 1UR3M 4GISA 2RAGA 4J28A 1Z69A 4N0RA 4CU8A 1R3TA 1G0CA 3OVRA 3MV01 3LCGA 1FY6A 1H7RA 4WOZA 1FWAC 2D2HA 4FS9A 1QPQA 5JUVA 4HMEA 3W1PA 1NQ6A 3TCEA 3U2OA 2VX5A 1K8YA 5I06A 2CNCA 1B31A 1R7AA 1NF0A 2CBJA 4I3GA 1EC7A 2PSNA 3PZTA 2FVLA 3PY2A 2XG9A 5I3JA 2OT0A 3DCPA 4LH8A 4DRKA 4OFCA 5JH2A 4DF1A 2AAAA 5DO8A 3N9KA 1E4IA 2GDUA 1KNWA 2O9TA 5CC3A 3FVDA 4ZO9A 3KZ7A 1NU5A 3VOIA 4ACZA 3S1WA 3I6RA 3AHXA 3UWEA 1TV8A 1OT2A 4PRWA 3S6TA 2CEQA 5HWCA 4RZBA 1VENA 3GDMA 3TXVA 1JXKA 1M04A 2A85A 3HU7A 2FPTA 3GNDA 5GNYA 2ZA3A 5EYWA 4QX4A 4ZE5A 1E73M 2ZUTA 4XSLA 5LZLA 1IXPA 3EY6A 1H5VA 3BSGA 5EB8A 5T9BG 2VX7A 1MFVA 2J6XA 3N29A 1BTMA 3OHMB 3CTLA 1LQ0A 2PLMA 1V5XA 3BW4A 1VFTA 1HJXA 3ABQA 4GA8A 2VFFA 1ZJIA 1VBHA 1TQXA 4ASTA 1J10A 4FOUA 2PWEA 2AQOA 1L1PA 2UY5A 2PRMA 1J0IA 2VOTA 1JCHB 2QCFA 1A53A 3HV8A 2LJ4A 4R7WA 5CSRA 3BSHA 1VPXA 5HATA 3FX4A 1DORA 4NJIA 1P0NA 3LSBA 1XBZA 2YR1A 1X8CA 1DJNA 4PBEA 3U4FA 2W63A 1N82A 1WP6A 3HPAA 2YCJA 3S5OA 2QPXA 2O4MA 1UG6A 2J25A 2WSQA 7A3HA 1JL8A 1VBRA 3G0SA 4IPPA 3GTNA 1F8MA 2E6DA 3A21A 4Y90A 3M7SA 1U83A 2Q6ZA 2D22A 2WMIA 3IWPA 4MVAA 1E51A 2DVXA 4M6UA 3ITYA 3CL8A 1HKJA 4KEUA 4QSFA 2EPKX 3B0VC 2PDQA 3LEPA 1KLZA 3W9ZA 3WIJA 5HW6A 3GDLA 4JTSA 2YW4A 2F2KA 4U85A 3KEHA 1WZLA 4DI9A 4DPPA 4MTVA 1HJQA 4O18A 4LS0A 1BGAA 3N3MA 4GZ7A 5REQB 3L21A 1FP8A 3BDKA 3LZ3A 5M2FX 2PUZA 1AODA 5G1MA 3ELFA 1FD9A 1JCTA 4XAZA 4E2OA 3NEHA 4IJCA 1A3HA 2KO7A 2QCCA 3DKLA 1GNXA 5F4WA 4I9TA 2PE4A 1PAMA 1P5BA 3A5VA 4HCHA 1IXNA 2N87A 1N55A 4BQ2A 1C29A 4IIDA 4YL2A 4IIFA 2ZZ4A 1HJUA 1SM9A 1XYAA 5G2IA 5CCZA 3HG2A 1QVBA 3E3HA 1OABA 1OFEA 3LCLA 3PR9A 4US6A 3G3MA 3W84A 4EWJA 3RFWA 2QHAA 1FP9A 1TPWA 3T8LA 3A23A 4RPQA 3VM5A 4D71A 1E5NA 2XSBA 2PGEA 1RZMA 3NOYA 3R8HA 2ZZ1A 3MWAA 3WH9A 4H4IA 4Q3MA 3AXHA 4OTKA 2G97A 1KKRA 2VFGA 1GVSA 1IEWA 5CC5A 4RX0A 3SEPA 5AC7A 2VDHA 4MJMA 4O50A 1W9UA 2QUMA 1UR2A 4Q8WA 2VFDA 4FI4A 2WNNA 4FXFA 2F7FA 4AX6A 4R9XA 1E71M 3ZR4A 3U6WA 2VRJA 1CECA 2J27A 1UHVA 3EOLA 2Y0FA 1IF2A 2Z7KA 3G8RA 3TYUA 1UMYA 2I16A 3QR3A 4G7EA 3TLQA 3ZWSA 2GUUA 1C9DA 4NQ1A 4L6OA 3UEQA 1F76A 4XUGA 3KP1A 1O5KA 1KBJA 3FKRA 4HKPA 2CLKA 1QPNA 2XGZA 4JHOA 3V3WA 4YTRA 5HUPA 4ZXLA 1ZENA 3EZ4A 3OZOA 3AU6A 3AIUA 3SCPA 3C52A 3HGRA 1SO3A 2C3ZA 3VOCA 2QR6A 4TUFA 2Q71A 1QNRA 2ALDA 3QV9A 2OCZA 3GNPA 1IWAA 3WZ0E 3CV2A 2NZLA 4A3HA 4AHQA 1B3WA 5F4SA 5EMLA 4KPLA 3IAPA 4G1NA 4XKMA 1F2JA 2VUYA 4PH6A 4RDWA 3MUXA 3GFXA 3GXNA 4RPPA 2ZX5A 4GUHA 3W7EA 5E5CA 3S2NA 1I1WA 1WOBA 4FXSA 1Q6DA 4D8ZA 3S5ZA 3KACA 1X96A 1C93A 3AIRA 4MJ4A 3S0CA 3RM8A 3PBMA 4BQ4A 2XHYA 2RURA 1PYFA 5MKGA 3W7DA 4AC7C 5I2UA 4B2DD 2OEKA 1VCGA 2DW7A 1AK5A 1GEQA 3SM0A 4Z1AA 3BOFA 3IGUA 3ZS4A 2V6AA 3VKCA 1NY1A 3HBLA 3WH8A 2W27A 4BI6A 3P67A 4AD3A 5AECA 4GY1A 3S9ZA 2A7RA 4IISA 5MHBA 1J0KA 1C8VA 3W87A 4N4PA 1B90A 1TR1A 4PRTA 1OK4A 4PBFA 3N18A 3ZYZA 1B57A 1ONEA 4GY7A 1H3GA 1DVJA 4IQEA 1YDYA 1L6GA 3EWUA 1GYLA 1XYZA 3MYOA 4M81A 2AMGA 3H2CA 4OV4A 5BU9A 1TWDA 4LY8A 2XSAA 4XB3A 5CAKA 4ODNA 4EX4A 4R53A 2FTWA 4PUKA 4W5UA 6REQA 4CNUA 4H9XA 4HSOA 1GVQA 2DQXA 3A6OA 4N6EA 1D7FA 2ZR6A 2IMRA 5J6EA 2VD9A 2JALA 4KWWA 3HOJA 1K8CA 2GUYA 3PJWA 3WBYA 1WDWA 3VTRA 4LNYA 3T81A 4RJEA 4UQCA 1DQUA 2OPJA 4AMCA 1B3ZA 5J5DA 3UWYA 1KC7A 4NUWA 3A5FA 2PGWA 2X1UA 4D6CA 3CUXA 3NQVA 1ML1A 2QPUA 5DQPA 3P8JA 4MJ2A 3WFZA 3L5MA 5DIUA 3UP8A 2OQYA 2VC6A 4C1LA 3OU8A 4AZ7A 4WVXA 3OB8A 4QJ3B 3H2FA 2RJGA 1ZJBA 3VGEA 3NOEA 5GNXA 3EMZA 4Y9PA 3BZGA 2Q01A 4ACYA 3DHDA 2ZRWA 3W2LA 3LHTA 4ENLA 3FFSA 4TMBA 2DT3A 3R8GA 3WH5A 4G7FA 4FK9A 1G01A 1H5YA 4Z2JA 4JHMA 4B3ZA 3WEZA 4GYPC 1AQMA 3WUEA 3ZLFA 3WF1A 3OJGA 4C91A 4LS1A 1T40A 3WFLA 5BXTA 4JPGA 4A4AA 4GIYA 1BSLA 3VGDA 2J8FA 4FNQA 3WF2A 2I5IA 3WLRA 4AWSA 3GXIA 1SJBA 4AQLA 2CBIA 2WVTA 1XLHA 4FLOA 1CLKA 1JRCA 2KZHA 2OG9A 4IGHA 2NT1A 1XHGA 3FHAA 1O6IA 1JXJA 9CGTA 4JCLA 1JQXA 5BMWA 4GGQA 3NYZA 1JCYA 1UKTA 4DJDD 5A6MA 1NSGA 3UQIA 3KX6A 2EKGA 3MSDA 2V5DA 2J9XA 3CMJA 3F7JA 5FEXA 2WWCA 2QULA 4GNVA 3WLPA 4S2CA 3A3XA 3GLCA 4FZIA 3W1UA 4O4VA 2HV5A 1PCWA 2VGFA 2GVGA 3WF3A 5BXJA 1WUFA 3STEA 2IW0A 2DT1A 4XUYA 4PULA 1XLAA 2CITA 2ABAA 5K4ZA 4YCPA 1F6KA 2PV1A 3W23A 1QASA 3VI2A 2DZXA 1OHLA 2YB4A 1ZP4A 4AWTA 1JZ4A 4Z42C 5FJRA 2ZDSA 3VOJA 1G4PA 1HNYA 4HARA 3IJQA 3U7BA 3S1GA 1M68A 2WM1A 2VTFA 2QGYA 3M64A 1RBAA 1RV8A <