3UQIA

Crystallographic structure of fkbp12 from aedes aegypti
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
108
structure length
108
Chain Sequence
b'MGVQVVTLAAGDEATYPKAGQVAVVHYTGTLADGKVFDSSRTRGKPFRFTVGRGEVIRGWDEGVAQMSVGQRAKLVCSPDYAYGSRGHPGVIPPNATLTFDVELLRVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase
publication title High-resolution crystal structure of FKBP12 from Aedes aegypti.
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Isomerase
total genus 26
structure length 108
sequence length 108
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2011-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3uqiA00
1Y0OA 4DH0A 3O5JA 4NNRA 2M1IA 4O2TA 5HW6A 2M08A 2RSEA 4DZ2A 1N1AA 2Q5AA 4ODQA 1EYMA 2DG9A 2OFNA 3OOBA 3KAFA 2FAPA 3KACA 3O5DA 1JVWA 3KABA 4ODKA 2F21A 2ZQSA 3O5FA 2MLYA 2KFWA 1ROUA 2PPPA 4IPXA 4LAYA 1C9HA 2KO7A 2RUDA 1M5YA 1TCOC 3O5EA 5B8IC 1HXVA 3PRBA 4TX0A 4QT2A 1FKDA 3UF8A 1YW5A 1FKHA 1FKFA 4DZ3A 4DRMA 4DROA 2PV3A 3O5RA 4MGVA 4DIPA 1NMWA 1PBKA 2VCDA 5BXJA 1FKJA 1L1PA 3MDYB 4DRPA 2LJ4A 2MNTA 3B7XA 2FKEA 3IK8A 4QT3A 1NMVA 3JYMA 3ODKA 1EQ3A 4U85A 5DIVA 1U79A 3IKGA 5HT1A 4J4NA 3UQAA 3UI4A 4DRHA 2ZQVA 4QIBA 3KAIA 3GPKA 2ZQTA 2KR7A 3O5QA 1JNTA 4DRNA 1FAPA 1F8AB 2LGOA 4TYOA 1FKBA 1FKIA 5HWBA 2ZQUA 3CGNA 3KAHA 3O5IA 4JFMA 1FKTA 3FAPA 2F2DA 3UI6A 4IQ2A 2IF4A 2N87A 1P5QA 3O5GA 3WH0A 3CGMA 1Q6UA 4JFKA 3IHZA 2XPBA 4TNSA 4BF8A 1QPLA 5HW8A 3O5PA 4LAXA 2ITKA 4FAPA 4DRJA 3UI5A 2M2AA 1FJDA 4JFIA 2L2SA 1J4RA 2RUQA 1FKKA 1NSGA 4FN2A 2F4EA 3NTPA 5D75A 4ITZA 2LKNA 5HKGA 4DRIA 1J6YA 2PPOA 4J4OA 1QPFA 1W26A 4LAWA 1D7JA 3UQBA 5J6EA 5HWCA 1A7XA 2DG4A 4ODNA 4IQCA 4DRKA 2XP9A 2ZR5A 1KT0A 4ODLA 3TDBA 4JFLA 2KI3A 4ODMA 2JZVA 2UZ5A 2XPAA 1FKGA 5HUAA 2VN1A 1PINA 2MLXA 2K8IA 4TW8A 1D7IA 4DRQA 5HTGA 2LPVA 3O5KA 3PA7A 4R0XA 2XP4A 1B6CA 1T11A 4N19A 1ROTA 4GGQA 4TW6A 4U84A 3RFWA 1BL4A 2MF9A 1Q1CA 2PBCA 2XP8A 3O5LA 1FKRA 3I6CA 5GPGA 4MSPA 3KADA 4JYSA 3O5MA 3NRKA 5DITA 4C02B 3PRDA 1F40A 1Q6HA 1D7HA 3VAWA 3KAGA 3NI6A 3JXVA 1JNSA 1BKFA 4W9QA 3IKDA 4TW7A 1YATA 2MLZA 1R9HA 2RUCA 2Y78A 4W9OA 4JFJA 4ODPA 1J4HA 2RQSA 4U86A 5DIUA 3JYJA 3RGCA 1D6OA 2KE0A 2AWGA 3KZ7A 3LUOA 3KCEA 4LAVA 4W9PA 5I98A 1FKSA 1QZ2A 4DT4A 2XP7A 3H9RB 3EY6A 1ZCNA 3TCZA 1Q6IA 2PV2A 2RURA 3UQIA 4G50A 2PPNA 2XP6A 4ODRA 2PV1A 3O5OA 2ZR4A 1KT1A 3TC5A 4GIVA 5HW7A 2XP3A 2ZR6A 2KGJA 1J4IA 1FKLA 2DG3A 4ODOA 2MPHA 1FD9A 4G2PA 1ZK6A 2XP5A 2D9FA
chains in the Genus database with same CATH superfamily
3O5JA 1E15A 2M1IA 4O2TA 5HW6A 2M08A 2Q5AA 3CHFA 4ZPWR 5DO2A 2OFNA 3OOBA 3KACA 4ODKA 4Z2HA 2F21A 1GOIA 4ML4A 1ROUA 4LAYA 1C9HA 1M5YA 3O5EA 3WQWA 3PRBA 4DZ3A 4DRMA 4DROA 2PV3A 1EDQA 1NMWA 1PBKA 2P4VA 5BXJA 1FKJA 3BMBA 4QT3A 4WIWA 3JYMA 1SYTA 2G8ZA 1KFWA 3UQAA 4DRHA 3KAIA 2ZQTA 3O5QA 1FAPA 1F8AB 2LGOA 4P8UA 1NH6A 3CGNA 3O5IA 3CH9A 4W5UA 3O5GA 3WH0A 3CGMA 4DWSB 4JFKA 1ZBWA 3OA5A 1QPLA 2DT0A 1UR9A 1O6IA 1FKKA 3ARRA 2F4EA 3NTPA 5D75A 4ITZA 2LKNA 2F23A 4MPKA 3AS1A 2PPOA 1J6YA 3UQBA 5HWCA 4ODNA 4URIA 3ARZA 4DRKA 1KT0A 2KI3A 2XPAA 1PINA 1E6RA 2K8IA 2DT2A 3O5KA 2XP4A 1B6CA 1T11A 4GGQA 3O5LA 3ARUA 4HBEA 1XRVA 3I6CA 3O5MA 2B5UB 3PRDA 3VAWA 1D7HA 3NI6A 1JNSA 4WKAA 1OGBA 3IKDA 3AROA 2MLZA 1R9HA 4U86A 1J4HA 4IT6A 1X6NA 4DT4A 4Z2LA 2XP7A 4WJXA 1HJWA 1ZCNA 3TCZA 4DWSD 1W9VA 3WD4A 4G50A 3G6LA 2XP6A 1ZB5A 3TC5A 1J4IA 4ODOA 3ARQA 1FD9A 1CTNA 1ZK6A 4TYOA 2D9FA 1Y0OA 4DH0A 4Z2GA 4LGXA 2RSEA 3WD1A 4DZ2A 1LG1A 2O92A 4ODQA 1EYMA 4AY1A 1NWUA 2OLHA 4S3JA 3KAFA 3O5FA 3AS2A 2KFWA 4PTMA 5HBFA 1ZBKA 1HXVA 1YW5A 1FKFA 4MGVA 2VCDA 2A3CA 2DSWA 1X6LA 4ZS6A 2MNTA 4U85A 1GPFA 1H0IA 3UI4A 2DSUA 3WIJA 3WL0A 2WLYA 1LQ0A 4JFMA 3FAPA 2F2DA 3UI6A 4KR0B 5GPRA 2N87A 1P5QA 2ETNA 3EIPA 1GRJA 1ZBCA 2A3AA 4MNMA 4FAPA 1EIBA 2M2AA 4JFIA 1ITXA 2A3BA 4DRIA 1W26A 4DWSC 1A7XA 1EHNA 2XP9A 3TDBA 2WK2A 4P8XA 5HUAA 1FKGA 2VN1A 2FDMA 5JH8A 3ARTA 4R0XA 3WQVA 4N19A 1ROTA 4WK9A 1BL4A 1HKJA 4S3KA 3CHDA 1TFVA 5GPGA 4JYSA 4XAKA 1SR0A 3WD3A 5DITA 4C02B 1F40A 4WKFA 3JXVA 2PN0A 2Y78A 4R5EA 4JFJA 3RGCA 5DIUA 1WNOA 1H0GA 3LUOA 4LAVA 3ALFA 5I98A 1Q6IA 2RURA 3UQIA 1FFQA 2PV1A 1KT1A 2ZR6A 1ZL1A 2DG3A 4UDMA 2YBUA 2ZQUA 3QOKA 1D2KA 4NNRA 4MNKA 2A3EA 1NWSA 1N1AA 3CZ8A 1RD6A 4L72B 2FAPA 3PR9A 1JVWA 2DT3A 3KABA 2KO7A 4DWSA 1HKKA 1TCOC 2RUDA 1HJXA 5B8IC 4TX0A 4QT2A 3UF8A 1FKHA 5GQBA 3RMEA 3MDYB 1JCHB 2IUZA 2LJ4A 3B7XA 2FKEA 1NMVA 1EQ3A 5DIVA 3B9DA 3IKGA 3B9AA 5HT1A 1XHGA 4QIBA 3GPKA 2KR7A 1JNEA 1JNTA 2B31A 5HWBA 1ZU8A 4IQ2A 2IF4A 3AS0A 1Q6UA 1FFRA 3IHZA 2XPBA 3O5PA 4LAXA 2ITKA 3UI5A 4ZPVR 1HJVA 2RUQA 3AS3A 1NSGA 4MNLA 4QZVB 1D7JA 3WD0A 4IQCA 2ZR5A 4ODLA 4Q22A 4JFLA 2DPEA 4ODMA 2JZVA 3RM8A 2MLXA 4DRQA 5HTGA 3GTYX 4U84A 5DEZA 1FKRA 2PBCA 4NSBA 1W1YA 4NZCA 4MSPA 3NRKA 3B8SA 1BKFA 1OGGA 3ARXA 2PI6A 4TW7A 4Z2KA 2O9OA 3BXWA 3PRAA 2RQSA 3WKZA 3FY1A 1LL7A 2KE0A 1LL6A 1NWRA 4KQZA 5DF0A 1FKSA 1LJYA 3ARWA 1W1PA 2PV2A 1GUVA 2PPNA 1VF8A 4MAVA 1E6NA 1OWQA 2XP3A 2KGJA 1E6ZA 2MPHA 3ARSA 2DSZA 2XP5A 4MTVA 2DG9A 1HKMA 3O5DA 4P8WA 2ESCA 2ZQSA 2MLYA 2PPPA 4IPXA 1W9PA 4Q7NA 2DT1A 1FKDA 1E9LA 3GU0A 3O5RA 2WM0A 4DIPA 1W1TA 1L1PA 4HBOA 3RM4A 4DRPA 3IK8A 2G41A 3FXYA 3ODKA 1E44A 1UR8A 1U79A 4WKHA 4J4NA 3CHEA 2QF8A 2ZQVA 3ALGA 4DRNA 1LG2A 1LL4A 3AQUA 1FKBA 1FKIA 3KAHA 1FKTA 1NWTA 1K9TA 1IX5A 2WLZA 4TNSA 4BF8A 3B9EA 5HW8A 4DRJA 1FJDA 4P8VA 2L2SA 3ARVA 1J4RA 4FN2A 5HKGA 4J4OA 1QPFA 4LAWA 1E6PA 5J6EA 2DG4A 1HKIA 3RM9A 4L3NA 2UZ5A 1ZBVA 4ZPTR 4TW8A 1D7IA 2LPVA 3PA7A 1JNDA 3ARYA 3RFWA 4TW6A 2MF9A 3CHCA 1Q1CA 2XP8A 1W1VA 2YBTA 4Z2IA 3KADA 3WL1A 1Q6HA 3KAGA 4HARA 2DSVA 4W9QA 1YATA 2RUCA 4W9OA 4ODPA 3JYJA 1WB0A 4IT4A 1W9UA 1D6OA 2AWGA 3KZ7A 4Z2JA 3KCEA 3ARPA 2EULA 4W9PA 1QZ2A 3H9RB 3EY6A 1WAWA 3W4RA 2AOSA 3WD2A 4MNJA 4ODRA 3O5OA 2ZR4A 4GIVA 5HW7A 1FKLA 4G2PA 3G6MA
chains in the Genus database with same CATH topology
3O5JA 1E15A 2M1IA 4O2TA 5HW6A 2M08A 2Q5AA 3CHFA 4ZPWR 5DO2A 2OFNA 3OOBA 3KACA 4ODKA 4Z2HA 2F21A 1GOIA 4ML4A 1ROUA 4LAYA 1C9HA 1M5YA 3O5EA 3WQWA 3PRBA 4DZ3A 4DRMA 4DROA 2PV3A 1EDQA 1NMWA 1PBKA 5BXJA 1FKJA 4QT3A 4WIWA 3JYMA 1SYTA 2G8ZA 1KFWA 3UQAA 4DRHA 3KAIA 2ZQTA 3O5QA 1FAPA 1F8AB 2LGOA 4P8UA 1NH6A 3CGNA 3O5IA 3CH9A 4W5UA 3O5GA 3WH0A 3CGMA 4DWSB 4JFKA 1ZBWA 3OA5A 1QPLA 2DT0A 1UR9A 1O6IA 1FKKA 3ARRA 2F4EA 3NTPA 5D75A 4ITZA 2LKNA 4MPKA 3AS1A 2PPOA 1J6YA 3UQBA 5HWCA 4ODNA 4URIA 3ARZA 4DRKA 1KT0A 2KI3A 2XPAA 1PINA 1E6RA 2K8IA 2DT2A 3O5KA 2XP4A 1B6CA 1T11A 4GGQA 3O5LA 3ARUA 4HBEA 1XRVA 3I6CA 3O5MA 3PRDA 3VAWA 1D7HA 3NI6A 1JNSA 4WKAA 1OGBA 3IKDA 3AROA 2MLZA 1R9HA 4U86A 1J4HA 4IT6A 1X6NA 4DT4A 4Z2LA 2XP7A 4WJXA 1HJWA 1ZCNA 3TCZA 4DWSD 1W9VA 3WD4A 4G50A 3G6LA 2XP6A 1ZB5A 3TC5A 1J4IA 4ODOA 3ARQA 1FD9A 1CTNA 1ZK6A 4TYOA 2D9FA 1Y0OA 4DH0A 4Z2GA 4LGXA 2RSEA 3WD1A 4DZ2A 1LG1A 2O92A 4ODQA 1EYMA 4AY1A 1NWUA 2OLHA 4S3JA 3KAFA 3O5FA 3AS2A 2KFWA 4PTMA 5HBFA 1ZBKA 1HXVA 1YW5A 1FKFA 4MGVA 2VCDA 2A3CA 2DSWA 1X6LA 4ZS6A 2MNTA 4U85A 1GPFA 1H0IA 3UI4A 2DSUA 3WIJA 3WL0A 2WLYA 1LQ0A 4JFMA 3FAPA 2F2DA 3UI6A 4KR0B 5GPRA 2N87A 1P5QA 1ZBCA 2A3AA 4MNMA 4FAPA 1EIBA 2M2AA 4JFIA 1ITXA 2A3BA 4DRIA 1W26A 4DWSC 1A7XA 1EHNA 2XP9A 3TDBA 2WK2A 4P8XA 5HUAA 1FKGA 2VN1A 2FDMA 5JH8A 3ARTA 4R0XA 3WQVA 4N19A 1ROTA 4WK9A 1BL4A 1HKJA 4S3KA 3CHDA 1TFVA 5GPGA 4JYSA 4XAKA 1SR0A 3WD3A 5DITA 4C02B 1F40A 4WKFA 3JXVA 2Y78A 4R5EA 4JFJA 3RGCA 5DIUA 1WNOA 1H0GA 3LUOA 4LAVA 3ALFA 5I98A 1Q6IA 2RURA 3UQIA 1FFQA 2PV1A 1KT1A 2ZR6A 1ZL1A 2DG3A 2YBUA 2ZQUA 3QOKA 1D2KA 4NNRA 4MNKA 2A3EA 1NWSA 1N1AA 3CZ8A 1RD6A 4L72B 2FAPA 3PR9A 1JVWA 2DT3A 3KABA 2KO7A 4DWSA 1HKKA 1TCOC 2RUDA 1HJXA 5B8IC 4TX0A 4QT2A 3UF8A 1FKHA 5GQBA 3RMEA 3MDYB 2IUZA 2LJ4A 3B7XA 2FKEA 1NMVA 1EQ3A 5DIVA 3B9DA 3IKGA 3B9AA 5HT1A 1XHGA 4QIBA 3GPKA 2KR7A 1JNEA 1JNTA 2B31A 5HWBA 1ZU8A 4IQ2A 2IF4A 3AS0A 1Q6UA 1FFRA 3IHZA 2XPBA 3O5PA 4LAXA 2ITKA 3UI5A 4ZPVR 1HJVA 2RUQA 3AS3A 1NSGA 4MNLA 4QZVB 1D7JA 3WD0A 4IQCA 2ZR5A 4ODLA 4Q22A 4JFLA 2DPEA 4ODMA 2JZVA 3RM8A 2MLXA 4DRQA 5HTGA 4U84A 5DEZA 1FKRA 2PBCA 4NSBA 1W1YA 4NZCA 4MSPA 3NRKA 3B8SA 1BKFA 1OGGA 3ARXA 2PI6A 4TW7A 4Z2KA 2O9OA 3BXWA 3PRAA 2RQSA 3WKZA 3FY1A 1LL7A 2KE0A 1LL6A 1NWRA 4KQZA 5DF0A 1FKSA 1LJYA 3ARWA 1W1PA 2PV2A 1GUVA 2PPNA 1VF8A 4MAVA 1E6NA 1OWQA 2XP3A 2KGJA 1E6ZA 2MPHA 3ARSA 2DSZA 2XP5A 4MTVA 2DG9A 1HKMA 3O5DA 4P8WA 2ESCA 2ZQSA 2MLYA 2PPPA 4IPXA 1W9PA 4Q7NA 2DT1A 1FKDA 1E9LA 3O5RA 2WM0A 4DIPA 1W1TA 1L1PA 4HBOA 3RM4A 4DRPA 3IK8A 2G41A 3FXYA 3ODKA 1UR8A 1U79A 4WKHA 4J4NA 3CHEA 2QF8A 2ZQVA 3ALGA 4DRNA 1LG2A 1LL4A 3AQUA 1FKBA 1FKIA 3KAHA 1FKTA 1NWTA 1K9TA 1IX5A 2WLZA 4TNSA 4BF8A 3B9EA 5HW8A 4DRJA 1FJDA 4P8VA 2L2SA 3ARVA 1J4RA 4FN2A 5HKGA 4J4OA 1QPFA 4LAWA 1E6PA 5J6EA 2DG4A 1HKIA 3RM9A 4L3NA 2UZ5A 1ZBVA 4ZPTR 4TW8A 1D7IA 2LPVA 3PA7A 1JNDA 3ARYA 3RFWA 4TW6A 2MF9A 3CHCA 1Q1CA 2XP8A 1W1VA 2YBTA 4Z2IA 3KADA 3WL1A 1Q6HA 3KAGA 4HARA 2DSVA 4W9QA 1YATA 2RUCA 4W9OA 4ODPA 3JYJA 1WB0A 4IT4A 1W9UA 1D6OA 2AWGA 3KZ7A 4Z2JA 3KCEA 3ARPA 4W9PA 1QZ2A 3H9RB 3EY6A 1WAWA 3W4RA 2AOSA 3WD2A 4MNJA 4ODRA 3O5OA 2ZR4A 4GIVA 5HW7A 1FKLA 4G2PA 3G6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y0O A;  4DH0 A;  3O5J A;  4NNR A;  2M1I A;  4O2T A;  5HW6 A;  2M08 A;  2RSE A;  4DZ2 A;  1N1A A;  2Q5A A;  4ODQ A;  1EYM A;  2DG9 A;  2OFN A;  3OOB A;  3KAF A;  2FAP A;  3KAC A;  3O5D A;  1JVW A;  3KAB A;  4ODK A;  2F21 A;  2ZQS A;  3O5F A;  2MLY A;  2KFW A;  1ROU A;  2PPP A;  4IPX A;  4LAY A;  1C9H A;  2KO7 A;  2RUD A;  1M5Y A;  1TCO C;  3O5E A;  5B8I C;  1HXV A;  3PRB A;  4TX0 A;  4QT2 A;  1FKD A;  3UF8 A;  1YW5 A;  1FKH A;  1FKF A;  4DZ3 A;  4DRM A;  4DRO A;  2PV3 A;  3O5R A;  4MGV A;  4DIP A;  1NMW A;  1PBK A;  2VCD A;  5BXJ A;  1FKJ A;  1L1P A;  3MDY B;  4DRP A;  2LJ4 A;  2MNT A;  3B7X A;  2FKE A;  3IK8 A;  4QT3 A;  1NMV A;  3JYM A;  3ODK A;  1EQ3 A;  4U85 A;  5DIV A;  1U79 A;  3IKG A;  5HT1 A;  4J4N A;  3UQA A;  3UI4 A;  4DRH A;  2ZQV A;  4QIB A;  3KAI A;  3GPK A;  2ZQT A;  2KR7 A;  3O5Q A;  1JNT A;  4DRN A;  1FAP A;  1F8A B;  2LGO A;  4TYO A;  1FKB A;  1FKI A;  5HWB A;  2ZQU A;  3CGN A;  3KAH A;  3O5I A;  4JFM A;  1FKT A;  3FAP A;  2F2D A;  3UI6 A;  4IQ2 A;  2IF4 A;  2N87 A;  1P5Q A;  3O5G A;  3WH0 A;  3CGM A;  1Q6U A;  4JFK A;  3IHZ A;  2XPB A;  4TNS A;  4BF8 A;  1QPL A;  5HW8 A;  3O5P A;  4LAX A;  2ITK A;  4FAP A;  4DRJ A;  3UI5 A;  2M2A A;  1FJD A;  4JFI A;  2L2S A;  1J4R A;  2RUQ A;  1FKK A;  1NSG A;  4FN2 A;  2F4E A;  3NTP A;  5D75 A;  4ITZ A;  2LKN A;  5HKG A;  4DRI A;  1J6Y A;  2PPO A;  4J4O A;  1QPF A;  1W26 A;  4LAW A;  1D7J A;  3UQB A;  5J6E A;  5HWC A;  1A7X A;  2DG4 A;  4ODN A;  4IQC A;  4DRK A;  2XP9 A;  2ZR5 A;  1KT0 A;  4ODL A;  3TDB A;  4JFL A;  2KI3 A;  4ODM A;  2JZV A;  2UZ5 A;  2XPA A;  1FKG A;  5HUA A;  2VN1 A;  1PIN A;  2MLX A;  2K8I A;  4TW8 A;  1D7I A;  4DRQ A;  5HTG A;  2LPV A;  3O5K A;  3PA7 A;  4R0X A;  2XP4 A;  1B6C A;  1T11 A;  4N19 A;  1ROT A;  4GGQ A;  4TW6 A;  4U84 A;  3RFW A;  1BL4 A;  2MF9 A;  1Q1C A;  2PBC A;  2XP8 A;  3O5L A;  1FKR A;  3I6C A;  5GPG A;  4MSP A;  3KAD A;  4JYS A;  3O5M A;  3NRK A;  5DIT A;  4C02 B;  3PRD A;  1F40 A;  1Q6H A;  1D7H A;  3VAW A;  3KAG A;  3NI6 A;  3JXV A;  1JNS A;  1BKF A;  4W9Q A;  3IKD A;  4TW7 A;  1YAT A;  2MLZ A;  1R9H A;  2RUC A;  2Y78 A;  4W9O A;  4JFJ A;  4ODP A;  1J4H A;  2RQS A;  4U86 A;  5DIU A;  3JYJ A;  3RGC A;  1D6O A;  2KE0 A;  2AWG A;  3KZ7 A;  3LUO A;  3KCE A;  4LAV A;  4W9P A;  5I98 A;  1FKS A;  1QZ2 A;  4DT4 A;  2XP7 A;  3H9R B;  3EY6 A;  1ZCN A;  3TCZ A;  1Q6I A;  2PV2 A;  2RUR A;  3UQI A;  4G50 A;  2PPN A;  2XP6 A;  4ODR A;  2PV1 A;  3O5O A;  2ZR4 A;  1KT1 A;  3TC5 A;  4GIV A;  5HW7 A;  2XP3 A;  2ZR6 A;  2KGJ A;  1J4I A;  1FKL A;  2DG3 A;  4ODO A;  2MPH A;  1FD9 A;  4G2P A;  1ZK6 A;  2XP5 A;  2D9F A; 
#chains in the Genus database with same CATH topology
 3O5J A;  1E15 A;  2M1I A;  4O2T A;  5HW6 A;  2M08 A;  2Q5A A;  3CHF A;  4ZPW R;  5DO2 A;  2OFN A;  3OOB A;  3KAC A;  4ODK A;  4Z2H A;  2F21 A;  1GOI A;  4ML4 A;  1ROU A;  4LAY A;  1C9H A;  1M5Y A;  3O5E A;  3WQW A;  3PRB A;  4DZ3 A;  4DRM A;  4DRO A;  2PV3 A;  1EDQ A;  1NMW A;  1PBK A;  2P4V A;  5BXJ A;  1FKJ A;  3BMB A;  4QT3 A;  4WIW A;  3JYM A;  1SYT A;  2G8Z A;  1KFW A;  3UQA A;  4DRH A;  3KAI A;  2ZQT A;  3O5Q A;  1FAP A;  1F8A B;  2LGO A;  4P8U A;  1NH6 A;  3CGN A;  3O5I A;  3CH9 A;  4W5U A;  3O5G A;  3WH0 A;  3CGM A;  4DWS B;  4JFK A;  1ZBW A;  3OA5 A;  1QPL A;  2DT0 A;  1UR9 A;  1O6I A;  1FKK A;  3ARR A;  2F4E A;  3NTP A;  5D75 A;  4ITZ A;  2LKN A;  2F23 A;  4MPK A;  3AS1 A;  2PPO A;  1J6Y A;  3UQB A;  5HWC A;  4ODN A;  4URI A;  3ARZ A;  4DRK A;  1KT0 A;  2KI3 A;  2XPA A;  1PIN A;  1E6R A;  2K8I A;  2DT2 A;  3O5K A;  2XP4 A;  1B6C A;  1T11 A;  4GGQ A;  3O5L A;  3ARU A;  4HBE A;  1XRV A;  3I6C A;  3O5M A;  2B5U B;  3PRD A;  3VAW A;  1D7H A;  3NI6 A;  1JNS A;  4WKA A;  1OGB A;  3IKD A;  3ARO A;  2MLZ A;  1R9H A;  4U86 A;  1J4H A;  4IT6 A;  1X6N A;  4DT4 A;  4Z2L A;  2XP7 A;  4WJX A;  1HJW A;  1ZCN A;  3TCZ A;  4DWS D;  1W9V A;  3WD4 A;  4G50 A;  3G6L A;  2XP6 A;  1ZB5 A;  3TC5 A;  1J4I A;  4ODO A;  3ARQ A;  1FD9 A;  1CTN A;  1ZK6 A;  4TYO A;  2D9F A;  1Y0O A;  4DH0 A;  4Z2G A;  4LGX A;  2RSE A;  3WD1 A;  4DZ2 A;  1LG1 A;  2O92 A;  4ODQ A;  1EYM A;  4AY1 A;  1NWU A;  2OLH A;  4S3J A;  3KAF A;  3O5F A;  3AS2 A;  2KFW A;  4PTM A;  5HBF A;  1ZBK A;  1HXV A;  1YW5 A;  1FKF A;  4MGV A;  2VCD A;  2A3C A;  2DSW A;  1X6L A;  4ZS6 A;  2MNT A;  4U85 A;  1GPF A;  1H0I A;  3UI4 A;  2DSU A;  3WIJ A;  3WL0 A;  2WLY A;  1LQ0 A;  4JFM A;  3FAP A;  2F2D A;  3UI6 A;  4KR0 B;  5GPR A;  2N87 A;  1P5Q A;  2ETN A;  3EIP A;  1GRJ A;  1ZBC A;  2A3A A;  4MNM A;  4FAP A;  1EIB A;  2M2A A;  4JFI A;  1ITX A;  2A3B A;  4DRI A;  1W26 A;  4DWS C;  1A7X A;  1EHN A;  2XP9 A;  3TDB A;  2WK2 A;  4P8X A;  5HUA A;  1FKG A;  2VN1 A;  2FDM A;  5JH8 A;  3ART A;  4R0X A;  3WQV A;  4N19 A;  1ROT A;  4WK9 A;  1BL4 A;  1HKJ A;  4S3K A;  3CHD A;  1TFV A;  5GPG A;  4JYS A;  4XAK A;  1SR0 A;  3WD3 A;  5DIT A;  4C02 B;  1F40 A;  4WKF A;  3JXV A;  2PN0 A;  2Y78 A;  4R5E A;  4JFJ A;  3RGC A;  5DIU A;  1WNO A;  1H0G A;  3LUO A;  4LAV A;  3ALF A;  5I98 A;  1Q6I A;  2RUR A;  3UQI A;  1FFQ A;  2PV1 A;  1KT1 A;  2ZR6 A;  1ZL1 A;  2DG3 A;  4UDM A;  2YBU A;  2ZQU A;  3QOK A;  1D2K A;  4NNR A;  4MNK A;  2A3E A;  1NWS A;  1N1A A;  3CZ8 A;  1RD6 A;  4L72 B;  2FAP A;  3PR9 A;  1JVW A;  2DT3 A;  3KAB A;  2KO7 A;  4DWS A;  1HKK A;  1TCO C;  2RUD A;  1HJX A;  5B8I C;  4TX0 A;  4QT2 A;  3UF8 A;  1FKH A;  5GQB A;  3RME A;  3MDY B;  1JCH B;  2IUZ A;  2LJ4 A;  3B7X A;  2FKE A;  1NMV A;  1EQ3 A;  5DIV A;  3B9D A;  3IKG A;  3B9A A;  5HT1 A;  1XHG A;  4QIB A;  3GPK A;  2KR7 A;  1JNE A;  1JNT A;  2B31 A;  5HWB A;  1ZU8 A;  4IQ2 A;  2IF4 A;  3AS0 A;  1Q6U A;  1FFR A;  3IHZ A;  2XPB A;  3O5P A;  4LAX A;  2ITK A;  3UI5 A;  4ZPV R;  1HJV A;  2RUQ A;  3AS3 A;  1NSG A;  4MNL A;  4QZV B;  1D7J A;  3WD0 A;  4IQC A;  2ZR5 A;  4ODL A;  4Q22 A;  4JFL A;  2DPE A;  4ODM A;  2JZV A;  3RM8 A;  2MLX A;  4DRQ A;  5HTG A;  3GTY X;  4U84 A;  5DEZ A;  1FKR A;  2PBC A;  4NSB A;  1W1Y A;  4NZC A;  4MSP A;  3NRK A;  3B8S A;  1BKF A;  1OGG A;  3ARX A;  2PI6 A;  4TW7 A;  4Z2K A;  2O9O A;  3BXW A;  3PRA A;  2RQS A;  3WKZ A;  3FY1 A;  1LL7 A;  2KE0 A;  1LL6 A;  1NWR A;  4KQZ A;  5DF0 A;  1FKS A;  1LJY A;  3ARW A;  1W1P A;  2PV2 A;  1GUV A;  2PPN A;  1VF8 A;  4MAV A;  1E6N A;  1OWQ A;  2XP3 A;  2KGJ A;  1E6Z A;  2MPH A;  3ARS A;  2DSZ A;  2XP5 A;  4MTV A;  2DG9 A;  1HKM A;  3O5D A;  4P8W A;  2ESC A;  2ZQS A;  2MLY A;  2PPP A;  4IPX A;  1W9P A;  4Q7N A;  2DT1 A;  1FKD A;  1E9L A;  3GU0 A;  3O5R A;  2WM0 A;  4DIP A;  1W1T A;  1L1P A;  4HBO A;  3RM4 A;  4DRP A;  3IK8 A;  2G41 A;  3FXY A;  3ODK A;  1E44 A;  1UR8 A;  1U79 A;  4WKH A;  4J4N A;  3CHE A;  2QF8 A;  2ZQV A;  3ALG A;  4DRN A;  1LG2 A;  1LL4 A;  3AQU A;  1FKB A;  1FKI A;  3KAH A;  1FKT A;  1NWT A;  1K9T A;  1IX5 A;  2WLZ A;  4TNS A;  4BF8 A;  3B9E A;  5HW8 A;  4DRJ A;  1FJD A;  4P8V A;  2L2S A;  3ARV A;  1J4R A;  4FN2 A;  5HKG A;  4J4O A;  1QPF A;  4LAW A;  1E6P A;  5J6E A;  2DG4 A;  1HKI A;  3RM9 A;  4L3N A;  2UZ5 A;  1ZBV A;  4ZPT R;  4TW8 A;  1D7I A;  2LPV A;  3PA7 A;  1JND A;  3ARY A;  3RFW A;  4TW6 A;  2MF9 A;  3CHC A;  1Q1C A;  2XP8 A;  1W1V A;  2YBT A;  4Z2I A;  3KAD A;  3WL1 A;  1Q6H A;  3KAG A;  4HAR A;  2DSV A;  4W9Q A;  1YAT A;  2RUC A;  4W9O A;  4ODP A;  3JYJ A;  1WB0 A;  4IT4 A;  1W9U A;  1D6O A;  2AWG A;  3KZ7 A;  4Z2J A;  3KCE A;  3ARP A;  2EUL A;  4W9P A;  1QZ2 A;  3H9R B;  3EY6 A;  1WAW A;  3W4R A;  2AOS A;  3WD2 A;  4MNJ A;  4ODR A;  3O5O A;  2ZR4 A;  4GIV A;  5HW7 A;  1FKL A;  4G2P A;  3G6M A; 
#chains in the Genus database with same CATH homology
 3O5J A;  1E15 A;  2M1I A;  4O2T A;  5HW6 A;  2M08 A;  2Q5A A;  3CHF A;  4ZPW R;  5DO2 A;  2OFN A;  3OOB A;  3KAC A;  4ODK A;  4Z2H A;  2F21 A;  1GOI A;  4ML4 A;  1ROU A;  4LAY A;  1C9H A;  1M5Y A;  3O5E A;  3WQW A;  3PRB A;  4DZ3 A;  4DRM A;  4DRO A;  2PV3 A;  1EDQ A;  1NMW A;  1PBK A;  5BXJ A;  1FKJ A;  4QT3 A;  4WIW A;  3JYM A;  1SYT A;  2G8Z A;  1KFW A;  3UQA A;  4DRH A;  3KAI A;  2ZQT A;  3O5Q A;  1FAP A;  1F8A B;  2LGO A;  4P8U A;  1NH6 A;  3CGN A;  3O5I A;  3CH9 A;  4W5U A;  3O5G A;  3WH0 A;  3CGM A;  4DWS B;  4JFK A;  1ZBW A;  3OA5 A;  1QPL A;  2DT0 A;  1UR9 A;  1O6I A;  1FKK A;  3ARR A;  2F4E A;  3NTP A;  5D75 A;  4ITZ A;  2LKN A;  4MPK A;  3AS1 A;  2PPO A;  1J6Y A;  3UQB A;  5HWC A;  4ODN A;  4URI A;  3ARZ A;  4DRK A;  1KT0 A;  2KI3 A;  2XPA A;  1PIN A;  1E6R A;  2K8I A;  2DT2 A;  3O5K A;  2XP4 A;  1B6C A;  1T11 A;  4GGQ A;  3O5L A;  3ARU A;  4HBE A;  1XRV A;  3I6C A;  3O5M A;  3PRD A;  3VAW A;  1D7H A;  3NI6 A;  1JNS A;  4WKA A;  1OGB A;  3IKD A;  3ARO A;  2MLZ A;  1R9H A;  4U86 A;  1J4H A;  4IT6 A;  1X6N A;  4DT4 A;  4Z2L A;  2XP7 A;  4WJX A;  1HJW A;  1ZCN A;  3TCZ A;  4DWS D;  1W9V A;  3WD4 A;  4G50 A;  3G6L A;  2XP6 A;  1ZB5 A;  3TC5 A;  1J4I A;  4ODO A;  3ARQ A;  1FD9 A;  1CTN A;  1ZK6 A;  4TYO A;  2D9F A;  1Y0O A;  4DH0 A;  4Z2G A;  4LGX A;  2RSE A;  3WD1 A;  4DZ2 A;  1LG1 A;  2O92 A;  4ODQ A;  1EYM A;  4AY1 A;  1NWU A;  2OLH A;  4S3J A;  3KAF A;  3O5F A;  3AS2 A;  2KFW A;  4PTM A;  5HBF A;  1ZBK A;  1HXV A;  1YW5 A;  1FKF A;  4MGV A;  2VCD A;  2A3C A;  2DSW A;  1X6L A;  4ZS6 A;  2MNT A;  4U85 A;  1GPF A;  1H0I A;  3UI4 A;  2DSU A;  3WIJ A;  3WL0 A;  2WLY A;  1LQ0 A;  4JFM A;  3FAP A;  2F2D A;  3UI6 A;  4KR0 B;  5GPR A;  2N87 A;  1P5Q A;  1ZBC A;  2A3A A;  4MNM A;  4FAP A;  1EIB A;  2M2A A;  4JFI A;  1ITX A;  2A3B A;  4DRI A;  1W26 A;  4DWS C;  1A7X A;  1EHN A;  2XP9 A;  3TDB A;  2WK2 A;  4P8X A;  5HUA A;  1FKG A;  2VN1 A;  2FDM A;  5JH8 A;  3ART A;  4R0X A;  3WQV A;  4N19 A;  1ROT A;  4WK9 A;  1BL4 A;  1HKJ A;  4S3K A;  3CHD A;  1TFV A;  5GPG A;  4JYS A;  4XAK A;  1SR0 A;  3WD3 A;  5DIT A;  4C02 B;  1F40 A;  4WKF A;  3JXV A;  2Y78 A;  4R5E A;  4JFJ A;  3RGC A;  5DIU A;  1WNO A;  1H0G A;  3LUO A;  4LAV A;  3ALF A;  5I98 A;  1Q6I A;  2RUR A;  3UQI A;  1FFQ A;  2PV1 A;  1KT1 A;  2ZR6 A;  1ZL1 A;  2DG3 A;  2YBU A;  2ZQU A;  3QOK A;  1D2K A;  4NNR A;  4MNK A;  2A3E A;  1NWS A;  1N1A A;  3CZ8 A;  1RD6 A;  4L72 B;  2FAP A;  3PR9 A;  1JVW A;  2DT3 A;  3KAB A;  2KO7 A;  4DWS A;  1HKK A;  1TCO C;  2RUD A;  1HJX A;  5B8I C;  4TX0 A;  4QT2 A;  3UF8 A;  1FKH A;  5GQB A;  3RME A;  3MDY B;  2IUZ A;  2LJ4 A;  3B7X A;  2FKE A;  1NMV A;  1EQ3 A;  5DIV A;  3B9D A;  3IKG A;  3B9A A;  5HT1 A;  1XHG A;  4QIB A;  3GPK A;  2KR7 A;  1JNE A;  1JNT A;  2B31 A;  5HWB A;  1ZU8 A;  4IQ2 A;  2IF4 A;  3AS0 A;  1Q6U A;  1FFR A;  3IHZ A;  2XPB A;  3O5P A;  4LAX A;  2ITK A;  3UI5 A;  4ZPV R;  1HJV A;  2RUQ A;  3AS3 A;  1NSG A;  4MNL A;  4QZV B;  1D7J A;  3WD0 A;  4IQC A;  2ZR5 A;  4ODL A;  4Q22 A;  4JFL A;  2DPE A;  4ODM A;  2JZV A;  3RM8 A;  2MLX A;  4DRQ A;  5HTG A;  4U84 A;  5DEZ A;  1FKR A;  2PBC A;  4NSB A;  1W1Y A;  4NZC A;  4MSP A;  3NRK A;  3B8S A;  1BKF A;  1OGG A;  3ARX A;  2PI6 A;  4TW7 A;  4Z2K A;  2O9O A;  3BXW A;  3PRA A;  2RQS A;  3WKZ A;  3FY1 A;  1LL7 A;  2KE0 A;  1LL6 A;  1NWR A;  4KQZ A;  5DF0 A;  1FKS A;  1LJY A;  3ARW A;  1W1P A;  2PV2 A;  1GUV A;  2PPN A;  1VF8 A;  4MAV A;  1E6N A;  1OWQ A;  2XP3 A;  2KGJ A;  1E6Z A;  2MPH A;  3ARS A;  2DSZ A;  2XP5 A;  4MTV A;  2DG9 A;  1HKM A;  3O5D A;  4P8W A;  2ESC A;  2ZQS A;  2MLY A;  2PPP A;  4IPX A;  1W9P A;  4Q7N A;  2DT1 A;  1FKD A;  1E9L A;  3O5R A;  2WM0 A;  4DIP A;  1W1T A;  1L1P A;  4HBO A;  3RM4 A;  4DRP A;  3IK8 A;  2G41 A;  3FXY A;  3ODK A;  1UR8 A;  1U79 A;  4WKH A;  4J4N A;  3CHE A;  2QF8 A;  2ZQV A;  3ALG A;  4DRN A;  1LG2 A;  1LL4 A;  3AQU A;  1FKB A;  1FKI A;  3KAH A;  1FKT A;  1NWT A;  1K9T A;  1IX5 A;  2WLZ A;  4TNS A;  4BF8 A;  3B9E A;  5HW8 A;  4DRJ A;  1FJD A;  4P8V A;  2L2S A;  3ARV A;  1J4R A;  4FN2 A;  5HKG A;  4J4O A;  1QPF A;  4LAW A;  1E6P A;  5J6E A;  2DG4 A;  1HKI A;  3RM9 A;  4L3N A;  2UZ5 A;  1ZBV A;  4ZPT R;  4TW8 A;  1D7I A;  2LPV A;  3PA7 A;  1JND A;  3ARY A;  3RFW A;  4TW6 A;  2MF9 A;  3CHC A;  1Q1C A;  2XP8 A;  1W1V A;  2YBT A;  4Z2I A;  3KAD A;  3WL1 A;  1Q6H A;  3KAG A;  4HAR A;  2DSV A;  4W9Q A;  1YAT A;  2RUC A;  4W9O A;  4ODP A;  3JYJ A;  1WB0 A;  4IT4 A;  1W9U A;  1D6O A;  2AWG A;  3KZ7 A;  4Z2J A;  3KCE A;  3ARP A;  4W9P A;  1QZ2 A;  3H9R B;  3EY6 A;  1WAW A;  3W4R A;  2AOS A;  3WD2 A;  4MNJ A;  4ODR A;  3O5O A;  2ZR4 A;  4GIV A;  5HW7 A;  1FKL A;  4G2P A;  3G6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...