5J6EA

Structure of disulfide crosslinked a. fumigatus fkbp12(v91c)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
111
structure length
111
Chain Sequence
MGVTKELKSPGNGVDFPKKGDFVTIHYTGRLTDGSKFDSSVDRNEPFQTQIGTGRVIKGWDEGVPQMSLGEKAVLTITPDYGYGARGFPPCIPGNSTLIFEVELLGINNKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Neosartorya fumigata (strain atcc mya-4609 / af293 / cbs 101355 / fgsc a1100)
molecule tags Isomerase
molecule keywords FK506-binding protein 1A
total genus 27
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5j6eA00
2LJ4A 2RUCA 4G2PA 2MLZA 2ZQVA 3KAFA 4ODKA 3RGCA 3UQBA 2XP9A 4DIPA 5HW8A 5HW7A 4ODLA 2UZ5A 2KR7A 2PPOA 1F8AB 1BL4A 3KAGA 3CGMA 4TYOA 4DT4A 4DRQA 1FKRA 3VAWA 3IKGA 2RURA 4ODPA 1Y0OA 2LKNA 3KZ7A 2IF4A 2XPBA 3IKDA 2XP5A 1FJDA 1KT1A 2L2SA 3I6CA 2PV1A 1J4HA 2Y78A 4ODMA 3O5MA 4LAWA 2DG9A 3OOBA 2Q5AA 1TCOC 3UI5A 1L1PA 3KADA 2F4EA 3JXVA 4JFMA 2ZR6A 2DG3A 3KAHA 3KAIA 2MLXA 1F40A 1QPLA 3KACA 5DIUA 1YATA 2F2DA 4JFKA 1D7JA 1N1AA 2XP4A 3PA7A 3CGNA 2M1IA 1PBKA 3O5IA 1ROUA 4QIBA 3TCZA 1NSGA 5HKGA 2N87A 2OFNA 2PPPA 1PINA 3O5QA 1FKBA 4W9QA 1D6OA 1BKFA 2FAPA 5HW6A 1FKGA 2MLYA 1B6CA 1C9HA 2XP8A 2XPAA 3NI6A 4JFLA 4NNRA 5J6EA 4FAPA 4R0XA 1QZ2A 1FD9A 3O5LA 2RQSA 3FAPA 1J6YA 3UI6A 4JFIA 5HWCA 1FKJA 2LGOA 1KT0A 2RUQA 2ZQUA 4DRPA 1JVWA 3O5DA 2M08A 4DRNA 2XP6A 4JFJA 2K8IA 4GIVA 2VCDA 1Q6IA 3JYJA 4DRMA 3UQAA 2KE0A 2KFWA 3UI4A 3IK8A 1FKSA 2ZQSA 1FKTA 1J4RA 2ZR4A 4ODRA 4DZ2A 5GPGA 4BF8A 1ZK6A 2M2AA 3RFWA 4LAVA 4TW7A 4TW6A 5HUAA 3O5OA 4DRIA 3H9RB 4FN2A 4J4OA 1Q6HA 2ZQTA 1FKHA 4DRKA 4DZ3A 1EQ3A 1JNTA 1T11A 4U85A 5D75A 3O5JA 2MF9A 4ODNA 1ROTA 5DITA 1FKKA 2RSEA 1P5QA 2KGJA 4J4NA 1JNSA 1D7HA 4O2TA 5HT1A 3O5EA 4W9OA 3ODKA 2LPVA 5I98A 3LUOA 1J4IA 4ITZA 4LAXA 1FKFA 4TNSA 2F21A 3O5KA 1A7XA 1R9HA 1FKDA 5B8IC 1Q6UA 3PRBA 3UF8A 4G50A 3EY6A 3NRKA 1YW5A 3O5RA 4IQCA 4TW8A 3UQIA 4TX0A 2XP3A 3TC5A 2ZR5A 4C02B 1D7IA 1NMVA 3NTPA 4IQ2A 1M5YA 4ODOA 3O5GA 1QPFA 4JYSA 4DH0A 1ZCNA 2MNTA 2AWGA 4U84A 4QT2A 1W26A 5HTGA 2FKEA 1Q1CA 2PPNA 2PV2A 1EYMA 3O5FA 5DIVA 4N19A 4QT3A 1FKIA 3KABA 2KO7A 3GPKA 2PBCA 4ODQA 2ITKA 3IHZA 2DG4A 3KCEA 4IPXA 2MPHA 5HWBA 1HXVA 4W9PA 1FKLA 4LAYA 3JYMA 3PRDA 2XP7A 2D9FA 3O5PA 4GGQA 4DROA 3MDYB 4MGVA 2PV3A 2RUDA 1NMWA 3B7XA 4MSPA 1U79A 2KI3A 3TDBA 3WH0A 4DRJA 4DRHA 2VN1A 5BXJA 2JZVA 4U86A 1FAPA
chains in the Genus database with same CATH superfamily
1ITXA 4G2PA 3RGCA 4ODKA 1VF8A 4P8VA 2PPOA 4TYOA 1EHNA 4DRQA 3GU0A 1IX5A 3ARVA 3OA5A 3G6MA 1GUVA 2DG9A 3OOBA 3WL0A 3ARUA 1TCOC 3BMBA 3KAHA 3KAIA 1F40A 1ZBVA 2DT2A 4Z2IA 1QPLA 1YATA 2F2DA 4JFKA 1N1AA 1NH6A 3TCZA 4QIBA 1NSGA 2N87A 2PPPA 1HJXA 2O9OA 3NI6A 1J6YA 5HWCA 1FKJA 2G41A 1JVWA 3RMEA 4PTMA 1W9PA 1ZBWA 2K8IA 3FXYA 3PRAA 4NZCA 4MNJA 1Q6IA 3UQAA 2DT1A 3AQUA 4IT6A 3UI4A 3IK8A 1E15A 4L3NA 2M2AA 3RFWA 4UDMA 3CH9A 2ZQTA 2YBTA 4HBOA 4LGXA 1EIBA 1XHGA 1FKKA 2RSEA 1P5QA 2P4VA 4O2TA 3O5EA 4Z2LA 2LPVA 4LAXA 4ZS6A 1FKFA 1OWQA 1R9HA 1EDQA 2DT3A 3EY6A 4TW8A 1YW5A 3O5RA 3UQIA 1GRJA 2XP3A 1D7IA 3NTPA 4JYSA 1ZCNA 2AWGA 2DSUA 3ARTA 3KABA 4Z2JA 2KO7A 4IPXA 4W9PA 4ML4A 3JYMA 4ZPWR 4ZPTR 1HJVA 2XP7A 1ZU8A 4GGQA 3WL1A 4MGVA 1NMWA 2KI3A 3FY1A 4DRJA 1TFVA 1NWSA 3WD3A 3AS3A 2RUCA 3KAFA 1WNOA 5HW8A 3AS1A 5DF0A 1HJWA 2KR7A 2YBUA 3WKZA 5GPRA 3KAGA 4DWSC 1FKRA 3IKGA 3RM8A 4ODPA 2G8ZA 2WLZA 3IKDA 2XP5A 3I6CA 3ALFA 3WQWA 3O5MA 2Q5AA 3ARRA 1HKJA 1L1PA 3KADA 3JXVA 2ZR6A 1K9TA 4WJXA 5HBFA 3CHEA 1D7JA 1LG1A 3PA7A 1RD6A 2XP4A 1ROUA 1HKKA 3WD2A 2FAPA 4NNRA 3B8SA 1LG2A 4R0XA 1QZ2A 3O5LA 3UI6A 4HARA 1OGGA 2ZQUA 1E6NA 4MNKA 2M08A 2XP6A 4JFJA 5DO2A 3ARQA 3WQVA 2VCDA 4IT4A 1FKSA 1H0IA 5GPGA 4LAVA 2EULA 4DRIA 3ARWA 3H9RB 4FN2A 1Q6HA 2O92A 1EQ3A 2WK2A 4U85A 2A3BA 4ODNA 4J4NA 1JCHB 1JNDA 1NWTA 1UR8A 2KGJA 5I98A 2IUZA 2PI6A 4ITZA 2DPEA 3AS2A 4HBEA 1WB0A 1KFWA 3PRBA 4IQCA 4Z2GA 1E6PA 2B31A 2FDMA 2ZR5A 4C02B 2PN0A 1M5YA 2AOSA 4WKHA 3O5GA 4DH0A 4Z2KA 4QT2A 1W26A 3B9DA 5DIVA 1EYMA 4N19A 1NWUA 4DWSB 2MPHA 1LL7A 4LAYA 2D9FA 4DROA 4Q7NA 3B7XA 4DRHA 1U79A 2VN1A 5BXJA 3B9EA 1ZBKA 2QF8A 4U86A 1FAPA 2A3AA 2LJ4A 2WLYA 4J4OA 1CTNA 4W5UA 4DIPA 2WM0A 2DT0A 3AS0A 2RURA 2LKNA 3KZ7A 4MNLA 3ARXA 2IF4A 1H0GA 2XPBA 4ZPVR 1KT1A 2L2SA 2Y78A 4LAWA 2F4EA 4JFMA 1SYTA 1W9UA 3RM4A 2MLXA 1W9VA 3KACA 5DIUA 1GPFA 3CZ8A 3CGNA 3ARYA 3CHFA 3ARPA 5HKGA 2A3EA 2OFNA 5HW6A 1PINA 1FKBA 1BKFA 1FKGA 2XP8A 1C9HA 4WIWA 2XPAA 4FAPA 1FD9A 2RQSA 4Q22A 2OLHA 1KT0A 4DRNA 5JH8A 3CHCA 4GIVA 2KE0A 2KFWA 1FKTA 1J4RA 2ZR4A 4ODRA 4DZ2A 4TW6A 1FKHA 4DZ3A 1W1VA 3EIPA 1X6NA 2MF9A 1LQ0A 1FFRA 1D7HA 5HT1A 1UR9A 3ODKA 3ALGA 1J4IA 4TNSA 2F21A 3O5KA 1A7XA 4R5EA 2B5UB 5B8IC 1Q6UA 4G50A 3NRKA 4S3KA 1NMVA 2F23A 4IQ2A 1NWRA 2MNTA 4U84A 5DEZA 1ZBCA 2ETNA 1JNEA 1Q1CA 1E6ZA 3O5FA 1X6LA 1FKIA 4ODQA 5HWBA 2ITKA 3KCEA 2DG4A 4KQZA 3CHDA 3PRDA 1XRVA 2PV3A 4MSPA 3TDBA 1HXVA 4DWSA 2RUQA 1LL6A 3WD1A 2MLZA 2ZQVA 3UQBA 1GOIA 2XP9A 5HW7A 4ODLA 2UZ5A 1W1TA 1F8AB 1BL4A 3CGMA 1E44A 4DT4A 3VAWA 3BXWA 3GTYX 3QOKA 1Y0OA 4DWSD 1FJDA 2PV1A 1J4HA 4ODMA 4S3JA 3UI5A 2DSZA 4NSBA 4KR0B 2DG3A 1LJYA 3B9AA 3WIJA 1W1YA 1LL4A 2M1IA 1PBKA 3O5IA 3O5QA 4W9QA 1D6OA 2MLYA 1B6CA 1WAWA 3ARZA 4JFLA 5J6EA 2A3CA 3FAPA 4JFIA 2LGOA 4DRPA 3O5DA 3JYJA 4DRMA 3PR9A 2ZQSA 4BF8A 1ZK6A 5HUAA 4TW7A 3O5OA 4AY1A 5GQBA 4DRKA 1JNTA 1T11A 5D75A 1OGBA 3O5JA 2DSVA 4MPKA 1ROTA 5DITA 1HKIA 1E9LA 1JNSA 4W9OA 3WD4A 1D2KA 4MTVA 3LUOA 1FFQA 4QZVB 4P8UA 4WKAA 1FKDA 3UF8A 4URIA 3G6LA 4TX0A 4WK9A 3TC5A 4MNMA 4ODOA 1QPFA 1W1PA 1ZB5A 4P8XA 1ZL1A 5HTGA 1E6RA 2FKEA 2PPNA 2PV2A 3W4RA 2DSWA 4L72B 3GPKA 2PBCA 3IHZA 4XAKA 3ARSA 1SR0A 4MAVA 2ESCA 3AROA 1FKLA 3WD0A 1O6IA 3O5PA 3RM9A 3MDYB 4Z2HA 2RUDA 3WH0A 4P8WA 2JZVA 4WKFA 1HKMA 4QT3A
chains in the Genus database with same CATH topology
1ITXA 4G2PA 3RGCA 4ODKA 1VF8A 4P8VA 2PPOA 4TYOA 1EHNA 4DRQA 1IX5A 3ARVA 3OA5A 3G6MA 1GUVA 2DG9A 3OOBA 3WL0A 3ARUA 1TCOC 3KAHA 3KAIA 1F40A 1ZBVA 2DT2A 4Z2IA 1QPLA 1YATA 2F2DA 4JFKA 1N1AA 1NH6A 3TCZA 4QIBA 1NSGA 2N87A 2PPPA 1HJXA 2O9OA 3NI6A 1J6YA 5HWCA 1FKJA 2G41A 1JVWA 3RMEA 4PTMA 1W9PA 1ZBWA 2K8IA 3FXYA 3PRAA 4NZCA 4MNJA 1Q6IA 3UQAA 2DT1A 3AQUA 4IT6A 3UI4A 3IK8A 1E15A 4L3NA 2M2AA 3RFWA 3CH9A 2ZQTA 2YBTA 4HBOA 4LGXA 1EIBA 1XHGA 1FKKA 2RSEA 1P5QA 4O2TA 3O5EA 4Z2LA 2LPVA 4LAXA 4ZS6A 1FKFA 1OWQA 1R9HA 1EDQA 2DT3A 3EY6A 4TW8A 1YW5A 3O5RA 3UQIA 2XP3A 1D7IA 3NTPA 4JYSA 1ZCNA 2AWGA 2DSUA 3ARTA 3KABA 4Z2JA 2KO7A 4IPXA 4W9PA 4ML4A 3JYMA 4ZPWR 4ZPTR 1HJVA 2XP7A 1ZU8A 4GGQA 3WL1A 4MGVA 1NMWA 2KI3A 3FY1A 4DRJA 1TFVA 1NWSA 3WD3A 3AS3A 2RUCA 3KAFA 1WNOA 5HW8A 3AS1A 5DF0A 1HJWA 2KR7A 2YBUA 3WKZA 5GPRA 3KAGA 4DWSC 1FKRA 3IKGA 3RM8A 4ODPA 2G8ZA 2WLZA 3IKDA 2XP5A 3I6CA 3ALFA 3WQWA 3O5MA 2Q5AA 3ARRA 1HKJA 1L1PA 3KADA 3JXVA 2ZR6A 1K9TA 4WJXA 5HBFA 3CHEA 1D7JA 1LG1A 3PA7A 1RD6A 2XP4A 1ROUA 1HKKA 3WD2A 2FAPA 4NNRA 3B8SA 1LG2A 4R0XA 1QZ2A 3O5LA 3UI6A 4HARA 1OGGA 2ZQUA 1E6NA 4MNKA 2M08A 2XP6A 4JFJA 5DO2A 3ARQA 3WQVA 2VCDA 4IT4A 1FKSA 1H0IA 5GPGA 4LAVA 4DRIA 3ARWA 3H9RB 4FN2A 1Q6HA 2O92A 1EQ3A 2WK2A 4U85A 2A3BA 4ODNA 4J4NA 1NWTA 1JNDA 1UR8A 2KGJA 5I98A 2IUZA 2PI6A 4ITZA 2DPEA 3AS2A 4HBEA 1WB0A 1KFWA 3PRBA 4IQCA 4Z2GA 1E6PA 2B31A 2FDMA 2ZR5A 4C02B 1M5YA 2AOSA 4WKHA 3O5GA 4DH0A 4Z2KA 4QT2A 1W26A 3B9DA 5DIVA 1EYMA 4N19A 1NWUA 4DWSB 2MPHA 1LL7A 4LAYA 2D9FA 4DROA 4Q7NA 3B7XA 4DRHA 1U79A 2VN1A 5BXJA 3B9EA 1ZBKA 2QF8A 4U86A 4J4OA 2A3AA 2LJ4A 2WLYA 1FAPA 1CTNA 4W5UA 4DIPA 2WM0A 2DT0A 3AS0A 2RURA 2LKNA 3KZ7A 4MNLA 3ARXA 2IF4A 1H0GA 2XPBA 4ZPVR 1KT1A 2L2SA 2Y78A 4LAWA 2F4EA 4JFMA 1SYTA 1W9UA 3RM4A 2MLXA 1W9VA 3KACA 5DIUA 1GPFA 3CZ8A 3CGNA 3ARYA 3CHFA 3ARPA 5HKGA 2A3EA 2OFNA 5HW6A 1PINA 1FKBA 1BKFA 1FKGA 2XP8A 1C9HA 4WIWA 2XPAA 4FAPA 1FD9A 2RQSA 4Q22A 2OLHA 1KT0A 4DRNA 5JH8A 3CHCA 4GIVA 2KE0A 2KFWA 1FKTA 1J4RA 2ZR4A 4ODRA 4DZ2A 4TW6A 1FKHA 4DZ3A 1W1VA 1X6NA 2MF9A 1LQ0A 1FFRA 1D7HA 5HT1A 1UR9A 3ODKA 3ALGA 1J4IA 4TNSA 2F21A 3O5KA 1A7XA 4R5EA 5B8IC 1Q6UA 4G50A 3NRKA 4S3KA 1NMVA 4IQ2A 1NWRA 2MNTA 4U84A 5DEZA 1ZBCA 1JNEA 1Q1CA 1E6ZA 3O5FA 1X6LA 1FKIA 4ODQA 5HWBA 2ITKA 3KCEA 2DG4A 4KQZA 3CHDA 3PRDA 1XRVA 2PV3A 4MSPA 3TDBA 1HXVA 4DWSA 2RUQA 1LL6A 3WD1A 2MLZA 2ZQVA 3UQBA 1GOIA 2XP9A 5HW7A 4ODLA 2UZ5A 1W1TA 1F8AB 1BL4A 3CGMA 4DT4A 3VAWA 3BXWA 3QOKA 1Y0OA 4DWSD 1FJDA 2PV1A 1J4HA 4ODMA 4S3JA 3UI5A 2DSZA 4NSBA 4KR0B 2DG3A 1LJYA 3B9AA 3WIJA 1W1YA 1LL4A 2M1IA 1PBKA 3O5IA 3O5QA 4W9QA 1D6OA 2MLYA 1B6CA 1WAWA 3ARZA 4JFLA 5J6EA 2A3CA 3FAPA 4JFIA 2LGOA 4DRPA 3O5DA 3JYJA 4DRMA 3PR9A 2ZQSA 4BF8A 1ZK6A 5HUAA 4TW7A 3O5OA 4AY1A 5GQBA 4DRKA 1JNTA 1T11A 5D75A 1OGBA 3O5JA 2DSVA 4MPKA 1ROTA 5DITA 1HKIA 1E9LA 1JNSA 4W9OA 3WD4A 1D2KA 4MTVA 3LUOA 1FFQA 4QZVB 4P8UA 4WKAA 1FKDA 3UF8A 4URIA 3G6LA 4TX0A 4WK9A 3TC5A 4MNMA 4ODOA 1QPFA 1W1PA 1ZB5A 4P8XA 1ZL1A 5HTGA 1E6RA 2FKEA 2PPNA 2PV2A 3W4RA 2DSWA 4L72B 3GPKA 2PBCA 3IHZA 4XAKA 3ARSA 1SR0A 4MAVA 2ESCA 3AROA 1FKLA 3WD0A 1O6IA 3O5PA 3RM9A 3MDYB 4Z2HA 2RUDA 3WH0A 4P8WA 2JZVA 4WKFA 1HKMA 4QT3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJ4 A;  2RUC A;  4G2P A;  2MLZ A;  2ZQV A;  3KAF A;  4ODK A;  3RGC A;  3UQB A;  2XP9 A;  4DIP A;  5HW8 A;  5HW7 A;  4ODL A;  2UZ5 A;  2KR7 A;  2PPO A;  1F8A B;  1BL4 A;  3KAG A;  3CGM A;  4TYO A;  4DT4 A;  4DRQ A;  1FKR A;  3VAW A;  3IKG A;  2RUR A;  4ODP A;  1Y0O A;  2LKN A;  3KZ7 A;  2IF4 A;  2XPB A;  3IKD A;  2XP5 A;  1FJD A;  1KT1 A;  2L2S A;  3I6C A;  2PV1 A;  1J4H A;  2Y78 A;  4ODM A;  3O5M A;  4LAW A;  2DG9 A;  3OOB A;  2Q5A A;  1TCO C;  3UI5 A;  1L1P A;  3KAD A;  2F4E A;  3JXV A;  4JFM A;  2ZR6 A;  2DG3 A;  3KAH A;  3KAI A;  2MLX A;  1F40 A;  1QPL A;  3KAC A;  5DIU A;  1YAT A;  2F2D A;  4JFK A;  1D7J A;  1N1A A;  2XP4 A;  3PA7 A;  3CGN A;  2M1I A;  1PBK A;  3O5I A;  1ROU A;  4QIB A;  3TCZ A;  1NSG A;  5HKG A;  2N87 A;  2OFN A;  2PPP A;  1PIN A;  3O5Q A;  1FKB A;  4W9Q A;  1D6O A;  1BKF A;  2FAP A;  5HW6 A;  1FKG A;  2MLY A;  1B6C A;  1C9H A;  2XP8 A;  2XPA A;  3NI6 A;  4JFL A;  4NNR A;  5J6E A;  4FAP A;  4R0X A;  1QZ2 A;  1FD9 A;  3O5L A;  2RQS A;  3FAP A;  1J6Y A;  3UI6 A;  4JFI A;  5HWC A;  1FKJ A;  2LGO A;  1KT0 A;  2RUQ A;  2ZQU A;  4DRP A;  1JVW A;  3O5D A;  2M08 A;  4DRN A;  2XP6 A;  4JFJ A;  2K8I A;  4GIV A;  2VCD A;  1Q6I A;  3JYJ A;  4DRM A;  3UQA A;  2KE0 A;  2KFW A;  3UI4 A;  3IK8 A;  1FKS A;  2ZQS A;  1FKT A;  1J4R A;  2ZR4 A;  4ODR A;  4DZ2 A;  5GPG A;  4BF8 A;  1ZK6 A;  2M2A A;  3RFW A;  4LAV A;  4TW7 A;  4TW6 A;  5HUA A;  3O5O A;  4DRI A;  3H9R B;  4FN2 A;  4J4O A;  1Q6H A;  2ZQT A;  1FKH A;  4DRK A;  4DZ3 A;  1EQ3 A;  1JNT A;  1T11 A;  4U85 A;  5D75 A;  3O5J A;  2MF9 A;  4ODN A;  1ROT A;  5DIT A;  1FKK A;  2RSE A;  1P5Q A;  2KGJ A;  4J4N A;  1JNS A;  1D7H A;  4O2T A;  5HT1 A;  3O5E A;  4W9O A;  3ODK A;  2LPV A;  5I98 A;  3LUO A;  1J4I A;  4ITZ A;  4LAX A;  1FKF A;  4TNS A;  2F21 A;  3O5K A;  1A7X A;  1R9H A;  1FKD A;  5B8I C;  1Q6U A;  3PRB A;  3UF8 A;  4G50 A;  3EY6 A;  3NRK A;  1YW5 A;  3O5R A;  4IQC A;  4TW8 A;  3UQI A;  4TX0 A;  2XP3 A;  3TC5 A;  2ZR5 A;  4C02 B;  1D7I A;  1NMV A;  3NTP A;  4IQ2 A;  1M5Y A;  4ODO A;  3O5G A;  1QPF A;  4JYS A;  4DH0 A;  1ZCN A;  2MNT A;  2AWG A;  4U84 A;  4QT2 A;  1W26 A;  5HTG A;  2FKE A;  1Q1C A;  2PPN A;  2PV2 A;  1EYM A;  3O5F A;  5DIV A;  4N19 A;  4QT3 A;  1FKI A;  3KAB A;  2KO7 A;  3GPK A;  2PBC A;  4ODQ A;  2ITK A;  3IHZ A;  2DG4 A;  3KCE A;  4IPX A;  2MPH A;  5HWB A;  1HXV A;  4W9P A;  1FKL A;  4LAY A;  3JYM A;  3PRD A;  2XP7 A;  2D9F A;  3O5P A;  4GGQ A;  4DRO A;  3MDY B;  4MGV A;  2PV3 A;  2RUD A;  1NMW A;  3B7X A;  4MSP A;  1U79 A;  2KI3 A;  3TDB A;  3WH0 A;  4DRJ A;  4DRH A;  2VN1 A;  5BXJ A;  2JZV A;  4U86 A;  1FAP A; 
#chains in the Genus database with same CATH topology
 1ITX A;  4G2P A;  3RGC A;  4ODK A;  1VF8 A;  4P8V A;  2PPO A;  4TYO A;  1EHN A;  4DRQ A;  3GU0 A;  1IX5 A;  3ARV A;  3OA5 A;  3G6M A;  1GUV A;  2DG9 A;  3OOB A;  3WL0 A;  3ARU A;  1TCO C;  3BMB A;  3KAH A;  3KAI A;  1F40 A;  1ZBV A;  2DT2 A;  4Z2I A;  1QPL A;  1YAT A;  2F2D A;  4JFK A;  1N1A A;  1NH6 A;  3TCZ A;  4QIB A;  1NSG A;  2N87 A;  2PPP A;  1HJX A;  2O9O A;  3NI6 A;  1J6Y A;  5HWC A;  1FKJ A;  2G41 A;  1JVW A;  3RME A;  4PTM A;  1W9P A;  1ZBW A;  2K8I A;  3FXY A;  3PRA A;  4NZC A;  4MNJ A;  1Q6I A;  3UQA A;  2DT1 A;  3AQU A;  4IT6 A;  3UI4 A;  3IK8 A;  1E15 A;  4L3N A;  2M2A A;  3RFW A;  4UDM A;  3CH9 A;  2ZQT A;  2YBT A;  4HBO A;  4LGX A;  1EIB A;  1XHG A;  1FKK A;  2RSE A;  1P5Q A;  2P4V A;  4O2T A;  3O5E A;  4Z2L A;  2LPV A;  4LAX A;  4ZS6 A;  1FKF A;  1OWQ A;  1R9H A;  1EDQ A;  2DT3 A;  3EY6 A;  4TW8 A;  1YW5 A;  3O5R A;  3UQI A;  1GRJ A;  2XP3 A;  1D7I A;  3NTP A;  4JYS A;  1ZCN A;  2AWG A;  2DSU A;  3ART A;  3KAB A;  4Z2J A;  2KO7 A;  4IPX A;  4W9P A;  4ML4 A;  3JYM A;  4ZPW R;  4ZPT R;  1HJV A;  2XP7 A;  1ZU8 A;  4GGQ A;  3WL1 A;  4MGV A;  1NMW A;  2KI3 A;  3FY1 A;  4DRJ A;  1TFV A;  1NWS A;  3WD3 A;  3AS3 A;  2RUC A;  3KAF A;  1WNO A;  5HW8 A;  3AS1 A;  5DF0 A;  1HJW A;  2KR7 A;  2YBU A;  3WKZ A;  5GPR A;  3KAG A;  4DWS C;  1FKR A;  3IKG A;  3RM8 A;  4ODP A;  2G8Z A;  2WLZ A;  3IKD A;  2XP5 A;  3I6C A;  3ALF A;  3WQW A;  3O5M A;  2Q5A A;  3ARR A;  1HKJ A;  1L1P A;  3KAD A;  3JXV A;  2ZR6 A;  1K9T A;  4WJX A;  5HBF A;  3CHE A;  1D7J A;  1LG1 A;  3PA7 A;  1RD6 A;  2XP4 A;  1ROU A;  1HKK A;  3WD2 A;  2FAP A;  4NNR A;  3B8S A;  1LG2 A;  4R0X A;  1QZ2 A;  3O5L A;  3UI6 A;  4HAR A;  1OGG A;  2ZQU A;  1E6N A;  4MNK A;  2M08 A;  2XP6 A;  4JFJ A;  5DO2 A;  3ARQ A;  3WQV A;  2VCD A;  4IT4 A;  1FKS A;  1H0I A;  5GPG A;  4LAV A;  2EUL A;  4DRI A;  3ARW A;  3H9R B;  4FN2 A;  1Q6H A;  2O92 A;  1EQ3 A;  2WK2 A;  4U85 A;  2A3B A;  4ODN A;  4J4N A;  1JCH B;  1JND A;  1NWT A;  1UR8 A;  2KGJ A;  5I98 A;  2IUZ A;  2PI6 A;  4ITZ A;  2DPE A;  3AS2 A;  4HBE A;  1WB0 A;  1KFW A;  3PRB A;  4IQC A;  4Z2G A;  1E6P A;  2B31 A;  2FDM A;  2ZR5 A;  4C02 B;  2PN0 A;  1M5Y A;  2AOS A;  4WKH A;  3O5G A;  4DH0 A;  4Z2K A;  4QT2 A;  1W26 A;  3B9D A;  5DIV A;  1EYM A;  4N19 A;  1NWU A;  4DWS B;  2MPH A;  1LL7 A;  4LAY A;  2D9F A;  4DRO A;  4Q7N A;  3B7X A;  4DRH A;  1U79 A;  2VN1 A;  5BXJ A;  3B9E A;  1ZBK A;  2QF8 A;  4U86 A;  1FAP A;  2A3A A;  2LJ4 A;  2WLY A;  4J4O A;  1CTN A;  4W5U A;  4DIP A;  2WM0 A;  2DT0 A;  3AS0 A;  2RUR A;  2LKN A;  3KZ7 A;  4MNL A;  3ARX A;  2IF4 A;  1H0G A;  2XPB A;  4ZPV R;  1KT1 A;  2L2S A;  2Y78 A;  4LAW A;  2F4E A;  4JFM A;  1SYT A;  1W9U A;  3RM4 A;  2MLX A;  1W9V A;  3KAC A;  5DIU A;  1GPF A;  3CZ8 A;  3CGN A;  3ARY A;  3CHF A;  3ARP A;  5HKG A;  2A3E A;  2OFN A;  5HW6 A;  1PIN A;  1FKB A;  1BKF A;  1FKG A;  2XP8 A;  1C9H A;  4WIW A;  2XPA A;  4FAP A;  1FD9 A;  2RQS A;  4Q22 A;  2OLH A;  1KT0 A;  4DRN A;  5JH8 A;  3CHC A;  4GIV A;  2KE0 A;  2KFW A;  1FKT A;  1J4R A;  2ZR4 A;  4ODR A;  4DZ2 A;  4TW6 A;  1FKH A;  4DZ3 A;  1W1V A;  3EIP A;  1X6N A;  2MF9 A;  1LQ0 A;  1FFR A;  1D7H A;  5HT1 A;  1UR9 A;  3ODK A;  3ALG A;  1J4I A;  4TNS A;  2F21 A;  3O5K A;  1A7X A;  4R5E A;  2B5U B;  5B8I C;  1Q6U A;  4G50 A;  3NRK A;  4S3K A;  1NMV A;  2F23 A;  4IQ2 A;  1NWR A;  2MNT A;  4U84 A;  5DEZ A;  1ZBC A;  2ETN A;  1JNE A;  1Q1C A;  1E6Z A;  3O5F A;  1X6L A;  1FKI A;  4ODQ A;  5HWB A;  2ITK A;  3KCE A;  2DG4 A;  4KQZ A;  3CHD A;  3PRD A;  1XRV A;  2PV3 A;  4MSP A;  3TDB A;  1HXV A;  4DWS A;  2RUQ A;  1LL6 A;  3WD1 A;  2MLZ A;  2ZQV A;  3UQB A;  1GOI A;  2XP9 A;  5HW7 A;  4ODL A;  2UZ5 A;  1W1T A;  1F8A B;  1BL4 A;  3CGM A;  1E44 A;  4DT4 A;  3VAW A;  3BXW A;  3GTY X;  3QOK A;  1Y0O A;  4DWS D;  1FJD A;  2PV1 A;  1J4H A;  4ODM A;  4S3J A;  3UI5 A;  2DSZ A;  4NSB A;  4KR0 B;  2DG3 A;  1LJY A;  3B9A A;  3WIJ A;  1W1Y A;  1LL4 A;  2M1I A;  1PBK A;  3O5I A;  3O5Q A;  4W9Q A;  1D6O A;  2MLY A;  1B6C A;  1WAW A;  3ARZ A;  4JFL A;  5J6E A;  2A3C A;  3FAP A;  4JFI A;  2LGO A;  4DRP A;  3O5D A;  3JYJ A;  4DRM A;  3PR9 A;  2ZQS A;  4BF8 A;  1ZK6 A;  5HUA A;  4TW7 A;  3O5O A;  4AY1 A;  5GQB A;  4DRK A;  1JNT A;  1T11 A;  5D75 A;  1OGB A;  3O5J A;  2DSV A;  4MPK A;  1ROT A;  5DIT A;  1HKI A;  1E9L A;  1JNS A;  4W9O A;  3WD4 A;  1D2K A;  4MTV A;  3LUO A;  1FFQ A;  4QZV B;  4P8U A;  4WKA A;  1FKD A;  3UF8 A;  4URI A;  3G6L A;  4TX0 A;  4WK9 A;  3TC5 A;  4MNM A;  4ODO A;  1QPF A;  1W1P A;  1ZB5 A;  4P8X A;  1ZL1 A;  5HTG A;  1E6R A;  2FKE A;  2PPN A;  2PV2 A;  3W4R A;  2DSW A;  4L72 B;  3GPK A;  2PBC A;  3IHZ A;  4XAK A;  3ARS A;  1SR0 A;  4MAV A;  2ESC A;  3ARO A;  1FKL A;  3WD0 A;  1O6I A;  3O5P A;  3RM9 A;  3MDY B;  4Z2H A;  2RUD A;  3WH0 A;  4P8W A;  2JZV A;  4WKF A;  1HKM A;  4QT3 A; 
#chains in the Genus database with same CATH homology
 1ITX A;  4G2P A;  3RGC A;  4ODK A;  1VF8 A;  4P8V A;  2PPO A;  4TYO A;  1EHN A;  4DRQ A;  1IX5 A;  3ARV A;  3OA5 A;  3G6M A;  1GUV A;  2DG9 A;  3OOB A;  3WL0 A;  3ARU A;  1TCO C;  3KAH A;  3KAI A;  1F40 A;  1ZBV A;  2DT2 A;  4Z2I A;  1QPL A;  1YAT A;  2F2D A;  4JFK A;  1N1A A;  1NH6 A;  3TCZ A;  4QIB A;  1NSG A;  2N87 A;  2PPP A;  1HJX A;  2O9O A;  3NI6 A;  1J6Y A;  5HWC A;  1FKJ A;  2G41 A;  1JVW A;  3RME A;  4PTM A;  1W9P A;  1ZBW A;  2K8I A;  3FXY A;  3PRA A;  4NZC A;  4MNJ A;  1Q6I A;  3UQA A;  2DT1 A;  3AQU A;  4IT6 A;  3UI4 A;  3IK8 A;  1E15 A;  4L3N A;  2M2A A;  3RFW A;  3CH9 A;  2ZQT A;  2YBT A;  4HBO A;  4LGX A;  1EIB A;  1XHG A;  1FKK A;  2RSE A;  1P5Q A;  4O2T A;  3O5E A;  4Z2L A;  2LPV A;  4LAX A;  4ZS6 A;  1FKF A;  1OWQ A;  1R9H A;  1EDQ A;  2DT3 A;  3EY6 A;  4TW8 A;  1YW5 A;  3O5R A;  3UQI A;  2XP3 A;  1D7I A;  3NTP A;  4JYS A;  1ZCN A;  2AWG A;  2DSU A;  3ART A;  3KAB A;  4Z2J A;  2KO7 A;  4IPX A;  4W9P A;  4ML4 A;  3JYM A;  4ZPW R;  4ZPT R;  1HJV A;  2XP7 A;  1ZU8 A;  4GGQ A;  3WL1 A;  4MGV A;  1NMW A;  2KI3 A;  3FY1 A;  4DRJ A;  1TFV A;  1NWS A;  3WD3 A;  3AS3 A;  2RUC A;  3KAF A;  1WNO A;  5HW8 A;  3AS1 A;  5DF0 A;  1HJW A;  2KR7 A;  2YBU A;  3WKZ A;  5GPR A;  3KAG A;  4DWS C;  1FKR A;  3IKG A;  3RM8 A;  4ODP A;  2G8Z A;  2WLZ A;  3IKD A;  2XP5 A;  3I6C A;  3ALF A;  3WQW A;  3O5M A;  2Q5A A;  3ARR A;  1HKJ A;  1L1P A;  3KAD A;  3JXV A;  2ZR6 A;  1K9T A;  4WJX A;  5HBF A;  3CHE A;  1D7J A;  1LG1 A;  3PA7 A;  1RD6 A;  2XP4 A;  1ROU A;  1HKK A;  3WD2 A;  2FAP A;  4NNR A;  3B8S A;  1LG2 A;  4R0X A;  1QZ2 A;  3O5L A;  3UI6 A;  4HAR A;  1OGG A;  2ZQU A;  1E6N A;  4MNK A;  2M08 A;  2XP6 A;  4JFJ A;  5DO2 A;  3ARQ A;  3WQV A;  2VCD A;  4IT4 A;  1FKS A;  1H0I A;  5GPG A;  4LAV A;  4DRI A;  3ARW A;  3H9R B;  4FN2 A;  1Q6H A;  2O92 A;  1EQ3 A;  2WK2 A;  4U85 A;  2A3B A;  4ODN A;  4J4N A;  1NWT A;  1JND A;  1UR8 A;  2KGJ A;  5I98 A;  2IUZ A;  2PI6 A;  4ITZ A;  2DPE A;  3AS2 A;  4HBE A;  1WB0 A;  1KFW A;  3PRB A;  4IQC A;  4Z2G A;  1E6P A;  2B31 A;  2FDM A;  2ZR5 A;  4C02 B;  1M5Y A;  2AOS A;  4WKH A;  3O5G A;  4DH0 A;  4Z2K A;  4QT2 A;  1W26 A;  3B9D A;  5DIV A;  1EYM A;  4N19 A;  1NWU A;  4DWS B;  2MPH A;  1LL7 A;  4LAY A;  2D9F A;  4DRO A;  4Q7N A;  3B7X A;  4DRH A;  1U79 A;  2VN1 A;  5BXJ A;  3B9E A;  1ZBK A;  2QF8 A;  4U86 A;  4J4O A;  2A3A A;  2LJ4 A;  2WLY A;  1FAP A;  1CTN A;  4W5U A;  4DIP A;  2WM0 A;  2DT0 A;  3AS0 A;  2RUR A;  2LKN A;  3KZ7 A;  4MNL A;  3ARX A;  2IF4 A;  1H0G A;  2XPB A;  4ZPV R;  1KT1 A;  2L2S A;  2Y78 A;  4LAW A;  2F4E A;  4JFM A;  1SYT A;  1W9U A;  3RM4 A;  2MLX A;  1W9V A;  3KAC A;  5DIU A;  1GPF A;  3CZ8 A;  3CGN A;  3ARY A;  3CHF A;  3ARP A;  5HKG A;  2A3E A;  2OFN A;  5HW6 A;  1PIN A;  1FKB A;  1BKF A;  1FKG A;  2XP8 A;  1C9H A;  4WIW A;  2XPA A;  4FAP A;  1FD9 A;  2RQS A;  4Q22 A;  2OLH A;  1KT0 A;  4DRN A;  5JH8 A;  3CHC A;  4GIV A;  2KE0 A;  2KFW A;  1FKT A;  1J4R A;  2ZR4 A;  4ODR A;  4DZ2 A;  4TW6 A;  1FKH A;  4DZ3 A;  1W1V A;  1X6N A;  2MF9 A;  1LQ0 A;  1FFR A;  1D7H A;  5HT1 A;  1UR9 A;  3ODK A;  3ALG A;  1J4I A;  4TNS A;  2F21 A;  3O5K A;  1A7X A;  4R5E A;  5B8I C;  1Q6U A;  4G50 A;  3NRK A;  4S3K A;  1NMV A;  4IQ2 A;  1NWR A;  2MNT A;  4U84 A;  5DEZ A;  1ZBC A;  1JNE A;  1Q1C A;  1E6Z A;  3O5F A;  1X6L A;  1FKI A;  4ODQ A;  5HWB A;  2ITK A;  3KCE A;  2DG4 A;  4KQZ A;  3CHD A;  3PRD A;  1XRV A;  2PV3 A;  4MSP A;  3TDB A;  1HXV A;  4DWS A;  2RUQ A;  1LL6 A;  3WD1 A;  2MLZ A;  2ZQV A;  3UQB A;  1GOI A;  2XP9 A;  5HW7 A;  4ODL A;  2UZ5 A;  1W1T A;  1F8A B;  1BL4 A;  3CGM A;  4DT4 A;  3VAW A;  3BXW A;  3QOK A;  1Y0O A;  4DWS D;  1FJD A;  2PV1 A;  1J4H A;  4ODM A;  4S3J A;  3UI5 A;  2DSZ A;  4NSB A;  4KR0 B;  2DG3 A;  1LJY A;  3B9A A;  3WIJ A;  1W1Y A;  1LL4 A;  2M1I A;  1PBK A;  3O5I A;  3O5Q A;  4W9Q A;  1D6O A;  2MLY A;  1B6C A;  1WAW A;  3ARZ A;  4JFL A;  5J6E A;  2A3C A;  3FAP A;  4JFI A;  2LGO A;  4DRP A;  3O5D A;  3JYJ A;  4DRM A;  3PR9 A;  2ZQS A;  4BF8 A;  1ZK6 A;  5HUA A;  4TW7 A;  3O5O A;  4AY1 A;  5GQB A;  4DRK A;  1JNT A;  1T11 A;  5D75 A;  1OGB A;  3O5J A;  2DSV A;  4MPK A;  1ROT A;  5DIT A;  1HKI A;  1E9L A;  1JNS A;  4W9O A;  3WD4 A;  1D2K A;  4MTV A;  3LUO A;  1FFQ A;  4QZV B;  4P8U A;  4WKA A;  1FKD A;  3UF8 A;  4URI A;  3G6L A;  4TX0 A;  4WK9 A;  3TC5 A;  4MNM A;  4ODO A;  1QPF A;  1W1P A;  1ZB5 A;  4P8X A;  1ZL1 A;  5HTG A;  1E6R A;  2FKE A;  2PPN A;  2PV2 A;  3W4R A;  2DSW A;  4L72 B;  3GPK A;  2PBC A;  3IHZ A;  4XAK A;  3ARS A;  1SR0 A;  4MAV A;  2ESC A;  3ARO A;  1FKL A;  3WD0 A;  1O6I A;  3O5P A;  3RM9 A;  3MDY B;  4Z2H A;  2RUD A;  3WH0 A;  4P8W A;  2JZV A;  4WKF A;  1HKM A;  4QT3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...