3UQIA

Crystallographic structure of fkbp12 from aedes aegypti
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
108
structure length
108
Chain Sequence
MGVQVVTLAAGDEATYPKAGQVAVVHYTGTLADGKVFDSSRTRGKPFRFTVGRGEVIRGWDEGVAQMSVGQRAKLVCSPDYAYGSRGHPGVIPPNATLTFDVELLRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase
publication title High-resolution crystal structure of FKBP12 from Aedes aegypti.
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Isomerase
total genus 26
structure length 108
sequence length 108
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2011-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3uqiA00
4DRIA 4QT2A 2KI3A 3KAHA 5HUAA 1JNTA 5I98A 2RUQA 1FKRA 3TDBA 3OOBA 3CGMA 4FAPA 1ZK6A 4U86A 5HWBA 1D7IA 4DRKA 3TCZA 2JZVA 2RUCA 1FKFA 3NTPA 2FKEA 2KFWA 3RFWA 2Q5AA 3KABA 2XP6A 1KT1A 1Q6UA 4BF8A 4DRJA 1QPFA 1L1PA 2UZ5A 2LGOA 2RQSA 2MF9A 3KAGA 4W9PA 1EYMA 4LAWA 3JYMA 2ZQSA 4J4NA 1ZCNA 4ITZA 4C02B 2KR7A 3WH0A 2IF4A 1ROUA 2PV2A 3MDYB 1EQ3A 2F2DA 3I6CA 1M5YA 2RUDA 3O5KA 2ITKA 1ROTA 4JFIA 5DITA 4ODOA 1Q6HA 1KT0A 2XP7A 1W26A 4IQ2A 2MPHA 4DRHA 2LPVA 4JFKA 4ODPA 3FAPA 2FAPA 4DIPA 3CGNA 3IKDA 3TC5A 4ODQA 1Q1CA 5B8IC 1FD9A 3KZ7A 3NI6A 3O5PA 4DH0A 5HKGA 5D75A 1HXVA 2ZR4A 3IKGA 4TX0A 1J4IA 2VCDA 4O2TA 2N87A 2L2SA 2PV1A 3LUOA 2LKNA 3UI4A 1JNSA 1J4RA 3O5RA 1T11A 4JFJA 4TNSA 2KGJA 4ODRA 2XPBA 2XP3A 3PA7A 2XP4A 3EY6A 5BXJA 2XP8A 4TW7A 1D6OA 1PINA 3JXVA 2ZQTA 2M1IA 3JYJA 1FKKA 2ZQVA 3KADA 3O5DA 4NNRA 4ODKA 2F21A 3UQAA 3GPKA 1R9HA 3RGCA 2MNTA 1PBKA 4G50A 2M08A 4IQCA 4N19A 4MGVA 1FKDA 2DG9A 4U84A 4LAYA 3O5LA 1J4HA 1D7JA 3IHZA 4LAVA 3O5FA 1P5QA 1B6CA 1JVWA 1FKIA 4JFLA 4DT4A 2DG3A 1YATA 2KO7A 5HW8A 4QT3A 4G2PA 3UI5A 4DROA 2XPAA 1Y0OA 2LJ4A 3B7XA 4MSPA 4LAXA 1U79A 2PPPA 2XP9A 4DRMA 5GPGA 1D7HA 1FJDA 1QZ2A 2OFNA 1FKSA 3PRBA 1J6YA 4ODLA 4J4OA 2PPNA 3O5JA 1FAPA 4GIVA 4IPXA 1F8AB 4JFMA 4JYSA 1F40A 2PBCA 2F4EA 1FKJA 1BL4A 1C9HA 3UI6A 2ZR5A 2RSEA 1QPLA 3KAFA 4DRNA 5HW7A 2D9FA 1FKLA 3NRKA 4FN2A 2MLXA 2M2AA 3UQIA 3H9RB 1BKFA 3UF8A 1NMVA 2AWGA 3KAIA 5HW6A 1NSGA 3PRDA 4TYOA 4DRQA 2RURA 3O5MA 2XP5A 3KACA 1N1AA 1FKBA 3O5IA 4QIBA 4R0XA 2PPOA 1A7XA 3O5OA 3VAWA 3IK8A 2PV3A 2DG4A 4TW6A 3KCEA 2ZQUA 1FKTA 1TCOC 5HWCA 3O5GA 5HTGA 3UQBA 1NMWA 2ZR6A 4ODMA 4TW8A 1FKGA 4U85A 2Y78A 4DZ3A 4W9QA 1Q6IA 2KE0A 2VN1A 5HT1A 2K8IA 3O5EA 3ODKA 5J6EA 2MLYA 5DIUA 4GGQA 5DIVA 1YW5A 3O5QA 4ODNA 4DZ2A 4W9OA 1FKHA 2MLZA 4DRPA
chains in the Genus database with same CATH superfamily
2DSWA 4MNJA 2DSZA 1VF8A 2RUQA 5HWBA 1W1VA 2WLYA 1FKFA 2KFWA 1D2KA 1Q6UA 1WAWA 2UZ5A 2A3EA 2PI6A 3KAGA 4W9PA 1JNEA 3MDYB 1M5YA 1SYTA 4P8WA 1HJXA 1KFWA 1Q6HA 5DITA 2XP7A 1W26A 4IQ2A 4ODPA 3FY1A 2EULA 4DWSA 1H0GA 4Q22A 3B8SA 5D75A 3CHDA 3UI4A 1JNSA 2XP3A 4P8VA 2XP8A 1PINA 2ZQTA 3WKZA 3O5DA 2ZQVA 3B9EA 4NNRA 4ZPWR 2F21A 3WQWA 3UQAA 3RGCA 1PBKA 3AQUA 4MGVA 2DSVA 4LAYA 2QF8A 1X6LA 1FKIA 2B31A 5HW8A 1LL7A 2LJ4A 4LAXA 3CHFA 5GPGA 1FJDA 1WNOA 5HBFA 3PRBA 2PPNA 4IPXA 1F8AB 1W1YA 4JFMA 4MAVA 3UI6A 1OGGA 1FKLA 3NRKA 2M2AA 1BKFA 1SR0A 3PRDA 4TYOA 4DRQA 4WKAA 3O5MA 3WD4A 2XP5A 4NZCA 4QIBA 3O5OA 3IK8A 5HWCA 3OA5A 1Q6IA 2K8IA 4ZPVR 4QZVB 4GGQA 3O5QA 3ARXA 1NWTA 4WKHA 2ZR5A 4P8XA 5DEZA 3KAHA 5I98A 4L3NA 4UDMA 3TDBA 3WD3A 1ZK6A 1LJYA 1D7IA 4DRKA 1FFRA 1E44A 2RUCA 3NTPA 3RFWA 2XP6A 4DRJA 1RD6A 1L1PA 1IX5A 2LGOA 2MF9A 1LG1A 2ZQSA 4C02B 1ZCNA 2KR7A 3AS1A 3CH9A 1EDQA 1FFQA 3GU0A 2ITKA 1ROTA 3CHCA 2AOSA 4WK9A 1ZU8A 4JFKA 3CGNA 3IKDA 3TC5A 1Q1CA 3KZ7A 1E9LA 3NI6A 3O5PA 4MNKA 4DH0A 4Z2LA 4TX0A 2L2SA 3LUOA 4PTMA 3W4RA 1J4RA 3O5RA 4Z2IA 5GQBA 3PA7A 3WL0A 2G41A 3AS2A 3WD1A 3GPKA 1R9HA 1UR8A 2MNTA 2M08A 1NWUA 1NWRA 2DG9A 2DT2A 1GUVA 1J4HA 1HKMA 3BMBA 3EIPA 1B6CA 2ETNA 4IT4A 2DT1A 1ZL1A 4QT3A 3UI5A 2XPAA 1HKJA 1Y0OA 4MSPA 1U79A 2PPPA 4WIWA 3RM4A 4DRMA 1D7HA 1ZBVA 1QZ2A 2O92A 1FKSA 2WM0A 1JNDA 4J4OA 3FXYA 2OLHA 3PRAA 1GRJA 4XAKA 2PBCA 2F4EA 4Z2KA 1C9HA 3WD2A 2RSEA 5HW7A 2D9FA 4FN2A 3UQIA 1ZBWA 1NMVA 1E15A 1LQ0A 5JH8A 4Z2HA 1ITXA 4URIA 2ESCA 2PV3A 1FKTA 3ARTA 5GPRA 5HTGA 1E6NA 2ZR6A 4TW8A 4U85A 3CHEA 2Y78A 4HBEA 4W9QA 2B5UB 5HT1A 1X6NA 3ALGA 1EHNA 1HKKA 2MLZA 2KI3A 1W9VA 4S3JA 4FAPA 3CGMA 2YBTA 4KR0B 2JZVA 3ARWA 3GTYX 4HARA 4ZS6A 3KABA 1KT1A 1QPFA 5DF0A 2RQSA 4P8UA 3WH0A 2IF4A 4ML4A 1O6IA 4W5UA 1ROUA 3ARRA 2PV2A 1EQ3A 2RUDA 1W1PA 5DO2A 1H0IA 4ODOA 4DRHA 2MPHA 4IT6A 2LPVA 1W9UA 3FAPA 4ODQA 5B8IC 3G6LA 4O2TA 4Q7NA 2LKNA 1E6PA 2A3CA 1LL6A 1T11A 1XHGA 2KGJA 4ODRA 2XPBA 3RMEA 3EY6A 4TW7A 1D6OA 3JXVA 4WKFA 2M1IA 3JYJA 1FKKA 3WL1A 3ARQA 1E6RA 3ARYA 4DWSC 4G50A 4IQCA 1ZBKA 4U84A 4S3KA 3WD0A 3IHZA 4LAVA 1JVWA 1GPFA 4JFLA 1YATA 4LGXA 4G2PA 4AY1A 1J6YA 3ARPA 4ODLA 4GIVA 3CZ8A 1BL4A 2DPEA 3KAFA 3B9DA 1GOIA 2MLXA 4MNMA 3RM8A 3H9RB 3UF8A 3ALFA 2AWGA 2WLZA 3KAIA 3ARUA 1NSGA 3KACA 1FKBA 1A7XA 1K9TA 2A3AA 2G8ZA 3KCEA 2ZQUA 3PR9A 3O5GA 1LG2A 3UQBA 1NMWA 4ODMA 2FDMA 4DZ3A 2KE0A 3O5EA 3ODKA 5J6EA 3B9AA 4ODNA 4DZ2A 4DRPA 2WK2A 4DRIA 1NWSA 4QT2A 5HUAA 1JNTA 2DT0A 2F23A 3ARZA 1FKRA 3OOBA 4ZPTR 4U86A 3TCZA 4DWSB 2FKEA 2Q5AA 4BF8A 4L72B 1ZBCA 4NSBA 4Z2JA 1EYMA 1HJWA 4LAWA 3JYMA 4R5EA 1EIBA 4J4NA 4ITZA 2O9OA 4HBOA 2IUZA 4DWSD 1E6ZA 1TFVA 2F2DA 1UR9A 3I6CA 3O5KA 4JFIA 1KT0A 1OWQA 3ARSA 4DIPA 2FAPA 3AS0A 4KQZA 1FD9A 1HXVA 3RM9A 1HKIA 5HKGA 2ZR4A 3IKGA 1J4IA 2VCDA 2N87A 2PV1A 3AS3A 3BXWA 4TNSA 4JFJA 5BXJA 2XP4A 1WB0A 1OGBA 3KADA 1LL4A 2DSUA 4ODKA 1JCHB 4Z2GA 4N19A 2YBUA 1FKDA 4MNLA 3O5LA 3QOKA 1D7JA 3O5FA 1P5QA 4DT4A 2DG3A 2KO7A 4DROA 1CTNA 3B7XA 3AROA 3G6MA 2XP9A 2OFNA 1W1TA 3O5JA 1FAPA 1NH6A 4JYSA 4MPKA 1F40A 1FKJA 1W9PA 1QPLA 4DRNA 3ARVA 3WIJA 2PN0A 5HW6A 4WJXA 1ZB5A 2RURA 3O5IA 1N1AA 4R0XA 3VAWA 2PPOA 2A3BA 2DG4A 4TW6A 1HJVA 3WQVA 4MTVA 1TCOC 2P4VA 1FKGA 2VN1A 1XRVA 2MLYA 2DT3A 5DIUA 5DIVA 1YW5A 4W9OA 1FKHA
chains in the Genus database with same CATH topology
2DSWA 4MNJA 2DSZA 1VF8A 2RUQA 5HWBA 1W1VA 2WLYA 1FKFA 2KFWA 1D2KA 1Q6UA 1WAWA 2UZ5A 2A3EA 2PI6A 3KAGA 4W9PA 1JNEA 3MDYB 1M5YA 1SYTA 4P8WA 1HJXA 1KFWA 1Q6HA 5DITA 2XP7A 1W26A 4IQ2A 4ODPA 3FY1A 4DWSA 1H0GA 4Q22A 3B8SA 5D75A 3CHDA 3UI4A 1JNSA 2XP3A 4P8VA 2XP8A 1PINA 2ZQTA 3WKZA 3O5DA 2ZQVA 3B9EA 4NNRA 4ZPWR 2F21A 3WQWA 3UQAA 3RGCA 1PBKA 3AQUA 4MGVA 2DSVA 4LAYA 2QF8A 1X6LA 1FKIA 2B31A 5HW8A 1LL7A 2LJ4A 4LAXA 3CHFA 5GPGA 1FJDA 1WNOA 5HBFA 3PRBA 2PPNA 4IPXA 1F8AB 1W1YA 4JFMA 4MAVA 3UI6A 1OGGA 1FKLA 3NRKA 2M2AA 1BKFA 1SR0A 3PRDA 4TYOA 4DRQA 4WKAA 3O5MA 3WD4A 2XP5A 4NZCA 4QIBA 3O5OA 3IK8A 5HWCA 3OA5A 1Q6IA 2K8IA 4ZPVR 4QZVB 4GGQA 3O5QA 3ARXA 1NWTA 4WKHA 2ZR5A 4P8XA 5DEZA 3KAHA 5I98A 4L3NA 3TDBA 3WD3A 1ZK6A 1LJYA 1D7IA 4DRKA 1FFRA 2RUCA 3NTPA 3RFWA 2XP6A 4DRJA 1RD6A 1L1PA 1IX5A 2LGOA 2MF9A 1LG1A 2ZQSA 4C02B 1ZCNA 2KR7A 3AS1A 3CH9A 1EDQA 1FFQA 2ITKA 1ROTA 3CHCA 2AOSA 4WK9A 1ZU8A 4JFKA 3CGNA 3IKDA 3TC5A 1Q1CA 3KZ7A 1E9LA 3NI6A 3O5PA 4MNKA 4DH0A 4Z2LA 4TX0A 2L2SA 3LUOA 4PTMA 3W4RA 1J4RA 3O5RA 4Z2IA 5GQBA 3PA7A 3WL0A 2G41A 3AS2A 3WD1A 3GPKA 1R9HA 1UR8A 2MNTA 2M08A 1NWUA 1NWRA 2DG9A 2DT2A 1GUVA 1J4HA 1HKMA 1B6CA 4IT4A 2DT1A 1ZL1A 4QT3A 3UI5A 2XPAA 1HKJA 1Y0OA 4MSPA 1U79A 2PPPA 4WIWA 3RM4A 4DRMA 1D7HA 1ZBVA 1QZ2A 2O92A 1FKSA 2WM0A 1JNDA 4J4OA 3FXYA 2OLHA 3PRAA 4XAKA 2PBCA 2F4EA 4Z2KA 1C9HA 3WD2A 2RSEA 5HW7A 2D9FA 4FN2A 3UQIA 1ZBWA 1NMVA 1E15A 1LQ0A 5JH8A 4Z2HA 1ITXA 4URIA 2ESCA 2PV3A 1FKTA 3ARTA 5GPRA 5HTGA 1E6NA 2ZR6A 4TW8A 4U85A 3CHEA 2Y78A 4HBEA 4W9QA 5HT1A 1X6NA 3ALGA 1EHNA 1HKKA 2MLZA 2KI3A 1W9VA 4S3JA 4FAPA 3CGMA 2YBTA 4KR0B 2JZVA 3ARWA 4HARA 4ZS6A 3KABA 1KT1A 1QPFA 5DF0A 2RQSA 4P8UA 3WH0A 2IF4A 4ML4A 1O6IA 4W5UA 1ROUA 3ARRA 2PV2A 1EQ3A 2RUDA 1W1PA 5DO2A 1H0IA 4ODOA 4DRHA 2MPHA 4IT6A 2LPVA 1W9UA 3FAPA 4ODQA 5B8IC 3G6LA 4O2TA 4Q7NA 2LKNA 1E6PA 2A3CA 1LL6A 1T11A 1XHGA 2KGJA 4ODRA 2XPBA 3RMEA 3EY6A 4TW7A 1D6OA 3JXVA 4WKFA 2M1IA 3JYJA 1FKKA 3WL1A 3ARQA 1E6RA 3ARYA 4DWSC 4G50A 4IQCA 1ZBKA 4U84A 4S3KA 3WD0A 3IHZA 4LAVA 1JVWA 1GPFA 4JFLA 1YATA 4LGXA 4G2PA 4AY1A 1J6YA 3ARPA 4ODLA 4GIVA 3CZ8A 1BL4A 2DPEA 3KAFA 3B9DA 1GOIA 2MLXA 4MNMA 3RM8A 3H9RB 3UF8A 3ALFA 2AWGA 2WLZA 3KAIA 3ARUA 1NSGA 3KACA 1FKBA 1A7XA 1K9TA 2A3AA 2G8ZA 3KCEA 2ZQUA 3PR9A 3O5GA 1LG2A 3UQBA 1NMWA 4ODMA 2FDMA 4DZ3A 2KE0A 3O5EA 3ODKA 5J6EA 3B9AA 4ODNA 4DZ2A 4DRPA 2WK2A 4DRIA 1NWSA 4QT2A 5HUAA 1JNTA 2DT0A 3ARZA 1FKRA 3OOBA 4ZPTR 4U86A 3TCZA 4DWSB 2FKEA 2Q5AA 4BF8A 4L72B 1ZBCA 4NSBA 4Z2JA 1EYMA 1HJWA 4LAWA 3JYMA 4R5EA 1EIBA 4J4NA 4ITZA 2O9OA 4HBOA 2IUZA 4DWSD 1E6ZA 1TFVA 2F2DA 1UR9A 3I6CA 3O5KA 4JFIA 1KT0A 1OWQA 3ARSA 4DIPA 2FAPA 3AS0A 4KQZA 1FD9A 1HXVA 3RM9A 1HKIA 5HKGA 2ZR4A 3IKGA 1J4IA 2VCDA 2N87A 2PV1A 3AS3A 3BXWA 4TNSA 4JFJA 5BXJA 2XP4A 1WB0A 1OGBA 3KADA 1LL4A 2DSUA 4ODKA 4Z2GA 4N19A 2YBUA 1FKDA 4MNLA 3O5LA 3QOKA 1D7JA 3O5FA 1P5QA 4DT4A 2DG3A 2KO7A 4DROA 1CTNA 3B7XA 3AROA 3G6MA 2XP9A 2OFNA 1W1TA 3O5JA 1FAPA 1NH6A 4JYSA 4MPKA 1F40A 1FKJA 1W9PA 1QPLA 4DRNA 3ARVA 3WIJA 5HW6A 4WJXA 1ZB5A 2RURA 3O5IA 1N1AA 4R0XA 3VAWA 2PPOA 2A3BA 2DG4A 4TW6A 1HJVA 3WQVA 4MTVA 1TCOC 1FKGA 2VN1A 1XRVA 2MLYA 2DT3A 5DIUA 5DIVA 1YW5A 4W9OA 1FKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRI A;  4QT2 A;  2KI3 A;  3KAH A;  5HUA A;  1JNT A;  5I98 A;  2RUQ A;  1FKR A;  3TDB A;  3OOB A;  3CGM A;  4FAP A;  1ZK6 A;  4U86 A;  5HWB A;  1D7I A;  4DRK A;  3TCZ A;  2JZV A;  2RUC A;  1FKF A;  3NTP A;  2FKE A;  2KFW A;  3RFW A;  2Q5A A;  3KAB A;  2XP6 A;  1KT1 A;  1Q6U A;  4BF8 A;  4DRJ A;  1QPF A;  1L1P A;  2UZ5 A;  2LGO A;  2RQS A;  2MF9 A;  3KAG A;  4W9P A;  1EYM A;  4LAW A;  3JYM A;  2ZQS A;  4J4N A;  1ZCN A;  4ITZ A;  4C02 B;  2KR7 A;  3WH0 A;  2IF4 A;  1ROU A;  2PV2 A;  3MDY B;  1EQ3 A;  2F2D A;  3I6C A;  1M5Y A;  2RUD A;  3O5K A;  2ITK A;  1ROT A;  4JFI A;  5DIT A;  4ODO A;  1Q6H A;  1KT0 A;  2XP7 A;  1W26 A;  4IQ2 A;  2MPH A;  4DRH A;  2LPV A;  4JFK A;  4ODP A;  3FAP A;  2FAP A;  4DIP A;  3CGN A;  3IKD A;  3TC5 A;  4ODQ A;  1Q1C A;  5B8I C;  1FD9 A;  3KZ7 A;  3NI6 A;  3O5P A;  4DH0 A;  5HKG A;  5D75 A;  1HXV A;  2ZR4 A;  3IKG A;  4TX0 A;  1J4I A;  2VCD A;  4O2T A;  2N87 A;  2L2S A;  2PV1 A;  3LUO A;  2LKN A;  3UI4 A;  1JNS A;  1J4R A;  3O5R A;  1T11 A;  4JFJ A;  4TNS A;  2KGJ A;  4ODR A;  2XPB A;  2XP3 A;  3PA7 A;  2XP4 A;  3EY6 A;  5BXJ A;  2XP8 A;  4TW7 A;  1D6O A;  1PIN A;  3JXV A;  2ZQT A;  2M1I A;  3JYJ A;  1FKK A;  2ZQV A;  3KAD A;  3O5D A;  4NNR A;  4ODK A;  2F21 A;  3UQA A;  3GPK A;  1R9H A;  3RGC A;  2MNT A;  1PBK A;  4G50 A;  2M08 A;  4IQC A;  4N19 A;  4MGV A;  1FKD A;  2DG9 A;  4U84 A;  4LAY A;  3O5L A;  1J4H A;  1D7J A;  3IHZ A;  4LAV A;  3O5F A;  1P5Q A;  1B6C A;  1JVW A;  1FKI A;  4JFL A;  4DT4 A;  2DG3 A;  1YAT A;  2KO7 A;  5HW8 A;  4QT3 A;  4G2P A;  3UI5 A;  4DRO A;  2XPA A;  1Y0O A;  2LJ4 A;  3B7X A;  4MSP A;  4LAX A;  1U79 A;  2PPP A;  2XP9 A;  4DRM A;  5GPG A;  1D7H A;  1FJD A;  1QZ2 A;  2OFN A;  1FKS A;  3PRB A;  1J6Y A;  4ODL A;  4J4O A;  2PPN A;  3O5J A;  1FAP A;  4GIV A;  4IPX A;  1F8A B;  4JFM A;  4JYS A;  1F40 A;  2PBC A;  2F4E A;  1FKJ A;  1BL4 A;  1C9H A;  3UI6 A;  2ZR5 A;  2RSE A;  1QPL A;  3KAF A;  4DRN A;  5HW7 A;  2D9F A;  1FKL A;  3NRK A;  4FN2 A;  2MLX A;  2M2A A;  3UQI A;  3H9R B;  1BKF A;  3UF8 A;  1NMV A;  2AWG A;  3KAI A;  5HW6 A;  1NSG A;  3PRD A;  4TYO A;  4DRQ A;  2RUR A;  3O5M A;  2XP5 A;  3KAC A;  1N1A A;  1FKB A;  3O5I A;  4QIB A;  4R0X A;  2PPO A;  1A7X A;  3O5O A;  3VAW A;  3IK8 A;  2PV3 A;  2DG4 A;  4TW6 A;  3KCE A;  2ZQU A;  1FKT A;  1TCO C;  5HWC A;  3O5G A;  5HTG A;  3UQB A;  1NMW A;  2ZR6 A;  4ODM A;  4TW8 A;  1FKG A;  4U85 A;  2Y78 A;  4DZ3 A;  4W9Q A;  1Q6I A;  2KE0 A;  2VN1 A;  5HT1 A;  2K8I A;  3O5E A;  3ODK A;  5J6E A;  2MLY A;  5DIU A;  4GGQ A;  5DIV A;  1YW5 A;  3O5Q A;  4ODN A;  4DZ2 A;  4W9O A;  1FKH A;  2MLZ A;  4DRP A; 
#chains in the Genus database with same CATH topology
 2DSW A;  4MNJ A;  2DSZ A;  1VF8 A;  2RUQ A;  5HWB A;  1W1V A;  2WLY A;  1FKF A;  2KFW A;  1D2K A;  1Q6U A;  1WAW A;  2UZ5 A;  2A3E A;  2PI6 A;  3KAG A;  4W9P A;  1JNE A;  3MDY B;  1M5Y A;  1SYT A;  4P8W A;  1HJX A;  1KFW A;  1Q6H A;  5DIT A;  2XP7 A;  1W26 A;  4IQ2 A;  4ODP A;  3FY1 A;  2EUL A;  4DWS A;  1H0G A;  4Q22 A;  3B8S A;  5D75 A;  3CHD A;  3UI4 A;  1JNS A;  2XP3 A;  4P8V A;  2XP8 A;  1PIN A;  2ZQT A;  3WKZ A;  3O5D A;  2ZQV A;  3B9E A;  4NNR A;  4ZPW R;  2F21 A;  3WQW A;  3UQA A;  3RGC A;  1PBK A;  3AQU A;  4MGV A;  2DSV A;  4LAY A;  2QF8 A;  1X6L A;  1FKI A;  2B31 A;  5HW8 A;  1LL7 A;  2LJ4 A;  4LAX A;  3CHF A;  5GPG A;  1FJD A;  1WNO A;  5HBF A;  3PRB A;  2PPN A;  4IPX A;  1F8A B;  1W1Y A;  4JFM A;  4MAV A;  3UI6 A;  1OGG A;  1FKL A;  3NRK A;  2M2A A;  1BKF A;  1SR0 A;  3PRD A;  4TYO A;  4DRQ A;  4WKA A;  3O5M A;  3WD4 A;  2XP5 A;  4NZC A;  4QIB A;  3O5O A;  3IK8 A;  5HWC A;  3OA5 A;  1Q6I A;  2K8I A;  4ZPV R;  4QZV B;  4GGQ A;  3O5Q A;  3ARX A;  1NWT A;  4WKH A;  2ZR5 A;  4P8X A;  5DEZ A;  3KAH A;  5I98 A;  4L3N A;  4UDM A;  3TDB A;  3WD3 A;  1ZK6 A;  1LJY A;  1D7I A;  4DRK A;  1FFR A;  1E44 A;  2RUC A;  3NTP A;  3RFW A;  2XP6 A;  4DRJ A;  1RD6 A;  1L1P A;  1IX5 A;  2LGO A;  2MF9 A;  1LG1 A;  2ZQS A;  4C02 B;  1ZCN A;  2KR7 A;  3AS1 A;  3CH9 A;  1EDQ A;  1FFQ A;  3GU0 A;  2ITK A;  1ROT A;  3CHC A;  2AOS A;  4WK9 A;  1ZU8 A;  4JFK A;  3CGN A;  3IKD A;  3TC5 A;  1Q1C A;  3KZ7 A;  1E9L A;  3NI6 A;  3O5P A;  4MNK A;  4DH0 A;  4Z2L A;  4TX0 A;  2L2S A;  3LUO A;  4PTM A;  3W4R A;  1J4R A;  3O5R A;  4Z2I A;  5GQB A;  3PA7 A;  3WL0 A;  2G41 A;  3AS2 A;  3WD1 A;  3GPK A;  1R9H A;  1UR8 A;  2MNT A;  2M08 A;  1NWU A;  1NWR A;  2DG9 A;  2DT2 A;  1GUV A;  1J4H A;  1HKM A;  3BMB A;  3EIP A;  1B6C A;  2ETN A;  4IT4 A;  2DT1 A;  1ZL1 A;  4QT3 A;  3UI5 A;  2XPA A;  1HKJ A;  1Y0O A;  4MSP A;  1U79 A;  2PPP A;  4WIW A;  3RM4 A;  4DRM A;  1D7H A;  1ZBV A;  1QZ2 A;  2O92 A;  1FKS A;  2WM0 A;  1JND A;  4J4O A;  3FXY A;  2OLH A;  3PRA A;  1GRJ A;  4XAK A;  2PBC A;  2F4E A;  4Z2K A;  1C9H A;  3WD2 A;  2RSE A;  5HW7 A;  2D9F A;  4FN2 A;  3UQI A;  1ZBW A;  1NMV A;  1E15 A;  1LQ0 A;  5JH8 A;  4Z2H A;  1ITX A;  4URI A;  2ESC A;  2PV3 A;  1FKT A;  3ART A;  5GPR A;  5HTG A;  1E6N A;  2ZR6 A;  4TW8 A;  4U85 A;  3CHE A;  2Y78 A;  4HBE A;  4W9Q A;  2B5U B;  5HT1 A;  1X6N A;  3ALG A;  1EHN A;  1HKK A;  2MLZ A;  2KI3 A;  1W9V A;  4S3J A;  4FAP A;  3CGM A;  2YBT A;  4KR0 B;  2JZV A;  3ARW A;  3GTY X;  4HAR A;  4ZS6 A;  3KAB A;  1KT1 A;  1QPF A;  5DF0 A;  2RQS A;  4P8U A;  3WH0 A;  2IF4 A;  4ML4 A;  1O6I A;  4W5U A;  1ROU A;  3ARR A;  2PV2 A;  1EQ3 A;  2RUD A;  1W1P A;  5DO2 A;  1H0I A;  4ODO A;  4DRH A;  2MPH A;  4IT6 A;  2LPV A;  1W9U A;  3FAP A;  4ODQ A;  5B8I C;  3G6L A;  4O2T A;  4Q7N A;  2LKN A;  1E6P A;  2A3C A;  1LL6 A;  1T11 A;  1XHG A;  2KGJ A;  4ODR A;  2XPB A;  3RME A;  3EY6 A;  4TW7 A;  1D6O A;  3JXV A;  4WKF A;  2M1I A;  3JYJ A;  1FKK A;  3WL1 A;  3ARQ A;  1E6R A;  3ARY A;  4DWS C;  4G50 A;  4IQC A;  1ZBK A;  4U84 A;  4S3K A;  3WD0 A;  3IHZ A;  4LAV A;  1JVW A;  1GPF A;  4JFL A;  1YAT A;  4LGX A;  4G2P A;  4AY1 A;  1J6Y A;  3ARP A;  4ODL A;  4GIV A;  3CZ8 A;  1BL4 A;  2DPE A;  3KAF A;  3B9D A;  1GOI A;  2MLX A;  4MNM A;  3RM8 A;  3H9R B;  3UF8 A;  3ALF A;  2AWG A;  2WLZ A;  3KAI A;  3ARU A;  1NSG A;  3KAC A;  1FKB A;  1A7X A;  1K9T A;  2A3A A;  2G8Z A;  3KCE A;  2ZQU A;  3PR9 A;  3O5G A;  1LG2 A;  3UQB A;  1NMW A;  4ODM A;  2FDM A;  4DZ3 A;  2KE0 A;  3O5E A;  3ODK A;  5J6E A;  3B9A A;  4ODN A;  4DZ2 A;  4DRP A;  2WK2 A;  4DRI A;  1NWS A;  4QT2 A;  5HUA A;  1JNT A;  2DT0 A;  2F23 A;  3ARZ A;  1FKR A;  3OOB A;  4ZPT R;  4U86 A;  3TCZ A;  4DWS B;  2FKE A;  2Q5A A;  4BF8 A;  4L72 B;  1ZBC A;  4NSB A;  4Z2J A;  1EYM A;  1HJW A;  4LAW A;  3JYM A;  4R5E A;  1EIB A;  4J4N A;  4ITZ A;  2O9O A;  4HBO A;  2IUZ A;  4DWS D;  1E6Z A;  1TFV A;  2F2D A;  1UR9 A;  3I6C A;  3O5K A;  4JFI A;  1KT0 A;  1OWQ A;  3ARS A;  4DIP A;  2FAP A;  3AS0 A;  4KQZ A;  1FD9 A;  1HXV A;  3RM9 A;  1HKI A;  5HKG A;  2ZR4 A;  3IKG A;  1J4I A;  2VCD A;  2N87 A;  2PV1 A;  3AS3 A;  3BXW A;  4TNS A;  4JFJ A;  5BXJ A;  2XP4 A;  1WB0 A;  1OGB A;  3KAD A;  1LL4 A;  2DSU A;  4ODK A;  1JCH B;  4Z2G A;  4N19 A;  2YBU A;  1FKD A;  4MNL A;  3O5L A;  3QOK A;  1D7J A;  3O5F A;  1P5Q A;  4DT4 A;  2DG3 A;  2KO7 A;  4DRO A;  1CTN A;  3B7X A;  3ARO A;  3G6M A;  2XP9 A;  2OFN A;  1W1T A;  3O5J A;  1FAP A;  1NH6 A;  4JYS A;  4MPK A;  1F40 A;  1FKJ A;  1W9P A;  1QPL A;  4DRN A;  3ARV A;  3WIJ A;  2PN0 A;  5HW6 A;  4WJX A;  1ZB5 A;  2RUR A;  3O5I A;  1N1A A;  4R0X A;  3VAW A;  2PPO A;  2A3B A;  2DG4 A;  4TW6 A;  1HJV A;  3WQV A;  4MTV A;  1TCO C;  2P4V A;  1FKG A;  2VN1 A;  1XRV A;  2MLY A;  2DT3 A;  5DIU A;  5DIV A;  1YW5 A;  4W9O A;  1FKH A; 
#chains in the Genus database with same CATH homology
 2DSW A;  4MNJ A;  2DSZ A;  1VF8 A;  2RUQ A;  5HWB A;  1W1V A;  2WLY A;  1FKF A;  2KFW A;  1D2K A;  1Q6U A;  1WAW A;  2UZ5 A;  2A3E A;  2PI6 A;  3KAG A;  4W9P A;  1JNE A;  3MDY B;  1M5Y A;  1SYT A;  4P8W A;  1HJX A;  1KFW A;  1Q6H A;  5DIT A;  2XP7 A;  1W26 A;  4IQ2 A;  4ODP A;  3FY1 A;  4DWS A;  1H0G A;  4Q22 A;  3B8S A;  5D75 A;  3CHD A;  3UI4 A;  1JNS A;  2XP3 A;  4P8V A;  2XP8 A;  1PIN A;  2ZQT A;  3WKZ A;  3O5D A;  2ZQV A;  3B9E A;  4NNR A;  4ZPW R;  2F21 A;  3WQW A;  3UQA A;  3RGC A;  1PBK A;  3AQU A;  4MGV A;  2DSV A;  4LAY A;  2QF8 A;  1X6L A;  1FKI A;  2B31 A;  5HW8 A;  1LL7 A;  2LJ4 A;  4LAX A;  3CHF A;  5GPG A;  1FJD A;  1WNO A;  5HBF A;  3PRB A;  2PPN A;  4IPX A;  1F8A B;  1W1Y A;  4JFM A;  4MAV A;  3UI6 A;  1OGG A;  1FKL A;  3NRK A;  2M2A A;  1BKF A;  1SR0 A;  3PRD A;  4TYO A;  4DRQ A;  4WKA A;  3O5M A;  3WD4 A;  2XP5 A;  4NZC A;  4QIB A;  3O5O A;  3IK8 A;  5HWC A;  3OA5 A;  1Q6I A;  2K8I A;  4ZPV R;  4QZV B;  4GGQ A;  3O5Q A;  3ARX A;  1NWT A;  4WKH A;  2ZR5 A;  4P8X A;  5DEZ A;  3KAH A;  5I98 A;  4L3N A;  3TDB A;  3WD3 A;  1ZK6 A;  1LJY A;  1D7I A;  4DRK A;  1FFR A;  2RUC A;  3NTP A;  3RFW A;  2XP6 A;  4DRJ A;  1RD6 A;  1L1P A;  1IX5 A;  2LGO A;  2MF9 A;  1LG1 A;  2ZQS A;  4C02 B;  1ZCN A;  2KR7 A;  3AS1 A;  3CH9 A;  1EDQ A;  1FFQ A;  2ITK A;  1ROT A;  3CHC A;  2AOS A;  4WK9 A;  1ZU8 A;  4JFK A;  3CGN A;  3IKD A;  3TC5 A;  1Q1C A;  3KZ7 A;  1E9L A;  3NI6 A;  3O5P A;  4MNK A;  4DH0 A;  4Z2L A;  4TX0 A;  2L2S A;  3LUO A;  4PTM A;  3W4R A;  1J4R A;  3O5R A;  4Z2I A;  5GQB A;  3PA7 A;  3WL0 A;  2G41 A;  3AS2 A;  3WD1 A;  3GPK A;  1R9H A;  1UR8 A;  2MNT A;  2M08 A;  1NWU A;  1NWR A;  2DG9 A;  2DT2 A;  1GUV A;  1J4H A;  1HKM A;  1B6C A;  4IT4 A;  2DT1 A;  1ZL1 A;  4QT3 A;  3UI5 A;  2XPA A;  1HKJ A;  1Y0O A;  4MSP A;  1U79 A;  2PPP A;  4WIW A;  3RM4 A;  4DRM A;  1D7H A;  1ZBV A;  1QZ2 A;  2O92 A;  1FKS A;  2WM0 A;  1JND A;  4J4O A;  3FXY A;  2OLH A;  3PRA A;  4XAK A;  2PBC A;  2F4E A;  4Z2K A;  1C9H A;  3WD2 A;  2RSE A;  5HW7 A;  2D9F A;  4FN2 A;  3UQI A;  1ZBW A;  1NMV A;  1E15 A;  1LQ0 A;  5JH8 A;  4Z2H A;  1ITX A;  4URI A;  2ESC A;  2PV3 A;  1FKT A;  3ART A;  5GPR A;  5HTG A;  1E6N A;  2ZR6 A;  4TW8 A;  4U85 A;  3CHE A;  2Y78 A;  4HBE A;  4W9Q A;  5HT1 A;  1X6N A;  3ALG A;  1EHN A;  1HKK A;  2MLZ A;  2KI3 A;  1W9V A;  4S3J A;  4FAP A;  3CGM A;  2YBT A;  4KR0 B;  2JZV A;  3ARW A;  4HAR A;  4ZS6 A;  3KAB A;  1KT1 A;  1QPF A;  5DF0 A;  2RQS A;  4P8U A;  3WH0 A;  2IF4 A;  4ML4 A;  1O6I A;  4W5U A;  1ROU A;  3ARR A;  2PV2 A;  1EQ3 A;  2RUD A;  1W1P A;  5DO2 A;  1H0I A;  4ODO A;  4DRH A;  2MPH A;  4IT6 A;  2LPV A;  1W9U A;  3FAP A;  4ODQ A;  5B8I C;  3G6L A;  4O2T A;  4Q7N A;  2LKN A;  1E6P A;  2A3C A;  1LL6 A;  1T11 A;  1XHG A;  2KGJ A;  4ODR A;  2XPB A;  3RME A;  3EY6 A;  4TW7 A;  1D6O A;  3JXV A;  4WKF A;  2M1I A;  3JYJ A;  1FKK A;  3WL1 A;  3ARQ A;  1E6R A;  3ARY A;  4DWS C;  4G50 A;  4IQC A;  1ZBK A;  4U84 A;  4S3K A;  3WD0 A;  3IHZ A;  4LAV A;  1JVW A;  1GPF A;  4JFL A;  1YAT A;  4LGX A;  4G2P A;  4AY1 A;  1J6Y A;  3ARP A;  4ODL A;  4GIV A;  3CZ8 A;  1BL4 A;  2DPE A;  3KAF A;  3B9D A;  1GOI A;  2MLX A;  4MNM A;  3RM8 A;  3H9R B;  3UF8 A;  3ALF A;  2AWG A;  2WLZ A;  3KAI A;  3ARU A;  1NSG A;  3KAC A;  1FKB A;  1A7X A;  1K9T A;  2A3A A;  2G8Z A;  3KCE A;  2ZQU A;  3PR9 A;  3O5G A;  1LG2 A;  3UQB A;  1NMW A;  4ODM A;  2FDM A;  4DZ3 A;  2KE0 A;  3O5E A;  3ODK A;  5J6E A;  3B9A A;  4ODN A;  4DZ2 A;  4DRP A;  2WK2 A;  4DRI A;  1NWS A;  4QT2 A;  5HUA A;  1JNT A;  2DT0 A;  3ARZ A;  1FKR A;  3OOB A;  4ZPT R;  4U86 A;  3TCZ A;  4DWS B;  2FKE A;  2Q5A A;  4BF8 A;  4L72 B;  1ZBC A;  4NSB A;  4Z2J A;  1EYM A;  1HJW A;  4LAW A;  3JYM A;  4R5E A;  1EIB A;  4J4N A;  4ITZ A;  2O9O A;  4HBO A;  2IUZ A;  4DWS D;  1E6Z A;  1TFV A;  2F2D A;  1UR9 A;  3I6C A;  3O5K A;  4JFI A;  1KT0 A;  1OWQ A;  3ARS A;  4DIP A;  2FAP A;  3AS0 A;  4KQZ A;  1FD9 A;  1HXV A;  3RM9 A;  1HKI A;  5HKG A;  2ZR4 A;  3IKG A;  1J4I A;  2VCD A;  2N87 A;  2PV1 A;  3AS3 A;  3BXW A;  4TNS A;  4JFJ A;  5BXJ A;  2XP4 A;  1WB0 A;  1OGB A;  3KAD A;  1LL4 A;  2DSU A;  4ODK A;  4Z2G A;  4N19 A;  2YBU A;  1FKD A;  4MNL A;  3O5L A;  3QOK A;  1D7J A;  3O5F A;  1P5Q A;  4DT4 A;  2DG3 A;  2KO7 A;  4DRO A;  1CTN A;  3B7X A;  3ARO A;  3G6M A;  2XP9 A;  2OFN A;  1W1T A;  3O5J A;  1FAP A;  1NH6 A;  4JYS A;  4MPK A;  1F40 A;  1FKJ A;  1W9P A;  1QPL A;  4DRN A;  3ARV A;  3WIJ A;  5HW6 A;  4WJX A;  1ZB5 A;  2RUR A;  3O5I A;  1N1A A;  4R0X A;  3VAW A;  2PPO A;  2A3B A;  2DG4 A;  4TW6 A;  1HJV A;  3WQV A;  4MTV A;  1TCO C;  1FKG A;  2VN1 A;  1XRV A;  2MLY A;  2DT3 A;  5DIU A;  5DIV A;  1YW5 A;  4W9O A;  1FKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...