5J6EA

Structure of disulfide crosslinked a. fumigatus fkbp12(v91c)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
111
structure length
111
Chain Sequence
MGVTKELKSPGNGVDFPKKGDFVTIHYTGRLTDGSKFDSSVDRNEPFQTQIGTGRVIKGWDEGVPQMSLGEKAVLTITPDYGYGARGFPPCIPGNSTLIFEVELLGINNKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Neosartorya fumigata (strain atcc mya-4609 / af293 / cbs 101355 / fgsc a1100)
molecule tags Isomerase
molecule keywords FK506-binding protein 1A
total genus 27
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5j6eA00
3O5QA 4JFMA 1BL4A 2L2SA 2DG9A 2PV2A 3H9RB 1EQ3A 3NTPA 4DRHA 2MF9A 2ZR4A 4LAXA 3UI5A 1BKFA 5HWBA 1T11A 4GGQA 2PPNA 4J4NA 4DRPA 1F40A 2ZQUA 2F2DA 1FKJA 4JFKA 3IHZA 5GPGA 1J4RA 2PBCA 2KR7A 1N1AA 1D7JA 4MGVA 5DITA 2XP7A 4MSPA 4DZ3A 4C02B 4W9OA 1FKSA 3O5JA 4IQCA 2XPBA 4ODPA 5I98A 2VN1A 3O5OA 4DH0A 3KACA 4TW6A 5BXJA 3JYJA 3UQAA 1ROTA 3LUOA 3UF8A 1FKLA 3PRBA 4O2TA 3KAIA 4DIPA 2XP6A 2Y78A 2LKNA 2XP4A 2DG3A 4LAYA 3WH0A 5HWCA 2MLYA 5D75A 1P5QA 3GPKA 1FD9A 1PBKA 2XP3A 2PV1A 4DRIA 5HW6A 4U86A 1ZK6A 2XP9A 3KADA 4ODQA 2LGOA 4ODMA 1W26A 1Y0OA 1FAPA 4FAPA 1D7HA 1FKHA 3KABA 1D7IA 2PV3A 1YW5A 3KAFA 1M5YA 4N19A 3O5PA 5B8IC 1ROUA 4DRJA 3ODKA 4GIVA 2MLZA 3PA7A 2KE0A 1A7XA 3NRKA 4ITZA 4NNRA 3B7XA 1QPFA 3KCEA 3O5LA 1TCOC 3O5RA 3JYMA 4TW8A 3TC5A 3IK8A 1HXVA 3UI6A 2RSEA 3NI6A 4TYOA 2MNTA 3JXVA 1JNTA 2RUQA 2RURA 1Q1CA 2XPAA 3O5FA 4IPXA 2OFNA 3MDYB 3IKDA 2FKEA 2MLXA 4BF8A 1J6YA 2MPHA 2DG4A 2LJ4A 4JFIA 1EYMA 3PRDA 1FKTA 2XP8A 3UQIA 1JVWA 4DROA 1PINA 2XP5A 3OOBA 2RUDA 1FKBA 1U79A 1D6OA 4LAVA 4ODKA 1FKDA 4W9PA 1NSGA 2K8IA 1ZCNA 2Q5AA 3O5GA 3O5EA 5DIVA 1Q6UA 2D9FA 2KFWA 3CGMA 2F4EA 3VAWA 4DT4A 4G2PA 4W9QA 2PPOA 2M1IA 4FN2A 1FKRA 3EY6A 4JFLA 2IF4A 4DRKA 1C9HA 4ODLA 5HUAA 1FKFA 2JZVA 1NMWA 4G50A 4TW7A 2ITKA 5HT1A 4QT2A 2ZQTA 4DZ2A 3UQBA 1FJDA 4QT3A 2VCDA 3KZ7A 4QIBA 4DRQA 3O5KA 5DIUA 3O5DA 2M08A 1YATA 4J4OA 3IKGA 2FAPA 2ZQVA 3KAGA 4TNSA 1Q6HA 3TCZA 2AWGA 4ODOA 5HW7A 4ODRA 4R0XA 4LAWA 4ODNA 5HTGA 1QPLA 2ZQSA 1KT0A 3O5MA 2ZR5A 1JNSA 1QZ2A 2KI3A 2RQSA 4IQ2A 4U84A 1J4IA 2PPPA 3RGCA 2KO7A 1F8AB 1NMVA 1FKGA 2M2AA 4DRNA 1J4HA 2UZ5A 1FKKA 3TDBA 4TX0A 4U85A 3O5IA 3UI4A 2KGJA 1R9HA 2F21A 2ZR6A 2RUCA 3FAPA 1Q6IA 3I6CA 1KT1A 4JYSA 4DRMA 5HKGA 5HW8A 3KAHA 1L1PA 1FKIA 4JFJA 1B6CA 3RFWA 2LPVA 3CGNA 2N87A 5J6EA
chains in the Genus database with same CATH superfamily
3RMEA 3B8SA 4MAVA 1BL4A 2PV2A 3WL1A 4DRHA 1GUVA 1T11A 2PPNA 1W1VA 3IHZA 4WJXA 1J4RA 2PBCA 5DITA 1N1AA 2A3EA 2F23A 3WL0A 3ARQA 4DZ3A 1ZB5A 4Z2IA 3O5JA 1HKMA 4WIWA 4S3JA 3KACA 4TW6A 5BXJA 5GPRA 3UQAA 2YBUA 3PRBA 1OGBA 4LAYA 2LKNA 3WH0A 2O92A 3FY1A 3ALGA 1EHNA 3GPKA 2DPEA 1UR8A 4DRIA 3KADA 2LGOA 3AS3A 4ODMA 4DWSD 1D7IA 3CHCA 4MNJA 1M5YA 1ROUA 3PA7A 3UI4A 3KCEA 1TCOC 2DT3A 3WKZA 2RUQA 3O5FA 2OFNA 1NWRA 2DG4A 3PRDA 3W4RA 4DROA 4QZVB 2DSWA 1GRJA 4W9PA 4ODKA 1FKDA 2K8IA 1EQ3A 1ZCNA 2Q5AA 1L1PA 3ARVA 3WD3A 1W1PA 4W9QA 4DRKA 5GQBA 4ODLA 1LG1A 5DF0A 1FFQA 4KQZA 1H0IA 1FJDA 2A3CA 2VCDA 4Q22A 4DRQA 5DIUA 4J4OA 2QF8A 1VF8A 3KAGA 4KR0B 4TNSA 4ODRA 4R0XA 3AS1A 1KT0A 2ZR5A 2DSVA 2PPPA 3BXWA 2DSZA 2FDMA 1FKKA 4WKHA 4ZPTR 3ARWA 3TDBA 4U85A 1HKIA 2AOSA 1E6NA 2ZR6A 1GOIA 1HJXA 2LPVA 1E15A 5J6EA 1W9VA 1XHGA 2P4VA 1E9LA 3NTPA 1EIBA 3B9EA 4L72B 4WKFA 4GGQA 1F40A 2F2DA 5GPGA 2KR7A 4MGVA 1ZBKA 3FXYA 3GU0A 2WM0A 4ODPA 5I98A 2G8ZA 2A3AA 1IX5A 3WD2A 3O5OA 4DH0A 4NSBA 3JYJA 3AQUA 1ROTA 4HBEA 4DIPA 3ARPA 4HARA 2XP6A 5HWCA 3ARRA 1E6PA 5D75A 1FD9A 2PV1A 1ZK6A 1HKJA 1W26A 2EULA 4IT6A 1GPFA 3O5PA 4MNMA 4MNKA 1X6NA 4NNRA 3NRKA 2PN0A 3B7XA 3G6MA 3RM9A 3UI6A 3NI6A 2MNTA 1JNTA 4IPXA 4BF8A 1J6YA 1X6LA 2MPHA 4ZPWR 2DSUA 2XP8A 1HJWA 1CTNA 1E6ZA 5JH8A 1ZL1A 1D6OA 1NSGA 1OWQA 5HW6A 3O5GA 1JNSA 2F4EA 2PPOA 3EY6A 2IF4A 3GTYX 1C9HA 3CHFA 5HUAA 4QT2A 2ZQTA 3UQBA 3BMBA 1KFWA 3O5KA 2FAPA 2ZQVA 1EDQA 2YBTA 1Q6HA 4URIA 4ODOA 4S3KA 4ODNA 2ZQSA 4L3NA 5DO2A 3WIJA 3RGCA 2IUZA 1F8AB 1NMVA 4DRNA 4DWSA 1J4HA 2UZ5A 3O5IA 1NWTA 1KT1A 4DRMA 1FKIA 4JFJA 4XAKA 1B6CA 1ZBVA 1LJYA 2RUDA 3CGNA 2N87A 3O5QA 4JFMA 1HJVA 2G41A 4P8XA 1NWSA 3EIPA 2L2SA 3H9RB 4IT4A 4LGXA 4AY1A 1HKKA 2ZR4A 3UI5A 1LL6A 4JFKA 1D7JA 4MSPA 1ITXA 4W9OA 4IQCA 4ZS6A 1SR0A 1XRVA 1FKLA 4O2TA 3RM4A 2ESCA 1WNOA 2Y78A 4Z2LA 1W1YA 2DG3A 2XP4A 4W5UA 3ARSA 2MLYA 1P5QA 1PBKA 2B5UB 3KABA 3KAFA 1O6IA 3ODKA 3B9DA 2KE0A 1A7XA 4ITZA 4TW8A 3O5LA 3O5RA 3TC5A 1HXVA 4P8WA 4TYOA 3JXVA 1Q1CA 3MDYB 3B9AA 3IKDA 1FFRA 4JFIA 1EYMA 1FKTA 3UQIA 2PI6A 1JVWA 4WK9A 2ETNA 4LAVA 3OOBA 1FKBA 1U79A 3QOKA 2DT1A 3O5EA 5DIVA 2D9FA 4DT4A 4G2PA 1FKFA 4TW7A 5HT1A 4QT3A 3KZ7A 1OGGA 3O5DA 1LG2A 3TCZA 1UR9A 5HTGA 1W9UA 2O9OA 3O5MA 1QZ2A 4IQ2A 2KO7A 3CZ8A 2WK2A 3ARXA 2M2AA 4Z2JA 1JNDA 4WKAA 2KGJA 1R9HA 3FAPA 2RUCA 4ZPVR 5HKGA 3OA5A 1SYTA 5HW8A 3KAHA 2WLZA 2OLHA 3ARTA 1LL4A 3CHEA 2DG9A 3CHDA 2MF9A 4LAXA 1D2KA 5HWBA 1K9TA 1LQ0A 3AROA 4J4NA 4DRPA 2ZQUA 1FKJA 1WAWA 3PR9A 2XP7A 2B31A 3G6LA 4C02B 1ZBCA 3WQWA 1FKSA 2XPBA 2WLYA 2VN1A 3RM8A 4R5EA 4Z2HA 4UDMA 3LUOA 3UF8A 3KAIA 4DWSC 2DT0A 5HBFA 1TFVA 2XP3A 4U86A 2XP9A 4ODQA 4FAPA 1Y0OA 1FAPA 1D7HA 1FKHA 4MNLA 1E44A 2PV3A 1YW5A 3PRAA 4N19A 4DWSB 5B8IC 1H0GA 4DRJA 4GIVA 4P8VA 1JNEA 2MLZA 3CH9A 1QPFA 3JYMA 3IK8A 2RSEA 1ZBWA 2DT2A 2RURA 2XPAA 4Z2GA 4MPKA 2FKEA 2MLXA 2LJ4A 3ARUA 1NH6A 1WB0A 1LL7A 1W9PA 5DEZA 3ALFA 3AS2A 1PINA 2XP5A 4HBOA 3VAWA 1Q6UA 2KFWA 3CGMA 1JCHB 2M1IA 4FN2A 3AS0A 3WD4A 4JFLA 1FKRA 3ARYA 2JZVA 4G50A 1NMWA 4Z2KA 4DZ2A 2ITKA 4Q7NA 4QIBA 3WD0A 1E6RA 2M08A 4ML4A 1YATA 3IKGA 2AWGA 4MTVA 5HW7A 4LAWA 1QPLA 4PTMA 2A3BA 2RQSA 2KI3A 4U84A 1ZU8A 1J4IA 4P8UA 1FKGA 1RD6A 1NWUA 4TX0A 3WD1A 3I6CA 2F21A 1Q6IA 4JYSA 3ARZA 3WQVA 1W1TA 3RFWA 4NZCA 1BKFA
chains in the Genus database with same CATH topology
3RMEA 3B8SA 4MAVA 1BL4A 2PV2A 3WL1A 4DRHA 1GUVA 1T11A 2PPNA 1W1VA 3IHZA 4WJXA 1J4RA 2PBCA 5DITA 1N1AA 2A3EA 3WL0A 3ARQA 4DZ3A 1ZB5A 4Z2IA 3O5JA 1HKMA 4WIWA 4S3JA 3KACA 4TW6A 5BXJA 5GPRA 3UQAA 2YBUA 3PRBA 1OGBA 4LAYA 2LKNA 3WH0A 2O92A 3FY1A 3ALGA 1EHNA 3GPKA 2DPEA 1UR8A 4DRIA 3KADA 2LGOA 3AS3A 4ODMA 4DWSD 1D7IA 3CHCA 4MNJA 1M5YA 1ROUA 3PA7A 3UI4A 3KCEA 1TCOC 2DT3A 3WKZA 2RUQA 3O5FA 2OFNA 1NWRA 2DG4A 3PRDA 3W4RA 4DROA 4QZVB 2DSWA 4W9PA 4ODKA 1FKDA 2K8IA 1EQ3A 1ZCNA 2Q5AA 1L1PA 3ARVA 3WD3A 1W1PA 4W9QA 4DRKA 5GQBA 4ODLA 1LG1A 5DF0A 1FFQA 4KQZA 1H0IA 1FJDA 2A3CA 2VCDA 4Q22A 4DRQA 5DIUA 4J4OA 2QF8A 1VF8A 3KAGA 4KR0B 4TNSA 4ODRA 4R0XA 3AS1A 1KT0A 2ZR5A 2DSVA 2PPPA 3BXWA 2DSZA 2FDMA 1FKKA 4WKHA 4ZPTR 3ARWA 3TDBA 4U85A 1HKIA 2AOSA 1E6NA 2ZR6A 1GOIA 1HJXA 2LPVA 1E15A 5J6EA 1W9VA 1XHGA 1E9LA 3NTPA 1EIBA 3B9EA 4L72B 4WKFA 4GGQA 1F40A 2F2DA 5GPGA 2KR7A 4MGVA 1ZBKA 3FXYA 2WM0A 4ODPA 5I98A 2G8ZA 2A3AA 1IX5A 3WD2A 3O5OA 4DH0A 4NSBA 3JYJA 3AQUA 1ROTA 4HBEA 4DIPA 3ARPA 4HARA 2XP6A 5HWCA 3ARRA 1E6PA 5D75A 1FD9A 2PV1A 1ZK6A 1HKJA 1W26A 4IT6A 1GPFA 3O5PA 4MNMA 4MNKA 1X6NA 4NNRA 3NRKA 3B7XA 3G6MA 3RM9A 3UI6A 3NI6A 2MNTA 1JNTA 4IPXA 4BF8A 1J6YA 1X6LA 2MPHA 4ZPWR 2DSUA 2XP8A 1HJWA 1CTNA 1E6ZA 5JH8A 1ZL1A 1D6OA 1NSGA 1OWQA 5HW6A 3O5GA 1JNSA 2F4EA 2PPOA 3EY6A 2IF4A 1C9HA 3CHFA 5HUAA 4QT2A 2ZQTA 3UQBA 1KFWA 3O5KA 2FAPA 2ZQVA 1EDQA 2YBTA 1Q6HA 4URIA 4ODOA 4S3KA 4ODNA 2ZQSA 4L3NA 5DO2A 3WIJA 3RGCA 2IUZA 1F8AB 1NMVA 4DRNA 4DWSA 1J4HA 2UZ5A 3O5IA 1NWTA 1KT1A 4DRMA 1FKIA 4JFJA 4XAKA 1B6CA 1ZBVA 1LJYA 2RUDA 3CGNA 2N87A 3O5QA 4JFMA 1HJVA 2G41A 4P8XA 1NWSA 2L2SA 3H9RB 4IT4A 4LGXA 4AY1A 1HKKA 2ZR4A 3UI5A 1LL6A 4JFKA 1D7JA 4MSPA 1ITXA 4W9OA 4IQCA 4ZS6A 1SR0A 1XRVA 1FKLA 4O2TA 3RM4A 2ESCA 1WNOA 2Y78A 4Z2LA 1W1YA 2DG3A 2XP4A 4W5UA 3ARSA 2MLYA 1P5QA 1PBKA 3KABA 3KAFA 1O6IA 3ODKA 3B9DA 2KE0A 1A7XA 4ITZA 4TW8A 3O5LA 3O5RA 3TC5A 1HXVA 4P8WA 4TYOA 3JXVA 1Q1CA 3MDYB 3B9AA 3IKDA 1FFRA 4JFIA 1EYMA 1FKTA 3UQIA 2PI6A 1JVWA 4WK9A 4LAVA 3OOBA 1FKBA 1U79A 3QOKA 2DT1A 3O5EA 5DIVA 2D9FA 4DT4A 4G2PA 1FKFA 4TW7A 5HT1A 4QT3A 3KZ7A 1OGGA 3O5DA 1LG2A 3TCZA 1UR9A 5HTGA 1W9UA 2O9OA 3O5MA 1QZ2A 4IQ2A 2KO7A 3CZ8A 2WK2A 3ARXA 2M2AA 4Z2JA 1JNDA 4WKAA 2KGJA 1R9HA 3FAPA 2RUCA 4ZPVR 5HKGA 3OA5A 1SYTA 5HW8A 3KAHA 2WLZA 2OLHA 3ARTA 1LL4A 3CHEA 2DG9A 3CHDA 2MF9A 4LAXA 1D2KA 5HWBA 1K9TA 1LQ0A 3AROA 4J4NA 4DRPA 2ZQUA 1FKJA 1WAWA 3PR9A 2XP7A 2B31A 3G6LA 4C02B 1ZBCA 3WQWA 1FKSA 2XPBA 2WLYA 2VN1A 3RM8A 4R5EA 4Z2HA 3LUOA 3UF8A 3KAIA 4DWSC 2DT0A 5HBFA 1TFVA 2XP3A 4U86A 2XP9A 4ODQA 4FAPA 1Y0OA 1FAPA 1D7HA 1FKHA 4MNLA 2PV3A 1YW5A 3PRAA 4N19A 4DWSB 5B8IC 1H0GA 4DRJA 4GIVA 4P8VA 1JNEA 2MLZA 3CH9A 1QPFA 3JYMA 3IK8A 2RSEA 1ZBWA 2DT2A 2RURA 2XPAA 4Z2GA 4MPKA 2FKEA 2MLXA 2LJ4A 3ARUA 1NH6A 1WB0A 1LL7A 1W9PA 5DEZA 3ALFA 3AS2A 1PINA 2XP5A 4HBOA 3VAWA 1Q6UA 2KFWA 3CGMA 2M1IA 4FN2A 3AS0A 3WD4A 4JFLA 1FKRA 3ARYA 2JZVA 4G50A 1NMWA 4Z2KA 4DZ2A 2ITKA 4Q7NA 4QIBA 3WD0A 1E6RA 2M08A 4ML4A 1YATA 3IKGA 2AWGA 4MTVA 5HW7A 4LAWA 1QPLA 4PTMA 2A3BA 2RQSA 2KI3A 4U84A 1ZU8A 1J4IA 4P8UA 1FKGA 1RD6A 1NWUA 4TX0A 3WD1A 3I6CA 2F21A 4JYSA 1Q6IA 3ARZA 3WQVA 1W1TA 3RFWA 4NZCA 1BKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5Q A;  4JFM A;  1BL4 A;  2L2S A;  2DG9 A;  2PV2 A;  3H9R B;  1EQ3 A;  3NTP A;  4DRH A;  2MF9 A;  2ZR4 A;  4LAX A;  3UI5 A;  1BKF A;  5HWB A;  1T11 A;  4GGQ A;  2PPN A;  4J4N A;  4DRP A;  1F40 A;  2ZQU A;  2F2D A;  1FKJ A;  4JFK A;  3IHZ A;  5GPG A;  1J4R A;  2PBC A;  2KR7 A;  1N1A A;  1D7J A;  4MGV A;  5DIT A;  2XP7 A;  4MSP A;  4DZ3 A;  4C02 B;  4W9O A;  1FKS A;  3O5J A;  4IQC A;  2XPB A;  4ODP A;  5I98 A;  2VN1 A;  3O5O A;  4DH0 A;  3KAC A;  4TW6 A;  5BXJ A;  3JYJ A;  3UQA A;  1ROT A;  3LUO A;  3UF8 A;  1FKL A;  3PRB A;  4O2T A;  3KAI A;  4DIP A;  2XP6 A;  2Y78 A;  2LKN A;  2XP4 A;  2DG3 A;  4LAY A;  3WH0 A;  5HWC A;  2MLY A;  5D75 A;  1P5Q A;  3GPK A;  1FD9 A;  1PBK A;  2XP3 A;  2PV1 A;  4DRI A;  5HW6 A;  4U86 A;  1ZK6 A;  2XP9 A;  3KAD A;  4ODQ A;  2LGO A;  4ODM A;  1W26 A;  1Y0O A;  1FAP A;  4FAP A;  1D7H A;  1FKH A;  3KAB A;  1D7I A;  2PV3 A;  1YW5 A;  3KAF A;  1M5Y A;  4N19 A;  3O5P A;  5B8I C;  1ROU A;  4DRJ A;  3ODK A;  4GIV A;  2MLZ A;  3PA7 A;  2KE0 A;  1A7X A;  3NRK A;  4ITZ A;  4NNR A;  3B7X A;  1QPF A;  3KCE A;  3O5L A;  1TCO C;  3O5R A;  3JYM A;  4TW8 A;  3TC5 A;  3IK8 A;  1HXV A;  3UI6 A;  2RSE A;  3NI6 A;  4TYO A;  2MNT A;  3JXV A;  1JNT A;  2RUQ A;  2RUR A;  1Q1C A;  2XPA A;  3O5F A;  4IPX A;  2OFN A;  3MDY B;  3IKD A;  2FKE A;  2MLX A;  4BF8 A;  1J6Y A;  2MPH A;  2DG4 A;  2LJ4 A;  4JFI A;  1EYM A;  3PRD A;  1FKT A;  2XP8 A;  3UQI A;  1JVW A;  4DRO A;  1PIN A;  2XP5 A;  3OOB A;  2RUD A;  1FKB A;  1U79 A;  1D6O A;  4LAV A;  4ODK A;  1FKD A;  4W9P A;  1NSG A;  2K8I A;  1ZCN A;  2Q5A A;  3O5G A;  3O5E A;  5DIV A;  1Q6U A;  2D9F A;  2KFW A;  3CGM A;  2F4E A;  3VAW A;  4DT4 A;  4G2P A;  4W9Q A;  2PPO A;  2M1I A;  4FN2 A;  1FKR A;  3EY6 A;  4JFL A;  2IF4 A;  4DRK A;  1C9H A;  4ODL A;  5HUA A;  1FKF A;  2JZV A;  1NMW A;  4G50 A;  4TW7 A;  2ITK A;  5HT1 A;  4QT2 A;  2ZQT A;  4DZ2 A;  3UQB A;  1FJD A;  4QT3 A;  2VCD A;  3KZ7 A;  4QIB A;  4DRQ A;  3O5K A;  5DIU A;  3O5D A;  2M08 A;  1YAT A;  4J4O A;  3IKG A;  2FAP A;  2ZQV A;  3KAG A;  4TNS A;  1Q6H A;  3TCZ A;  2AWG A;  4ODO A;  5HW7 A;  4ODR A;  4R0X A;  4LAW A;  4ODN A;  5HTG A;  1QPL A;  2ZQS A;  1KT0 A;  3O5M A;  2ZR5 A;  1JNS A;  1QZ2 A;  2KI3 A;  2RQS A;  4IQ2 A;  4U84 A;  1J4I A;  2PPP A;  3RGC A;  2KO7 A;  1F8A B;  1NMV A;  1FKG A;  2M2A A;  4DRN A;  1J4H A;  2UZ5 A;  1FKK A;  3TDB A;  4TX0 A;  4U85 A;  3O5I A;  3UI4 A;  2KGJ A;  1R9H A;  2F21 A;  2ZR6 A;  2RUC A;  3FAP A;  1Q6I A;  3I6C A;  1KT1 A;  4JYS A;  4DRM A;  5HKG A;  5HW8 A;  3KAH A;  1L1P A;  1FKI A;  4JFJ A;  1B6C A;  3RFW A;  2LPV A;  3CGN A;  2N87 A;  5J6E A; 
#chains in the Genus database with same CATH topology
 3RME A;  3B8S A;  4MAV A;  1BL4 A;  2PV2 A;  3WL1 A;  4DRH A;  1GUV A;  1T11 A;  2PPN A;  1W1V A;  3IHZ A;  4WJX A;  1J4R A;  2PBC A;  5DIT A;  1N1A A;  2A3E A;  2F23 A;  3WL0 A;  3ARQ A;  4DZ3 A;  1ZB5 A;  4Z2I A;  3O5J A;  1HKM A;  4WIW A;  4S3J A;  3KAC A;  4TW6 A;  5BXJ A;  5GPR A;  3UQA A;  2YBU A;  3PRB A;  1OGB A;  4LAY A;  2LKN A;  3WH0 A;  2O92 A;  3FY1 A;  3ALG A;  1EHN A;  3GPK A;  2DPE A;  1UR8 A;  4DRI A;  3KAD A;  2LGO A;  3AS3 A;  4ODM A;  4DWS D;  1D7I A;  3CHC A;  4MNJ A;  1M5Y A;  1ROU A;  3PA7 A;  3UI4 A;  3KCE A;  1TCO C;  2DT3 A;  3WKZ A;  2RUQ A;  3O5F A;  2OFN A;  1NWR A;  2DG4 A;  3PRD A;  3W4R A;  4DRO A;  4QZV B;  2DSW A;  1GRJ A;  4W9P A;  4ODK A;  1FKD A;  2K8I A;  1EQ3 A;  1ZCN A;  2Q5A A;  1L1P A;  3ARV A;  3WD3 A;  1W1P A;  4W9Q A;  4DRK A;  5GQB A;  4ODL A;  1LG1 A;  5DF0 A;  1FFQ A;  4KQZ A;  1H0I A;  1FJD A;  2A3C A;  2VCD A;  4Q22 A;  4DRQ A;  5DIU A;  4J4O A;  2QF8 A;  1VF8 A;  3KAG A;  4KR0 B;  4TNS A;  4ODR A;  4R0X A;  3AS1 A;  1KT0 A;  2ZR5 A;  2DSV A;  2PPP A;  3BXW A;  2DSZ A;  2FDM A;  1FKK A;  4WKH A;  4ZPT R;  3ARW A;  3TDB A;  4U85 A;  1HKI A;  2AOS A;  1E6N A;  2ZR6 A;  1GOI A;  1HJX A;  2LPV A;  1E15 A;  5J6E A;  1W9V A;  1XHG A;  2P4V A;  1E9L A;  3NTP A;  1EIB A;  3B9E A;  4L72 B;  4WKF A;  4GGQ A;  1F40 A;  2F2D A;  5GPG A;  2KR7 A;  4MGV A;  1ZBK A;  3FXY A;  3GU0 A;  2WM0 A;  4ODP A;  5I98 A;  2G8Z A;  2A3A A;  1IX5 A;  3WD2 A;  3O5O A;  4DH0 A;  4NSB A;  3JYJ A;  3AQU A;  1ROT A;  4HBE A;  4DIP A;  3ARP A;  4HAR A;  2XP6 A;  5HWC A;  3ARR A;  1E6P A;  5D75 A;  1FD9 A;  2PV1 A;  1ZK6 A;  1HKJ A;  1W26 A;  2EUL A;  4IT6 A;  1GPF A;  3O5P A;  4MNM A;  4MNK A;  1X6N A;  4NNR A;  3NRK A;  2PN0 A;  3B7X A;  3G6M A;  3RM9 A;  3UI6 A;  3NI6 A;  2MNT A;  1JNT A;  4IPX A;  4BF8 A;  1J6Y A;  1X6L A;  2MPH A;  4ZPW R;  2DSU A;  2XP8 A;  1HJW A;  1CTN A;  1E6Z A;  5JH8 A;  1ZL1 A;  1D6O A;  1NSG A;  1OWQ A;  5HW6 A;  3O5G A;  1JNS A;  2F4E A;  2PPO A;  3EY6 A;  2IF4 A;  3GTY X;  1C9H A;  3CHF A;  5HUA A;  4QT2 A;  2ZQT A;  3UQB A;  3BMB A;  1KFW A;  3O5K A;  2FAP A;  2ZQV A;  1EDQ A;  2YBT A;  1Q6H A;  4URI A;  4ODO A;  4S3K A;  4ODN A;  2ZQS A;  4L3N A;  5DO2 A;  3WIJ A;  3RGC A;  2IUZ A;  1F8A B;  1NMV A;  4DRN A;  4DWS A;  1J4H A;  2UZ5 A;  3O5I A;  1NWT A;  1KT1 A;  4DRM A;  1FKI A;  4JFJ A;  4XAK A;  1B6C A;  1ZBV A;  1LJY A;  2RUD A;  3CGN A;  2N87 A;  3O5Q A;  4JFM A;  1HJV A;  2G41 A;  4P8X A;  1NWS A;  3EIP A;  2L2S A;  3H9R B;  4IT4 A;  4LGX A;  4AY1 A;  1HKK A;  2ZR4 A;  3UI5 A;  1LL6 A;  4JFK A;  1D7J A;  4MSP A;  1ITX A;  4W9O A;  4IQC A;  4ZS6 A;  1SR0 A;  1XRV A;  1FKL A;  4O2T A;  3RM4 A;  2ESC A;  1WNO A;  2Y78 A;  4Z2L A;  1W1Y A;  2DG3 A;  2XP4 A;  4W5U A;  3ARS A;  2MLY A;  1P5Q A;  1PBK A;  2B5U B;  3KAB A;  3KAF A;  1O6I A;  3ODK A;  3B9D A;  2KE0 A;  1A7X A;  4ITZ A;  4TW8 A;  3O5L A;  3O5R A;  3TC5 A;  1HXV A;  4P8W A;  4TYO A;  3JXV A;  1Q1C A;  3MDY B;  3B9A A;  3IKD A;  1FFR A;  4JFI A;  1EYM A;  1FKT A;  3UQI A;  2PI6 A;  1JVW A;  4WK9 A;  2ETN A;  4LAV A;  3OOB A;  1FKB A;  1U79 A;  3QOK A;  2DT1 A;  3O5E A;  5DIV A;  2D9F A;  4DT4 A;  4G2P A;  1FKF A;  4TW7 A;  5HT1 A;  4QT3 A;  3KZ7 A;  1OGG A;  3O5D A;  1LG2 A;  3TCZ A;  1UR9 A;  5HTG A;  1W9U A;  2O9O A;  3O5M A;  1QZ2 A;  4IQ2 A;  2KO7 A;  3CZ8 A;  2WK2 A;  3ARX A;  2M2A A;  4Z2J A;  1JND A;  4WKA A;  2KGJ A;  1R9H A;  3FAP A;  2RUC A;  4ZPV R;  5HKG A;  3OA5 A;  1SYT A;  5HW8 A;  3KAH A;  2WLZ A;  2OLH A;  3ART A;  1LL4 A;  3CHE A;  2DG9 A;  3CHD A;  2MF9 A;  4LAX A;  1D2K A;  5HWB A;  1K9T A;  1LQ0 A;  3ARO A;  4J4N A;  4DRP A;  2ZQU A;  1FKJ A;  1WAW A;  3PR9 A;  2XP7 A;  2B31 A;  3G6L A;  4C02 B;  1ZBC A;  3WQW A;  1FKS A;  2XPB A;  2WLY A;  2VN1 A;  3RM8 A;  4R5E A;  4Z2H A;  4UDM A;  3LUO A;  3UF8 A;  3KAI A;  4DWS C;  2DT0 A;  5HBF A;  1TFV A;  2XP3 A;  4U86 A;  2XP9 A;  4ODQ A;  4FAP A;  1Y0O A;  1FAP A;  1D7H A;  1FKH A;  4MNL A;  1E44 A;  2PV3 A;  1YW5 A;  3PRA A;  4N19 A;  4DWS B;  5B8I C;  1H0G A;  4DRJ A;  4GIV A;  4P8V A;  1JNE A;  2MLZ A;  3CH9 A;  1QPF A;  3JYM A;  3IK8 A;  2RSE A;  1ZBW A;  2DT2 A;  2RUR A;  2XPA A;  4Z2G A;  4MPK A;  2FKE A;  2MLX A;  2LJ4 A;  3ARU A;  1NH6 A;  1WB0 A;  1LL7 A;  1W9P A;  5DEZ A;  3ALF A;  3AS2 A;  1PIN A;  2XP5 A;  4HBO A;  3VAW A;  1Q6U A;  2KFW A;  3CGM A;  1JCH B;  2M1I A;  4FN2 A;  3AS0 A;  3WD4 A;  4JFL A;  1FKR A;  3ARY A;  2JZV A;  4G50 A;  1NMW A;  4Z2K A;  4DZ2 A;  2ITK A;  4Q7N A;  4QIB A;  3WD0 A;  1E6R A;  2M08 A;  4ML4 A;  1YAT A;  3IKG A;  2AWG A;  4MTV A;  5HW7 A;  4LAW A;  1QPL A;  4PTM A;  2A3B A;  2RQS A;  2KI3 A;  4U84 A;  1ZU8 A;  1J4I A;  4P8U A;  1FKG A;  1RD6 A;  1NWU A;  4TX0 A;  3WD1 A;  3I6C A;  2F21 A;  1Q6I A;  4JYS A;  3ARZ A;  3WQV A;  1W1T A;  3RFW A;  4NZC A;  1BKF A; 
#chains in the Genus database with same CATH homology
 3RME A;  3B8S A;  4MAV A;  1BL4 A;  2PV2 A;  3WL1 A;  4DRH A;  1GUV A;  1T11 A;  2PPN A;  1W1V A;  3IHZ A;  4WJX A;  1J4R A;  2PBC A;  5DIT A;  1N1A A;  2A3E A;  3WL0 A;  3ARQ A;  4DZ3 A;  1ZB5 A;  4Z2I A;  3O5J A;  1HKM A;  4WIW A;  4S3J A;  3KAC A;  4TW6 A;  5BXJ A;  5GPR A;  3UQA A;  2YBU A;  3PRB A;  1OGB A;  4LAY A;  2LKN A;  3WH0 A;  2O92 A;  3FY1 A;  3ALG A;  1EHN A;  3GPK A;  2DPE A;  1UR8 A;  4DRI A;  3KAD A;  2LGO A;  3AS3 A;  4ODM A;  4DWS D;  1D7I A;  3CHC A;  4MNJ A;  1M5Y A;  1ROU A;  3PA7 A;  3UI4 A;  3KCE A;  1TCO C;  2DT3 A;  3WKZ A;  2RUQ A;  3O5F A;  2OFN A;  1NWR A;  2DG4 A;  3PRD A;  3W4R A;  4DRO A;  4QZV B;  2DSW A;  4W9P A;  4ODK A;  1FKD A;  2K8I A;  1EQ3 A;  1ZCN A;  2Q5A A;  1L1P A;  3ARV A;  3WD3 A;  1W1P A;  4W9Q A;  4DRK A;  5GQB A;  4ODL A;  1LG1 A;  5DF0 A;  1FFQ A;  4KQZ A;  1H0I A;  1FJD A;  2A3C A;  2VCD A;  4Q22 A;  4DRQ A;  5DIU A;  4J4O A;  2QF8 A;  1VF8 A;  3KAG A;  4KR0 B;  4TNS A;  4ODR A;  4R0X A;  3AS1 A;  1KT0 A;  2ZR5 A;  2DSV A;  2PPP A;  3BXW A;  2DSZ A;  2FDM A;  1FKK A;  4WKH A;  4ZPT R;  3ARW A;  3TDB A;  4U85 A;  1HKI A;  2AOS A;  1E6N A;  2ZR6 A;  1GOI A;  1HJX A;  2LPV A;  1E15 A;  5J6E A;  1W9V A;  1XHG A;  1E9L A;  3NTP A;  1EIB A;  3B9E A;  4L72 B;  4WKF A;  4GGQ A;  1F40 A;  2F2D A;  5GPG A;  2KR7 A;  4MGV A;  1ZBK A;  3FXY A;  2WM0 A;  4ODP A;  5I98 A;  2G8Z A;  2A3A A;  1IX5 A;  3WD2 A;  3O5O A;  4DH0 A;  4NSB A;  3JYJ A;  3AQU A;  1ROT A;  4HBE A;  4DIP A;  3ARP A;  4HAR A;  2XP6 A;  5HWC A;  3ARR A;  1E6P A;  5D75 A;  1FD9 A;  2PV1 A;  1ZK6 A;  1HKJ A;  1W26 A;  4IT6 A;  1GPF A;  3O5P A;  4MNM A;  4MNK A;  1X6N A;  4NNR A;  3NRK A;  3B7X A;  3G6M A;  3RM9 A;  3UI6 A;  3NI6 A;  2MNT A;  1JNT A;  4IPX A;  4BF8 A;  1J6Y A;  1X6L A;  2MPH A;  4ZPW R;  2DSU A;  2XP8 A;  1HJW A;  1CTN A;  1E6Z A;  5JH8 A;  1ZL1 A;  1D6O A;  1NSG A;  1OWQ A;  5HW6 A;  3O5G A;  1JNS A;  2F4E A;  2PPO A;  3EY6 A;  2IF4 A;  1C9H A;  3CHF A;  5HUA A;  4QT2 A;  2ZQT A;  3UQB A;  1KFW A;  3O5K A;  2FAP A;  2ZQV A;  1EDQ A;  2YBT A;  1Q6H A;  4URI A;  4ODO A;  4S3K A;  4ODN A;  2ZQS A;  4L3N A;  5DO2 A;  3WIJ A;  3RGC A;  2IUZ A;  1F8A B;  1NMV A;  4DRN A;  4DWS A;  1J4H A;  2UZ5 A;  3O5I A;  1NWT A;  1KT1 A;  4DRM A;  1FKI A;  4JFJ A;  4XAK A;  1B6C A;  1ZBV A;  1LJY A;  2RUD A;  3CGN A;  2N87 A;  3O5Q A;  4JFM A;  1HJV A;  2G41 A;  4P8X A;  1NWS A;  2L2S A;  3H9R B;  4IT4 A;  4LGX A;  4AY1 A;  1HKK A;  2ZR4 A;  3UI5 A;  1LL6 A;  4JFK A;  1D7J A;  4MSP A;  1ITX A;  4W9O A;  4IQC A;  4ZS6 A;  1SR0 A;  1XRV A;  1FKL A;  4O2T A;  3RM4 A;  2ESC A;  1WNO A;  2Y78 A;  4Z2L A;  1W1Y A;  2DG3 A;  2XP4 A;  4W5U A;  3ARS A;  2MLY A;  1P5Q A;  1PBK A;  3KAB A;  3KAF A;  1O6I A;  3ODK A;  3B9D A;  2KE0 A;  1A7X A;  4ITZ A;  4TW8 A;  3O5L A;  3O5R A;  3TC5 A;  1HXV A;  4P8W A;  4TYO A;  3JXV A;  1Q1C A;  3MDY B;  3B9A A;  3IKD A;  1FFR A;  4JFI A;  1EYM A;  1FKT A;  3UQI A;  2PI6 A;  1JVW A;  4WK9 A;  4LAV A;  3OOB A;  1FKB A;  1U79 A;  3QOK A;  2DT1 A;  3O5E A;  5DIV A;  2D9F A;  4DT4 A;  4G2P A;  1FKF A;  4TW7 A;  5HT1 A;  4QT3 A;  3KZ7 A;  1OGG A;  3O5D A;  1LG2 A;  3TCZ A;  1UR9 A;  5HTG A;  1W9U A;  2O9O A;  3O5M A;  1QZ2 A;  4IQ2 A;  2KO7 A;  3CZ8 A;  2WK2 A;  3ARX A;  2M2A A;  4Z2J A;  1JND A;  4WKA A;  2KGJ A;  1R9H A;  3FAP A;  2RUC A;  4ZPV R;  5HKG A;  3OA5 A;  1SYT A;  5HW8 A;  3KAH A;  2WLZ A;  2OLH A;  3ART A;  1LL4 A;  3CHE A;  2DG9 A;  3CHD A;  2MF9 A;  4LAX A;  1D2K A;  5HWB A;  1K9T A;  1LQ0 A;  3ARO A;  4J4N A;  4DRP A;  2ZQU A;  1FKJ A;  1WAW A;  3PR9 A;  2XP7 A;  2B31 A;  3G6L A;  4C02 B;  1ZBC A;  3WQW A;  1FKS A;  2XPB A;  2WLY A;  2VN1 A;  3RM8 A;  4R5E A;  4Z2H A;  3LUO A;  3UF8 A;  3KAI A;  4DWS C;  2DT0 A;  5HBF A;  1TFV A;  2XP3 A;  4U86 A;  2XP9 A;  4ODQ A;  4FAP A;  1Y0O A;  1FAP A;  1D7H A;  1FKH A;  4MNL A;  2PV3 A;  1YW5 A;  3PRA A;  4N19 A;  4DWS B;  5B8I C;  1H0G A;  4DRJ A;  4GIV A;  4P8V A;  1JNE A;  2MLZ A;  3CH9 A;  1QPF A;  3JYM A;  3IK8 A;  2RSE A;  1ZBW A;  2DT2 A;  2RUR A;  2XPA A;  4Z2G A;  4MPK A;  2FKE A;  2MLX A;  2LJ4 A;  3ARU A;  1NH6 A;  1WB0 A;  1LL7 A;  1W9P A;  5DEZ A;  3ALF A;  3AS2 A;  1PIN A;  2XP5 A;  4HBO A;  3VAW A;  1Q6U A;  2KFW A;  3CGM A;  2M1I A;  4FN2 A;  3AS0 A;  3WD4 A;  4JFL A;  1FKR A;  3ARY A;  2JZV A;  4G50 A;  1NMW A;  4Z2K A;  4DZ2 A;  2ITK A;  4Q7N A;  4QIB A;  3WD0 A;  1E6R A;  2M08 A;  4ML4 A;  1YAT A;  3IKG A;  2AWG A;  4MTV A;  5HW7 A;  4LAW A;  1QPL A;  4PTM A;  2A3B A;  2RQS A;  2KI3 A;  4U84 A;  1ZU8 A;  1J4I A;  4P8U A;  1FKG A;  1RD6 A;  1NWU A;  4TX0 A;  3WD1 A;  3I6C A;  2F21 A;  4JYS A;  1Q6I A;  3ARZ A;  3WQV A;  1W1T A;  3RFW A;  4NZC A;  1BKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...