1JVWA

Trypanosoma cruzi macrophage infectivity potentiator (tcmip)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
160
structure length
160
Chain Sequence
b'AASHEERMNNYRKRVGRLFMEQKAAQPDAVKLPSGLVFQRIARGSGKRAPAIDDKCEVHYTGRLRDGTVFDSSRERGKPTTFRPNEVIKGWTEALQLMREGDRWRLFIPYDLAYGVTGGGGMIPPYSPLEFDVELISIKDGGKGRTAEEVDEILRKAEED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MACROPHAGE INFECTIVITY POTENTIATOR
publication title Trypanosoma cruzi macrophage infectivity potentiator has a rotamase core and a highly exposed alpha-helix.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Isomerase
total genus 50
structure length 160
sequence length 160
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1jvwA00
4ODMA 3JXVA 1Q6UA 1D7HA 5HW7A 3O5PA 4J4OA 1Q6HA 2F2DA 2UZ5A 3KAFA 3O5MA 4O2TA 2N87A 4TNSA 2K8IA 1TCOC 2IF4A 2XP4A 2XP7A 2F4EA 2PPPA 1Y0OA 4ODQA 4G50A 4R0XA 1PBKA 4QT3A 2KGJA 4FN2A 1FJDA 4TYOA 1FKJA 1ZCNA 2FAPA 2RQSA 2VN1A 1HXVA 2KI3A 3O5KA 4MSPA 2XP3A 3KAHA 2RUDA 2PV1A 5DIVA 3UI6A 5DITA 2M1IA 4C02B 4W9QA 4ODKA 3IKDA 1NMVA 4DZ2A 1FAPA 1JNTA 1FKTA 2KO7A 2ZR5A 3EY6A 5HW6A 2MLYA 4JFKA 1NSGA 2XP8A 2ZQUA 2RSEA 2ITKA 4NNRA 5HW8A 3NRKA 5HWCA 1FKGA 1EQ3A 4DRPA 1FKBA 2PV2A 2XP6A 4DRQA 2M2AA 1NMWA 4JFIA 1D7JA 1QPLA 1J6YA 2LKNA 1PINA 1KT0A 2PPOA 1BKFA 1Q6IA 4G2PA 3PRDA 1C9HA 2PBCA 1FKFA 1FD9A 3NTPA 4ODOA 4DRKA 3KABA 2RURA 2DG4A 3O5RA 4DRMA 5BXJA 3NI6A 1ROUA 3JYMA 2XP9A 4DRIA 4LAWA 1L1PA 4JFLA 5HUAA 4QIBA 3O5DA 2MLXA 2VCDA 3KACA 3KAIA 3UI4A 5J6EA 2FKEA 4DROA 3FAPA 1YATA 2MF9A 5HWBA 4W9OA 3TDBA 1J4RA 2MPHA 1FKKA 2ZQTA 1R9HA 2PPNA 5HT1A 4ODRA 1FKIA 4W9PA 3IKGA 1J4HA 2KE0A 2KFWA 1QPFA 2KR7A 2M08A 2XP5A 4J4NA 4DIPA 3CGMA 4IPXA 4JFJA 3KZ7A 4U86A 1EYMA 1F40A 5HTGA 3UQBA 3MDYB 2OFNA 1YW5A 2Q5AA 4GIVA 4DZ3A 4TX0A 2LJ4A 3O5IA 4TW8A 1D7IA 4DRHA 4JFMA 3RFWA 2ZR4A 4N19A 2L2SA 3O5EA 1B6CA 2AWGA 3IHZA 1FKHA 4ODPA 3O5LA 4DRJA 5B8IC 4TW7A 3O5OA 1FKLA 3O5GA 3O5QA 1U79A 4IQCA 3UI5A 2F21A 3TC5A 4JYSA 3JYJA 1F8AB 4ODLA 4U85A 4DT4A 2RUCA 1QZ2A 2PV3A 4U84A 1N1AA 1T11A 3LUOA 5DIUA 1JVWA 3CGNA 1FKSA 1A7XA 2XPBA 1P5QA 3IK8A 3TCZA 3PA7A 4MGVA 3KAGA 3H9RB 3KCEA 1W26A 3PRBA 2LGOA 4ITZA 3VAWA 1ZK6A 2XPAA 4QT2A 4DH0A 3UQAA 1D6OA 4LAXA 5I98A 3UF8A 1BL4A 4IQ2A 4BF8A 4TW6A 4DRNA 1JNSA 1Q1CA 3I6CA 2LPVA 3B7XA 2Y78A 4GGQA 2RUQA 3O5FA 3ODKA 1J4IA 2D9FA 1ROTA 2ZQSA 2ZQVA 2MNTA 4ODNA 2ZR6A 3RGCA 2DG9A 2DG3A 2MLZA 3KADA 1FKDA 4LAVA 3O5JA 4LAYA 3WH0A 5HKGA 1M5YA 3UQIA 2JZVA 4FAPA 1FKRA 5GPGA 5D75A 3OOBA 1KT1A 3GPKA
chains in the Genus database with same CATH superfamily
3ARZA 4ODMA 3JXVA 1Q6UA 3ALGA 4NZCA 5HW7A 1OGGA 4ZPTR 3ARXA 2N87A 4TNSA 4URIA 2XP4A 2PI6A 2PPPA 4ODQA 4R0XA 2O9OA 1OGBA 3KAHA 1JNEA 2RUDA 5DIVA 2M1IA 1WB0A 3B8SA 4ODKA 3IKDA 2DSZA 5HW6A 3EY6A 4JFKA 1NSGA 4S3JA 4WIWA 3ARPA 2A3CA 2XP6A 1LL6A 3OA5A 1D7JA 2LKNA 1KT0A 1LG1A 1BKFA 1Q6IA 4G2PA 3WL1A 4Q7NA 3KABA 2RURA 2P4VA 1SR0A 1W9UA 1NWTA 5HUAA 3O5DA 3KACA 3KAIA 3B9EA 2FKEA 3FAPA 2MF9A 5HWBA 4W9OA 1WAWA 4WK9A 1FKKA 1VF8A 3RMEA 1R9HA 2PPNA 3IKGA 1FFRA 2XP5A 5HTGA 1JNDA 1YW5A 1ZBWA 4PTMA 3WL0A 4DRHA 4JFMA 3RFWA 4Z2IA 3O5EA 2AWGA 1FKHA 4IQCA 2QF8A 4U85A 3JYJA 1F8AB 4ODLA 1HKKA 4DT4A 2YBTA 2DSUA 3LUOA 3AQUA 3IK8A 4Z2JA 3PA7A 4MGVA 1ZBVA 3H9RB 3KCEA 3PRBA 1W1TA 1ZK6A 3WD4A 3AS0A 1XRVA 4LAXA 5I98A 1ZBCA 4HBEA 1UR8A 1BL4A 1JNSA 3I6CA 3B7XA 2Y78A 2RUQA 1LL4A 1E6PA 2MNTA 1HJWA 2DG9A 2DG3A 3ARTA 4P8UA 3KADA 3ALFA 4LAVA 4LAYA 3WH0A 1IX5A 4FAPA 5GPGA 1ITXA 4DWSD 2B31A 2OLHA 4ML4A 2UZ5A 2F2DA 4L3NA 2G8ZA 3AS2A 2F23A 2G41A 1H0GA 2WLZA 1FJDA 1ZCNA 2FAPA 2RQSA 2VN1A 2XP3A 3AS3A 4C02B 4DZ2A 1NWSA 1E9LA 3WD0A 2MLYA 2DSVA 2ZQUA 4NNRA 5HW8A 3NRKA 1FKGA 4DRPA 2PV2A 3QOKA 1QPLA 5DO2A 1W9PA 4KQZA 1D2KA 1C9HA 2DT1A 3B9AA 4ZPVR 3NTPA 4ODOA 4DRKA 5HBFA 4Z2HA 4JFLA 4IT4A 4QIBA 2MLXA 3UI4A 1H0IA 4DROA 1W1YA 3AS1A 3FXYA 3RM8A 5HT1A 1FKIA 4W9PA 1GPFA 4MNKA 1J4HA 4MPKA 2M08A 1QPFA 4DIPA 1ZU8A 3BMBA 1EYMA 1GOIA 3CZ8A 4MAVA 3MDYB 2OFNA 4LGXA 4GIVA 4TW8A 4DWSA 5DF0A 1HKJA 2ZR4A 4N19A 1X6LA 3O5LA 4DRJA 4ZS6A 4TW7A 3O5OA 3WQWA 4U84A 1N1AA 3CGNA 2XPBA 3VAWA 3UQAA 1HKIA 1E15A 2DSWA 1D6OA 1LL7A 3UF8A 4R5EA 5GPRA 1WNOA 4DWSC 1Q1CA 2ZQSA 2ZQVA 4S3KA 3RGCA 2MLZA 1FKDA 3UQIA 3G6LA 1FFQA 4MSPA 3CH9A 3W4RA 1XHGA 3CHFA 3O5PA 1Q6HA 4O2TA 2K8IA 2XP7A 2F4EA 1Y0OA 1PBKA 1GUVA 4QT3A 2KGJA 4FN2A 1CTNA 4TYOA 1FKJA 3GTYX 1HXVA 3O5KA 2AOSA 1E6RA 2PV1A 3UI6A 3BXWA 1W1PA 4L72B 1JNTA 4MNJA 2KO7A 2ZR5A 2RSEA 1KFWA 1FKBA 4UDMA 4WKFA 3GU0A 1EIBA 2B5UB 3ARYA 2PPOA 4HBOA 2DT2A 4MTVA 3O5RA 4IT6A 4DRMA 3NI6A 4W5UA 1ROUA 3JYMA 2XP9A 1X6NA 2WK2A 3ARUA 4P8VA 3WKZA 1L1PA 4AY1A 3CHCA 2ESCA 1YATA 4P8WA 2DT0A 1HJVA 1OWQA 2KR7A 2KE0A 4WJXA 4IPXA 3KZ7A 4XAKA 1ZB5A 2PN0A 1E6NA 4DZ3A 4TX0A 3PRAA 3O5IA 2IUZA 4DWSB 2A3EA 5BXJA 1B6CA 3IHZA 2F21A 3TC5A 4QZVB 4JYSA 2DT3A 2RUCA 1QZ2A 1FKSA 3TCZA 3CHDA 4NSBA 3EIPA 3ARWA 3KAGA 1W26A 2LGOA 2XPAA 4DH0A 4Z2LA 4KR0B 1RD6A 2A3BA 2WLYA 4BF8A 4Z2GA 3CHEA 4TW6A 1SYTA 1NH6A 3ODKA 4MNMA 2D9FA 1ROTA 4Z2KA 5HKGA 1M5YA 4WKAA 2O92A 5D75A 5DEZA 3OOBA 1KT1A 3ARRA 4WKHA 1D7HA 4J4OA 3KAFA 3O5MA 1HJXA 1TCOC 2IF4A 2YBUA 4Q22A 4G50A 1E6ZA 3WIJA 2KI3A 1NWRA 1HKMA 5DITA 1LG2A 4W9QA 3RM9A 1EHNA 1TFVA 1NMVA 1FAPA 5JH8A 4ZPWR 1FKTA 1LQ0A 3ARSA 2XP8A 3ARQA 2ITKA 5HWCA 1W9VA 1EQ3A 4DRQA 2M2AA 1NMWA 1W1VA 4JFIA 1UR9A 1EDQA 1J6YA 1E44A 1PINA 1LJYA 2ETNA 3PRDA 2PBCA 1FKFA 1FD9A 2DPEA 2A3AA 2DG4A 2EULA 4DRIA 4LAWA 3FY1A 1O6IA 5J6EA 2VCDA 3WD3A 3TDBA 1J4RA 2MPHA 2ZQTA 4P8XA 4ODRA 2KFWA 4J4NA 3CGMA 4JFJA 4U86A 1F40A 3UQBA 5GQBA 2Q5AA 2LJ4A 3PR9A 3WD2A 1D7IA 3G6MA 2L2SA 4ODPA 1GRJA 5B8IC 1FKLA 3O5GA 3O5QA 1U79A 3UI5A 3ARVA 1ZL1A 1ZBKA 2PV3A 5DIUA 1T11A 1JVWA 1A7XA 1P5QA 2FDMA 4ITZA 4QT2A 1NWUA 3AROA 4MNLA 4HARA 4IQ2A 4DRNA 3RM4A 2LPVA 4GGQA 1JCHB 3O5FA 2WM0A 1J4IA 4ODNA 2ZR6A 1K9TA 3WQVA 3WD1A 3O5JA 3B9DA 2JZVA 1FKRA 3GPKA
chains in the Genus database with same CATH topology
3ARZA 4ODMA 3JXVA 1Q6UA 3ALGA 4NZCA 5HW7A 1OGGA 4ZPTR 3ARXA 2N87A 4TNSA 4URIA 2XP4A 2PI6A 2PPPA 4ODQA 4R0XA 2O9OA 1OGBA 3KAHA 1JNEA 2RUDA 5DIVA 2M1IA 1WB0A 3B8SA 4ODKA 3IKDA 2DSZA 5HW6A 3EY6A 4JFKA 1NSGA 4S3JA 4WIWA 3ARPA 2A3CA 2XP6A 1LL6A 3OA5A 1D7JA 2LKNA 1KT0A 1LG1A 1BKFA 1Q6IA 4G2PA 3WL1A 4Q7NA 3KABA 2RURA 1SR0A 1W9UA 1NWTA 5HUAA 3O5DA 3KACA 3KAIA 3B9EA 2FKEA 3FAPA 2MF9A 5HWBA 4W9OA 1WAWA 4WK9A 1FKKA 1VF8A 3RMEA 1R9HA 2PPNA 3IKGA 1FFRA 2XP5A 5HTGA 1JNDA 1YW5A 1ZBWA 4PTMA 3WL0A 4DRHA 4JFMA 3RFWA 4Z2IA 3O5EA 2AWGA 1FKHA 4IQCA 2QF8A 4U85A 3JYJA 1F8AB 4ODLA 1HKKA 4DT4A 2YBTA 2DSUA 3LUOA 3AQUA 3IK8A 4Z2JA 3PA7A 4MGVA 1ZBVA 3H9RB 3KCEA 3PRBA 1W1TA 1ZK6A 3WD4A 3AS0A 1XRVA 4LAXA 5I98A 1ZBCA 4HBEA 1UR8A 1BL4A 1JNSA 3I6CA 3B7XA 2Y78A 2RUQA 1LL4A 1E6PA 2MNTA 1HJWA 2DG9A 2DG3A 3ARTA 4P8UA 3KADA 3ALFA 4LAVA 4LAYA 3WH0A 1IX5A 4FAPA 5GPGA 1ITXA 4DWSD 2B31A 2OLHA 4ML4A 2UZ5A 2F2DA 4L3NA 2G8ZA 3AS2A 2G41A 1H0GA 2WLZA 1FJDA 1ZCNA 2FAPA 2RQSA 2VN1A 2XP3A 3AS3A 4C02B 4DZ2A 1NWSA 1E9LA 3WD0A 2MLYA 2DSVA 2ZQUA 4NNRA 5HW8A 3NRKA 1FKGA 4DRPA 2PV2A 3QOKA 1QPLA 5DO2A 1W9PA 4KQZA 1D2KA 1C9HA 2DT1A 3B9AA 4ZPVR 3NTPA 4ODOA 4DRKA 5HBFA 4Z2HA 4JFLA 4IT4A 4QIBA 2MLXA 3UI4A 1H0IA 4DROA 1W1YA 3AS1A 3FXYA 3RM8A 5HT1A 1FKIA 4W9PA 1GPFA 4MNKA 1J4HA 4MPKA 2M08A 1QPFA 4DIPA 1ZU8A 1EYMA 1GOIA 3CZ8A 4MAVA 3MDYB 2OFNA 4LGXA 4GIVA 4TW8A 4DWSA 5DF0A 1HKJA 2ZR4A 4N19A 1X6LA 3O5LA 4DRJA 4ZS6A 4TW7A 3O5OA 3WQWA 4U84A 1N1AA 3CGNA 2XPBA 3VAWA 3UQAA 1HKIA 1E15A 2DSWA 1D6OA 1LL7A 3UF8A 4R5EA 5GPRA 1WNOA 4DWSC 1Q1CA 2ZQSA 2ZQVA 4S3KA 3RGCA 2MLZA 1FKDA 3UQIA 3G6LA 1FFQA 4MSPA 3CH9A 3W4RA 1XHGA 3CHFA 3O5PA 1Q6HA 4O2TA 2K8IA 2XP7A 2F4EA 1Y0OA 1PBKA 1GUVA 4QT3A 2KGJA 4FN2A 1CTNA 4TYOA 1FKJA 1HXVA 3O5KA 2AOSA 1E6RA 2PV1A 3UI6A 3BXWA 1W1PA 4L72B 1JNTA 4MNJA 2KO7A 2ZR5A 2RSEA 1KFWA 1FKBA 4WKFA 1EIBA 3ARYA 2PPOA 4HBOA 2DT2A 4MTVA 3O5RA 4IT6A 4DRMA 3NI6A 4W5UA 1ROUA 3JYMA 2XP9A 1X6NA 2WK2A 3ARUA 4P8VA 3WKZA 1L1PA 4AY1A 3CHCA 2ESCA 1YATA 4P8WA 2DT0A 1HJVA 1OWQA 2KR7A 2KE0A 4WJXA 4IPXA 3KZ7A 4XAKA 1ZB5A 1E6NA 4DZ3A 4TX0A 3PRAA 3O5IA 2IUZA 4DWSB 2A3EA 5BXJA 1B6CA 3IHZA 2F21A 3TC5A 4QZVB 4JYSA 2DT3A 2RUCA 1QZ2A 1FKSA 3TCZA 3CHDA 4NSBA 3KAGA 3ARWA 1W26A 2LGOA 2XPAA 4DH0A 4Z2LA 4KR0B 1RD6A 2A3BA 2WLYA 4BF8A 4Z2GA 3CHEA 4TW6A 1SYTA 1NH6A 3ODKA 4MNMA 2D9FA 1ROTA 4Z2KA 5HKGA 1M5YA 4WKAA 2O92A 5D75A 5DEZA 3OOBA 1KT1A 3ARRA 4WKHA 1D7HA 4J4OA 3KAFA 3O5MA 1HJXA 1TCOC 2IF4A 2YBUA 4Q22A 4G50A 1E6ZA 3WIJA 2KI3A 1NWRA 1HKMA 5DITA 1LG2A 4W9QA 3RM9A 1EHNA 1TFVA 1NMVA 1FAPA 5JH8A 4ZPWR 1FKTA 1LQ0A 3ARSA 2XP8A 3ARQA 2ITKA 5HWCA 1W9VA 1EQ3A 4DRQA 2M2AA 1NMWA 1W1VA 4JFIA 1UR9A 1EDQA 1J6YA 1PINA 1LJYA 3PRDA 2PBCA 1FKFA 1FD9A 2DPEA 2A3AA 2DG4A 4DRIA 4LAWA 3FY1A 1O6IA 5J6EA 2VCDA 3WD3A 3TDBA 1J4RA 2MPHA 2ZQTA 4P8XA 4ODRA 2KFWA 4J4NA 3CGMA 4JFJA 4U86A 1F40A 3UQBA 5GQBA 2Q5AA 2LJ4A 3PR9A 3WD2A 1D7IA 3G6MA 2L2SA 4ODPA 5B8IC 1FKLA 3O5GA 3O5QA 1U79A 3UI5A 3ARVA 1ZL1A 1ZBKA 2PV3A 5DIUA 1T11A 1JVWA 1A7XA 1P5QA 2FDMA 4ITZA 4QT2A 1NWUA 3AROA 4MNLA 4HARA 4IQ2A 4DRNA 3RM4A 2LPVA 4GGQA 3O5FA 2WM0A 1J4IA 4ODNA 2ZR6A 1K9TA 3WQVA 3WD1A 3O5JA 3B9DA 2JZVA 1FKRA 3GPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ODM A;  3JXV A;  1Q6U A;  1D7H A;  5HW7 A;  3O5P A;  4J4O A;  1Q6H A;  2F2D A;  2UZ5 A;  3KAF A;  3O5M A;  4O2T A;  2N87 A;  4TNS A;  2K8I A;  1TCO C;  2IF4 A;  2XP4 A;  2XP7 A;  2F4E A;  2PPP A;  1Y0O A;  4ODQ A;  4G50 A;  4R0X A;  1PBK A;  4QT3 A;  2KGJ A;  4FN2 A;  1FJD A;  4TYO A;  1FKJ A;  1ZCN A;  2FAP A;  2RQS A;  2VN1 A;  1HXV A;  2KI3 A;  3O5K A;  4MSP A;  2XP3 A;  3KAH A;  2RUD A;  2PV1 A;  5DIV A;  3UI6 A;  5DIT A;  2M1I A;  4C02 B;  4W9Q A;  4ODK A;  3IKD A;  1NMV A;  4DZ2 A;  1FAP A;  1JNT A;  1FKT A;  2KO7 A;  2ZR5 A;  3EY6 A;  5HW6 A;  2MLY A;  4JFK A;  1NSG A;  2XP8 A;  2ZQU A;  2RSE A;  2ITK A;  4NNR A;  5HW8 A;  3NRK A;  5HWC A;  1FKG A;  1EQ3 A;  4DRP A;  1FKB A;  2PV2 A;  2XP6 A;  4DRQ A;  2M2A A;  1NMW A;  4JFI A;  1D7J A;  1QPL A;  1J6Y A;  2LKN A;  1PIN A;  1KT0 A;  2PPO A;  1BKF A;  1Q6I A;  4G2P A;  3PRD A;  1C9H A;  2PBC A;  1FKF A;  1FD9 A;  3NTP A;  4ODO A;  4DRK A;  3KAB A;  2RUR A;  2DG4 A;  3O5R A;  4DRM A;  5BXJ A;  3NI6 A;  1ROU A;  3JYM A;  2XP9 A;  4DRI A;  4LAW A;  1L1P A;  4JFL A;  5HUA A;  4QIB A;  3O5D A;  2MLX A;  2VCD A;  3KAC A;  3KAI A;  3UI4 A;  5J6E A;  2FKE A;  4DRO A;  3FAP A;  1YAT A;  2MF9 A;  5HWB A;  4W9O A;  3TDB A;  1J4R A;  2MPH A;  1FKK A;  2ZQT A;  1R9H A;  2PPN A;  5HT1 A;  4ODR A;  1FKI A;  4W9P A;  3IKG A;  1J4H A;  2KE0 A;  2KFW A;  1QPF A;  2KR7 A;  2M08 A;  2XP5 A;  4J4N A;  4DIP A;  3CGM A;  4IPX A;  4JFJ A;  3KZ7 A;  4U86 A;  1EYM A;  1F40 A;  5HTG A;  3UQB A;  3MDY B;  2OFN A;  1YW5 A;  2Q5A A;  4GIV A;  4DZ3 A;  4TX0 A;  2LJ4 A;  3O5I A;  4TW8 A;  1D7I A;  4DRH A;  4JFM A;  3RFW A;  2ZR4 A;  4N19 A;  2L2S A;  3O5E A;  1B6C A;  2AWG A;  3IHZ A;  1FKH A;  4ODP A;  3O5L A;  4DRJ A;  5B8I C;  4TW7 A;  3O5O A;  1FKL A;  3O5G A;  3O5Q A;  1U79 A;  4IQC A;  3UI5 A;  2F21 A;  3TC5 A;  4JYS A;  3JYJ A;  1F8A B;  4ODL A;  4U85 A;  4DT4 A;  2RUC A;  1QZ2 A;  2PV3 A;  4U84 A;  1N1A A;  1T11 A;  3LUO A;  5DIU A;  1JVW A;  3CGN A;  1FKS A;  1A7X A;  2XPB A;  1P5Q A;  3IK8 A;  3TCZ A;  3PA7 A;  4MGV A;  3KAG A;  3H9R B;  3KCE A;  1W26 A;  3PRB A;  2LGO A;  4ITZ A;  3VAW A;  1ZK6 A;  2XPA A;  4QT2 A;  4DH0 A;  3UQA A;  1D6O A;  4LAX A;  5I98 A;  3UF8 A;  1BL4 A;  4IQ2 A;  4BF8 A;  4TW6 A;  4DRN A;  1JNS A;  1Q1C A;  3I6C A;  2LPV A;  3B7X A;  2Y78 A;  4GGQ A;  2RUQ A;  3O5F A;  3ODK A;  1J4I A;  2D9F A;  1ROT A;  2ZQS A;  2ZQV A;  2MNT A;  4ODN A;  2ZR6 A;  3RGC A;  2DG9 A;  2DG3 A;  2MLZ A;  3KAD A;  1FKD A;  4LAV A;  3O5J A;  4LAY A;  3WH0 A;  5HKG A;  1M5Y A;  3UQI A;  2JZV A;  4FAP A;  1FKR A;  5GPG A;  5D75 A;  3OOB A;  1KT1 A;  3GPK A; 
#chains in the Genus database with same CATH topology
 3ARZ A;  4ODM A;  3JXV A;  1Q6U A;  3ALG A;  4NZC A;  5HW7 A;  1OGG A;  4ZPT R;  3ARX A;  2N87 A;  4TNS A;  4URI A;  2XP4 A;  2PI6 A;  2PPP A;  4ODQ A;  4R0X A;  2O9O A;  1OGB A;  3KAH A;  1JNE A;  2RUD A;  5DIV A;  2M1I A;  1WB0 A;  3B8S A;  4ODK A;  3IKD A;  2DSZ A;  5HW6 A;  3EY6 A;  4JFK A;  1NSG A;  4S3J A;  4WIW A;  3ARP A;  2A3C A;  2XP6 A;  1LL6 A;  3OA5 A;  1D7J A;  2LKN A;  1KT0 A;  1LG1 A;  1BKF A;  1Q6I A;  4G2P A;  3WL1 A;  4Q7N A;  3KAB A;  2RUR A;  2P4V A;  1SR0 A;  1W9U A;  1NWT A;  5HUA A;  3O5D A;  3KAC A;  3KAI A;  3B9E A;  2FKE A;  3FAP A;  2MF9 A;  5HWB A;  4W9O A;  1WAW A;  4WK9 A;  1FKK A;  1VF8 A;  3RME A;  1R9H A;  2PPN A;  3IKG A;  1FFR A;  2XP5 A;  5HTG A;  1JND A;  1YW5 A;  1ZBW A;  4PTM A;  3WL0 A;  4DRH A;  4JFM A;  3RFW A;  4Z2I A;  3O5E A;  2AWG A;  1FKH A;  4IQC A;  2QF8 A;  4U85 A;  3JYJ A;  1F8A B;  4ODL A;  1HKK A;  4DT4 A;  2YBT A;  2DSU A;  3LUO A;  3AQU A;  3IK8 A;  4Z2J A;  3PA7 A;  4MGV A;  1ZBV A;  3H9R B;  3KCE A;  3PRB A;  1W1T A;  1ZK6 A;  3WD4 A;  3AS0 A;  1XRV A;  4LAX A;  5I98 A;  1ZBC A;  4HBE A;  1UR8 A;  1BL4 A;  1JNS A;  3I6C A;  3B7X A;  2Y78 A;  2RUQ A;  1LL4 A;  1E6P A;  2MNT A;  1HJW A;  2DG9 A;  2DG3 A;  3ART A;  4P8U A;  3KAD A;  3ALF A;  4LAV A;  4LAY A;  3WH0 A;  1IX5 A;  4FAP A;  5GPG A;  1ITX A;  4DWS D;  2B31 A;  2OLH A;  4ML4 A;  2UZ5 A;  2F2D A;  4L3N A;  2G8Z A;  3AS2 A;  2F23 A;  2G41 A;  1H0G A;  2WLZ A;  1FJD A;  1ZCN A;  2FAP A;  2RQS A;  2VN1 A;  2XP3 A;  3AS3 A;  4C02 B;  4DZ2 A;  1NWS A;  1E9L A;  3WD0 A;  2MLY A;  2DSV A;  2ZQU A;  4NNR A;  5HW8 A;  3NRK A;  1FKG A;  4DRP A;  2PV2 A;  3QOK A;  1QPL A;  5DO2 A;  1W9P A;  4KQZ A;  1D2K A;  1C9H A;  2DT1 A;  3B9A A;  4ZPV R;  3NTP A;  4ODO A;  4DRK A;  5HBF A;  4Z2H A;  4JFL A;  4IT4 A;  4QIB A;  2MLX A;  3UI4 A;  1H0I A;  4DRO A;  1W1Y A;  3AS1 A;  3FXY A;  3RM8 A;  5HT1 A;  1FKI A;  4W9P A;  1GPF A;  4MNK A;  1J4H A;  4MPK A;  2M08 A;  1QPF A;  4DIP A;  1ZU8 A;  3BMB A;  1EYM A;  1GOI A;  3CZ8 A;  4MAV A;  3MDY B;  2OFN A;  4LGX A;  4GIV A;  4TW8 A;  4DWS A;  5DF0 A;  1HKJ A;  2ZR4 A;  4N19 A;  1X6L A;  3O5L A;  4DRJ A;  4ZS6 A;  4TW7 A;  3O5O A;  3WQW A;  4U84 A;  1N1A A;  3CGN A;  2XPB A;  3VAW A;  3UQA A;  1HKI A;  1E15 A;  2DSW A;  1D6O A;  1LL7 A;  3UF8 A;  4R5E A;  5GPR A;  1WNO A;  4DWS C;  1Q1C A;  2ZQS A;  2ZQV A;  4S3K A;  3RGC A;  2MLZ A;  1FKD A;  3UQI A;  3G6L A;  1FFQ A;  4MSP A;  3CH9 A;  3W4R A;  1XHG A;  3CHF A;  3O5P A;  1Q6H A;  4O2T A;  2K8I A;  2XP7 A;  2F4E A;  1Y0O A;  1PBK A;  1GUV A;  4QT3 A;  2KGJ A;  4FN2 A;  1CTN A;  4TYO A;  1FKJ A;  3GTY X;  1HXV A;  3O5K A;  2AOS A;  1E6R A;  2PV1 A;  3UI6 A;  3BXW A;  1W1P A;  4L72 B;  1JNT A;  4MNJ A;  2KO7 A;  2ZR5 A;  2RSE A;  1KFW A;  1FKB A;  4UDM A;  4WKF A;  3GU0 A;  1EIB A;  2B5U B;  3ARY A;  2PPO A;  4HBO A;  2DT2 A;  4MTV A;  3O5R A;  4IT6 A;  4DRM A;  3NI6 A;  4W5U A;  1ROU A;  3JYM A;  2XP9 A;  1X6N A;  2WK2 A;  3ARU A;  4P8V A;  3WKZ A;  1L1P A;  4AY1 A;  3CHC A;  2ESC A;  1YAT A;  4P8W A;  2DT0 A;  1HJV A;  1OWQ A;  2KR7 A;  2KE0 A;  4WJX A;  4IPX A;  3KZ7 A;  4XAK A;  1ZB5 A;  2PN0 A;  1E6N A;  4DZ3 A;  4TX0 A;  3PRA A;  3O5I A;  2IUZ A;  4DWS B;  2A3E A;  5BXJ A;  1B6C A;  3IHZ A;  2F21 A;  3TC5 A;  4QZV B;  4JYS A;  2DT3 A;  2RUC A;  1QZ2 A;  1FKS A;  3TCZ A;  3CHD A;  4NSB A;  3EIP A;  3ARW A;  3KAG A;  1W26 A;  2LGO A;  2XPA A;  4DH0 A;  4Z2L A;  4KR0 B;  1RD6 A;  2A3B A;  2WLY A;  4BF8 A;  4Z2G A;  3CHE A;  4TW6 A;  1SYT A;  1NH6 A;  3ODK A;  4MNM A;  2D9F A;  1ROT A;  4Z2K A;  5HKG A;  1M5Y A;  4WKA A;  2O92 A;  5D75 A;  5DEZ A;  3OOB A;  1KT1 A;  3ARR A;  4WKH A;  1D7H A;  4J4O A;  3KAF A;  3O5M A;  1HJX A;  1TCO C;  2IF4 A;  2YBU A;  4Q22 A;  4G50 A;  1E6Z A;  3WIJ A;  2KI3 A;  1NWR A;  1HKM A;  5DIT A;  1LG2 A;  4W9Q A;  3RM9 A;  1EHN A;  1TFV A;  1NMV A;  1FAP A;  5JH8 A;  4ZPW R;  1FKT A;  1LQ0 A;  3ARS A;  2XP8 A;  3ARQ A;  2ITK A;  5HWC A;  1W9V A;  1EQ3 A;  4DRQ A;  2M2A A;  1NMW A;  1W1V A;  4JFI A;  1UR9 A;  1EDQ A;  1J6Y A;  1E44 A;  1PIN A;  1LJY A;  2ETN A;  3PRD A;  2PBC A;  1FKF A;  1FD9 A;  2DPE A;  2A3A A;  2DG4 A;  2EUL A;  4DRI A;  4LAW A;  3FY1 A;  1O6I A;  5J6E A;  2VCD A;  3WD3 A;  3TDB A;  1J4R A;  2MPH A;  2ZQT A;  4P8X A;  4ODR A;  2KFW A;  4J4N A;  3CGM A;  4JFJ A;  4U86 A;  1F40 A;  3UQB A;  5GQB A;  2Q5A A;  2LJ4 A;  3PR9 A;  3WD2 A;  1D7I A;  3G6M A;  2L2S A;  4ODP A;  1GRJ A;  5B8I C;  1FKL A;  3O5G A;  3O5Q A;  1U79 A;  3UI5 A;  3ARV A;  1ZL1 A;  1ZBK A;  2PV3 A;  5DIU A;  1T11 A;  1JVW A;  1A7X A;  1P5Q A;  2FDM A;  4ITZ A;  4QT2 A;  1NWU A;  3ARO A;  4MNL A;  4HAR A;  4IQ2 A;  4DRN A;  3RM4 A;  2LPV A;  4GGQ A;  1JCH B;  3O5F A;  2WM0 A;  1J4I A;  4ODN A;  2ZR6 A;  1K9T A;  3WQV A;  3WD1 A;  3O5J A;  3B9D A;  2JZV A;  1FKR A;  3GPK A; 
#chains in the Genus database with same CATH homology
 3ARZ A;  4ODM A;  3JXV A;  1Q6U A;  3ALG A;  4NZC A;  5HW7 A;  1OGG A;  4ZPT R;  3ARX A;  2N87 A;  4TNS A;  4URI A;  2XP4 A;  2PI6 A;  2PPP A;  4ODQ A;  4R0X A;  2O9O A;  1OGB A;  3KAH A;  1JNE A;  2RUD A;  5DIV A;  2M1I A;  1WB0 A;  3B8S A;  4ODK A;  3IKD A;  2DSZ A;  5HW6 A;  3EY6 A;  4JFK A;  1NSG A;  4S3J A;  4WIW A;  3ARP A;  2A3C A;  2XP6 A;  1LL6 A;  3OA5 A;  1D7J A;  2LKN A;  1KT0 A;  1LG1 A;  1BKF A;  1Q6I A;  4G2P A;  3WL1 A;  4Q7N A;  3KAB A;  2RUR A;  1SR0 A;  1W9U A;  1NWT A;  5HUA A;  3O5D A;  3KAC A;  3KAI A;  3B9E A;  2FKE A;  3FAP A;  2MF9 A;  5HWB A;  4W9O A;  1WAW A;  4WK9 A;  1FKK A;  1VF8 A;  3RME A;  1R9H A;  2PPN A;  3IKG A;  1FFR A;  2XP5 A;  5HTG A;  1JND A;  1YW5 A;  1ZBW A;  4PTM A;  3WL0 A;  4DRH A;  4JFM A;  3RFW A;  4Z2I A;  3O5E A;  2AWG A;  1FKH A;  4IQC A;  2QF8 A;  4U85 A;  3JYJ A;  1F8A B;  4ODL A;  1HKK A;  4DT4 A;  2YBT A;  2DSU A;  3LUO A;  3AQU A;  3IK8 A;  4Z2J A;  3PA7 A;  4MGV A;  1ZBV A;  3H9R B;  3KCE A;  3PRB A;  1W1T A;  1ZK6 A;  3WD4 A;  3AS0 A;  1XRV A;  4LAX A;  5I98 A;  1ZBC A;  4HBE A;  1UR8 A;  1BL4 A;  1JNS A;  3I6C A;  3B7X A;  2Y78 A;  2RUQ A;  1LL4 A;  1E6P A;  2MNT A;  1HJW A;  2DG9 A;  2DG3 A;  3ART A;  4P8U A;  3KAD A;  3ALF A;  4LAV A;  4LAY A;  3WH0 A;  1IX5 A;  4FAP A;  5GPG A;  1ITX A;  4DWS D;  2B31 A;  2OLH A;  4ML4 A;  2UZ5 A;  2F2D A;  4L3N A;  2G8Z A;  3AS2 A;  2G41 A;  1H0G A;  2WLZ A;  1FJD A;  1ZCN A;  2FAP A;  2RQS A;  2VN1 A;  2XP3 A;  3AS3 A;  4C02 B;  4DZ2 A;  1NWS A;  1E9L A;  3WD0 A;  2MLY A;  2DSV A;  2ZQU A;  4NNR A;  5HW8 A;  3NRK A;  1FKG A;  4DRP A;  2PV2 A;  3QOK A;  1QPL A;  5DO2 A;  1W9P A;  4KQZ A;  1D2K A;  1C9H A;  2DT1 A;  3B9A A;  4ZPV R;  3NTP A;  4ODO A;  4DRK A;  5HBF A;  4Z2H A;  4JFL A;  4IT4 A;  4QIB A;  2MLX A;  3UI4 A;  1H0I A;  4DRO A;  1W1Y A;  3AS1 A;  3FXY A;  3RM8 A;  5HT1 A;  1FKI A;  4W9P A;  1GPF A;  4MNK A;  1J4H A;  4MPK A;  2M08 A;  1QPF A;  4DIP A;  1ZU8 A;  1EYM A;  1GOI A;  3CZ8 A;  4MAV A;  3MDY B;  2OFN A;  4LGX A;  4GIV A;  4TW8 A;  4DWS A;  5DF0 A;  1HKJ A;  2ZR4 A;  4N19 A;  1X6L A;  3O5L A;  4DRJ A;  4ZS6 A;  4TW7 A;  3O5O A;  3WQW A;  4U84 A;  1N1A A;  3CGN A;  2XPB A;  3VAW A;  3UQA A;  1HKI A;  1E15 A;  2DSW A;  1D6O A;  1LL7 A;  3UF8 A;  4R5E A;  5GPR A;  1WNO A;  4DWS C;  1Q1C A;  2ZQS A;  2ZQV A;  4S3K A;  3RGC A;  2MLZ A;  1FKD A;  3UQI A;  3G6L A;  1FFQ A;  4MSP A;  3CH9 A;  3W4R A;  1XHG A;  3CHF A;  3O5P A;  1Q6H A;  4O2T A;  2K8I A;  2XP7 A;  2F4E A;  1Y0O A;  1PBK A;  1GUV A;  4QT3 A;  2KGJ A;  4FN2 A;  1CTN A;  4TYO A;  1FKJ A;  1HXV A;  3O5K A;  2AOS A;  1E6R A;  2PV1 A;  3UI6 A;  3BXW A;  1W1P A;  4L72 B;  1JNT A;  4MNJ A;  2KO7 A;  2ZR5 A;  2RSE A;  1KFW A;  1FKB A;  4WKF A;  1EIB A;  3ARY A;  2PPO A;  4HBO A;  2DT2 A;  4MTV A;  3O5R A;  4IT6 A;  4DRM A;  3NI6 A;  4W5U A;  1ROU A;  3JYM A;  2XP9 A;  1X6N A;  2WK2 A;  3ARU A;  4P8V A;  3WKZ A;  1L1P A;  4AY1 A;  3CHC A;  2ESC A;  1YAT A;  4P8W A;  2DT0 A;  1HJV A;  1OWQ A;  2KR7 A;  2KE0 A;  4WJX A;  4IPX A;  3KZ7 A;  4XAK A;  1ZB5 A;  1E6N A;  4DZ3 A;  4TX0 A;  3PRA A;  3O5I A;  2IUZ A;  4DWS B;  2A3E A;  5BXJ A;  1B6C A;  3IHZ A;  2F21 A;  3TC5 A;  4QZV B;  4JYS A;  2DT3 A;  2RUC A;  1QZ2 A;  1FKS A;  3TCZ A;  3CHD A;  4NSB A;  3KAG A;  3ARW A;  1W26 A;  2LGO A;  2XPA A;  4DH0 A;  4Z2L A;  4KR0 B;  1RD6 A;  2A3B A;  2WLY A;  4BF8 A;  4Z2G A;  3CHE A;  4TW6 A;  1SYT A;  1NH6 A;  3ODK A;  4MNM A;  2D9F A;  1ROT A;  4Z2K A;  5HKG A;  1M5Y A;  4WKA A;  2O92 A;  5D75 A;  5DEZ A;  3OOB A;  1KT1 A;  3ARR A;  4WKH A;  1D7H A;  4J4O A;  3KAF A;  3O5M A;  1HJX A;  1TCO C;  2IF4 A;  2YBU A;  4Q22 A;  4G50 A;  1E6Z A;  3WIJ A;  2KI3 A;  1NWR A;  1HKM A;  5DIT A;  1LG2 A;  4W9Q A;  3RM9 A;  1EHN A;  1TFV A;  1NMV A;  1FAP A;  5JH8 A;  4ZPW R;  1FKT A;  1LQ0 A;  3ARS A;  2XP8 A;  3ARQ A;  2ITK A;  5HWC A;  1W9V A;  1EQ3 A;  4DRQ A;  2M2A A;  1NMW A;  1W1V A;  4JFI A;  1UR9 A;  1EDQ A;  1J6Y A;  1PIN A;  1LJY A;  3PRD A;  2PBC A;  1FKF A;  1FD9 A;  2DPE A;  2A3A A;  2DG4 A;  4DRI A;  4LAW A;  3FY1 A;  1O6I A;  5J6E A;  2VCD A;  3WD3 A;  3TDB A;  1J4R A;  2MPH A;  2ZQT A;  4P8X A;  4ODR A;  2KFW A;  4J4N A;  3CGM A;  4JFJ A;  4U86 A;  1F40 A;  3UQB A;  5GQB A;  2Q5A A;  2LJ4 A;  3PR9 A;  3WD2 A;  1D7I A;  3G6M A;  2L2S A;  4ODP A;  5B8I C;  1FKL A;  3O5G A;  3O5Q A;  1U79 A;  3UI5 A;  3ARV A;  1ZL1 A;  1ZBK A;  2PV3 A;  5DIU A;  1T11 A;  1JVW A;  1A7X A;  1P5Q A;  2FDM A;  4ITZ A;  4QT2 A;  1NWU A;  3ARO A;  4MNL A;  4HAR A;  4IQ2 A;  4DRN A;  3RM4 A;  2LPV A;  4GGQ A;  3O5F A;  2WM0 A;  1J4I A;  4ODN A;  2ZR6 A;  1K9T A;  3WQV A;  3WD1 A;  3O5J A;  3B9D A;  2JZV A;  1FKR A;  3GPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...