1JVWA

Trypanosoma cruzi macrophage infectivity potentiator (tcmip)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
160
structure length
160
Chain Sequence
AASHEERMNNYRKRVGRLFMEQKAAQPDAVKLPSGLVFQRIARGSGKRAPAIDDKCEVHYTGRLRDGTVFDSSRERGKPTTFRPNEVIKGWTEALQLMREGDRWRLFIPYDLAYGVTGGGGMIPPYSPLEFDVELISIKDGGKGRTAEEVDEILRKAEED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords MACROPHAGE INFECTIVITY POTENTIATOR
publication title Trypanosoma cruzi macrophage infectivity potentiator has a rotamase core and a highly exposed alpha-helix.
pubmed doi rcsb
source organism Trypanosoma cruzi
total genus 50
structure length 160
sequence length 160
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1jvwA00
3KADA 2F2DA 4DRHA 2IF4A 1PINA 2XPBA 3LUOA 3O5GA 3KAHA 3KZ7A 2UZ5A 4DIPA 2F21A 1J4RA 2M2AA 2FKEA 1R9HA 1F40A 3O5LA 4TNSA 4BF8A 5D75A 4JFKA 2DG4A 4JFLA 1FKTA 4DRIA 3KAFA 1N1AA 4DRPA 5HT1A 2PPOA 3NTPA 4GGQA 4ODQA 1EYMA 3JYJA 1U79A 4W9PA 3KAIA 1F8AB 3UI4A 4TW6A 1ROTA 5HUAA 5HWCA 4J4NA 2RUQA 2LGOA 2KR7A 4C02B 2JZVA 2M08A 2MNTA 4G2PA 4N19A 4ODMA 3VAWA 1FKHA 1KT0A 2ZR4A 3O5OA 1TCOC 4JFIA 5GPGA 2MLYA 2XP5A 2DG9A 2VCDA 1FKGA 1BL4A 2XP8A 3O5FA 2MLXA 3RFWA 2Y78A 4ODKA 4TYOA 3JXVA 1Q1CA 1NMWA 2MPHA 1QPFA 1FAPA 3NI6A 4QT3A 4JFMA 2AWGA 2XP4A 1M5YA 4DRQA 2KGJA 3IKGA 3CGMA 1FKFA 5J6EA 3O5IA 4U84A 4MGVA 3TC5A 5HW7A 1ROUA 2ITKA 3TDBA 2XPAA 2DG3A 3IHZA 4DRJA 1C9HA 5B8IC 1J6YA 3I6CA 3UI6A 2PPPA 4DRKA 2M1IA 2XP3A 2XP9A 4G50A 3UQIA 5I98A 4IQCA 1D7HA 1NMVA 2LPVA 2KE0A 3PRDA 1FKSA 5DIUA 2KI3A 1QPLA 4O2TA 1QZ2A 3O5JA 2FAPA 3KAGA 4TW8A 3RGCA 2RURA 2ZQVA 3FAPA 4IQ2A 4IPXA 4LAVA 4ODLA 4TX0A 4W9QA 4U86A 1JVWA 1FKKA 1KT1A 2VN1A 3O5DA 4DROA 3KABA 3O5QA 3EY6A 3UQAA 3PA7A 5HKGA 1D7IA 3ODKA 2KFWA 5DIVA 1NSGA 4TW7A 1FJDA 4LAXA 5HW6A 5HW8A 2PBCA 3UF8A 1BKFA 4FAPA 2MF9A 2OFNA 4JFJA 2Q5AA 4ODNA 1J4IA 3OOBA 4MSPA 1T11A 4FN2A 4ODOA 1Y0OA 4QIBA 1Q6UA 1Q6HA 4W9OA 2ZR6A 1P5QA 1FKLA 1FKIA 4J4OA 4ODRA 3O5PA 2L2SA 1HXVA 2XP6A 3CGNA 1YW5A 2F4EA 1D7JA 1A7XA 5HTGA 1ZCNA 2LJ4A 3B7XA 2ZQTA 2RQSA 2ZR5A 4NNRA 2KO7A 1FKBA 1ZK6A 2RSEA 2RUDA 1FD9A 2D9FA 2XP7A 1FKDA 3IK8A 3O5KA 3O5RA 4DRNA 4DT4A 1D6OA 3KCEA 4ODPA 1YATA 2MLZA 1L1PA 3NRKA 1W26A 2LKNA 3GPKA 4GIVA 4JYSA 2PPNA 2PV2A 4DZ3A 1B6CA 3IKDA 2RUCA 3JYMA 2PV3A 1FKJA 2K8IA 1EQ3A 1FKRA 4DZ2A 3H9RB 4QT2A 3WH0A 3O5EA 4U85A 5DITA 4DRMA 1JNTA 2ZQUA 4LAYA 1Q6IA 3MDYB 3UI5A 4DH0A 5BXJA 2PV1A 2N87A 1JNSA 5HWBA 3UQBA 3KACA 4LAWA 4R0XA 3TCZA 3O5MA 1PBKA 2ZQSA 3PRBA 1J4HA 4ITZA
chains in the Genus database with same CATH superfamily
3KADA 3RM4A 1EDQA 2IF4A 2XPBA 3LUOA 3KZ7A 2DT2A 2O92A 3AS1A 3QOKA 3RMEA 1F40A 4NZCA 4WKHA 1FFQA 4QZVB 4JFLA 4DRIA 1WB0A 4DRPA 2DT3A 2PPOA 3NTPA 4GGQA 3JYJA 1U79A 1F8AB 5DF0A 2KR7A 4C02B 2JZVA 4G2PA 3VAWA 1FKHA 1KT0A 1NWRA 2ZR4A 4S3JA 5GPGA 5GQBA 2DSWA 1ZBKA 1BL4A 2DPEA 3RFWA 4TYOA 1NMWA 4QT3A 3IKGA 1E9LA 4MGVA 3TC5A 2PI6A 1EHNA 3IHZA 4L3NA 1K9TA 1JNEA 2PPPA 2XP3A 4DRKA 1EIBA 1ZB5A 4O2TA 3KAGA 4P8WA 1H0GA 2ZQVA 4IQ2A 4IPXA 4MAVA 4DWSC 4ML4A 1JCHB 4ZPVR 1FKKA 3O5DA 3KABA 3UQAA 3EY6A 1E6ZA 1W9UA 5HKGA 1KFWA 2KFWA 4TW7A 1SR0A 1ZBWA 1BKFA 4FAPA 1J4IA 1Q6UA 4W9OA 2ZR6A 1HKIA 1LL6A 4ODRA 2L2SA 4Z2JA 2XP6A 3BXWA 1HJWA 3WQWA 2DSZA 1SYTA 4NNRA 3IK8A 2A3EA 1L1PA 1W26A 3ALGA 2LKNA 3GPKA 1E6RA 2PPNA 2PV2A 4Z2LA 3JYMA 2PV3A 2K8IA 1FKRA 1ITXA 4DZ2A 3H9RB 3CHFA 3O5EA 1JNTA 4LAYA 1LL7A 1JNSA 4ZPWR 3G6MA 1W1YA 1HKJA 3KACA 4AY1A 3O5MA 3ARZA 1FFRA 3B9DA 2WM0A 3TCZA 3AS2A 4DWSA 4DIPA 2F21A 2M2AA 2FKEA 5D75A 4JFKA 1N1AA 1EYMA 4W9PA 5HUAA 5HWCA 4J4NA 3CZ8A 2LGOA 3ARPA 2M08A 1GOIA 2MNTA 1OWQA 3CH9A 4WIWA 4DWSB 3O5FA 2MLXA 4ODKA 1Q1CA 1FAPA 3ALFA 2O9OA 2YBTA 1LG2A 1M5YA 4DWSD 3CGMA 4Z2HA 5HW7A 1OGGA 3AROA 3B9AA 3I6CA 3UI6A 5I98A 2LPVA 2KE0A 5DIUA 1XHGA 2DSUA 1HKMA 1VF8A 4TW8A 4ODLA 1WAWA 2EULA 4U86A 1JVWA 1KT1A 4S3KA 2ESCA 2P4VA 3PA7A 1D7IA 1NSGA 4WKAA 3ARXA 3B9EA 3ARVA 3WD0A 3CHCA 4JFJA 2Q5AA 4ODOA 5B8IC 4QIBA 1T11A 4FN2A 1LJYA 1NWSA 1P5QA 1FKIA 4HBEA 4ZPTR 1HXVA 1D7JA 2F4EA 1A7XA 1W9PA 3FY1A 2LJ4A 3B7XA 2RQSA 2ZR5A 2IUZA 4URIA 4ODPA 2MLZA 1X6LA 4JYSA 3WQVA 4U85A 3WD1A 1NWUA 4DH0A 3MDYB 1GRJA 1W1TA 1W1PA 1PBKA 4MPKA 4MNKA 2VCDA 4WJXA 5JH8A 1CTNA 4L72B 2F2DA 4DRHA 2B31A 1PINA 3ARSA 3O5GA 2DSVA 1LQ0A 2UZ5A 1J4RA 4W5UA 1ZL1A 3O5LA 3WD2A 1O6IA 4BF8A 2DG4A 3WD4A 1UR8A 4ODQA 3FXYA 3UI4A 3KAIA 4TW6A 1ROTA 2RUQA 4HARA 4P8XA 3WL0A 1W9VA 2WK2A 3O5OA 1TCOC 2MLYA 2XP5A 4IT6A 2XP8A 2Y78A 3JXVA 3NI6A 1QPFA 4JFMA 2A3CA 2KGJA 4XAKA 1FKFA 5J6EA 3PRAA 1ZU8A 1ROUA 4Z2IA 3PR9A 2XPAA 2DG3A 2ETNA 4Q22A 5HBFA 1XRVA 1C9HA 3GU0A 1J6YA 1HJXA 2M1IA 2XP9A 2F23A 4IQCA 1D7HA 1NMVA 3PRDA 3EIPA 2KI3A 3BMBA 1QZ2A 3O5JA 3RGCA 3FAPA 2VN1A 3ARYA 4Q7NA 3O5QA 5DIVA 3W4RA 4LAXA 5HW6A 2WLZA 1HKKA 3UQIA 3OOBA 4MSPA 1GPFA 2G41A 2G8ZA 1FKLA 4J4OA 4WKFA 3O5PA 4KQZA 1YW5A 3RM9A 1GUVA 3RM8A 1ZCNA 3ARTA 2ZQTA 3GTYX 1FKBA 2XP7A 5HTGA 1IX5A 2D9FA 4DT4A 3NRKA 3AQUA 2AOSA 3CHDA 1W1VA 4DZ3A 1B6CA 4NSBA 3IKDA 3B8SA 2WLYA 4MTVA 1E15A 2OLHA 3WIJA 3UI5A 2N87A 5HWBA 3UQBA 4LAWA 1RD6A 1JNDA 1J4HA 4ITZA 3CHEA 2B5UB 3KAHA 3ARQA 1R9HA 4WK9A 4TNSA 4KR0B 4P8UA 1FKTA 3KAFA 2DT1A 5HT1A 1OGBA 1ZBVA 4ODMA 4N19A 2FDMA 4MNJA 4JFIA 1NWTA 1H0IA 3AS3A 1ZBCA 2DG9A 4Z2KA 1FKGA 2MPHA 2AWGA 2XP4A 2DT0A 4DRQA 3O5IA 4U84A 2ITKA 3TDBA 3WD3A 3WL1A 2QF8A 2A3BA 4Z2GA 4G50A 4ZS6A 2A3AA 1X6NA 4R5EA 1FKSA 1QPLA 2FAPA 3ARRA 1E44A 4P8VA 2RURA 4LAVA 4TX0A 2YBUA 4W9QA 4DROA 1UR9A 1LG1A 3ODKA 4HBOA 1E6NA 1FJDA 1D2KA 5HW8A 2PBCA 3UF8A 1HJVA 2MF9A 2OFNA 4LGXA 1NH6A 4ODNA 1Y0OA 1Q6HA 5DEZA 5GPRA 3WKZA 3CGNA 4IT4A 3ARUA 3G6LA 2KO7A 1ZK6A 2RSEA 3O5KA 2RUDA 1FD9A 1E6PA 3O5RA 1FKDA 4DRJA 4DRNA 1D6OA 3KCEA 1YATA 4UDMA 4MNLA 4GIVA 1TFVA 1LL4A 2RUCA 1FKJA 1EQ3A 3ARWA 4QT2A 3WH0A 5DITA 4DRMA 2ZQUA 3AS0A 4MNMA 1Q6IA 5BXJA 2PV1A 1WNOA 4PTMA 3OA5A 4R0XA 5DO2A 2ZQSA 2PN0A 3PRBA
chains in the Genus database with same CATH topology
3KADA 3RM4A 1EDQA 2IF4A 2XPBA 3LUOA 3KZ7A 2DT2A 2O92A 3AS1A 3QOKA 3RMEA 1F40A 4NZCA 4WKHA 1FFQA 4QZVB 4JFLA 4DRIA 1WB0A 4DRPA 2DT3A 2PPOA 3NTPA 4GGQA 3JYJA 1U79A 1F8AB 5DF0A 2KR7A 4C02B 2JZVA 4G2PA 3VAWA 1FKHA 1KT0A 1NWRA 2ZR4A 4S3JA 5GPGA 5GQBA 2DSWA 1ZBKA 1BL4A 2DPEA 3RFWA 4TYOA 1NMWA 4QT3A 3IKGA 1E9LA 4MGVA 3TC5A 2PI6A 1EHNA 3IHZA 4L3NA 1K9TA 1JNEA 2PPPA 2XP3A 4DRKA 1EIBA 1ZB5A 4O2TA 3KAGA 4P8WA 1H0GA 2ZQVA 4IQ2A 4IPXA 4MAVA 4DWSC 4ML4A 4ZPVR 1FKKA 3O5DA 3KABA 3UQAA 3EY6A 1E6ZA 1W9UA 5HKGA 1KFWA 2KFWA 4TW7A 1SR0A 1ZBWA 1BKFA 4FAPA 1J4IA 1Q6UA 4W9OA 2ZR6A 1HKIA 1LL6A 4ODRA 2L2SA 4Z2JA 2XP6A 3BXWA 1HJWA 3WQWA 2DSZA 1SYTA 4NNRA 3IK8A 2A3EA 1L1PA 1W26A 3ALGA 2LKNA 3GPKA 1E6RA 2PPNA 2PV2A 4Z2LA 3JYMA 2PV3A 2K8IA 1FKRA 1ITXA 4DZ2A 3H9RB 3CHFA 3O5EA 1JNTA 4LAYA 1LL7A 1JNSA 4ZPWR 3G6MA 1W1YA 1HKJA 3KACA 4AY1A 3O5MA 3ARZA 1FFRA 3B9DA 2WM0A 3TCZA 3AS2A 4DWSA 4DIPA 2F21A 2M2AA 2FKEA 5D75A 4JFKA 1N1AA 1EYMA 4W9PA 5HUAA 5HWCA 4J4NA 3CZ8A 2LGOA 3ARPA 2M08A 1GOIA 2MNTA 1OWQA 3CH9A 4WIWA 4DWSB 3O5FA 2MLXA 4ODKA 1Q1CA 1FAPA 3ALFA 2O9OA 2YBTA 1LG2A 1M5YA 4DWSD 3CGMA 4Z2HA 5HW7A 1OGGA 3AROA 3B9AA 3I6CA 3UI6A 5I98A 2LPVA 2KE0A 5DIUA 1XHGA 2DSUA 1HKMA 1VF8A 4TW8A 4ODLA 1WAWA 4U86A 1JVWA 1KT1A 4S3KA 2ESCA 3PA7A 1D7IA 1NSGA 4WKAA 3ARXA 3B9EA 3ARVA 3WD0A 3CHCA 4JFJA 2Q5AA 4ODOA 5B8IC 4QIBA 1T11A 4FN2A 1LJYA 1NWSA 1P5QA 1FKIA 4HBEA 4ZPTR 1HXVA 1D7JA 2F4EA 1A7XA 1W9PA 3FY1A 2LJ4A 3B7XA 2RQSA 2ZR5A 2IUZA 4URIA 4ODPA 2MLZA 1X6LA 4JYSA 3WQVA 4U85A 3WD1A 1NWUA 4DH0A 3MDYB 1W1TA 1W1PA 1PBKA 4MPKA 4MNKA 2VCDA 4WJXA 5JH8A 1CTNA 4L72B 2F2DA 4DRHA 2B31A 1PINA 3ARSA 3O5GA 2DSVA 1LQ0A 2UZ5A 1J4RA 4W5UA 1ZL1A 3O5LA 3WD2A 1O6IA 4BF8A 2DG4A 3WD4A 1UR8A 4ODQA 3FXYA 3UI4A 3KAIA 4TW6A 1ROTA 2RUQA 4HARA 4P8XA 3WL0A 1W9VA 2WK2A 3O5OA 1TCOC 2MLYA 2XP5A 4IT6A 2XP8A 2Y78A 3JXVA 3NI6A 1QPFA 4JFMA 2A3CA 2KGJA 4XAKA 1FKFA 5J6EA 3PRAA 1ZU8A 1ROUA 4Z2IA 3PR9A 2XPAA 2DG3A 4Q22A 5HBFA 1XRVA 1C9HA 1J6YA 1HJXA 2M1IA 2XP9A 4IQCA 1D7HA 1NMVA 3PRDA 2KI3A 1QZ2A 3O5JA 3RGCA 3FAPA 2VN1A 3ARYA 4Q7NA 3O5QA 5DIVA 3W4RA 4LAXA 5HW6A 2WLZA 1HKKA 3UQIA 3OOBA 4MSPA 1GPFA 2G41A 2G8ZA 1FKLA 4J4OA 4WKFA 3O5PA 4KQZA 1YW5A 3RM9A 1GUVA 3RM8A 1ZCNA 3ARTA 2ZQTA 1FKBA 2XP7A 5HTGA 1IX5A 2D9FA 4DT4A 3NRKA 3AQUA 2AOSA 3CHDA 1W1VA 4DZ3A 1B6CA 4NSBA 3IKDA 3B8SA 2WLYA 4MTVA 1E15A 2OLHA 3WIJA 3UI5A 2N87A 5HWBA 3UQBA 4LAWA 1RD6A 1JNDA 1J4HA 4ITZA 3CHEA 3KAHA 3ARQA 1R9HA 4WK9A 4TNSA 4KR0B 4P8UA 1FKTA 3KAFA 2DT1A 5HT1A 1OGBA 1ZBVA 4ODMA 4N19A 2FDMA 4MNJA 4JFIA 1NWTA 1H0IA 3AS3A 1ZBCA 2DG9A 4Z2KA 1FKGA 2MPHA 2AWGA 2XP4A 2DT0A 4DRQA 3O5IA 4U84A 2ITKA 3TDBA 3WD3A 3WL1A 2QF8A 2A3BA 4Z2GA 4G50A 4ZS6A 2A3AA 1X6NA 4R5EA 1FKSA 1QPLA 2FAPA 3ARRA 4P8VA 2RURA 4LAVA 4TX0A 2YBUA 4W9QA 4DROA 1UR9A 1LG1A 3ODKA 4HBOA 1E6NA 1FJDA 1D2KA 5HW8A 2PBCA 3UF8A 1HJVA 2MF9A 2OFNA 4LGXA 1NH6A 4ODNA 1Y0OA 1Q6HA 5DEZA 5GPRA 3WKZA 3CGNA 4IT4A 3ARUA 3G6LA 2KO7A 1ZK6A 2RSEA 3O5KA 2RUDA 1FD9A 1E6PA 3O5RA 1FKDA 4DRJA 4DRNA 1D6OA 3KCEA 1YATA 4MNLA 4GIVA 1TFVA 1LL4A 2RUCA 1FKJA 1EQ3A 3ARWA 4QT2A 3WH0A 5DITA 4DRMA 2ZQUA 3AS0A 4MNMA 1Q6IA 5BXJA 2PV1A 1WNOA 4PTMA 3OA5A 4R0XA 5DO2A 2ZQSA 3PRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KAD A;  2F2D A;  4DRH A;  2IF4 A;  1PIN A;  2XPB A;  3LUO A;  3O5G A;  3KAH A;  3KZ7 A;  2UZ5 A;  4DIP A;  2F21 A;  1J4R A;  2M2A A;  2FKE A;  1R9H A;  1F40 A;  3O5L A;  4TNS A;  4BF8 A;  5D75 A;  4JFK A;  2DG4 A;  4JFL A;  1FKT A;  4DRI A;  3KAF A;  1N1A A;  4DRP A;  5HT1 A;  2PPO A;  3NTP A;  4GGQ A;  4ODQ A;  1EYM A;  3JYJ A;  1U79 A;  4W9P A;  3KAI A;  1F8A B;  3UI4 A;  4TW6 A;  1ROT A;  5HUA A;  5HWC A;  4J4N A;  2RUQ A;  2LGO A;  2KR7 A;  4C02 B;  2JZV A;  2M08 A;  2MNT A;  4G2P A;  4N19 A;  4ODM A;  3VAW A;  1FKH A;  1KT0 A;  2ZR4 A;  3O5O A;  1TCO C;  4JFI A;  5GPG A;  2MLY A;  2XP5 A;  2DG9 A;  2VCD A;  1FKG A;  1BL4 A;  2XP8 A;  3O5F A;  2MLX A;  3RFW A;  2Y78 A;  4ODK A;  4TYO A;  3JXV A;  1Q1C A;  1NMW A;  2MPH A;  1QPF A;  1FAP A;  3NI6 A;  4QT3 A;  4JFM A;  2AWG A;  2XP4 A;  1M5Y A;  4DRQ A;  2KGJ A;  3IKG A;  3CGM A;  1FKF A;  5J6E A;  3O5I A;  4U84 A;  4MGV A;  3TC5 A;  5HW7 A;  1ROU A;  2ITK A;  3TDB A;  2XPA A;  2DG3 A;  3IHZ A;  4DRJ A;  1C9H A;  5B8I C;  1J6Y A;  3I6C A;  3UI6 A;  2PPP A;  4DRK A;  2M1I A;  2XP3 A;  2XP9 A;  4G50 A;  3UQI A;  5I98 A;  4IQC A;  1D7H A;  1NMV A;  2LPV A;  2KE0 A;  3PRD A;  1FKS A;  5DIU A;  2KI3 A;  1QPL A;  4O2T A;  1QZ2 A;  3O5J A;  2FAP A;  3KAG A;  4TW8 A;  3RGC A;  2RUR A;  2ZQV A;  3FAP A;  4IQ2 A;  4IPX A;  4LAV A;  4ODL A;  4TX0 A;  4W9Q A;  4U86 A;  1JVW A;  1FKK A;  1KT1 A;  2VN1 A;  3O5D A;  4DRO A;  3KAB A;  3O5Q A;  3EY6 A;  3UQA A;  3PA7 A;  5HKG A;  1D7I A;  3ODK A;  2KFW A;  5DIV A;  1NSG A;  4TW7 A;  1FJD A;  4LAX A;  5HW6 A;  5HW8 A;  2PBC A;  3UF8 A;  1BKF A;  4FAP A;  2MF9 A;  2OFN A;  4JFJ A;  2Q5A A;  4ODN A;  1J4I A;  3OOB A;  4MSP A;  1T11 A;  4FN2 A;  4ODO A;  1Y0O A;  4QIB A;  1Q6U A;  1Q6H A;  4W9O A;  2ZR6 A;  1P5Q A;  1FKL A;  1FKI A;  4J4O A;  4ODR A;  3O5P A;  2L2S A;  1HXV A;  2XP6 A;  3CGN A;  1YW5 A;  2F4E A;  1D7J A;  1A7X A;  5HTG A;  1ZCN A;  2LJ4 A;  3B7X A;  2ZQT A;  2RQS A;  2ZR5 A;  4NNR A;  2KO7 A;  1FKB A;  1ZK6 A;  2RSE A;  2RUD A;  1FD9 A;  2D9F A;  2XP7 A;  1FKD A;  3IK8 A;  3O5K A;  3O5R A;  4DRN A;  4DT4 A;  1D6O A;  3KCE A;  4ODP A;  1YAT A;  2MLZ A;  1L1P A;  3NRK A;  1W26 A;  2LKN A;  3GPK A;  4GIV A;  4JYS A;  2PPN A;  2PV2 A;  4DZ3 A;  1B6C A;  3IKD A;  2RUC A;  3JYM A;  2PV3 A;  1FKJ A;  2K8I A;  1EQ3 A;  1FKR A;  4DZ2 A;  3H9R B;  4QT2 A;  3WH0 A;  3O5E A;  4U85 A;  5DIT A;  4DRM A;  1JNT A;  2ZQU A;  4LAY A;  1Q6I A;  3MDY B;  3UI5 A;  4DH0 A;  5BXJ A;  2PV1 A;  2N87 A;  1JNS A;  5HWB A;  3UQB A;  3KAC A;  4LAW A;  4R0X A;  3TCZ A;  3O5M A;  1PBK A;  2ZQS A;  3PRB A;  1J4H A;  4ITZ A; 
#chains in the Genus database with same CATH topology
 3KAD A;  3RM4 A;  1EDQ A;  2IF4 A;  2XPB A;  3LUO A;  3KZ7 A;  2DT2 A;  2O92 A;  3AS1 A;  3QOK A;  3RME A;  1F40 A;  4NZC A;  4WKH A;  1FFQ A;  4QZV B;  4JFL A;  4DRI A;  1WB0 A;  4DRP A;  2DT3 A;  2PPO A;  3NTP A;  4GGQ A;  3JYJ A;  1U79 A;  1F8A B;  5DF0 A;  2KR7 A;  4C02 B;  2JZV A;  4G2P A;  3VAW A;  1FKH A;  1KT0 A;  1NWR A;  2ZR4 A;  4S3J A;  5GPG A;  5GQB A;  2DSW A;  1ZBK A;  1BL4 A;  2DPE A;  3RFW A;  4TYO A;  1NMW A;  4QT3 A;  3IKG A;  1E9L A;  4MGV A;  3TC5 A;  2PI6 A;  1EHN A;  3IHZ A;  4L3N A;  1K9T A;  1JNE A;  2PPP A;  2XP3 A;  4DRK A;  1EIB A;  1ZB5 A;  4O2T A;  3KAG A;  4P8W A;  1H0G A;  2ZQV A;  4IQ2 A;  4IPX A;  4MAV A;  4DWS C;  4ML4 A;  1JCH B;  4ZPV R;  1FKK A;  3O5D A;  3KAB A;  3UQA A;  3EY6 A;  1E6Z A;  1W9U A;  5HKG A;  1KFW A;  2KFW A;  4TW7 A;  1SR0 A;  1ZBW A;  1BKF A;  4FAP A;  1J4I A;  1Q6U A;  4W9O A;  2ZR6 A;  1HKI A;  1LL6 A;  4ODR A;  2L2S A;  4Z2J A;  2XP6 A;  3BXW A;  1HJW A;  3WQW A;  2DSZ A;  1SYT A;  4NNR A;  3IK8 A;  2A3E A;  1L1P A;  1W26 A;  3ALG A;  2LKN A;  3GPK A;  1E6R A;  2PPN A;  2PV2 A;  4Z2L A;  3JYM A;  2PV3 A;  2K8I A;  1FKR A;  1ITX A;  4DZ2 A;  3H9R B;  3CHF A;  3O5E A;  1JNT A;  4LAY A;  1LL7 A;  1JNS A;  4ZPW R;  3G6M A;  1W1Y A;  1HKJ A;  3KAC A;  4AY1 A;  3O5M A;  3ARZ A;  1FFR A;  3B9D A;  2WM0 A;  3TCZ A;  3AS2 A;  4DWS A;  4DIP A;  2F21 A;  2M2A A;  2FKE A;  5D75 A;  4JFK A;  1N1A A;  1EYM A;  4W9P A;  5HUA A;  5HWC A;  4J4N A;  3CZ8 A;  2LGO A;  3ARP A;  2M08 A;  1GOI A;  2MNT A;  1OWQ A;  3CH9 A;  4WIW A;  4DWS B;  3O5F A;  2MLX A;  4ODK A;  1Q1C A;  1FAP A;  3ALF A;  2O9O A;  2YBT A;  1LG2 A;  1M5Y A;  4DWS D;  3CGM A;  4Z2H A;  5HW7 A;  1OGG A;  3ARO A;  3B9A A;  3I6C A;  3UI6 A;  5I98 A;  2LPV A;  2KE0 A;  5DIU A;  1XHG A;  2DSU A;  1HKM A;  1VF8 A;  4TW8 A;  4ODL A;  1WAW A;  2EUL A;  4U86 A;  1JVW A;  1KT1 A;  4S3K A;  2ESC A;  2P4V A;  3PA7 A;  1D7I A;  1NSG A;  4WKA A;  3ARX A;  3B9E A;  3ARV A;  3WD0 A;  3CHC A;  4JFJ A;  2Q5A A;  4ODO A;  5B8I C;  4QIB A;  1T11 A;  4FN2 A;  1LJY A;  1NWS A;  1P5Q A;  1FKI A;  4HBE A;  4ZPT R;  1HXV A;  1D7J A;  2F4E A;  1A7X A;  1W9P A;  3FY1 A;  2LJ4 A;  3B7X A;  2RQS A;  2ZR5 A;  2IUZ A;  4URI A;  4ODP A;  2MLZ A;  1X6L A;  4JYS A;  3WQV A;  4U85 A;  3WD1 A;  1NWU A;  4DH0 A;  3MDY B;  1GRJ A;  1W1T A;  1W1P A;  1PBK A;  4MPK A;  4MNK A;  2VCD A;  4WJX A;  5JH8 A;  1CTN A;  4L72 B;  2F2D A;  4DRH A;  2B31 A;  1PIN A;  3ARS A;  3O5G A;  2DSV A;  1LQ0 A;  2UZ5 A;  1J4R A;  4W5U A;  1ZL1 A;  3O5L A;  3WD2 A;  1O6I A;  4BF8 A;  2DG4 A;  3WD4 A;  1UR8 A;  4ODQ A;  3FXY A;  3UI4 A;  3KAI A;  4TW6 A;  1ROT A;  2RUQ A;  4HAR A;  4P8X A;  3WL0 A;  1W9V A;  2WK2 A;  3O5O A;  1TCO C;  2MLY A;  2XP5 A;  4IT6 A;  2XP8 A;  2Y78 A;  3JXV A;  3NI6 A;  1QPF A;  4JFM A;  2A3C A;  2KGJ A;  4XAK A;  1FKF A;  5J6E A;  3PRA A;  1ZU8 A;  1ROU A;  4Z2I A;  3PR9 A;  2XPA A;  2DG3 A;  2ETN A;  4Q22 A;  5HBF A;  1XRV A;  1C9H A;  3GU0 A;  1J6Y A;  1HJX A;  2M1I A;  2XP9 A;  2F23 A;  4IQC A;  1D7H A;  1NMV A;  3PRD A;  3EIP A;  2KI3 A;  3BMB A;  1QZ2 A;  3O5J A;  3RGC A;  3FAP A;  2VN1 A;  3ARY A;  4Q7N A;  3O5Q A;  5DIV A;  3W4R A;  4LAX A;  5HW6 A;  2WLZ A;  1HKK A;  3UQI A;  3OOB A;  4MSP A;  1GPF A;  2G41 A;  2G8Z A;  1FKL A;  4J4O A;  4WKF A;  3O5P A;  4KQZ A;  1YW5 A;  3RM9 A;  1GUV A;  3RM8 A;  1ZCN A;  3ART A;  2ZQT A;  3GTY X;  1FKB A;  2XP7 A;  5HTG A;  1IX5 A;  2D9F A;  4DT4 A;  3NRK A;  3AQU A;  2AOS A;  3CHD A;  1W1V A;  4DZ3 A;  1B6C A;  4NSB A;  3IKD A;  3B8S A;  2WLY A;  4MTV A;  1E15 A;  2OLH A;  3WIJ A;  3UI5 A;  2N87 A;  5HWB A;  3UQB A;  4LAW A;  1RD6 A;  1JND A;  1J4H A;  4ITZ A;  3CHE A;  2B5U B;  3KAH A;  3ARQ A;  1R9H A;  4WK9 A;  4TNS A;  4KR0 B;  4P8U A;  1FKT A;  3KAF A;  2DT1 A;  5HT1 A;  1OGB A;  1ZBV A;  4ODM A;  4N19 A;  2FDM A;  4MNJ A;  4JFI A;  1NWT A;  1H0I A;  3AS3 A;  1ZBC A;  2DG9 A;  4Z2K A;  1FKG A;  2MPH A;  2AWG A;  2XP4 A;  2DT0 A;  4DRQ A;  3O5I A;  4U84 A;  2ITK A;  3TDB A;  3WD3 A;  3WL1 A;  2QF8 A;  2A3B A;  4Z2G A;  4G50 A;  4ZS6 A;  2A3A A;  1X6N A;  4R5E A;  1FKS A;  1QPL A;  2FAP A;  3ARR A;  1E44 A;  4P8V A;  2RUR A;  4LAV A;  4TX0 A;  2YBU A;  4W9Q A;  4DRO A;  1UR9 A;  1LG1 A;  3ODK A;  4HBO A;  1E6N A;  1FJD A;  1D2K A;  5HW8 A;  2PBC A;  3UF8 A;  1HJV A;  2MF9 A;  2OFN A;  4LGX A;  1NH6 A;  4ODN A;  1Y0O A;  1Q6H A;  5DEZ A;  5GPR A;  3WKZ A;  3CGN A;  4IT4 A;  3ARU A;  3G6L A;  2KO7 A;  1ZK6 A;  2RSE A;  3O5K A;  2RUD A;  1FD9 A;  1E6P A;  3O5R A;  1FKD A;  4DRJ A;  4DRN A;  1D6O A;  3KCE A;  1YAT A;  4UDM A;  4MNL A;  4GIV A;  1TFV A;  1LL4 A;  2RUC A;  1FKJ A;  1EQ3 A;  3ARW A;  4QT2 A;  3WH0 A;  5DIT A;  4DRM A;  2ZQU A;  3AS0 A;  4MNM A;  1Q6I A;  5BXJ A;  2PV1 A;  1WNO A;  4PTM A;  3OA5 A;  4R0X A;  5DO2 A;  2ZQS A;  2PN0 A;  3PRB A; 
#chains in the Genus database with same CATH homology
 3KAD A;  3RM4 A;  1EDQ A;  2IF4 A;  2XPB A;  3LUO A;  3KZ7 A;  2DT2 A;  2O92 A;  3AS1 A;  3QOK A;  3RME A;  1F40 A;  4NZC A;  4WKH A;  1FFQ A;  4QZV B;  4JFL A;  4DRI A;  1WB0 A;  4DRP A;  2DT3 A;  2PPO A;  3NTP A;  4GGQ A;  3JYJ A;  1U79 A;  1F8A B;  5DF0 A;  2KR7 A;  4C02 B;  2JZV A;  4G2P A;  3VAW A;  1FKH A;  1KT0 A;  1NWR A;  2ZR4 A;  4S3J A;  5GPG A;  5GQB A;  2DSW A;  1ZBK A;  1BL4 A;  2DPE A;  3RFW A;  4TYO A;  1NMW A;  4QT3 A;  3IKG A;  1E9L A;  4MGV A;  3TC5 A;  2PI6 A;  1EHN A;  3IHZ A;  4L3N A;  1K9T A;  1JNE A;  2PPP A;  2XP3 A;  4DRK A;  1EIB A;  1ZB5 A;  4O2T A;  3KAG A;  4P8W A;  1H0G A;  2ZQV A;  4IQ2 A;  4IPX A;  4MAV A;  4DWS C;  4ML4 A;  4ZPV R;  1FKK A;  3O5D A;  3KAB A;  3UQA A;  3EY6 A;  1E6Z A;  1W9U A;  5HKG A;  1KFW A;  2KFW A;  4TW7 A;  1SR0 A;  1ZBW A;  1BKF A;  4FAP A;  1J4I A;  1Q6U A;  4W9O A;  2ZR6 A;  1HKI A;  1LL6 A;  4ODR A;  2L2S A;  4Z2J A;  2XP6 A;  3BXW A;  1HJW A;  3WQW A;  2DSZ A;  1SYT A;  4NNR A;  3IK8 A;  2A3E A;  1L1P A;  1W26 A;  3ALG A;  2LKN A;  3GPK A;  1E6R A;  2PPN A;  2PV2 A;  4Z2L A;  3JYM A;  2PV3 A;  2K8I A;  1FKR A;  1ITX A;  4DZ2 A;  3H9R B;  3CHF A;  3O5E A;  1JNT A;  4LAY A;  1LL7 A;  1JNS A;  4ZPW R;  3G6M A;  1W1Y A;  1HKJ A;  3KAC A;  4AY1 A;  3O5M A;  3ARZ A;  1FFR A;  3B9D A;  2WM0 A;  3TCZ A;  3AS2 A;  4DWS A;  4DIP A;  2F21 A;  2M2A A;  2FKE A;  5D75 A;  4JFK A;  1N1A A;  1EYM A;  4W9P A;  5HUA A;  5HWC A;  4J4N A;  3CZ8 A;  2LGO A;  3ARP A;  2M08 A;  1GOI A;  2MNT A;  1OWQ A;  3CH9 A;  4WIW A;  4DWS B;  3O5F A;  2MLX A;  4ODK A;  1Q1C A;  1FAP A;  3ALF A;  2O9O A;  2YBT A;  1LG2 A;  1M5Y A;  4DWS D;  3CGM A;  4Z2H A;  5HW7 A;  1OGG A;  3ARO A;  3B9A A;  3I6C A;  3UI6 A;  5I98 A;  2LPV A;  2KE0 A;  5DIU A;  1XHG A;  2DSU A;  1HKM A;  1VF8 A;  4TW8 A;  4ODL A;  1WAW A;  4U86 A;  1JVW A;  1KT1 A;  4S3K A;  2ESC A;  3PA7 A;  1D7I A;  1NSG A;  4WKA A;  3ARX A;  3B9E A;  3ARV A;  3WD0 A;  3CHC A;  4JFJ A;  2Q5A A;  4ODO A;  5B8I C;  4QIB A;  1T11 A;  4FN2 A;  1LJY A;  1NWS A;  1P5Q A;  1FKI A;  4HBE A;  4ZPT R;  1HXV A;  1D7J A;  2F4E A;  1A7X A;  1W9P A;  3FY1 A;  2LJ4 A;  3B7X A;  2RQS A;  2ZR5 A;  2IUZ A;  4URI A;  4ODP A;  2MLZ A;  1X6L A;  4JYS A;  3WQV A;  4U85 A;  3WD1 A;  1NWU A;  4DH0 A;  3MDY B;  1W1T A;  1W1P A;  1PBK A;  4MPK A;  4MNK A;  2VCD A;  4WJX A;  5JH8 A;  1CTN A;  4L72 B;  2F2D A;  4DRH A;  2B31 A;  1PIN A;  3ARS A;  3O5G A;  2DSV A;  1LQ0 A;  2UZ5 A;  1J4R A;  4W5U A;  1ZL1 A;  3O5L A;  3WD2 A;  1O6I A;  4BF8 A;  2DG4 A;  3WD4 A;  1UR8 A;  4ODQ A;  3FXY A;  3UI4 A;  3KAI A;  4TW6 A;  1ROT A;  2RUQ A;  4HAR A;  4P8X A;  3WL0 A;  1W9V A;  2WK2 A;  3O5O A;  1TCO C;  2MLY A;  2XP5 A;  4IT6 A;  2XP8 A;  2Y78 A;  3JXV A;  3NI6 A;  1QPF A;  4JFM A;  2A3C A;  2KGJ A;  4XAK A;  1FKF A;  5J6E A;  3PRA A;  1ZU8 A;  1ROU A;  4Z2I A;  3PR9 A;  2XPA A;  2DG3 A;  4Q22 A;  5HBF A;  1XRV A;  1C9H A;  1J6Y A;  1HJX A;  2M1I A;  2XP9 A;  4IQC A;  1D7H A;  1NMV A;  3PRD A;  2KI3 A;  1QZ2 A;  3O5J A;  3RGC A;  3FAP A;  2VN1 A;  3ARY A;  4Q7N A;  3O5Q A;  5DIV A;  3W4R A;  4LAX A;  5HW6 A;  2WLZ A;  1HKK A;  3UQI A;  3OOB A;  4MSP A;  1GPF A;  2G41 A;  2G8Z A;  1FKL A;  4J4O A;  4WKF A;  3O5P A;  4KQZ A;  1YW5 A;  3RM9 A;  1GUV A;  3RM8 A;  1ZCN A;  3ART A;  2ZQT A;  1FKB A;  2XP7 A;  5HTG A;  1IX5 A;  2D9F A;  4DT4 A;  3NRK A;  3AQU A;  2AOS A;  3CHD A;  1W1V A;  4DZ3 A;  1B6C A;  4NSB A;  3IKD A;  3B8S A;  2WLY A;  4MTV A;  1E15 A;  2OLH A;  3WIJ A;  3UI5 A;  2N87 A;  5HWB A;  3UQB A;  4LAW A;  1RD6 A;  1JND A;  1J4H A;  4ITZ A;  3CHE A;  3KAH A;  3ARQ A;  1R9H A;  4WK9 A;  4TNS A;  4KR0 B;  4P8U A;  1FKT A;  3KAF A;  2DT1 A;  5HT1 A;  1OGB A;  1ZBV A;  4ODM A;  4N19 A;  2FDM A;  4MNJ A;  4JFI A;  1NWT A;  1H0I A;  3AS3 A;  1ZBC A;  2DG9 A;  4Z2K A;  1FKG A;  2MPH A;  2AWG A;  2XP4 A;  2DT0 A;  4DRQ A;  3O5I A;  4U84 A;  2ITK A;  3TDB A;  3WD3 A;  3WL1 A;  2QF8 A;  2A3B A;  4Z2G A;  4G50 A;  4ZS6 A;  2A3A A;  1X6N A;  4R5E A;  1FKS A;  1QPL A;  2FAP A;  3ARR A;  4P8V A;  2RUR A;  4LAV A;  4TX0 A;  2YBU A;  4W9Q A;  4DRO A;  1UR9 A;  1LG1 A;  3ODK A;  4HBO A;  1E6N A;  1FJD A;  1D2K A;  5HW8 A;  2PBC A;  3UF8 A;  1HJV A;  2MF9 A;  2OFN A;  4LGX A;  1NH6 A;  4ODN A;  1Y0O A;  1Q6H A;  5DEZ A;  5GPR A;  3WKZ A;  3CGN A;  4IT4 A;  3ARU A;  3G6L A;  2KO7 A;  1ZK6 A;  2RSE A;  3O5K A;  2RUD A;  1FD9 A;  1E6P A;  3O5R A;  1FKD A;  4DRJ A;  4DRN A;  1D6O A;  3KCE A;  1YAT A;  4MNL A;  4GIV A;  1TFV A;  1LL4 A;  2RUC A;  1FKJ A;  1EQ3 A;  3ARW A;  4QT2 A;  3WH0 A;  5DIT A;  4DRM A;  2ZQU A;  3AS0 A;  4MNM A;  1Q6I A;  5BXJ A;  2PV1 A;  1WNO A;  4PTM A;  3OA5 A;  4R0X A;  5DO2 A;  2ZQS A;  3PRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...