1J4HA

Crystal structure analysis of the fkbp12 complexed with 000107 small molecule
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and structure-based study of new potential FKBP12 inhibitors
pubmed rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords FKBP12
total genus 27
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1j4hA00
2F21A 1N1AA 4MGVA 1FKJA 3PRBA 3O5MA 1ZK6A 4QIBA 4TYOA 4DRKA 4LAYA 1FKLA 2OFNA 4DRQA 3KABA 2ZR6A 2LPVA 4IQCA 2KGJA 2M1IA 2N87A 1R9HA 2VCDA 2RURA 1ZCNA 3O5OA 4W9QA 2XPBA 1EYMA 2RUDA 4DZ3A 4LAXA 5HKGA 4TW8A 3KCEA 4JFMA 5HW6A 3NRKA 1P5QA 1FKFA 2LKNA 2VN1A 5D75A 1D7JA 4W9OA 3NI6A 1ROUA 2Q5AA 2XP8A 3O5JA 2KO7A 1EQ3A 4TW7A 4O2TA 2MLZA 3O5FA 3O5LA 2MF9A 4DH0A 4ODMA 2RSEA 3O5KA 3IKDA 2F4EA 3KZ7A 4JFIA 4JFLA 5GPGA 4DT4A 4DRNA 1J4RA 2XP9A 2XP6A 4QT2A 2MLXA 3UI5A 3O5GA 3PRDA 4DROA 4DRPA 4ODPA 1TCOC 4IQ2A 2LJ4A 2DG4A 1NMWA 2MLYA 2K8IA 4MSPA 3KAIA 1F40A 2M2AA 4R0XA 4FN2A 1BKFA 1PINA 3KAGA 4ODOA 3O5RA 5B8IC 4U86A 1JVWA 1FKGA 3TDBA 2MNTA 3KACA 1FKHA 4W9PA 2MPHA 3VAWA 4JFKA 5HWBA 3RGCA 1QZ2A 4J4NA 1Q1CA 4U85A 4G50A 2RUCA 2PV2A 4LAVA 4TW6A 4ODKA 2JZVA 5DIVA 4LAWA 2PV3A 2AWGA 1FKIA 2FKEA 2ZQVA 4JFJA 2UZ5A 4DZ2A 1L1PA 3UQAA 1W26A 4ITZA 1QPFA 3MDYB 5HT1A 3JYJA 3UI4A 5HW8A 5I98A 3JXVA 3UQIA 2ZQSA 4DRMA 1FAPA 3O5EA 2ITKA 1FKSA 5DITA 3KADA 1KT1A 2XP3A 1Q6IA 4JYSA 3PA7A 4GIVA 1F8AB 3KAFA 4U84A 4ODRA 1ROTA 2DG9A 1FKRA 3KAHA 3O5IA 5HWCA 4ODQA 1KT0A 4N19A 4G2PA 2D9FA 2RQSA 1J4HA 3NTPA 4TX0A 1J6YA 3JYMA 2PPOA 1NSGA 3IHZA 4ODNA 1T11A 3O5DA 1D7HA 4DIPA 3UQBA 2IF4A 2PV1A 1D6OA 3UF8A 2ZQUA 2KE0A 1C9HA 3CGMA 1B6CA 2ZQTA 3CGNA 4GGQA 2KFWA 5HTGA 1FKKA 3RFWA 1JNSA 3B7XA 3ODKA 3I6CA 4FAPA 4C02B 2Y78A 4QT3A 1D7IA 1YW5A 1U79A 4DRIA 1Q6HA 1Y0OA 1NMVA 4DRHA 2XP5A 2DG3A 3O5QA 2KR7A 4TNSA 5DIUA 3UI6A 5HW7A 5HUAA 3FAPA 3EY6A 5J6EA 1Q6UA 2LGOA 2PPNA 1QPLA 1JNTA 3OOBA 3TC5A 1FKTA 1M5YA 2L2SA 2XP7A 3LUOA 4IPXA 4BF8A 1FKBA 2F2DA 4DRJA 2PPPA 2XP4A 4ODLA 5BXJA 1FD9A 1FJDA 2M08A 2XPAA 1BL4A 2PBCA 2RUQA 2ZR5A 4J4OA 2ZR4A 3O5PA 3WH0A 2FAPA 3GPKA 3IKGA 1J4IA 3IK8A 4NNRA 1HXVA 2KI3A 3H9RB 1FKDA 1A7XA 1YATA 3TCZA 1PBKA
chains in the Genus database with same CATH superfamily
1N1AA 4MGVA 1FKJA 4DRKA 4LAYA 3WL0A 1E6PA 2ZR6A 1E6RA 3O5OA 2N87A 3CZ8A 4DZ3A 1ZCNA 2DPEA 3ARSA 5HKGA 1HKJA 5HW6A 1FFRA 3ARYA 1HKIA 4Q7NA 1NWTA 4W9OA 2Q5AA 2XP8A 3O5JA 2DT1A 2MLZA 4MPKA 4P8UA 3IKDA 4DT4A 4DRNA 1HJWA 1E6ZA 3UI5A 3B8SA 4ODPA 3OA5A 1ZB5A 2MLYA 2K8IA 1W9PA 3CHCA 2M2AA 2YBTA 2A3BA 5DF0A 4R0XA 4FN2A 1PINA 4ODOA 3O5RA 3FXYA 2MNTA 2DT0A 3QOKA 3AROA 4ZPWR 1NH6A 4AY1A 1CTNA 1E15A 4TW6A 4Z2IA 1ZBCA 1FKIA 2FKEA 1W26A 3JYJA 5GQBA 4DRMA 2A3EA 5DITA 3KADA 1E6NA 1Q6IA 1IX5A 4GIVA 1F8AB 3KAFA 3PR9A 4ODRA 1FKRA 3ARRA 5HWCA 4G2PA 2IUZA 3CH9A 1J6YA 4TX0A 3JYMA 2B31A 1O6IA 3G6LA 2P4VA 5HBFA 3B7XA 3ODKA 4WKFA 1ZL1A 4WKAA 1SYTA 4DRIA 1Q6HA 3W4RA 3ALGA 2XP5A 3WQWA 1OGBA 4L72B 2A3AA 1LG2A 2DT3A 1W1TA 2LGOA 3TC5A 1M5YA 4DRJA 2PPPA 1TFVA 1SR0A 1E9LA 2PN0A 3GPKA 1HXVA 4ML4A 1A7XA 1QPFA 3UI4A 3TCZA 1PBKA 1ZBWA 1FKLA 2LPVA 2VCDA 1R9HA 1ITXA 2RURA 2O9OA 2XPBA 4PTMA 4Z2KA 5DO2A 3KCEA 1P5QA 1FKFA 2VN1A 1D7JA 2G8ZA 1JNDA 4L3NA 4WIWA 3O5FA 1OGGA 1W9VA 3B9EA 4ODMA 3O5KA 2F4EA 4W5UA 4S3KA 3G6MA 1HKKA 2MLXA 1X6NA 4IQ2A 2LJ4A 2DG4A 1NMWA 3ARQA 4MSPA 3KAIA 1F40A 2WM0A 2B5UB 3KAGA 1X6LA 1FKGA 1XHGA 5HWBA 1D2KA 1FKHA 3VAWA 1QZ2A 3AQUA 4ODKA 2JZVA 4LAWA 4JFJA 4Z2HA 3UQAA 1EIBA 4MNJA 1LL4A 4MNKA 3UQIA 2ZQSA 3O5EA 2ITKA 1FKSA 1H0GA 1KFWA 2PI6A 4QZVB 2DG9A 3KAHA 3O5IA 1KT0A 3WL1A 2D9FA 1ZBVA 3NTPA 2YBUA 2PPOA 4KR0B 3O5DA 2PV1A 3UF8A 4GGQA 1B6CA 3RFWA 4FAPA 4C02B 1LQ0A 2Y78A 1GUVA 3ARZA 1WNOA 1Y0OA 4MTVA 3O5QA 2KR7A 5DIUA 5JH8A 3FAPA 3EY6A 1Q6UA 2QF8A 1FKTA 2XP7A 4IPXA 4Q22A 1FKBA 4BF8A 2XP4A 5BXJA 1FD9A 2M08A 2PBCA 2RUQA 2ZR4A 3CHFA 4DWSB 2KI3A 3H9RB 3RM9A 1YATA 3B9DA 3PRBA 4WK9A 1ZK6A 2OFNA 2KGJA 2M1IA 4W9QA 4MNMA 3AS1A 1HJXA 2RUDA 4TW8A 4NSBA 3NI6A 1ROUA 2KO7A 1VF8A 4LGXA 4O2TA 4S3JA 3O5LA 2MF9A 4DH0A 2ETNA 4JFIA 1NWSA 1J4RA 2XP9A 4DROA 3O5GA 4DRPA 1RD6A 2DSZA 2A3CA 2FDMA 4MAVA 1BKFA 1JVWA 3TDBA 4HARA 4KQZA 4J4NA 4U85A 4G50A 4LAVA 1ZBKA 3CHEA 3ARPA 4URIA 5DIVA 1H0IA 1GRJA 2PV3A 3B9AA 4XAKA 5GPRA 2UZ5A 1NWRA 3FY1A 4ITZA 1ZU8A 3MDYB 2F23A 4R5EA 3JXVA 1FAPA 2WK2A 1UR9A 1KT1A 2WLZA 1ROTA 1UR8A 4ODQA 4HBEA 4IT6A 1W1PA 3GTYX 3ARXA 4ODNA 3UQBA 1D7HA 2IF4A 1D6OA 2DT2A 2KE0A 1C9HA 3CGMA 2ZQTA 2KFWA 3I6CA 4P8XA 4P8VA 1JNEA 1OWQA 2G41A 4Z2JA 4ZPTR 1U79A 1W1YA 3BXWA 3RM4A 3WKZA 2DG3A 5HW7A 5HUAA 1LJYA 3PRAA 3ARVA 5J6EA 1E44A 3OOBA 2L2SA 2F2DA 1FJDA 4ODLA 1GOIA 2XPAA 1BL4A 4J4OA 2ZR5A 1JCHB 3IKGA 1J4IA 3IK8A 4DWSD 3WD3A 1EQ3A 2F21A 2O92A 3O5MA 4QIBA 4TYOA 4DRQA 4P8WA 3KABA 1WB0A 3RMEA 4IQCA 5HW8A 1EYMA 4LAXA 1FFQA 4JFMA 3NRKA 3ARTA 2WLYA 2LKNA 3WQVA 5D75A 4UDMA 3WD1A 1XRVA 3EIPA 3WD2A 4TW7A 2RSEA 4NZCA 3KZ7A 1LL6A 4JFLA 5GPGA 4Z2GA 2XP6A 3AS2A 4QT2A 3PRDA 1W1VA 3RM8A 1TCOC 3AS0A 2DSUA 3AS3A 4WJXA 5B8IC 4U86A 2AOSA 3GU0A 3KACA 4W9PA 2MPHA 4JFKA 3RGCA 1Q1CA 2RUCA 2PV2A 1K9TA 2AWGA 2ZQVA 4DZ2A 1L1PA 5HT1A 5I98A 2XP3A 1LL7A 4JYSA 3PA7A 4Z2LA 4DWSA 3ARWA 4U84A 2OLHA 3BMBA 4N19A 1W9UA 3ALFA 2DSWA 2RQSA 1J4HA 4MNLA 1NSGA 3IHZA 1T11A 4DIPA 2EULA 1EDQA 1HJVA 2ZQUA 3CGNA 5HTGA 1FKKA 1JNSA 1EHNA 4HBOA 1GPFA 4IT4A 4QT3A 1D7IA 1YW5A 3WIJA 2DSVA 4ZS6A 1NMVA 4DRHA 3WD0A 4WKHA 4DWSC 3ARUA 3CHDA 4TNSA 3UI6A 1HKMA 1NWUA 2PPNA 1QPLA 1JNTA 3LUOA 3WD4A 3O5PA 3WH0A 1LG1A 2FAPA 5DEZA 2ESCA 4NNRA 1FKDA 4ZPVR 1WAWA
chains in the Genus database with same CATH topology
1N1AA 4MGVA 1FKJA 4DRKA 4LAYA 3WL0A 1E6PA 2ZR6A 1E6RA 3O5OA 2N87A 3CZ8A 4DZ3A 1ZCNA 2DPEA 3ARSA 5HKGA 1HKJA 5HW6A 1FFRA 3ARYA 1HKIA 4Q7NA 1NWTA 4W9OA 2Q5AA 2XP8A 3O5JA 2DT1A 2MLZA 4MPKA 4P8UA 3IKDA 4DT4A 4DRNA 1HJWA 1E6ZA 3UI5A 3B8SA 4ODPA 3OA5A 1ZB5A 2MLYA 2K8IA 1W9PA 3CHCA 2M2AA 2YBTA 2A3BA 5DF0A 4R0XA 4FN2A 1PINA 4ODOA 3O5RA 3FXYA 2MNTA 2DT0A 3QOKA 3AROA 4ZPWR 1NH6A 4AY1A 1CTNA 1E15A 4TW6A 4Z2IA 1ZBCA 1FKIA 2FKEA 1W26A 3JYJA 5GQBA 4DRMA 2A3EA 5DITA 3KADA 1E6NA 1Q6IA 1IX5A 4GIVA 1F8AB 3KAFA 3PR9A 4ODRA 1FKRA 3ARRA 5HWCA 4G2PA 2IUZA 3CH9A 1J6YA 4TX0A 3JYMA 2B31A 1O6IA 3G6LA 5HBFA 3B7XA 3ODKA 4WKFA 1ZL1A 4WKAA 1SYTA 4DRIA 1Q6HA 3W4RA 3ALGA 2XP5A 3WQWA 1OGBA 4L72B 2A3AA 1LG2A 2DT3A 1W1TA 2LGOA 3TC5A 1M5YA 4DRJA 2PPPA 1TFVA 1SR0A 1E9LA 3GPKA 1HXVA 4ML4A 1A7XA 1QPFA 3UI4A 3TCZA 1PBKA 1ZBWA 1FKLA 2LPVA 2VCDA 1R9HA 1ITXA 2RURA 2O9OA 2XPBA 4PTMA 4Z2KA 5DO2A 3KCEA 1P5QA 1FKFA 2VN1A 1D7JA 2G8ZA 1JNDA 4L3NA 4WIWA 3O5FA 1OGGA 1W9VA 3B9EA 4ODMA 3O5KA 2F4EA 4W5UA 4S3KA 3G6MA 1HKKA 2MLXA 1X6NA 4IQ2A 2LJ4A 2DG4A 1NMWA 3ARQA 4MSPA 3KAIA 1F40A 2WM0A 3KAGA 1X6LA 1FKGA 1XHGA 5HWBA 1D2KA 1FKHA 3VAWA 1QZ2A 3AQUA 4ODKA 2JZVA 4LAWA 4JFJA 4Z2HA 3UQAA 1EIBA 4MNJA 1LL4A 4MNKA 3UQIA 2ZQSA 3O5EA 2ITKA 1FKSA 1H0GA 1KFWA 2PI6A 4QZVB 2DG9A 3KAHA 3O5IA 1KT0A 3WL1A 2D9FA 1ZBVA 3NTPA 2YBUA 2PPOA 4KR0B 3O5DA 2PV1A 3UF8A 4GGQA 1B6CA 3RFWA 4FAPA 4C02B 1LQ0A 2Y78A 1GUVA 3ARZA 1WNOA 1Y0OA 4MTVA 3O5QA 2KR7A 5DIUA 5JH8A 3FAPA 3EY6A 1Q6UA 2QF8A 1FKTA 2XP7A 4IPXA 4Q22A 1FKBA 4BF8A 2XP4A 5BXJA 1FD9A 2M08A 2PBCA 2RUQA 2ZR4A 3CHFA 4DWSB 2KI3A 3H9RB 3RM9A 1YATA 3B9DA 3PRBA 4WK9A 1ZK6A 2OFNA 2KGJA 2M1IA 4W9QA 4MNMA 3AS1A 1HJXA 2RUDA 4TW8A 4NSBA 3NI6A 1ROUA 2KO7A 1VF8A 4LGXA 4O2TA 4S3JA 3O5LA 2MF9A 4DH0A 4JFIA 1NWSA 1J4RA 2XP9A 4DROA 3O5GA 4DRPA 1RD6A 2DSZA 2A3CA 2FDMA 4MAVA 1BKFA 1JVWA 3TDBA 4HARA 4KQZA 4J4NA 4U85A 4G50A 4LAVA 1ZBKA 3CHEA 3ARPA 4URIA 5DIVA 1H0IA 2PV3A 3B9AA 4XAKA 5GPRA 2UZ5A 1NWRA 3FY1A 4ITZA 1ZU8A 3MDYB 4R5EA 3JXVA 1FAPA 2WK2A 1UR9A 1KT1A 2WLZA 1ROTA 1UR8A 4ODQA 4HBEA 4IT6A 1W1PA 3ARXA 4ODNA 3UQBA 1D7HA 2IF4A 1D6OA 2DT2A 2KE0A 1C9HA 3CGMA 2ZQTA 2KFWA 3I6CA 4P8XA 4P8VA 1JNEA 1OWQA 2G41A 4Z2JA 4ZPTR 1U79A 1W1YA 3BXWA 3RM4A 3WKZA 2DG3A 5HW7A 5HUAA 1LJYA 3PRAA 3ARVA 5J6EA 3OOBA 2L2SA 2F2DA 1FJDA 4ODLA 1GOIA 2XPAA 1BL4A 4J4OA 2ZR5A 3IKGA 1J4IA 3IK8A 4DWSD 3WD3A 1EQ3A 2F21A 2O92A 3O5MA 4QIBA 4TYOA 4DRQA 4P8WA 3KABA 1WB0A 3RMEA 4IQCA 5HW8A 1EYMA 4LAXA 1FFQA 4JFMA 3NRKA 3ARTA 2WLYA 2LKNA 3WQVA 5D75A 3WD1A 1XRVA 3WD2A 4TW7A 2RSEA 4NZCA 3KZ7A 1LL6A 4JFLA 5GPGA 4Z2GA 2XP6A 3AS2A 4QT2A 3PRDA 1W1VA 3RM8A 1TCOC 3AS0A 2DSUA 3AS3A 4WJXA 5B8IC 4U86A 2AOSA 3KACA 4W9PA 2MPHA 4JFKA 3RGCA 1Q1CA 2RUCA 2PV2A 1K9TA 2AWGA 2ZQVA 4DZ2A 1L1PA 5HT1A 5I98A 2XP3A 1LL7A 4JYSA 3PA7A 4Z2LA 4DWSA 3ARWA 4U84A 2OLHA 4N19A 1W9UA 3ALFA 2DSWA 2RQSA 1J4HA 4MNLA 1NSGA 3IHZA 1T11A 4DIPA 1EDQA 1HJVA 2ZQUA 3CGNA 5HTGA 1FKKA 1JNSA 1EHNA 4HBOA 1GPFA 4IT4A 4QT3A 1D7IA 1YW5A 3WIJA 2DSVA 4ZS6A 1NMVA 4DRHA 3WD0A 4WKHA 4DWSC 3ARUA 3CHDA 4TNSA 3UI6A 1HKMA 1NWUA 2PPNA 1QPLA 1JNTA 3LUOA 3WD4A 3O5PA 3WH0A 1LG1A 2FAPA 5DEZA 2ESCA 4NNRA 1FKDA 4ZPVR 1WAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F21 A;  1N1A A;  4MGV A;  1FKJ A;  3PRB A;  3O5M A;  1ZK6 A;  4QIB A;  4TYO A;  4DRK A;  4LAY A;  1FKL A;  2OFN A;  4DRQ A;  3KAB A;  2ZR6 A;  2LPV A;  4IQC A;  2KGJ A;  2M1I A;  2N87 A;  1R9H A;  2VCD A;  2RUR A;  1ZCN A;  3O5O A;  4W9Q A;  2XPB A;  1EYM A;  2RUD A;  4DZ3 A;  4LAX A;  5HKG A;  4TW8 A;  3KCE A;  4JFM A;  5HW6 A;  3NRK A;  1P5Q A;  1FKF A;  2LKN A;  2VN1 A;  5D75 A;  1D7J A;  4W9O A;  3NI6 A;  1ROU A;  2Q5A A;  2XP8 A;  3O5J A;  2KO7 A;  1EQ3 A;  4TW7 A;  4O2T A;  2MLZ A;  3O5F A;  3O5L A;  2MF9 A;  4DH0 A;  4ODM A;  2RSE A;  3O5K A;  3IKD A;  2F4E A;  3KZ7 A;  4JFI A;  4JFL A;  5GPG A;  4DT4 A;  4DRN A;  1J4R A;  2XP9 A;  2XP6 A;  4QT2 A;  2MLX A;  3UI5 A;  3O5G A;  3PRD A;  4DRO A;  4DRP A;  4ODP A;  1TCO C;  4IQ2 A;  2LJ4 A;  2DG4 A;  1NMW A;  2MLY A;  2K8I A;  4MSP A;  3KAI A;  1F40 A;  2M2A A;  4R0X A;  4FN2 A;  1BKF A;  1PIN A;  3KAG A;  4ODO A;  3O5R A;  5B8I C;  4U86 A;  1JVW A;  1FKG A;  3TDB A;  2MNT A;  3KAC A;  1FKH A;  4W9P A;  2MPH A;  3VAW A;  4JFK A;  5HWB A;  3RGC A;  1QZ2 A;  4J4N A;  1Q1C A;  4U85 A;  4G50 A;  2RUC A;  2PV2 A;  4LAV A;  4TW6 A;  4ODK A;  2JZV A;  5DIV A;  4LAW A;  2PV3 A;  2AWG A;  1FKI A;  2FKE A;  2ZQV A;  4JFJ A;  2UZ5 A;  4DZ2 A;  1L1P A;  3UQA A;  1W26 A;  4ITZ A;  1QPF A;  3MDY B;  5HT1 A;  3JYJ A;  3UI4 A;  5HW8 A;  5I98 A;  3JXV A;  3UQI A;  2ZQS A;  4DRM A;  1FAP A;  3O5E A;  2ITK A;  1FKS A;  5DIT A;  3KAD A;  1KT1 A;  2XP3 A;  1Q6I A;  4JYS A;  3PA7 A;  4GIV A;  1F8A B;  3KAF A;  4U84 A;  4ODR A;  1ROT A;  2DG9 A;  1FKR A;  3KAH A;  3O5I A;  5HWC A;  4ODQ A;  1KT0 A;  4N19 A;  4G2P A;  2D9F A;  2RQS A;  1J4H A;  3NTP A;  4TX0 A;  1J6Y A;  3JYM A;  2PPO A;  1NSG A;  3IHZ A;  4ODN A;  1T11 A;  3O5D A;  1D7H A;  4DIP A;  3UQB A;  2IF4 A;  2PV1 A;  1D6O A;  3UF8 A;  2ZQU A;  2KE0 A;  1C9H A;  3CGM A;  1B6C A;  2ZQT A;  3CGN A;  4GGQ A;  2KFW A;  5HTG A;  1FKK A;  3RFW A;  1JNS A;  3B7X A;  3ODK A;  3I6C A;  4FAP A;  4C02 B;  2Y78 A;  4QT3 A;  1D7I A;  1YW5 A;  1U79 A;  4DRI A;  1Q6H A;  1Y0O A;  1NMV A;  4DRH A;  2XP5 A;  2DG3 A;  3O5Q A;  2KR7 A;  4TNS A;  5DIU A;  3UI6 A;  5HW7 A;  5HUA A;  3FAP A;  3EY6 A;  5J6E A;  1Q6U A;  2LGO A;  2PPN A;  1QPL A;  1JNT A;  3OOB A;  3TC5 A;  1FKT A;  1M5Y A;  2L2S A;  2XP7 A;  3LUO A;  4IPX A;  4BF8 A;  1FKB A;  2F2D A;  4DRJ A;  2PPP A;  2XP4 A;  4ODL A;  5BXJ A;  1FD9 A;  1FJD A;  2M08 A;  2XPA A;  1BL4 A;  2PBC A;  2RUQ A;  2ZR5 A;  4J4O A;  2ZR4 A;  3O5P A;  3WH0 A;  2FAP A;  3GPK A;  3IKG A;  1J4I A;  3IK8 A;  4NNR A;  1HXV A;  2KI3 A;  3H9R B;  1FKD A;  1A7X A;  1YAT A;  3TCZ A;  1PBK A; 
#chains in the Genus database with same CATH topology
 1N1A A;  4MGV A;  1FKJ A;  4DRK A;  4LAY A;  3WL0 A;  1E6P A;  2ZR6 A;  1E6R A;  3O5O A;  2N87 A;  3CZ8 A;  4DZ3 A;  1ZCN A;  2DPE A;  3ARS A;  5HKG A;  1HKJ A;  5HW6 A;  1FFR A;  3ARY A;  1HKI A;  4Q7N A;  1NWT A;  4W9O A;  2Q5A A;  2XP8 A;  3O5J A;  2DT1 A;  2MLZ A;  4MPK A;  4P8U A;  3IKD A;  4DT4 A;  4DRN A;  1HJW A;  1E6Z A;  3UI5 A;  3B8S A;  4ODP A;  3OA5 A;  1ZB5 A;  2MLY A;  2K8I A;  1W9P A;  3CHC A;  2M2A A;  2YBT A;  2A3B A;  5DF0 A;  4R0X A;  4FN2 A;  1PIN A;  4ODO A;  3O5R A;  3FXY A;  2MNT A;  2DT0 A;  3QOK A;  3ARO A;  4ZPW R;  1NH6 A;  4AY1 A;  1CTN A;  1E15 A;  4TW6 A;  4Z2I A;  1ZBC A;  1FKI A;  2FKE A;  1W26 A;  3JYJ A;  5GQB A;  4DRM A;  2A3E A;  5DIT A;  3KAD A;  1E6N A;  1Q6I A;  1IX5 A;  4GIV A;  1F8A B;  3KAF A;  3PR9 A;  4ODR A;  1FKR A;  3ARR A;  5HWC A;  4G2P A;  2IUZ A;  3CH9 A;  1J6Y A;  4TX0 A;  3JYM A;  2B31 A;  1O6I A;  3G6L A;  2P4V A;  5HBF A;  3B7X A;  3ODK A;  4WKF A;  1ZL1 A;  4WKA A;  1SYT A;  4DRI A;  1Q6H A;  3W4R A;  3ALG A;  2XP5 A;  3WQW A;  1OGB A;  4L72 B;  2A3A A;  1LG2 A;  2DT3 A;  1W1T A;  2LGO A;  3TC5 A;  1M5Y A;  4DRJ A;  2PPP A;  1TFV A;  1SR0 A;  1E9L A;  2PN0 A;  3GPK A;  1HXV A;  4ML4 A;  1A7X A;  1QPF A;  3UI4 A;  3TCZ A;  1PBK A;  1ZBW A;  1FKL A;  2LPV A;  2VCD A;  1R9H A;  1ITX A;  2RUR A;  2O9O A;  2XPB A;  4PTM A;  4Z2K A;  5DO2 A;  3KCE A;  1P5Q A;  1FKF A;  2VN1 A;  1D7J A;  2G8Z A;  1JND A;  4L3N A;  4WIW A;  3O5F A;  1OGG A;  1W9V A;  3B9E A;  4ODM A;  3O5K A;  2F4E A;  4W5U A;  4S3K A;  3G6M A;  1HKK A;  2MLX A;  1X6N A;  4IQ2 A;  2LJ4 A;  2DG4 A;  1NMW A;  3ARQ A;  4MSP A;  3KAI A;  1F40 A;  2WM0 A;  2B5U B;  3KAG A;  1X6L A;  1FKG A;  1XHG A;  5HWB A;  1D2K A;  1FKH A;  3VAW A;  1QZ2 A;  3AQU A;  4ODK A;  2JZV A;  4LAW A;  4JFJ A;  4Z2H A;  3UQA A;  1EIB A;  4MNJ A;  1LL4 A;  4MNK A;  3UQI A;  2ZQS A;  3O5E A;  2ITK A;  1FKS A;  1H0G A;  1KFW A;  2PI6 A;  4QZV B;  2DG9 A;  3KAH A;  3O5I A;  1KT0 A;  3WL1 A;  2D9F A;  1ZBV A;  3NTP A;  2YBU A;  2PPO A;  4KR0 B;  3O5D A;  2PV1 A;  3UF8 A;  4GGQ A;  1B6C A;  3RFW A;  4FAP A;  4C02 B;  1LQ0 A;  2Y78 A;  1GUV A;  3ARZ A;  1WNO A;  1Y0O A;  4MTV A;  3O5Q A;  2KR7 A;  5DIU A;  5JH8 A;  3FAP A;  3EY6 A;  1Q6U A;  2QF8 A;  1FKT A;  2XP7 A;  4IPX A;  4Q22 A;  1FKB A;  4BF8 A;  2XP4 A;  5BXJ A;  1FD9 A;  2M08 A;  2PBC A;  2RUQ A;  2ZR4 A;  3CHF A;  4DWS B;  2KI3 A;  3H9R B;  3RM9 A;  1YAT A;  3B9D A;  3PRB A;  4WK9 A;  1ZK6 A;  2OFN A;  2KGJ A;  2M1I A;  4W9Q A;  4MNM A;  3AS1 A;  1HJX A;  2RUD A;  4TW8 A;  4NSB A;  3NI6 A;  1ROU A;  2KO7 A;  1VF8 A;  4LGX A;  4O2T A;  4S3J A;  3O5L A;  2MF9 A;  4DH0 A;  2ETN A;  4JFI A;  1NWS A;  1J4R A;  2XP9 A;  4DRO A;  3O5G A;  4DRP A;  1RD6 A;  2DSZ A;  2A3C A;  2FDM A;  4MAV A;  1BKF A;  1JVW A;  3TDB A;  4HAR A;  4KQZ A;  4J4N A;  4U85 A;  4G50 A;  4LAV A;  1ZBK A;  3CHE A;  3ARP A;  4URI A;  5DIV A;  1H0I A;  1GRJ A;  2PV3 A;  3B9A A;  4XAK A;  5GPR A;  2UZ5 A;  1NWR A;  3FY1 A;  4ITZ A;  1ZU8 A;  3MDY B;  2F23 A;  4R5E A;  3JXV A;  1FAP A;  2WK2 A;  1UR9 A;  1KT1 A;  2WLZ A;  1ROT A;  1UR8 A;  4ODQ A;  4HBE A;  4IT6 A;  1W1P A;  3GTY X;  3ARX A;  4ODN A;  3UQB A;  1D7H A;  2IF4 A;  1D6O A;  2DT2 A;  2KE0 A;  1C9H A;  3CGM A;  2ZQT A;  2KFW A;  3I6C A;  4P8X A;  4P8V A;  1JNE A;  1OWQ A;  2G41 A;  4Z2J A;  4ZPT R;  1U79 A;  1W1Y A;  3BXW A;  3RM4 A;  3WKZ A;  2DG3 A;  5HW7 A;  5HUA A;  1LJY A;  3PRA A;  3ARV A;  5J6E A;  1E44 A;  3OOB A;  2L2S A;  2F2D A;  1FJD A;  4ODL A;  1GOI A;  2XPA A;  1BL4 A;  4J4O A;  2ZR5 A;  1JCH B;  3IKG A;  1J4I A;  3IK8 A;  4DWS D;  3WD3 A;  1EQ3 A;  2F21 A;  2O92 A;  3O5M A;  4QIB A;  4TYO A;  4DRQ A;  4P8W A;  3KAB A;  1WB0 A;  3RME A;  4IQC A;  5HW8 A;  1EYM A;  4LAX A;  1FFQ A;  4JFM A;  3NRK A;  3ART A;  2WLY A;  2LKN A;  3WQV A;  5D75 A;  4UDM A;  3WD1 A;  1XRV A;  3EIP A;  3WD2 A;  4TW7 A;  2RSE A;  4NZC A;  3KZ7 A;  1LL6 A;  4JFL A;  5GPG A;  4Z2G A;  2XP6 A;  3AS2 A;  4QT2 A;  3PRD A;  1W1V A;  3RM8 A;  1TCO C;  3AS0 A;  2DSU A;  3AS3 A;  4WJX A;  5B8I C;  4U86 A;  2AOS A;  3GU0 A;  3KAC A;  4W9P A;  2MPH A;  4JFK A;  3RGC A;  1Q1C A;  2RUC A;  2PV2 A;  1K9T A;  2AWG A;  2ZQV A;  4DZ2 A;  1L1P A;  5HT1 A;  5I98 A;  2XP3 A;  1LL7 A;  4JYS A;  3PA7 A;  4Z2L A;  4DWS A;  3ARW A;  4U84 A;  2OLH A;  3BMB A;  4N19 A;  1W9U A;  3ALF A;  2DSW A;  2RQS A;  1J4H A;  4MNL A;  1NSG A;  3IHZ A;  1T11 A;  4DIP A;  2EUL A;  1EDQ A;  1HJV A;  2ZQU A;  3CGN A;  5HTG A;  1FKK A;  1JNS A;  1EHN A;  4HBO A;  1GPF A;  4IT4 A;  4QT3 A;  1D7I A;  1YW5 A;  3WIJ A;  2DSV A;  4ZS6 A;  1NMV A;  4DRH A;  3WD0 A;  4WKH A;  4DWS C;  3ARU A;  3CHD A;  4TNS A;  3UI6 A;  1HKM A;  1NWU A;  2PPN A;  1QPL A;  1JNT A;  3LUO A;  3WD4 A;  3O5P A;  3WH0 A;  1LG1 A;  2FAP A;  5DEZ A;  2ESC A;  4NNR A;  1FKD A;  4ZPV R;  1WAW A; 
#chains in the Genus database with same CATH homology
 1N1A A;  4MGV A;  1FKJ A;  4DRK A;  4LAY A;  3WL0 A;  1E6P A;  2ZR6 A;  1E6R A;  3O5O A;  2N87 A;  3CZ8 A;  4DZ3 A;  1ZCN A;  2DPE A;  3ARS A;  5HKG A;  1HKJ A;  5HW6 A;  1FFR A;  3ARY A;  1HKI A;  4Q7N A;  1NWT A;  4W9O A;  2Q5A A;  2XP8 A;  3O5J A;  2DT1 A;  2MLZ A;  4MPK A;  4P8U A;  3IKD A;  4DT4 A;  4DRN A;  1HJW A;  1E6Z A;  3UI5 A;  3B8S A;  4ODP A;  3OA5 A;  1ZB5 A;  2MLY A;  2K8I A;  1W9P A;  3CHC A;  2M2A A;  2YBT A;  2A3B A;  5DF0 A;  4R0X A;  4FN2 A;  1PIN A;  4ODO A;  3O5R A;  3FXY A;  2MNT A;  2DT0 A;  3QOK A;  3ARO A;  4ZPW R;  1NH6 A;  4AY1 A;  1CTN A;  1E15 A;  4TW6 A;  4Z2I A;  1ZBC A;  1FKI A;  2FKE A;  1W26 A;  3JYJ A;  5GQB A;  4DRM A;  2A3E A;  5DIT A;  3KAD A;  1E6N A;  1Q6I A;  1IX5 A;  4GIV A;  1F8A B;  3KAF A;  3PR9 A;  4ODR A;  1FKR A;  3ARR A;  5HWC A;  4G2P A;  2IUZ A;  3CH9 A;  1J6Y A;  4TX0 A;  3JYM A;  2B31 A;  1O6I A;  3G6L A;  5HBF A;  3B7X A;  3ODK A;  4WKF A;  1ZL1 A;  4WKA A;  1SYT A;  4DRI A;  1Q6H A;  3W4R A;  3ALG A;  2XP5 A;  3WQW A;  1OGB A;  4L72 B;  2A3A A;  1LG2 A;  2DT3 A;  1W1T A;  2LGO A;  3TC5 A;  1M5Y A;  4DRJ A;  2PPP A;  1TFV A;  1SR0 A;  1E9L A;  3GPK A;  1HXV A;  4ML4 A;  1A7X A;  1QPF A;  3UI4 A;  3TCZ A;  1PBK A;  1ZBW A;  1FKL A;  2LPV A;  2VCD A;  1R9H A;  1ITX A;  2RUR A;  2O9O A;  2XPB A;  4PTM A;  4Z2K A;  5DO2 A;  3KCE A;  1P5Q A;  1FKF A;  2VN1 A;  1D7J A;  2G8Z A;  1JND A;  4L3N A;  4WIW A;  3O5F A;  1OGG A;  1W9V A;  3B9E A;  4ODM A;  3O5K A;  2F4E A;  4W5U A;  4S3K A;  3G6M A;  1HKK A;  2MLX A;  1X6N A;  4IQ2 A;  2LJ4 A;  2DG4 A;  1NMW A;  3ARQ A;  4MSP A;  3KAI A;  1F40 A;  2WM0 A;  3KAG A;  1X6L A;  1FKG A;  1XHG A;  5HWB A;  1D2K A;  1FKH A;  3VAW A;  1QZ2 A;  3AQU A;  4ODK A;  2JZV A;  4LAW A;  4JFJ A;  4Z2H A;  3UQA A;  1EIB A;  4MNJ A;  1LL4 A;  4MNK A;  3UQI A;  2ZQS A;  3O5E A;  2ITK A;  1FKS A;  1H0G A;  1KFW A;  2PI6 A;  4QZV B;  2DG9 A;  3KAH A;  3O5I A;  1KT0 A;  3WL1 A;  2D9F A;  1ZBV A;  3NTP A;  2YBU A;  2PPO A;  4KR0 B;  3O5D A;  2PV1 A;  3UF8 A;  4GGQ A;  1B6C A;  3RFW A;  4FAP A;  4C02 B;  1LQ0 A;  2Y78 A;  1GUV A;  3ARZ A;  1WNO A;  1Y0O A;  4MTV A;  3O5Q A;  2KR7 A;  5DIU A;  5JH8 A;  3FAP A;  3EY6 A;  1Q6U A;  2QF8 A;  1FKT A;  2XP7 A;  4IPX A;  4Q22 A;  1FKB A;  4BF8 A;  2XP4 A;  5BXJ A;  1FD9 A;  2M08 A;  2PBC A;  2RUQ A;  2ZR4 A;  3CHF A;  4DWS B;  2KI3 A;  3H9R B;  3RM9 A;  1YAT A;  3B9D A;  3PRB A;  4WK9 A;  1ZK6 A;  2OFN A;  2KGJ A;  2M1I A;  4W9Q A;  4MNM A;  3AS1 A;  1HJX A;  2RUD A;  4TW8 A;  4NSB A;  3NI6 A;  1ROU A;  2KO7 A;  1VF8 A;  4LGX A;  4O2T A;  4S3J A;  3O5L A;  2MF9 A;  4DH0 A;  4JFI A;  1NWS A;  1J4R A;  2XP9 A;  4DRO A;  3O5G A;  4DRP A;  1RD6 A;  2DSZ A;  2A3C A;  2FDM A;  4MAV A;  1BKF A;  1JVW A;  3TDB A;  4HAR A;  4KQZ A;  4J4N A;  4U85 A;  4G50 A;  4LAV A;  1ZBK A;  3CHE A;  3ARP A;  4URI A;  5DIV A;  1H0I A;  2PV3 A;  3B9A A;  4XAK A;  5GPR A;  2UZ5 A;  1NWR A;  3FY1 A;  4ITZ A;  1ZU8 A;  3MDY B;  4R5E A;  3JXV A;  1FAP A;  2WK2 A;  1UR9 A;  1KT1 A;  2WLZ A;  1ROT A;  1UR8 A;  4ODQ A;  4HBE A;  4IT6 A;  1W1P A;  3ARX A;  4ODN A;  3UQB A;  1D7H A;  2IF4 A;  1D6O A;  2DT2 A;  2KE0 A;  1C9H A;  3CGM A;  2ZQT A;  2KFW A;  3I6C A;  4P8X A;  4P8V A;  1JNE A;  1OWQ A;  2G41 A;  4Z2J A;  4ZPT R;  1U79 A;  1W1Y A;  3BXW A;  3RM4 A;  3WKZ A;  2DG3 A;  5HW7 A;  5HUA A;  1LJY A;  3PRA A;  3ARV A;  5J6E A;  3OOB A;  2L2S A;  2F2D A;  1FJD A;  4ODL A;  1GOI A;  2XPA A;  1BL4 A;  4J4O A;  2ZR5 A;  3IKG A;  1J4I A;  3IK8 A;  4DWS D;  3WD3 A;  1EQ3 A;  2F21 A;  2O92 A;  3O5M A;  4QIB A;  4TYO A;  4DRQ A;  4P8W A;  3KAB A;  1WB0 A;  3RME A;  4IQC A;  5HW8 A;  1EYM A;  4LAX A;  1FFQ A;  4JFM A;  3NRK A;  3ART A;  2WLY A;  2LKN A;  3WQV A;  5D75 A;  3WD1 A;  1XRV A;  3WD2 A;  4TW7 A;  2RSE A;  4NZC A;  3KZ7 A;  1LL6 A;  4JFL A;  5GPG A;  4Z2G A;  2XP6 A;  3AS2 A;  4QT2 A;  3PRD A;  1W1V A;  3RM8 A;  1TCO C;  3AS0 A;  2DSU A;  3AS3 A;  4WJX A;  5B8I C;  4U86 A;  2AOS A;  3KAC A;  4W9P A;  2MPH A;  4JFK A;  3RGC A;  1Q1C A;  2RUC A;  2PV2 A;  1K9T A;  2AWG A;  2ZQV A;  4DZ2 A;  1L1P A;  5HT1 A;  5I98 A;  2XP3 A;  1LL7 A;  4JYS A;  3PA7 A;  4Z2L A;  4DWS A;  3ARW A;  4U84 A;  2OLH A;  4N19 A;  1W9U A;  3ALF A;  2DSW A;  2RQS A;  1J4H A;  4MNL A;  1NSG A;  3IHZ A;  1T11 A;  4DIP A;  1EDQ A;  1HJV A;  2ZQU A;  3CGN A;  5HTG A;  1FKK A;  1JNS A;  1EHN A;  4HBO A;  1GPF A;  4IT4 A;  4QT3 A;  1D7I A;  1YW5 A;  3WIJ A;  2DSV A;  4ZS6 A;  1NMV A;  4DRH A;  3WD0 A;  4WKH A;  4DWS C;  3ARU A;  3CHD A;  4TNS A;  3UI6 A;  1HKM A;  1NWU A;  2PPN A;  1QPL A;  1JNT A;  3LUO A;  3WD4 A;  3O5P A;  3WH0 A;  1LG1 A;  2FAP A;  5DEZ A;  2ESC A;  4NNR A;  1FKD A;  4ZPV R;  1WAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...