5J6EA

Structure of disulfide crosslinked a. fumigatus fkbp12(v91c)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
111
structure length
111
Chain Sequence
b'MGVTKELKSPGNGVDFPKKGDFVTIHYTGRLTDGSKFDSSVDRNEPFQTQIGTGRVIKGWDEGVPQMSLGEKAVLTITPDYGYGARGFPPCIPGNSTLIFEVELLGINNKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 1A
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Neosartorya fumigata (strain atcc mya-4609 / af293 / cbs 101355 / fgsc a1100)
molecule tags Isomerase
total genus 27
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5j6eA00
2XP4A 3KADA 3PRDA 4W9PA 1KT1A 3KACA 3KZ7A 2D9FA 3IKDA 1A7XA 1JVWA 3LUOA 1QZ2A 1FAPA 2KR7A 1D6OA 2XP7A 3I6CA 4G2PA 1D7IA 4MGVA 3TCZA 4DRHA 1FKGA 2F4EA 3H9RB 4QT3A 4DRKA 3KABA 1EYMA 3O5RA 3UI5A 2ITKA 4QT2A 4ODQA 2PV3A 2RURA 1ZCNA 2ZR6A 4DZ2A 2Q5AA 4J4OA 5HUAA 2PPOA 3O5JA 1J4RA 5D75A 1FKIA 1ZK6A 3O5OA 4QIBA 1PINA 5HKGA 5GPGA 4DH0A 4LAXA 2MLXA 4TYOA 4W9OA 1R9HA 4ODLA 1Q6UA 4TX0A 5DIVA 5B8IC 1NSGA 3KCEA 1Y0OA 4JFJA 2M1IA 4J4NA 2DG9A 5DIUA 5HW7A 3NI6A 4NNRA 5HWBA 4IQCA 4DROA 1QPFA 3UI6A 3JYJA 2M2AA 2ZQVA 4G50A 2MNTA 4R0XA 1J4HA 2FAPA 3O5IA 4GGQA 4U86A 1FKTA 1FKSA 1J4IA 2N87A 2ZQSA 4BF8A 5HW8A 2M08A 2PPNA 4DT4A 4DRQA 2PV2A 3WH0A 1D7JA 1KT0A 4ODKA 2K8IA 2RUQA 2L2SA 2XP5A 2VCDA 2RQSA 3FAPA 1FKHA 1FD9A 2XP9A 3VAWA 2XPAA 3O5PA 4JFIA 4DRNA 5HTGA 2ZR4A 3KAIA 1F8AB 2JZVA 2LPVA 1PBKA 4ODMA 3O5MA 4JFMA 4ODPA 3UQAA 3O5GA 4JFKA 2F2DA 1U79A 1FKLA 1C9HA 1EQ3A 2FKEA 4ODNA 1FKFA 2PV1A 3EY6A 4IPXA 2XP8A 2MLYA 5HW6A 1NMVA 4JFLA 1QPLA 3TDBA 3NTPA 4MSPA 3MDYB 1N1AA 4N19A 3PA7A 4U84A 5I98A 3CGNA 4DIPA 3IK8A 1F40A 1FKBA 3GPKA 3ODKA 3CGMA 5HT1A 2LJ4A 3IKGA 3UF8A 1NMWA 2XP6A 2ZQTA 2ZQUA 2MPHA 4ODOA 4TW7A 2LGOA 4W9QA 1P5QA 1Q6IA 1FJDA 3O5QA 2KFWA 4JYSA 4DRIA 2KE0A 1YATA 3PRBA 4C02B 2KI3A 1Q1CA 3UQIA 3IHZA 2OFNA 3KAHA 4TW8A 3UQBA 4DRMA 1HXVA 1FKKA 1FKJA 4DZ3A 3O5KA 1BKFA 3JXVA 1T11A 2DG4A 1JNSA 2Y78A 3RFWA 4TW6A 4ODRA 3JYMA 3RGCA 1D7HA 2VN1A 5J6EA 1B6CA 4LAWA 4O2TA 1YW5A 2DG3A 2MLZA 4FN2A 2F21A 3TC5A 1M5YA 1J6YA 2UZ5A 3KAFA 2XP3A 3OOBA 4TNSA 2RUCA 3O5FA 2XPBA 5HWCA 1FKDA 2ZR5A 4IQ2A 4U85A 1BL4A 4DRJA 2MF9A 1FKRA 4LAVA 2AWGA 4FAPA 3O5EA 2IF4A 1Q6HA 5DITA 4LAYA 3NRKA 1ROUA 2RSEA 1W26A 1L1PA 1ROTA 4ITZA 3O5DA 2LKNA 1TCOC 2PBCA 4DRPA 2KGJA 2PPPA 3B7XA 3KAGA 1JNTA 5BXJA 3UI4A 2KO7A 4GIVA 2RUDA 3O5LA
chains in the Genus database with same CATH superfamily
4P8UA 4DWSC 4W9PA 3IKDA 2DPEA 4Z2JA 1JVWA 4MGVA 4MNMA 1OGGA 3ARYA 1NWTA 4QT2A 4Z2IA 4ODQA 4DZ2A 2RURA 3AS0A 3WQVA 2DSVA 5D75A 1FKIA 2YBTA 4P8XA 5GPGA 4W9OA 5GPRA 4TX0A 1Q6UA 3AQUA 3WD0A 5B8IC 2DT3A 1Y0OA 5HWBA 5HW7A 4WKFA 1QPFA 3UI6A 1HJWA 4R0XA 1SR0A 2FAPA 4GGQA 1FKTA 4Z2HA 3BMBA 1KT0A 4ODKA 2RUQA 1WAWA 3CHDA 3ARVA 3VAWA 1E9LA 1ZBVA 3ARUA 4JFIA 1GOIA 3FY1A 3OA5A 3WD3A 3KAIA 4IT6A 4KR0B 2LPVA 1PBKA 4R5EA 3UQAA 2B31A 3O5GA 3ARQA 4Q7NA 1JCHB 1H0GA 3PRAA 1C9HA 1ZU8A 2FKEA 1FKFA 4IPXA 2XP8A 1NMVA 4JFLA 3MDYB 3WL0A 1F40A 1FKBA 2PI6A 4DWSA 2LJ4A 3UF8A 2ZQTA 3RM4A 3G6LA 4DRIA 2KI3A 3RMEA 3IHZA 4TW8A 1HXVA 2WK2A 1FKKA 1BKFA 1WB0A 3JXVA 3B9AA 2VN1A 4O2TA 1YW5A 4FN2A 2UZ5A 3ARRA 4HBOA 2XP3A 1NWSA 3O5FA 4URIA 2ZR5A 3CHFA 1HKKA 4DRJA 4ITZA 3O5DA 4Z2KA 2PBCA 2KGJA 2PPPA 3ALGA 5BXJA 3PRDA 1KT1A 1W9PA 1LG1A 2EULA 1QZ2A 1FFRA 1D6OA 5DF0A 1D7IA 3TCZA 1EHNA 4DRKA 2F4EA 3ARXA 3KABA 1W9UA 1RD6A 2PV3A 2ZR6A 2Q5AA 1KFWA 3WKZA 4J4OA 5HUAA 3BXWA 1ZK6A 4QIBA 2MLXA 4TYOA 1R9HA 4ODLA 4W5UA 1NSGA 3KCEA 4WK9A 2M1IA 4J4NA 4IQCA 1K9TA 1XHGA 2M2AA 1J4HA 1E6ZA 2DT1A 2N87A 3ARTA 1ITXA 2PV2A 1JNDA 4DWSD 1D7JA 2K8IA 1LG2A 4S3KA 3FXYA 2DT2A 2XP9A 2XPAA 3O5PA 5DEZA 1GUVA 1F8AB 1SYTA 2O9OA 4JFMA 3PR9A 1GRJA 2F2DA 1FKLA 1W1PA 1LJYA 2MLYA 3RM8A 5HW6A 3QOKA 4N19A 3PA7A 4DIPA 1EDQA 3GPKA 3WD2A 5HT1A 3IKGA 2XP6A 4TW7A 1UR9A 4MPKA 4W9QA 4JYSA 1HKJA 3UQIA 1LL6A 3KAHA 4DRMA 3O5KA 1HKMA 4WKAA 1JNEA 4TW6A 1W1TA 4ODRA 3RGCA 1D7HA 4P8VA 5J6EA 2DG3A 2MLZA 2F21A 1ZBKA 1J6YA 3OOBA 1IX5A 4IQ2A 2MF9A 4FAPA 1XRVA 2IF4A 1W1VA 2RSEA 1L1PA 2ETNA 3KAGA 5DO2A 1W9VA 1JNTA 5HWCA 4NSBA 3CH9A 1CTNA 3KADA 3KACA 2D9FA 1A7XA 4HBEA 1FAPA 2XP7A 4P8WA 4DRHA 4IT4A 1FKGA 4QT3A 1EYMA 3O5RA 3UI5A 2ITKA 1D2KA 1ZCNA 5GQBA 1ZBWA 1EIBA 4MNKA 4WIWA 1ZL1A 3AS1A 3WD1A 1NWUA 5DIUA 1NWRA 4Z2LA 1HJVA 3JYJA 2ZQVA 4U86A 1J4IA 1HKIA 4DT4A 4DRQA 3ALFA 3B9EA 3RM9A 4ZPWR 2VCDA 3FAPA 2IUZA 4MTVA 3AS2A 2O92A 5HTGA 2QF8A 2A3CA 3WIJA 3O5MA 4ODPA 1LQ0A 3CHCA 4JFKA 4ODNA 2FDMA 3ARZA 1E6RA 3WD4A 3ARSA 4ML4A 1QPLA 4MSPA 1E6NA 4XAKA 4U84A 3IK8A 1UR8A 2ZQUA 2KE0A 1YATA 2OLHA 1FFQA 4MNLA 2A3BA 2OFNA 4ZPVR 2P4VA 2Y78A 1HJXA 1B6CA 3EIPA 3CZ8A 3KAFA 4TNSA 2WLZA 2RUCA 4WJXA 4U85A 1BL4A 4QZVB 4NZCA 4LAVA 2AWGA 3O5EA 5DITA 4LAYA 4KQZA 1W26A 3GTYX 2LKNA 1TCOC 4GIVA 2XP4A 4ZS6A 3WL1A 1GPFA 3KZ7A 2B5UB 1NH6A 3LUOA 2KR7A 4G2PA 3I6CA 4UDMA 3H9RB 2DSUA 4AY1A 3B9DA 2DSZA 2PPOA 3AROA 3O5JA 1J4RA 4LGXA 5HKGA 3O5OA 1PINA 4DH0A 4LAXA 4MAVA 4DWSB 1VF8A 4HARA 5DIVA 1LL4A 3B8SA 1O6IA 4JFJA 2DG9A 2A3EA 3NI6A 4NNRA 4DROA 2WM0A 2F23A 4G50A 2MNTA 1ZBCA 3ARWA 3O5IA 1FKSA 2ZQSA 5HW8A 2G8ZA 3GU0A 4BF8A 2M08A 2PPNA 4MNJA 3WH0A 1OGBA 2L2SA 2XP5A 2RQSA 1FKHA 1FD9A 2AOSA 3ARPA 1X6NA 2YBUA 4PTMA 2PN0A 4DRNA 2DT0A 2ZR4A 2JZVA 2DSWA 4ODMA 1OWQA 1TFVA 1U79A 1LL7A 4ZPTR 1EQ3A 2PV1A 3EY6A 4WKHA 5HBFA 3TDBA 3NTPA 2A3AA 1N1AA 5I98A 3CGNA 4Z2GA 1E6PA 1WNOA 2G41A 1H0IA 4L72B 3ODKA 3CGMA 1E44A 3AS3A 1E15A 1NMWA 2MPHA 4ODOA 2LGOA 1P5QA 1Q6IA 4S3JA 3O5QA 2KFWA 1FJDA 1X6LA 3PRBA 4C02B 1Q1CA 3UQBA 1FKJA 4DZ3A 1T11A 2DG4A 1JNSA 3RFWA 1ZB5A 3JYMA 4LAWA 2ESCA 3TC5A 1M5YA 3WQWA 2WLYA 2XPBA 1FKDA 5JH8A 3CHEA 1FKRA 4Q22A 1Q6HA 3NRKA 1ROUA 4L3NA 1ROTA 3W4RA 4DRPA 3B7XA 1W1YA 3UI4A 2KO7A 3G6MA 2RUDA 3O5LA
chains in the Genus database with same CATH topology
4P8UA 4DWSC 4W9PA 3IKDA 2DPEA 4Z2JA 1JVWA 4MGVA 4MNMA 1OGGA 3ARYA 1NWTA 4QT2A 4Z2IA 4ODQA 4DZ2A 2RURA 3AS0A 3WQVA 2DSVA 5D75A 1FKIA 2YBTA 4P8XA 5GPGA 4W9OA 5GPRA 4TX0A 1Q6UA 3AQUA 3WD0A 5B8IC 2DT3A 1Y0OA 5HWBA 5HW7A 4WKFA 1QPFA 3UI6A 1HJWA 4R0XA 1SR0A 2FAPA 4GGQA 1FKTA 4Z2HA 1KT0A 4ODKA 2RUQA 1WAWA 3CHDA 3ARVA 3VAWA 1E9LA 1ZBVA 3ARUA 4JFIA 1GOIA 3FY1A 3OA5A 3WD3A 3KAIA 4IT6A 4KR0B 2LPVA 1PBKA 4R5EA 3UQAA 2B31A 3O5GA 3ARQA 4Q7NA 1H0GA 3PRAA 1C9HA 1ZU8A 2FKEA 1FKFA 4IPXA 2XP8A 1NMVA 4JFLA 3MDYB 3WL0A 1F40A 1FKBA 2PI6A 4DWSA 2LJ4A 3UF8A 2ZQTA 3RM4A 3G6LA 4DRIA 2KI3A 3RMEA 3IHZA 4TW8A 1HXVA 2WK2A 1FKKA 1BKFA 1WB0A 3JXVA 3B9AA 2VN1A 4O2TA 1YW5A 4FN2A 2UZ5A 3ARRA 4HBOA 2XP3A 1NWSA 3O5FA 4URIA 2ZR5A 3CHFA 1HKKA 4DRJA 4ITZA 3O5DA 4Z2KA 2PBCA 2KGJA 2PPPA 3ALGA 5BXJA 3PRDA 1KT1A 1W9PA 1LG1A 1QZ2A 1FFRA 1D6OA 5DF0A 1D7IA 3TCZA 1EHNA 4DRKA 2F4EA 3ARXA 3KABA 1W9UA 1RD6A 2PV3A 2ZR6A 2Q5AA 1KFWA 3WKZA 4J4OA 5HUAA 3BXWA 1ZK6A 4QIBA 2MLXA 4TYOA 1R9HA 4ODLA 4W5UA 1NSGA 3KCEA 4WK9A 2M1IA 4J4NA 4IQCA 1K9TA 1XHGA 2M2AA 1J4HA 1E6ZA 2DT1A 2N87A 3ARTA 1ITXA 2PV2A 1JNDA 4DWSD 1D7JA 2K8IA 1LG2A 4S3KA 3FXYA 2DT2A 2XP9A 2XPAA 3O5PA 5DEZA 1GUVA 1F8AB 1SYTA 2O9OA 4JFMA 3PR9A 2F2DA 1FKLA 1W1PA 1LJYA 2MLYA 3RM8A 5HW6A 3QOKA 4N19A 3PA7A 4DIPA 1EDQA 3GPKA 3WD2A 5HT1A 3IKGA 2XP6A 4TW7A 1UR9A 4MPKA 4W9QA 4JYSA 1HKJA 3UQIA 1LL6A 3KAHA 4DRMA 3O5KA 1HKMA 4WKAA 1JNEA 4TW6A 1W1TA 4ODRA 3RGCA 1D7HA 4P8VA 5J6EA 2DG3A 2MLZA 2F21A 1ZBKA 1J6YA 3OOBA 1IX5A 4IQ2A 2MF9A 4FAPA 1XRVA 2IF4A 1W1VA 2RSEA 1L1PA 3KAGA 5DO2A 1W9VA 1JNTA 5HWCA 4NSBA 3CH9A 1CTNA 3KADA 3KACA 2D9FA 1A7XA 4HBEA 1FAPA 2XP7A 4P8WA 4DRHA 4IT4A 1FKGA 4QT3A 1EYMA 3O5RA 3UI5A 2ITKA 1D2KA 1ZCNA 5GQBA 1ZBWA 1EIBA 4MNKA 4WIWA 1ZL1A 3AS1A 3WD1A 1NWUA 5DIUA 1NWRA 4Z2LA 1HJVA 3JYJA 2ZQVA 4U86A 1J4IA 1HKIA 4DT4A 4DRQA 3ALFA 3B9EA 3RM9A 4ZPWR 2VCDA 3FAPA 2IUZA 4MTVA 3AS2A 2O92A 5HTGA 2QF8A 2A3CA 3WIJA 3O5MA 4ODPA 1LQ0A 3CHCA 4JFKA 4ODNA 2FDMA 3ARZA 1E6RA 3WD4A 3ARSA 4ML4A 1QPLA 4MSPA 1E6NA 4XAKA 4U84A 3IK8A 1UR8A 2ZQUA 2KE0A 1YATA 2OLHA 1FFQA 4MNLA 2A3BA 2OFNA 4ZPVR 2Y78A 1HJXA 1B6CA 3CZ8A 3KAFA 4TNSA 2WLZA 2RUCA 4WJXA 4U85A 1BL4A 4QZVB 4NZCA 4LAVA 2AWGA 3O5EA 5DITA 4LAYA 4KQZA 1W26A 2LKNA 1TCOC 4GIVA 2XP4A 4ZS6A 3WL1A 1GPFA 3KZ7A 1NH6A 3LUOA 2KR7A 4G2PA 3I6CA 3H9RB 2DSUA 4AY1A 3B9DA 2DSZA 2PPOA 3AROA 3O5JA 1J4RA 4LGXA 5HKGA 3O5OA 1PINA 4DH0A 4LAXA 4MAVA 4DWSB 1VF8A 4HARA 5DIVA 1LL4A 3B8SA 1O6IA 4JFJA 2DG9A 2A3EA 3NI6A 4NNRA 4DROA 2WM0A 4G50A 2MNTA 1ZBCA 3ARWA 3O5IA 1FKSA 2ZQSA 5HW8A 2G8ZA 4BF8A 2M08A 2PPNA 4MNJA 3WH0A 1OGBA 2L2SA 2XP5A 2RQSA 1FKHA 1FD9A 2AOSA 3ARPA 1X6NA 2YBUA 4PTMA 4DRNA 2DT0A 2ZR4A 2JZVA 2DSWA 4ODMA 1OWQA 1TFVA 1U79A 1LL7A 4ZPTR 1EQ3A 2PV1A 3EY6A 4WKHA 5HBFA 3TDBA 3NTPA 2A3AA 1N1AA 5I98A 3CGNA 4Z2GA 1E6PA 1WNOA 2G41A 1H0IA 4L72B 3ODKA 3CGMA 3AS3A 1E15A 1NMWA 2MPHA 4ODOA 2LGOA 1P5QA 1Q6IA 4S3JA 3O5QA 2KFWA 1FJDA 1X6LA 3PRBA 4C02B 1Q1CA 3UQBA 1FKJA 4DZ3A 1T11A 2DG4A 1JNSA 3RFWA 1ZB5A 3JYMA 4LAWA 2ESCA 3TC5A 1M5YA 3WQWA 2WLYA 2XPBA 1FKDA 5JH8A 3CHEA 1FKRA 4Q22A 1Q6HA 3NRKA 1ROUA 4L3NA 1ROTA 3W4RA 4DRPA 3B7XA 1W1YA 3UI4A 2KO7A 3G6MA 2RUDA 3O5LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XP4 A;  3KAD A;  3PRD A;  4W9P A;  1KT1 A;  3KAC A;  3KZ7 A;  2D9F A;  3IKD A;  1A7X A;  1JVW A;  3LUO A;  1QZ2 A;  1FAP A;  2KR7 A;  1D6O A;  2XP7 A;  3I6C A;  4G2P A;  1D7I A;  4MGV A;  3TCZ A;  4DRH A;  1FKG A;  2F4E A;  3H9R B;  4QT3 A;  4DRK A;  3KAB A;  1EYM A;  3O5R A;  3UI5 A;  2ITK A;  4QT2 A;  4ODQ A;  2PV3 A;  2RUR A;  1ZCN A;  2ZR6 A;  4DZ2 A;  2Q5A A;  4J4O A;  5HUA A;  2PPO A;  3O5J A;  1J4R A;  5D75 A;  1FKI A;  1ZK6 A;  3O5O A;  4QIB A;  1PIN A;  5HKG A;  5GPG A;  4DH0 A;  4LAX A;  2MLX A;  4TYO A;  4W9O A;  1R9H A;  4ODL A;  1Q6U A;  4TX0 A;  5DIV A;  5B8I C;  1NSG A;  3KCE A;  1Y0O A;  4JFJ A;  2M1I A;  4J4N A;  2DG9 A;  5DIU A;  5HW7 A;  3NI6 A;  4NNR A;  5HWB A;  4IQC A;  4DRO A;  1QPF A;  3UI6 A;  3JYJ A;  2M2A A;  2ZQV A;  4G50 A;  2MNT A;  4R0X A;  1J4H A;  2FAP A;  3O5I A;  4GGQ A;  4U86 A;  1FKT A;  1FKS A;  1J4I A;  2N87 A;  2ZQS A;  4BF8 A;  5HW8 A;  2M08 A;  2PPN A;  4DT4 A;  4DRQ A;  2PV2 A;  3WH0 A;  1D7J A;  1KT0 A;  4ODK A;  2K8I A;  2RUQ A;  2L2S A;  2XP5 A;  2VCD A;  2RQS A;  3FAP A;  1FKH A;  1FD9 A;  2XP9 A;  3VAW A;  2XPA A;  3O5P A;  4JFI A;  4DRN A;  5HTG A;  2ZR4 A;  3KAI A;  1F8A B;  2JZV A;  2LPV A;  1PBK A;  4ODM A;  3O5M A;  4JFM A;  4ODP A;  3UQA A;  3O5G A;  4JFK A;  2F2D A;  1U79 A;  1FKL A;  1C9H A;  1EQ3 A;  2FKE A;  4ODN A;  1FKF A;  2PV1 A;  3EY6 A;  4IPX A;  2XP8 A;  2MLY A;  5HW6 A;  1NMV A;  4JFL A;  1QPL A;  3TDB A;  3NTP A;  4MSP A;  3MDY B;  1N1A A;  4N19 A;  3PA7 A;  4U84 A;  5I98 A;  3CGN A;  4DIP A;  3IK8 A;  1F40 A;  1FKB A;  3GPK A;  3ODK A;  3CGM A;  5HT1 A;  2LJ4 A;  3IKG A;  3UF8 A;  1NMW A;  2XP6 A;  2ZQT A;  2ZQU A;  2MPH A;  4ODO A;  4TW7 A;  2LGO A;  4W9Q A;  1P5Q A;  1Q6I A;  1FJD A;  3O5Q A;  2KFW A;  4JYS A;  4DRI A;  2KE0 A;  1YAT A;  3PRB A;  4C02 B;  2KI3 A;  1Q1C A;  3UQI A;  3IHZ A;  2OFN A;  3KAH A;  4TW8 A;  3UQB A;  4DRM A;  1HXV A;  1FKK A;  1FKJ A;  4DZ3 A;  3O5K A;  1BKF A;  3JXV A;  1T11 A;  2DG4 A;  1JNS A;  2Y78 A;  3RFW A;  4TW6 A;  4ODR A;  3JYM A;  3RGC A;  1D7H A;  2VN1 A;  5J6E A;  1B6C A;  4LAW A;  4O2T A;  1YW5 A;  2DG3 A;  2MLZ A;  4FN2 A;  2F21 A;  3TC5 A;  1M5Y A;  1J6Y A;  2UZ5 A;  3KAF A;  2XP3 A;  3OOB A;  4TNS A;  2RUC A;  3O5F A;  2XPB A;  5HWC A;  1FKD A;  2ZR5 A;  4IQ2 A;  4U85 A;  1BL4 A;  4DRJ A;  2MF9 A;  1FKR A;  4LAV A;  2AWG A;  4FAP A;  3O5E A;  2IF4 A;  1Q6H A;  5DIT A;  4LAY A;  3NRK A;  1ROU A;  2RSE A;  1W26 A;  1L1P A;  1ROT A;  4ITZ A;  3O5D A;  2LKN A;  1TCO C;  2PBC A;  4DRP A;  2KGJ A;  2PPP A;  3B7X A;  3KAG A;  1JNT A;  5BXJ A;  3UI4 A;  2KO7 A;  4GIV A;  2RUD A;  3O5L A; 
#chains in the Genus database with same CATH topology
 4P8U A;  4DWS C;  4W9P A;  3IKD A;  2DPE A;  4Z2J A;  1JVW A;  4MGV A;  4MNM A;  1OGG A;  3ARY A;  1NWT A;  4QT2 A;  4Z2I A;  4ODQ A;  4DZ2 A;  2RUR A;  3AS0 A;  3WQV A;  2DSV A;  5D75 A;  1FKI A;  2YBT A;  4P8X A;  5GPG A;  4W9O A;  5GPR A;  4TX0 A;  1Q6U A;  3AQU A;  3WD0 A;  5B8I C;  2DT3 A;  1Y0O A;  5HWB A;  5HW7 A;  4WKF A;  1QPF A;  3UI6 A;  1HJW A;  4R0X A;  1SR0 A;  2FAP A;  4GGQ A;  1FKT A;  4Z2H A;  3BMB A;  1KT0 A;  4ODK A;  2RUQ A;  1WAW A;  3CHD A;  3ARV A;  3VAW A;  1E9L A;  1ZBV A;  3ARU A;  4JFI A;  1GOI A;  3FY1 A;  3OA5 A;  3WD3 A;  3KAI A;  4IT6 A;  4KR0 B;  2LPV A;  1PBK A;  4R5E A;  3UQA A;  2B31 A;  3O5G A;  3ARQ A;  4Q7N A;  1JCH B;  1H0G A;  3PRA A;  1C9H A;  1ZU8 A;  2FKE A;  1FKF A;  4IPX A;  2XP8 A;  1NMV A;  4JFL A;  3MDY B;  3WL0 A;  1F40 A;  1FKB A;  2PI6 A;  4DWS A;  2LJ4 A;  3UF8 A;  2ZQT A;  3RM4 A;  3G6L A;  4DRI A;  2KI3 A;  3RME A;  3IHZ A;  4TW8 A;  1HXV A;  2WK2 A;  1FKK A;  1BKF A;  1WB0 A;  3JXV A;  3B9A A;  2VN1 A;  4O2T A;  1YW5 A;  4FN2 A;  2UZ5 A;  3ARR A;  4HBO A;  2XP3 A;  1NWS A;  3O5F A;  4URI A;  2ZR5 A;  3CHF A;  1HKK A;  4DRJ A;  4ITZ A;  3O5D A;  4Z2K A;  2PBC A;  2KGJ A;  2PPP A;  3ALG A;  5BXJ A;  3PRD A;  1KT1 A;  1W9P A;  1LG1 A;  2EUL A;  1QZ2 A;  1FFR A;  1D6O A;  5DF0 A;  1D7I A;  3TCZ A;  1EHN A;  4DRK A;  2F4E A;  3ARX A;  3KAB A;  1W9U A;  1RD6 A;  2PV3 A;  2ZR6 A;  2Q5A A;  1KFW A;  3WKZ A;  4J4O A;  5HUA A;  3BXW A;  1ZK6 A;  4QIB A;  2MLX A;  4TYO A;  1R9H A;  4ODL A;  4W5U A;  1NSG A;  3KCE A;  4WK9 A;  2M1I A;  4J4N A;  4IQC A;  1K9T A;  1XHG A;  2M2A A;  1J4H A;  1E6Z A;  2DT1 A;  2N87 A;  3ART A;  1ITX A;  2PV2 A;  1JND A;  4DWS D;  1D7J A;  2K8I A;  1LG2 A;  4S3K A;  3FXY A;  2DT2 A;  2XP9 A;  2XPA A;  3O5P A;  5DEZ A;  1GUV A;  1F8A B;  1SYT A;  2O9O A;  4JFM A;  3PR9 A;  1GRJ A;  2F2D A;  1FKL A;  1W1P A;  1LJY A;  2MLY A;  3RM8 A;  5HW6 A;  3QOK A;  4N19 A;  3PA7 A;  4DIP A;  1EDQ A;  3GPK A;  3WD2 A;  5HT1 A;  3IKG A;  2XP6 A;  4TW7 A;  1UR9 A;  4MPK A;  4W9Q A;  4JYS A;  1HKJ A;  3UQI A;  1LL6 A;  3KAH A;  4DRM A;  3O5K A;  1HKM A;  4WKA A;  1JNE A;  4TW6 A;  1W1T A;  4ODR A;  3RGC A;  1D7H A;  4P8V A;  5J6E A;  2DG3 A;  2MLZ A;  2F21 A;  1ZBK A;  1J6Y A;  3OOB A;  1IX5 A;  4IQ2 A;  2MF9 A;  4FAP A;  1XRV A;  2IF4 A;  1W1V A;  2RSE A;  1L1P A;  2ETN A;  3KAG A;  5DO2 A;  1W9V A;  1JNT A;  5HWC A;  4NSB A;  3CH9 A;  1CTN A;  3KAD A;  3KAC A;  2D9F A;  1A7X A;  4HBE A;  1FAP A;  2XP7 A;  4P8W A;  4DRH A;  4IT4 A;  1FKG A;  4QT3 A;  1EYM A;  3O5R A;  3UI5 A;  2ITK A;  1D2K A;  1ZCN A;  5GQB A;  1ZBW A;  1EIB A;  4MNK A;  4WIW A;  1ZL1 A;  3AS1 A;  3WD1 A;  1NWU A;  5DIU A;  1NWR A;  4Z2L A;  1HJV A;  3JYJ A;  2ZQV A;  4U86 A;  1J4I A;  1HKI A;  4DT4 A;  4DRQ A;  3ALF A;  3B9E A;  3RM9 A;  4ZPW R;  2VCD A;  3FAP A;  2IUZ A;  4MTV A;  3AS2 A;  2O92 A;  5HTG A;  2QF8 A;  2A3C A;  3WIJ A;  3O5M A;  4ODP A;  1LQ0 A;  3CHC A;  4JFK A;  4ODN A;  2FDM A;  3ARZ A;  1E6R A;  3WD4 A;  3ARS A;  4ML4 A;  1QPL A;  4MSP A;  1E6N A;  4XAK A;  4U84 A;  3IK8 A;  1UR8 A;  2ZQU A;  2KE0 A;  1YAT A;  2OLH A;  1FFQ A;  4MNL A;  2A3B A;  2OFN A;  4ZPV R;  2P4V A;  2Y78 A;  1HJX A;  1B6C A;  3EIP A;  3CZ8 A;  3KAF A;  4TNS A;  2WLZ A;  2RUC A;  4WJX A;  4U85 A;  1BL4 A;  4QZV B;  4NZC A;  4LAV A;  2AWG A;  3O5E A;  5DIT A;  4LAY A;  4KQZ A;  1W26 A;  3GTY X;  2LKN A;  1TCO C;  4GIV A;  2XP4 A;  4ZS6 A;  3WL1 A;  1GPF A;  3KZ7 A;  2B5U B;  1NH6 A;  3LUO A;  2KR7 A;  4G2P A;  3I6C A;  4UDM A;  3H9R B;  2DSU A;  4AY1 A;  3B9D A;  2DSZ A;  2PPO A;  3ARO A;  3O5J A;  1J4R A;  4LGX A;  5HKG A;  3O5O A;  1PIN A;  4DH0 A;  4LAX A;  4MAV A;  4DWS B;  1VF8 A;  4HAR A;  5DIV A;  1LL4 A;  3B8S A;  1O6I A;  4JFJ A;  2DG9 A;  2A3E A;  3NI6 A;  4NNR A;  4DRO A;  2WM0 A;  2F23 A;  4G50 A;  2MNT A;  1ZBC A;  3ARW A;  3O5I A;  1FKS A;  2ZQS A;  5HW8 A;  2G8Z A;  3GU0 A;  4BF8 A;  2M08 A;  2PPN A;  4MNJ A;  3WH0 A;  1OGB A;  2L2S A;  2XP5 A;  2RQS A;  1FKH A;  1FD9 A;  2AOS A;  3ARP A;  1X6N A;  2YBU A;  4PTM A;  2PN0 A;  4DRN A;  2DT0 A;  2ZR4 A;  2JZV A;  2DSW A;  4ODM A;  1OWQ A;  1TFV A;  1U79 A;  1LL7 A;  4ZPT R;  1EQ3 A;  2PV1 A;  3EY6 A;  4WKH A;  5HBF A;  3TDB A;  3NTP A;  2A3A A;  1N1A A;  5I98 A;  3CGN A;  4Z2G A;  1E6P A;  1WNO A;  2G41 A;  1H0I A;  4L72 B;  3ODK A;  3CGM A;  1E44 A;  3AS3 A;  1E15 A;  1NMW A;  2MPH A;  4ODO A;  2LGO A;  1P5Q A;  1Q6I A;  4S3J A;  3O5Q A;  2KFW A;  1FJD A;  1X6L A;  3PRB A;  4C02 B;  1Q1C A;  3UQB A;  1FKJ A;  4DZ3 A;  1T11 A;  2DG4 A;  1JNS A;  3RFW A;  1ZB5 A;  3JYM A;  4LAW A;  2ESC A;  3TC5 A;  1M5Y A;  3WQW A;  2WLY A;  2XPB A;  1FKD A;  5JH8 A;  3CHE A;  1FKR A;  4Q22 A;  1Q6H A;  3NRK A;  1ROU A;  4L3N A;  1ROT A;  3W4R A;  4DRP A;  3B7X A;  1W1Y A;  3UI4 A;  2KO7 A;  3G6M A;  2RUD A;  3O5L A; 
#chains in the Genus database with same CATH homology
 4P8U A;  4DWS C;  4W9P A;  3IKD A;  2DPE A;  4Z2J A;  1JVW A;  4MGV A;  4MNM A;  1OGG A;  3ARY A;  1NWT A;  4QT2 A;  4Z2I A;  4ODQ A;  4DZ2 A;  2RUR A;  3AS0 A;  3WQV A;  2DSV A;  5D75 A;  1FKI A;  2YBT A;  4P8X A;  5GPG A;  4W9O A;  5GPR A;  4TX0 A;  1Q6U A;  3AQU A;  3WD0 A;  5B8I C;  2DT3 A;  1Y0O A;  5HWB A;  5HW7 A;  4WKF A;  1QPF A;  3UI6 A;  1HJW A;  4R0X A;  1SR0 A;  2FAP A;  4GGQ A;  1FKT A;  4Z2H A;  1KT0 A;  4ODK A;  2RUQ A;  1WAW A;  3CHD A;  3ARV A;  3VAW A;  1E9L A;  1ZBV A;  3ARU A;  4JFI A;  1GOI A;  3FY1 A;  3OA5 A;  3WD3 A;  3KAI A;  4IT6 A;  4KR0 B;  2LPV A;  1PBK A;  4R5E A;  3UQA A;  2B31 A;  3O5G A;  3ARQ A;  4Q7N A;  1H0G A;  3PRA A;  1C9H A;  1ZU8 A;  2FKE A;  1FKF A;  4IPX A;  2XP8 A;  1NMV A;  4JFL A;  3MDY B;  3WL0 A;  1F40 A;  1FKB A;  2PI6 A;  4DWS A;  2LJ4 A;  3UF8 A;  2ZQT A;  3RM4 A;  3G6L A;  4DRI A;  2KI3 A;  3RME A;  3IHZ A;  4TW8 A;  1HXV A;  2WK2 A;  1FKK A;  1BKF A;  1WB0 A;  3JXV A;  3B9A A;  2VN1 A;  4O2T A;  1YW5 A;  4FN2 A;  2UZ5 A;  3ARR A;  4HBO A;  2XP3 A;  1NWS A;  3O5F A;  4URI A;  2ZR5 A;  3CHF A;  1HKK A;  4DRJ A;  4ITZ A;  3O5D A;  4Z2K A;  2PBC A;  2KGJ A;  2PPP A;  3ALG A;  5BXJ A;  3PRD A;  1KT1 A;  1W9P A;  1LG1 A;  1QZ2 A;  1FFR A;  1D6O A;  5DF0 A;  1D7I A;  3TCZ A;  1EHN A;  4DRK A;  2F4E A;  3ARX A;  3KAB A;  1W9U A;  1RD6 A;  2PV3 A;  2ZR6 A;  2Q5A A;  1KFW A;  3WKZ A;  4J4O A;  5HUA A;  3BXW A;  1ZK6 A;  4QIB A;  2MLX A;  4TYO A;  1R9H A;  4ODL A;  4W5U A;  1NSG A;  3KCE A;  4WK9 A;  2M1I A;  4J4N A;  4IQC A;  1K9T A;  1XHG A;  2M2A A;  1J4H A;  1E6Z A;  2DT1 A;  2N87 A;  3ART A;  1ITX A;  2PV2 A;  1JND A;  4DWS D;  1D7J A;  2K8I A;  1LG2 A;  4S3K A;  3FXY A;  2DT2 A;  2XP9 A;  2XPA A;  3O5P A;  5DEZ A;  1GUV A;  1F8A B;  1SYT A;  2O9O A;  4JFM A;  3PR9 A;  2F2D A;  1FKL A;  1W1P A;  1LJY A;  2MLY A;  3RM8 A;  5HW6 A;  3QOK A;  4N19 A;  3PA7 A;  4DIP A;  1EDQ A;  3GPK A;  3WD2 A;  5HT1 A;  3IKG A;  2XP6 A;  4TW7 A;  1UR9 A;  4MPK A;  4W9Q A;  4JYS A;  1HKJ A;  3UQI A;  1LL6 A;  3KAH A;  4DRM A;  3O5K A;  1HKM A;  4WKA A;  1JNE A;  4TW6 A;  1W1T A;  4ODR A;  3RGC A;  1D7H A;  4P8V A;  5J6E A;  2DG3 A;  2MLZ A;  2F21 A;  1ZBK A;  1J6Y A;  3OOB A;  1IX5 A;  4IQ2 A;  2MF9 A;  4FAP A;  1XRV A;  2IF4 A;  1W1V A;  2RSE A;  1L1P A;  3KAG A;  5DO2 A;  1W9V A;  1JNT A;  5HWC A;  4NSB A;  3CH9 A;  1CTN A;  3KAD A;  3KAC A;  2D9F A;  1A7X A;  4HBE A;  1FAP A;  2XP7 A;  4P8W A;  4DRH A;  4IT4 A;  1FKG A;  4QT3 A;  1EYM A;  3O5R A;  3UI5 A;  2ITK A;  1D2K A;  1ZCN A;  5GQB A;  1ZBW A;  1EIB A;  4MNK A;  4WIW A;  1ZL1 A;  3AS1 A;  3WD1 A;  1NWU A;  5DIU A;  1NWR A;  4Z2L A;  1HJV A;  3JYJ A;  2ZQV A;  4U86 A;  1J4I A;  1HKI A;  4DT4 A;  4DRQ A;  3ALF A;  3B9E A;  3RM9 A;  4ZPW R;  2VCD A;  3FAP A;  2IUZ A;  4MTV A;  3AS2 A;  2O92 A;  5HTG A;  2QF8 A;  2A3C A;  3WIJ A;  3O5M A;  4ODP A;  1LQ0 A;  3CHC A;  4JFK A;  4ODN A;  2FDM A;  3ARZ A;  1E6R A;  3WD4 A;  3ARS A;  4ML4 A;  1QPL A;  4MSP A;  1E6N A;  4XAK A;  4U84 A;  3IK8 A;  1UR8 A;  2ZQU A;  2KE0 A;  1YAT A;  2OLH A;  1FFQ A;  4MNL A;  2A3B A;  2OFN A;  4ZPV R;  2Y78 A;  1HJX A;  1B6C A;  3CZ8 A;  3KAF A;  4TNS A;  2WLZ A;  2RUC A;  4WJX A;  4U85 A;  1BL4 A;  4QZV B;  4NZC A;  4LAV A;  2AWG A;  3O5E A;  5DIT A;  4LAY A;  4KQZ A;  1W26 A;  2LKN A;  1TCO C;  4GIV A;  2XP4 A;  4ZS6 A;  3WL1 A;  1GPF A;  3KZ7 A;  1NH6 A;  3LUO A;  2KR7 A;  4G2P A;  3I6C A;  3H9R B;  2DSU A;  4AY1 A;  3B9D A;  2DSZ A;  2PPO A;  3ARO A;  3O5J A;  1J4R A;  4LGX A;  5HKG A;  3O5O A;  1PIN A;  4DH0 A;  4LAX A;  4MAV A;  4DWS B;  1VF8 A;  4HAR A;  5DIV A;  1LL4 A;  3B8S A;  1O6I A;  4JFJ A;  2DG9 A;  2A3E A;  3NI6 A;  4NNR A;  4DRO A;  2WM0 A;  4G50 A;  2MNT A;  1ZBC A;  3ARW A;  3O5I A;  1FKS A;  2ZQS A;  5HW8 A;  2G8Z A;  4BF8 A;  2M08 A;  2PPN A;  4MNJ A;  3WH0 A;  1OGB A;  2L2S A;  2XP5 A;  2RQS A;  1FKH A;  1FD9 A;  2AOS A;  3ARP A;  1X6N A;  2YBU A;  4PTM A;  4DRN A;  2DT0 A;  2ZR4 A;  2JZV A;  2DSW A;  4ODM A;  1OWQ A;  1TFV A;  1U79 A;  1LL7 A;  4ZPT R;  1EQ3 A;  2PV1 A;  3EY6 A;  4WKH A;  5HBF A;  3TDB A;  3NTP A;  2A3A A;  1N1A A;  5I98 A;  3CGN A;  4Z2G A;  1E6P A;  1WNO A;  2G41 A;  1H0I A;  4L72 B;  3ODK A;  3CGM A;  3AS3 A;  1E15 A;  1NMW A;  2MPH A;  4ODO A;  2LGO A;  1P5Q A;  1Q6I A;  4S3J A;  3O5Q A;  2KFW A;  1FJD A;  1X6L A;  3PRB A;  4C02 B;  1Q1C A;  3UQB A;  1FKJ A;  4DZ3 A;  1T11 A;  2DG4 A;  1JNS A;  3RFW A;  1ZB5 A;  3JYM A;  4LAW A;  2ESC A;  3TC5 A;  1M5Y A;  3WQW A;  2WLY A;  2XPB A;  1FKD A;  5JH8 A;  3CHE A;  1FKR A;  4Q22 A;  1Q6H A;  3NRK A;  1ROU A;  4L3N A;  1ROT A;  3W4R A;  4DRP A;  3B7X A;  1W1Y A;  3UI4 A;  2KO7 A;  3G6M A;  2RUD A;  3O5L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...