1J4HA

Crystal structure analysis of the fkbp12 complexed with 000107 small molecule
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FKBP12
publication title Design and structure-based study of new potential FKBP12 inhibitors
pubmed rcsb
source organism Homo sapiens
total genus 27
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1j4hA00
4W9PA 3H9RB 1Q6HA 1P5QA 2LPVA 2PPPA 3LUOA 1R9HA 1FKLA 2XP7A 1FKJA 4LAYA 2XP6A 1L1PA 3UI6A 1QZ2A 4IQ2A 4ODRA 4O2TA 5HW6A 1FJDA 4ODLA 2KI3A 1T11A 2ZQTA 3IK8A 4DIPA 4GGQA 1PBKA 3O5OA 2F21A 3O5GA 1ROTA 2MPHA 1FKKA 2ZR5A 5DITA 3KABA 1NSGA 3JYMA 2M08A 2ZR4A 3O5IA 4DZ3A 3UQBA 4DZ2A 1B6CA 4DRNA 2UZ5A 4IQCA 3NRKA 4JFMA 2XP3A 1EQ3A 4ODMA 1FKRA 3KADA 1QPLA 4LAXA 4TW7A 3NI6A 1D7IA 4DRJA 1FAPA 1D6OA 3TC5A 4DRMA 1M5YA 1KT1A 2L2SA 3KZ7A 2VCDA 4DT4A 3KAIA 2MLXA 2PPNA 3O5FA 2Q5AA 3CGMA 1D7JA 1YW5A 1HXVA 2XPAA 4QT2A 2DG9A 1U79A 2JZVA 3FAPA 4FN2A 1N1AA 3IKGA 2DG4A 2ZQUA 4U86A 3UF8A 1NMWA 5HUAA 1FKSA 1ZK6A 2K8IA 2ZR6A 3RGCA 1QPFA 2RURA 1J4HA 1PINA 1D7HA 1FKFA 2XPBA 3RFWA 2IF4A 3UQIA 3O5MA 4R0XA 4G50A 1JVWA 2ITKA 2KR7A 3O5PA 2OFNA 3O5QA 3WH0A 1BKFA 5B8IC 4TYOA 3O5RA 2Y78A 2FKEA 2ZQSA 4U84A 1Q1CA 3ODKA 3OOBA 2F4EA 2LJ4A 1FKTA 4MSPA 3UQAA 1Q6IA 4DRHA 5HW7A 2RUCA 4MGVA 2MLYA 2PV1A 1BL4A 2F2DA 2RUQA 4J4OA 3NTPA 3KAGA 4DRPA 2LGOA 5HWBA 1F40A 3O5JA 1NMVA 4IPXA 4DRKA 3PA7A 4DH0A 1J4IA 1ZCNA 4JFJA 3PRBA 4ODOA 3TDBA 3PRDA 2PBCA 3KAFA 3KCEA 1KT0A 4QIBA 3JXVA 4DRQA 4FAPA 1FKGA 4ODNA 4LAVA 2D9FA 2N87A 2RSEA 5HWCA 2RQSA 5GPGA 4W9OA 5I98A 4TW6A 2VN1A 4NNRA 2KO7A 1Y0OA 4U85A 1YATA 3KAHA 3IHZA 3GPKA 4ODKA 2XP8A 2M1IA 4W9QA 2M2AA 4J4NA 2RUDA 5DIVA 3IKDA 5DIUA 2XP9A 1C9HA 2KGJA 4GIVA 3O5DA 4JYSA 1A7XA 4DROA 5HTGA 3KACA 4G2PA 1W26A 2LKNA 4JFIA 4TX0A 1Q6UA 1ROUA 2FAPA 2AWGA 2PPOA 2XP5A 3MDYB 5D75A 3B7XA 5HT1A 4ITZA 3O5LA 5HW8A 3UI4A 5HKGA 1TCOC 1J4RA 3JYJA 4TW8A 1J6YA 2PV2A 2KE0A 2MNTA 1JNTA 4JFLA 4ODQA 4C02B 3TCZA 5J6EA 2DG3A 4ODPA 1F8AB 3UI5A 3VAWA 3CGNA 2XP4A 3EY6A 2MF9A 2PV3A 3O5EA 4DRIA 4JFKA 3O5KA 2MLZA 1FKBA 1EYMA 4N19A 2KFWA 4LAWA 1JNSA 1FD9A 1FKIA 4QT3A 2ZQVA 4BF8A 5BXJA 1FKHA 3I6CA 4TNSA 1FKDA
chains in the Genus database with same CATH superfamily
4NSBA 5JH8A 1HKIA 1Q6HA 2LPVA 2PPPA 3WD0A 3PRAA 1L1PA 2ZQTA 2WK2A 1HJWA 1ROTA 2ZR5A 5DITA 1E6PA 4NZCA 3WL0A 4DZ2A 4DRNA 2UZ5A 1W9VA 3NRKA 1UR9A 3BMBA 1ZBWA 1QPLA 4TW7A 3RM4A 1D7IA 1D6OA 4DRMA 1W9UA 4Z2IA 2PI6A 2DG9A 1X6NA 2ZQUA 4U86A 5HUAA 1NMWA 4QZVB 1ZK6A 2K8IA 4W5UA 2ZR6A 1QPFA 1J4HA 1PINA 1D7HA 1H0GA 1FKFA 3RFWA 4Z2LA 4R0XA 4G50A 1JVWA 3O5PA 2DSVA 4ML4A 5B8IC 3ARUA 3ARQA 2FKEA 3OOBA 2F4EA 1FKTA 2B31A 4MSPA 3UQAA 4DRHA 2PV1A 3NTPA 4DRPA 3B9AA 4L3NA 4DRKA 3PA7A 4P8XA 1J4IA 4JFJA 3PR9A 4ODOA 4QIBA 1KT0A 2DT3A 3CZ8A 2N87A 2RSEA 1GPFA 4Z2HA 4TW6A 2VN1A 1EIBA 1Y0OA 3GPKA 3ARWA 2M2AA 3IKDA 5DIUA 2XP9A 1XRVA 2A3CA 4JYSA 2F23A 1ITXA 4G2PA 3WD2A 3AS1A 4Z2GA 4P8UA 3MDYB 5D75A 3B7XA 5HW8A 1JCHB 3UI4A 2DT2A 1J6YA 2PV2A 3TCZA 2DG3A 4DWSA 3UI5A 2YBTA 2XP4A 3B8SA 3AS0A 1FKBA 1EYMA 3RMEA 1FD9A 4QT3A 4Z2KA 1FKDA 1K9TA 4FN2A 4W9PA 4DWSC 4AY1A 4HARA 4DWSD 2G8ZA 3WD1A 3UI6A 1HKJA 4ODLA 3IK8A 4ZPTR 4GGQA 1PBKA 4WKAA 1FKKA 4S3JA 3KABA 1NWSA 1M5YA 1KT1A 4PTMA 3KZ7A 1NWTA 2PPNA 3ARSA 1LJYA 5DF0A 2A3BA 1D7JA 1LQ0A 1U79A 2JZVA 3ARTA 1ZBKA 2DG4A 1UR8A 3RM8A 3WQVA 2RURA 2DSUA 3WIJA 3UQIA 1W9PA 2OFNA 3GU0A 3WH0A 1BKFA 4U84A 1ZB5A 2LJ4A 1LG1A 1Q6IA 1GOIA 5HW7A 4MGVA 3B9EA 2RUQA 2WLZA 4MPKA 1D2KA 4IPXA 2O9OA 3WQWA 3KCEA 4UDMA 4ODNA 4ZPWR 4LAVA 5GPGA 5I98A 4Q7NA 1XHGA 2KO7A 2IUZA 4MNJA 4U85A 3WD4A 2ESCA 1YATA 3IHZA 4ODKA 1E6ZA 4MAVA 3RM9A 1C9HA 3O5DA 4MTVA 1A7XA 3EIPA 5HTGA 4JFIA 4TX0A 1Q6UA 1ROUA 2PPOA 2XP5A 1E6RA 1WB0A 4TW8A 2KE0A 3AQUA 1ZBCA 2MNTA 1E9LA 1JNTA 5J6EA 1HJXA 3CGNA 3EY6A 3O5EA 1JNEA 2ETNA 1WAWA 2KFWA 4P8VA 1FKIA 4BF8A 1FKHA 4NNRA 5HBFA 1NWUA 2EULA 1X6LA 3H9RB 1P5QA 3G6MA 3LUOA 2XP7A 4P8WA 1OGGA 1LG2A 4LAYA 1SYTA 1QZ2A 4IQ2A 1FJDA 1T11A 3ARRA 3W4RA 2F21A 2MPHA 1E6NA 3JYMA 2M08A 3O5IA 4DZ3A 1EDQA 1W1YA 4JFMA 1FKRA 3KADA 1SR0A 4LAXA 4ZPVR 1RD6A 4IT6A 3TC5A 4DRJA 3KAIA 3O5FA 1GUVA 3FY1A 1H0IA 4S3KA 1YW5A 1EHNA 1HXVA 2XPAA 3AS3A 3IKGA 3ALFA 1E44A 2IF4A 4XAKA 3O5QA 1OWQA 3AROA 1GRJA 3CHCA 1NWRA 2Y78A 1IX5A 2ZQSA 1Q1CA 3ODKA 2RUCA 2F2DA 1JNDA 4J4OA 3KAGA 4IT4A 3ARPA 4DH0A 3PRDA 2G41A 2PBCA 3KAFA 5GQBA 4DRQA 4MNKA 1FKGA 2B5UB 2DT1A 3OA5A 1TFVA 2D9FA 2AOSA 2RQSA 4L72B 3KAHA 1O6IA 4W9QA 3WD3A 2O92A 2RUDA 4J4NA 3WKZA 2KGJA 1ZBVA 4URIA 4GIVA 4Z2JA 2LKNA 2AWGA 3CH9A 4WIWA 1ZU8A 3WL1A 3G6LA 5HT1A 4ITZA 3O5LA 1E15A 1TCOC 1J4RA 3JYJA 4ZS6A 4Q22A 1W1TA 4JFLA 4ODQA 1F8AB 1HKKA 2MF9A 2PV3A 4WK9A 4DRIA 4JFKA 4N19A 1JNSA 5DEZA 1OGBA 1W1VA 2ZQVA 5BXJA 4TNSA 2OLHA 1R9HA 1FKLA 1FKJA 2XP6A 4ODRA 3ARZA 4O2TA 5HW6A 4WKFA 2KI3A 4DIPA 2DPEA 3O5OA 3O5GA 3CHEA 1NSGA 3B9DA 2ZR4A 3UQBA 1WNOA 1B6CA 3FXYA 4IQCA 3ARYA 3CHFA 2XP3A 1EQ3A 4ODMA 3NI6A 4WJXA 1FAPA 2YBUA 2L2SA 3CHDA 2DT0A 2VCDA 4DT4A 2MLXA 2Q5AA 3CGMA 5DO2A 1VF8A 4KR0B 4QT2A 3FAPA 1N1AA 3UF8A 4HBOA 1W1PA 1FKSA 3RGCA 3AS2A 1ZL1A 2XPBA 4LGXA 4HBEA 3ALGA 3O5MA 2ITKA 2KR7A 1KFWA 2FDMA 2DSWA 4TYOA 3O5RA 2QF8A 2P4VA 1CTNA 5GPRA 4DWSB 2MLYA 1BL4A 4WKHA 1NH6A 1F40A 2LGOA 5HWBA 3O5JA 1NMVA 1LL6A 4MNLA 1ZCNA 3QOKA 3PRBA 3TDBA 3ARVA 3JXVA 4FAPA 5HWCA 3GTYX 1HKMA 4W9OA 2WLYA 2A3EA 1FFQA 1FFRA 3ARXA 2XP8A 2M1IA 5DIVA 4KQZA 4DROA 2DSZA 3KACA 1W26A 4MNMA 1LL4A 2FAPA 2WM0A 5HKGA 1LL7A 4C02B 1HJVA 4ODPA 3VAWA 4R5EA 3BXWA 3O5KA 2MLZA 4LAWA 2A3AA 3I6CA 2PN0A
chains in the Genus database with same CATH topology
4NSBA 5JH8A 1HKIA 1Q6HA 2LPVA 2PPPA 3WD0A 3PRAA 1L1PA 2ZQTA 2WK2A 1HJWA 1ROTA 2ZR5A 5DITA 1E6PA 4NZCA 3WL0A 4DZ2A 4DRNA 2UZ5A 1W9VA 3NRKA 1UR9A 1ZBWA 1QPLA 4TW7A 3RM4A 1D7IA 1D6OA 4DRMA 1W9UA 4Z2IA 2PI6A 2DG9A 1X6NA 2ZQUA 4U86A 5HUAA 1NMWA 4QZVB 1ZK6A 2K8IA 4W5UA 2ZR6A 1QPFA 1J4HA 1PINA 1D7HA 1H0GA 1FKFA 3RFWA 4Z2LA 4R0XA 4G50A 1JVWA 3O5PA 2DSVA 4ML4A 5B8IC 3ARUA 3ARQA 2FKEA 3OOBA 2F4EA 1FKTA 2B31A 4MSPA 3UQAA 4DRHA 2PV1A 3NTPA 4DRPA 3B9AA 4L3NA 4DRKA 3PA7A 4P8XA 1J4IA 4JFJA 3PR9A 4ODOA 4QIBA 1KT0A 2DT3A 3CZ8A 2N87A 2RSEA 1GPFA 4Z2HA 4TW6A 2VN1A 1EIBA 1Y0OA 3GPKA 3ARWA 2M2AA 3IKDA 5DIUA 2XP9A 1XRVA 2A3CA 4JYSA 4G2PA 1ITXA 3WD2A 3AS1A 4Z2GA 4P8UA 3MDYB 5D75A 3B7XA 5HW8A 3UI4A 2DT2A 1J6YA 2PV2A 3TCZA 2DG3A 4DWSA 3UI5A 2YBTA 2XP4A 3B8SA 3AS0A 1FKBA 1EYMA 3RMEA 1FD9A 4QT3A 4Z2KA 1FKDA 1K9TA 4FN2A 4W9PA 4DWSC 4AY1A 4HARA 4DWSD 2G8ZA 3WD1A 3UI6A 1HKJA 4ODLA 3IK8A 4ZPTR 4GGQA 1PBKA 4WKAA 1FKKA 4S3JA 3KABA 1NWSA 1M5YA 1KT1A 4PTMA 3KZ7A 1NWTA 2PPNA 3ARSA 1LJYA 5DF0A 2A3BA 1D7JA 1LQ0A 1U79A 2JZVA 3ARTA 1ZBKA 2DG4A 1UR8A 3RM8A 3WQVA 2RURA 2DSUA 3WIJA 3UQIA 1W9PA 2OFNA 3WH0A 1BKFA 4U84A 1ZB5A 2LJ4A 1LG1A 1Q6IA 1GOIA 5HW7A 4MGVA 3B9EA 2RUQA 2WLZA 4MPKA 1D2KA 4IPXA 2O9OA 3WQWA 3KCEA 4ODNA 4ZPWR 4LAVA 5GPGA 5I98A 4Q7NA 1XHGA 2KO7A 2IUZA 4MNJA 4U85A 3WD4A 2ESCA 1YATA 3IHZA 4ODKA 1E6ZA 4MAVA 3RM9A 1C9HA 3O5DA 4MTVA 1A7XA 5HTGA 4JFIA 4TX0A 1Q6UA 1ROUA 2PPOA 2XP5A 1E6RA 1WB0A 4TW8A 2KE0A 3AQUA 1ZBCA 2MNTA 1E9LA 1JNTA 5J6EA 1HJXA 3CGNA 3EY6A 3O5EA 1JNEA 1WAWA 2KFWA 4P8VA 1FKIA 4BF8A 1FKHA 4NNRA 5HBFA 1NWUA 3G6MA 1X6LA 3H9RB 1P5QA 3LUOA 2XP7A 4P8WA 1OGGA 1LG2A 4LAYA 1SYTA 1QZ2A 4IQ2A 1FJDA 1T11A 3ARRA 3W4RA 2F21A 2MPHA 1E6NA 3JYMA 2M08A 3O5IA 4DZ3A 1EDQA 1W1YA 4JFMA 1FKRA 3KADA 1SR0A 4LAXA 4ZPVR 1RD6A 4IT6A 3TC5A 4DRJA 3KAIA 3O5FA 1GUVA 3FY1A 1H0IA 4S3KA 1YW5A 1EHNA 1HXVA 2XPAA 3AS3A 3IKGA 3ALFA 2IF4A 4XAKA 3O5QA 1OWQA 3AROA 3CHCA 1NWRA 2Y78A 1IX5A 2ZQSA 1Q1CA 3ODKA 2RUCA 2F2DA 1JNDA 4J4OA 3KAGA 4IT4A 3ARPA 4DH0A 3PRDA 2G41A 2PBCA 3KAFA 5GQBA 4DRQA 4MNKA 1FKGA 2DT1A 3OA5A 1TFVA 2D9FA 2AOSA 2RQSA 4L72B 3KAHA 1O6IA 4W9QA 3WD3A 2O92A 2RUDA 4J4NA 3WKZA 2KGJA 1ZBVA 4URIA 4GIVA 4Z2JA 2LKNA 2AWGA 3CH9A 4WIWA 1ZU8A 3WL1A 3G6LA 5HT1A 4ITZA 3O5LA 1E15A 1TCOC 1J4RA 3JYJA 4ZS6A 4Q22A 1W1TA 4JFLA 4ODQA 1F8AB 1HKKA 2MF9A 2PV3A 4WK9A 4DRIA 4JFKA 4N19A 1JNSA 5DEZA 1OGBA 1W1VA 2ZQVA 5BXJA 4TNSA 2OLHA 1R9HA 1FKLA 1FKJA 2XP6A 4ODRA 3ARZA 4O2TA 5HW6A 4WKFA 2KI3A 4DIPA 2DPEA 3O5OA 3O5GA 3CHEA 1NSGA 3B9DA 2ZR4A 3UQBA 1WNOA 1B6CA 3FXYA 4IQCA 3ARYA 3CHFA 2XP3A 1EQ3A 4ODMA 3NI6A 4WJXA 1FAPA 2YBUA 2L2SA 3CHDA 2DT0A 2VCDA 4DT4A 2MLXA 2Q5AA 3CGMA 5DO2A 1VF8A 4KR0B 4QT2A 3FAPA 1N1AA 3UF8A 4HBOA 1W1PA 1FKSA 3RGCA 3AS2A 1ZL1A 2XPBA 4LGXA 4HBEA 3ALGA 3O5MA 2ITKA 2KR7A 1KFWA 2FDMA 2DSWA 4TYOA 3O5RA 2QF8A 1CTNA 5GPRA 4DWSB 2MLYA 1BL4A 4WKHA 1NH6A 1F40A 2LGOA 5HWBA 3O5JA 1NMVA 1LL6A 4MNLA 1ZCNA 3QOKA 3PRBA 3TDBA 3ARVA 3JXVA 4FAPA 5HWCA 1HKMA 4W9OA 2WLYA 2A3EA 1FFQA 1FFRA 3ARXA 2XP8A 2M1IA 5DIVA 4KQZA 4DROA 2DSZA 3KACA 1W26A 4MNMA 1LL4A 2FAPA 2WM0A 5HKGA 1LL7A 4C02B 1HJVA 4ODPA 3VAWA 4R5EA 3BXWA 3O5KA 2MLZA 4LAWA 2A3AA 3I6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9P A;  3H9R B;  1Q6H A;  1P5Q A;  2LPV A;  2PPP A;  3LUO A;  1R9H A;  1FKL A;  2XP7 A;  1FKJ A;  4LAY A;  2XP6 A;  1L1P A;  3UI6 A;  1QZ2 A;  4IQ2 A;  4ODR A;  4O2T A;  5HW6 A;  1FJD A;  4ODL A;  2KI3 A;  1T11 A;  2ZQT A;  3IK8 A;  4DIP A;  4GGQ A;  1PBK A;  3O5O A;  2F21 A;  3O5G A;  1ROT A;  2MPH A;  1FKK A;  2ZR5 A;  5DIT A;  3KAB A;  1NSG A;  3JYM A;  2M08 A;  2ZR4 A;  3O5I A;  4DZ3 A;  3UQB A;  4DZ2 A;  1B6C A;  4DRN A;  2UZ5 A;  4IQC A;  3NRK A;  4JFM A;  2XP3 A;  1EQ3 A;  4ODM A;  1FKR A;  3KAD A;  1QPL A;  4LAX A;  4TW7 A;  3NI6 A;  1D7I A;  4DRJ A;  1FAP A;  1D6O A;  3TC5 A;  4DRM A;  1M5Y A;  1KT1 A;  2L2S A;  3KZ7 A;  2VCD A;  4DT4 A;  3KAI A;  2MLX A;  2PPN A;  3O5F A;  2Q5A A;  3CGM A;  1D7J A;  1YW5 A;  1HXV A;  2XPA A;  4QT2 A;  2DG9 A;  1U79 A;  2JZV A;  3FAP A;  4FN2 A;  1N1A A;  3IKG A;  2DG4 A;  2ZQU A;  4U86 A;  3UF8 A;  1NMW A;  5HUA A;  1FKS A;  1ZK6 A;  2K8I A;  2ZR6 A;  3RGC A;  1QPF A;  2RUR A;  1J4H A;  1PIN A;  1D7H A;  1FKF A;  2XPB A;  3RFW A;  2IF4 A;  3UQI A;  3O5M A;  4R0X A;  4G50 A;  1JVW A;  2ITK A;  2KR7 A;  3O5P A;  2OFN A;  3O5Q A;  3WH0 A;  1BKF A;  5B8I C;  4TYO A;  3O5R A;  2Y78 A;  2FKE A;  2ZQS A;  4U84 A;  1Q1C A;  3ODK A;  3OOB A;  2F4E A;  2LJ4 A;  1FKT A;  4MSP A;  3UQA A;  1Q6I A;  4DRH A;  5HW7 A;  2RUC A;  4MGV A;  2MLY A;  2PV1 A;  1BL4 A;  2F2D A;  2RUQ A;  4J4O A;  3NTP A;  3KAG A;  4DRP A;  2LGO A;  5HWB A;  1F40 A;  3O5J A;  1NMV A;  4IPX A;  4DRK A;  3PA7 A;  4DH0 A;  1J4I A;  1ZCN A;  4JFJ A;  3PRB A;  4ODO A;  3TDB A;  3PRD A;  2PBC A;  3KAF A;  3KCE A;  1KT0 A;  4QIB A;  3JXV A;  4DRQ A;  4FAP A;  1FKG A;  4ODN A;  4LAV A;  2D9F A;  2N87 A;  2RSE A;  5HWC A;  2RQS A;  5GPG A;  4W9O A;  5I98 A;  4TW6 A;  2VN1 A;  4NNR A;  2KO7 A;  1Y0O A;  4U85 A;  1YAT A;  3KAH A;  3IHZ A;  3GPK A;  4ODK A;  2XP8 A;  2M1I A;  4W9Q A;  2M2A A;  4J4N A;  2RUD A;  5DIV A;  3IKD A;  5DIU A;  2XP9 A;  1C9H A;  2KGJ A;  4GIV A;  3O5D A;  4JYS A;  1A7X A;  4DRO A;  5HTG A;  3KAC A;  4G2P A;  1W26 A;  2LKN A;  4JFI A;  4TX0 A;  1Q6U A;  1ROU A;  2FAP A;  2AWG A;  2PPO A;  2XP5 A;  3MDY B;  5D75 A;  3B7X A;  5HT1 A;  4ITZ A;  3O5L A;  5HW8 A;  3UI4 A;  5HKG A;  1TCO C;  1J4R A;  3JYJ A;  4TW8 A;  1J6Y A;  2PV2 A;  2KE0 A;  2MNT A;  1JNT A;  4JFL A;  4ODQ A;  4C02 B;  3TCZ A;  5J6E A;  2DG3 A;  4ODP A;  1F8A B;  3UI5 A;  3VAW A;  3CGN A;  2XP4 A;  3EY6 A;  2MF9 A;  2PV3 A;  3O5E A;  4DRI A;  4JFK A;  3O5K A;  2MLZ A;  1FKB A;  1EYM A;  4N19 A;  2KFW A;  4LAW A;  1JNS A;  1FD9 A;  1FKI A;  4QT3 A;  2ZQV A;  4BF8 A;  5BXJ A;  1FKH A;  3I6C A;  4TNS A;  1FKD A; 
#chains in the Genus database with same CATH topology
 4NSB A;  5JH8 A;  1HKI A;  1Q6H A;  2LPV A;  2PPP A;  3WD0 A;  3PRA A;  1L1P A;  2ZQT A;  2WK2 A;  1HJW A;  1ROT A;  2ZR5 A;  5DIT A;  1E6P A;  4NZC A;  3WL0 A;  4DZ2 A;  4DRN A;  2UZ5 A;  1W9V A;  3NRK A;  1UR9 A;  3BMB A;  1ZBW A;  1QPL A;  4TW7 A;  3RM4 A;  1D7I A;  1D6O A;  4DRM A;  1W9U A;  4Z2I A;  2PI6 A;  2DG9 A;  1X6N A;  2ZQU A;  4U86 A;  5HUA A;  1NMW A;  4QZV B;  1ZK6 A;  2K8I A;  4W5U A;  2ZR6 A;  1QPF A;  1J4H A;  1PIN A;  1D7H A;  1H0G A;  1FKF A;  3RFW A;  4Z2L A;  4R0X A;  4G50 A;  1JVW A;  3O5P A;  2DSV A;  4ML4 A;  5B8I C;  3ARU A;  3ARQ A;  2FKE A;  3OOB A;  2F4E A;  1FKT A;  2B31 A;  4MSP A;  3UQA A;  4DRH A;  2PV1 A;  3NTP A;  4DRP A;  3B9A A;  4L3N A;  4DRK A;  3PA7 A;  4P8X A;  1J4I A;  4JFJ A;  3PR9 A;  4ODO A;  4QIB A;  1KT0 A;  2DT3 A;  3CZ8 A;  2N87 A;  2RSE A;  1GPF A;  4Z2H A;  4TW6 A;  2VN1 A;  1EIB A;  1Y0O A;  3GPK A;  3ARW A;  2M2A A;  3IKD A;  5DIU A;  2XP9 A;  1XRV A;  2A3C A;  4JYS A;  2F23 A;  1ITX A;  4G2P A;  3WD2 A;  3AS1 A;  4Z2G A;  4P8U A;  3MDY B;  5D75 A;  3B7X A;  5HW8 A;  1JCH B;  3UI4 A;  2DT2 A;  1J6Y A;  2PV2 A;  3TCZ A;  2DG3 A;  4DWS A;  3UI5 A;  2YBT A;  2XP4 A;  3B8S A;  3AS0 A;  1FKB A;  1EYM A;  3RME A;  1FD9 A;  4QT3 A;  4Z2K A;  1FKD A;  1K9T A;  4FN2 A;  4W9P A;  4DWS C;  4AY1 A;  4HAR A;  4DWS D;  2G8Z A;  3WD1 A;  3UI6 A;  1HKJ A;  4ODL A;  3IK8 A;  4ZPT R;  4GGQ A;  1PBK A;  4WKA A;  1FKK A;  4S3J A;  3KAB A;  1NWS A;  1M5Y A;  1KT1 A;  4PTM A;  3KZ7 A;  1NWT A;  2PPN A;  3ARS A;  1LJY A;  5DF0 A;  2A3B A;  1D7J A;  1LQ0 A;  1U79 A;  2JZV A;  3ART A;  1ZBK A;  2DG4 A;  1UR8 A;  3RM8 A;  3WQV A;  2RUR A;  2DSU A;  3WIJ A;  3UQI A;  1W9P A;  2OFN A;  3GU0 A;  3WH0 A;  1BKF A;  4U84 A;  1ZB5 A;  2LJ4 A;  1LG1 A;  1Q6I A;  1GOI A;  5HW7 A;  4MGV A;  3B9E A;  2RUQ A;  2WLZ A;  4MPK A;  1D2K A;  4IPX A;  2O9O A;  3WQW A;  3KCE A;  4UDM A;  4ODN A;  4ZPW R;  4LAV A;  5GPG A;  5I98 A;  4Q7N A;  1XHG A;  2KO7 A;  2IUZ A;  4MNJ A;  4U85 A;  3WD4 A;  2ESC A;  1YAT A;  3IHZ A;  4ODK A;  1E6Z A;  4MAV A;  3RM9 A;  1C9H A;  3O5D A;  4MTV A;  1A7X A;  3EIP A;  5HTG A;  4JFI A;  4TX0 A;  1Q6U A;  1ROU A;  2PPO A;  2XP5 A;  1E6R A;  1WB0 A;  4TW8 A;  2KE0 A;  3AQU A;  1ZBC A;  2MNT A;  1E9L A;  1JNT A;  5J6E A;  1HJX A;  3CGN A;  3EY6 A;  3O5E A;  1JNE A;  2ETN A;  1WAW A;  2KFW A;  4P8V A;  1FKI A;  4BF8 A;  1FKH A;  4NNR A;  5HBF A;  1NWU A;  2EUL A;  1X6L A;  3H9R B;  1P5Q A;  3G6M A;  3LUO A;  2XP7 A;  4P8W A;  1OGG A;  1LG2 A;  4LAY A;  1SYT A;  1QZ2 A;  4IQ2 A;  1FJD A;  1T11 A;  3ARR A;  3W4R A;  2F21 A;  2MPH A;  1E6N A;  3JYM A;  2M08 A;  3O5I A;  4DZ3 A;  1EDQ A;  1W1Y A;  4JFM A;  1FKR A;  3KAD A;  1SR0 A;  4LAX A;  4ZPV R;  1RD6 A;  4IT6 A;  3TC5 A;  4DRJ A;  3KAI A;  3O5F A;  1GUV A;  3FY1 A;  1H0I A;  4S3K A;  1YW5 A;  1EHN A;  1HXV A;  2XPA A;  3AS3 A;  3IKG A;  3ALF A;  1E44 A;  2IF4 A;  4XAK A;  3O5Q A;  1OWQ A;  3ARO A;  1GRJ A;  3CHC A;  1NWR A;  2Y78 A;  1IX5 A;  2ZQS A;  1Q1C A;  3ODK A;  2RUC A;  2F2D A;  1JND A;  4J4O A;  3KAG A;  4IT4 A;  3ARP A;  4DH0 A;  3PRD A;  2G41 A;  2PBC A;  3KAF A;  5GQB A;  4DRQ A;  4MNK A;  1FKG A;  2B5U B;  2DT1 A;  3OA5 A;  1TFV A;  2D9F A;  2AOS A;  2RQS A;  4L72 B;  3KAH A;  1O6I A;  4W9Q A;  3WD3 A;  2O92 A;  2RUD A;  4J4N A;  3WKZ A;  2KGJ A;  1ZBV A;  4URI A;  4GIV A;  4Z2J A;  2LKN A;  2AWG A;  3CH9 A;  4WIW A;  1ZU8 A;  3WL1 A;  3G6L A;  5HT1 A;  4ITZ A;  3O5L A;  1E15 A;  1TCO C;  1J4R A;  3JYJ A;  4ZS6 A;  4Q22 A;  1W1T A;  4JFL A;  4ODQ A;  1F8A B;  1HKK A;  2MF9 A;  2PV3 A;  4WK9 A;  4DRI A;  4JFK A;  4N19 A;  1JNS A;  5DEZ A;  1OGB A;  1W1V A;  2ZQV A;  5BXJ A;  4TNS A;  2OLH A;  1R9H A;  1FKL A;  1FKJ A;  2XP6 A;  4ODR A;  3ARZ A;  4O2T A;  5HW6 A;  4WKF A;  2KI3 A;  4DIP A;  2DPE A;  3O5O A;  3O5G A;  3CHE A;  1NSG A;  3B9D A;  2ZR4 A;  3UQB A;  1WNO A;  1B6C A;  3FXY A;  4IQC A;  3ARY A;  3CHF A;  2XP3 A;  1EQ3 A;  4ODM A;  3NI6 A;  4WJX A;  1FAP A;  2YBU A;  2L2S A;  3CHD A;  2DT0 A;  2VCD A;  4DT4 A;  2MLX A;  2Q5A A;  3CGM A;  5DO2 A;  1VF8 A;  4KR0 B;  4QT2 A;  3FAP A;  1N1A A;  3UF8 A;  4HBO A;  1W1P A;  1FKS A;  3RGC A;  3AS2 A;  1ZL1 A;  2XPB A;  4LGX A;  4HBE A;  3ALG A;  3O5M A;  2ITK A;  2KR7 A;  1KFW A;  2FDM A;  2DSW A;  4TYO A;  3O5R A;  2QF8 A;  2P4V A;  1CTN A;  5GPR A;  4DWS B;  2MLY A;  1BL4 A;  4WKH A;  1NH6 A;  1F40 A;  2LGO A;  5HWB A;  3O5J A;  1NMV A;  1LL6 A;  4MNL A;  1ZCN A;  3QOK A;  3PRB A;  3TDB A;  3ARV A;  3JXV A;  4FAP A;  5HWC A;  3GTY X;  1HKM A;  4W9O A;  2WLY A;  2A3E A;  1FFQ A;  1FFR A;  3ARX A;  2XP8 A;  2M1I A;  5DIV A;  4KQZ A;  4DRO A;  2DSZ A;  3KAC A;  1W26 A;  4MNM A;  1LL4 A;  2FAP A;  2WM0 A;  5HKG A;  1LL7 A;  4C02 B;  1HJV A;  4ODP A;  3VAW A;  4R5E A;  3BXW A;  3O5K A;  2MLZ A;  4LAW A;  2A3A A;  3I6C A;  2PN0 A; 
#chains in the Genus database with same CATH homology
 4NSB A;  5JH8 A;  1HKI A;  1Q6H A;  2LPV A;  2PPP A;  3WD0 A;  3PRA A;  1L1P A;  2ZQT A;  2WK2 A;  1HJW A;  1ROT A;  2ZR5 A;  5DIT A;  1E6P A;  4NZC A;  3WL0 A;  4DZ2 A;  4DRN A;  2UZ5 A;  1W9V A;  3NRK A;  1UR9 A;  1ZBW A;  1QPL A;  4TW7 A;  3RM4 A;  1D7I A;  1D6O A;  4DRM A;  1W9U A;  4Z2I A;  2PI6 A;  2DG9 A;  1X6N A;  2ZQU A;  4U86 A;  5HUA A;  1NMW A;  4QZV B;  1ZK6 A;  2K8I A;  4W5U A;  2ZR6 A;  1QPF A;  1J4H A;  1PIN A;  1D7H A;  1H0G A;  1FKF A;  3RFW A;  4Z2L A;  4R0X A;  4G50 A;  1JVW A;  3O5P A;  2DSV A;  4ML4 A;  5B8I C;  3ARU A;  3ARQ A;  2FKE A;  3OOB A;  2F4E A;  1FKT A;  2B31 A;  4MSP A;  3UQA A;  4DRH A;  2PV1 A;  3NTP A;  4DRP A;  3B9A A;  4L3N A;  4DRK A;  3PA7 A;  4P8X A;  1J4I A;  4JFJ A;  3PR9 A;  4ODO A;  4QIB A;  1KT0 A;  2DT3 A;  3CZ8 A;  2N87 A;  2RSE A;  1GPF A;  4Z2H A;  4TW6 A;  2VN1 A;  1EIB A;  1Y0O A;  3GPK A;  3ARW A;  2M2A A;  3IKD A;  5DIU A;  2XP9 A;  1XRV A;  2A3C A;  4JYS A;  4G2P A;  1ITX A;  3WD2 A;  3AS1 A;  4Z2G A;  4P8U A;  3MDY B;  5D75 A;  3B7X A;  5HW8 A;  3UI4 A;  2DT2 A;  1J6Y A;  2PV2 A;  3TCZ A;  2DG3 A;  4DWS A;  3UI5 A;  2YBT A;  2XP4 A;  3B8S A;  3AS0 A;  1FKB A;  1EYM A;  3RME A;  1FD9 A;  4QT3 A;  4Z2K A;  1FKD A;  1K9T A;  4FN2 A;  4W9P A;  4DWS C;  4AY1 A;  4HAR A;  4DWS D;  2G8Z A;  3WD1 A;  3UI6 A;  1HKJ A;  4ODL A;  3IK8 A;  4ZPT R;  4GGQ A;  1PBK A;  4WKA A;  1FKK A;  4S3J A;  3KAB A;  1NWS A;  1M5Y A;  1KT1 A;  4PTM A;  3KZ7 A;  1NWT A;  2PPN A;  3ARS A;  1LJY A;  5DF0 A;  2A3B A;  1D7J A;  1LQ0 A;  1U79 A;  2JZV A;  3ART A;  1ZBK A;  2DG4 A;  1UR8 A;  3RM8 A;  3WQV A;  2RUR A;  2DSU A;  3WIJ A;  3UQI A;  1W9P A;  2OFN A;  3WH0 A;  1BKF A;  4U84 A;  1ZB5 A;  2LJ4 A;  1LG1 A;  1Q6I A;  1GOI A;  5HW7 A;  4MGV A;  3B9E A;  2RUQ A;  2WLZ A;  4MPK A;  1D2K A;  4IPX A;  2O9O A;  3WQW A;  3KCE A;  4ODN A;  4ZPW R;  4LAV A;  5GPG A;  5I98 A;  4Q7N A;  1XHG A;  2KO7 A;  2IUZ A;  4MNJ A;  4U85 A;  3WD4 A;  2ESC A;  1YAT A;  3IHZ A;  4ODK A;  1E6Z A;  4MAV A;  3RM9 A;  1C9H A;  3O5D A;  4MTV A;  1A7X A;  5HTG A;  4JFI A;  4TX0 A;  1Q6U A;  1ROU A;  2PPO A;  2XP5 A;  1E6R A;  1WB0 A;  4TW8 A;  2KE0 A;  3AQU A;  1ZBC A;  2MNT A;  1E9L A;  1JNT A;  5J6E A;  1HJX A;  3CGN A;  3EY6 A;  3O5E A;  1JNE A;  1WAW A;  2KFW A;  4P8V A;  1FKI A;  4BF8 A;  1FKH A;  4NNR A;  5HBF A;  1NWU A;  3G6M A;  1X6L A;  3H9R B;  1P5Q A;  3LUO A;  2XP7 A;  4P8W A;  1OGG A;  1LG2 A;  4LAY A;  1SYT A;  1QZ2 A;  4IQ2 A;  1FJD A;  1T11 A;  3ARR A;  3W4R A;  2F21 A;  2MPH A;  1E6N A;  3JYM A;  2M08 A;  3O5I A;  4DZ3 A;  1EDQ A;  1W1Y A;  4JFM A;  1FKR A;  3KAD A;  1SR0 A;  4LAX A;  4ZPV R;  1RD6 A;  4IT6 A;  3TC5 A;  4DRJ A;  3KAI A;  3O5F A;  1GUV A;  3FY1 A;  1H0I A;  4S3K A;  1YW5 A;  1EHN A;  1HXV A;  2XPA A;  3AS3 A;  3IKG A;  3ALF A;  2IF4 A;  4XAK A;  3O5Q A;  1OWQ A;  3ARO A;  3CHC A;  1NWR A;  2Y78 A;  1IX5 A;  2ZQS A;  1Q1C A;  3ODK A;  2RUC A;  2F2D A;  1JND A;  4J4O A;  3KAG A;  4IT4 A;  3ARP A;  4DH0 A;  3PRD A;  2G41 A;  2PBC A;  3KAF A;  5GQB A;  4DRQ A;  4MNK A;  1FKG A;  2DT1 A;  3OA5 A;  1TFV A;  2D9F A;  2AOS A;  2RQS A;  4L72 B;  3KAH A;  1O6I A;  4W9Q A;  3WD3 A;  2O92 A;  2RUD A;  4J4N A;  3WKZ A;  2KGJ A;  1ZBV A;  4URI A;  4GIV A;  4Z2J A;  2LKN A;  2AWG A;  3CH9 A;  4WIW A;  1ZU8 A;  3WL1 A;  3G6L A;  5HT1 A;  4ITZ A;  3O5L A;  1E15 A;  1TCO C;  1J4R A;  3JYJ A;  4ZS6 A;  4Q22 A;  1W1T A;  4JFL A;  4ODQ A;  1F8A B;  1HKK A;  2MF9 A;  2PV3 A;  4WK9 A;  4DRI A;  4JFK A;  4N19 A;  1JNS A;  5DEZ A;  1OGB A;  1W1V A;  2ZQV A;  5BXJ A;  4TNS A;  2OLH A;  1R9H A;  1FKL A;  1FKJ A;  2XP6 A;  4ODR A;  3ARZ A;  4O2T A;  5HW6 A;  4WKF A;  2KI3 A;  4DIP A;  2DPE A;  3O5O A;  3O5G A;  3CHE A;  1NSG A;  3B9D A;  2ZR4 A;  3UQB A;  1WNO A;  1B6C A;  3FXY A;  4IQC A;  3ARY A;  3CHF A;  2XP3 A;  1EQ3 A;  4ODM A;  3NI6 A;  4WJX A;  1FAP A;  2YBU A;  2L2S A;  3CHD A;  2DT0 A;  2VCD A;  4DT4 A;  2MLX A;  2Q5A A;  3CGM A;  5DO2 A;  1VF8 A;  4KR0 B;  4QT2 A;  3FAP A;  1N1A A;  3UF8 A;  4HBO A;  1W1P A;  1FKS A;  3RGC A;  3AS2 A;  1ZL1 A;  2XPB A;  4LGX A;  4HBE A;  3ALG A;  3O5M A;  2ITK A;  2KR7 A;  1KFW A;  2FDM A;  2DSW A;  4TYO A;  3O5R A;  2QF8 A;  1CTN A;  5GPR A;  4DWS B;  2MLY A;  1BL4 A;  4WKH A;  1NH6 A;  1F40 A;  2LGO A;  5HWB A;  3O5J A;  1NMV A;  1LL6 A;  4MNL A;  1ZCN A;  3QOK A;  3PRB A;  3TDB A;  3ARV A;  3JXV A;  4FAP A;  5HWC A;  1HKM A;  4W9O A;  2WLY A;  2A3E A;  1FFQ A;  1FFR A;  3ARX A;  2XP8 A;  2M1I A;  5DIV A;  4KQZ A;  4DRO A;  2DSZ A;  3KAC A;  1W26 A;  4MNM A;  1LL4 A;  2FAP A;  2WM0 A;  5HKG A;  1LL7 A;  4C02 B;  1HJV A;  4ODP A;  3VAW A;  4R5E A;  3BXW A;  3O5K A;  2MLZ A;  4LAW A;  2A3A A;  3I6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...