3UQIA

Crystallographic structure of fkbp12 from aedes aegypti
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
108
structure length
108
Chain Sequence
MGVQVVTLAAGDEATYPKAGQVAVVHYTGTLADGKVFDSSRTRGKPFRFTVGRGEVIRGWDEGVAQMSVGQRAKLVCSPDYAYGSRGHPGVIPPNATLTFDVELLRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution crystal structure of FKBP12 from Aedes aegypti.
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Isomerase
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase
total genus 26
structure length 108
sequence length 108
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2011-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3uqiA00
4N19A 2Q5AA 2Y78A 3O5KA 1Q1CA 2XPBA 1ZK6A 3JYJA 1YATA 3IKGA 4DRKA 3O5EA 3CGNA 4DH0A 3UQIA 3UI5A 1ZCNA 3UQBA 1FAPA 2XP6A 3TC5A 3KAFA 2ZR6A 3UI6A 2D9FA 2PV2A 3KCEA 4G50A 3O5RA 4TW6A 5HKGA 2N87A 3O5IA 3ODKA 4G2PA 2PV1A 1JNSA 2AWGA 1D7IA 2PBCA 1P5QA 2F2DA 4TW7A 3RGCA 1C9HA 3VAWA 2XP5A 3O5QA 2RQSA 4DZ3A 3WH0A 3LUOA 5I98A 1Q6HA 4IQ2A 4JYSA 4DT4A 1F8AB 4U84A 3KADA 1FKRA 4JFMA 2K8IA 3TDBA 3RFWA 1EQ3A 4DRHA 4JFKA 3O5JA 4QIBA 1D7JA 1FKHA 3KAGA 1FKSA 1J4IA 1NMVA 5J6EA 2M2AA 3EY6A 3MDYB 4FAPA 4DRNA 4DRIA 1JVWA 5HTGA 3KZ7A 1YW5A 1FKBA 2JZVA 3O5GA 3NI6A 3GPKA 2LGOA 4ODOA 2RURA 3FAPA 2MLXA 4LAYA 5HWBA 2PPNA 4IQCA 4J4OA 4TW8A 1TCOC 2XP4A 1KT0A 2M08A 2KO7A 1D6OA 3IKDA 3O5PA 4ODQA 2KGJA 2UZ5A 3NRKA 5DIVA 4C02B 3UQAA 3IK8A 3O5MA 2PV3A 4DRMA 1F40A 2DG4A 2ZQSA 4DRJA 4ODMA 4ODLA 1W26A 1FKJA 2KE0A 1NSGA 4JFJA 2F21A 4O2TA 5GPGA 1J4HA 1QPFA 1M5YA 4LAXA 2F4EA 2XP8A 3KABA 3KACA 1Q6IA 4JFIA 2ZQUA 4W9PA 5HW6A 1T11A 4QT2A 4JFLA 2KR7A 1U79A 4U86A 2XP3A 3UF8A 2RUDA 2MF9A 3UI4A 2KI3A 1QZ2A 4U85A 2VN1A 2ZQVA 2PPPA 4ITZA 2VCDA 4DZ2A 1HXVA 4GGQA 3O5DA 5DIUA 4DROA 2DG9A 4DIPA 4FN2A 2ZQTA 1EYMA 2RSEA 3JXVA 4LAWA 5HT1A 5HW8A 1FKKA 3PRBA 2LPVA 3I6CA 1D7HA 3KAHA 1FKFA 2MPHA 3TCZA 4DRPA 4DRQA 1Q6UA 1J6YA 3KAIA 1QPLA 1FKLA 2RUQA 4MGVA 3CGMA 4MSPA 2M1IA 1J4RA 2KFWA 4NNRA 4TX0A 2ITKA 1L1PA 4ODPA 1FD9A 2OFNA 3O5LA 4W9QA 2XP7A 4BF8A 2IF4A 2XPAA 4GIVA 4QT3A 2ZR5A 1Y0OA 1BL4A 4J4NA 3IHZA 1FJDA 2RUCA 3B7XA 5BXJA 1KT1A 1NMWA 5B8IC 2PPOA 3O5FA 1FKDA 1ROTA 2DG3A 2LKNA 3PRDA 4ODNA 5D75A 2FKEA 3H9RB 2FAPA 4R0XA 3OOBA 4W9OA 5HWCA 1JNTA 1FKIA 2MLZA 4IPXA 3PA7A 4ODKA 5HW7A 1ROUA 2MLYA 4LAVA 1A7XA 2MNTA 1R9HA 4ODRA 2L2SA 1FKTA 5HUAA 3O5OA 1PBKA 1FKGA 1BKFA 2XP9A 2ZR4A 1B6CA 4TYOA 4TNSA 2LJ4A 1N1AA 5DITA 1PINA 3NTPA 3JYMA
chains in the Genus database with same CATH superfamily
2Y78A 1EDQA 3JYJA 1YATA 3IKGA 3CGNA 4WJXA 4DH0A 4WKHA 4MPKA 3G6LA 1KFWA 1HKMA 4ML4A 3TC5A 3KAFA 2ZR6A 3UI6A 2WM0A 3B9DA 3FXYA 2PV2A 4TW6A 5HKGA 4G2PA 1JNSA 3OA5A 1P5QA 1WNOA 1LG2A 2FDMA 4LGXA 4P8UA 1GRJA 3O5QA 1HKKA 3LUOA 3RM8A 3CHEA 4MAVA 4DT4A 1XHGA 4U84A 3KADA 2K8IA 3RFWA 1EQ3A 3CHCA 1TFVA 1D7JA 1NMVA 3MDYB 1EIBA 1JVWA 5HTGA 1FKBA 2JZVA 3ARWA 1X6NA 1H0GA 4J4OA 1KT0A 2M08A 3IKDA 4MNLA 5DIVA 3NRKA 3QOKA 4C02B 3O5MA 3ARTA 4DRMA 1W26A 1FKJA 4O2TA 3CHDA 5JH8A 2F21A 1HKJA 4LAXA 1HJVA 2B31A 2XP8A 5HW6A 4JFIA 2ZQUA 4ZS6A 4JFLA 3AROA 2RUDA 2ETNA 1SR0A 2MF9A 4L3NA 2PPPA 4HBEA 2ZQTA 4LAWA 4S3JA 2DT2A 4MSPA 3ARRA 4ZPWR 4ODPA 1L1PA 1FD9A 2XP7A 2XPAA 2DT1A 4J4NA 1NWSA 3PRDA 1W1TA 2DT3A 2LKNA 4DWSC 2A3AA 1K9TA 4ODKA 2QF8A 3ARPA 1R9HA 3PR9A 4DWSD 3O5OA 2ZR4A 4TNSA 5DITA 1PINA 3NTPA 3JYMA 4N19A 1H0IA 4L72B 2B5UB 1NWUA 3O5EA 2F23A 2DSWA 3PRAA 1WAWA 2WLYA 4ZPTR 3UI5A 3UQBA 1FAPA 3ALFA 2XP6A 1OGGA 4IT6A 2D9FA 3O5RA 3ODKA 2PV1A 2F2DA 1C9HA 3VAWA 4Z2KA 1GUVA 4IT4A 3WH0A 1NH6A 4KR0B 2PI6A 4DRHA 4JFKA 4QIBA 1HKIA 2M2AA 3CZ8A 1EHNA 3WD1A 1YW5A 3NI6A 4ODOA 3ARVA 2RURA 3GU0A 4LAYA 4IQCA 1IX5A 1E6PA 2KO7A 1D6OA 4HARA 1JCHB 4ODQA 2KGJA 3UQAA 3IK8A 1F40A 3RM9A 4NSBA 4ODMA 2A3CA 1NSGA 4MNMA 1M5YA 5HBFA 4W9PA 3KACA 3BXWA 2VN1A 4ITZA 2VCDA 1JNDA 3ARQA 4DZ2A 1HJXA 3O5DA 2DG9A 4DIPA 4FN2A 1EYMA 3JXVA 1ZB5A 3G6MA 3ARSA 4HBOA 3WD2A 1D7HA 3KAHA 4P8VA 3TCZA 4DRPA 1J6YA 4TX0A 1J4RA 4BF8A 2IF4A 4GIVA 4QT3A 4XAKA 1Y0OA 1HJWA 3GTYX 3IHZA 2RUCA 3B7XA 5B8IC 2PPOA 1FKDA 1ROTA 2YBUA 2FKEA 4R0XA 3OOBA 4IPXA 1FKIA 2A3BA 2MLZA 4WIWA 4MTVA 1D2KA 1ROUA 1W9PA 1A7XA 4MNKA 1FKTA 3RM4A 5HUAA 3WIJA 1PBKA 1FKGA 1BKFA 1ZBCA 1N1AA 3B8SA 1W1PA 2XPBA 3WL0A 1ZK6A 2DT0A 1W9VA 4P8WA 2O92A 3UQIA 1LG1A 1ZCNA 1E6NA 3WQVA 4WKFA 2DSZA 3AS0A 3KCEA 4G50A 5DEZA 1GOIA 2N87A 3O5IA 1D7IA 1CTNA 2PBCA 3RGCA 3WD0A 4S3KA 2XP5A 1X6LA 1Q6HA 4IQ2A 4JYSA 4JFMA 3TDBA 4P8XA 2ESCA 2YBTA 1FKHA 1FKSA 1E9LA 4FAPA 1O6IA 4DRNA 3GPKA 3FAPA 5HWBA 4TW8A 3O5PA 3ARXA 2UZ5A 5DO2A 4Q7NA 2PV3A 3WD3A 1UR9A 2DG4A 2DSUA 2OLHA 3B9AA 2G8ZA 4JFJA 5GPGA 4AY1A 4Z2IA 4W5UA 1J4HA 3ARYA 1ZBWA 1Q6IA 1T11A 2KR7A 1OGBA 2EULA 2KI3A 1QZ2A 4U85A 3W4RA 2ZQVA 4PTMA 1HXVA 3EIPA 1ZBKA 5DIUA 4Z2JA 2RSEA 4URIA 2LPVA 1ZBVA 3WL1A 4ZPVR 3RMEA 1FKFA 4R5EA 4DRQA 1Q6UA 1FFRA 2DPEA 3KAIA 1FKLA 2RUQA 4MGVA 3CGMA 4DWSA 4NNRA 2KFWA 3O5LA 4W9QA 4WKAA 2ZR5A 4KQZA 1NMWA 1XRVA 3O5FA 2DG3A 4ODNA 4DROA 3H9RB 2FAPA 5HWCA 1JNTA 1E6RA 4QZVB 5HW7A 2MLYA 2WK2A 2L2SA 4Z2GA 1B6CA 4TYOA 2LJ4A 2AOSA 1UR8A 4MNJA 4Q22A 4UDMA 2Q5AA 3O5KA 1Q1CA 1NWTA 1E15A 4DRKA 4WK9A 1VF8A 2DSVA 2PN0A 1E44A 3AS2A 1JNEA 1ZL1A 1LL6A 2AWGA 3CH9A 4TW7A 3WKZA 4DZ3A 2RQSA 3AS1A 5I98A 4Z2LA 1F8AB 4DWSB 1FKRA 3AQUA 1WB0A 2G41A 3O5JA 3KAGA 1J4IA 3BMBA 5J6EA 3EY6A 1GPFA 4DRIA 3KZ7A 3O5GA 2LGOA 2MLXA 2PPNA 1TCOC 2XP4A 3WQWA 2ZQSA 4DRJA 4ODLA 3ARUA 2KE0A 1NWRA 1RD6A 1QPFA 1FFQA 2P4VA 1OWQA 2F4EA 1LJYA 3KABA 4QT2A 1U79A 4U86A 2XP3A 3UF8A 3FY1A 3UI4A 1W1VA 1ZU8A 2IUZA 2WLZA 1LQ0A 4GGQA 5HW8A 1FJDA 1LL7A 5HT1A 1FKKA 3PRBA 3CHFA 3I6CA 2MPHA 1ITXA 3B9EA 1LL4A 1QPLA 4NZCA 2O9OA 2M1IA 2A3EA 2ITKA 2OFNA 3WD4A 1W9UA 1W1YA 1BL4A 5BXJA 1KT1A 5D75A 3ALGA 4W9OA 5GQBA 3ARZA 3PA7A 5GPRA 4LAVA 2MNTA 4ODRA 5DF0A 1SYTA 4Z2HA 2XP9A 1E6ZA 3AS3A
chains in the Genus database with same CATH topology
2Y78A 1EDQA 3JYJA 1YATA 3IKGA 3CGNA 4WJXA 4DH0A 4WKHA 4MPKA 3G6LA 1KFWA 1HKMA 4ML4A 3TC5A 3KAFA 2ZR6A 3UI6A 2WM0A 3B9DA 3FXYA 2PV2A 4TW6A 5HKGA 4G2PA 1JNSA 3OA5A 1P5QA 1WNOA 1LG2A 2FDMA 4LGXA 4P8UA 3O5QA 1HKKA 3LUOA 3RM8A 3CHEA 4MAVA 4DT4A 1XHGA 4U84A 3KADA 2K8IA 3RFWA 1EQ3A 3CHCA 1TFVA 1D7JA 1NMVA 3MDYB 1EIBA 1JVWA 5HTGA 1FKBA 2JZVA 3ARWA 1X6NA 1H0GA 4J4OA 1KT0A 2M08A 3IKDA 4MNLA 5DIVA 3NRKA 3QOKA 4C02B 3O5MA 3ARTA 4DRMA 1W26A 1FKJA 4O2TA 3CHDA 5JH8A 2F21A 1HKJA 4LAXA 1HJVA 2B31A 2XP8A 5HW6A 4JFIA 2ZQUA 4ZS6A 4JFLA 3AROA 2RUDA 2MF9A 1SR0A 4L3NA 2PPPA 4HBEA 2ZQTA 4LAWA 4S3JA 2DT2A 4MSPA 3ARRA 4ZPWR 4ODPA 1L1PA 1FD9A 2XP7A 2XPAA 2DT1A 4J4NA 1NWSA 3PRDA 1W1TA 2DT3A 2LKNA 4DWSC 2A3AA 1K9TA 4ODKA 2QF8A 3ARPA 1R9HA 3PR9A 4DWSD 3O5OA 2ZR4A 4TNSA 5DITA 1PINA 3NTPA 3JYMA 4N19A 1H0IA 4L72B 1NWUA 3O5EA 2DSWA 3PRAA 1WAWA 2WLYA 4ZPTR 3UI5A 3UQBA 1FAPA 3ALFA 2XP6A 1OGGA 4IT6A 2D9FA 3O5RA 3ODKA 2PV1A 2F2DA 1C9HA 3VAWA 4Z2KA 1GUVA 4IT4A 3WH0A 1NH6A 4KR0B 2PI6A 4DRHA 4JFKA 4QIBA 1HKIA 2M2AA 3CZ8A 1EHNA 3WD1A 1YW5A 3NI6A 4ODOA 3ARVA 2RURA 4LAYA 4IQCA 1IX5A 1E6PA 2KO7A 1D6OA 4HARA 4ODQA 2KGJA 3UQAA 3IK8A 1F40A 3RM9A 4NSBA 4ODMA 2A3CA 1NSGA 4MNMA 1M5YA 5HBFA 4W9PA 3KACA 3BXWA 2VN1A 4ITZA 2VCDA 1JNDA 3ARQA 4DZ2A 1HJXA 3O5DA 2DG9A 4DIPA 4FN2A 1EYMA 3JXVA 1ZB5A 3G6MA 3ARSA 4HBOA 3WD2A 1D7HA 3KAHA 4P8VA 3TCZA 4DRPA 1J6YA 4TX0A 1J4RA 4BF8A 2IF4A 4GIVA 4QT3A 4XAKA 1Y0OA 1HJWA 3IHZA 2RUCA 3B7XA 5B8IC 2PPOA 1FKDA 1ROTA 2YBUA 2FKEA 4R0XA 3OOBA 4IPXA 1FKIA 2A3BA 2MLZA 4WIWA 4MTVA 1D2KA 1ROUA 1W9PA 1A7XA 4MNKA 1FKTA 3RM4A 5HUAA 3WIJA 1PBKA 1FKGA 1BKFA 1ZBCA 1N1AA 3B8SA 1W1PA 2XPBA 3WL0A 1ZK6A 2DT0A 1W9VA 4P8WA 2O92A 3UQIA 1LG1A 1ZCNA 1E6NA 3WQVA 4WKFA 2DSZA 3AS0A 3KCEA 4G50A 5DEZA 1GOIA 2N87A 3O5IA 1D7IA 1CTNA 2PBCA 3RGCA 3WD0A 4S3KA 2XP5A 1X6LA 1Q6HA 4IQ2A 4JYSA 4JFMA 3TDBA 4P8XA 2ESCA 2YBTA 1FKHA 1FKSA 1E9LA 4FAPA 1O6IA 4DRNA 3GPKA 3FAPA 5HWBA 4TW8A 3O5PA 3ARXA 2UZ5A 5DO2A 4Q7NA 2PV3A 3WD3A 1UR9A 2DG4A 2DSUA 2OLHA 3B9AA 2G8ZA 4JFJA 5GPGA 4AY1A 4Z2IA 4W5UA 1J4HA 3ARYA 1ZBWA 1Q6IA 1T11A 2KR7A 1OGBA 2KI3A 1QZ2A 4U85A 3W4RA 2ZQVA 4PTMA 1HXVA 1ZBKA 5DIUA 4Z2JA 2RSEA 4URIA 2LPVA 1ZBVA 3WL1A 4ZPVR 3RMEA 1FKFA 4R5EA 4DRQA 1Q6UA 1FFRA 2DPEA 3KAIA 1FKLA 2RUQA 4MGVA 3CGMA 4DWSA 4NNRA 2KFWA 3O5LA 4W9QA 4WKAA 2ZR5A 4KQZA 1NMWA 1XRVA 3O5FA 2DG3A 4ODNA 4DROA 3H9RB 2FAPA 5HWCA 1JNTA 1E6RA 4QZVB 5HW7A 2MLYA 2WK2A 2L2SA 4Z2GA 1B6CA 4TYOA 2LJ4A 2AOSA 1UR8A 4MNJA 4Q22A 2Q5AA 3O5KA 1Q1CA 1NWTA 1E15A 4DRKA 4WK9A 1VF8A 2DSVA 3AS2A 1JNEA 1ZL1A 1LL6A 2AWGA 3CH9A 4TW7A 3WKZA 4DZ3A 2RQSA 3AS1A 5I98A 4Z2LA 1F8AB 4DWSB 1FKRA 3AQUA 1WB0A 2G41A 3O5JA 3KAGA 1J4IA 5J6EA 3EY6A 1GPFA 4DRIA 3KZ7A 3O5GA 2LGOA 2MLXA 2PPNA 1TCOC 2XP4A 3WQWA 2ZQSA 4DRJA 4ODLA 3ARUA 2KE0A 1NWRA 1RD6A 1QPFA 1FFQA 1OWQA 2F4EA 1LJYA 3KABA 4QT2A 1U79A 4U86A 2XP3A 3UF8A 3FY1A 3UI4A 1W1VA 1ZU8A 2IUZA 2WLZA 1LQ0A 4GGQA 5HW8A 1FJDA 1LL7A 5HT1A 1FKKA 3PRBA 3CHFA 3I6CA 2MPHA 1ITXA 3B9EA 1LL4A 1QPLA 4NZCA 2O9OA 2M1IA 2A3EA 2ITKA 2OFNA 3WD4A 1W9UA 1W1YA 1BL4A 5BXJA 1KT1A 5D75A 3ALGA 4W9OA 5GQBA 3ARZA 3PA7A 5GPRA 4LAVA 2MNTA 4ODRA 5DF0A 1SYTA 4Z2HA 2XP9A 1E6ZA 3AS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N19 A;  2Q5A A;  2Y78 A;  3O5K A;  1Q1C A;  2XPB A;  1ZK6 A;  3JYJ A;  1YAT A;  3IKG A;  4DRK A;  3O5E A;  3CGN A;  4DH0 A;  3UQI A;  3UI5 A;  1ZCN A;  3UQB A;  1FAP A;  2XP6 A;  3TC5 A;  3KAF A;  2ZR6 A;  3UI6 A;  2D9F A;  2PV2 A;  3KCE A;  4G50 A;  3O5R A;  4TW6 A;  5HKG A;  2N87 A;  3O5I A;  3ODK A;  4G2P A;  2PV1 A;  1JNS A;  2AWG A;  1D7I A;  2PBC A;  1P5Q A;  2F2D A;  4TW7 A;  3RGC A;  1C9H A;  3VAW A;  2XP5 A;  3O5Q A;  2RQS A;  4DZ3 A;  3WH0 A;  3LUO A;  5I98 A;  1Q6H A;  4IQ2 A;  4JYS A;  4DT4 A;  1F8A B;  4U84 A;  3KAD A;  1FKR A;  4JFM A;  2K8I A;  3TDB A;  3RFW A;  1EQ3 A;  4DRH A;  4JFK A;  3O5J A;  4QIB A;  1D7J A;  1FKH A;  3KAG A;  1FKS A;  1J4I A;  1NMV A;  5J6E A;  2M2A A;  3EY6 A;  3MDY B;  4FAP A;  4DRN A;  4DRI A;  1JVW A;  5HTG A;  3KZ7 A;  1YW5 A;  1FKB A;  2JZV A;  3O5G A;  3NI6 A;  3GPK A;  2LGO A;  4ODO A;  2RUR A;  3FAP A;  2MLX A;  4LAY A;  5HWB A;  2PPN A;  4IQC A;  4J4O A;  4TW8 A;  1TCO C;  2XP4 A;  1KT0 A;  2M08 A;  2KO7 A;  1D6O A;  3IKD A;  3O5P A;  4ODQ A;  2KGJ A;  2UZ5 A;  3NRK A;  5DIV A;  4C02 B;  3UQA A;  3IK8 A;  3O5M A;  2PV3 A;  4DRM A;  1F40 A;  2DG4 A;  2ZQS A;  4DRJ A;  4ODM A;  4ODL A;  1W26 A;  1FKJ A;  2KE0 A;  1NSG A;  4JFJ A;  2F21 A;  4O2T A;  5GPG A;  1J4H A;  1QPF A;  1M5Y A;  4LAX A;  2F4E A;  2XP8 A;  3KAB A;  3KAC A;  1Q6I A;  4JFI A;  2ZQU A;  4W9P A;  5HW6 A;  1T11 A;  4QT2 A;  4JFL A;  2KR7 A;  1U79 A;  4U86 A;  2XP3 A;  3UF8 A;  2RUD A;  2MF9 A;  3UI4 A;  2KI3 A;  1QZ2 A;  4U85 A;  2VN1 A;  2ZQV A;  2PPP A;  4ITZ A;  2VCD A;  4DZ2 A;  1HXV A;  4GGQ A;  3O5D A;  5DIU A;  4DRO A;  2DG9 A;  4DIP A;  4FN2 A;  2ZQT A;  1EYM A;  2RSE A;  3JXV A;  4LAW A;  5HT1 A;  5HW8 A;  1FKK A;  3PRB A;  2LPV A;  3I6C A;  1D7H A;  3KAH A;  1FKF A;  2MPH A;  3TCZ A;  4DRP A;  4DRQ A;  1Q6U A;  1J6Y A;  3KAI A;  1QPL A;  1FKL A;  2RUQ A;  4MGV A;  3CGM A;  4MSP A;  2M1I A;  1J4R A;  2KFW A;  4NNR A;  4TX0 A;  2ITK A;  1L1P A;  4ODP A;  1FD9 A;  2OFN A;  3O5L A;  4W9Q A;  2XP7 A;  4BF8 A;  2IF4 A;  2XPA A;  4GIV A;  4QT3 A;  2ZR5 A;  1Y0O A;  1BL4 A;  4J4N A;  3IHZ A;  1FJD A;  2RUC A;  3B7X A;  5BXJ A;  1KT1 A;  1NMW A;  5B8I C;  2PPO A;  3O5F A;  1FKD A;  1ROT A;  2DG3 A;  2LKN A;  3PRD A;  4ODN A;  5D75 A;  2FKE A;  3H9R B;  2FAP A;  4R0X A;  3OOB A;  4W9O A;  5HWC A;  1JNT A;  1FKI A;  2MLZ A;  4IPX A;  3PA7 A;  4ODK A;  5HW7 A;  1ROU A;  2MLY A;  4LAV A;  1A7X A;  2MNT A;  1R9H A;  4ODR A;  2L2S A;  1FKT A;  5HUA A;  3O5O A;  1PBK A;  1FKG A;  1BKF A;  2XP9 A;  2ZR4 A;  1B6C A;  4TYO A;  4TNS A;  2LJ4 A;  1N1A A;  5DIT A;  1PIN A;  3NTP A;  3JYM A; 
#chains in the Genus database with same CATH topology
 2Y78 A;  1EDQ A;  3JYJ A;  1YAT A;  3IKG A;  3CGN A;  4WJX A;  4DH0 A;  4WKH A;  4MPK A;  3G6L A;  1KFW A;  1HKM A;  4ML4 A;  3TC5 A;  3KAF A;  2ZR6 A;  3UI6 A;  2WM0 A;  3B9D A;  3FXY A;  2PV2 A;  4TW6 A;  5HKG A;  4G2P A;  1JNS A;  3OA5 A;  1P5Q A;  1WNO A;  1LG2 A;  2FDM A;  4LGX A;  4P8U A;  1GRJ A;  3O5Q A;  1HKK A;  3LUO A;  3RM8 A;  3CHE A;  4MAV A;  4DT4 A;  1XHG A;  4U84 A;  3KAD A;  2K8I A;  3RFW A;  1EQ3 A;  3CHC A;  1TFV A;  1D7J A;  1NMV A;  3MDY B;  1EIB A;  1JVW A;  5HTG A;  1FKB A;  2JZV A;  3ARW A;  1X6N A;  1H0G A;  4J4O A;  1KT0 A;  2M08 A;  3IKD A;  4MNL A;  5DIV A;  3NRK A;  3QOK A;  4C02 B;  3O5M A;  3ART A;  4DRM A;  1W26 A;  1FKJ A;  4O2T A;  3CHD A;  5JH8 A;  2F21 A;  1HKJ A;  4LAX A;  1HJV A;  2B31 A;  2XP8 A;  5HW6 A;  4JFI A;  2ZQU A;  4ZS6 A;  4JFL A;  3ARO A;  2RUD A;  2ETN A;  1SR0 A;  2MF9 A;  4L3N A;  2PPP A;  4HBE A;  2ZQT A;  4LAW A;  4S3J A;  2DT2 A;  4MSP A;  3ARR A;  4ZPW R;  4ODP A;  1L1P A;  1FD9 A;  2XP7 A;  2XPA A;  2DT1 A;  4J4N A;  1NWS A;  3PRD A;  1W1T A;  2DT3 A;  2LKN A;  4DWS C;  2A3A A;  1K9T A;  4ODK A;  2QF8 A;  3ARP A;  1R9H A;  3PR9 A;  4DWS D;  3O5O A;  2ZR4 A;  4TNS A;  5DIT A;  1PIN A;  3NTP A;  3JYM A;  4N19 A;  1H0I A;  4L72 B;  2B5U B;  1NWU A;  3O5E A;  2F23 A;  2DSW A;  3PRA A;  1WAW A;  2WLY A;  4ZPT R;  3UI5 A;  3UQB A;  1FAP A;  3ALF A;  2XP6 A;  1OGG A;  4IT6 A;  2D9F A;  3O5R A;  3ODK A;  2PV1 A;  2F2D A;  1C9H A;  3VAW A;  4Z2K A;  1GUV A;  4IT4 A;  3WH0 A;  1NH6 A;  4KR0 B;  2PI6 A;  4DRH A;  4JFK A;  4QIB A;  1HKI A;  2M2A A;  3CZ8 A;  1EHN A;  3WD1 A;  1YW5 A;  3NI6 A;  4ODO A;  3ARV A;  2RUR A;  3GU0 A;  4LAY A;  4IQC A;  1IX5 A;  1E6P A;  2KO7 A;  1D6O A;  4HAR A;  1JCH B;  4ODQ A;  2KGJ A;  3UQA A;  3IK8 A;  1F40 A;  3RM9 A;  4NSB A;  4ODM A;  2A3C A;  1NSG A;  4MNM A;  1M5Y A;  5HBF A;  4W9P A;  3KAC A;  3BXW A;  2VN1 A;  4ITZ A;  2VCD A;  1JND A;  3ARQ A;  4DZ2 A;  1HJX A;  3O5D A;  2DG9 A;  4DIP A;  4FN2 A;  1EYM A;  3JXV A;  1ZB5 A;  3G6M A;  3ARS A;  4HBO A;  3WD2 A;  1D7H A;  3KAH A;  4P8V A;  3TCZ A;  4DRP A;  1J6Y A;  4TX0 A;  1J4R A;  4BF8 A;  2IF4 A;  4GIV A;  4QT3 A;  4XAK A;  1Y0O A;  1HJW A;  3GTY X;  3IHZ A;  2RUC A;  3B7X A;  5B8I C;  2PPO A;  1FKD A;  1ROT A;  2YBU A;  2FKE A;  4R0X A;  3OOB A;  4IPX A;  1FKI A;  2A3B A;  2MLZ A;  4WIW A;  4MTV A;  1D2K A;  1ROU A;  1W9P A;  1A7X A;  4MNK A;  1FKT A;  3RM4 A;  5HUA A;  3WIJ A;  1PBK A;  1FKG A;  1BKF A;  1ZBC A;  1N1A A;  3B8S A;  1W1P A;  2XPB A;  3WL0 A;  1ZK6 A;  2DT0 A;  1W9V A;  4P8W A;  2O92 A;  3UQI A;  1LG1 A;  1ZCN A;  1E6N A;  3WQV A;  4WKF A;  2DSZ A;  3AS0 A;  3KCE A;  4G50 A;  5DEZ A;  1GOI A;  2N87 A;  3O5I A;  1D7I A;  1CTN A;  2PBC A;  3RGC A;  3WD0 A;  4S3K A;  2XP5 A;  1X6L A;  1Q6H A;  4IQ2 A;  4JYS A;  4JFM A;  3TDB A;  4P8X A;  2ESC A;  2YBT A;  1FKH A;  1FKS A;  1E9L A;  4FAP A;  1O6I A;  4DRN A;  3GPK A;  3FAP A;  5HWB A;  4TW8 A;  3O5P A;  3ARX A;  2UZ5 A;  5DO2 A;  4Q7N A;  2PV3 A;  3WD3 A;  1UR9 A;  2DG4 A;  2DSU A;  2OLH A;  3B9A A;  2G8Z A;  4JFJ A;  5GPG A;  4AY1 A;  4Z2I A;  4W5U A;  1J4H A;  3ARY A;  1ZBW A;  1Q6I A;  1T11 A;  2KR7 A;  1OGB A;  2EUL A;  2KI3 A;  1QZ2 A;  4U85 A;  3W4R A;  2ZQV A;  4PTM A;  1HXV A;  3EIP A;  1ZBK A;  5DIU A;  4Z2J A;  2RSE A;  4URI A;  2LPV A;  1ZBV A;  3WL1 A;  4ZPV R;  3RME A;  1FKF A;  4R5E A;  4DRQ A;  1Q6U A;  1FFR A;  2DPE A;  3KAI A;  1FKL A;  2RUQ A;  4MGV A;  3CGM A;  4DWS A;  4NNR A;  2KFW A;  3O5L A;  4W9Q A;  4WKA A;  2ZR5 A;  4KQZ A;  1NMW A;  1XRV A;  3O5F A;  2DG3 A;  4ODN A;  4DRO A;  3H9R B;  2FAP A;  5HWC A;  1JNT A;  1E6R A;  4QZV B;  5HW7 A;  2MLY A;  2WK2 A;  2L2S A;  4Z2G A;  1B6C A;  4TYO A;  2LJ4 A;  2AOS A;  1UR8 A;  4MNJ A;  4Q22 A;  4UDM A;  2Q5A A;  3O5K A;  1Q1C A;  1NWT A;  1E15 A;  4DRK A;  4WK9 A;  1VF8 A;  2DSV A;  2PN0 A;  1E44 A;  3AS2 A;  1JNE A;  1ZL1 A;  1LL6 A;  2AWG A;  3CH9 A;  4TW7 A;  3WKZ A;  4DZ3 A;  2RQS A;  3AS1 A;  5I98 A;  4Z2L A;  1F8A B;  4DWS B;  1FKR A;  3AQU A;  1WB0 A;  2G41 A;  3O5J A;  3KAG A;  1J4I A;  3BMB A;  5J6E A;  3EY6 A;  1GPF A;  4DRI A;  3KZ7 A;  3O5G A;  2LGO A;  2MLX A;  2PPN A;  1TCO C;  2XP4 A;  3WQW A;  2ZQS A;  4DRJ A;  4ODL A;  3ARU A;  2KE0 A;  1NWR A;  1RD6 A;  1QPF A;  1FFQ A;  2P4V A;  1OWQ A;  2F4E A;  1LJY A;  3KAB A;  4QT2 A;  1U79 A;  4U86 A;  2XP3 A;  3UF8 A;  3FY1 A;  3UI4 A;  1W1V A;  1ZU8 A;  2IUZ A;  2WLZ A;  1LQ0 A;  4GGQ A;  5HW8 A;  1FJD A;  1LL7 A;  5HT1 A;  1FKK A;  3PRB A;  3CHF A;  3I6C A;  2MPH A;  1ITX A;  3B9E A;  1LL4 A;  1QPL A;  4NZC A;  2O9O A;  2M1I A;  2A3E A;  2ITK A;  2OFN A;  3WD4 A;  1W9U A;  1W1Y A;  1BL4 A;  5BXJ A;  1KT1 A;  5D75 A;  3ALG A;  4W9O A;  5GQB A;  3ARZ A;  3PA7 A;  5GPR A;  4LAV A;  2MNT A;  4ODR A;  5DF0 A;  1SYT A;  4Z2H A;  2XP9 A;  1E6Z A;  3AS3 A; 
#chains in the Genus database with same CATH homology
 2Y78 A;  1EDQ A;  3JYJ A;  1YAT A;  3IKG A;  3CGN A;  4WJX A;  4DH0 A;  4WKH A;  4MPK A;  3G6L A;  1KFW A;  1HKM A;  4ML4 A;  3TC5 A;  3KAF A;  2ZR6 A;  3UI6 A;  2WM0 A;  3B9D A;  3FXY A;  2PV2 A;  4TW6 A;  5HKG A;  4G2P A;  1JNS A;  3OA5 A;  1P5Q A;  1WNO A;  1LG2 A;  2FDM A;  4LGX A;  4P8U A;  3O5Q A;  1HKK A;  3LUO A;  3RM8 A;  3CHE A;  4MAV A;  4DT4 A;  1XHG A;  4U84 A;  3KAD A;  2K8I A;  3RFW A;  1EQ3 A;  3CHC A;  1TFV A;  1D7J A;  1NMV A;  3MDY B;  1EIB A;  1JVW A;  5HTG A;  1FKB A;  2JZV A;  3ARW A;  1X6N A;  1H0G A;  4J4O A;  1KT0 A;  2M08 A;  3IKD A;  4MNL A;  5DIV A;  3NRK A;  3QOK A;  4C02 B;  3O5M A;  3ART A;  4DRM A;  1W26 A;  1FKJ A;  4O2T A;  3CHD A;  5JH8 A;  2F21 A;  1HKJ A;  4LAX A;  1HJV A;  2B31 A;  2XP8 A;  5HW6 A;  4JFI A;  2ZQU A;  4ZS6 A;  4JFL A;  3ARO A;  2RUD A;  2MF9 A;  1SR0 A;  4L3N A;  2PPP A;  4HBE A;  2ZQT A;  4LAW A;  4S3J A;  2DT2 A;  4MSP A;  3ARR A;  4ZPW R;  4ODP A;  1L1P A;  1FD9 A;  2XP7 A;  2XPA A;  2DT1 A;  4J4N A;  1NWS A;  3PRD A;  1W1T A;  2DT3 A;  2LKN A;  4DWS C;  2A3A A;  1K9T A;  4ODK A;  2QF8 A;  3ARP A;  1R9H A;  3PR9 A;  4DWS D;  3O5O A;  2ZR4 A;  4TNS A;  5DIT A;  1PIN A;  3NTP A;  3JYM A;  4N19 A;  1H0I A;  4L72 B;  1NWU A;  3O5E A;  2DSW A;  3PRA A;  1WAW A;  2WLY A;  4ZPT R;  3UI5 A;  3UQB A;  1FAP A;  3ALF A;  2XP6 A;  1OGG A;  4IT6 A;  2D9F A;  3O5R A;  3ODK A;  2PV1 A;  2F2D A;  1C9H A;  3VAW A;  4Z2K A;  1GUV A;  4IT4 A;  3WH0 A;  1NH6 A;  4KR0 B;  2PI6 A;  4DRH A;  4JFK A;  4QIB A;  1HKI A;  2M2A A;  3CZ8 A;  1EHN A;  3WD1 A;  1YW5 A;  3NI6 A;  4ODO A;  3ARV A;  2RUR A;  4LAY A;  4IQC A;  1IX5 A;  1E6P A;  2KO7 A;  1D6O A;  4HAR A;  4ODQ A;  2KGJ A;  3UQA A;  3IK8 A;  1F40 A;  3RM9 A;  4NSB A;  4ODM A;  2A3C A;  1NSG A;  4MNM A;  1M5Y A;  5HBF A;  4W9P A;  3KAC A;  3BXW A;  2VN1 A;  4ITZ A;  2VCD A;  1JND A;  3ARQ A;  4DZ2 A;  1HJX A;  3O5D A;  2DG9 A;  4DIP A;  4FN2 A;  1EYM A;  3JXV A;  1ZB5 A;  3G6M A;  3ARS A;  4HBO A;  3WD2 A;  1D7H A;  3KAH A;  4P8V A;  3TCZ A;  4DRP A;  1J6Y A;  4TX0 A;  1J4R A;  4BF8 A;  2IF4 A;  4GIV A;  4QT3 A;  4XAK A;  1Y0O A;  1HJW A;  3IHZ A;  2RUC A;  3B7X A;  5B8I C;  2PPO A;  1FKD A;  1ROT A;  2YBU A;  2FKE A;  4R0X A;  3OOB A;  4IPX A;  1FKI A;  2A3B A;  2MLZ A;  4WIW A;  4MTV A;  1D2K A;  1ROU A;  1W9P A;  1A7X A;  4MNK A;  1FKT A;  3RM4 A;  5HUA A;  3WIJ A;  1PBK A;  1FKG A;  1BKF A;  1ZBC A;  1N1A A;  3B8S A;  1W1P A;  2XPB A;  3WL0 A;  1ZK6 A;  2DT0 A;  1W9V A;  4P8W A;  2O92 A;  3UQI A;  1LG1 A;  1ZCN A;  1E6N A;  3WQV A;  4WKF A;  2DSZ A;  3AS0 A;  3KCE A;  4G50 A;  5DEZ A;  1GOI A;  2N87 A;  3O5I A;  1D7I A;  1CTN A;  2PBC A;  3RGC A;  3WD0 A;  4S3K A;  2XP5 A;  1X6L A;  1Q6H A;  4IQ2 A;  4JYS A;  4JFM A;  3TDB A;  4P8X A;  2ESC A;  2YBT A;  1FKH A;  1FKS A;  1E9L A;  4FAP A;  1O6I A;  4DRN A;  3GPK A;  3FAP A;  5HWB A;  4TW8 A;  3O5P A;  3ARX A;  2UZ5 A;  5DO2 A;  4Q7N A;  2PV3 A;  3WD3 A;  1UR9 A;  2DG4 A;  2DSU A;  2OLH A;  3B9A A;  2G8Z A;  4JFJ A;  5GPG A;  4AY1 A;  4Z2I A;  4W5U A;  1J4H A;  3ARY A;  1ZBW A;  1Q6I A;  1T11 A;  2KR7 A;  1OGB A;  2KI3 A;  1QZ2 A;  4U85 A;  3W4R A;  2ZQV A;  4PTM A;  1HXV A;  1ZBK A;  5DIU A;  4Z2J A;  2RSE A;  4URI A;  2LPV A;  1ZBV A;  3WL1 A;  4ZPV R;  3RME A;  1FKF A;  4R5E A;  4DRQ A;  1Q6U A;  1FFR A;  2DPE A;  3KAI A;  1FKL A;  2RUQ A;  4MGV A;  3CGM A;  4DWS A;  4NNR A;  2KFW A;  3O5L A;  4W9Q A;  4WKA A;  2ZR5 A;  4KQZ A;  1NMW A;  1XRV A;  3O5F A;  2DG3 A;  4ODN A;  4DRO A;  3H9R B;  2FAP A;  5HWC A;  1JNT A;  1E6R A;  4QZV B;  5HW7 A;  2MLY A;  2WK2 A;  2L2S A;  4Z2G A;  1B6C A;  4TYO A;  2LJ4 A;  2AOS A;  1UR8 A;  4MNJ A;  4Q22 A;  2Q5A A;  3O5K A;  1Q1C A;  1NWT A;  1E15 A;  4DRK A;  4WK9 A;  1VF8 A;  2DSV A;  3AS2 A;  1JNE A;  1ZL1 A;  1LL6 A;  2AWG A;  3CH9 A;  4TW7 A;  3WKZ A;  4DZ3 A;  2RQS A;  3AS1 A;  5I98 A;  4Z2L A;  1F8A B;  4DWS B;  1FKR A;  3AQU A;  1WB0 A;  2G41 A;  3O5J A;  3KAG A;  1J4I A;  5J6E A;  3EY6 A;  1GPF A;  4DRI A;  3KZ7 A;  3O5G A;  2LGO A;  2MLX A;  2PPN A;  1TCO C;  2XP4 A;  3WQW A;  2ZQS A;  4DRJ A;  4ODL A;  3ARU A;  2KE0 A;  1NWR A;  1RD6 A;  1QPF A;  1FFQ A;  1OWQ A;  2F4E A;  1LJY A;  3KAB A;  4QT2 A;  1U79 A;  4U86 A;  2XP3 A;  3UF8 A;  3FY1 A;  3UI4 A;  1W1V A;  1ZU8 A;  2IUZ A;  2WLZ A;  1LQ0 A;  4GGQ A;  5HW8 A;  1FJD A;  1LL7 A;  5HT1 A;  1FKK A;  3PRB A;  3CHF A;  3I6C A;  2MPH A;  1ITX A;  3B9E A;  1LL4 A;  1QPL A;  4NZC A;  2O9O A;  2M1I A;  2A3E A;  2ITK A;  2OFN A;  3WD4 A;  1W9U A;  1W1Y A;  1BL4 A;  5BXJ A;  1KT1 A;  5D75 A;  3ALG A;  4W9O A;  5GQB A;  3ARZ A;  3PA7 A;  5GPR A;  4LAV A;  2MNT A;  4ODR A;  5DF0 A;  1SYT A;  4Z2H A;  2XP9 A;  1E6Z A;  3AS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...