5J6EA

Structure of disulfide crosslinked a. fumigatus fkbp12(v91c)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
111
structure length
111
Chain Sequence
MGVTKELKSPGNGVDFPKKGDFVTIHYTGRLTDGSKFDSSVDRNEPFQTQIGTGRVIKGWDEGVPQMSLGEKAVLTITPDYGYGARGFPPCIPGNSTLIFEVELLGINNKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 1A
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Neosartorya fumigata (strain atcc mya-4609 / af293 / cbs 101355 / fgsc a1100)
molecule tags Isomerase
total genus 27
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5j6eA00
3I6CA 4FAPA 2KO7A 4QT3A 3UI4A 3KAHA 3TCZA 3JYMA 3UQBA 1ROUA 3O5KA 1ROTA 2PV3A 4DRMA 1PBKA 4J4NA 1NMVA 4IQCA 4DROA 4TNSA 2XP4A 3O5GA 1EQ3A 1B6CA 1P5QA 1YW5A 1N1AA 3O5RA 3RGCA 2ZR6A 3KAGA 4W9PA 2ZR4A 3OOBA 2XP8A 4ODKA 5HT1A 3UQAA 4U86A 2LPVA 3KAIA 5HW6A 4MGVA 5DITA 1M5YA 2MPHA 1C9HA 3GPKA 2FKEA 3IK8A 1BKFA 5DIUA 3WH0A 4TW7A 2LKNA 2RSEA 3VAWA 2ZQVA 1J4HA 2MLXA 4U85A 1FJDA 3TDBA 2IF4A 4ITZA 4QIBA 1FKHA 3TC5A 1BL4A 1J4RA 1NMWA 2JZVA 2PBCA 2PPNA 3O5JA 1PINA 1JVWA 3KAFA 2ZQUA 4JFIA 4BF8A 4J4OA 2D9FA 1L1PA 4DRKA 2XP5A 2Q5AA 4G50A 2N87A 3UQIA 2MLZA 3CGMA 2RUQA 2ZR5A 3IHZA 2KI3A 1QZ2A 4NNRA 2KGJA 2MF9A 4LAXA 2RURA 3NI6A 2UZ5A 2MLYA 2VN1A 3CGNA 4IPXA 3LUOA 4JYSA 3O5QA 1Q6IA 1KT1A 4LAYA 5HKGA 3KABA 1FD9A 1F8AB 4TW6A 5HUAA 2DG4A 1J6YA 2M2AA 3IKGA 1JNTA 1FKRA 3O5LA 1FKTA 2ZQSA 3UI6A 2RUCA 3FAPA 1J4IA 2DG3A 4ODLA 4ODRA 4GIVA 4MSPA 1NSGA 5D75A 2XPBA 4DIPA 1ZCNA 2PPPA 2K8IA 3O5PA 1A7XA 1R9HA 3KACA 5GPGA 4QT2A 2ZQTA 5DIVA 3PRBA 5BXJA 2LJ4A 1FKFA 1FKLA 4DRQA 1F40A 2PV1A 1T11A 2XPAA 4DRPA 4TYOA 2RQSA 3UI5A 3O5OA 2KR7A 5HWCA 5HTGA 2XP7A 2M1IA 2F4EA 3O5EA 4DRNA 2VCDA 2F21A 4FN2A 2KE0A 4ODNA 2LGOA 3IKDA 3PRDA 2XP3A 5HWBA 4TX0A 1KT0A 1FKGA 2PPOA 2XP9A 4ODMA 1D7IA 3KCEA 4N19A 4JFMA 1FKSA 2ITKA 4JFKA 4GGQA 1FAPA 2OFNA 4DZ3A 4LAVA 2MNTA 2M08A 2KFWA 4ODQA 1Q6HA 4G2PA 2FAPA 2RUDA 4JFJA 1Q6UA 2Y78A 3O5FA 5I98A 1EYMA 3PA7A 1QPFA 2F2DA 3KADA 5HW8A 1FKJA 1Y0OA 3H9RB 4DH0A 4W9OA 1U79A 4JFLA 2AWGA 1D7JA 4U84A 3RFWA 4O2TA 1FKDA 3O5MA 5HW7A 3JYJA 3NRKA 4DRJA 4C02B 1FKBA 1FKKA 1JNSA 3ODKA 1Q1CA 3NTPA 3UF8A 1TCOC 2XP6A 4ODOA 3KZ7A 4DRHA 2PV2A 4IQ2A 3EY6A 1YATA 1QPLA 5B8IC 1D6OA 4TW8A 4DZ2A 1HXVA 4ODPA 1W26A 3O5DA 4R0XA 5J6EA 3O5IA 1FKIA 3B7XA 4LAWA 1ZK6A 4W9QA 4DT4A 3JXVA 4DRIA 2L2SA 1D7HA 2DG9A 3MDYB
chains in the Genus database with same CATH superfamily
5DEZA 3CZ8A 3TCZA 3WKZA 2WK2A 1TFVA 2XP4A 3O5GA 5DF0A 1EQ3A 1E44A 1B6CA 2A3EA 3KAGA 4ML4A 2ZR4A 3CHCA 3OOBA 4WKAA 4Z2LA 2WLZA 4MGVA 1E6RA 3GPKA 4TW7A 3RM4A 3B8SA 2LKNA 2RSEA 1XHGA 2IUZA 5GPRA 1FFQA 3GU0A 2ETNA 1BL4A 3O5JA 1EIBA 1JVWA 1W9VA 1L1PA 4S3KA 2Q5AA 2N87A 4MNKA 3IHZA 1E9LA 1CTNA 2DSUA 2MLYA 1WAWA 2VN1A 4IPXA 4JYSA 3O5QA 1KT1A 5HKGA 2DT0A 1LQ0A 5HUAA 1XRVA 1H0IA 3BXWA 1HKKA 4Z2IA 4ODLA 1EHNA 2XPBA 1ZCNA 2K8IA 5GPGA 3PRBA 3B9EA 4DWSB 1FKLA 4DRPA 5JH8A 3UI5A 4DWSC 1W1TA 2M1IA 4L3NA 1VF8A 4ODNA 2AOSA 2XP3A 2XP9A 1FKSA 2ITKA 4GGQA 1OGGA 3CHFA 4MTVA 2M08A 4ODQA 2FAPA 2Y78A 5HBFA 1EYMA 4P8WA 5HW8A 3KADA 3H9RB 2WM0A 4W9OA 4JFLA 2AWGA 4Z2HA 3WD2A 3WQVA 2ESCA 1GOIA 1Q1CA 3UF8A 3AS1A 4ODOA 4DRHA 1E6NA 1KFWA 2O9OA 3EY6A 4ZPVR 3FXYA 4ODPA 3WD1A 3O5DA 4HARA 1FKIA 3B7XA 1ZK6A 4DT4A 1D7HA 3MDYB 3I6CA 4FAPA 3KAHA 2PI6A 3JYMA 3O5KA 1ROTA 2PV3A 1LL4A 1PBKA 1ZBVA 4J4NA 4S3JA 4DROA 4MNLA 4WKHA 3RGCA 2ZR6A 4MNMA 2XP8A 3UQAA 3CHDA 4U86A 3G6MA 1M5YA 3CHEA 1X6LA 1BKFA 3WH0A 3VAWA 1J4HA 2MLXA 3ALGA 1FJDA 3TDBA 4ITZA 1W1PA 4QIBA 4PTMA 2PBCA 3KAFA 4DRKA 2F23A 2XP5A 2WLYA 1D2KA 3ALFA 2KI3A 2KGJA 1O6IA 4LAXA 2RURA 3NI6A 1HJWA 3ARYA 3KABA 1F8AB 1ZBCA 1ZU8A 1FKRA 3O5LA 1FKTA 4P8XA 1RD6A 2DG3A 2G8ZA 4GIVA 1NSGA 1R9HA 3KACA 3GTYX 3EIPA 3B9AA 5BXJA 4DRQA 2RQSA 1JNEA 1GRJA 2F21A 4FN2A 4TX0A 1KT0A 4ODMA 1GPFA 4N19A 4JFKA 4WJXA 4DZ3A 2MNTA 3ARRA 2YBTA 4JFJA 5I98A 1UR9A 2F2DA 1FKJA 1K9TA 1Y0OA 1U79A 1D7JA 1ZBWA 1OGBA 4DWSA 1FKKA 4UDMA 1JNSA 3ODKA 1ZBKA 4MAVA 4L72B 2FDMA 4IT4A 3WD0A 4LGXA 1QPLA 5B8IC 3RM9A 1HXVA 1W26A 4DRIA 3AS3A 4P8VA 2DG9A 2KO7A 4QT3A 5DO2A 3UI4A 4KQZA 2O92A 1NMVA 4MNJA 1ITXA 1P5QA 1YW5A 3ARXA 4WK9A 5HW6A 2LPVA 4XAKA 3IK8A 1C9HA 2FKEA 4U85A 2A3AA 2IF4A 1FKHA 3TC5A 1W1YA 1J4RA 1NMWA 2JZVA 4JFIA 4BF8A 1PINA 2ZQUA 4J4OA 2D9FA 1LG2A 3UQIA 2MLZA 1GUVA 2ZR5A 1QZ2A 2MF9A 1X6NA 3OA5A 2EULA 2UZ5A 2YBUA 1HJXA 3WL0A 4HBEA 4TW6A 4ZS6A 2DG4A 1J6YA 2ZQSA 3UI6A 2RUCA 3FAPA 3WD3A 4ODRA 4MSPA 4MPKA 4DIPA 3O5PA 2PPPA 1A7XA 1W9UA 3ARUA 1LJYA 3AS0A 2ZQTA 5DIVA 4Z2KA 2LJ4A 1FKFA 4ZPTR 2PV1A 1T11A 2P4VA 2XPAA 4KR0B 3O5OA 2KR7A 5HWCA 1NWSA 4QZVB 3RM8A 5HTGA 2XP7A 3WQWA 4DRNA 2VCDA 1IX5A 2KE0A 4P8UA 3PRDA 5HWBA 4NSBA 2PPOA 1FKGA 1D7IA 3KCEA 3WD4A 4URIA 3WL1A 2OFNA 3B9DA 1LL7A 2KFWA 1Q6HA 4G2PA 1Q6UA 3PA7A 2A3BA 3FY1A 4Z2JA 3RFWA 4O2TA 1FKDA 3O5MA 3QOKA 3JYJA 1LG1A 4DRJA 1SYTA 1FKBA 2PN0A 2DT3A 3AS2A 3NTPA 1TCOC 4Q22A 4HBOA 3WIJA 4IQ2A 4NZCA 3ARTA 4ZPWR 4DZ2A 2DSZA 5J6EA 3O5IA 1EDQA 1NWRA 4W9QA 2L2SA 1JCHB 2B31A 3UQBA 1ROUA 1HKIA 4DRMA 1W1VA 4IQCA 4TNSA 3PR9A 3ARVA 1N1AA 3O5RA 4W9PA 3RMEA 2QF8A 4ODKA 1OWQA 5HT1A 3KAIA 5DITA 1HKJA 1WNOA 2MPHA 1HJVA 5DIUA 1SR0A 2ZQVA 1JNDA 3ARSA 4R5EA 2DT2A 3W4RA 2PPNA 1FFRA 2A3CA 1NH6A 4G50A 2DSWA 3CGMA 1E15A 2RUQA 4NNRA 3ARZA 2DSVA 3ARPA 3BMBA 3CH9A 3CGNA 1LL6A 3LUOA 1Q6IA 4LAYA 2B5UB 3ARWA 1FD9A 2G41A 1HKMA 2M2AA 3IKGA 1W9PA 1JNTA 3AROA 4IT6A 1NWTA 1ZL1A 4WKFA 1J4IA 4DWSD 5D75A 2DPEA 3G6LA 4QT2A 1F40A 2DT1A 4TYOA 2F4EA 3O5EA 2LGOA 3IKDA 4JFMA 1FAPA 4LAVA 4W5UA 1E6ZA 2RUDA 3O5FA 1H0GA 1QPFA 4DH0A 4U84A 5GQBA 4AY1A 5HW7A 3PRAA 3NRKA 4Q7NA 3ARQA 4C02B 1ZB5A 4Z2GA 3AQUA 2XP6A 4WIWA 3KZ7A 2PV2A 1UR8A 1YATA 1NWUA 1D6OA 4TW8A 2OLHA 1E6PA 1WB0A 4R0XA 4LAWA 3JXVA
chains in the Genus database with same CATH topology
5DEZA 3CZ8A 3TCZA 3WKZA 2WK2A 1TFVA 2XP4A 3O5GA 5DF0A 1EQ3A 1B6CA 2A3EA 3KAGA 4ML4A 2ZR4A 3CHCA 3OOBA 4WKAA 4Z2LA 2WLZA 4MGVA 1E6RA 3GPKA 4TW7A 3RM4A 3B8SA 2LKNA 2RSEA 1XHGA 2IUZA 5GPRA 1FFQA 1BL4A 3O5JA 1EIBA 1JVWA 1W9VA 1L1PA 4S3KA 2Q5AA 2N87A 4MNKA 3IHZA 1E9LA 1CTNA 2DSUA 2MLYA 1WAWA 2VN1A 4IPXA 4JYSA 3O5QA 1KT1A 5HKGA 2DT0A 1LQ0A 5HUAA 1XRVA 1H0IA 3BXWA 1HKKA 4Z2IA 4ODLA 1EHNA 2XPBA 1ZCNA 2K8IA 5GPGA 3PRBA 3B9EA 4DWSB 1FKLA 4DRPA 5JH8A 3UI5A 4DWSC 1W1TA 2M1IA 4L3NA 1VF8A 4ODNA 2AOSA 2XP3A 2XP9A 1FKSA 2ITKA 4GGQA 1OGGA 3CHFA 4MTVA 2M08A 4ODQA 2FAPA 2Y78A 5HBFA 1EYMA 4P8WA 5HW8A 3KADA 3H9RB 2WM0A 4W9OA 4JFLA 2AWGA 4Z2HA 3WD2A 3WQVA 2ESCA 1GOIA 1Q1CA 3UF8A 3AS1A 4ODOA 4DRHA 1E6NA 1KFWA 2O9OA 3EY6A 4ZPVR 3FXYA 4ODPA 3WD1A 3O5DA 4HARA 1FKIA 3B7XA 1ZK6A 4DT4A 1D7HA 3MDYB 3I6CA 4FAPA 3KAHA 2PI6A 3JYMA 3O5KA 1ROTA 2PV3A 1LL4A 1PBKA 1ZBVA 4J4NA 4S3JA 4DROA 4MNLA 4WKHA 3RGCA 2ZR6A 4MNMA 2XP8A 3UQAA 3CHDA 4U86A 3G6MA 1M5YA 3CHEA 1X6LA 1BKFA 3WH0A 3VAWA 1J4HA 2MLXA 3ALGA 1FJDA 3TDBA 4ITZA 1W1PA 4QIBA 4PTMA 2PBCA 3KAFA 4DRKA 2XP5A 2WLYA 1D2KA 3ALFA 2KI3A 2KGJA 1O6IA 4LAXA 2RURA 3NI6A 1HJWA 3ARYA 3KABA 1F8AB 1ZBCA 1ZU8A 1FKRA 3O5LA 1FKTA 4P8XA 1RD6A 2DG3A 2G8ZA 4GIVA 1NSGA 1R9HA 3KACA 3B9AA 5BXJA 4DRQA 2RQSA 1JNEA 2F21A 4FN2A 4TX0A 1KT0A 4ODMA 1GPFA 4N19A 4JFKA 4WJXA 4DZ3A 2MNTA 3ARRA 2YBTA 4JFJA 5I98A 1UR9A 2F2DA 1FKJA 1K9TA 1Y0OA 1U79A 1D7JA 1ZBWA 1OGBA 4DWSA 1FKKA 1JNSA 3ODKA 1ZBKA 4MAVA 4L72B 2FDMA 4IT4A 3WD0A 4LGXA 1QPLA 5B8IC 3RM9A 1HXVA 1W26A 4DRIA 3AS3A 4P8VA 2DG9A 2KO7A 4QT3A 5DO2A 3UI4A 4KQZA 2O92A 1NMVA 4MNJA 1ITXA 1P5QA 1YW5A 3ARXA 4WK9A 5HW6A 2LPVA 4XAKA 3IK8A 1C9HA 2FKEA 4U85A 2A3AA 2IF4A 1FKHA 3TC5A 1W1YA 1J4RA 1NMWA 2JZVA 4JFIA 4BF8A 1PINA 2ZQUA 4J4OA 2D9FA 1LG2A 3UQIA 2MLZA 1GUVA 2ZR5A 1QZ2A 2MF9A 1X6NA 3OA5A 2UZ5A 2YBUA 1HJXA 3WL0A 4HBEA 4TW6A 4ZS6A 2DG4A 1J6YA 2ZQSA 3UI6A 2RUCA 3FAPA 3WD3A 4ODRA 4MSPA 4MPKA 4DIPA 3O5PA 2PPPA 1A7XA 1W9UA 3ARUA 1LJYA 3AS0A 2ZQTA 5DIVA 4Z2KA 2LJ4A 1FKFA 4ZPTR 2PV1A 1T11A 2XPAA 4KR0B 3O5OA 2KR7A 5HWCA 1NWSA 4QZVB 3RM8A 5HTGA 2XP7A 3WQWA 4DRNA 2VCDA 1IX5A 2KE0A 4P8UA 3PRDA 5HWBA 4NSBA 2PPOA 1FKGA 1D7IA 3KCEA 3WD4A 4URIA 3WL1A 2OFNA 3B9DA 1LL7A 2KFWA 1Q6HA 4G2PA 1Q6UA 3PA7A 2A3BA 3FY1A 4Z2JA 3RFWA 4O2TA 1FKDA 3O5MA 3QOKA 3JYJA 1LG1A 4DRJA 1SYTA 1FKBA 2DT3A 3AS2A 3NTPA 1TCOC 4Q22A 4HBOA 3WIJA 4IQ2A 4NZCA 3ARTA 4ZPWR 4DZ2A 2DSZA 5J6EA 3O5IA 1EDQA 1NWRA 4W9QA 2L2SA 2B31A 3UQBA 1ROUA 1HKIA 4DRMA 1W1VA 4IQCA 4TNSA 3PR9A 3ARVA 1N1AA 3O5RA 4W9PA 3RMEA 2QF8A 4ODKA 1OWQA 5HT1A 3KAIA 5DITA 1HKJA 1WNOA 2MPHA 1HJVA 5DIUA 1SR0A 2ZQVA 1JNDA 3ARSA 4R5EA 2DT2A 3W4RA 2PPNA 1FFRA 2A3CA 1NH6A 4G50A 2DSWA 3CGMA 1E15A 2RUQA 4NNRA 3ARZA 2DSVA 3ARPA 3CH9A 3CGNA 1LL6A 3LUOA 1Q6IA 4LAYA 3ARWA 1FD9A 2G41A 1HKMA 2M2AA 3IKGA 1W9PA 1JNTA 3AROA 4IT6A 1NWTA 1ZL1A 4WKFA 1J4IA 4DWSD 5D75A 2DPEA 3G6LA 4QT2A 1F40A 2DT1A 4TYOA 2F4EA 3O5EA 2LGOA 3IKDA 4JFMA 1FAPA 4LAVA 4W5UA 1E6ZA 2RUDA 3O5FA 1H0GA 1QPFA 4DH0A 4U84A 5GQBA 4AY1A 5HW7A 3PRAA 3NRKA 4Q7NA 3ARQA 4C02B 1ZB5A 4Z2GA 3AQUA 2XP6A 4WIWA 3KZ7A 2PV2A 1UR8A 1YATA 1NWUA 1D6OA 4TW8A 2OLHA 1E6PA 1WB0A 4R0XA 4LAWA 3JXVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I6C A;  4FAP A;  2KO7 A;  4QT3 A;  3UI4 A;  3KAH A;  3TCZ A;  3JYM A;  3UQB A;  1ROU A;  3O5K A;  1ROT A;  2PV3 A;  4DRM A;  1PBK A;  4J4N A;  1NMV A;  4IQC A;  4DRO A;  4TNS A;  2XP4 A;  3O5G A;  1EQ3 A;  1B6C A;  1P5Q A;  1YW5 A;  1N1A A;  3O5R A;  3RGC A;  2ZR6 A;  3KAG A;  4W9P A;  2ZR4 A;  3OOB A;  2XP8 A;  4ODK A;  5HT1 A;  3UQA A;  4U86 A;  2LPV A;  3KAI A;  5HW6 A;  4MGV A;  5DIT A;  1M5Y A;  2MPH A;  1C9H A;  3GPK A;  2FKE A;  3IK8 A;  1BKF A;  5DIU A;  3WH0 A;  4TW7 A;  2LKN A;  2RSE A;  3VAW A;  2ZQV A;  1J4H A;  2MLX A;  4U85 A;  1FJD A;  3TDB A;  2IF4 A;  4ITZ A;  4QIB A;  1FKH A;  3TC5 A;  1BL4 A;  1J4R A;  1NMW A;  2JZV A;  2PBC A;  2PPN A;  3O5J A;  1PIN A;  1JVW A;  3KAF A;  2ZQU A;  4JFI A;  4BF8 A;  4J4O A;  2D9F A;  1L1P A;  4DRK A;  2XP5 A;  2Q5A A;  4G50 A;  2N87 A;  3UQI A;  2MLZ A;  3CGM A;  2RUQ A;  2ZR5 A;  3IHZ A;  2KI3 A;  1QZ2 A;  4NNR A;  2KGJ A;  2MF9 A;  4LAX A;  2RUR A;  3NI6 A;  2UZ5 A;  2MLY A;  2VN1 A;  3CGN A;  4IPX A;  3LUO A;  4JYS A;  3O5Q A;  1Q6I A;  1KT1 A;  4LAY A;  5HKG A;  3KAB A;  1FD9 A;  1F8A B;  4TW6 A;  5HUA A;  2DG4 A;  1J6Y A;  2M2A A;  3IKG A;  1JNT A;  1FKR A;  3O5L A;  1FKT A;  2ZQS A;  3UI6 A;  2RUC A;  3FAP A;  1J4I A;  2DG3 A;  4ODL A;  4ODR A;  4GIV A;  4MSP A;  1NSG A;  5D75 A;  2XPB A;  4DIP A;  1ZCN A;  2PPP A;  2K8I A;  3O5P A;  1A7X A;  1R9H A;  3KAC A;  5GPG A;  4QT2 A;  2ZQT A;  5DIV A;  3PRB A;  5BXJ A;  2LJ4 A;  1FKF A;  1FKL A;  4DRQ A;  1F40 A;  2PV1 A;  1T11 A;  2XPA A;  4DRP A;  4TYO A;  2RQS A;  3UI5 A;  3O5O A;  2KR7 A;  5HWC A;  5HTG A;  2XP7 A;  2M1I A;  2F4E A;  3O5E A;  4DRN A;  2VCD A;  2F21 A;  4FN2 A;  2KE0 A;  4ODN A;  2LGO A;  3IKD A;  3PRD A;  2XP3 A;  5HWB A;  4TX0 A;  1KT0 A;  1FKG A;  2PPO A;  2XP9 A;  4ODM A;  1D7I A;  3KCE A;  4N19 A;  4JFM A;  1FKS A;  2ITK A;  4JFK A;  4GGQ A;  1FAP A;  2OFN A;  4DZ3 A;  4LAV A;  2MNT A;  2M08 A;  2KFW A;  4ODQ A;  1Q6H A;  4G2P A;  2FAP A;  2RUD A;  4JFJ A;  1Q6U A;  2Y78 A;  3O5F A;  5I98 A;  1EYM A;  3PA7 A;  1QPF A;  2F2D A;  3KAD A;  5HW8 A;  1FKJ A;  1Y0O A;  3H9R B;  4DH0 A;  4W9O A;  1U79 A;  4JFL A;  2AWG A;  1D7J A;  4U84 A;  3RFW A;  4O2T A;  1FKD A;  3O5M A;  5HW7 A;  3JYJ A;  3NRK A;  4DRJ A;  4C02 B;  1FKB A;  1FKK A;  1JNS A;  3ODK A;  1Q1C A;  3NTP A;  3UF8 A;  1TCO C;  2XP6 A;  4ODO A;  3KZ7 A;  4DRH A;  2PV2 A;  4IQ2 A;  3EY6 A;  1YAT A;  1QPL A;  5B8I C;  1D6O A;  4TW8 A;  4DZ2 A;  1HXV A;  4ODP A;  1W26 A;  3O5D A;  4R0X A;  5J6E A;  3O5I A;  1FKI A;  3B7X A;  4LAW A;  1ZK6 A;  4W9Q A;  4DT4 A;  3JXV A;  4DRI A;  2L2S A;  1D7H A;  2DG9 A;  3MDY B; 
#chains in the Genus database with same CATH topology
 5DEZ A;  3CZ8 A;  3TCZ A;  3WKZ A;  2WK2 A;  1TFV A;  2XP4 A;  3O5G A;  5DF0 A;  1EQ3 A;  1E44 A;  1B6C A;  2A3E A;  3KAG A;  4ML4 A;  2ZR4 A;  3CHC A;  3OOB A;  4WKA A;  4Z2L A;  2WLZ A;  4MGV A;  1E6R A;  3GPK A;  4TW7 A;  3RM4 A;  3B8S A;  2LKN A;  2RSE A;  1XHG A;  2IUZ A;  5GPR A;  1FFQ A;  3GU0 A;  2ETN A;  1BL4 A;  3O5J A;  1EIB A;  1JVW A;  1W9V A;  1L1P A;  4S3K A;  2Q5A A;  2N87 A;  4MNK A;  3IHZ A;  1E9L A;  1CTN A;  2DSU A;  2MLY A;  1WAW A;  2VN1 A;  4IPX A;  4JYS A;  3O5Q A;  1KT1 A;  5HKG A;  2DT0 A;  1LQ0 A;  5HUA A;  1XRV A;  1H0I A;  3BXW A;  1HKK A;  4Z2I A;  4ODL A;  1EHN A;  2XPB A;  1ZCN A;  2K8I A;  5GPG A;  3PRB A;  3B9E A;  4DWS B;  1FKL A;  4DRP A;  5JH8 A;  3UI5 A;  4DWS C;  1W1T A;  2M1I A;  4L3N A;  1VF8 A;  4ODN A;  2AOS A;  2XP3 A;  2XP9 A;  1FKS A;  2ITK A;  4GGQ A;  1OGG A;  3CHF A;  4MTV A;  2M08 A;  4ODQ A;  2FAP A;  2Y78 A;  5HBF A;  1EYM A;  4P8W A;  5HW8 A;  3KAD A;  3H9R B;  2WM0 A;  4W9O A;  4JFL A;  2AWG A;  4Z2H A;  3WD2 A;  3WQV A;  2ESC A;  1GOI A;  1Q1C A;  3UF8 A;  3AS1 A;  4ODO A;  4DRH A;  1E6N A;  1KFW A;  2O9O A;  3EY6 A;  4ZPV R;  3FXY A;  4ODP A;  3WD1 A;  3O5D A;  4HAR A;  1FKI A;  3B7X A;  1ZK6 A;  4DT4 A;  1D7H A;  3MDY B;  3I6C A;  4FAP A;  3KAH A;  2PI6 A;  3JYM A;  3O5K A;  1ROT A;  2PV3 A;  1LL4 A;  1PBK A;  1ZBV A;  4J4N A;  4S3J A;  4DRO A;  4MNL A;  4WKH A;  3RGC A;  2ZR6 A;  4MNM A;  2XP8 A;  3UQA A;  3CHD A;  4U86 A;  3G6M A;  1M5Y A;  3CHE A;  1X6L A;  1BKF A;  3WH0 A;  3VAW A;  1J4H A;  2MLX A;  3ALG A;  1FJD A;  3TDB A;  4ITZ A;  1W1P A;  4QIB A;  4PTM A;  2PBC A;  3KAF A;  4DRK A;  2F23 A;  2XP5 A;  2WLY A;  1D2K A;  3ALF A;  2KI3 A;  2KGJ A;  1O6I A;  4LAX A;  2RUR A;  3NI6 A;  1HJW A;  3ARY A;  3KAB A;  1F8A B;  1ZBC A;  1ZU8 A;  1FKR A;  3O5L A;  1FKT A;  4P8X A;  1RD6 A;  2DG3 A;  2G8Z A;  4GIV A;  1NSG A;  1R9H A;  3KAC A;  3GTY X;  3EIP A;  3B9A A;  5BXJ A;  4DRQ A;  2RQS A;  1JNE A;  1GRJ A;  2F21 A;  4FN2 A;  4TX0 A;  1KT0 A;  4ODM A;  1GPF A;  4N19 A;  4JFK A;  4WJX A;  4DZ3 A;  2MNT A;  3ARR A;  2YBT A;  4JFJ A;  5I98 A;  1UR9 A;  2F2D A;  1FKJ A;  1K9T A;  1Y0O A;  1U79 A;  1D7J A;  1ZBW A;  1OGB A;  4DWS A;  1FKK A;  4UDM A;  1JNS A;  3ODK A;  1ZBK A;  4MAV A;  4L72 B;  2FDM A;  4IT4 A;  3WD0 A;  4LGX A;  1QPL A;  5B8I C;  3RM9 A;  1HXV A;  1W26 A;  4DRI A;  3AS3 A;  4P8V A;  2DG9 A;  2KO7 A;  4QT3 A;  5DO2 A;  3UI4 A;  4KQZ A;  2O92 A;  1NMV A;  4MNJ A;  1ITX A;  1P5Q A;  1YW5 A;  3ARX A;  4WK9 A;  5HW6 A;  2LPV A;  4XAK A;  3IK8 A;  1C9H A;  2FKE A;  4U85 A;  2A3A A;  2IF4 A;  1FKH A;  3TC5 A;  1W1Y A;  1J4R A;  1NMW A;  2JZV A;  4JFI A;  4BF8 A;  1PIN A;  2ZQU A;  4J4O A;  2D9F A;  1LG2 A;  3UQI A;  2MLZ A;  1GUV A;  2ZR5 A;  1QZ2 A;  2MF9 A;  1X6N A;  3OA5 A;  2EUL A;  2UZ5 A;  2YBU A;  1HJX A;  3WL0 A;  4HBE A;  4TW6 A;  4ZS6 A;  2DG4 A;  1J6Y A;  2ZQS A;  3UI6 A;  2RUC A;  3FAP A;  3WD3 A;  4ODR A;  4MSP A;  4MPK A;  4DIP A;  3O5P A;  2PPP A;  1A7X A;  1W9U A;  3ARU A;  1LJY A;  3AS0 A;  2ZQT A;  5DIV A;  4Z2K A;  2LJ4 A;  1FKF A;  4ZPT R;  2PV1 A;  1T11 A;  2P4V A;  2XPA A;  4KR0 B;  3O5O A;  2KR7 A;  5HWC A;  1NWS A;  4QZV B;  3RM8 A;  5HTG A;  2XP7 A;  3WQW A;  4DRN A;  2VCD A;  1IX5 A;  2KE0 A;  4P8U A;  3PRD A;  5HWB A;  4NSB A;  2PPO A;  1FKG A;  1D7I A;  3KCE A;  3WD4 A;  4URI A;  3WL1 A;  2OFN A;  3B9D A;  1LL7 A;  2KFW A;  1Q6H A;  4G2P A;  1Q6U A;  3PA7 A;  2A3B A;  3FY1 A;  4Z2J A;  3RFW A;  4O2T A;  1FKD A;  3O5M A;  3QOK A;  3JYJ A;  1LG1 A;  4DRJ A;  1SYT A;  1FKB A;  2PN0 A;  2DT3 A;  3AS2 A;  3NTP A;  1TCO C;  4Q22 A;  4HBO A;  3WIJ A;  4IQ2 A;  4NZC A;  3ART A;  4ZPW R;  4DZ2 A;  2DSZ A;  5J6E A;  3O5I A;  1EDQ A;  1NWR A;  4W9Q A;  2L2S A;  1JCH B;  2B31 A;  3UQB A;  1ROU A;  1HKI A;  4DRM A;  1W1V A;  4IQC A;  4TNS A;  3PR9 A;  3ARV A;  1N1A A;  3O5R A;  4W9P A;  3RME A;  2QF8 A;  4ODK A;  1OWQ A;  5HT1 A;  3KAI A;  5DIT A;  1HKJ A;  1WNO A;  2MPH A;  1HJV A;  5DIU A;  1SR0 A;  2ZQV A;  1JND A;  3ARS A;  4R5E A;  2DT2 A;  3W4R A;  2PPN A;  1FFR A;  2A3C A;  1NH6 A;  4G50 A;  2DSW A;  3CGM A;  1E15 A;  2RUQ A;  4NNR A;  3ARZ A;  2DSV A;  3ARP A;  3BMB A;  3CH9 A;  3CGN A;  1LL6 A;  3LUO A;  1Q6I A;  4LAY A;  2B5U B;  3ARW A;  1FD9 A;  2G41 A;  1HKM A;  2M2A A;  3IKG A;  1W9P A;  1JNT A;  3ARO A;  4IT6 A;  1NWT A;  1ZL1 A;  4WKF A;  1J4I A;  4DWS D;  5D75 A;  2DPE A;  3G6L A;  4QT2 A;  1F40 A;  2DT1 A;  4TYO A;  2F4E A;  3O5E A;  2LGO A;  3IKD A;  4JFM A;  1FAP A;  4LAV A;  4W5U A;  1E6Z A;  2RUD A;  3O5F A;  1H0G A;  1QPF A;  4DH0 A;  4U84 A;  5GQB A;  4AY1 A;  5HW7 A;  3PRA A;  3NRK A;  4Q7N A;  3ARQ A;  4C02 B;  1ZB5 A;  4Z2G A;  3AQU A;  2XP6 A;  4WIW A;  3KZ7 A;  2PV2 A;  1UR8 A;  1YAT A;  1NWU A;  1D6O A;  4TW8 A;  2OLH A;  1E6P A;  1WB0 A;  4R0X A;  4LAW A;  3JXV A; 
#chains in the Genus database with same CATH homology
 5DEZ A;  3CZ8 A;  3TCZ A;  3WKZ A;  2WK2 A;  1TFV A;  2XP4 A;  3O5G A;  5DF0 A;  1EQ3 A;  1B6C A;  2A3E A;  3KAG A;  4ML4 A;  2ZR4 A;  3CHC A;  3OOB A;  4WKA A;  4Z2L A;  2WLZ A;  4MGV A;  1E6R A;  3GPK A;  4TW7 A;  3RM4 A;  3B8S A;  2LKN A;  2RSE A;  1XHG A;  2IUZ A;  5GPR A;  1FFQ A;  1BL4 A;  3O5J A;  1EIB A;  1JVW A;  1W9V A;  1L1P A;  4S3K A;  2Q5A A;  2N87 A;  4MNK A;  3IHZ A;  1E9L A;  1CTN A;  2DSU A;  2MLY A;  1WAW A;  2VN1 A;  4IPX A;  4JYS A;  3O5Q A;  1KT1 A;  5HKG A;  2DT0 A;  1LQ0 A;  5HUA A;  1XRV A;  1H0I A;  3BXW A;  1HKK A;  4Z2I A;  4ODL A;  1EHN A;  2XPB A;  1ZCN A;  2K8I A;  5GPG A;  3PRB A;  3B9E A;  4DWS B;  1FKL A;  4DRP A;  5JH8 A;  3UI5 A;  4DWS C;  1W1T A;  2M1I A;  4L3N A;  1VF8 A;  4ODN A;  2AOS A;  2XP3 A;  2XP9 A;  1FKS A;  2ITK A;  4GGQ A;  1OGG A;  3CHF A;  4MTV A;  2M08 A;  4ODQ A;  2FAP A;  2Y78 A;  5HBF A;  1EYM A;  4P8W A;  5HW8 A;  3KAD A;  3H9R B;  2WM0 A;  4W9O A;  4JFL A;  2AWG A;  4Z2H A;  3WD2 A;  3WQV A;  2ESC A;  1GOI A;  1Q1C A;  3UF8 A;  3AS1 A;  4ODO A;  4DRH A;  1E6N A;  1KFW A;  2O9O A;  3EY6 A;  4ZPV R;  3FXY A;  4ODP A;  3WD1 A;  3O5D A;  4HAR A;  1FKI A;  3B7X A;  1ZK6 A;  4DT4 A;  1D7H A;  3MDY B;  3I6C A;  4FAP A;  3KAH A;  2PI6 A;  3JYM A;  3O5K A;  1ROT A;  2PV3 A;  1LL4 A;  1PBK A;  1ZBV A;  4J4N A;  4S3J A;  4DRO A;  4MNL A;  4WKH A;  3RGC A;  2ZR6 A;  4MNM A;  2XP8 A;  3UQA A;  3CHD A;  4U86 A;  3G6M A;  1M5Y A;  3CHE A;  1X6L A;  1BKF A;  3WH0 A;  3VAW A;  1J4H A;  2MLX A;  3ALG A;  1FJD A;  3TDB A;  4ITZ A;  1W1P A;  4QIB A;  4PTM A;  2PBC A;  3KAF A;  4DRK A;  2XP5 A;  2WLY A;  1D2K A;  3ALF A;  2KI3 A;  2KGJ A;  1O6I A;  4LAX A;  2RUR A;  3NI6 A;  1HJW A;  3ARY A;  3KAB A;  1F8A B;  1ZBC A;  1ZU8 A;  1FKR A;  3O5L A;  1FKT A;  4P8X A;  1RD6 A;  2DG3 A;  2G8Z A;  4GIV A;  1NSG A;  1R9H A;  3KAC A;  3B9A A;  5BXJ A;  4DRQ A;  2RQS A;  1JNE A;  2F21 A;  4FN2 A;  4TX0 A;  1KT0 A;  4ODM A;  1GPF A;  4N19 A;  4JFK A;  4WJX A;  4DZ3 A;  2MNT A;  3ARR A;  2YBT A;  4JFJ A;  5I98 A;  1UR9 A;  2F2D A;  1FKJ A;  1K9T A;  1Y0O A;  1U79 A;  1D7J A;  1ZBW A;  1OGB A;  4DWS A;  1FKK A;  1JNS A;  3ODK A;  1ZBK A;  4MAV A;  4L72 B;  2FDM A;  4IT4 A;  3WD0 A;  4LGX A;  1QPL A;  5B8I C;  3RM9 A;  1HXV A;  1W26 A;  4DRI A;  3AS3 A;  4P8V A;  2DG9 A;  2KO7 A;  4QT3 A;  5DO2 A;  3UI4 A;  4KQZ A;  2O92 A;  1NMV A;  4MNJ A;  1ITX A;  1P5Q A;  1YW5 A;  3ARX A;  4WK9 A;  5HW6 A;  2LPV A;  4XAK A;  3IK8 A;  1C9H A;  2FKE A;  4U85 A;  2A3A A;  2IF4 A;  1FKH A;  3TC5 A;  1W1Y A;  1J4R A;  1NMW A;  2JZV A;  4JFI A;  4BF8 A;  1PIN A;  2ZQU A;  4J4O A;  2D9F A;  1LG2 A;  3UQI A;  2MLZ A;  1GUV A;  2ZR5 A;  1QZ2 A;  2MF9 A;  1X6N A;  3OA5 A;  2UZ5 A;  2YBU A;  1HJX A;  3WL0 A;  4HBE A;  4TW6 A;  4ZS6 A;  2DG4 A;  1J6Y A;  2ZQS A;  3UI6 A;  2RUC A;  3FAP A;  3WD3 A;  4ODR A;  4MSP A;  4MPK A;  4DIP A;  3O5P A;  2PPP A;  1A7X A;  1W9U A;  3ARU A;  1LJY A;  3AS0 A;  2ZQT A;  5DIV A;  4Z2K A;  2LJ4 A;  1FKF A;  4ZPT R;  2PV1 A;  1T11 A;  2XPA A;  4KR0 B;  3O5O A;  2KR7 A;  5HWC A;  1NWS A;  4QZV B;  3RM8 A;  5HTG A;  2XP7 A;  3WQW A;  4DRN A;  2VCD A;  1IX5 A;  2KE0 A;  4P8U A;  3PRD A;  5HWB A;  4NSB A;  2PPO A;  1FKG A;  1D7I A;  3KCE A;  3WD4 A;  4URI A;  3WL1 A;  2OFN A;  3B9D A;  1LL7 A;  2KFW A;  1Q6H A;  4G2P A;  1Q6U A;  3PA7 A;  2A3B A;  3FY1 A;  4Z2J A;  3RFW A;  4O2T A;  1FKD A;  3O5M A;  3QOK A;  3JYJ A;  1LG1 A;  4DRJ A;  1SYT A;  1FKB A;  2DT3 A;  3AS2 A;  3NTP A;  1TCO C;  4Q22 A;  4HBO A;  3WIJ A;  4IQ2 A;  4NZC A;  3ART A;  4ZPW R;  4DZ2 A;  2DSZ A;  5J6E A;  3O5I A;  1EDQ A;  1NWR A;  4W9Q A;  2L2S A;  2B31 A;  3UQB A;  1ROU A;  1HKI A;  4DRM A;  1W1V A;  4IQC A;  4TNS A;  3PR9 A;  3ARV A;  1N1A A;  3O5R A;  4W9P A;  3RME A;  2QF8 A;  4ODK A;  1OWQ A;  5HT1 A;  3KAI A;  5DIT A;  1HKJ A;  1WNO A;  2MPH A;  1HJV A;  5DIU A;  1SR0 A;  2ZQV A;  1JND A;  3ARS A;  4R5E A;  2DT2 A;  3W4R A;  2PPN A;  1FFR A;  2A3C A;  1NH6 A;  4G50 A;  2DSW A;  3CGM A;  1E15 A;  2RUQ A;  4NNR A;  3ARZ A;  2DSV A;  3ARP A;  3CH9 A;  3CGN A;  1LL6 A;  3LUO A;  1Q6I A;  4LAY A;  3ARW A;  1FD9 A;  2G41 A;  1HKM A;  2M2A A;  3IKG A;  1W9P A;  1JNT A;  3ARO A;  4IT6 A;  1NWT A;  1ZL1 A;  4WKF A;  1J4I A;  4DWS D;  5D75 A;  2DPE A;  3G6L A;  4QT2 A;  1F40 A;  2DT1 A;  4TYO A;  2F4E A;  3O5E A;  2LGO A;  3IKD A;  4JFM A;  1FAP A;  4LAV A;  4W5U A;  1E6Z A;  2RUD A;  3O5F A;  1H0G A;  1QPF A;  4DH0 A;  4U84 A;  5GQB A;  4AY1 A;  5HW7 A;  3PRA A;  3NRK A;  4Q7N A;  3ARQ A;  4C02 B;  1ZB5 A;  4Z2G A;  3AQU A;  2XP6 A;  4WIW A;  3KZ7 A;  2PV2 A;  1UR8 A;  1YAT A;  1NWU A;  1D6O A;  4TW8 A;  2OLH A;  1E6P A;  1WB0 A;  4R0X A;  4LAW A;  3JXV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...