1J4HA

Crystal structure analysis of the fkbp12 complexed with 000107 small molecule
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP12
publication title Design and structure-based study of new potential FKBP12 inhibitors
pubmed rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 27
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1j4hA00
2ZQTA 1FKRA 1W26A 2KO7A 3TC5A 5HW6A 3UI4A 1JVWA 1FKFA 3O5QA 3KACA 4O2TA 4DRJA 4U85A 2PBCA 1FKHA 4DIPA 3RFWA 1EYMA 1FKGA 1ZCNA 2RSEA 1ROUA 3KAHA 4JYSA 4ODLA 1YW5A 4U86A 3TDBA 3ODKA 3PA7A 1F40A 1P5QA 1Q6UA 3LUOA 1C9HA 2M2AA 1Q1CA 2L2SA 1R9HA 2KFWA 2OFNA 2PV3A 4J4NA 2K8IA 1QPLA 2DG4A 2RUCA 2ITKA 5DIUA 3KCEA 2XP9A 4JFKA 3KABA 2LJ4A 1J6YA 1J4IA 1FD9A 2MF9A 4ODPA 4IQCA 1JNSA 2ZR5A 1U79A 5J6EA 5HWBA 3UI6A 1FJDA 2KE0A 1D6OA 2FKEA 3KAFA 4G2PA 2XP5A 2RURA 1FKKA 1PINA 1YATA 2Y78A 3O5PA 4DRMA 2PV2A 1FKBA 1JNTA 4DZ2A 3JXVA 4NNRA 2XP7A 4TYOA 3OOBA 4DH0A 1NSGA 2LKNA 2RUDA 2ZR6A 2DG3A 4ODMA 3UF8A 2XP3A 4W9OA 2XP6A 3I6CA 2VCDA 1FKLA 3O5MA 4ODOA 4TW8A 2ZQVA 2LGOA 3CGNA 1NMWA 3KAIA 1Y0OA 3UQIA 2N87A 2ZQUA 1M5YA 4JFIA 2MPHA 4DROA 3GPKA 3KZ7A 4DT4A 1ZK6A 2PPOA 3O5EA 5D75A 3WH0A 1BKFA 2F2DA 4LAVA 3IKGA 4C02B 3JYJA 1J4RA 1Q6IA 5GPGA 4QT3A 4W9QA 2Q5AA 2M08A 5HT1A 3VAWA 4TW6A 3PRBA 4J4OA 2MNTA 4ODKA 1BL4A 3TCZA 4JFMA 1FAPA 3RGCA 4TNSA 4ODQA 1B6CA 2F4EA 3B7XA 1J4HA 4DRQA 2M1IA 1NMVA 4DRHA 1F8AB 2PPPA 4G50A 3O5IA 3O5KA 1FKDA 1HXVA 4GIVA 5B8IC 2RUQA 1Q6HA 1EQ3A 3NRKA 1D7JA 3JYMA 5HW8A 5HWCA 3UQAA 3O5DA 2XPBA 4FAPA 3O5JA 1ROTA 2XP4A 2PV1A 4JFJA 1PBKA 2VN1A 4FN2A 2MLYA 2ZR4A 4U84A 1N1AA 4IQ2A 1KT1A 1FKSA 1FKTA 2JZVA 3IHZA 3FAPA 4MSPA 4N19A 3UI5A 5HW7A 3MDYB 3NTPA 2FAPA 3EY6A 3H9RB 4R0XA 2MLXA 3KAGA 1QPFA 2IF4A 3PRDA 5DIVA 2RQSA 4DRKA 4ODRA 2UZ5A 4DRNA 3IKDA 4ITZA 2F21A 1A7XA 4IPXA 3O5LA 2MLZA 1KT0A 2PPNA 2XPAA 3O5FA 1D7IA 2DG9A 1TCOC 5HUAA 4BF8A 4LAYA 3KADA 3O5OA 2D9FA 4DRPA 4DZ3A 2KGJA 3O5RA 1L1PA 1FKIA 1D7HA 2KR7A 4TX0A 4GGQA 3NI6A 4MGVA 2AWGA 4W9PA 4LAXA 5DITA 5BXJA 3IK8A 2KI3A 4LAWA 2ZQSA 4JFLA 1FKJA 4QIBA 4QT2A 1QZ2A 5HKGA 3UQBA 1T11A 2LPVA 4ODNA 5I98A 3O5GA 4TW7A 3CGMA 5HTGA 4DRIA 2XP8A
chains in the Genus database with same CATH superfamily
1W26A 3O5QA 3WIJA 3G6MA 4ZPTR 1W9VA 1EYMA 1WB0A 1KFWA 4U86A 1P5QA 2AOSA 1Q6UA 1O6IA 1R9HA 1LJYA 2PV3A 4Q7NA 1X6LA 3FY1A 1NH6A 2DG4A 3BMBA 3KCEA 3AS0A 3CHCA 2LJ4A 1FD9A 1HKIA 5HWBA 4DRMA 2DSUA 2XP7A 5DEZA 1LL4A 2ZR6A 4WKHA 3UF8A 3ARQA 1W1VA 3KAIA 1Y0OA 2N87A 1M5YA 1E9LA 3GPKA 3KZ7A 4DT4A 3IKGA 1E6ZA 1J4RA 3JYJA 3CHDA 2DSWA 2FDMA 5HT1A 1IX5A 3W4RA 4Z2LA 3G6LA 4J4OA 1NWRA 1BL4A 1NWSA 2F4EA 1ZU8A 3B7XA 1VF8A 4DRHA 3WL1A 3O5IA 1WAWA 3FXYA 1Q6HA 1EQ3A 3NRKA 3ARPA 2XP4A 1HKJA 2VN1A 3OA5A 1XRVA 1KT1A 2F23A 4ZPWR 3IHZA 1GUVA 2MLXA 4NSBA 1E6RA 2IF4A 2RQSA 4KR0B 1E6PA 2UZ5A 4NZCA 1NWTA 4ITZA 2F21A 3O5LA 1CTNA 3O5FA 4QZVB 1D7IA 5HUAA 4DRPA 4DZ3A 4MGVA 4XAKA 4URIA 1LG1A 3IK8A 2KI3A 4MNMA 1T11A 1W9UA 3CGMA 5HTGA 2ZQTA 4ZPVR 1FKRA 4WKAA 1D2KA 5HW6A 1JVWA 3KACA 4MNKA 5GPRA 2WLYA 3PRAA 2RSEA 1ROUA 4JYSA 3TDBA 1EHNA 3LUOA 1C9HA 2L2SA 2KFWA 2OFNA 2PN0A 2K8IA 1QPLA 2RUCA 1FFQA 4JFKA 2MF9A 4ODPA 4HBEA 3CZ8A 5J6EA 3UI6A 2KE0A 1D6OA 2FKEA 4PTMA 3ALFA 5DO2A 2RURA 1ITXA 1PINA 3O5PA 1RD6A 1LL6A 1FKBA 3RMEA 3OOBA 4MPKA 1W1TA 1E6NA 2RUDA 4ODMA 2XP3A 4W9OA 2XP6A 3I6CA 1FKLA 3O5MA 4ODOA 3CHFA 2MPHA 1HKKA 4DWSA 2B5UB 1HKMA 5D75A 2F2DA 1Q6IA 4QT3A 4W9QA 4P8WA 4TW6A 2MNTA 3RGCA 1B6CA 1J4HA 4DRQA 2M1IA 2O9OA 1F8AB 3WD0A 3O5KA 1SYTA 1HXVA 2O92A 3JYMA 5HW8A 5HWCA 2XPBA 3GU0A 3WL0A 4JFJA 2PI6A 4FN2A 2MLYA 1N1AA 4R5EA 3RM4A 1H0IA 4HARA 3EY6A 4R0XA 3KAGA 3ARYA 3PRDA 4MNJA 4DRKA 4DRNA 4IPXA 2MLZA 4DWSB 1KT0A 2PPNA 3ARSA 2DG9A 3RM8A 4BF8A 3KADA 3O5OA 3RM9A 2KGJA 3O5RA 4IT4A 1FKIA 2KR7A 1XHGA 3NI6A 4LAXA 5DITA 2DT3A 3WQVA 2ZQSA 3AS1A 5HKGA 3UQBA 1JNEA 1HJVA 3AROA 2LPVA 4L3NA 4WK9A 3WQWA 2XP8A 1GRJA 4Z2IA 3TC5A 4O2TA 2PBCA 4DIPA 1OWQA 1ZCNA 1FKGA 2G8ZA 2EULA 3AQUA 4ODLA 1YW5A 3ALGA 1ZL1A 3ODKA 1W1PA 3PA7A 4Z2JA 1X6NA 1Q1CA 4S3KA 4ML4A 4L72B 5DIUA 1W1YA 2IUZA 3ARUA 2XP9A 3KABA 2A3BA 2ZR5A 3WD3A 2A3EA 4G2PA 1EDQA 2XP5A 1YATA 1JNTA 3WD2A 4NNRA 4TYOA 4Z2HA 4Z2GA 2LKNA 2DG3A 3QOKA 2VCDA 2LGOA 3B9EA 4Z2KA 4JFIA 3PR9A 3CHEA 1WNOA 2PPOA 3AS3A 3O5EA 3WH0A 1BKFA 4LAVA 4C02B 2OLHA 2M08A 4TNSA 1UR9A 2B31A 2YBTA 1NMVA 2PPPA 1FKDA 1UR8A 3AS2A 1K9TA 4P8UA 4FAPA 1PBKA 2WK2A 4U84A 2DSVA 4IQ2A 1FKSA 1OGBA 2JZVA 4MSPA 3GTYX 4WIWA 3NTPA 2FAPA 5DIVA 3H9RB 1JNSA 3WD4A 2P4VA 4ODRA 2DSZA 1JCHB 1OGGA 1NWUA 2DT2A 2WLZA 1TCOC 4LAYA 2A3CA 1SR0A 3ARWA 1L1PA 4TX0A 5DF0A 2AWGA 4W9PA 4Q22A 5BXJA 1ZBWA 4KQZA 3B9AA 4JFLA 1FKJA 4QIBA 1QZ2A 3ARRA 4P8VA 2DPEA 4P8XA 5I98A 4TW7A 4DWSC 4DRIA 1E15A 2KO7A 2G41A 1ZBCA 1LL7A 1FKFA 4MNLA 4DRJA 2ETNA 4U85A 1FKHA 3RFWA 2YBUA 3KAHA 2DT1A 1F40A 2M2AA 4DWSD 4AY1A 3ARXA 4J4NA 1EIBA 4MTVA 1HJXA 2ITKA 1GPFA 2QF8A 1E44A 2WM0A 1J6YA 1J4IA 4IQCA 1U79A 1FJDA 1ZBVA 3KAFA 1FKKA 2Y78A 2PV2A 4DZ2A 3JXVA 4DH0A 1NSGA 4TW8A 2ZQVA 3CGNA 3UQIA 1NMWA 4LGXA 2ZQUA 4DROA 1ZK6A 3BXWA 4IT6A 5GPGA 3VAWA 2Q5AA 4UDMA 3PRBA 4ODKA 3B9DA 3TCZA 4JFMA 1FAPA 4ODQA 4G50A 1ZB5A 4GIVA 5B8IC 2RUQA 3WKZA 1H0GA 1D7JA 3UQAA 5HBFA 1GOIA 3O5DA 3O5JA 1ROTA 4MAVA 2PV1A 1W9PA 4WKFA 2ZR4A 4W5UA 3ARVA 1FKTA 4HBOA 1FFRA 5JH8A 2A3AA 4N19A 3FAPA 3UI5A 3CH9A 5HW7A 3MDYB 3UI4A 1QPFA 1LG2A 3IKDA 4ZS6A 3ARTA 1A7XA 1LQ0A 1JNDA 2XPAA 3ARZA 3EIPA 4WJXA 2D9FA 1ZBKA 1HJWA 1TFVA 1D7HA 4GGQA 3WD1A 4LAWA 4QT2A 2DT0A 5GQBA 4S3JA 4ODNA 3B8SA 3O5GA 2ESCA
chains in the Genus database with same CATH topology
1W26A 3O5QA 3WIJA 3G6MA 4ZPTR 1W9VA 1EYMA 1WB0A 1KFWA 4U86A 1P5QA 2AOSA 1Q6UA 1O6IA 1R9HA 1LJYA 2PV3A 4Q7NA 1X6LA 3FY1A 1NH6A 2DG4A 3KCEA 3AS0A 3CHCA 2LJ4A 1FD9A 1HKIA 5HWBA 4DRMA 2DSUA 2XP7A 5DEZA 1LL4A 2ZR6A 4WKHA 3UF8A 3ARQA 1W1VA 3KAIA 1Y0OA 2N87A 1M5YA 1E9LA 3GPKA 3KZ7A 4DT4A 3IKGA 1E6ZA 1J4RA 3JYJA 3CHDA 2DSWA 2FDMA 5HT1A 1IX5A 3W4RA 4Z2LA 3G6LA 4J4OA 1NWRA 1BL4A 1NWSA 2F4EA 1ZU8A 3B7XA 1VF8A 4DRHA 3WL1A 3O5IA 1WAWA 3FXYA 1Q6HA 1EQ3A 3NRKA 3ARPA 2XP4A 1HKJA 2VN1A 3OA5A 1XRVA 1KT1A 4ZPWR 3IHZA 1GUVA 2MLXA 4NSBA 1E6RA 2IF4A 2RQSA 4KR0B 1E6PA 2UZ5A 4NZCA 1NWTA 4ITZA 2F21A 3O5LA 1CTNA 3O5FA 4QZVB 1D7IA 5HUAA 4DRPA 4DZ3A 4MGVA 4XAKA 4URIA 1LG1A 3IK8A 2KI3A 4MNMA 1T11A 1W9UA 3CGMA 5HTGA 2ZQTA 4ZPVR 1FKRA 4WKAA 1D2KA 5HW6A 1JVWA 3KACA 4MNKA 5GPRA 2WLYA 3PRAA 2RSEA 1ROUA 4JYSA 3TDBA 1EHNA 3LUOA 1C9HA 2L2SA 2KFWA 2OFNA 2K8IA 1QPLA 2RUCA 1FFQA 4JFKA 2MF9A 4ODPA 4HBEA 3CZ8A 5J6EA 3UI6A 2KE0A 1D6OA 2FKEA 4PTMA 3ALFA 5DO2A 2RURA 1ITXA 1PINA 3O5PA 1RD6A 1LL6A 1FKBA 3RMEA 3OOBA 4MPKA 1W1TA 1E6NA 2RUDA 4ODMA 2XP3A 4W9OA 2XP6A 3I6CA 1FKLA 3O5MA 4ODOA 3CHFA 2MPHA 1HKKA 4DWSA 1HKMA 5D75A 2F2DA 1Q6IA 4QT3A 4W9QA 4P8WA 4TW6A 2MNTA 3RGCA 1B6CA 1J4HA 4DRQA 2M1IA 2O9OA 1F8AB 3WD0A 3O5KA 1SYTA 1HXVA 2O92A 3JYMA 5HW8A 5HWCA 2XPBA 3WL0A 4JFJA 2PI6A 4FN2A 2MLYA 1N1AA 4R5EA 3RM4A 1H0IA 4HARA 3EY6A 4R0XA 3KAGA 3ARYA 3PRDA 4MNJA 4DRKA 4DRNA 4IPXA 2MLZA 4DWSB 1KT0A 2PPNA 3ARSA 2DG9A 3RM8A 4BF8A 3KADA 3O5OA 3RM9A 2KGJA 3O5RA 4IT4A 1FKIA 2KR7A 1XHGA 3NI6A 4LAXA 5DITA 2DT3A 3WQVA 2ZQSA 3AS1A 5HKGA 3UQBA 1JNEA 1HJVA 3AROA 2LPVA 4L3NA 4WK9A 3WQWA 2XP8A 4Z2IA 3TC5A 4O2TA 2PBCA 4DIPA 1OWQA 1ZCNA 1FKGA 2G8ZA 3AQUA 4ODLA 1YW5A 3ALGA 1ZL1A 3ODKA 1W1PA 3PA7A 4Z2JA 1X6NA 1Q1CA 4S3KA 4ML4A 4L72B 5DIUA 1W1YA 2IUZA 3ARUA 2XP9A 3KABA 2A3BA 2ZR5A 3WD3A 2A3EA 4G2PA 1EDQA 2XP5A 1YATA 1JNTA 3WD2A 4NNRA 4TYOA 4Z2HA 4Z2GA 2LKNA 2DG3A 3QOKA 2VCDA 2LGOA 3B9EA 4Z2KA 4JFIA 3PR9A 3CHEA 1WNOA 2PPOA 3AS3A 3O5EA 3WH0A 1BKFA 4LAVA 4C02B 2OLHA 2M08A 4TNSA 1UR9A 2B31A 2YBTA 1NMVA 2PPPA 1FKDA 1UR8A 3AS2A 1K9TA 4P8UA 4FAPA 1PBKA 2WK2A 4U84A 2DSVA 4IQ2A 1FKSA 1OGBA 2JZVA 4MSPA 4WIWA 3NTPA 2FAPA 5DIVA 3H9RB 1JNSA 3WD4A 4ODRA 2DSZA 1OGGA 1NWUA 2DT2A 2WLZA 1TCOC 4LAYA 2A3CA 1SR0A 3ARWA 1L1PA 4TX0A 5DF0A 2AWGA 4W9PA 4Q22A 5BXJA 1ZBWA 4KQZA 3B9AA 4JFLA 1FKJA 4QIBA 1QZ2A 3ARRA 4P8VA 2DPEA 4P8XA 5I98A 4TW7A 4DWSC 4DRIA 1E15A 2KO7A 2G41A 1ZBCA 1LL7A 1FKFA 4MNLA 4DRJA 4U85A 1FKHA 3RFWA 2YBUA 3KAHA 2DT1A 1F40A 2M2AA 4DWSD 4AY1A 3ARXA 4J4NA 1EIBA 4MTVA 1HJXA 2ITKA 1GPFA 2QF8A 2WM0A 1J6YA 1J4IA 4IQCA 1U79A 1FJDA 1ZBVA 3KAFA 1FKKA 2Y78A 2PV2A 4DZ2A 3JXVA 4DH0A 1NSGA 4TW8A 2ZQVA 3CGNA 3UQIA 1NMWA 4LGXA 2ZQUA 4DROA 1ZK6A 3BXWA 4IT6A 5GPGA 3VAWA 2Q5AA 3PRBA 4ODKA 3B9DA 3TCZA 4JFMA 1FAPA 4ODQA 4G50A 1ZB5A 4GIVA 5B8IC 2RUQA 3WKZA 1H0GA 1D7JA 3UQAA 5HBFA 1GOIA 3O5DA 3O5JA 1ROTA 4MAVA 2PV1A 1W9PA 4WKFA 2ZR4A 4W5UA 3ARVA 1FKTA 4HBOA 1FFRA 5JH8A 2A3AA 4N19A 3FAPA 3UI5A 3CH9A 5HW7A 3MDYB 3UI4A 1QPFA 1LG2A 3IKDA 4ZS6A 3ARTA 1A7XA 1LQ0A 1JNDA 2XPAA 3ARZA 4WJXA 2D9FA 1ZBKA 1HJWA 1TFVA 1D7HA 4GGQA 3WD1A 4LAWA 4QT2A 2DT0A 5GQBA 4S3JA 4ODNA 3B8SA 3O5GA 2ESCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZQT A;  1FKR A;  1W26 A;  2KO7 A;  3TC5 A;  5HW6 A;  3UI4 A;  1JVW A;  1FKF A;  3O5Q A;  3KAC A;  4O2T A;  4DRJ A;  4U85 A;  2PBC A;  1FKH A;  4DIP A;  3RFW A;  1EYM A;  1FKG A;  1ZCN A;  2RSE A;  1ROU A;  3KAH A;  4JYS A;  4ODL A;  1YW5 A;  4U86 A;  3TDB A;  3ODK A;  3PA7 A;  1F40 A;  1P5Q A;  1Q6U A;  3LUO A;  1C9H A;  2M2A A;  1Q1C A;  2L2S A;  1R9H A;  2KFW A;  2OFN A;  2PV3 A;  4J4N A;  2K8I A;  1QPL A;  2DG4 A;  2RUC A;  2ITK A;  5DIU A;  3KCE A;  2XP9 A;  4JFK A;  3KAB A;  2LJ4 A;  1J6Y A;  1J4I A;  1FD9 A;  2MF9 A;  4ODP A;  4IQC A;  1JNS A;  2ZR5 A;  1U79 A;  5J6E A;  5HWB A;  3UI6 A;  1FJD A;  2KE0 A;  1D6O A;  2FKE A;  3KAF A;  4G2P A;  2XP5 A;  2RUR A;  1FKK A;  1PIN A;  1YAT A;  2Y78 A;  3O5P A;  4DRM A;  2PV2 A;  1FKB A;  1JNT A;  4DZ2 A;  3JXV A;  4NNR A;  2XP7 A;  4TYO A;  3OOB A;  4DH0 A;  1NSG A;  2LKN A;  2RUD A;  2ZR6 A;  2DG3 A;  4ODM A;  3UF8 A;  2XP3 A;  4W9O A;  2XP6 A;  3I6C A;  2VCD A;  1FKL A;  3O5M A;  4ODO A;  4TW8 A;  2ZQV A;  2LGO A;  3CGN A;  1NMW A;  3KAI A;  1Y0O A;  3UQI A;  2N87 A;  2ZQU A;  1M5Y A;  4JFI A;  2MPH A;  4DRO A;  3GPK A;  3KZ7 A;  4DT4 A;  1ZK6 A;  2PPO A;  3O5E A;  5D75 A;  3WH0 A;  1BKF A;  2F2D A;  4LAV A;  3IKG A;  4C02 B;  3JYJ A;  1J4R A;  1Q6I A;  5GPG A;  4QT3 A;  4W9Q A;  2Q5A A;  2M08 A;  5HT1 A;  3VAW A;  4TW6 A;  3PRB A;  4J4O A;  2MNT A;  4ODK A;  1BL4 A;  3TCZ A;  4JFM A;  1FAP A;  3RGC A;  4TNS A;  4ODQ A;  1B6C A;  2F4E A;  3B7X A;  1J4H A;  4DRQ A;  2M1I A;  1NMV A;  4DRH A;  1F8A B;  2PPP A;  4G50 A;  3O5I A;  3O5K A;  1FKD A;  1HXV A;  4GIV A;  5B8I C;  2RUQ A;  1Q6H A;  1EQ3 A;  3NRK A;  1D7J A;  3JYM A;  5HW8 A;  5HWC A;  3UQA A;  3O5D A;  2XPB A;  4FAP A;  3O5J A;  1ROT A;  2XP4 A;  2PV1 A;  4JFJ A;  1PBK A;  2VN1 A;  4FN2 A;  2MLY A;  2ZR4 A;  4U84 A;  1N1A A;  4IQ2 A;  1KT1 A;  1FKS A;  1FKT A;  2JZV A;  3IHZ A;  3FAP A;  4MSP A;  4N19 A;  3UI5 A;  5HW7 A;  3MDY B;  3NTP A;  2FAP A;  3EY6 A;  3H9R B;  4R0X A;  2MLX A;  3KAG A;  1QPF A;  2IF4 A;  3PRD A;  5DIV A;  2RQS A;  4DRK A;  4ODR A;  2UZ5 A;  4DRN A;  3IKD A;  4ITZ A;  2F21 A;  1A7X A;  4IPX A;  3O5L A;  2MLZ A;  1KT0 A;  2PPN A;  2XPA A;  3O5F A;  1D7I A;  2DG9 A;  1TCO C;  5HUA A;  4BF8 A;  4LAY A;  3KAD A;  3O5O A;  2D9F A;  4DRP A;  4DZ3 A;  2KGJ A;  3O5R A;  1L1P A;  1FKI A;  1D7H A;  2KR7 A;  4TX0 A;  4GGQ A;  3NI6 A;  4MGV A;  2AWG A;  4W9P A;  4LAX A;  5DIT A;  5BXJ A;  3IK8 A;  2KI3 A;  4LAW A;  2ZQS A;  4JFL A;  1FKJ A;  4QIB A;  4QT2 A;  1QZ2 A;  5HKG A;  3UQB A;  1T11 A;  2LPV A;  4ODN A;  5I98 A;  3O5G A;  4TW7 A;  3CGM A;  5HTG A;  4DRI A;  2XP8 A; 
#chains in the Genus database with same CATH topology
 1W26 A;  3O5Q A;  3WIJ A;  3G6M A;  4ZPT R;  1W9V A;  1EYM A;  1WB0 A;  1KFW A;  4U86 A;  1P5Q A;  2AOS A;  1Q6U A;  1O6I A;  1R9H A;  1LJY A;  2PV3 A;  4Q7N A;  1X6L A;  3FY1 A;  1NH6 A;  2DG4 A;  3BMB A;  3KCE A;  3AS0 A;  3CHC A;  2LJ4 A;  1FD9 A;  1HKI A;  5HWB A;  4DRM A;  2DSU A;  2XP7 A;  5DEZ A;  1LL4 A;  2ZR6 A;  4WKH A;  3UF8 A;  3ARQ A;  1W1V A;  3KAI A;  1Y0O A;  2N87 A;  1M5Y A;  1E9L A;  3GPK A;  3KZ7 A;  4DT4 A;  3IKG A;  1E6Z A;  1J4R A;  3JYJ A;  3CHD A;  2DSW A;  2FDM A;  5HT1 A;  1IX5 A;  3W4R A;  4Z2L A;  3G6L A;  4J4O A;  1NWR A;  1BL4 A;  1NWS A;  2F4E A;  1ZU8 A;  3B7X A;  1VF8 A;  4DRH A;  3WL1 A;  3O5I A;  1WAW A;  3FXY A;  1Q6H A;  1EQ3 A;  3NRK A;  3ARP A;  2XP4 A;  1HKJ A;  2VN1 A;  3OA5 A;  1XRV A;  1KT1 A;  2F23 A;  4ZPW R;  3IHZ A;  1GUV A;  2MLX A;  4NSB A;  1E6R A;  2IF4 A;  2RQS A;  4KR0 B;  1E6P A;  2UZ5 A;  4NZC A;  1NWT A;  4ITZ A;  2F21 A;  3O5L A;  1CTN A;  3O5F A;  4QZV B;  1D7I A;  5HUA A;  4DRP A;  4DZ3 A;  4MGV A;  4XAK A;  4URI A;  1LG1 A;  3IK8 A;  2KI3 A;  4MNM A;  1T11 A;  1W9U A;  3CGM A;  5HTG A;  2ZQT A;  4ZPV R;  1FKR A;  4WKA A;  1D2K A;  5HW6 A;  1JVW A;  3KAC A;  4MNK A;  5GPR A;  2WLY A;  3PRA A;  2RSE A;  1ROU A;  4JYS A;  3TDB A;  1EHN A;  3LUO A;  1C9H A;  2L2S A;  2KFW A;  2OFN A;  2PN0 A;  2K8I A;  1QPL A;  2RUC A;  1FFQ A;  4JFK A;  2MF9 A;  4ODP A;  4HBE A;  3CZ8 A;  5J6E A;  3UI6 A;  2KE0 A;  1D6O A;  2FKE A;  4PTM A;  3ALF A;  5DO2 A;  2RUR A;  1ITX A;  1PIN A;  3O5P A;  1RD6 A;  1LL6 A;  1FKB A;  3RME A;  3OOB A;  4MPK A;  1W1T A;  1E6N A;  2RUD A;  4ODM A;  2XP3 A;  4W9O A;  2XP6 A;  3I6C A;  1FKL A;  3O5M A;  4ODO A;  3CHF A;  2MPH A;  1HKK A;  4DWS A;  2B5U B;  1HKM A;  5D75 A;  2F2D A;  1Q6I A;  4QT3 A;  4W9Q A;  4P8W A;  4TW6 A;  2MNT A;  3RGC A;  1B6C A;  1J4H A;  4DRQ A;  2M1I A;  2O9O A;  1F8A B;  3WD0 A;  3O5K A;  1SYT A;  1HXV A;  2O92 A;  3JYM A;  5HW8 A;  5HWC A;  2XPB A;  3GU0 A;  3WL0 A;  4JFJ A;  2PI6 A;  4FN2 A;  2MLY A;  1N1A A;  4R5E A;  3RM4 A;  1H0I A;  4HAR A;  3EY6 A;  4R0X A;  3KAG A;  3ARY A;  3PRD A;  4MNJ A;  4DRK A;  4DRN A;  4IPX A;  2MLZ A;  4DWS B;  1KT0 A;  2PPN A;  3ARS A;  2DG9 A;  3RM8 A;  4BF8 A;  3KAD A;  3O5O A;  3RM9 A;  2KGJ A;  3O5R A;  4IT4 A;  1FKI A;  2KR7 A;  1XHG A;  3NI6 A;  4LAX A;  5DIT A;  2DT3 A;  3WQV A;  2ZQS A;  3AS1 A;  5HKG A;  3UQB A;  1JNE A;  1HJV A;  3ARO A;  2LPV A;  4L3N A;  4WK9 A;  3WQW A;  2XP8 A;  1GRJ A;  4Z2I A;  3TC5 A;  4O2T A;  2PBC A;  4DIP A;  1OWQ A;  1ZCN A;  1FKG A;  2G8Z A;  2EUL A;  3AQU A;  4ODL A;  1YW5 A;  3ALG A;  1ZL1 A;  3ODK A;  1W1P A;  3PA7 A;  4Z2J A;  1X6N A;  1Q1C A;  4S3K A;  4ML4 A;  4L72 B;  5DIU A;  1W1Y A;  2IUZ A;  3ARU A;  2XP9 A;  3KAB A;  2A3B A;  2ZR5 A;  3WD3 A;  2A3E A;  4G2P A;  1EDQ A;  2XP5 A;  1YAT A;  1JNT A;  3WD2 A;  4NNR A;  4TYO A;  4Z2H A;  4Z2G A;  2LKN A;  2DG3 A;  3QOK A;  2VCD A;  2LGO A;  3B9E A;  4Z2K A;  4JFI A;  3PR9 A;  3CHE A;  1WNO A;  2PPO A;  3AS3 A;  3O5E A;  3WH0 A;  1BKF A;  4LAV A;  4C02 B;  2OLH A;  2M08 A;  4TNS A;  1UR9 A;  2B31 A;  2YBT A;  1NMV A;  2PPP A;  1FKD A;  1UR8 A;  3AS2 A;  1K9T A;  4P8U A;  4FAP A;  1PBK A;  2WK2 A;  4U84 A;  2DSV A;  4IQ2 A;  1FKS A;  1OGB A;  2JZV A;  4MSP A;  3GTY X;  4WIW A;  3NTP A;  2FAP A;  5DIV A;  3H9R B;  1JNS A;  3WD4 A;  2P4V A;  4ODR A;  2DSZ A;  1JCH B;  1OGG A;  1NWU A;  2DT2 A;  2WLZ A;  1TCO C;  4LAY A;  2A3C A;  1SR0 A;  3ARW A;  1L1P A;  4TX0 A;  5DF0 A;  2AWG A;  4W9P A;  4Q22 A;  5BXJ A;  1ZBW A;  4KQZ A;  3B9A A;  4JFL A;  1FKJ A;  4QIB A;  1QZ2 A;  3ARR A;  4P8V A;  2DPE A;  4P8X A;  5I98 A;  4TW7 A;  4DWS C;  4DRI A;  1E15 A;  2KO7 A;  2G41 A;  1ZBC A;  1LL7 A;  1FKF A;  4MNL A;  4DRJ A;  2ETN A;  4U85 A;  1FKH A;  3RFW A;  2YBU A;  3KAH A;  2DT1 A;  1F40 A;  2M2A A;  4DWS D;  4AY1 A;  3ARX A;  4J4N A;  1EIB A;  4MTV A;  1HJX A;  2ITK A;  1GPF A;  2QF8 A;  1E44 A;  2WM0 A;  1J6Y A;  1J4I A;  4IQC A;  1U79 A;  1FJD A;  1ZBV A;  3KAF A;  1FKK A;  2Y78 A;  2PV2 A;  4DZ2 A;  3JXV A;  4DH0 A;  1NSG A;  4TW8 A;  2ZQV A;  3CGN A;  3UQI A;  1NMW A;  4LGX A;  2ZQU A;  4DRO A;  1ZK6 A;  3BXW A;  4IT6 A;  5GPG A;  3VAW A;  2Q5A A;  4UDM A;  3PRB A;  4ODK A;  3B9D A;  3TCZ A;  4JFM A;  1FAP A;  4ODQ A;  4G50 A;  1ZB5 A;  4GIV A;  5B8I C;  2RUQ A;  3WKZ A;  1H0G A;  1D7J A;  3UQA A;  5HBF A;  1GOI A;  3O5D A;  3O5J A;  1ROT A;  4MAV A;  2PV1 A;  1W9P A;  4WKF A;  2ZR4 A;  4W5U A;  3ARV A;  1FKT A;  4HBO A;  1FFR A;  5JH8 A;  2A3A A;  4N19 A;  3FAP A;  3UI5 A;  3CH9 A;  5HW7 A;  3MDY B;  3UI4 A;  1QPF A;  1LG2 A;  3IKD A;  4ZS6 A;  3ART A;  1A7X A;  1LQ0 A;  1JND A;  2XPA A;  3ARZ A;  3EIP A;  4WJX A;  2D9F A;  1ZBK A;  1HJW A;  1TFV A;  1D7H A;  4GGQ A;  3WD1 A;  4LAW A;  4QT2 A;  2DT0 A;  5GQB A;  4S3J A;  4ODN A;  3B8S A;  3O5G A;  2ESC A; 
#chains in the Genus database with same CATH homology
 1W26 A;  3O5Q A;  3WIJ A;  3G6M A;  4ZPT R;  1W9V A;  1EYM A;  1WB0 A;  1KFW A;  4U86 A;  1P5Q A;  2AOS A;  1Q6U A;  1O6I A;  1R9H A;  1LJY A;  2PV3 A;  4Q7N A;  1X6L A;  3FY1 A;  1NH6 A;  2DG4 A;  3KCE A;  3AS0 A;  3CHC A;  2LJ4 A;  1FD9 A;  1HKI A;  5HWB A;  4DRM A;  2DSU A;  2XP7 A;  5DEZ A;  1LL4 A;  2ZR6 A;  4WKH A;  3UF8 A;  3ARQ A;  1W1V A;  3KAI A;  1Y0O A;  2N87 A;  1M5Y A;  1E9L A;  3GPK A;  3KZ7 A;  4DT4 A;  3IKG A;  1E6Z A;  1J4R A;  3JYJ A;  3CHD A;  2DSW A;  2FDM A;  5HT1 A;  1IX5 A;  3W4R A;  4Z2L A;  3G6L A;  4J4O A;  1NWR A;  1BL4 A;  1NWS A;  2F4E A;  1ZU8 A;  3B7X A;  1VF8 A;  4DRH A;  3WL1 A;  3O5I A;  1WAW A;  3FXY A;  1Q6H A;  1EQ3 A;  3NRK A;  3ARP A;  2XP4 A;  1HKJ A;  2VN1 A;  3OA5 A;  1XRV A;  1KT1 A;  4ZPW R;  3IHZ A;  1GUV A;  2MLX A;  4NSB A;  1E6R A;  2IF4 A;  2RQS A;  4KR0 B;  1E6P A;  2UZ5 A;  4NZC A;  1NWT A;  4ITZ A;  2F21 A;  3O5L A;  1CTN A;  3O5F A;  4QZV B;  1D7I A;  5HUA A;  4DRP A;  4DZ3 A;  4MGV A;  4XAK A;  4URI A;  1LG1 A;  3IK8 A;  2KI3 A;  4MNM A;  1T11 A;  1W9U A;  3CGM A;  5HTG A;  2ZQT A;  4ZPV R;  1FKR A;  4WKA A;  1D2K A;  5HW6 A;  1JVW A;  3KAC A;  4MNK A;  5GPR A;  2WLY A;  3PRA A;  2RSE A;  1ROU A;  4JYS A;  3TDB A;  1EHN A;  3LUO A;  1C9H A;  2L2S A;  2KFW A;  2OFN A;  2K8I A;  1QPL A;  2RUC A;  1FFQ A;  4JFK A;  2MF9 A;  4ODP A;  4HBE A;  3CZ8 A;  5J6E A;  3UI6 A;  2KE0 A;  1D6O A;  2FKE A;  4PTM A;  3ALF A;  5DO2 A;  2RUR A;  1ITX A;  1PIN A;  3O5P A;  1RD6 A;  1LL6 A;  1FKB A;  3RME A;  3OOB A;  4MPK A;  1W1T A;  1E6N A;  2RUD A;  4ODM A;  2XP3 A;  4W9O A;  2XP6 A;  3I6C A;  1FKL A;  3O5M A;  4ODO A;  3CHF A;  2MPH A;  1HKK A;  4DWS A;  1HKM A;  5D75 A;  2F2D A;  1Q6I A;  4QT3 A;  4W9Q A;  4P8W A;  4TW6 A;  2MNT A;  3RGC A;  1B6C A;  1J4H A;  4DRQ A;  2M1I A;  2O9O A;  1F8A B;  3WD0 A;  3O5K A;  1SYT A;  1HXV A;  2O92 A;  3JYM A;  5HW8 A;  5HWC A;  2XPB A;  3WL0 A;  4JFJ A;  2PI6 A;  4FN2 A;  2MLY A;  1N1A A;  4R5E A;  3RM4 A;  1H0I A;  4HAR A;  3EY6 A;  4R0X A;  3KAG A;  3ARY A;  3PRD A;  4MNJ A;  4DRK A;  4DRN A;  4IPX A;  2MLZ A;  4DWS B;  1KT0 A;  2PPN A;  3ARS A;  2DG9 A;  3RM8 A;  4BF8 A;  3KAD A;  3O5O A;  3RM9 A;  2KGJ A;  3O5R A;  4IT4 A;  1FKI A;  2KR7 A;  1XHG A;  3NI6 A;  4LAX A;  5DIT A;  2DT3 A;  3WQV A;  2ZQS A;  3AS1 A;  5HKG A;  3UQB A;  1JNE A;  1HJV A;  3ARO A;  2LPV A;  4L3N A;  4WK9 A;  3WQW A;  2XP8 A;  4Z2I A;  3TC5 A;  4O2T A;  2PBC A;  4DIP A;  1OWQ A;  1ZCN A;  1FKG A;  2G8Z A;  3AQU A;  4ODL A;  1YW5 A;  3ALG A;  1ZL1 A;  3ODK A;  1W1P A;  3PA7 A;  4Z2J A;  1X6N A;  1Q1C A;  4S3K A;  4ML4 A;  4L72 B;  5DIU A;  1W1Y A;  2IUZ A;  3ARU A;  2XP9 A;  3KAB A;  2A3B A;  2ZR5 A;  3WD3 A;  2A3E A;  4G2P A;  1EDQ A;  2XP5 A;  1YAT A;  1JNT A;  3WD2 A;  4NNR A;  4TYO A;  4Z2H A;  4Z2G A;  2LKN A;  2DG3 A;  3QOK A;  2VCD A;  2LGO A;  3B9E A;  4Z2K A;  4JFI A;  3PR9 A;  3CHE A;  1WNO A;  2PPO A;  3AS3 A;  3O5E A;  3WH0 A;  1BKF A;  4LAV A;  4C02 B;  2OLH A;  2M08 A;  4TNS A;  1UR9 A;  2B31 A;  2YBT A;  1NMV A;  2PPP A;  1FKD A;  1UR8 A;  3AS2 A;  1K9T A;  4P8U A;  4FAP A;  1PBK A;  2WK2 A;  4U84 A;  2DSV A;  4IQ2 A;  1FKS A;  1OGB A;  2JZV A;  4MSP A;  4WIW A;  3NTP A;  2FAP A;  5DIV A;  3H9R B;  1JNS A;  3WD4 A;  4ODR A;  2DSZ A;  1OGG A;  1NWU A;  2DT2 A;  2WLZ A;  1TCO C;  4LAY A;  2A3C A;  1SR0 A;  3ARW A;  1L1P A;  4TX0 A;  5DF0 A;  2AWG A;  4W9P A;  4Q22 A;  5BXJ A;  1ZBW A;  4KQZ A;  3B9A A;  4JFL A;  1FKJ A;  4QIB A;  1QZ2 A;  3ARR A;  4P8V A;  2DPE A;  4P8X A;  5I98 A;  4TW7 A;  4DWS C;  4DRI A;  1E15 A;  2KO7 A;  2G41 A;  1ZBC A;  1LL7 A;  1FKF A;  4MNL A;  4DRJ A;  4U85 A;  1FKH A;  3RFW A;  2YBU A;  3KAH A;  2DT1 A;  1F40 A;  2M2A A;  4DWS D;  4AY1 A;  3ARX A;  4J4N A;  1EIB A;  4MTV A;  1HJX A;  2ITK A;  1GPF A;  2QF8 A;  2WM0 A;  1J6Y A;  1J4I A;  4IQC A;  1U79 A;  1FJD A;  1ZBV A;  3KAF A;  1FKK A;  2Y78 A;  2PV2 A;  4DZ2 A;  3JXV A;  4DH0 A;  1NSG A;  4TW8 A;  2ZQV A;  3CGN A;  3UQI A;  1NMW A;  4LGX A;  2ZQU A;  4DRO A;  1ZK6 A;  3BXW A;  4IT6 A;  5GPG A;  3VAW A;  2Q5A A;  3PRB A;  4ODK A;  3B9D A;  3TCZ A;  4JFM A;  1FAP A;  4ODQ A;  4G50 A;  1ZB5 A;  4GIV A;  5B8I C;  2RUQ A;  3WKZ A;  1H0G A;  1D7J A;  3UQA A;  5HBF A;  1GOI A;  3O5D A;  3O5J A;  1ROT A;  4MAV A;  2PV1 A;  1W9P A;  4WKF A;  2ZR4 A;  4W5U A;  3ARV A;  1FKT A;  4HBO A;  1FFR A;  5JH8 A;  2A3A A;  4N19 A;  3FAP A;  3UI5 A;  3CH9 A;  5HW7 A;  3MDY B;  3UI4 A;  1QPF A;  1LG2 A;  3IKD A;  4ZS6 A;  3ART A;  1A7X A;  1LQ0 A;  1JND A;  2XPA A;  3ARZ A;  4WJX A;  2D9F A;  1ZBK A;  1HJW A;  1TFV A;  1D7H A;  4GGQ A;  3WD1 A;  4LAW A;  4QT2 A;  2DT0 A;  5GQB A;  4S3J A;  4ODN A;  3B8S A;  3O5G A;  2ESC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...