5J6EA

Structure of disulfide crosslinked a. fumigatus fkbp12(v91c)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
111
structure length
111
Chain Sequence
MGVTKELKSPGNGVDFPKKGDFVTIHYTGRLTDGSKFDSSVDRNEPFQTQIGTGRVIKGWDEGVPQMSLGEKAVLTITPDYGYGARGFPPCIPGNSTLIFEVELLGINNKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FK506-binding protein 1A
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Neosartorya fumigata (strain atcc mya-4609 / af293 / cbs 101355 / fgsc a1100)
total genus 27
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5j6eA00
4GGQA 4TW8A 3O5QA 4IQ2A 4ODNA 1P5QA 2JZVA 4QT3A 3UI4A 3O5MA 3EY6A 2N87A 4N19A 1ZK6A 1T11A 4C02B 1J4IA 3O5OA 4BF8A 2ZQUA 2LGOA 2PV1A 3KAFA 2RUDA 3KZ7A 3O5GA 4J4OA 4J4NA 4QT2A 3PA7A 1BL4A 1BKFA 2OFNA 3H9RB 3RGCA 3UF8A 4DH0A 5HKGA 3FAPA 2F2DA 2VN1A 4QIBA 2XP8A 5HWCA 2KFWA 2M1IA 2Q5AA 2XPBA 4DT4A 1KT1A 4GIVA 1FD9A 2UZ5A 4IQCA 4MSPA 3OOBA 4G50A 4DROA 2D9FA 1FKBA 2MLYA 2XPAA 3JYJA 4DZ3A 4DZ2A 4ODLA 4IPXA 4NNRA 3TDBA 1FKRA 4G2PA 5I98A 4JFIA 3B7XA 4JYSA 2ZQVA 3O5DA 5BXJA 2PV3A 2ZQTA 2ZR6A 2KE0A 1JNSA 2RUCA 1HXVA 5HW6A 1KT0A 4DRJA 3O5JA 1JNTA 1QPFA 5HT1A 3LUOA 3TC5A 1M5YA 4TX0A 4ITZA 5DITA 3UI6A 4DRPA 1FKLA 2MF9A 2XP4A 1ROTA 2MLXA 1ZCNA 3KCEA 2ITKA 1D6OA 3IKGA 2ZQSA 1NMVA 2RQSA 3UQIA 5DIVA 2RURA 3IKDA 3KADA 3ODKA 3KABA 1YW5A 4TW7A 2FAPA 2F21A 4FN2A 3WH0A 1FKTA 1D7IA 1QPLA 2F4EA 4DRNA 4LAWA 2KO7A 1TCOC 1NMWA 1FKKA 1J4RA 3CGMA 3O5RA 4FAPA 1L1PA 2AWGA 1FKDA 2PPPA 2MPHA 1PINA 3JYMA 4DRMA 4DRQA 5D75A 4U84A 5HUAA 5J6EA 4DRIA 4W9PA 4LAXA 4W9OA 2LJ4A 3I6CA 2KR7A 3O5PA 1J6YA 1FJDA 1YATA 1N1AA 3O5FA 4W9QA 1FKGA 1FKJA 2MLZA 4JFMA 4TNSA 1F40A 3CGNA 1FAPA 1FKFA 3UQAA 4ODMA 2ZR5A 2RSEA 4DRHA 1NSGA 1FKSA 1F8AB 1W26A 2Y78A 2K8IA 1U79A 4O2TA 1D7JA 3KAHA 2XP7A 1JVWA 4DRKA 3RFWA 4ODQA 4TW6A 1A7XA 5HTGA 2M2AA 4JFLA 5DIUA 1QZ2A 2IF4A 1Y0OA 1ROUA 2VCDA 2L2SA 5HW7A 1R9HA 3GPKA 5GPGA 3IHZA 3VAWA 1FKHA 4ODPA 2XP5A 1FKIA 3UQBA 2PPNA 2RUQA 1Q6HA 3PRBA 5B8IC 4LAVA 2ZR4A 3NRKA 3O5IA 3O5LA 2PV2A 1EQ3A 2DG9A 4TYOA 1EYMA 3KAIA 3TCZA 2M08A 2PPOA 4MGVA 4DIPA 3PRDA 2LKNA 2LPVA 4ODOA 2XP9A 2DG4A 1Q6UA 2XP6A 2PBCA 2XP3A 1J4HA 3JXVA 3O5EA 1C9HA 4JFKA 4ODKA 4R0XA 3MDYB 3NI6A 4U86A 1D7HA 2DG3A 3O5KA 3KAGA 4LAYA 3KACA 5HWBA 1Q6IA 1Q1CA 2FKEA 3IK8A 2KI3A 2KGJA 3NTPA 4ODRA 1PBKA 3UI5A 5HW8A 2MNTA 4JFJA 4U85A 1B6CA
chains in the Genus database with same CATH superfamily
4L3NA 1H0GA 4NZCA 4N19A 3O5OA 2LGOA 2PV1A 3KAFA 2A3EA 4J4OA 4DRKA 1KFWA 2OFNA 5DO2A 5HKGA 1E6NA 3ALGA 2F2DA 2KFWA 1HKJA 2XPBA 1KT1A 2UZ5A 1CTNA 2D9FA 1NWTA 1ZU8A 3AS0A 3AQUA 1X6LA 4R5EA 3TDBA 1FKRA 3B7XA 4JYSA 2B5UB 3O5DA 2PV3A 1GUVA 2ZR6A 1HXVA 5HW6A 4DWSA 1X6NA 5DITA 4URIA 2ITKA 2ZQSA 2OLHA 3ARRA 5DIVA 2RURA 3IKDA 3KABA 1YW5A 1IX5A 2FAPA 4FN2A 4WJXA 4Z2JA 2F4EA 3ARPA 1LL7A 1HJXA 1NMWA 2DSZA 1FKKA 1L1PA 1LL4A 1FKDA 2AWGA 4MNJA 4DRQA 1PINA 3PRAA 4U84A 5J6EA 2WM0A 4DRIA 4W9OA 2LJ4A 1FJDA 1ZBCA 1E9LA 4W9QA 4MNLA 1FKJA 4DWSD 1FAPA 2PI6A 4ODMA 1ITXA 1E44A 2DT0A 1GPFA 1D7JA 3RFWA 4TW6A 5DEZA 3ARTA 5DIUA 1Y0OA 2VCDA 3ARSA 2XP5A 3UQBA 2ZR4A 3WD1A 4ZPVR 3NRKA 1EYMA 3KAIA 1E15A 4MGVA 1LG1A 1W9UA 1E6RA 3JXVA 2XP3A 4JFKA 4LGXA 3MDYB 4MTVA 1WNOA 4LAYA 3ARVA 2P4VA 2FKEA 1K9TA 1EIBA 5HW8A 1JNDA 4TW8A 3O5QA 3O5MA 3ARWA 3EY6A 2B31A 2N87A 1HKKA 1ZK6A 3CZ8A 4BF8A 2ZQUA 1E6ZA 1RD6A 1BL4A 2DT3A 2YBUA 1FFQA 3FAPA 4Z2LA 5HWCA 2XP8A 4DT4A 1FD9A 4MNKA 1FKBA 2MLYA 3JYJA 3WQWA 4P8VA 3ARZA 3RM8A 3QOKA 4JFIA 1WB0A 1LL6A 1EHNA 1LQ0A 1SYTA 5BXJA 2KE0A 1JNSA 4DRJA 1OWQA 3O5JA 1JNTA 2ETNA 2PN0A 3TC5A 1M5YA 2DSUA 3PR9A 4DWSB 4Q7NA 2XP4A 1ROTA 1HJVA 2MLXA 3KCEA 5DF0A 1W9VA 1NMVA 2RQSA 1LG2A 4W5UA 1FKTA 1QPLA 4KQZA 3WD3A 2KO7A 3O5RA 1W1YA 2G41A 2MPHA 2PPPA 3FY1A 5D75A 4HARA 1E6PA 4PTMA 4TNSA 1FKFA 3UQAA 2ZR5A 1F8AB 4HBOA 2Y78A 3CH9A 1U79A 1UR9A 1JVWA 4ODQA 4P8XA 2M2AA 2DT1A 2L2SA 1R9HA 3VAWA 4ODPA 1W9PA 1FKIA 1D2KA 3CHFA 1Q6HA 1O6IA 2M08A 3PRDA 2LKNA 2WLYA 2DG4A 1Q6UA 3O5EA 1C9HA 3NI6A 2DG3A 1GOIA 2WLZA 1Q1CA 4IT4A 3UI5A 4UDMA 4JFJA 4GGQA 5GQBA 4IQ2A 2JZVA 1WAWA 4C02B 1T11A 4HBEA 2A3AA 3RGCA 2RUDA 4J4NA 3PA7A 3RMEA 3H9RB 3UF8A 4DH0A 2VN1A 4MNMA 3GTYX 4IQCA 4MSPA 3OOBA 2FDMA 3WKZA 4DZ3A 2A3BA 4WKFA 4L72B 4ODLA 4ZPTR 1FFRA 1GRJA 4IPXA 4NNRA 3AS2A 2ZQVA 4WK9A 3BXWA 2ZQTA 1VF8A 1NWUA 1ZBKA 2DSWA 5HT1A 3LUOA 4TX0A 4WKHA 3WQVA 4P8UA 1FKLA 1ZL1A 3IKGA 3ARYA 3UQIA 3RM9A 4DWSC 3KADA 3ODKA 4TW7A 3WH0A 4DRNA 1D7IA 2IUZA 4LAWA 3AROA 3CGMA 3JYMA 4DRMA 5HUAA 3ARQA 4LAXA 2G8ZA 1N1AA 1FKGA 2MLZA 3ALFA 1F40A 4WKAA 2RSEA 4DRHA 5GPRA 1NSGA 1FKSA 3G6LA 3AS1A 3GU0A 1A7XA 3WL0A 2ESCA 1QZ2A 2IF4A 4ZPWR 5HW7A 3GPKA 5GPGA 2O9OA 1FKHA 1NWSA 3CHEA 3ARXA 2RUQA 3B9EA 4XAKA 5B8IC 3EIPA 3O5IA 3O5LA 1EQ3A 2DG9A 4TYOA 4DIPA 3G6MA 2LPVA 1TFVA 4ODOA 2AOSA 1NWRA 1W1TA 2XP9A 2WK2A 2PBCA 1HKMA 2A3CA 3WD2A 1XRVA 2F23A 1D7HA 4KR0B 3KAGA 5HWBA 1Q6IA 3IK8A 5JH8A 4P8WA 5HBFA 3BMBA 4ODRA 2MNTA 4U85A 1B6CA 3AS3A 3FXYA 1OGBA 4ODNA 1P5QA 4NSBA 4QT3A 3UI4A 2QF8A 1J4IA 3KZ7A 3O5GA 4QT2A 4Z2GA 1BKFA 4QIBA 2M1IA 2Q5AA 1W1VA 4GIVA 4G50A 4DROA 4IT6A 2XPAA 4DZ2A 1JCHB 4G2PA 5I98A 3WL1A 3RM4A 2DSVA 3OA5A 1EDQA 2RUCA 1UR8A 1ZBWA 1KT0A 1QPFA 4ITZA 3UI6A 3W4RA 4DRPA 3CHDA 2MF9A 1HJWA 1XHGA 1ZCNA 4ZS6A 1D6OA 1H0IA 4S3JA 2F21A 4WIWA 2DPEA 1TCOC 1J4RA 4FAPA 3CHCA 4AY1A 4Z2IA 4W9PA 4ML4A 1J6YA 3I6CA 2KR7A 3O5PA 1YATA 3O5FA 1ZB5A 1W1PA 4QZVB 4MPKA 4JFMA 1LJYA 3WD0A 3B8SA 3CGNA 4S3KA 4Z2KA 1W26A 2K8IA 4O2TA 3KAHA 2XP7A 2YBTA 1NH6A 1SR0A 2EULA 5HTGA 4JFLA 1ZBVA 1ROUA 4Z2HA 1JNEA 3IHZA 2PPNA 3B9DA 3PRBA 4Q22A 3WIJA 1HKIA 2PV2A 2O92A 2PPOA 1OGGA 3TCZA 2XP6A 1J4HA 4MAVA 4R0XA 4U86A 4ODKA 3O5KA 3WD4A 3KACA 3ARUA 2DT2A 2KI3A 2KGJA 3NTPA 1PBKA 3B9AA 4LAVA
chains in the Genus database with same CATH topology
4L3NA 1H0GA 4NZCA 4N19A 3O5OA 2LGOA 2PV1A 3KAFA 2A3EA 4J4OA 4DRKA 1KFWA 2OFNA 5DO2A 5HKGA 1E6NA 3ALGA 2F2DA 2KFWA 1HKJA 2XPBA 1KT1A 2UZ5A 1CTNA 2D9FA 1NWTA 1ZU8A 3AS0A 3AQUA 1X6LA 4R5EA 3TDBA 1FKRA 3B7XA 4JYSA 3O5DA 2PV3A 1GUVA 2ZR6A 1HXVA 5HW6A 4DWSA 1X6NA 5DITA 4URIA 2ITKA 2ZQSA 2OLHA 3ARRA 5DIVA 2RURA 3IKDA 3KABA 1YW5A 1IX5A 2FAPA 4FN2A 4WJXA 4Z2JA 2F4EA 3ARPA 1LL7A 1HJXA 1NMWA 2DSZA 1FKKA 1L1PA 1LL4A 1FKDA 2AWGA 4MNJA 4DRQA 1PINA 3PRAA 4U84A 5J6EA 2WM0A 4DRIA 4W9OA 2LJ4A 1FJDA 1ZBCA 1E9LA 4W9QA 4MNLA 1FKJA 4DWSD 1FAPA 2PI6A 4ODMA 1ITXA 2DT0A 1GPFA 1D7JA 3RFWA 4TW6A 5DEZA 3ARTA 5DIUA 1Y0OA 2VCDA 3ARSA 2XP5A 3UQBA 2ZR4A 3WD1A 4ZPVR 3NRKA 1EYMA 3KAIA 1E15A 4MGVA 1LG1A 1W9UA 1E6RA 3JXVA 2XP3A 4JFKA 4LGXA 3MDYB 4MTVA 1WNOA 4LAYA 3ARVA 2FKEA 1K9TA 1EIBA 5HW8A 1JNDA 4TW8A 3O5QA 3O5MA 3ARWA 3EY6A 2B31A 2N87A 1HKKA 1ZK6A 3CZ8A 4BF8A 2ZQUA 1E6ZA 1RD6A 1BL4A 2DT3A 2YBUA 1FFQA 3FAPA 4Z2LA 5HWCA 2XP8A 4DT4A 1FD9A 4MNKA 1FKBA 2MLYA 3JYJA 3WQWA 4P8VA 3ARZA 3RM8A 3QOKA 4JFIA 1WB0A 1LL6A 1EHNA 1LQ0A 1SYTA 5BXJA 2KE0A 1JNSA 4DRJA 1OWQA 3O5JA 1JNTA 3TC5A 1M5YA 2DSUA 3PR9A 4DWSB 4Q7NA 2XP4A 1ROTA 1HJVA 2MLXA 3KCEA 5DF0A 1W9VA 1NMVA 2RQSA 1LG2A 4W5UA 1FKTA 1QPLA 4KQZA 3WD3A 2KO7A 3O5RA 1W1YA 2G41A 2MPHA 2PPPA 3FY1A 5D75A 4HARA 1E6PA 4PTMA 4TNSA 1FKFA 3UQAA 2ZR5A 1F8AB 4HBOA 2Y78A 3CH9A 1U79A 1UR9A 1JVWA 4ODQA 4P8XA 2M2AA 2DT1A 2L2SA 1R9HA 3VAWA 4ODPA 1W9PA 1FKIA 1D2KA 3CHFA 1Q6HA 1O6IA 2M08A 3PRDA 2LKNA 2WLYA 2DG4A 1Q6UA 3O5EA 1C9HA 3NI6A 2DG3A 1GOIA 2WLZA 1Q1CA 4IT4A 3UI5A 4JFJA 4GGQA 5GQBA 4IQ2A 2JZVA 1WAWA 4C02B 1T11A 4HBEA 2A3AA 3RGCA 2RUDA 4J4NA 3PA7A 3RMEA 3H9RB 3UF8A 4DH0A 2VN1A 4MNMA 4IQCA 4MSPA 3OOBA 2FDMA 3WKZA 4DZ3A 2A3BA 4WKFA 4L72B 4ODLA 4ZPTR 1FFRA 4IPXA 4NNRA 3AS2A 2ZQVA 4WK9A 3BXWA 2ZQTA 1VF8A 1NWUA 1ZBKA 2DSWA 5HT1A 3LUOA 4TX0A 4WKHA 3WQVA 4P8UA 1FKLA 1ZL1A 3IKGA 3ARYA 3UQIA 3RM9A 4DWSC 3KADA 3ODKA 4TW7A 3WH0A 4DRNA 1D7IA 2IUZA 4LAWA 3AROA 3CGMA 3JYMA 4DRMA 5HUAA 3ARQA 4LAXA 2G8ZA 1N1AA 1FKGA 2MLZA 3ALFA 1F40A 4WKAA 2RSEA 4DRHA 5GPRA 1NSGA 1FKSA 3G6LA 3AS1A 1A7XA 3WL0A 2ESCA 1QZ2A 2IF4A 4ZPWR 5HW7A 3GPKA 5GPGA 2O9OA 1FKHA 1NWSA 3CHEA 3ARXA 2RUQA 3B9EA 4XAKA 5B8IC 3O5IA 3O5LA 1EQ3A 2DG9A 4TYOA 4DIPA 3G6MA 2LPVA 1TFVA 4ODOA 2AOSA 1NWRA 1W1TA 2XP9A 2WK2A 2PBCA 1HKMA 2A3CA 3WD2A 1XRVA 1D7HA 4KR0B 3KAGA 5HWBA 1Q6IA 3IK8A 5JH8A 4P8WA 5HBFA 4ODRA 2MNTA 4U85A 1B6CA 3AS3A 3FXYA 1OGBA 4ODNA 1P5QA 4NSBA 4QT3A 3UI4A 2QF8A 1J4IA 3KZ7A 3O5GA 4QT2A 4Z2GA 1BKFA 4QIBA 2M1IA 2Q5AA 1W1VA 4GIVA 4G50A 4DROA 4IT6A 2XPAA 4DZ2A 4G2PA 5I98A 3WL1A 3RM4A 2DSVA 3OA5A 1EDQA 2RUCA 1UR8A 1ZBWA 1KT0A 1QPFA 4ITZA 3UI6A 3W4RA 4DRPA 3CHDA 2MF9A 1HJWA 1XHGA 1ZCNA 4ZS6A 1D6OA 1H0IA 4S3JA 2F21A 4WIWA 2DPEA 1TCOC 1J4RA 4FAPA 3CHCA 4AY1A 4Z2IA 4W9PA 4ML4A 1J6YA 3I6CA 2KR7A 3O5PA 1YATA 3O5FA 1ZB5A 1W1PA 4QZVB 4MPKA 4JFMA 1LJYA 3WD0A 3B8SA 3CGNA 4S3KA 4Z2KA 1W26A 2K8IA 4O2TA 3KAHA 2XP7A 2YBTA 1NH6A 1SR0A 5HTGA 4JFLA 1ZBVA 1ROUA 4Z2HA 1JNEA 3IHZA 2PPNA 3B9DA 3PRBA 4Q22A 3WIJA 1HKIA 2PV2A 2O92A 2PPOA 1OGGA 3TCZA 2XP6A 1J4HA 4MAVA 4R0XA 4U86A 4ODKA 3O5KA 3WD4A 3KACA 3ARUA 2DT2A 2KI3A 2KGJA 3NTPA 1PBKA 3B9AA 4LAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GGQ A;  4TW8 A;  3O5Q A;  4IQ2 A;  4ODN A;  1P5Q A;  2JZV A;  4QT3 A;  3UI4 A;  3O5M A;  3EY6 A;  2N87 A;  4N19 A;  1ZK6 A;  1T11 A;  4C02 B;  1J4I A;  3O5O A;  4BF8 A;  2ZQU A;  2LGO A;  2PV1 A;  3KAF A;  2RUD A;  3KZ7 A;  3O5G A;  4J4O A;  4J4N A;  4QT2 A;  3PA7 A;  1BL4 A;  1BKF A;  2OFN A;  3H9R B;  3RGC A;  3UF8 A;  4DH0 A;  5HKG A;  3FAP A;  2F2D A;  2VN1 A;  4QIB A;  2XP8 A;  5HWC A;  2KFW A;  2M1I A;  2Q5A A;  2XPB A;  4DT4 A;  1KT1 A;  4GIV A;  1FD9 A;  2UZ5 A;  4IQC A;  4MSP A;  3OOB A;  4G50 A;  4DRO A;  2D9F A;  1FKB A;  2MLY A;  2XPA A;  3JYJ A;  4DZ3 A;  4DZ2 A;  4ODL A;  4IPX A;  4NNR A;  3TDB A;  1FKR A;  4G2P A;  5I98 A;  4JFI A;  3B7X A;  4JYS A;  2ZQV A;  3O5D A;  5BXJ A;  2PV3 A;  2ZQT A;  2ZR6 A;  2KE0 A;  1JNS A;  2RUC A;  1HXV A;  5HW6 A;  1KT0 A;  4DRJ A;  3O5J A;  1JNT A;  1QPF A;  5HT1 A;  3LUO A;  3TC5 A;  1M5Y A;  4TX0 A;  4ITZ A;  5DIT A;  3UI6 A;  4DRP A;  1FKL A;  2MF9 A;  2XP4 A;  1ROT A;  2MLX A;  1ZCN A;  3KCE A;  2ITK A;  1D6O A;  3IKG A;  2ZQS A;  1NMV A;  2RQS A;  3UQI A;  5DIV A;  2RUR A;  3IKD A;  3KAD A;  3ODK A;  3KAB A;  1YW5 A;  4TW7 A;  2FAP A;  2F21 A;  4FN2 A;  3WH0 A;  1FKT A;  1D7I A;  1QPL A;  2F4E A;  4DRN A;  4LAW A;  2KO7 A;  1TCO C;  1NMW A;  1FKK A;  1J4R A;  3CGM A;  3O5R A;  4FAP A;  1L1P A;  2AWG A;  1FKD A;  2PPP A;  2MPH A;  1PIN A;  3JYM A;  4DRM A;  4DRQ A;  5D75 A;  4U84 A;  5HUA A;  5J6E A;  4DRI A;  4W9P A;  4LAX A;  4W9O A;  2LJ4 A;  3I6C A;  2KR7 A;  3O5P A;  1J6Y A;  1FJD A;  1YAT A;  1N1A A;  3O5F A;  4W9Q A;  1FKG A;  1FKJ A;  2MLZ A;  4JFM A;  4TNS A;  1F40 A;  3CGN A;  1FAP A;  1FKF A;  3UQA A;  4ODM A;  2ZR5 A;  2RSE A;  4DRH A;  1NSG A;  1FKS A;  1F8A B;  1W26 A;  2Y78 A;  2K8I A;  1U79 A;  4O2T A;  1D7J A;  3KAH A;  2XP7 A;  1JVW A;  4DRK A;  3RFW A;  4ODQ A;  4TW6 A;  1A7X A;  5HTG A;  2M2A A;  4JFL A;  5DIU A;  1QZ2 A;  2IF4 A;  1Y0O A;  1ROU A;  2VCD A;  2L2S A;  5HW7 A;  1R9H A;  3GPK A;  5GPG A;  3IHZ A;  3VAW A;  1FKH A;  4ODP A;  2XP5 A;  1FKI A;  3UQB A;  2PPN A;  2RUQ A;  1Q6H A;  3PRB A;  5B8I C;  4LAV A;  2ZR4 A;  3NRK A;  3O5I A;  3O5L A;  2PV2 A;  1EQ3 A;  2DG9 A;  4TYO A;  1EYM A;  3KAI A;  3TCZ A;  2M08 A;  2PPO A;  4MGV A;  4DIP A;  3PRD A;  2LKN A;  2LPV A;  4ODO A;  2XP9 A;  2DG4 A;  1Q6U A;  2XP6 A;  2PBC A;  2XP3 A;  1J4H A;  3JXV A;  3O5E A;  1C9H A;  4JFK A;  4ODK A;  4R0X A;  3MDY B;  3NI6 A;  4U86 A;  1D7H A;  2DG3 A;  3O5K A;  3KAG A;  4LAY A;  3KAC A;  5HWB A;  1Q6I A;  1Q1C A;  2FKE A;  3IK8 A;  2KI3 A;  2KGJ A;  3NTP A;  4ODR A;  1PBK A;  3UI5 A;  5HW8 A;  2MNT A;  4JFJ A;  4U85 A;  1B6C A; 
#chains in the Genus database with same CATH topology
 4L3N A;  1H0G A;  4NZC A;  4N19 A;  3O5O A;  2LGO A;  2PV1 A;  3KAF A;  2A3E A;  4J4O A;  4DRK A;  1KFW A;  2OFN A;  5DO2 A;  5HKG A;  1E6N A;  3ALG A;  2F2D A;  2KFW A;  1HKJ A;  2XPB A;  1KT1 A;  2UZ5 A;  1CTN A;  2D9F A;  1NWT A;  1ZU8 A;  3AS0 A;  3AQU A;  1X6L A;  4R5E A;  3TDB A;  1FKR A;  3B7X A;  4JYS A;  2B5U B;  3O5D A;  2PV3 A;  1GUV A;  2ZR6 A;  1HXV A;  5HW6 A;  4DWS A;  1X6N A;  5DIT A;  4URI A;  2ITK A;  2ZQS A;  2OLH A;  3ARR A;  5DIV A;  2RUR A;  3IKD A;  3KAB A;  1YW5 A;  1IX5 A;  2FAP A;  4FN2 A;  4WJX A;  4Z2J A;  2F4E A;  3ARP A;  1LL7 A;  1HJX A;  1NMW A;  2DSZ A;  1FKK A;  1L1P A;  1LL4 A;  1FKD A;  2AWG A;  4MNJ A;  4DRQ A;  1PIN A;  3PRA A;  4U84 A;  5J6E A;  2WM0 A;  4DRI A;  4W9O A;  2LJ4 A;  1FJD A;  1ZBC A;  1E9L A;  4W9Q A;  4MNL A;  1FKJ A;  4DWS D;  1FAP A;  2PI6 A;  4ODM A;  1ITX A;  1E44 A;  2DT0 A;  1GPF A;  1D7J A;  3RFW A;  4TW6 A;  5DEZ A;  3ART A;  5DIU A;  1Y0O A;  2VCD A;  3ARS A;  2XP5 A;  3UQB A;  2ZR4 A;  3WD1 A;  4ZPV R;  3NRK A;  1EYM A;  3KAI A;  1E15 A;  4MGV A;  1LG1 A;  1W9U A;  1E6R A;  3JXV A;  2XP3 A;  4JFK A;  4LGX A;  3MDY B;  4MTV A;  1WNO A;  4LAY A;  3ARV A;  2P4V A;  2FKE A;  1K9T A;  1EIB A;  5HW8 A;  1JND A;  4TW8 A;  3O5Q A;  3O5M A;  3ARW A;  3EY6 A;  2B31 A;  2N87 A;  1HKK A;  1ZK6 A;  3CZ8 A;  4BF8 A;  2ZQU A;  1E6Z A;  1RD6 A;  1BL4 A;  2DT3 A;  2YBU A;  1FFQ A;  3FAP A;  4Z2L A;  5HWC A;  2XP8 A;  4DT4 A;  1FD9 A;  4MNK A;  1FKB A;  2MLY A;  3JYJ A;  3WQW A;  4P8V A;  3ARZ A;  3RM8 A;  3QOK A;  4JFI A;  1WB0 A;  1LL6 A;  1EHN A;  1LQ0 A;  1SYT A;  5BXJ A;  2KE0 A;  1JNS A;  4DRJ A;  1OWQ A;  3O5J A;  1JNT A;  2ETN A;  2PN0 A;  3TC5 A;  1M5Y A;  2DSU A;  3PR9 A;  4DWS B;  4Q7N A;  2XP4 A;  1ROT A;  1HJV A;  2MLX A;  3KCE A;  5DF0 A;  1W9V A;  1NMV A;  2RQS A;  1LG2 A;  4W5U A;  1FKT A;  1QPL A;  4KQZ A;  3WD3 A;  2KO7 A;  3O5R A;  1W1Y A;  2G41 A;  2MPH A;  2PPP A;  3FY1 A;  5D75 A;  4HAR A;  1E6P A;  4PTM A;  4TNS A;  1FKF A;  3UQA A;  2ZR5 A;  1F8A B;  4HBO A;  2Y78 A;  3CH9 A;  1U79 A;  1UR9 A;  1JVW A;  4ODQ A;  4P8X A;  2M2A A;  2DT1 A;  2L2S A;  1R9H A;  3VAW A;  4ODP A;  1W9P A;  1FKI A;  1D2K A;  3CHF A;  1Q6H A;  1O6I A;  2M08 A;  3PRD A;  2LKN A;  2WLY A;  2DG4 A;  1Q6U A;  3O5E A;  1C9H A;  3NI6 A;  2DG3 A;  1GOI A;  2WLZ A;  1Q1C A;  4IT4 A;  3UI5 A;  4UDM A;  4JFJ A;  4GGQ A;  5GQB A;  4IQ2 A;  2JZV A;  1WAW A;  4C02 B;  1T11 A;  4HBE A;  2A3A A;  3RGC A;  2RUD A;  4J4N A;  3PA7 A;  3RME A;  3H9R B;  3UF8 A;  4DH0 A;  2VN1 A;  4MNM A;  3GTY X;  4IQC A;  4MSP A;  3OOB A;  2FDM A;  3WKZ A;  4DZ3 A;  2A3B A;  4WKF A;  4L72 B;  4ODL A;  4ZPT R;  1FFR A;  1GRJ A;  4IPX A;  4NNR A;  3AS2 A;  2ZQV A;  4WK9 A;  3BXW A;  2ZQT A;  1VF8 A;  1NWU A;  1ZBK A;  2DSW A;  5HT1 A;  3LUO A;  4TX0 A;  4WKH A;  3WQV A;  4P8U A;  1FKL A;  1ZL1 A;  3IKG A;  3ARY A;  3UQI A;  3RM9 A;  4DWS C;  3KAD A;  3ODK A;  4TW7 A;  3WH0 A;  4DRN A;  1D7I A;  2IUZ A;  4LAW A;  3ARO A;  3CGM A;  3JYM A;  4DRM A;  5HUA A;  3ARQ A;  4LAX A;  2G8Z A;  1N1A A;  1FKG A;  2MLZ A;  3ALF A;  1F40 A;  4WKA A;  2RSE A;  4DRH A;  5GPR A;  1NSG A;  1FKS A;  3G6L A;  3AS1 A;  3GU0 A;  1A7X A;  3WL0 A;  2ESC A;  1QZ2 A;  2IF4 A;  4ZPW R;  5HW7 A;  3GPK A;  5GPG A;  2O9O A;  1FKH A;  1NWS A;  3CHE A;  3ARX A;  2RUQ A;  3B9E A;  4XAK A;  5B8I C;  3EIP A;  3O5I A;  3O5L A;  1EQ3 A;  2DG9 A;  4TYO A;  4DIP A;  3G6M A;  2LPV A;  1TFV A;  4ODO A;  2AOS A;  1NWR A;  1W1T A;  2XP9 A;  2WK2 A;  2PBC A;  1HKM A;  2A3C A;  3WD2 A;  1XRV A;  2F23 A;  1D7H A;  4KR0 B;  3KAG A;  5HWB A;  1Q6I A;  3IK8 A;  5JH8 A;  4P8W A;  5HBF A;  3BMB A;  4ODR A;  2MNT A;  4U85 A;  1B6C A;  3AS3 A;  3FXY A;  1OGB A;  4ODN A;  1P5Q A;  4NSB A;  4QT3 A;  3UI4 A;  2QF8 A;  1J4I A;  3KZ7 A;  3O5G A;  4QT2 A;  4Z2G A;  1BKF A;  4QIB A;  2M1I A;  2Q5A A;  1W1V A;  4GIV A;  4G50 A;  4DRO A;  4IT6 A;  2XPA A;  4DZ2 A;  1JCH B;  4G2P A;  5I98 A;  3WL1 A;  3RM4 A;  2DSV A;  3OA5 A;  1EDQ A;  2RUC A;  1UR8 A;  1ZBW A;  1KT0 A;  1QPF A;  4ITZ A;  3UI6 A;  3W4R A;  4DRP A;  3CHD A;  2MF9 A;  1HJW A;  1XHG A;  1ZCN A;  4ZS6 A;  1D6O A;  1H0I A;  4S3J A;  2F21 A;  4WIW A;  2DPE A;  1TCO C;  1J4R A;  4FAP A;  3CHC A;  4AY1 A;  4Z2I A;  4W9P A;  4ML4 A;  1J6Y A;  3I6C A;  2KR7 A;  3O5P A;  1YAT A;  3O5F A;  1ZB5 A;  1W1P A;  4QZV B;  4MPK A;  4JFM A;  1LJY A;  3WD0 A;  3B8S A;  3CGN A;  4S3K A;  4Z2K A;  1W26 A;  2K8I A;  4O2T A;  3KAH A;  2XP7 A;  2YBT A;  1NH6 A;  1SR0 A;  2EUL A;  5HTG A;  4JFL A;  1ZBV A;  1ROU A;  4Z2H A;  1JNE A;  3IHZ A;  2PPN A;  3B9D A;  3PRB A;  4Q22 A;  3WIJ A;  1HKI A;  2PV2 A;  2O92 A;  2PPO A;  1OGG A;  3TCZ A;  2XP6 A;  1J4H A;  4MAV A;  4R0X A;  4U86 A;  4ODK A;  3O5K A;  3WD4 A;  3KAC A;  3ARU A;  2DT2 A;  2KI3 A;  2KGJ A;  3NTP A;  1PBK A;  3B9A A;  4LAV A; 
#chains in the Genus database with same CATH homology
 4L3N A;  1H0G A;  4NZC A;  4N19 A;  3O5O A;  2LGO A;  2PV1 A;  3KAF A;  2A3E A;  4J4O A;  4DRK A;  1KFW A;  2OFN A;  5DO2 A;  5HKG A;  1E6N A;  3ALG A;  2F2D A;  2KFW A;  1HKJ A;  2XPB A;  1KT1 A;  2UZ5 A;  1CTN A;  2D9F A;  1NWT A;  1ZU8 A;  3AS0 A;  3AQU A;  1X6L A;  4R5E A;  3TDB A;  1FKR A;  3B7X A;  4JYS A;  3O5D A;  2PV3 A;  1GUV A;  2ZR6 A;  1HXV A;  5HW6 A;  4DWS A;  1X6N A;  5DIT A;  4URI A;  2ITK A;  2ZQS A;  2OLH A;  3ARR A;  5DIV A;  2RUR A;  3IKD A;  3KAB A;  1YW5 A;  1IX5 A;  2FAP A;  4FN2 A;  4WJX A;  4Z2J A;  2F4E A;  3ARP A;  1LL7 A;  1HJX A;  1NMW A;  2DSZ A;  1FKK A;  1L1P A;  1LL4 A;  1FKD A;  2AWG A;  4MNJ A;  4DRQ A;  1PIN A;  3PRA A;  4U84 A;  5J6E A;  2WM0 A;  4DRI A;  4W9O A;  2LJ4 A;  1FJD A;  1ZBC A;  1E9L A;  4W9Q A;  4MNL A;  1FKJ A;  4DWS D;  1FAP A;  2PI6 A;  4ODM A;  1ITX A;  2DT0 A;  1GPF A;  1D7J A;  3RFW A;  4TW6 A;  5DEZ A;  3ART A;  5DIU A;  1Y0O A;  2VCD A;  3ARS A;  2XP5 A;  3UQB A;  2ZR4 A;  3WD1 A;  4ZPV R;  3NRK A;  1EYM A;  3KAI A;  1E15 A;  4MGV A;  1LG1 A;  1W9U A;  1E6R A;  3JXV A;  2XP3 A;  4JFK A;  4LGX A;  3MDY B;  4MTV A;  1WNO A;  4LAY A;  3ARV A;  2FKE A;  1K9T A;  1EIB A;  5HW8 A;  1JND A;  4TW8 A;  3O5Q A;  3O5M A;  3ARW A;  3EY6 A;  2B31 A;  2N87 A;  1HKK A;  1ZK6 A;  3CZ8 A;  4BF8 A;  2ZQU A;  1E6Z A;  1RD6 A;  1BL4 A;  2DT3 A;  2YBU A;  1FFQ A;  3FAP A;  4Z2L A;  5HWC A;  2XP8 A;  4DT4 A;  1FD9 A;  4MNK A;  1FKB A;  2MLY A;  3JYJ A;  3WQW A;  4P8V A;  3ARZ A;  3RM8 A;  3QOK A;  4JFI A;  1WB0 A;  1LL6 A;  1EHN A;  1LQ0 A;  1SYT A;  5BXJ A;  2KE0 A;  1JNS A;  4DRJ A;  1OWQ A;  3O5J A;  1JNT A;  3TC5 A;  1M5Y A;  2DSU A;  3PR9 A;  4DWS B;  4Q7N A;  2XP4 A;  1ROT A;  1HJV A;  2MLX A;  3KCE A;  5DF0 A;  1W9V A;  1NMV A;  2RQS A;  1LG2 A;  4W5U A;  1FKT A;  1QPL A;  4KQZ A;  3WD3 A;  2KO7 A;  3O5R A;  1W1Y A;  2G41 A;  2MPH A;  2PPP A;  3FY1 A;  5D75 A;  4HAR A;  1E6P A;  4PTM A;  4TNS A;  1FKF A;  3UQA A;  2ZR5 A;  1F8A B;  4HBO A;  2Y78 A;  3CH9 A;  1U79 A;  1UR9 A;  1JVW A;  4ODQ A;  4P8X A;  2M2A A;  2DT1 A;  2L2S A;  1R9H A;  3VAW A;  4ODP A;  1W9P A;  1FKI A;  1D2K A;  3CHF A;  1Q6H A;  1O6I A;  2M08 A;  3PRD A;  2LKN A;  2WLY A;  2DG4 A;  1Q6U A;  3O5E A;  1C9H A;  3NI6 A;  2DG3 A;  1GOI A;  2WLZ A;  1Q1C A;  4IT4 A;  3UI5 A;  4JFJ A;  4GGQ A;  5GQB A;  4IQ2 A;  2JZV A;  1WAW A;  4C02 B;  1T11 A;  4HBE A;  2A3A A;  3RGC A;  2RUD A;  4J4N A;  3PA7 A;  3RME A;  3H9R B;  3UF8 A;  4DH0 A;  2VN1 A;  4MNM A;  4IQC A;  4MSP A;  3OOB A;  2FDM A;  3WKZ A;  4DZ3 A;  2A3B A;  4WKF A;  4L72 B;  4ODL A;  4ZPT R;  1FFR A;  4IPX A;  4NNR A;  3AS2 A;  2ZQV A;  4WK9 A;  3BXW A;  2ZQT A;  1VF8 A;  1NWU A;  1ZBK A;  2DSW A;  5HT1 A;  3LUO A;  4TX0 A;  4WKH A;  3WQV A;  4P8U A;  1FKL A;  1ZL1 A;  3IKG A;  3ARY A;  3UQI A;  3RM9 A;  4DWS C;  3KAD A;  3ODK A;  4TW7 A;  3WH0 A;  4DRN A;  1D7I A;  2IUZ A;  4LAW A;  3ARO A;  3CGM A;  3JYM A;  4DRM A;  5HUA A;  3ARQ A;  4LAX A;  2G8Z A;  1N1A A;  1FKG A;  2MLZ A;  3ALF A;  1F40 A;  4WKA A;  2RSE A;  4DRH A;  5GPR A;  1NSG A;  1FKS A;  3G6L A;  3AS1 A;  1A7X A;  3WL0 A;  2ESC A;  1QZ2 A;  2IF4 A;  4ZPW R;  5HW7 A;  3GPK A;  5GPG A;  2O9O A;  1FKH A;  1NWS A;  3CHE A;  3ARX A;  2RUQ A;  3B9E A;  4XAK A;  5B8I C;  3O5I A;  3O5L A;  1EQ3 A;  2DG9 A;  4TYO A;  4DIP A;  3G6M A;  2LPV A;  1TFV A;  4ODO A;  2AOS A;  1NWR A;  1W1T A;  2XP9 A;  2WK2 A;  2PBC A;  1HKM A;  2A3C A;  3WD2 A;  1XRV A;  1D7H A;  4KR0 B;  3KAG A;  5HWB A;  1Q6I A;  3IK8 A;  5JH8 A;  4P8W A;  5HBF A;  4ODR A;  2MNT A;  4U85 A;  1B6C A;  3AS3 A;  3FXY A;  1OGB A;  4ODN A;  1P5Q A;  4NSB A;  4QT3 A;  3UI4 A;  2QF8 A;  1J4I A;  3KZ7 A;  3O5G A;  4QT2 A;  4Z2G A;  1BKF A;  4QIB A;  2M1I A;  2Q5A A;  1W1V A;  4GIV A;  4G50 A;  4DRO A;  4IT6 A;  2XPA A;  4DZ2 A;  4G2P A;  5I98 A;  3WL1 A;  3RM4 A;  2DSV A;  3OA5 A;  1EDQ A;  2RUC A;  1UR8 A;  1ZBW A;  1KT0 A;  1QPF A;  4ITZ A;  3UI6 A;  3W4R A;  4DRP A;  3CHD A;  2MF9 A;  1HJW A;  1XHG A;  1ZCN A;  4ZS6 A;  1D6O A;  1H0I A;  4S3J A;  2F21 A;  4WIW A;  2DPE A;  1TCO C;  1J4R A;  4FAP A;  3CHC A;  4AY1 A;  4Z2I A;  4W9P A;  4ML4 A;  1J6Y A;  3I6C A;  2KR7 A;  3O5P A;  1YAT A;  3O5F A;  1ZB5 A;  1W1P A;  4QZV B;  4MPK A;  4JFM A;  1LJY A;  3WD0 A;  3B8S A;  3CGN A;  4S3K A;  4Z2K A;  1W26 A;  2K8I A;  4O2T A;  3KAH A;  2XP7 A;  2YBT A;  1NH6 A;  1SR0 A;  5HTG A;  4JFL A;  1ZBV A;  1ROU A;  4Z2H A;  1JNE A;  3IHZ A;  2PPN A;  3B9D A;  3PRB A;  4Q22 A;  3WIJ A;  1HKI A;  2PV2 A;  2O92 A;  2PPO A;  1OGG A;  3TCZ A;  2XP6 A;  1J4H A;  4MAV A;  4R0X A;  4U86 A;  4ODK A;  3O5K A;  3WD4 A;  3KAC A;  3ARU A;  2DT2 A;  2KI3 A;  2KGJ A;  3NTP A;  1PBK A;  3B9A A;  4LAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...