3UQIA

Crystallographic structure of fkbp12 from aedes aegypti
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
108
structure length
108
Chain Sequence
MGVQVVTLAAGDEATYPKAGQVAVVHYTGTLADGKVFDSSRTRGKPFRFTVGRGEVIRGWDEGVAQMSVGQRAKLVCSPDYAYGSRGHPGVIPPNATLTFDVELLRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution crystal structure of FKBP12 from Aedes aegypti.
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Isomerase
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase
total genus 26
structure length 108
sequence length 108
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2011-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3uqiA00
2RUCA 3ODKA 1FKJA 2K8IA 1JVWA 4ODMA 3UI4A 3CGMA 1KT1A 1J6YA 4DH0A 1D7JA 2ZR6A 4DZ3A 5HWCA 1Y0OA 4ODRA 1FKSA 4JFJA 5D75A 5DIVA 4TX0A 2LKNA 1W26A 1NSGA 2L2SA 4MGVA 1A7XA 4LAYA 1ROTA 3TDBA 1Q6UA 1ZK6A 2ZQSA 1JNTA 2PBCA 4N19A 2PPPA 4QT2A 5BXJA 4FAPA 2VCDA 2DG9A 2F21A 3O5PA 3O5FA 4ODPA 1FAPA 1Q1CA 1JNSA 1FKDA 2DG3A 2M1IA 1FD9A 3UQBA 3PA7A 1FKIA 2ZR5A 2VN1A 2KFWA 5HTGA 1J4RA 2ZQVA 4W9PA 3O5OA 1EYMA 1Q6IA 3PRDA 4TYOA 3B7XA 1EQ3A 4J4OA 1B6CA 2MPHA 2UZ5A 1KT0A 5HUAA 3IK8A 1M5YA 2RUDA 4DROA 4JFLA 1Q6HA 2KI3A 3NI6A 4IQCA 3UI6A 2Y78A 3FAPA 4U85A 3O5RA 4GGQA 2ITKA 1FKTA 1R9HA 2LGOA 3RFWA 2IF4A 5HW7A 2XP5A 3O5DA 2ZR4A 5HWBA 2LPVA 2KR7A 3O5QA 2RURA 4LAWA 1FKLA 1FKFA 1BKFA 4DRQA 2MLZA 2XP9A 2KE0A 5HW6A 4W9QA 4ODOA 1FJDA 3EY6A 3O5MA 4DRMA 2XP4A 3KABA 4JFKA 3O5LA 1FKGA 2FKEA 4DRNA 4U86A 2DG4A 1D7HA 2PV2A 3UF8A 1U79A 3PRBA 4IPXA 4GIVA 4LAVA 1YW5A 4O2TA 2LJ4A 1J4HA 1FKBA 2M08A 4ODLA 5I98A 3H9RB 4J4NA 4ODNA 2PV1A 3LUOA 4ITZA 1T11A 4TW7A 1N1AA 1QZ2A 3WH0A 4TW6A 4C02B 4DRKA 1L1PA 1D7IA 2XP3A 2F2DA 2FAPA 4QT3A 3JXVA 3KCEA 2ZQUA 4JYSA 3O5EA 1YATA 5DIUA 3IHZA 2PPNA 3RGCA 3UI5A 5DITA 3TCZA 3KZ7A 3UQAA 3O5IA 4QIBA 4IQ2A 2D9FA 4DRIA 1TCOC 3KACA 2N87A 1FKRA 1P5QA 3O5GA 3JYMA 5HW8A 3KAHA 5HT1A 1BL4A 3IKGA 4ODQA 1QPFA 3KAIA 2ZQTA 4DRJA 1NMVA 1HXVA 1PINA 2AWGA 2XPAA 4NNRA 3MDYB 1QPLA 4TW8A 2MLXA 1J4IA 2XP8A 2XP6A 4G2PA 3JYJA 3KAGA 3TC5A 4DIPA 5B8IC 4ODKA 4DRPA 3I6CA 1F8AB 1ZCNA 2PPOA 1F40A 4U84A 2KGJA 3NRKA 2KO7A 5HKGA 3UQIA 3VAWA 4BF8A 5J6EA 1C9HA 3O5KA 3GPKA 3IKDA 1NMWA 4LAXA 3OOBA 3KAFA 2OFNA 2XP7A 1D6OA 2MLYA 5GPGA 4G50A 2PV3A 3NTPA 1FKHA 4JFMA 4MSPA 2F4EA 2XPBA 4JFIA 4FN2A 4W9OA 3KADA 2RSEA 2RUQA 4R0XA 2Q5AA 1FKKA 1PBKA 2MNTA 4DRHA 4TNSA 2JZVA 2M2AA 2RQSA 3O5JA 3CGNA 4DT4A 4DZ2A 1ROUA 2MF9A
chains in the Genus database with same CATH superfamily
4WKHA 3CGMA 1HKMA 1IX5A 1D7JA 5HWCA 4ODRA 5DF0A 3TDBA 1A7XA 1EDQA 1ROTA 2PBCA 2PPPA 4FAPA 1E6RA 2DG9A 3O5FA 1FKDA 4S3JA 2KFWA 4HBOA 3ARYA 1NWUA 1B6CA 3WQWA 1WAWA 4JFLA 4S3KA 2LGOA 2LPVA 1JNDA 4DRQA 1E44A 4W9QA 1O6IA 3EY6A 2XP4A 4JFKA 1FKGA 4DRNA 4U86A 2DG4A 2PV2A 3WQVA 1FKBA 2M08A 3ALGA 4HBEA 4J4NA 4ODNA 3LUOA 4ITZA 4TW7A 1QZ2A 1L1PA 4C02B 3ALFA 2FAPA 4JYSA 1YATA 5DIUA 3UI5A 1X6LA 1D2KA 4IQ2A 4ZPWR 3KACA 1FKRA 3O5GA 1CTNA 2A3EA 2G41A 3IKGA 3WD4A 1QPFA 4MPKA 3G6LA 4MNMA 4IT4A 2O92A 1GUVA 2XP6A 3JYJA 1GPFA 3KAGA 4DIPA 1ZCNA 1F40A 1W9VA 1HKIA 1NWRA 3CZ8A 1HJWA 1LL7A 4ZPTR 5JH8A 3IKDA 4DWSD 3KAFA 2O9OA 2XPBA 4KR0B 5DO2A 4JFIA 1ZL1A 4W9OA 3WD3A 2RSEA 2RUQA 4R0XA 2M2AA 3O5JA 4DZ2A 4L72B 2P4VA 1NWSA 1SR0A 3CHDA 4ODMA 1FKJA 2K8IA 1KT1A 2ZR6A 4DZ3A 4ML4A 3B8SA 5DIVA 2ZQSA 1VF8A 5BXJA 1E6ZA 4WK9A 2F21A 3O5PA 1FAPA 1Q1CA 1XHGA 3PA7A 1LL4A 5HTGA 2VN1A 4W9PA 3PRDA 1EYMA 1EQ3A 2DPEA 4J4OA 2MPHA 2UZ5A 2YBTA 1KT0A 1OGBA 3B9EA 3NI6A 3UI6A 1KFWA 2PN0A 4GGQA 1FKTA 5HW7A 2IF4A 5HWBA 3O5DA 1UR8A 2DT3A 2KR7A 2RURA 4ZS6A 1BKFA 1FKFA 3ARZA 3ARXA 3CH9A 4WJXA 1W1YA 2EULA 3O5LA 1D7HA 3UF8A 1U79A 4IPXA 1FFQA 2YBUA 4LAVA 4ODLA 5I98A 3H9RB 1TFVA 3AS2A 4Z2JA 1T11A 4L3NA 1EIBA 1SYTA 4DRKA 1ZBKA 2F2DA 4PTMA 2ZQUA 1W9PA 2PPNA 4W5UA 5DITA 3TCZA 3KZ7A 3O5IA 2WM0A 4QIBA 1ITXA 4DWSA 4DRIA 1P5QA 3KAHA 5HT1A 4DWSC 1BL4A 3AS0A 3KAIA 4Z2LA 2XPAA 4UDMA 1ZB5A 1J4IA 1HJXA 2XP8A 4G2PA 5B8IC 1ZBCA 3RMEA 1H0GA 2KGJA 3AROA 1RD6A 1WB0A 2WLYA 4P8UA 1LJYA 5HKGA 3VAWA 1C9HA 3PR9A 1NMWA 3OOBA 3CHEA 2OFNA 2XP7A 4QZVB 4G50A 2PV3A 3NTPA 5GPGA 1HJVA 1LG2A 2AOSA 2F4EA 4JFMA 4MSPA 3WIJA 3KADA 2Q5AA 2JZVA 4DT4A 1JVWA 3UI4A 4DH0A 1Y0OA 5D75A 1NSGA 1E6PA 4MGVA 4LAYA 1Q6UA 1WNOA 1ZK6A 4Z2KA 1JNTA 1HKJA 3ARSA 1NH6A 2WK2A 2DG3A 3WD0A 1FD9A 3UQBA 3RM8A 1FKIA 2ZR5A 4AY1A 2ZQVA 4NSBA 3O5OA 1Q6IA 4TYOA 3B7XA 4Z2GA 2DT2A 1ZU8A 3AS3A 2RUDA 1Q6HA 4IQCA 5DEZA 2Y78A 3FAPA 4U85A 3WKZA 3O5RA 2ITKA 3OA5A 3ARWA 4MNJA 4WKAA 3RFWA 2ETNA 2XP5A 2ZR4A 4LGXA 3O5QA 4LAWA 1FKLA 3WL0A 2XP9A 2KE0A 4Z2HA 3FY1A 4ODOA 4Q7NA 2DSWA 2FKEA 3CHCA 5GPRA 3PRAA 1YW5A 4O2TA 2PV1A 1E15A 1N1AA 3ARRA 4TW6A 2DSVA 1NWTA 3WH0A 3BXWA 1D7IA 4QT3A 3KCEA 3ARPA 1E9LA 3IHZA 3RGCA 3UQAA 4DWSB 2D9FA 3WD2A 1TCOC 2A3BA 3JYMA 5HW8A 1UR9A 4ODQA 1NMVA 2IUZA 4IT6A 2AWGA 4NNRA 4MNKA 4TW8A 2MLXA 1JCHB 3TC5A 3ARUA 4ODKA 4DRPA 2DSUA 2PPOA 4U84A 3B9AA 3NRKA 2KO7A 3UQIA 4BF8A 3O5KA 3GPKA 4LAXA 1W1PA 1D6OA 2QF8A 2DSZA 1FKKA 2MNTA 4DRHA 3G6MA 2RQSA 3CGNA 4R5EA 1ROUA 2B31A 1LL6A 2RUCA 3ARQA 3ODKA 4KQZA 4P8XA 1J6YA 1E6NA 3RM9A 2OLHA 3ARVA 1FKSA 4JFJA 4TX0A 2LKNA 1HKKA 1W26A 2L2SA 4WKFA 2A3AA 2ESCA 4HARA 4N19A 4QT2A 1GOIA 2VCDA 4MAVA 4ODPA 1JNSA 4P8VA 4P8WA 4WIWA 2M1IA 4NZCA 4URIA 3EIPA 1W1VA 1J4RA 1LQ0A 3B9DA 3CHFA 5HUAA 3IK8A 1M5YA 4DROA 2KI3A 1R9HA 3RM4A 1JNEA 2A3CA 4Z2IA 2MLZA 5HW6A 1FJDA 3O5MA 4DRMA 3KABA 2F23A 2FDMA 2DT0A 4ZPVR 3PRBA 4GIVA 4MTVA 2LJ4A 1J4HA 1OGGA 3AS1A 1GRJA 1ZBWA 2XP3A 3WL1A 3JXVA 3O5EA 1EHNA 3ARTA 3QOKA 2N87A 1X6NA 1OWQA 2DT1A 2PI6A 2ZQTA 4DRJA 1HXVA 1PINA 2B5UB 5GQBA 5HBFA 3MDYB 3WD1A 1QPLA 1FFRA 3I6CA 2WLZA 1F8AB 4Q22A 1W9UA 4XAKA 1H0IA 2G8ZA 5J6EA 3W4RA 1ZBVA 1W1TA 3FXYA 1XRVA 2MLYA 1FKHA 4MNLA 4FN2A 1K9TA 1LG1A 1PBKA 3GU0A 4TNSA 3BMBA 3AQUA 3GTYX 2MF9A
chains in the Genus database with same CATH topology
4WKHA 3CGMA 1HKMA 1IX5A 1D7JA 5HWCA 4ODRA 5DF0A 3TDBA 1A7XA 1EDQA 1ROTA 2PBCA 2PPPA 4FAPA 1E6RA 2DG9A 3O5FA 1FKDA 4S3JA 2KFWA 4HBOA 3ARYA 1NWUA 1B6CA 3WQWA 1WAWA 4JFLA 4S3KA 2LGOA 2LPVA 1JNDA 4DRQA 4W9QA 1O6IA 3EY6A 2XP4A 4JFKA 1FKGA 4DRNA 4U86A 2DG4A 2PV2A 3WQVA 1FKBA 2M08A 3ALGA 4HBEA 4J4NA 4ODNA 3LUOA 4ITZA 4TW7A 1QZ2A 1L1PA 4C02B 3ALFA 2FAPA 4JYSA 1YATA 5DIUA 3UI5A 1X6LA 1D2KA 4IQ2A 4ZPWR 3KACA 1FKRA 3O5GA 1CTNA 2A3EA 2G41A 3IKGA 3WD4A 1QPFA 4MPKA 3G6LA 4MNMA 4IT4A 2O92A 1GUVA 2XP6A 3JYJA 1GPFA 3KAGA 4DIPA 1ZCNA 1F40A 1W9VA 1HKIA 1NWRA 3CZ8A 1HJWA 1LL7A 4ZPTR 5JH8A 3IKDA 4DWSD 3KAFA 2O9OA 2XPBA 4KR0B 5DO2A 4JFIA 1ZL1A 4W9OA 3WD3A 2RSEA 2RUQA 4R0XA 2M2AA 3O5JA 4DZ2A 4L72B 1NWSA 1SR0A 3CHDA 4ODMA 1FKJA 2K8IA 1KT1A 2ZR6A 4DZ3A 4ML4A 3B8SA 5DIVA 2ZQSA 1VF8A 5BXJA 1E6ZA 4WK9A 2F21A 3O5PA 1FAPA 1Q1CA 1XHGA 3PA7A 1LL4A 5HTGA 2VN1A 4W9PA 3PRDA 1EYMA 1EQ3A 2DPEA 4J4OA 2MPHA 2UZ5A 2YBTA 1KT0A 1OGBA 3B9EA 3NI6A 3UI6A 1KFWA 4GGQA 1FKTA 5HW7A 2IF4A 5HWBA 3O5DA 1UR8A 2DT3A 2KR7A 2RURA 4ZS6A 1BKFA 1FKFA 3ARZA 3ARXA 3CH9A 4WJXA 1W1YA 3O5LA 1D7HA 3UF8A 1U79A 4IPXA 1FFQA 2YBUA 4LAVA 4ODLA 5I98A 3H9RB 1TFVA 3AS2A 4Z2JA 1T11A 4L3NA 1EIBA 1SYTA 4DRKA 1ZBKA 2F2DA 4PTMA 2ZQUA 1W9PA 2PPNA 4W5UA 5DITA 3TCZA 3KZ7A 3O5IA 2WM0A 4QIBA 1ITXA 4DWSA 4DRIA 1P5QA 3KAHA 5HT1A 4DWSC 1BL4A 3AS0A 3KAIA 4Z2LA 2XPAA 1ZB5A 1J4IA 1HJXA 2XP8A 4G2PA 5B8IC 1ZBCA 3RMEA 1H0GA 2KGJA 3AROA 1RD6A 1WB0A 2WLYA 4P8UA 1LJYA 5HKGA 3VAWA 1C9HA 3PR9A 1NMWA 3OOBA 3CHEA 2OFNA 2XP7A 4QZVB 4G50A 2PV3A 3NTPA 5GPGA 1HJVA 1LG2A 2AOSA 2F4EA 4JFMA 4MSPA 3WIJA 3KADA 2Q5AA 2JZVA 4DT4A 1JVWA 3UI4A 4DH0A 1Y0OA 5D75A 1NSGA 1E6PA 4MGVA 4LAYA 1Q6UA 1WNOA 1ZK6A 4Z2KA 1JNTA 1HKJA 3ARSA 1NH6A 2WK2A 2DG3A 3WD0A 1FD9A 3UQBA 3RM8A 1FKIA 2ZR5A 4AY1A 2ZQVA 4NSBA 3O5OA 1Q6IA 4TYOA 3B7XA 4Z2GA 2DT2A 1ZU8A 3AS3A 2RUDA 1Q6HA 4IQCA 5DEZA 2Y78A 3FAPA 4U85A 3WKZA 3O5RA 2ITKA 3OA5A 3ARWA 4MNJA 4WKAA 3RFWA 2XP5A 4LGXA 2ZR4A 3O5QA 4LAWA 1FKLA 3WL0A 2XP9A 2KE0A 4Z2HA 3FY1A 4ODOA 4Q7NA 2DSWA 2FKEA 3CHCA 5GPRA 3PRAA 1YW5A 4O2TA 2PV1A 1E15A 1N1AA 3ARRA 4TW6A 2DSVA 1NWTA 3WH0A 3BXWA 1D7IA 4QT3A 3KCEA 3ARPA 1E9LA 3IHZA 3RGCA 3UQAA 4DWSB 2D9FA 3WD2A 1TCOC 2A3BA 3JYMA 5HW8A 1UR9A 4ODQA 1NMVA 2IUZA 4IT6A 2AWGA 4NNRA 4MNKA 4TW8A 2MLXA 3TC5A 3ARUA 4ODKA 4DRPA 2DSUA 2PPOA 4U84A 3B9AA 3NRKA 2KO7A 3UQIA 4BF8A 3O5KA 3GPKA 4LAXA 1W1PA 1D6OA 2QF8A 2DSZA 1FKKA 2MNTA 4DRHA 3G6MA 2RQSA 3CGNA 4R5EA 1ROUA 2B31A 1LL6A 2RUCA 3ARQA 3ODKA 4KQZA 4P8XA 1J6YA 1E6NA 3RM9A 2OLHA 3ARVA 1FKSA 4JFJA 4TX0A 2LKNA 1HKKA 1W26A 2L2SA 4WKFA 2A3AA 2ESCA 4HARA 4N19A 4QT2A 1GOIA 2VCDA 4MAVA 4ODPA 1JNSA 4P8VA 4P8WA 4WIWA 2M1IA 4NZCA 4URIA 1W1VA 1J4RA 1LQ0A 3B9DA 3CHFA 5HUAA 3IK8A 1M5YA 4DROA 2KI3A 1R9HA 3RM4A 1JNEA 2A3CA 4Z2IA 2MLZA 5HW6A 1FJDA 3O5MA 4DRMA 3KABA 2FDMA 2DT0A 4ZPVR 3PRBA 4GIVA 4MTVA 2LJ4A 1J4HA 1OGGA 3AS1A 1ZBWA 2XP3A 3WL1A 3JXVA 3O5EA 1EHNA 3ARTA 3QOKA 2N87A 1X6NA 1OWQA 2DT1A 2PI6A 2ZQTA 4DRJA 1HXVA 1PINA 5GQBA 5HBFA 3MDYB 3WD1A 1QPLA 1FFRA 3I6CA 2WLZA 1F8AB 4Q22A 1W9UA 4XAKA 1H0IA 2G8ZA 5J6EA 3W4RA 1ZBVA 1W1TA 3FXYA 1XRVA 2MLYA 1FKHA 4MNLA 4FN2A 1K9TA 1LG1A 1PBKA 4TNSA 3AQUA 2MF9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RUC A;  3ODK A;  1FKJ A;  2K8I A;  1JVW A;  4ODM A;  3UI4 A;  3CGM A;  1KT1 A;  1J6Y A;  4DH0 A;  1D7J A;  2ZR6 A;  4DZ3 A;  5HWC A;  1Y0O A;  4ODR A;  1FKS A;  4JFJ A;  5D75 A;  5DIV A;  4TX0 A;  2LKN A;  1W26 A;  1NSG A;  2L2S A;  4MGV A;  1A7X A;  4LAY A;  1ROT A;  3TDB A;  1Q6U A;  1ZK6 A;  2ZQS A;  1JNT A;  2PBC A;  4N19 A;  2PPP A;  4QT2 A;  5BXJ A;  4FAP A;  2VCD A;  2DG9 A;  2F21 A;  3O5P A;  3O5F A;  4ODP A;  1FAP A;  1Q1C A;  1JNS A;  1FKD A;  2DG3 A;  2M1I A;  1FD9 A;  3UQB A;  3PA7 A;  1FKI A;  2ZR5 A;  2VN1 A;  2KFW A;  5HTG A;  1J4R A;  2ZQV A;  4W9P A;  3O5O A;  1EYM A;  1Q6I A;  3PRD A;  4TYO A;  3B7X A;  1EQ3 A;  4J4O A;  1B6C A;  2MPH A;  2UZ5 A;  1KT0 A;  5HUA A;  3IK8 A;  1M5Y A;  2RUD A;  4DRO A;  4JFL A;  1Q6H A;  2KI3 A;  3NI6 A;  4IQC A;  3UI6 A;  2Y78 A;  3FAP A;  4U85 A;  3O5R A;  4GGQ A;  2ITK A;  1FKT A;  1R9H A;  2LGO A;  3RFW A;  2IF4 A;  5HW7 A;  2XP5 A;  3O5D A;  2ZR4 A;  5HWB A;  2LPV A;  2KR7 A;  3O5Q A;  2RUR A;  4LAW A;  1FKL A;  1FKF A;  1BKF A;  4DRQ A;  2MLZ A;  2XP9 A;  2KE0 A;  5HW6 A;  4W9Q A;  4ODO A;  1FJD A;  3EY6 A;  3O5M A;  4DRM A;  2XP4 A;  3KAB A;  4JFK A;  3O5L A;  1FKG A;  2FKE A;  4DRN A;  4U86 A;  2DG4 A;  1D7H A;  2PV2 A;  3UF8 A;  1U79 A;  3PRB A;  4IPX A;  4GIV A;  4LAV A;  1YW5 A;  4O2T A;  2LJ4 A;  1J4H A;  1FKB A;  2M08 A;  4ODL A;  5I98 A;  3H9R B;  4J4N A;  4ODN A;  2PV1 A;  3LUO A;  4ITZ A;  1T11 A;  4TW7 A;  1N1A A;  1QZ2 A;  3WH0 A;  4TW6 A;  4C02 B;  4DRK A;  1L1P A;  1D7I A;  2XP3 A;  2F2D A;  2FAP A;  4QT3 A;  3JXV A;  3KCE A;  2ZQU A;  4JYS A;  3O5E A;  1YAT A;  5DIU A;  3IHZ A;  2PPN A;  3RGC A;  3UI5 A;  5DIT A;  3TCZ A;  3KZ7 A;  3UQA A;  3O5I A;  4QIB A;  4IQ2 A;  2D9F A;  4DRI A;  1TCO C;  3KAC A;  2N87 A;  1FKR A;  1P5Q A;  3O5G A;  3JYM A;  5HW8 A;  3KAH A;  5HT1 A;  1BL4 A;  3IKG A;  4ODQ A;  1QPF A;  3KAI A;  2ZQT A;  4DRJ A;  1NMV A;  1HXV A;  1PIN A;  2AWG A;  2XPA A;  4NNR A;  3MDY B;  1QPL A;  4TW8 A;  2MLX A;  1J4I A;  2XP8 A;  2XP6 A;  4G2P A;  3JYJ A;  3KAG A;  3TC5 A;  4DIP A;  5B8I C;  4ODK A;  4DRP A;  3I6C A;  1F8A B;  1ZCN A;  2PPO A;  1F40 A;  4U84 A;  2KGJ A;  3NRK A;  2KO7 A;  5HKG A;  3UQI A;  3VAW A;  4BF8 A;  5J6E A;  1C9H A;  3O5K A;  3GPK A;  3IKD A;  1NMW A;  4LAX A;  3OOB A;  3KAF A;  2OFN A;  2XP7 A;  1D6O A;  2MLY A;  5GPG A;  4G50 A;  2PV3 A;  3NTP A;  1FKH A;  4JFM A;  4MSP A;  2F4E A;  2XPB A;  4JFI A;  4FN2 A;  4W9O A;  3KAD A;  2RSE A;  2RUQ A;  4R0X A;  2Q5A A;  1FKK A;  1PBK A;  2MNT A;  4DRH A;  4TNS A;  2JZV A;  2M2A A;  2RQS A;  3O5J A;  3CGN A;  4DT4 A;  4DZ2 A;  1ROU A;  2MF9 A; 
#chains in the Genus database with same CATH topology
 4WKH A;  3CGM A;  1HKM A;  1IX5 A;  1D7J A;  5HWC A;  4ODR A;  5DF0 A;  3TDB A;  1A7X A;  1EDQ A;  1ROT A;  2PBC A;  2PPP A;  4FAP A;  1E6R A;  2DG9 A;  3O5F A;  1FKD A;  4S3J A;  2KFW A;  4HBO A;  3ARY A;  1NWU A;  1B6C A;  3WQW A;  1WAW A;  4JFL A;  4S3K A;  2LGO A;  2LPV A;  1JND A;  4DRQ A;  1E44 A;  4W9Q A;  1O6I A;  3EY6 A;  2XP4 A;  4JFK A;  1FKG A;  4DRN A;  4U86 A;  2DG4 A;  2PV2 A;  3WQV A;  1FKB A;  2M08 A;  3ALG A;  4HBE A;  4J4N A;  4ODN A;  3LUO A;  4ITZ A;  4TW7 A;  1QZ2 A;  1L1P A;  4C02 B;  3ALF A;  2FAP A;  4JYS A;  1YAT A;  5DIU A;  3UI5 A;  1X6L A;  1D2K A;  4IQ2 A;  4ZPW R;  3KAC A;  1FKR A;  3O5G A;  1CTN A;  2A3E A;  2G41 A;  3IKG A;  3WD4 A;  1QPF A;  4MPK A;  3G6L A;  4MNM A;  4IT4 A;  2O92 A;  1GUV A;  2XP6 A;  3JYJ A;  1GPF A;  3KAG A;  4DIP A;  1ZCN A;  1F40 A;  1W9V A;  1HKI A;  1NWR A;  3CZ8 A;  1HJW A;  1LL7 A;  4ZPT R;  5JH8 A;  3IKD A;  4DWS D;  3KAF A;  2O9O A;  2XPB A;  4KR0 B;  5DO2 A;  4JFI A;  1ZL1 A;  4W9O A;  3WD3 A;  2RSE A;  2RUQ A;  4R0X A;  2M2A A;  3O5J A;  4DZ2 A;  4L72 B;  2P4V A;  1NWS A;  1SR0 A;  3CHD A;  4ODM A;  1FKJ A;  2K8I A;  1KT1 A;  2ZR6 A;  4DZ3 A;  4ML4 A;  3B8S A;  5DIV A;  2ZQS A;  1VF8 A;  5BXJ A;  1E6Z A;  4WK9 A;  2F21 A;  3O5P A;  1FAP A;  1Q1C A;  1XHG A;  3PA7 A;  1LL4 A;  5HTG A;  2VN1 A;  4W9P A;  3PRD A;  1EYM A;  1EQ3 A;  2DPE A;  4J4O A;  2MPH A;  2UZ5 A;  2YBT A;  1KT0 A;  1OGB A;  3B9E A;  3NI6 A;  3UI6 A;  1KFW A;  2PN0 A;  4GGQ A;  1FKT A;  5HW7 A;  2IF4 A;  5HWB A;  3O5D A;  1UR8 A;  2DT3 A;  2KR7 A;  2RUR A;  4ZS6 A;  1BKF A;  1FKF A;  3ARZ A;  3ARX A;  3CH9 A;  4WJX A;  1W1Y A;  2EUL A;  3O5L A;  1D7H A;  3UF8 A;  1U79 A;  4IPX A;  1FFQ A;  2YBU A;  4LAV A;  4ODL A;  5I98 A;  3H9R B;  1TFV A;  3AS2 A;  4Z2J A;  1T11 A;  4L3N A;  1EIB A;  1SYT A;  4DRK A;  1ZBK A;  2F2D A;  4PTM A;  2ZQU A;  1W9P A;  2PPN A;  4W5U A;  5DIT A;  3TCZ A;  3KZ7 A;  3O5I A;  2WM0 A;  4QIB A;  1ITX A;  4DWS A;  4DRI A;  1P5Q A;  3KAH A;  5HT1 A;  4DWS C;  1BL4 A;  3AS0 A;  3KAI A;  4Z2L A;  2XPA A;  4UDM A;  1ZB5 A;  1J4I A;  1HJX A;  2XP8 A;  4G2P A;  5B8I C;  1ZBC A;  3RME A;  1H0G A;  2KGJ A;  3ARO A;  1RD6 A;  1WB0 A;  2WLY A;  4P8U A;  1LJY A;  5HKG A;  3VAW A;  1C9H A;  3PR9 A;  1NMW A;  3OOB A;  3CHE A;  2OFN A;  2XP7 A;  4QZV B;  4G50 A;  2PV3 A;  3NTP A;  5GPG A;  1HJV A;  1LG2 A;  2AOS A;  2F4E A;  4JFM A;  4MSP A;  3WIJ A;  3KAD A;  2Q5A A;  2JZV A;  4DT4 A;  1JVW A;  3UI4 A;  4DH0 A;  1Y0O A;  5D75 A;  1NSG A;  1E6P A;  4MGV A;  4LAY A;  1Q6U A;  1WNO A;  1ZK6 A;  4Z2K A;  1JNT A;  1HKJ A;  3ARS A;  1NH6 A;  2WK2 A;  2DG3 A;  3WD0 A;  1FD9 A;  3UQB A;  3RM8 A;  1FKI A;  2ZR5 A;  4AY1 A;  2ZQV A;  4NSB A;  3O5O A;  1Q6I A;  4TYO A;  3B7X A;  4Z2G A;  2DT2 A;  1ZU8 A;  3AS3 A;  2RUD A;  1Q6H A;  4IQC A;  5DEZ A;  2Y78 A;  3FAP A;  4U85 A;  3WKZ A;  3O5R A;  2ITK A;  3OA5 A;  3ARW A;  4MNJ A;  4WKA A;  3RFW A;  2ETN A;  2XP5 A;  2ZR4 A;  4LGX A;  3O5Q A;  4LAW A;  1FKL A;  3WL0 A;  2XP9 A;  2KE0 A;  4Z2H A;  3FY1 A;  4ODO A;  4Q7N A;  2DSW A;  2FKE A;  3CHC A;  5GPR A;  3PRA A;  1YW5 A;  4O2T A;  2PV1 A;  1E15 A;  1N1A A;  3ARR A;  4TW6 A;  2DSV A;  1NWT A;  3WH0 A;  3BXW A;  1D7I A;  4QT3 A;  3KCE A;  3ARP A;  1E9L A;  3IHZ A;  3RGC A;  3UQA A;  4DWS B;  2D9F A;  3WD2 A;  1TCO C;  2A3B A;  3JYM A;  5HW8 A;  1UR9 A;  4ODQ A;  1NMV A;  2IUZ A;  4IT6 A;  2AWG A;  4NNR A;  4MNK A;  4TW8 A;  2MLX A;  1JCH B;  3TC5 A;  3ARU A;  4ODK A;  4DRP A;  2DSU A;  2PPO A;  4U84 A;  3B9A A;  3NRK A;  2KO7 A;  3UQI A;  4BF8 A;  3O5K A;  3GPK A;  4LAX A;  1W1P A;  1D6O A;  2QF8 A;  2DSZ A;  1FKK A;  2MNT A;  4DRH A;  3G6M A;  2RQS A;  3CGN A;  4R5E A;  1ROU A;  2B31 A;  1LL6 A;  2RUC A;  3ARQ A;  3ODK A;  4KQZ A;  4P8X A;  1J6Y A;  1E6N A;  3RM9 A;  2OLH A;  3ARV A;  1FKS A;  4JFJ A;  4TX0 A;  2LKN A;  1HKK A;  1W26 A;  2L2S A;  4WKF A;  2A3A A;  2ESC A;  4HAR A;  4N19 A;  4QT2 A;  1GOI A;  2VCD A;  4MAV A;  4ODP A;  1JNS A;  4P8V A;  4P8W A;  4WIW A;  2M1I A;  4NZC A;  4URI A;  3EIP A;  1W1V A;  1J4R A;  1LQ0 A;  3B9D A;  3CHF A;  5HUA A;  3IK8 A;  1M5Y A;  4DRO A;  2KI3 A;  1R9H A;  3RM4 A;  1JNE A;  2A3C A;  4Z2I A;  2MLZ A;  5HW6 A;  1FJD A;  3O5M A;  4DRM A;  3KAB A;  2F23 A;  2FDM A;  2DT0 A;  4ZPV R;  3PRB A;  4GIV A;  4MTV A;  2LJ4 A;  1J4H A;  1OGG A;  3AS1 A;  1GRJ A;  1ZBW A;  2XP3 A;  3WL1 A;  3JXV A;  3O5E A;  1EHN A;  3ART A;  3QOK A;  2N87 A;  1X6N A;  1OWQ A;  2DT1 A;  2PI6 A;  2ZQT A;  4DRJ A;  1HXV A;  1PIN A;  2B5U B;  5GQB A;  5HBF A;  3MDY B;  3WD1 A;  1QPL A;  1FFR A;  3I6C A;  2WLZ A;  1F8A B;  4Q22 A;  1W9U A;  4XAK A;  1H0I A;  2G8Z A;  5J6E A;  3W4R A;  1ZBV A;  1W1T A;  3FXY A;  1XRV A;  2MLY A;  1FKH A;  4MNL A;  4FN2 A;  1K9T A;  1LG1 A;  1PBK A;  3GU0 A;  4TNS A;  3BMB A;  3AQU A;  3GTY X;  2MF9 A; 
#chains in the Genus database with same CATH homology
 4WKH A;  3CGM A;  1HKM A;  1IX5 A;  1D7J A;  5HWC A;  4ODR A;  5DF0 A;  3TDB A;  1A7X A;  1EDQ A;  1ROT A;  2PBC A;  2PPP A;  4FAP A;  1E6R A;  2DG9 A;  3O5F A;  1FKD A;  4S3J A;  2KFW A;  4HBO A;  3ARY A;  1NWU A;  1B6C A;  3WQW A;  1WAW A;  4JFL A;  4S3K A;  2LGO A;  2LPV A;  1JND A;  4DRQ A;  4W9Q A;  1O6I A;  3EY6 A;  2XP4 A;  4JFK A;  1FKG A;  4DRN A;  4U86 A;  2DG4 A;  2PV2 A;  3WQV A;  1FKB A;  2M08 A;  3ALG A;  4HBE A;  4J4N A;  4ODN A;  3LUO A;  4ITZ A;  4TW7 A;  1QZ2 A;  1L1P A;  4C02 B;  3ALF A;  2FAP A;  4JYS A;  1YAT A;  5DIU A;  3UI5 A;  1X6L A;  1D2K A;  4IQ2 A;  4ZPW R;  3KAC A;  1FKR A;  3O5G A;  1CTN A;  2A3E A;  2G41 A;  3IKG A;  3WD4 A;  1QPF A;  4MPK A;  3G6L A;  4MNM A;  4IT4 A;  2O92 A;  1GUV A;  2XP6 A;  3JYJ A;  1GPF A;  3KAG A;  4DIP A;  1ZCN A;  1F40 A;  1W9V A;  1HKI A;  1NWR A;  3CZ8 A;  1HJW A;  1LL7 A;  4ZPT R;  5JH8 A;  3IKD A;  4DWS D;  3KAF A;  2O9O A;  2XPB A;  4KR0 B;  5DO2 A;  4JFI A;  1ZL1 A;  4W9O A;  3WD3 A;  2RSE A;  2RUQ A;  4R0X A;  2M2A A;  3O5J A;  4DZ2 A;  4L72 B;  1NWS A;  1SR0 A;  3CHD A;  4ODM A;  1FKJ A;  2K8I A;  1KT1 A;  2ZR6 A;  4DZ3 A;  4ML4 A;  3B8S A;  5DIV A;  2ZQS A;  1VF8 A;  5BXJ A;  1E6Z A;  4WK9 A;  2F21 A;  3O5P A;  1FAP A;  1Q1C A;  1XHG A;  3PA7 A;  1LL4 A;  5HTG A;  2VN1 A;  4W9P A;  3PRD A;  1EYM A;  1EQ3 A;  2DPE A;  4J4O A;  2MPH A;  2UZ5 A;  2YBT A;  1KT0 A;  1OGB A;  3B9E A;  3NI6 A;  3UI6 A;  1KFW A;  4GGQ A;  1FKT A;  5HW7 A;  2IF4 A;  5HWB A;  3O5D A;  1UR8 A;  2DT3 A;  2KR7 A;  2RUR A;  4ZS6 A;  1BKF A;  1FKF A;  3ARZ A;  3ARX A;  3CH9 A;  4WJX A;  1W1Y A;  3O5L A;  1D7H A;  3UF8 A;  1U79 A;  4IPX A;  1FFQ A;  2YBU A;  4LAV A;  4ODL A;  5I98 A;  3H9R B;  1TFV A;  3AS2 A;  4Z2J A;  1T11 A;  4L3N A;  1EIB A;  1SYT A;  4DRK A;  1ZBK A;  2F2D A;  4PTM A;  2ZQU A;  1W9P A;  2PPN A;  4W5U A;  5DIT A;  3TCZ A;  3KZ7 A;  3O5I A;  2WM0 A;  4QIB A;  1ITX A;  4DWS A;  4DRI A;  1P5Q A;  3KAH A;  5HT1 A;  4DWS C;  1BL4 A;  3AS0 A;  3KAI A;  4Z2L A;  2XPA A;  1ZB5 A;  1J4I A;  1HJX A;  2XP8 A;  4G2P A;  5B8I C;  1ZBC A;  3RME A;  1H0G A;  2KGJ A;  3ARO A;  1RD6 A;  1WB0 A;  2WLY A;  4P8U A;  1LJY A;  5HKG A;  3VAW A;  1C9H A;  3PR9 A;  1NMW A;  3OOB A;  3CHE A;  2OFN A;  2XP7 A;  4QZV B;  4G50 A;  2PV3 A;  3NTP A;  5GPG A;  1HJV A;  1LG2 A;  2AOS A;  2F4E A;  4JFM A;  4MSP A;  3WIJ A;  3KAD A;  2Q5A A;  2JZV A;  4DT4 A;  1JVW A;  3UI4 A;  4DH0 A;  1Y0O A;  5D75 A;  1NSG A;  1E6P A;  4MGV A;  4LAY A;  1Q6U A;  1WNO A;  1ZK6 A;  4Z2K A;  1JNT A;  1HKJ A;  3ARS A;  1NH6 A;  2WK2 A;  2DG3 A;  3WD0 A;  1FD9 A;  3UQB A;  3RM8 A;  1FKI A;  2ZR5 A;  4AY1 A;  2ZQV A;  4NSB A;  3O5O A;  1Q6I A;  4TYO A;  3B7X A;  4Z2G A;  2DT2 A;  1ZU8 A;  3AS3 A;  2RUD A;  1Q6H A;  4IQC A;  5DEZ A;  2Y78 A;  3FAP A;  4U85 A;  3WKZ A;  3O5R A;  2ITK A;  3OA5 A;  3ARW A;  4MNJ A;  4WKA A;  3RFW A;  2XP5 A;  4LGX A;  2ZR4 A;  3O5Q A;  4LAW A;  1FKL A;  3WL0 A;  2XP9 A;  2KE0 A;  4Z2H A;  3FY1 A;  4ODO A;  4Q7N A;  2DSW A;  2FKE A;  3CHC A;  5GPR A;  3PRA A;  1YW5 A;  4O2T A;  2PV1 A;  1E15 A;  1N1A A;  3ARR A;  4TW6 A;  2DSV A;  1NWT A;  3WH0 A;  3BXW A;  1D7I A;  4QT3 A;  3KCE A;  3ARP A;  1E9L A;  3IHZ A;  3RGC A;  3UQA A;  4DWS B;  2D9F A;  3WD2 A;  1TCO C;  2A3B A;  3JYM A;  5HW8 A;  1UR9 A;  4ODQ A;  1NMV A;  2IUZ A;  4IT6 A;  2AWG A;  4NNR A;  4MNK A;  4TW8 A;  2MLX A;  3TC5 A;  3ARU A;  4ODK A;  4DRP A;  2DSU A;  2PPO A;  4U84 A;  3B9A A;  3NRK A;  2KO7 A;  3UQI A;  4BF8 A;  3O5K A;  3GPK A;  4LAX A;  1W1P A;  1D6O A;  2QF8 A;  2DSZ A;  1FKK A;  2MNT A;  4DRH A;  3G6M A;  2RQS A;  3CGN A;  4R5E A;  1ROU A;  2B31 A;  1LL6 A;  2RUC A;  3ARQ A;  3ODK A;  4KQZ A;  4P8X A;  1J6Y A;  1E6N A;  3RM9 A;  2OLH A;  3ARV A;  1FKS A;  4JFJ A;  4TX0 A;  2LKN A;  1HKK A;  1W26 A;  2L2S A;  4WKF A;  2A3A A;  2ESC A;  4HAR A;  4N19 A;  4QT2 A;  1GOI A;  2VCD A;  4MAV A;  4ODP A;  1JNS A;  4P8V A;  4P8W A;  4WIW A;  2M1I A;  4NZC A;  4URI A;  1W1V A;  1J4R A;  1LQ0 A;  3B9D A;  3CHF A;  5HUA A;  3IK8 A;  1M5Y A;  4DRO A;  2KI3 A;  1R9H A;  3RM4 A;  1JNE A;  2A3C A;  4Z2I A;  2MLZ A;  5HW6 A;  1FJD A;  3O5M A;  4DRM A;  3KAB A;  2FDM A;  2DT0 A;  4ZPV R;  3PRB A;  4GIV A;  4MTV A;  2LJ4 A;  1J4H A;  1OGG A;  3AS1 A;  1ZBW A;  2XP3 A;  3WL1 A;  3JXV A;  3O5E A;  1EHN A;  3ART A;  3QOK A;  2N87 A;  1X6N A;  1OWQ A;  2DT1 A;  2PI6 A;  2ZQT A;  4DRJ A;  1HXV A;  1PIN A;  5GQB A;  5HBF A;  3MDY B;  3WD1 A;  1QPL A;  1FFR A;  3I6C A;  2WLZ A;  1F8A B;  4Q22 A;  1W9U A;  4XAK A;  1H0I A;  2G8Z A;  5J6E A;  3W4R A;  1ZBV A;  1W1T A;  3FXY A;  1XRV A;  2MLY A;  1FKH A;  4MNL A;  4FN2 A;  1K9T A;  1LG1 A;  1PBK A;  4TNS A;  3AQU A;  2MF9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...