3UQIA

Crystallographic structure of fkbp12 from aedes aegypti
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
108
structure length
108
Chain Sequence
MGVQVVTLAAGDEATYPKAGQVAVVHYTGTLADGKVFDSSRTRGKPFRFTVGRGEVIRGWDEGVAQMSVGQRAKLVCSPDYAYGSRGHPGVIPPNATLTFDVELLRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase
publication title High-resolution crystal structure of FKBP12 from Aedes aegypti.
pubmed doi rcsb
source organism Aedes aegypti
total genus 26
structure length 108
sequence length 108
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2011-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3uqiA00
1FKLA 1Q6UA 4DRQA 2ZR4A 5GPGA 2MLXA 2XP5A 3KZ7A 4N19A 4TNSA 3UF8A 1QZ2A 2XP6A 3I6CA 3MDYB 4GIVA 3TDBA 3TC5A 3IHZA 1TCOC 5D75A 5HW8A 3UQAA 2ZQSA 4QIBA 2PPOA 3LUOA 2F21A 3PA7A 3EY6A 5HUAA 2VCDA 2N87A 2ZR5A 3NTPA 1ZCNA 3O5QA 4ODQA 4IPXA 2LJ4A 3O5LA 4LAYA 5HKGA 4G50A 1T11A 4ITZA 5DITA 4DRIA 5HWBA 5HWCA 2FKEA 3CGNA 3UQBA 3O5EA 4O2TA 3VAWA 3GPKA 1KT1A 3NI6A 3IKDA 2ITKA 5HTGA 2IF4A 2MPHA 4DRHA 4FN2A 4IQCA 4R0XA 5B8IC 2RSEA 4MGVA 3PRDA 1W26A 2XPBA 1PBKA 4LAVA 5HT1A 4BF8A 4JFIA 2UZ5A 2MLZA 1NSGA 4TW6A 3TCZA 2PPNA 1FKHA 1F8AB 2PV2A 1A7XA 3KAHA 3RGCA 4DZ3A 2K8IA 4TYOA 2OFNA 3JYJA 1Q1CA 2DG9A 1FKDA 3RFWA 5BXJA 1B6CA 3O5DA 4J4OA 2Y78A 1ROUA 1M5YA 3UI6A 3KACA 2L2SA 3O5IA 3B7XA 3O5KA 3KAFA 2MLYA 4QT2A 4U86A 2XP4A 2KR7A 3O5OA 1FKFA 2D9FA 2PV1A 1FKKA 4DIPA 2F4EA 3CGMA 1ROTA 4DRMA 1FAPA 3PRBA 5DIUA 4TX0A 5J6EA 4W9QA 1BKFA 1YW5A 1JNSA 2KI3A 1D7HA 2DG4A 1JVWA 1R9HA 2F2DA 2KFWA 2RUQA 2VN1A 1NMVA 1QPFA 3KABA 3O5RA 1FKGA 4ODOA 4DROA 1JNTA 1FKIA 3UI5A 4DRNA 2M2AA 3JYMA 4DRJA 1J4HA 3KAGA 3UQIA 1D6OA 2PV3A 4DT4A 1F40A 5DIVA 4U85A 4FAPA 3JXVA 3ODKA 1N1AA 4ODMA 2ZR6A 3IKGA 2M1IA 3O5MA 2FAPA 4TW7A 1BL4A 3OOBA 1KT0A 4W9OA 3KCEA 3O5PA 2PPPA 4U84A 4JFJA 1FKSA 4ODRA 2KO7A 3H9RB 1EYMA 4DRKA 5HW6A 1P5QA 2M08A 3O5FA 2LGOA 1J4RA 2XP8A 4NNRA 4TW8A 1ZK6A 1EQ3A 1J4IA 4DH0A 3KAIA 1NMWA 2MNTA 2Q5AA 4JFKA 4JYSA 4DRPA 4DZ2A 1FJDA 4G2PA 2PBCA 4ODKA 1YATA 1D7IA 3IK8A 3O5JA 4C02B 4QT3A 1FKRA 2LKNA 2ZQUA 1Q6HA 4MSPA 1D7JA 3FAPA 1FKTA 3NRKA 1J6YA 3KADA 2DG3A 5I98A 1L1PA 1FKJA 1FD9A 2XP3A 5HW7A 4J4NA 4LAWA 2KE0A 1PINA 2XPAA 2ZQVA 4LAXA 4ODNA 4GGQA 1FKBA 2LPVA 3UI4A 1U79A 2RQSA 2JZVA 2KGJA 1Q6IA 1QPLA 2ZQTA 2MF9A 4ODLA 2RUDA 1C9HA 4JFMA 1Y0OA 2RUCA 4IQ2A 2XP7A 2RURA 2XP9A 3O5GA 3WH0A 4W9PA 4JFLA 1HXVA 4ODPA 2AWGA
chains in the Genus database with same CATH superfamily
1Q6UA 3FXYA 4IT6A 5DO2A 3KZ7A 4TNSA 4Q7NA 3TC5A 4Z2LA 2DT3A 4QIBA 2PPOA 2F21A 2N87A 3NTPA 1GPFA 4G50A 4ZPTR 3WD2A 1NWUA 5HWCA 1E44A 3O5EA 4O2TA 1W9UA 3VAWA 3AROA 3NI6A 4W5UA 1D2KA 3B8SA 4WIWA 4R5EA 4MGVA 5B8IC 1PBKA 2YBTA 1GOIA 4BF8A 4MPKA 2UZ5A 4Z2JA 1NH6A 1NSGA 4MTVA 2PPNA 2PV2A 3JYJA 3AS0A 2G41A 2Y78A 3CHEA 1UR9A 3KACA 1W1PA 2PV1A 2A3AA 2G8ZA 2PN0A 4DRMA 3PRBA 1BKFA 1JNSA 2KI3A 2F2DA 3KABA 2O92A 1W9PA 4DROA 1FKIA 3JYMA 3UQIA 4ZPVR 5DIVA 4DWSC 3IKGA 2YBUA 3WD1A 3KCEA 1NWTA 1FKSA 4NSBA 1E15A 1HJWA 4MNMA 4Z2GA 2XP8A 4TW8A 3ARUA 1JNEA 3KAIA 1NMWA 1LG1A 3B9DA 2WK2A 4ODKA 1NWSA 3O5JA 3ARPA 4QT3A 2LKNA 2ZQUA 1OGGA 2DT2A 2DG3A 1L1PA 2XP3A 2XPAA 3CHCA 2ZQVA 1WNOA 1LL6A 1K9TA 3CHFA 2ZQTA 2OLHA 3ARYA 1E6ZA 4IQ2A 4P8WA 2XP9A 4KR0B 1HXVA 4ODPA 1FKLA 4DRQA 2ZR4A 5GPGA 2MLXA 1ZBWA 3I6CA 4GIVA 1IX5A 1CTNA 5D75A 4KQZA 3EIPA 5HUAA 3WD0A 1W1YA 3BXWA 4DRIA 1T11A 5HWBA 2FKEA 3CGNA 3UQBA 4ML4A 1OGBA 1ITXA 2DSVA 5HTGA 4DRHA 4FN2A 4IQCA 3RM4A 3PRDA 1W26A 1E6RA 4JFIA 1F8AB 2DPEA 4LGXA 3GTYX 2FDMA 3UI6A 1O6IA 3O5IA 3B7XA 1E6PA 1H0GA 2WLZA 3ARTA 4HARA 2ESCA 5HBFA 2KR7A 3O5OA 4DIPA 3B9AA 4MNJA 4PTMA 1FFRA 1SYTA 1JVWA 1R9HA 2KFWA 2RUQA 3O5RA 1NMVA 1QPFA 1ZBKA 5JH8A 4L3NA 2M2AA 2DT1A 4U85A 4FAPA 3JXVA 3GU0A 4WJXA 2FAPA 4TW7A 1BL4A 1ZBVA 1ZBCA 4HBEA 3ARQA 3W4RA 1W9VA 4JFJA 4IT4A 3BMBA 3H9RB 4AY1A 1ZB5A 4NNRA 1ZK6A 1EQ3A 1J4IA 4Z2HA 2WM0A 4JFKA 2Q5AA 4JYSA 4Q22A 4DRPA 2PBCA 1FKRA 4MSPA 1Q6HA 3FAPA 1FKTA 3NRKA 5I98A 4LAWA 4LAXA 4ODNA 1H0IA 1EDQA 2O9OA 3UI4A 2ETNA 1QPLA 2MF9A 1ZL1A 3WL1A 1C9HA 4JFMA 1Y0OA 4MNKA 1HKMA 1W1TA 2RURA 4W9PA 4JFLA 2AWGA 1W1VA 2DT0A 2XP5A 3UF8A 5GPRA 1HKIA 3MDYB 4P8XA 3IHZA 5HW8A 1LL7A 2VCDA 4ODQA 3CZ8A 4IPXA 2LJ4A 3PR9A 4LAYA 5DITA 3GPKA 2ITKA 2IF4A 4NZCA 4R0XA 4LAVA 3WQVA 2MLZA 3KAHA 1A7XA 4WKAA 2OFNA 1Q1CA 2DG9A 2DSWA 3RFWA 5BXJA 3FY1A 1HKJA 4J4OA 4DWSD 2AOSA 3RM9A 2L2SA 3O5KA 3KAFA 2MLYA 4WK9A 1FKKA 1XHGA 2B5UB 3CGMA 1ROTA 1FAPA 5J6EA 4W9QA 2VN1A 1JNTA 3UI5A 3AS3A 4DRJA 1J4HA 5DEZA 3KAGA 3ALGA 1D6OA 4DT4A 1F40A 3ARXA 2EULA 4Z2IA 3OA5A 3ARVA 4XAKA 3O5MA 2M1IA 3OOBA 2QF8A 4W9OA 2PPPA 4MNLA 1UR8A 3AS2A 1GRJA 3ARWA 4P8UA 4WKFA 4DRKA 4URIA 5DF0A 3WD4A 1P5QA 5HW6A 2A3BA 1SR0A 2LGOA 1J4RA 1OWQA 4S3JA 3WIJA 1TFVA 1HJXA 4DH0A 1LJYA 1VF8A 1D7IA 4C02B 1D7JA 3QOKA 1J6YA 3KADA 1FD9A 5HW7A 4J4NA 2KE0A 1EIBA 3ALFA 1FKBA 2DSUA 2LPVA 1Q6IA 2WLYA 1XRVA 3WQWA 2XP7A 3O5GA 3G6MA 4TX0A 4N19A 1QZ2A 1ZU8A 2XP6A 3TDBA 1HKKA 1TCOC 3UQAA 2ZQSA 3LUOA 3PA7A 3EY6A 4UDMA 3G6LA 2ZR5A 3O5QA 1ZCNA 1LQ0A 3O5LA 5HKGA 4ITZA 3ARSA 1NWRA 1KT1A 4S3KA 3IKDA 2A3CA 2MPHA 1HJVA 1X6NA 4P8VA 2IUZA 2RSEA 2XPBA 5HT1A 4TW6A 3TCZA 1FKHA 3RGCA 4DZ3A 1E6NA 2DSZA 2K8IA 3RMEA 4TYOA 1WAWA 1FKDA 1B6CA 3AS1A 3RM8A 3O5DA 1ROUA 1M5YA 5GQBA 3ARRA 4U86A 4QT2A 2XP4A 4ZPWR 1FKFA 2D9FA 2F4EA 2F23A 5DIUA 1RD6A 1YW5A 1LG2A 3PRAA 1D7HA 2DG4A 3ARZA 1EHNA 4ODOA 1FKGA 4DRNA 1FFQA 1WB0A 4MAVA 2PV3A 3B9EA 4DWSB 3ODKA 1JCHB 3CHDA 1N1AA 4ODMA 2ZR6A 4DWSA 2PI6A 1KT0A 3O5PA 1GUVA 4U84A 4L72B 4ODRA 4WKHA 2KO7A 1EYMA 2P4VA 2B31A 2M08A 3O5FA 1JNDA 1E9LA 2MNTA 1FJDA 4HBOA 4DZ2A 4G2PA 1YATA 3IK8A 4QZVB 4ZS6A 3WKZA 1FKJA 2A3EA 3AQUA 1PINA 3WD3A 1LL4A 4GGQA 3CH9A 1X6LA 1U79A 3WL0A 2RQSA 2JZVA 2KGJA 4ODLA 1KFWA 2RUDA 2RUCA 3WH0A 4Z2KA
chains in the Genus database with same CATH topology
1Q6UA 3FXYA 4IT6A 5DO2A 3KZ7A 4TNSA 4Q7NA 3TC5A 4Z2LA 2DT3A 4QIBA 2PPOA 2F21A 2N87A 3NTPA 1GPFA 4G50A 4ZPTR 3WD2A 1NWUA 5HWCA 3O5EA 4O2TA 1W9UA 3VAWA 3AROA 3NI6A 4W5UA 1D2KA 3B8SA 4WIWA 4R5EA 4MGVA 5B8IC 1PBKA 2YBTA 1GOIA 4BF8A 4MPKA 2UZ5A 4Z2JA 1NH6A 1NSGA 4MTVA 2PPNA 2PV2A 3JYJA 3AS0A 2G41A 2Y78A 3CHEA 1UR9A 3KACA 1W1PA 2PV1A 2A3AA 2G8ZA 4DRMA 3PRBA 1BKFA 1JNSA 2KI3A 2F2DA 3KABA 2O92A 1W9PA 4DROA 1FKIA 3JYMA 3UQIA 4ZPVR 5DIVA 4DWSC 3IKGA 2YBUA 3WD1A 3KCEA 1NWTA 1FKSA 4NSBA 1E15A 1HJWA 4MNMA 4Z2GA 2XP8A 4TW8A 3ARUA 1JNEA 3KAIA 1NMWA 1LG1A 3B9DA 2WK2A 4ODKA 1NWSA 3O5JA 3ARPA 4QT3A 2LKNA 2ZQUA 1OGGA 2DT2A 2DG3A 1L1PA 2XP3A 2XPAA 3CHCA 2ZQVA 1WNOA 1LL6A 1K9TA 3CHFA 2ZQTA 2OLHA 3ARYA 1E6ZA 4IQ2A 4P8WA 2XP9A 4KR0B 1HXVA 4ODPA 1FKLA 4DRQA 2ZR4A 5GPGA 2MLXA 1ZBWA 3I6CA 4GIVA 1IX5A 1CTNA 5D75A 4KQZA 5HUAA 3WD0A 1W1YA 3BXWA 4DRIA 1T11A 5HWBA 2FKEA 3CGNA 3UQBA 4ML4A 1OGBA 1ITXA 2DSVA 5HTGA 4DRHA 4FN2A 4IQCA 3RM4A 3PRDA 1W26A 1E6RA 4JFIA 1F8AB 2DPEA 4LGXA 2FDMA 3UI6A 1O6IA 3O5IA 3B7XA 1E6PA 1H0GA 2WLZA 3ARTA 4HARA 2ESCA 5HBFA 2KR7A 3O5OA 4DIPA 3B9AA 4MNJA 4PTMA 1FFRA 1SYTA 1JVWA 1R9HA 2KFWA 2RUQA 3O5RA 1NMVA 1QPFA 1ZBKA 5JH8A 4L3NA 2M2AA 2DT1A 4U85A 4FAPA 3JXVA 4WJXA 2FAPA 4TW7A 1BL4A 1ZBVA 1ZBCA 4HBEA 3ARQA 3W4RA 1W9VA 4JFJA 4IT4A 3H9RB 4AY1A 1ZB5A 4NNRA 1ZK6A 1EQ3A 1J4IA 4Z2HA 2WM0A 4JFKA 2Q5AA 4JYSA 4Q22A 4DRPA 2PBCA 1FKRA 4MSPA 1Q6HA 3FAPA 1FKTA 3NRKA 5I98A 4LAWA 4LAXA 4ODNA 1H0IA 1EDQA 2O9OA 3UI4A 1QPLA 2MF9A 1ZL1A 3WL1A 1C9HA 4JFMA 1Y0OA 4MNKA 1HKMA 1W1TA 2RURA 4W9PA 4JFLA 2AWGA 1W1VA 2DT0A 2XP5A 3UF8A 5GPRA 1HKIA 3MDYB 4P8XA 3IHZA 5HW8A 1LL7A 2VCDA 4ODQA 3CZ8A 4IPXA 2LJ4A 3PR9A 4LAYA 5DITA 3GPKA 2ITKA 2IF4A 4NZCA 4R0XA 4LAVA 3WQVA 2MLZA 3KAHA 1A7XA 4WKAA 2OFNA 1Q1CA 2DG9A 2DSWA 3RFWA 5BXJA 3FY1A 1HKJA 4J4OA 4DWSD 2AOSA 3RM9A 2L2SA 3O5KA 3KAFA 2MLYA 4WK9A 1FKKA 1XHGA 3CGMA 1ROTA 1FAPA 5J6EA 4W9QA 2VN1A 1JNTA 3UI5A 3AS3A 4DRJA 1J4HA 5DEZA 3KAGA 3ALGA 1D6OA 4DT4A 1F40A 3ARXA 4Z2IA 3OA5A 3ARVA 4XAKA 3O5MA 2M1IA 3OOBA 2QF8A 4W9OA 2PPPA 4MNLA 1UR8A 3AS2A 3ARWA 4P8UA 4WKFA 4DRKA 4URIA 5DF0A 3WD4A 1P5QA 5HW6A 2A3BA 1SR0A 2LGOA 1J4RA 1OWQA 4S3JA 3WIJA 1TFVA 1HJXA 4DH0A 1LJYA 1VF8A 1D7IA 4C02B 1D7JA 3QOKA 1J6YA 3KADA 1FD9A 5HW7A 4J4NA 2KE0A 1EIBA 3ALFA 1FKBA 2DSUA 2LPVA 1Q6IA 2WLYA 1XRVA 3WQWA 2XP7A 3O5GA 3G6MA 4TX0A 4N19A 1QZ2A 1ZU8A 2XP6A 3TDBA 1HKKA 1TCOC 3UQAA 2ZQSA 3LUOA 3PA7A 3EY6A 3G6LA 2ZR5A 3O5QA 1ZCNA 1LQ0A 3O5LA 5HKGA 4ITZA 3ARSA 1NWRA 1KT1A 4S3KA 3IKDA 2A3CA 2MPHA 1HJVA 1X6NA 4P8VA 2IUZA 2RSEA 2XPBA 5HT1A 4TW6A 3TCZA 1FKHA 3RGCA 4DZ3A 1E6NA 2DSZA 2K8IA 3RMEA 4TYOA 1WAWA 1FKDA 1B6CA 3AS1A 3RM8A 3O5DA 1ROUA 1M5YA 5GQBA 3ARRA 4U86A 4QT2A 2XP4A 4ZPWR 1FKFA 2D9FA 2F4EA 5DIUA 1RD6A 1YW5A 1LG2A 3PRAA 1D7HA 2DG4A 3ARZA 1EHNA 4ODOA 1FKGA 4DRNA 1FFQA 1WB0A 4MAVA 2PV3A 3B9EA 4DWSB 3ODKA 3CHDA 1N1AA 4ODMA 2ZR6A 4DWSA 2PI6A 1KT0A 3O5PA 1GUVA 4U84A 4L72B 4ODRA 4WKHA 2KO7A 1EYMA 2B31A 2M08A 3O5FA 1JNDA 1E9LA 2MNTA 1FJDA 4HBOA 4DZ2A 4G2PA 1YATA 3IK8A 4QZVB 4ZS6A 3WKZA 1FKJA 2A3EA 3AQUA 1PINA 3WD3A 1LL4A 4GGQA 3CH9A 1X6LA 1U79A 3WL0A 2RQSA 2JZVA 2KGJA 4ODLA 1KFWA 2RUDA 2RUCA 3WH0A 4Z2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKL A;  1Q6U A;  4DRQ A;  2ZR4 A;  5GPG A;  2MLX A;  2XP5 A;  3KZ7 A;  4N19 A;  4TNS A;  3UF8 A;  1QZ2 A;  2XP6 A;  3I6C A;  3MDY B;  4GIV A;  3TDB A;  3TC5 A;  3IHZ A;  1TCO C;  5D75 A;  5HW8 A;  3UQA A;  2ZQS A;  4QIB A;  2PPO A;  3LUO A;  2F21 A;  3PA7 A;  3EY6 A;  5HUA A;  2VCD A;  2N87 A;  2ZR5 A;  3NTP A;  1ZCN A;  3O5Q A;  4ODQ A;  4IPX A;  2LJ4 A;  3O5L A;  4LAY A;  5HKG A;  4G50 A;  1T11 A;  4ITZ A;  5DIT A;  4DRI A;  5HWB A;  5HWC A;  2FKE A;  3CGN A;  3UQB A;  3O5E A;  4O2T A;  3VAW A;  3GPK A;  1KT1 A;  3NI6 A;  3IKD A;  2ITK A;  5HTG A;  2IF4 A;  2MPH A;  4DRH A;  4FN2 A;  4IQC A;  4R0X A;  5B8I C;  2RSE A;  4MGV A;  3PRD A;  1W26 A;  2XPB A;  1PBK A;  4LAV A;  5HT1 A;  4BF8 A;  4JFI A;  2UZ5 A;  2MLZ A;  1NSG A;  4TW6 A;  3TCZ A;  2PPN A;  1FKH A;  1F8A B;  2PV2 A;  1A7X A;  3KAH A;  3RGC A;  4DZ3 A;  2K8I A;  4TYO A;  2OFN A;  3JYJ A;  1Q1C A;  2DG9 A;  1FKD A;  3RFW A;  5BXJ A;  1B6C A;  3O5D A;  4J4O A;  2Y78 A;  1ROU A;  1M5Y A;  3UI6 A;  3KAC A;  2L2S A;  3O5I A;  3B7X A;  3O5K A;  3KAF A;  2MLY A;  4QT2 A;  4U86 A;  2XP4 A;  2KR7 A;  3O5O A;  1FKF A;  2D9F A;  2PV1 A;  1FKK A;  4DIP A;  2F4E A;  3CGM A;  1ROT A;  4DRM A;  1FAP A;  3PRB A;  5DIU A;  4TX0 A;  5J6E A;  4W9Q A;  1BKF A;  1YW5 A;  1JNS A;  2KI3 A;  1D7H A;  2DG4 A;  1JVW A;  1R9H A;  2F2D A;  2KFW A;  2RUQ A;  2VN1 A;  1NMV A;  1QPF A;  3KAB A;  3O5R A;  1FKG A;  4ODO A;  4DRO A;  1JNT A;  1FKI A;  3UI5 A;  4DRN A;  2M2A A;  3JYM A;  4DRJ A;  1J4H A;  3KAG A;  3UQI A;  1D6O A;  2PV3 A;  4DT4 A;  1F40 A;  5DIV A;  4U85 A;  4FAP A;  3JXV A;  3ODK A;  1N1A A;  4ODM A;  2ZR6 A;  3IKG A;  2M1I A;  3O5M A;  2FAP A;  4TW7 A;  1BL4 A;  3OOB A;  1KT0 A;  4W9O A;  3KCE A;  3O5P A;  2PPP A;  4U84 A;  4JFJ A;  1FKS A;  4ODR A;  2KO7 A;  3H9R B;  1EYM A;  4DRK A;  5HW6 A;  1P5Q A;  2M08 A;  3O5F A;  2LGO A;  1J4R A;  2XP8 A;  4NNR A;  4TW8 A;  1ZK6 A;  1EQ3 A;  1J4I A;  4DH0 A;  3KAI A;  1NMW A;  2MNT A;  2Q5A A;  4JFK A;  4JYS A;  4DRP A;  4DZ2 A;  1FJD A;  4G2P A;  2PBC A;  4ODK A;  1YAT A;  1D7I A;  3IK8 A;  3O5J A;  4C02 B;  4QT3 A;  1FKR A;  2LKN A;  2ZQU A;  1Q6H A;  4MSP A;  1D7J A;  3FAP A;  1FKT A;  3NRK A;  1J6Y A;  3KAD A;  2DG3 A;  5I98 A;  1L1P A;  1FKJ A;  1FD9 A;  2XP3 A;  5HW7 A;  4J4N A;  4LAW A;  2KE0 A;  1PIN A;  2XPA A;  2ZQV A;  4LAX A;  4ODN A;  4GGQ A;  1FKB A;  2LPV A;  3UI4 A;  1U79 A;  2RQS A;  2JZV A;  2KGJ A;  1Q6I A;  1QPL A;  2ZQT A;  2MF9 A;  4ODL A;  2RUD A;  1C9H A;  4JFM A;  1Y0O A;  2RUC A;  4IQ2 A;  2XP7 A;  2RUR A;  2XP9 A;  3O5G A;  3WH0 A;  4W9P A;  4JFL A;  1HXV A;  4ODP A;  2AWG A; 
#chains in the Genus database with same CATH topology
 1Q6U A;  3FXY A;  4IT6 A;  5DO2 A;  3KZ7 A;  4TNS A;  4Q7N A;  3TC5 A;  4Z2L A;  2DT3 A;  4QIB A;  2PPO A;  2F21 A;  2N87 A;  3NTP A;  1GPF A;  4G50 A;  4ZPT R;  3WD2 A;  1NWU A;  5HWC A;  1E44 A;  3O5E A;  4O2T A;  1W9U A;  3VAW A;  3ARO A;  3NI6 A;  4W5U A;  1D2K A;  3B8S A;  4WIW A;  4R5E A;  4MGV A;  5B8I C;  1PBK A;  2YBT A;  1GOI A;  4BF8 A;  4MPK A;  2UZ5 A;  4Z2J A;  1NH6 A;  1NSG A;  4MTV A;  2PPN A;  2PV2 A;  3JYJ A;  3AS0 A;  2G41 A;  2Y78 A;  3CHE A;  1UR9 A;  3KAC A;  1W1P A;  2PV1 A;  2A3A A;  2G8Z A;  2PN0 A;  4DRM A;  3PRB A;  1BKF A;  1JNS A;  2KI3 A;  2F2D A;  3KAB A;  2O92 A;  1W9P A;  4DRO A;  1FKI A;  3JYM A;  3UQI A;  4ZPV R;  5DIV A;  4DWS C;  3IKG A;  2YBU A;  3WD1 A;  3KCE A;  1NWT A;  1FKS A;  4NSB A;  1E15 A;  1HJW A;  4MNM A;  4Z2G A;  2XP8 A;  4TW8 A;  3ARU A;  1JNE A;  3KAI A;  1NMW A;  1LG1 A;  3B9D A;  2WK2 A;  4ODK A;  1NWS A;  3O5J A;  3ARP A;  4QT3 A;  2LKN A;  2ZQU A;  1OGG A;  2DT2 A;  2DG3 A;  1L1P A;  2XP3 A;  2XPA A;  3CHC A;  2ZQV A;  1WNO A;  1LL6 A;  1K9T A;  3CHF A;  2ZQT A;  2OLH A;  3ARY A;  1E6Z A;  4IQ2 A;  4P8W A;  2XP9 A;  4KR0 B;  1HXV A;  4ODP A;  1FKL A;  4DRQ A;  2ZR4 A;  5GPG A;  2MLX A;  1ZBW A;  3I6C A;  4GIV A;  1IX5 A;  1CTN A;  5D75 A;  4KQZ A;  3EIP A;  5HUA A;  3WD0 A;  1W1Y A;  3BXW A;  4DRI A;  1T11 A;  5HWB A;  2FKE A;  3CGN A;  3UQB A;  4ML4 A;  1OGB A;  1ITX A;  2DSV A;  5HTG A;  4DRH A;  4FN2 A;  4IQC A;  3RM4 A;  3PRD A;  1W26 A;  1E6R A;  4JFI A;  1F8A B;  2DPE A;  4LGX A;  3GTY X;  2FDM A;  3UI6 A;  1O6I A;  3O5I A;  3B7X A;  1E6P A;  1H0G A;  2WLZ A;  3ART A;  4HAR A;  2ESC A;  5HBF A;  2KR7 A;  3O5O A;  4DIP A;  3B9A A;  4MNJ A;  4PTM A;  1FFR A;  1SYT A;  1JVW A;  1R9H A;  2KFW A;  2RUQ A;  3O5R A;  1NMV A;  1QPF A;  1ZBK A;  5JH8 A;  4L3N A;  2M2A A;  2DT1 A;  4U85 A;  4FAP A;  3JXV A;  3GU0 A;  4WJX A;  2FAP A;  4TW7 A;  1BL4 A;  1ZBV A;  1ZBC A;  4HBE A;  3ARQ A;  3W4R A;  1W9V A;  4JFJ A;  4IT4 A;  3BMB A;  3H9R B;  4AY1 A;  1ZB5 A;  4NNR A;  1ZK6 A;  1EQ3 A;  1J4I A;  4Z2H A;  2WM0 A;  4JFK A;  2Q5A A;  4JYS A;  4Q22 A;  4DRP A;  2PBC A;  1FKR A;  4MSP A;  1Q6H A;  3FAP A;  1FKT A;  3NRK A;  5I98 A;  4LAW A;  4LAX A;  4ODN A;  1H0I A;  1EDQ A;  2O9O A;  3UI4 A;  2ETN A;  1QPL A;  2MF9 A;  1ZL1 A;  3WL1 A;  1C9H A;  4JFM A;  1Y0O A;  4MNK A;  1HKM A;  1W1T A;  2RUR A;  4W9P A;  4JFL A;  2AWG A;  1W1V A;  2DT0 A;  2XP5 A;  3UF8 A;  5GPR A;  1HKI A;  3MDY B;  4P8X A;  3IHZ A;  5HW8 A;  1LL7 A;  2VCD A;  4ODQ A;  3CZ8 A;  4IPX A;  2LJ4 A;  3PR9 A;  4LAY A;  5DIT A;  3GPK A;  2ITK A;  2IF4 A;  4NZC A;  4R0X A;  4LAV A;  3WQV A;  2MLZ A;  3KAH A;  1A7X A;  4WKA A;  2OFN A;  1Q1C A;  2DG9 A;  2DSW A;  3RFW A;  5BXJ A;  3FY1 A;  1HKJ A;  4J4O A;  4DWS D;  2AOS A;  3RM9 A;  2L2S A;  3O5K A;  3KAF A;  2MLY A;  4WK9 A;  1FKK A;  1XHG A;  2B5U B;  3CGM A;  1ROT A;  1FAP A;  5J6E A;  4W9Q A;  2VN1 A;  1JNT A;  3UI5 A;  3AS3 A;  4DRJ A;  1J4H A;  5DEZ A;  3KAG A;  3ALG A;  1D6O A;  4DT4 A;  1F40 A;  3ARX A;  2EUL A;  4Z2I A;  3OA5 A;  3ARV A;  4XAK A;  3O5M A;  2M1I A;  3OOB A;  2QF8 A;  4W9O A;  2PPP A;  4MNL A;  1UR8 A;  3AS2 A;  1GRJ A;  3ARW A;  4P8U A;  4WKF A;  4DRK A;  4URI A;  5DF0 A;  3WD4 A;  1P5Q A;  5HW6 A;  2A3B A;  1SR0 A;  2LGO A;  1J4R A;  1OWQ A;  4S3J A;  3WIJ A;  1TFV A;  1HJX A;  4DH0 A;  1LJY A;  1VF8 A;  1D7I A;  4C02 B;  1D7J A;  3QOK A;  1J6Y A;  3KAD A;  1FD9 A;  5HW7 A;  4J4N A;  2KE0 A;  1EIB A;  3ALF A;  1FKB A;  2DSU A;  2LPV A;  1Q6I A;  2WLY A;  1XRV A;  3WQW A;  2XP7 A;  3O5G A;  3G6M A;  4TX0 A;  4N19 A;  1QZ2 A;  1ZU8 A;  2XP6 A;  3TDB A;  1HKK A;  1TCO C;  3UQA A;  2ZQS A;  3LUO A;  3PA7 A;  3EY6 A;  4UDM A;  3G6L A;  2ZR5 A;  3O5Q A;  1ZCN A;  1LQ0 A;  3O5L A;  5HKG A;  4ITZ A;  3ARS A;  1NWR A;  1KT1 A;  4S3K A;  3IKD A;  2A3C A;  2MPH A;  1HJV A;  1X6N A;  4P8V A;  2IUZ A;  2RSE A;  2XPB A;  5HT1 A;  4TW6 A;  3TCZ A;  1FKH A;  3RGC A;  4DZ3 A;  1E6N A;  2DSZ A;  2K8I A;  3RME A;  4TYO A;  1WAW A;  1FKD A;  1B6C A;  3AS1 A;  3RM8 A;  3O5D A;  1ROU A;  1M5Y A;  5GQB A;  3ARR A;  4U86 A;  4QT2 A;  2XP4 A;  4ZPW R;  1FKF A;  2D9F A;  2F4E A;  2F23 A;  5DIU A;  1RD6 A;  1YW5 A;  1LG2 A;  3PRA A;  1D7H A;  2DG4 A;  3ARZ A;  1EHN A;  4ODO A;  1FKG A;  4DRN A;  1FFQ A;  1WB0 A;  4MAV A;  2PV3 A;  3B9E A;  4DWS B;  3ODK A;  1JCH B;  3CHD A;  1N1A A;  4ODM A;  2ZR6 A;  4DWS A;  2PI6 A;  1KT0 A;  3O5P A;  1GUV A;  4U84 A;  4L72 B;  4ODR A;  4WKH A;  2KO7 A;  1EYM A;  2P4V A;  2B31 A;  2M08 A;  3O5F A;  1JND A;  1E9L A;  2MNT A;  1FJD A;  4HBO A;  4DZ2 A;  4G2P A;  1YAT A;  3IK8 A;  4QZV B;  4ZS6 A;  3WKZ A;  1FKJ A;  2A3E A;  3AQU A;  1PIN A;  3WD3 A;  1LL4 A;  4GGQ A;  3CH9 A;  1X6L A;  1U79 A;  3WL0 A;  2RQS A;  2JZV A;  2KGJ A;  4ODL A;  1KFW A;  2RUD A;  2RUC A;  3WH0 A;  4Z2K A; 
#chains in the Genus database with same CATH homology
 1Q6U A;  3FXY A;  4IT6 A;  5DO2 A;  3KZ7 A;  4TNS A;  4Q7N A;  3TC5 A;  4Z2L A;  2DT3 A;  4QIB A;  2PPO A;  2F21 A;  2N87 A;  3NTP A;  1GPF A;  4G50 A;  4ZPT R;  3WD2 A;  1NWU A;  5HWC A;  3O5E A;  4O2T A;  1W9U A;  3VAW A;  3ARO A;  3NI6 A;  4W5U A;  1D2K A;  3B8S A;  4WIW A;  4R5E A;  4MGV A;  5B8I C;  1PBK A;  2YBT A;  1GOI A;  4BF8 A;  4MPK A;  2UZ5 A;  4Z2J A;  1NH6 A;  1NSG A;  4MTV A;  2PPN A;  2PV2 A;  3JYJ A;  3AS0 A;  2G41 A;  2Y78 A;  3CHE A;  1UR9 A;  3KAC A;  1W1P A;  2PV1 A;  2A3A A;  2G8Z A;  4DRM A;  3PRB A;  1BKF A;  1JNS A;  2KI3 A;  2F2D A;  3KAB A;  2O92 A;  1W9P A;  4DRO A;  1FKI A;  3JYM A;  3UQI A;  4ZPV R;  5DIV A;  4DWS C;  3IKG A;  2YBU A;  3WD1 A;  3KCE A;  1NWT A;  1FKS A;  4NSB A;  1E15 A;  1HJW A;  4MNM A;  4Z2G A;  2XP8 A;  4TW8 A;  3ARU A;  1JNE A;  3KAI A;  1NMW A;  1LG1 A;  3B9D A;  2WK2 A;  4ODK A;  1NWS A;  3O5J A;  3ARP A;  4QT3 A;  2LKN A;  2ZQU A;  1OGG A;  2DT2 A;  2DG3 A;  1L1P A;  2XP3 A;  2XPA A;  3CHC A;  2ZQV A;  1WNO A;  1LL6 A;  1K9T A;  3CHF A;  2ZQT A;  2OLH A;  3ARY A;  1E6Z A;  4IQ2 A;  4P8W A;  2XP9 A;  4KR0 B;  1HXV A;  4ODP A;  1FKL A;  4DRQ A;  2ZR4 A;  5GPG A;  2MLX A;  1ZBW A;  3I6C A;  4GIV A;  1IX5 A;  1CTN A;  5D75 A;  4KQZ A;  5HUA A;  3WD0 A;  1W1Y A;  3BXW A;  4DRI A;  1T11 A;  5HWB A;  2FKE A;  3CGN A;  3UQB A;  4ML4 A;  1OGB A;  1ITX A;  2DSV A;  5HTG A;  4DRH A;  4FN2 A;  4IQC A;  3RM4 A;  3PRD A;  1W26 A;  1E6R A;  4JFI A;  1F8A B;  2DPE A;  4LGX A;  2FDM A;  3UI6 A;  1O6I A;  3O5I A;  3B7X A;  1E6P A;  1H0G A;  2WLZ A;  3ART A;  4HAR A;  2ESC A;  5HBF A;  2KR7 A;  3O5O A;  4DIP A;  3B9A A;  4MNJ A;  4PTM A;  1FFR A;  1SYT A;  1JVW A;  1R9H A;  2KFW A;  2RUQ A;  3O5R A;  1NMV A;  1QPF A;  1ZBK A;  5JH8 A;  4L3N A;  2M2A A;  2DT1 A;  4U85 A;  4FAP A;  3JXV A;  4WJX A;  2FAP A;  4TW7 A;  1BL4 A;  1ZBV A;  1ZBC A;  4HBE A;  3ARQ A;  3W4R A;  1W9V A;  4JFJ A;  4IT4 A;  3H9R B;  4AY1 A;  1ZB5 A;  4NNR A;  1ZK6 A;  1EQ3 A;  1J4I A;  4Z2H A;  2WM0 A;  4JFK A;  2Q5A A;  4JYS A;  4Q22 A;  4DRP A;  2PBC A;  1FKR A;  4MSP A;  1Q6H A;  3FAP A;  1FKT A;  3NRK A;  5I98 A;  4LAW A;  4LAX A;  4ODN A;  1H0I A;  1EDQ A;  2O9O A;  3UI4 A;  1QPL A;  2MF9 A;  1ZL1 A;  3WL1 A;  1C9H A;  4JFM A;  1Y0O A;  4MNK A;  1HKM A;  1W1T A;  2RUR A;  4W9P A;  4JFL A;  2AWG A;  1W1V A;  2DT0 A;  2XP5 A;  3UF8 A;  5GPR A;  1HKI A;  3MDY B;  4P8X A;  3IHZ A;  5HW8 A;  1LL7 A;  2VCD A;  4ODQ A;  3CZ8 A;  4IPX A;  2LJ4 A;  3PR9 A;  4LAY A;  5DIT A;  3GPK A;  2ITK A;  2IF4 A;  4NZC A;  4R0X A;  4LAV A;  3WQV A;  2MLZ A;  3KAH A;  1A7X A;  4WKA A;  2OFN A;  1Q1C A;  2DG9 A;  2DSW A;  3RFW A;  5BXJ A;  3FY1 A;  1HKJ A;  4J4O A;  4DWS D;  2AOS A;  3RM9 A;  2L2S A;  3O5K A;  3KAF A;  2MLY A;  4WK9 A;  1FKK A;  1XHG A;  3CGM A;  1ROT A;  1FAP A;  5J6E A;  4W9Q A;  2VN1 A;  1JNT A;  3UI5 A;  3AS3 A;  4DRJ A;  1J4H A;  5DEZ A;  3KAG A;  3ALG A;  1D6O A;  4DT4 A;  1F40 A;  3ARX A;  4Z2I A;  3OA5 A;  3ARV A;  4XAK A;  3O5M A;  2M1I A;  3OOB A;  2QF8 A;  4W9O A;  2PPP A;  4MNL A;  1UR8 A;  3AS2 A;  3ARW A;  4P8U A;  4WKF A;  4DRK A;  4URI A;  5DF0 A;  3WD4 A;  1P5Q A;  5HW6 A;  2A3B A;  1SR0 A;  2LGO A;  1J4R A;  1OWQ A;  4S3J A;  3WIJ A;  1TFV A;  1HJX A;  4DH0 A;  1LJY A;  1VF8 A;  1D7I A;  4C02 B;  1D7J A;  3QOK A;  1J6Y A;  3KAD A;  1FD9 A;  5HW7 A;  4J4N A;  2KE0 A;  1EIB A;  3ALF A;  1FKB A;  2DSU A;  2LPV A;  1Q6I A;  2WLY A;  1XRV A;  3WQW A;  2XP7 A;  3O5G A;  3G6M A;  4TX0 A;  4N19 A;  1QZ2 A;  1ZU8 A;  2XP6 A;  3TDB A;  1HKK A;  1TCO C;  3UQA A;  2ZQS A;  3LUO A;  3PA7 A;  3EY6 A;  3G6L A;  2ZR5 A;  3O5Q A;  1ZCN A;  1LQ0 A;  3O5L A;  5HKG A;  4ITZ A;  3ARS A;  1NWR A;  1KT1 A;  4S3K A;  3IKD A;  2A3C A;  2MPH A;  1HJV A;  1X6N A;  4P8V A;  2IUZ A;  2RSE A;  2XPB A;  5HT1 A;  4TW6 A;  3TCZ A;  1FKH A;  3RGC A;  4DZ3 A;  1E6N A;  2DSZ A;  2K8I A;  3RME A;  4TYO A;  1WAW A;  1FKD A;  1B6C A;  3AS1 A;  3RM8 A;  3O5D A;  1ROU A;  1M5Y A;  5GQB A;  3ARR A;  4U86 A;  4QT2 A;  2XP4 A;  4ZPW R;  1FKF A;  2D9F A;  2F4E A;  5DIU A;  1RD6 A;  1YW5 A;  1LG2 A;  3PRA A;  1D7H A;  2DG4 A;  3ARZ A;  1EHN A;  4ODO A;  1FKG A;  4DRN A;  1FFQ A;  1WB0 A;  4MAV A;  2PV3 A;  3B9E A;  4DWS B;  3ODK A;  3CHD A;  1N1A A;  4ODM A;  2ZR6 A;  4DWS A;  2PI6 A;  1KT0 A;  3O5P A;  1GUV A;  4U84 A;  4L72 B;  4ODR A;  4WKH A;  2KO7 A;  1EYM A;  2B31 A;  2M08 A;  3O5F A;  1JND A;  1E9L A;  2MNT A;  1FJD A;  4HBO A;  4DZ2 A;  4G2P A;  1YAT A;  3IK8 A;  4QZV B;  4ZS6 A;  3WKZ A;  1FKJ A;  2A3E A;  3AQU A;  1PIN A;  3WD3 A;  1LL4 A;  4GGQ A;  3CH9 A;  1X6L A;  1U79 A;  3WL0 A;  2RQS A;  2JZV A;  2KGJ A;  4ODL A;  1KFW A;  2RUD A;  2RUC A;  3WH0 A;  4Z2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...