5J6EA

Structure of disulfide crosslinked a. fumigatus fkbp12(v91c)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
111
structure length
111
Chain Sequence
MGVTKELKSPGNGVDFPKKGDFVTIHYTGRLTDGSKFDSSVDRNEPFQTQIGTGRVIKGWDEGVPQMSLGEKAVLTITPDYGYGARGFPPCIPGNSTLIFEVELLGINNKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 1A
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Neosartorya fumigata (strain atcc mya-4609 / af293 / cbs 101355 / fgsc a1100)
molecule tags Isomerase
total genus 27
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5j6eA00
2KGJA 4W9QA 2UZ5A 1U79A 1D6OA 2PV1A 2ZQVA 3PA7A 1ZCNA 1FKTA 2PPPA 3JYJA 2XP6A 2MLXA 3VAWA 3NRKA 2IF4A 3OOBA 4LAYA 4TW7A 1F40A 1PBKA 3KZ7A 4DRPA 5B8IC 4U86A 5I98A 4O2TA 2M08A 2LPVA 4N19A 2L2SA 1QPLA 4JFMA 1EYMA 2RSEA 1HXVA 1BKFA 4DROA 4DRHA 4DT4A 4DH0A 3UI5A 2JZVA 2LJ4A 1C9HA 1F8AB 3UQBA 1JVWA 1FKHA 3O5QA 3O5GA 4ODNA 3I6CA 1FKRA 1B6CA 4QT3A 4LAXA 2VCDA 2M1IA 2RUDA 2KE0A 2XP7A 4TNSA 1M5YA 3O5FA 4W9OA 3UF8A 4DRNA 4TX0A 4ODLA 3IKGA 3LUOA 2N87A 5HWBA 4MSPA 1FKLA 2ZQSA 4GIVA 4ODMA 4DRJA 5HW8A 4G2PA 5DITA 3IHZA 3KAFA 2FKEA 3IK8A 3RGCA 3O5LA 1TCOC 2M2AA 2RQSA 4FN2A 2OFNA 5DIVA 4C02B 1FJDA 2MLYA 2KFWA 3O5DA 2FAPA 3UQIA 2PV3A 2RUQA 1FKFA 2XPBA 4DRKA 3PRBA 2DG9A 4J4NA 1KT1A 3NTPA 4LAVA 1L1PA 2LKNA 3PRDA 1Y0OA 1Q1CA 2ZQUA 4NNRA 1FKJA 2XP9A 2ZQTA 2DG4A 1FKSA 4U85A 4DZ2A 2F21A 1FKBA 2LGOA 3IKDA 1QZ2A 1NMVA 2RUCA 2D9FA 2KO7A 4GGQA 4ITZA 2DG3A 2F4EA 4J4OA 1ROTA 4ODQA 3KABA 3KAGA 3TDBA 5HW6A 2Q5AA 3UQAA 1JNSA 1J4IA 3O5EA 2VN1A 3O5IA 1Q6HA 2XP8A 5HUAA 1A7XA 1D7JA 4R0XA 3TCZA 4TW8A 2MPHA 3B7XA 3NI6A 3EY6A 3WH0A 3KADA 4DZ3A 1J4HA 4ODPA 4ODKA 4DIPA 1Q6UA 2PPOA 3O5KA 4G50A 3KCEA 1BL4A 2KR7A 2PV2A 1D7IA 1FKDA 3ODKA 2PPNA 2ITKA 2XPAA 4JYSA 1FD9A 1QPFA 1P5QA 4DRIA 1FAPA 1D7HA 4DRQA 5BXJA 3O5JA 1J6YA 2KI3A 5D75A 2XP5A 1J4RA 1NMWA 3KAIA 3O5MA 2ZR4A 1PINA 1YW5A 2ZR6A 2XP3A 3UI6A 4JFKA 5HWCA 2PBCA 3MDYB 4MGVA 1FKKA 1ROUA 2ZR5A 2MLZA 1T11A 2MF9A 4LAWA 5GPGA 1JNTA 4ODOA 1N1AA 1YATA 4TYOA 4ODRA 1FKIA 4IQCA 3CGMA 3GPKA 4QIBA 1ZK6A 2RURA 3CGNA 3FAPA 4BF8A 4DRMA 5HTGA 3O5OA 3KAHA 4JFIA 4JFLA 1EQ3A 5HT1A 1KT0A 4FAPA 1FKGA 4IPXA 4JFJA 1Q6IA 2XP4A 2F2DA 3O5PA 4IQ2A 4QT2A 3H9RB 1R9HA 3O5RA 4W9PA 3JYMA 5DIUA 2K8IA 5HKGA 4TW6A 4U84A 3RFWA 1W26A 2AWGA 5HW7A 3UI4A 2MNTA 2Y78A 5J6EA 3JXVA 3KACA 1NSGA 3TC5A
chains in the Genus database with same CATH superfamily
2KGJA 3B9EA 2UZ5A 1U79A 4NSBA 1ZCNA 2PPPA 3CHCA 3VAWA 1NWTA 1LJYA 4DRPA 2M08A 4Z2IA 4P8XA 3WD1A 4DT4A 2WK2A 2LJ4A 1JNEA 1F8AB 4P8UA 1JVWA 2ESCA 1B6CA 4QT3A 1JNDA 1M5YA 1K9TA 3O5FA 1ZBWA 3CHEA 3LUOA 5HWBA 4MSPA 4GIVA 1D2KA 4DRJA 4G2PA 5DITA 2AOSA 3ARWA 2M2AA 4FN2A 2QF8A 3OA5A 3GU0A 2KFWA 2FAPA 3RMEA 2PV3A 1NWUA 3WD4A 2PN0A 3AROA 3NTPA 4WJXA 1Y0OA 3B9AA 1FKSA 1OWQA 3WD2A 3AQUA 1EHNA 2FDMA 4ODQA 5HW6A 1HKJA 3O5EA 2XP8A 3WIJA 4P8VA 4R0XA 1WNOA 3WH0A 4ODKA 4G50A 1EDQA 1BL4A 2DT0A 2ITKA 2XPAA 4DRIA 1LL4A 1D7HA 3PRAA 1GUVA 1F40A 1NMWA 3KAIA 2ZR4A 2ZR6A 2XP3A 4MPKA 3MDYB 4MGVA 1T11A 5HBFA 1W9UA 1JNTA 4ODOA 1YATA 4HBEA 2P4VA 1FKIA 2O9OA 1ITXA 4BF8A 4DRMA 5HTGA 1E15A 4IPXA 4JFJA 1Q6IA 1W1YA 4IQ2A 4QT2A 4ZPVR 4U84A 3RFWA 5DO2A 2AWGA 2MNTA 2Y78A 3JXVA 4TW7A 3KACA 1NSGA 4LAXA 4WKAA 3TC5A 4W9QA 2ZQVA 2PV1A 2EULA 3ARTA 4Z2GA 2XP6A 3NRKA 4LAYA 1PBKA 3ARPA 5B8IC 4U86A 1WB0A 1QPLA 2A3BA 1FFQA 2RSEA 4ZS6A 3CZ8A 3UI5A 1C9HA 1FKHA 1FKRA 3I6CA 2M1IA 1CTNA 1W1VA 1FKLA 3CH9A 2DT1A 2G8ZA 3IHZA 3RGCA 2FKEA 3IK8A 2OFNA 5DIVA 1H0GA 4DWSC 2XPBA 3PRBA 1ZU8A 2B31A 3PRDA 2ZQUA 4NNRA 2DG4A 1UR8A 2LGOA 1E6NA 3ARUA 4KR0B 2D9FA 4ITZA 2DG3A 4J4OA 4IT6A 3KABA 2DSUA 3KAGA 3UQAA 1JNSA 2VN1A 1A7XA 1SYTA 4TW8A 1ZBCA 4Z2HA 3RM4A 3EY6A 1J4HA 1XHGA 4ODPA 3QOKA 2PPOA 3O5KA 4Z2KA 2KR7A 1HKKA 1HKIA 1D7IA 3WQVA 3ODKA 4JYSA 3ARXA 4DWSB 1FD9A 1P5QA 3BMBA 1E6PA 5JH8A 1FAPA 3G6LA 2DT3A 5BXJA 1W1TA 2KI3A 5D75A 2XP5A 1J4RA 3WL1A 4LGXA 3O5MA 4MNLA 4JFKA 2PBCA 1LQ0A 2ZR5A 4IT4A 1E6ZA 4LAWA 5GPGA 1N1AA 3CHFA 4NZCA 3FAPA 1E6RA 4JFIA 5DF0A 3RM8A 4FAPA 1LL6A 4W9PA 3JYMA 4WKFA 1E44A 1IX5A 1O6IA 2OLHA 4MNKA 3UI6A 1FKTA 2WLYA 3GTYX 3ARSA 1W1PA 3BXWA 5GQBA 2IF4A 3KZ7A 5I98A 4O2TA 2L2SA 3FXYA 1EYMA 3ALFA 4DROA 4KQZA 4MNJA 1ZB5A 3UQBA 3O5QA 4ODNA 2RUDA 2XP7A 3UF8A 4TX0A 4ODLA 3IKGA 4ODMA 1X6NA 4AY1A 4DWSA 4S3JA 1KFWA 1FJDA 1FKFA 1ZBKA 4DRKA 2DG9A 4Z2LA 2IUZA 3G6MA 2LKNA 1X6LA 2WLZA 4DZ2A 1FKBA 1QZ2A 1FFRA 1NMVA 1JCHB 2DSVA 2DT2A 1ROTA 1H0IA 4DWSD 2WM0A 3O5IA 4W5UA 1D7JA 1HKMA 2YBUA 3NI6A 1GPFA 4DZ3A 1NWRA 4DIPA 3KCEA 2PV2A 1RD6A 1UR9A 3B9DA 4HBOA 1QPFA 1VF8A 2B5UB 3WQWA 1FKKA 1ROUA 4R5EA 1HJWA 4TYOA 4IQCA 2ETNA 2F23A 4QIBA 3O5OA 1XRVA 1E9LA 3KAHA 3ARRA 4JFLA 5HT1A 1TFVA 4L3NA 1FKGA 4HARA 3CHDA 4XAKA 3B8SA 2A3CA 2K8IA 4TW6A 3W4RA 3ARVA 1LL7A 1EIBA 1HJVA 4WKHA 1D6OA 3PA7A 2A3EA 3JYJA 2PI6A 2MLXA 3AS0A 3OOBA 1LG2A 4ZPWR 2LPVA 4N19A 4JFMA 3ARYA 2DPEA 1W9PA 1HXVA 1BKFA 4DRHA 4S3KA 4DH0A 2JZVA 4Q7NA 3O5GA 3WL0A 3PR9A 2VCDA 4W9OA 2KE0A 1LG1A 4QZVB 4TNSA 4DRNA 2G41A 3FY1A 2N87A 1W9VA 2ZQSA 5HW8A 4L72B 3KAFA 3ARQA 1TCOC 3O5LA 2RQSA 4C02B 2MLYA 3O5DA 3UQIA 2RUQA 1NWSA 2O92A 5GPRA 3WD3A 4URIA 4J4NA 1KT1A 4P8WA 4LAVA 1L1PA 1ZL1A 1Q1CA 3AS3A 1FKJA 2XP9A 2ZQTA 4U85A 1OGBA 2F21A 3IKDA 2RUCA 2KO7A 4GGQA 1WAWA 2F4EA 3ALGA 3TDBA 2Q5AA 1J4IA 1NH6A 2DSZA 4Q22A 3WD0A 1Q6HA 5HUAA 5DEZA 3TCZA 2MPHA 3B7XA 3KADA 1Q6UA 1FKDA 2PPNA 3EIPA 2A3AA 4ZPTR 4DRQA 3O5JA 1J6YA 1OGGA 4Z2JA 4UDMA 4MNMA 1PINA 1YW5A 3ARZA 5HWCA 3RM9A 4WIWA 2MLZA 2MF9A 4MTVA 3AS1A 1SR0A 4ODRA 3CGMA 3GPKA 1HJXA 3WKZA 1ZK6A 2RURA 3CGNA 4MAVA 4WK9A 2DSWA 2YBTA 1EQ3A 1KT0A 4PTMA 2XP4A 2F2DA 3O5PA 3H9RB 1R9HA 3O5RA 5DIUA 5HKGA 1ZBVA 1GOIA 1W26A 5HW7A 3UI4A 5J6EA 1GRJA 3AS2A 4ML4A
chains in the Genus database with same CATH topology
2KGJA 3B9EA 2UZ5A 1U79A 4NSBA 1ZCNA 2PPPA 3CHCA 3VAWA 1NWTA 1LJYA 4DRPA 2M08A 4Z2IA 4P8XA 3WD1A 4DT4A 2WK2A 2LJ4A 1JNEA 1F8AB 4P8UA 1JVWA 2ESCA 1B6CA 4QT3A 1JNDA 1M5YA 1K9TA 3O5FA 1ZBWA 3CHEA 3LUOA 5HWBA 4MSPA 4GIVA 1D2KA 4DRJA 4G2PA 5DITA 2AOSA 3ARWA 2M2AA 4FN2A 2QF8A 3OA5A 2KFWA 2FAPA 3RMEA 2PV3A 1NWUA 3WD4A 3AROA 3NTPA 4WJXA 1Y0OA 3B9AA 1FKSA 1OWQA 3WD2A 3AQUA 1EHNA 2FDMA 4ODQA 5HW6A 1HKJA 3O5EA 2XP8A 3WIJA 4P8VA 4R0XA 1WNOA 3WH0A 4ODKA 4G50A 1EDQA 1BL4A 2DT0A 2ITKA 2XPAA 4DRIA 1LL4A 1D7HA 3PRAA 1GUVA 1F40A 1NMWA 3KAIA 2ZR4A 2ZR6A 2XP3A 4MPKA 3MDYB 4MGVA 1T11A 5HBFA 1W9UA 1JNTA 4ODOA 1YATA 4HBEA 1FKIA 2O9OA 1ITXA 4BF8A 4DRMA 5HTGA 1E15A 4IPXA 4JFJA 1Q6IA 1W1YA 4IQ2A 4QT2A 4ZPVR 4U84A 3RFWA 5DO2A 2AWGA 2MNTA 2Y78A 3JXVA 4TW7A 3KACA 1NSGA 4LAXA 4WKAA 3TC5A 4W9QA 2ZQVA 2PV1A 3ARTA 4Z2GA 2XP6A 3NRKA 4LAYA 1PBKA 3ARPA 5B8IC 4U86A 1WB0A 1QPLA 2A3BA 1FFQA 2RSEA 4ZS6A 3CZ8A 3UI5A 1C9HA 1FKHA 1FKRA 3I6CA 2M1IA 1CTNA 1W1VA 1FKLA 3CH9A 2DT1A 2G8ZA 3IHZA 3RGCA 2FKEA 3IK8A 2OFNA 5DIVA 1H0GA 4DWSC 2XPBA 3PRBA 1ZU8A 2B31A 3PRDA 2ZQUA 4NNRA 2DG4A 1UR8A 2LGOA 1E6NA 3ARUA 4KR0B 2D9FA 4ITZA 2DG3A 4J4OA 4IT6A 3KABA 2DSUA 3KAGA 3UQAA 1JNSA 2VN1A 1A7XA 1SYTA 4TW8A 1ZBCA 4Z2HA 3RM4A 3EY6A 1J4HA 1XHGA 4ODPA 3QOKA 2PPOA 3O5KA 4Z2KA 2KR7A 1HKKA 1HKIA 1D7IA 3WQVA 3ODKA 4JYSA 3ARXA 4DWSB 1FD9A 1P5QA 1E6PA 5JH8A 1FAPA 3G6LA 2DT3A 5BXJA 1W1TA 2KI3A 5D75A 2XP5A 1J4RA 3WL1A 4LGXA 3O5MA 4MNLA 4JFKA 2PBCA 1LQ0A 2ZR5A 4IT4A 1E6ZA 4LAWA 5GPGA 1N1AA 3CHFA 4NZCA 3FAPA 1E6RA 4JFIA 5DF0A 3RM8A 4FAPA 1LL6A 4W9PA 3JYMA 4WKFA 1IX5A 1O6IA 2OLHA 4MNKA 3UI6A 1FKTA 2WLYA 3ARSA 1W1PA 3BXWA 5GQBA 2IF4A 3KZ7A 5I98A 4O2TA 2L2SA 3FXYA 1EYMA 3ALFA 4DROA 4KQZA 4MNJA 1ZB5A 3UQBA 3O5QA 4ODNA 2RUDA 2XP7A 3UF8A 4TX0A 4ODLA 3IKGA 4ODMA 1X6NA 4AY1A 4DWSA 4S3JA 1KFWA 1FJDA 1FKFA 1ZBKA 4DRKA 2DG9A 4Z2LA 2IUZA 3G6MA 2LKNA 1X6LA 2WLZA 4DZ2A 1FKBA 1QZ2A 1FFRA 1NMVA 2DSVA 2DT2A 1ROTA 1H0IA 4DWSD 2WM0A 3O5IA 4W5UA 1D7JA 1HKMA 2YBUA 3NI6A 1GPFA 4DZ3A 1NWRA 4DIPA 3KCEA 2PV2A 1RD6A 1UR9A 3B9DA 4HBOA 1QPFA 1VF8A 3WQWA 1FKKA 1ROUA 4R5EA 1HJWA 4TYOA 4IQCA 4QIBA 3O5OA 1XRVA 1E9LA 3KAHA 3ARRA 4JFLA 5HT1A 1TFVA 4L3NA 1FKGA 4HARA 3CHDA 4XAKA 3B8SA 2A3CA 2K8IA 4TW6A 3W4RA 3ARVA 1LL7A 1EIBA 1HJVA 4WKHA 1D6OA 3PA7A 2A3EA 3JYJA 2PI6A 2MLXA 3AS0A 3OOBA 1LG2A 4ZPWR 2LPVA 4N19A 4JFMA 3ARYA 2DPEA 1W9PA 1HXVA 1BKFA 4DRHA 4S3KA 4DH0A 2JZVA 4Q7NA 3O5GA 3WL0A 3PR9A 2VCDA 4W9OA 2KE0A 1LG1A 4QZVB 4TNSA 4DRNA 2G41A 3FY1A 2N87A 1W9VA 2ZQSA 5HW8A 4L72B 3KAFA 3ARQA 1TCOC 3O5LA 2RQSA 4C02B 2MLYA 3O5DA 3UQIA 2RUQA 1NWSA 2O92A 5GPRA 3WD3A 4URIA 4J4NA 1KT1A 4P8WA 4LAVA 1L1PA 1ZL1A 1Q1CA 3AS3A 1FKJA 2XP9A 2ZQTA 4U85A 1OGBA 2F21A 3IKDA 2RUCA 2KO7A 4GGQA 1WAWA 2F4EA 3ALGA 3TDBA 2Q5AA 1J4IA 1NH6A 2DSZA 4Q22A 3WD0A 1Q6HA 5HUAA 5DEZA 3TCZA 2MPHA 3B7XA 3KADA 1Q6UA 1FKDA 2PPNA 2A3AA 4ZPTR 4DRQA 3O5JA 1J6YA 1OGGA 4Z2JA 4MNMA 1PINA 1YW5A 3ARZA 5HWCA 3RM9A 4WIWA 2MLZA 2MF9A 4MTVA 3AS1A 1SR0A 4ODRA 3CGMA 1HJXA 3GPKA 3WKZA 1ZK6A 2RURA 3CGNA 4MAVA 4WK9A 2DSWA 2YBTA 1EQ3A 1KT0A 4PTMA 2XP4A 2F2DA 3O5PA 3H9RB 1R9HA 3O5RA 5DIUA 5HKGA 1ZBVA 1GOIA 1W26A 5HW7A 3UI4A 5J6EA 3AS2A 4ML4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGJ A;  4W9Q A;  2UZ5 A;  1U79 A;  1D6O A;  2PV1 A;  2ZQV A;  3PA7 A;  1ZCN A;  1FKT A;  2PPP A;  3JYJ A;  2XP6 A;  2MLX A;  3VAW A;  3NRK A;  2IF4 A;  3OOB A;  4LAY A;  4TW7 A;  1F40 A;  1PBK A;  3KZ7 A;  4DRP A;  5B8I C;  4U86 A;  5I98 A;  4O2T A;  2M08 A;  2LPV A;  4N19 A;  2L2S A;  1QPL A;  4JFM A;  1EYM A;  2RSE A;  1HXV A;  1BKF A;  4DRO A;  4DRH A;  4DT4 A;  4DH0 A;  3UI5 A;  2JZV A;  2LJ4 A;  1C9H A;  1F8A B;  3UQB A;  1JVW A;  1FKH A;  3O5Q A;  3O5G A;  4ODN A;  3I6C A;  1FKR A;  1B6C A;  4QT3 A;  4LAX A;  2VCD A;  2M1I A;  2RUD A;  2KE0 A;  2XP7 A;  4TNS A;  1M5Y A;  3O5F A;  4W9O A;  3UF8 A;  4DRN A;  4TX0 A;  4ODL A;  3IKG A;  3LUO A;  2N87 A;  5HWB A;  4MSP A;  1FKL A;  2ZQS A;  4GIV A;  4ODM A;  4DRJ A;  5HW8 A;  4G2P A;  5DIT A;  3IHZ A;  3KAF A;  2FKE A;  3IK8 A;  3RGC A;  3O5L A;  1TCO C;  2M2A A;  2RQS A;  4FN2 A;  2OFN A;  5DIV A;  4C02 B;  1FJD A;  2MLY A;  2KFW A;  3O5D A;  2FAP A;  3UQI A;  2PV3 A;  2RUQ A;  1FKF A;  2XPB A;  4DRK A;  3PRB A;  2DG9 A;  4J4N A;  1KT1 A;  3NTP A;  4LAV A;  1L1P A;  2LKN A;  3PRD A;  1Y0O A;  1Q1C A;  2ZQU A;  4NNR A;  1FKJ A;  2XP9 A;  2ZQT A;  2DG4 A;  1FKS A;  4U85 A;  4DZ2 A;  2F21 A;  1FKB A;  2LGO A;  3IKD A;  1QZ2 A;  1NMV A;  2RUC A;  2D9F A;  2KO7 A;  4GGQ A;  4ITZ A;  2DG3 A;  2F4E A;  4J4O A;  1ROT A;  4ODQ A;  3KAB A;  3KAG A;  3TDB A;  5HW6 A;  2Q5A A;  3UQA A;  1JNS A;  1J4I A;  3O5E A;  2VN1 A;  3O5I A;  1Q6H A;  2XP8 A;  5HUA A;  1A7X A;  1D7J A;  4R0X A;  3TCZ A;  4TW8 A;  2MPH A;  3B7X A;  3NI6 A;  3EY6 A;  3WH0 A;  3KAD A;  4DZ3 A;  1J4H A;  4ODP A;  4ODK A;  4DIP A;  1Q6U A;  2PPO A;  3O5K A;  4G50 A;  3KCE A;  1BL4 A;  2KR7 A;  2PV2 A;  1D7I A;  1FKD A;  3ODK A;  2PPN A;  2ITK A;  2XPA A;  4JYS A;  1FD9 A;  1QPF A;  1P5Q A;  4DRI A;  1FAP A;  1D7H A;  4DRQ A;  5BXJ A;  3O5J A;  1J6Y A;  2KI3 A;  5D75 A;  2XP5 A;  1J4R A;  1NMW A;  3KAI A;  3O5M A;  2ZR4 A;  1PIN A;  1YW5 A;  2ZR6 A;  2XP3 A;  3UI6 A;  4JFK A;  5HWC A;  2PBC A;  3MDY B;  4MGV A;  1FKK A;  1ROU A;  2ZR5 A;  2MLZ A;  1T11 A;  2MF9 A;  4LAW A;  5GPG A;  1JNT A;  4ODO A;  1N1A A;  1YAT A;  4TYO A;  4ODR A;  1FKI A;  4IQC A;  3CGM A;  3GPK A;  4QIB A;  1ZK6 A;  2RUR A;  3CGN A;  3FAP A;  4BF8 A;  4DRM A;  5HTG A;  3O5O A;  3KAH A;  4JFI A;  4JFL A;  1EQ3 A;  5HT1 A;  1KT0 A;  4FAP A;  1FKG A;  4IPX A;  4JFJ A;  1Q6I A;  2XP4 A;  2F2D A;  3O5P A;  4IQ2 A;  4QT2 A;  3H9R B;  1R9H A;  3O5R A;  4W9P A;  3JYM A;  5DIU A;  2K8I A;  5HKG A;  4TW6 A;  4U84 A;  3RFW A;  1W26 A;  2AWG A;  5HW7 A;  3UI4 A;  2MNT A;  2Y78 A;  5J6E A;  3JXV A;  3KAC A;  1NSG A;  3TC5 A; 
#chains in the Genus database with same CATH topology
 2KGJ A;  3B9E A;  2UZ5 A;  1U79 A;  4NSB A;  1ZCN A;  2PPP A;  3CHC A;  3VAW A;  1NWT A;  1LJY A;  4DRP A;  2M08 A;  4Z2I A;  4P8X A;  3WD1 A;  4DT4 A;  2WK2 A;  2LJ4 A;  1JNE A;  1F8A B;  4P8U A;  1JVW A;  2ESC A;  1B6C A;  4QT3 A;  1JND A;  1M5Y A;  1K9T A;  3O5F A;  1ZBW A;  3CHE A;  3LUO A;  5HWB A;  4MSP A;  4GIV A;  1D2K A;  4DRJ A;  4G2P A;  5DIT A;  2AOS A;  3ARW A;  2M2A A;  4FN2 A;  2QF8 A;  3OA5 A;  3GU0 A;  2KFW A;  2FAP A;  3RME A;  2PV3 A;  1NWU A;  3WD4 A;  2PN0 A;  3ARO A;  3NTP A;  4WJX A;  1Y0O A;  3B9A A;  1FKS A;  1OWQ A;  3WD2 A;  3AQU A;  1EHN A;  2FDM A;  4ODQ A;  5HW6 A;  1HKJ A;  3O5E A;  2XP8 A;  3WIJ A;  4P8V A;  4R0X A;  1WNO A;  3WH0 A;  4ODK A;  4G50 A;  1EDQ A;  1BL4 A;  2DT0 A;  2ITK A;  2XPA A;  4DRI A;  1LL4 A;  1D7H A;  3PRA A;  1GUV A;  1F40 A;  1NMW A;  3KAI A;  2ZR4 A;  2ZR6 A;  2XP3 A;  4MPK A;  3MDY B;  4MGV A;  1T11 A;  5HBF A;  1W9U A;  1JNT A;  4ODO A;  1YAT A;  4HBE A;  2P4V A;  1FKI A;  2O9O A;  1ITX A;  4BF8 A;  4DRM A;  5HTG A;  1E15 A;  4IPX A;  4JFJ A;  1Q6I A;  1W1Y A;  4IQ2 A;  4QT2 A;  4ZPV R;  4U84 A;  3RFW A;  5DO2 A;  2AWG A;  2MNT A;  2Y78 A;  3JXV A;  4TW7 A;  3KAC A;  1NSG A;  4LAX A;  4WKA A;  3TC5 A;  4W9Q A;  2ZQV A;  2PV1 A;  2EUL A;  3ART A;  4Z2G A;  2XP6 A;  3NRK A;  4LAY A;  1PBK A;  3ARP A;  5B8I C;  4U86 A;  1WB0 A;  1QPL A;  2A3B A;  1FFQ A;  2RSE A;  4ZS6 A;  3CZ8 A;  3UI5 A;  1C9H A;  1FKH A;  1FKR A;  3I6C A;  2M1I A;  1CTN A;  1W1V A;  1FKL A;  3CH9 A;  2DT1 A;  2G8Z A;  3IHZ A;  3RGC A;  2FKE A;  3IK8 A;  2OFN A;  5DIV A;  1H0G A;  4DWS C;  2XPB A;  3PRB A;  1ZU8 A;  2B31 A;  3PRD A;  2ZQU A;  4NNR A;  2DG4 A;  1UR8 A;  2LGO A;  1E6N A;  3ARU A;  4KR0 B;  2D9F A;  4ITZ A;  2DG3 A;  4J4O A;  4IT6 A;  3KAB A;  2DSU A;  3KAG A;  3UQA A;  1JNS A;  2VN1 A;  1A7X A;  1SYT A;  4TW8 A;  1ZBC A;  4Z2H A;  3RM4 A;  3EY6 A;  1J4H A;  1XHG A;  4ODP A;  3QOK A;  2PPO A;  3O5K A;  4Z2K A;  2KR7 A;  1HKK A;  1HKI A;  1D7I A;  3WQV A;  3ODK A;  4JYS A;  3ARX A;  4DWS B;  1FD9 A;  1P5Q A;  3BMB A;  1E6P A;  5JH8 A;  1FAP A;  3G6L A;  2DT3 A;  5BXJ A;  1W1T A;  2KI3 A;  5D75 A;  2XP5 A;  1J4R A;  3WL1 A;  4LGX A;  3O5M A;  4MNL A;  4JFK A;  2PBC A;  1LQ0 A;  2ZR5 A;  4IT4 A;  1E6Z A;  4LAW A;  5GPG A;  1N1A A;  3CHF A;  4NZC A;  3FAP A;  1E6R A;  4JFI A;  5DF0 A;  3RM8 A;  4FAP A;  1LL6 A;  4W9P A;  3JYM A;  4WKF A;  1E44 A;  1IX5 A;  1O6I A;  2OLH A;  4MNK A;  3UI6 A;  1FKT A;  2WLY A;  3GTY X;  3ARS A;  1W1P A;  3BXW A;  5GQB A;  2IF4 A;  3KZ7 A;  5I98 A;  4O2T A;  2L2S A;  3FXY A;  1EYM A;  3ALF A;  4DRO A;  4KQZ A;  4MNJ A;  1ZB5 A;  3UQB A;  3O5Q A;  4ODN A;  2RUD A;  2XP7 A;  3UF8 A;  4TX0 A;  4ODL A;  3IKG A;  4ODM A;  1X6N A;  4AY1 A;  4DWS A;  4S3J A;  1KFW A;  1FJD A;  1FKF A;  1ZBK A;  4DRK A;  2DG9 A;  4Z2L A;  2IUZ A;  3G6M A;  2LKN A;  1X6L A;  2WLZ A;  4DZ2 A;  1FKB A;  1QZ2 A;  1FFR A;  1NMV A;  1JCH B;  2DSV A;  2DT2 A;  1ROT A;  1H0I A;  4DWS D;  2WM0 A;  3O5I A;  4W5U A;  1D7J A;  1HKM A;  2YBU A;  3NI6 A;  1GPF A;  4DZ3 A;  1NWR A;  4DIP A;  3KCE A;  2PV2 A;  1RD6 A;  1UR9 A;  3B9D A;  4HBO A;  1QPF A;  1VF8 A;  2B5U B;  3WQW A;  1FKK A;  1ROU A;  4R5E A;  1HJW A;  4TYO A;  4IQC A;  2ETN A;  2F23 A;  4QIB A;  3O5O A;  1XRV A;  1E9L A;  3KAH A;  3ARR A;  4JFL A;  5HT1 A;  1TFV A;  4L3N A;  1FKG A;  4HAR A;  3CHD A;  4XAK A;  3B8S A;  2A3C A;  2K8I A;  4TW6 A;  3W4R A;  3ARV A;  1LL7 A;  1EIB A;  1HJV A;  4WKH A;  1D6O A;  3PA7 A;  2A3E A;  3JYJ A;  2PI6 A;  2MLX A;  3AS0 A;  3OOB A;  1LG2 A;  4ZPW R;  2LPV A;  4N19 A;  4JFM A;  3ARY A;  2DPE A;  1W9P A;  1HXV A;  1BKF A;  4DRH A;  4S3K A;  4DH0 A;  2JZV A;  4Q7N A;  3O5G A;  3WL0 A;  3PR9 A;  2VCD A;  4W9O A;  2KE0 A;  1LG1 A;  4QZV B;  4TNS A;  4DRN A;  2G41 A;  3FY1 A;  2N87 A;  1W9V A;  2ZQS A;  5HW8 A;  4L72 B;  3KAF A;  3ARQ A;  1TCO C;  3O5L A;  2RQS A;  4C02 B;  2MLY A;  3O5D A;  3UQI A;  2RUQ A;  1NWS A;  2O92 A;  5GPR A;  3WD3 A;  4URI A;  4J4N A;  1KT1 A;  4P8W A;  4LAV A;  1L1P A;  1ZL1 A;  1Q1C A;  3AS3 A;  1FKJ A;  2XP9 A;  2ZQT A;  4U85 A;  1OGB A;  2F21 A;  3IKD A;  2RUC A;  2KO7 A;  4GGQ A;  1WAW A;  2F4E A;  3ALG A;  3TDB A;  2Q5A A;  1J4I A;  1NH6 A;  2DSZ A;  4Q22 A;  3WD0 A;  1Q6H A;  5HUA A;  5DEZ A;  3TCZ A;  2MPH A;  3B7X A;  3KAD A;  1Q6U A;  1FKD A;  2PPN A;  3EIP A;  2A3A A;  4ZPT R;  4DRQ A;  3O5J A;  1J6Y A;  1OGG A;  4Z2J A;  4UDM A;  4MNM A;  1PIN A;  1YW5 A;  3ARZ A;  5HWC A;  3RM9 A;  4WIW A;  2MLZ A;  2MF9 A;  4MTV A;  3AS1 A;  1SR0 A;  4ODR A;  3CGM A;  3GPK A;  1HJX A;  3WKZ A;  1ZK6 A;  2RUR A;  3CGN A;  4MAV A;  4WK9 A;  2DSW A;  2YBT A;  1EQ3 A;  1KT0 A;  4PTM A;  2XP4 A;  2F2D A;  3O5P A;  3H9R B;  1R9H A;  3O5R A;  5DIU A;  5HKG A;  1ZBV A;  1GOI A;  1W26 A;  5HW7 A;  3UI4 A;  5J6E A;  1GRJ A;  3AS2 A;  4ML4 A; 
#chains in the Genus database with same CATH homology
 2KGJ A;  3B9E A;  2UZ5 A;  1U79 A;  4NSB A;  1ZCN A;  2PPP A;  3CHC A;  3VAW A;  1NWT A;  1LJY A;  4DRP A;  2M08 A;  4Z2I A;  4P8X A;  3WD1 A;  4DT4 A;  2WK2 A;  2LJ4 A;  1JNE A;  1F8A B;  4P8U A;  1JVW A;  2ESC A;  1B6C A;  4QT3 A;  1JND A;  1M5Y A;  1K9T A;  3O5F A;  1ZBW A;  3CHE A;  3LUO A;  5HWB A;  4MSP A;  4GIV A;  1D2K A;  4DRJ A;  4G2P A;  5DIT A;  2AOS A;  3ARW A;  2M2A A;  4FN2 A;  2QF8 A;  3OA5 A;  2KFW A;  2FAP A;  3RME A;  2PV3 A;  1NWU A;  3WD4 A;  3ARO A;  3NTP A;  4WJX A;  1Y0O A;  3B9A A;  1FKS A;  1OWQ A;  3WD2 A;  3AQU A;  1EHN A;  2FDM A;  4ODQ A;  5HW6 A;  1HKJ A;  3O5E A;  2XP8 A;  3WIJ A;  4P8V A;  4R0X A;  1WNO A;  3WH0 A;  4ODK A;  4G50 A;  1EDQ A;  1BL4 A;  2DT0 A;  2ITK A;  2XPA A;  4DRI A;  1LL4 A;  1D7H A;  3PRA A;  1GUV A;  1F40 A;  1NMW A;  3KAI A;  2ZR4 A;  2ZR6 A;  2XP3 A;  4MPK A;  3MDY B;  4MGV A;  1T11 A;  5HBF A;  1W9U A;  1JNT A;  4ODO A;  1YAT A;  4HBE A;  1FKI A;  2O9O A;  1ITX A;  4BF8 A;  4DRM A;  5HTG A;  1E15 A;  4IPX A;  4JFJ A;  1Q6I A;  1W1Y A;  4IQ2 A;  4QT2 A;  4ZPV R;  4U84 A;  3RFW A;  5DO2 A;  2AWG A;  2MNT A;  2Y78 A;  3JXV A;  4TW7 A;  3KAC A;  1NSG A;  4LAX A;  4WKA A;  3TC5 A;  4W9Q A;  2ZQV A;  2PV1 A;  3ART A;  4Z2G A;  2XP6 A;  3NRK A;  4LAY A;  1PBK A;  3ARP A;  5B8I C;  4U86 A;  1WB0 A;  1QPL A;  2A3B A;  1FFQ A;  2RSE A;  4ZS6 A;  3CZ8 A;  3UI5 A;  1C9H A;  1FKH A;  1FKR A;  3I6C A;  2M1I A;  1CTN A;  1W1V A;  1FKL A;  3CH9 A;  2DT1 A;  2G8Z A;  3IHZ A;  3RGC A;  2FKE A;  3IK8 A;  2OFN A;  5DIV A;  1H0G A;  4DWS C;  2XPB A;  3PRB A;  1ZU8 A;  2B31 A;  3PRD A;  2ZQU A;  4NNR A;  2DG4 A;  1UR8 A;  2LGO A;  1E6N A;  3ARU A;  4KR0 B;  2D9F A;  4ITZ A;  2DG3 A;  4J4O A;  4IT6 A;  3KAB A;  2DSU A;  3KAG A;  3UQA A;  1JNS A;  2VN1 A;  1A7X A;  1SYT A;  4TW8 A;  1ZBC A;  4Z2H A;  3RM4 A;  3EY6 A;  1J4H A;  1XHG A;  4ODP A;  3QOK A;  2PPO A;  3O5K A;  4Z2K A;  2KR7 A;  1HKK A;  1HKI A;  1D7I A;  3WQV A;  3ODK A;  4JYS A;  3ARX A;  4DWS B;  1FD9 A;  1P5Q A;  1E6P A;  5JH8 A;  1FAP A;  3G6L A;  2DT3 A;  5BXJ A;  1W1T A;  2KI3 A;  5D75 A;  2XP5 A;  1J4R A;  3WL1 A;  4LGX A;  3O5M A;  4MNL A;  4JFK A;  2PBC A;  1LQ0 A;  2ZR5 A;  4IT4 A;  1E6Z A;  4LAW A;  5GPG A;  1N1A A;  3CHF A;  4NZC A;  3FAP A;  1E6R A;  4JFI A;  5DF0 A;  3RM8 A;  4FAP A;  1LL6 A;  4W9P A;  3JYM A;  4WKF A;  1IX5 A;  1O6I A;  2OLH A;  4MNK A;  3UI6 A;  1FKT A;  2WLY A;  3ARS A;  1W1P A;  3BXW A;  5GQB A;  2IF4 A;  3KZ7 A;  5I98 A;  4O2T A;  2L2S A;  3FXY A;  1EYM A;  3ALF A;  4DRO A;  4KQZ A;  4MNJ A;  1ZB5 A;  3UQB A;  3O5Q A;  4ODN A;  2RUD A;  2XP7 A;  3UF8 A;  4TX0 A;  4ODL A;  3IKG A;  4ODM A;  1X6N A;  4AY1 A;  4DWS A;  4S3J A;  1KFW A;  1FJD A;  1FKF A;  1ZBK A;  4DRK A;  2DG9 A;  4Z2L A;  2IUZ A;  3G6M A;  2LKN A;  1X6L A;  2WLZ A;  4DZ2 A;  1FKB A;  1QZ2 A;  1FFR A;  1NMV A;  2DSV A;  2DT2 A;  1ROT A;  1H0I A;  4DWS D;  2WM0 A;  3O5I A;  4W5U A;  1D7J A;  1HKM A;  2YBU A;  3NI6 A;  1GPF A;  4DZ3 A;  1NWR A;  4DIP A;  3KCE A;  2PV2 A;  1RD6 A;  1UR9 A;  3B9D A;  4HBO A;  1QPF A;  1VF8 A;  3WQW A;  1FKK A;  1ROU A;  4R5E A;  1HJW A;  4TYO A;  4IQC A;  4QIB A;  3O5O A;  1XRV A;  1E9L A;  3KAH A;  3ARR A;  4JFL A;  5HT1 A;  1TFV A;  4L3N A;  1FKG A;  4HAR A;  3CHD A;  4XAK A;  3B8S A;  2A3C A;  2K8I A;  4TW6 A;  3W4R A;  3ARV A;  1LL7 A;  1EIB A;  1HJV A;  4WKH A;  1D6O A;  3PA7 A;  2A3E A;  3JYJ A;  2PI6 A;  2MLX A;  3AS0 A;  3OOB A;  1LG2 A;  4ZPW R;  2LPV A;  4N19 A;  4JFM A;  3ARY A;  2DPE A;  1W9P A;  1HXV A;  1BKF A;  4DRH A;  4S3K A;  4DH0 A;  2JZV A;  4Q7N A;  3O5G A;  3WL0 A;  3PR9 A;  2VCD A;  4W9O A;  2KE0 A;  1LG1 A;  4QZV B;  4TNS A;  4DRN A;  2G41 A;  3FY1 A;  2N87 A;  1W9V A;  2ZQS A;  5HW8 A;  4L72 B;  3KAF A;  3ARQ A;  1TCO C;  3O5L A;  2RQS A;  4C02 B;  2MLY A;  3O5D A;  3UQI A;  2RUQ A;  1NWS A;  2O92 A;  5GPR A;  3WD3 A;  4URI A;  4J4N A;  1KT1 A;  4P8W A;  4LAV A;  1L1P A;  1ZL1 A;  1Q1C A;  3AS3 A;  1FKJ A;  2XP9 A;  2ZQT A;  4U85 A;  1OGB A;  2F21 A;  3IKD A;  2RUC A;  2KO7 A;  4GGQ A;  1WAW A;  2F4E A;  3ALG A;  3TDB A;  2Q5A A;  1J4I A;  1NH6 A;  2DSZ A;  4Q22 A;  3WD0 A;  1Q6H A;  5HUA A;  5DEZ A;  3TCZ A;  2MPH A;  3B7X A;  3KAD A;  1Q6U A;  1FKD A;  2PPN A;  2A3A A;  4ZPT R;  4DRQ A;  3O5J A;  1J6Y A;  1OGG A;  4Z2J A;  4MNM A;  1PIN A;  1YW5 A;  3ARZ A;  5HWC A;  3RM9 A;  4WIW A;  2MLZ A;  2MF9 A;  4MTV A;  3AS1 A;  1SR0 A;  4ODR A;  3CGM A;  1HJX A;  3GPK A;  3WKZ A;  1ZK6 A;  2RUR A;  3CGN A;  4MAV A;  4WK9 A;  2DSW A;  2YBT A;  1EQ3 A;  1KT0 A;  4PTM A;  2XP4 A;  2F2D A;  3O5P A;  3H9R B;  1R9H A;  3O5R A;  5DIU A;  5HKG A;  1ZBV A;  1GOI A;  1W26 A;  5HW7 A;  3UI4 A;  5J6E A;  3AS2 A;  4ML4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...