4DRMA

Evaluation of synthetic fk506 analogs as ligands for fkbp51 and fkbp52: complex of fkbp51 with {3-[(1r)-3-(3,4-dimethoxyphenyl)-1-({[(2s)-1-{[(1s,2r)-2-ethyl-1-hydroxycyclohexyl](oxo)acetyl}piperidin-2-yl]carbonyl}oxy)propyl]phenoxy}acetic acid
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Evaluation of Synthetic FK506 Analogues as Ligands for the FK506-Binding Proteins 51 and 52.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drmA00
4W9OA 2DG9A 1C9HA 2MLZA 1JVWA 4DRKA 1QZ2A 2F2DA 2XP9A 3OOBA 3O5DA 1HXVA 2PPPA 5HWCA 2PV2A 3UI4A 2PV1A 4DRNA 4JFIA 1L1PA 2LKNA 1FKIA 4QIBA 2MF9A 2XP5A 1FKTA 3JYJA 5HKGA 1NMWA 2RQSA 2RUQA 1F40A 3H9RB 1QPFA 4JFKA 1ZK6A 3CGMA 4ODRA 2MLXA 5HW7A 3O5LA 3RFWA 4ODOA 1R9HA 1BL4A 2PPOA 3O5RA 4FAPA 4TW7A 2ZR4A 3O5IA 2MNTA 3NRKA 2FKEA 4TYOA 1YW5A 5HW6A 3KAIA 2Y78A 1ROUA 1Q6HA 2XP3A 1J6YA 3JYMA 3ODKA 3UI6A 1Q6UA 2RUDA 3IKGA 1D7HA 4JFMA 2XP7A 2IF4A 5GPGA 4DRIA 3O5EA 5HW8A 5BXJA 5I98A 1FKRA 2KFWA 3LUOA 4JYSA 3TC5A 1KT1A 4QT2A 4J4OA 2XPBA 2KO7A 1PINA 2Q5AA 1EYMA 1J4IA 4LAVA 2XP4A 4FN2A 4DRHA 4DRMA 1P5QA 1D6OA 2LPVA 4IQCA 4ODMA 4MSPA 1FAPA 2MPHA 2VCDA 3CGNA 4R0XA 3KAGA 4U84A 2ZQVA 1NMVA 4U86A 4U85A 3RGCA 1PBKA 3O5JA 2PPNA 1FKLA 3MDYB 4GGQA 3KABA 1D7JA 2PV3A 2KE0A 3UQBA 2M1IA 1FKKA 3UQIA 4W9QA 1Q6IA 3NTPA 4ODPA 3O5FA 1FKFA 2KGJA 2KI3A 1KT0A 3KAHA 4DROA 5B8IC 4ITZA 2OFNA 5DIVA 1N1AA 2ITKA 4ODQA 3JXVA 4W9PA 1FD9A 2ZQSA 4JFLA 2XPAA 2ZR6A 3NI6A 1FKHA 4DRJA 3TDBA 1FKGA 3O5KA 4GIVA 4LAXA 4IPXA 5D75A 4DZ3A 3KCEA 1ZCNA 1J4HA 2ZQTA 4QT3A 4DRPA 4DZ2A 1Q1CA 3O5MA 1W26A 3UI5A 4IQ2A 3WH0A 1FJDA 2L2SA 1Y0OA 2VN1A 1A7XA 4ODLA 4LAYA 4DIPA 1FKBA 4MGVA 3EY6A 2PBCA 3O5QA 5DITA 2DG4A 2DG3A 4G2PA 1M5YA 1U79A 2D9FA 1FKJA 1FKSA 1J4RA 2M08A 4TX0A 3TCZA 4BF8A 3I6CA 3O5OA 3PA7A 5HT1A 3KACA 4DRQA 2F4EA 3UQAA 1QPLA 3O5GA 2M2AA 1EQ3A 4DT4A 1F8AB 4DH0A 1TCOC 1BKFA 1FKDA 3KZ7A 3GPKA 4J4NA 1T11A 3B7XA 4JFJA 4LAWA 2JZVA 2ZQUA 4O2TA 5HTGA 2K8IA 1B6CA 3PRBA 2KR7A 5DIUA 4TNSA 4G50A 2N87A 2RUCA 2F21A 4TW8A 2FAPA 3IKDA 4C02B 1ROTA 3FAPA 5J6EA 2RSEA 3KAFA 2LGOA 4NNRA 2XP6A 4TW6A 1YATA 1NSGA 1D7IA 2AWGA 4ODNA 3KADA 3VAWA 1JNSA 3PRDA 2LJ4A 1JNTA 3UF8A 2RURA 2XP8A 2ZR5A 3O5PA 2MLYA 3IHZA 5HUAA 2UZ5A 4N19A 3IK8A 5HWBA 4ODKA
chains in the Genus database with same CATH superfamily
4W9OA 2MLZA 2F2DA 2XP9A 3O5DA 1HXVA 2PPPA 3BMBA 3ARZA 3CZ8A 4P8VA 2PN0A 1L1PA 4HBEA 4DRNA 4Z2LA 1FKIA 1WAWA 3AS2A 1FKTA 1LG1A 2RUQA 1QPFA 3CGMA 4ODRA 3GU0A 4ZPVR 1SYTA 1R9HA 1BL4A 4FAPA 4TW7A 1W1TA 3KAIA 1ROUA 2B5UB 2XP3A 4WKHA 1Q6UA 2DT3A 1W1VA 4ML4A 4DWSA 4HBOA 1O6IA 4J4OA 1ZBWA 2PI6A 4LAVA 1D6OA 2LPVA 4DRQA 1FAPA 4U84A 3KAGA 4U85A 1NMVA 1PBKA 1D7JA 2PV3A 2KE0A 4PTMA 2O92A 4P8XA 1CTNA 4W9QA 3ARRA 1K9TA 4KR0B 2OFNA 3PR9A 2XPAA 3NI6A 1FKHA 1EDQA 3PRAA 3TDBA 3WQWA 3ARQA 4IPXA 1ZCNA 1ZL1A 4MNKA 4DRPA 3RM4A 1FJDA 1Y0OA 2VN1A 1A7XA 1FKBA 2PBCA 1W9UA 5DITA 1FKJA 2F23A 2OLHA 3TCZA 3I6CA 3O5OA 2WLYA 3G6LA 2F4EA 3UQAA 1QPLA 1EQ3A 3ARUA 4DH0A 1TCOC 2DT1A 3GPKA 2DSVA 1GUVA 2K8IA 5HBFA 1B6CA 1NWRA 2KR7A 4WJXA 4TNSA 2N87A 3CH9A 4TW8A 5J6EA 2RSEA 4NNRA 2EULA 3PRDA 3UF8A 3O5PA 2UZ5A 4N19A 3AQUA 1JCHB 3AS1A 2PV2A 3EIPA 2PV1A 1E6ZA 1ZBVA 2MF9A 5HKGA 3G6MA 1NMWA 2RQSA 3H9RB 3B9DA 5HW7A 2YBUA 1W9PA 3RFWA 4ODOA 2ZR4A 2A3CA 2MNTA 2FDMA 2FKEA 1YW5A 5HW6A 1Q6HA 4AY1A 3WD2A 3UI6A 3AROA 4ZPWR 5I98A 2XP7A 1W1PA 1NWTA 5BXJA 2QF8A 1PINA 1OWQA 1E6RA 4DT4A 4WIWA 3CGNA 3WL0A 4U86A 3MDYB 4GGQA 3KABA 1HKJA 1HKMA 2ETNA 4MAVA 1Q6IA 3O5FA 3KAHA 3ARXA 4DROA 4NZCA 4W9PA 4ZPTR 4JFLA 1E6PA 5D75A 1J4HA 1HJWA 4QT3A 3O5MA 2WM0A 2YBTA 4ODLA 4DIPA 2B31A 3ARWA 1TFVA 1GPFA 1ZB5A 3EY6A 2DG4A 2G8ZA 5DO2A 4G2PA 1U79A 2M08A 4TX0A 4BF8A 2DT0A 1SR0A 1F8AB 3ARTA 1T11A 4JFJA 1NH6A 4LAWA 2JZVA 4O2TA 1ZBKA 4C02B 2FAPA 3FAPA 3KAFA 1H0GA 4Z2IA 4DRKA 3VAWA 5HWCA 2AWGA 1OGGA 2XP8A 4NSBA 5HUAA 3IHZA 4ODKA 4XAKA 2DG9A 1C9HA 3WKZA 1QZ2A 3OOBA 1ITXA 3RM8A 4JFIA 2LKNA 3WQVA 1NWSA 4QIBA 2XP5A 4Z2KA 3JYJA 3AS0A 1LG2A 4JFKA 1LQ0A 4P8UA 4UDMA 1E15A 1D2KA 2PPOA 3B9AA 3NRKA 4LGXA 4Z2GA 2IUZA 4TYOA 1RD6A 2Y78A 5JH8A 4HARA 4MPKA 3JYMA 1HJXA 4Z2JA 2RUDA 3B9EA 3IKGA 5GPGA 2IF4A 4DRIA 1FKRA 3FXYA 3LUOA 4JYSA 5DF0A 1KT1A 4QT2A 2KO7A 4DWSC 4FN2A 4WKAA 1P5QA 4IQCA 1F40A 4MSPA 2MPHA 1GOIA 2ZQVA 3RGCA 3O5JA 2PPNA 3UQBA 1LL6A 2DSUA 2WK2A 1FKKA 4S3JA 2DPEA 4ODPA 4Q22A 1KT0A 2AOSA 5B8IC 2WLZA 1N1AA 4ODQA 5DIVA 3JXVA 2ZR6A 4DWSB 3RMEA 1WB0A 4WKFA 3CHDA 1FKGA 4DZ3A 3KCEA 3FY1A 2ZQTA 3B8SA 4DZ2A 3WD1A 3UI5A 4MGVA 3WD0A 3O5QA 3WD4A 3WL1A 1JNDA 4MNMA 1M5YA 5DEZA 3CHCA 3PA7A 5HT1A 3O5GA 1FFRA 1GRJA 3AS3A 1BKFA 1FKDA 3ARYA 2ZQUA 3GTYX 5HTGA 1E6NA 1H0IA 2G41A 2F21A 3IKDA 1ROTA 2O9OA 1NWUA 2ESCA 3BXWA 1D7IA 3KADA 4MNJA 1XRVA 3QOKA 1JNTA 1ZU8A 2DT2A 4ZS6A 4L3NA 2MLYA 1WNOA 4P8WA 3IK8A 1ZBCA 1JVWA 1IX5A 3UI4A 3ALFA 2A3BA 3ARPA 3WIJA 3OA5A 4MNLA 1LL4A 1ZK6A 1KFWA 2MLXA 3O5LA 1E9LA 1JNEA 3O5RA 3CHFA 4KQZA 1UR9A 3O5IA 1EHNA 4Z2HA 3RM9A 1VF8A 1J6YA 3ODKA 1E44A 4QZVB 1HKKA 1D7HA 4JFMA 5HW8A 3O5EA 2KFWA 4R5EA 3TC5A 1EIBA 2XPBA 2Q5AA 1EYMA 1J4IA 2XP4A 3W4RA 4DRHA 4DRMA 4ODMA 4L72B 4R0XA 1X6NA 2VCDA 4S3KA 2P4VA 1W9VA 2A3AA 1FKLA 1OGBA 2M1IA 3UQIA 4W5UA 4IT6A 3NTPA 1FKFA 2KGJA 2KI3A 1X6LA 4ITZA 2ITKA 1FD9A 2ZQSA 4WK9A 5GQBA 1HKIA 4DRJA 3O5KA 4GIVA 4LAXA 4DWSD 1UR8A 1LJYA 1Q1CA 1W26A 2DSWA 1LL7A 4IQ2A 3WH0A 2L2SA 4LAYA 2A3EA 3CHEA 2DG3A 4Q7NA 3ARSA 2D9FA 1FKSA 1J4RA 4URIA 1W1YA 3KACA 2M2AA 4MTVA 3KZ7A 1HJVA 1FFQA 4J4NA 3B7XA 3PRBA 5DIUA 3ARVA 4G50A 3WD3A 2RUCA 5GPRA 2DSZA 2LGOA 2XP6A 4TW6A 1YATA 1NSGA 4ODNA 1JNSA 3ALGA 2LJ4A 1XHGA 2RURA 4IT4A 2ZR5A 5HWBA
chains in the Genus database with same CATH topology
4W9OA 2MLZA 2F2DA 2XP9A 3O5DA 1HXVA 2PPPA 3ARZA 3CZ8A 4P8VA 1L1PA 4HBEA 4DRNA 4Z2LA 1FKIA 1WAWA 3AS2A 1FKTA 1LG1A 2RUQA 1QPFA 3CGMA 4ODRA 4ZPVR 1SYTA 1R9HA 1BL4A 4FAPA 4TW7A 1W1TA 3KAIA 1ROUA 2XP3A 4WKHA 1Q6UA 2DT3A 1W1VA 4ML4A 4DWSA 4HBOA 1O6IA 4J4OA 1ZBWA 2PI6A 4LAVA 1D6OA 2LPVA 4DRQA 1FAPA 4U84A 3KAGA 4U85A 1NMVA 1PBKA 1D7JA 2PV3A 2KE0A 4PTMA 2O92A 4P8XA 1CTNA 4W9QA 3ARRA 1K9TA 4KR0B 2OFNA 3PR9A 2XPAA 3NI6A 1FKHA 1EDQA 3PRAA 3TDBA 3WQWA 3ARQA 4IPXA 1ZCNA 1ZL1A 4MNKA 4DRPA 3RM4A 1FJDA 1Y0OA 2VN1A 1A7XA 1FKBA 2PBCA 1W9UA 5DITA 1FKJA 2OLHA 3TCZA 3I6CA 3O5OA 2WLYA 3G6LA 2F4EA 3UQAA 1QPLA 1EQ3A 3ARUA 4DH0A 1TCOC 2DT1A 3GPKA 2DSVA 1GUVA 2K8IA 5HBFA 1B6CA 1NWRA 2KR7A 4WJXA 4TNSA 2N87A 3CH9A 4TW8A 5J6EA 2RSEA 4NNRA 3PRDA 3UF8A 3O5PA 2UZ5A 4N19A 3AQUA 3AS1A 2PV2A 2PV1A 1E6ZA 1ZBVA 2MF9A 5HKGA 3G6MA 1NMWA 2RQSA 3H9RB 3B9DA 5HW7A 2YBUA 1W9PA 3RFWA 4ODOA 2ZR4A 2A3CA 2MNTA 2FDMA 2FKEA 1YW5A 5HW6A 1Q6HA 4AY1A 3WD2A 3UI6A 3AROA 4ZPWR 5I98A 2XP7A 1W1PA 1NWTA 5BXJA 2QF8A 1PINA 1OWQA 1E6RA 4DT4A 4WIWA 3CGNA 3WL0A 4U86A 3MDYB 4GGQA 3KABA 1HKJA 1HKMA 4MAVA 1Q6IA 3O5FA 3KAHA 3ARXA 4DROA 4NZCA 4W9PA 4ZPTR 4JFLA 1E6PA 5D75A 1J4HA 1HJWA 4QT3A 3O5MA 2WM0A 2YBTA 4ODLA 4DIPA 2B31A 3ARWA 1TFVA 1GPFA 1ZB5A 3EY6A 2DG4A 2G8ZA 5DO2A 4G2PA 1U79A 2M08A 4TX0A 4BF8A 2DT0A 1SR0A 1F8AB 3ARTA 1T11A 4JFJA 1NH6A 4LAWA 2JZVA 4O2TA 1ZBKA 4C02B 2FAPA 3FAPA 3KAFA 1H0GA 4Z2IA 4DRKA 3VAWA 5HWCA 2AWGA 1OGGA 2XP8A 4NSBA 5HUAA 3IHZA 4ODKA 4XAKA 2DG9A 1C9HA 3WKZA 1QZ2A 3OOBA 1ITXA 3RM8A 4JFIA 2LKNA 3WQVA 1NWSA 4QIBA 2XP5A 4Z2KA 3JYJA 3AS0A 1LG2A 4JFKA 1LQ0A 4P8UA 1E15A 1D2KA 2PPOA 3B9AA 3NRKA 4LGXA 4Z2GA 2IUZA 4TYOA 1RD6A 2Y78A 5JH8A 4HARA 4MPKA 3JYMA 1HJXA 4Z2JA 2RUDA 3B9EA 3IKGA 5GPGA 2IF4A 4DRIA 1FKRA 3FXYA 3LUOA 4JYSA 5DF0A 1KT1A 4QT2A 2KO7A 4DWSC 4FN2A 4WKAA 1P5QA 4IQCA 1F40A 4MSPA 2MPHA 1GOIA 2ZQVA 3RGCA 3O5JA 2PPNA 3UQBA 1LL6A 2DSUA 2WK2A 1FKKA 4S3JA 2DPEA 4ODPA 4Q22A 1KT0A 2AOSA 5B8IC 2WLZA 1N1AA 4ODQA 5DIVA 3JXVA 2ZR6A 4DWSB 3RMEA 1WB0A 4WKFA 3CHDA 1FKGA 4DZ3A 3KCEA 3FY1A 2ZQTA 3B8SA 4DZ2A 3WD1A 3UI5A 4MGVA 3WD0A 3O5QA 3WD4A 3WL1A 1JNDA 4MNMA 1M5YA 5DEZA 3CHCA 3PA7A 5HT1A 3O5GA 1FFRA 3AS3A 1BKFA 1FKDA 3ARYA 2ZQUA 5HTGA 1E6NA 1H0IA 2G41A 2F21A 3IKDA 1ROTA 2O9OA 1NWUA 2ESCA 3BXWA 1D7IA 3KADA 4MNJA 1XRVA 3QOKA 1JNTA 1ZU8A 2DT2A 4ZS6A 4L3NA 2MLYA 1WNOA 4P8WA 3IK8A 1ZBCA 1JVWA 1IX5A 3UI4A 3ALFA 2A3BA 3ARPA 3WIJA 3OA5A 4MNLA 1LL4A 1ZK6A 1KFWA 2MLXA 3O5LA 1E9LA 1JNEA 3O5RA 3CHFA 4KQZA 1UR9A 3O5IA 1EHNA 4Z2HA 3RM9A 1VF8A 1J6YA 3ODKA 4QZVB 1HKKA 1D7HA 4JFMA 5HW8A 3O5EA 2KFWA 4R5EA 3TC5A 1EIBA 2XPBA 2Q5AA 1EYMA 1J4IA 2XP4A 3W4RA 4DRHA 4DRMA 4ODMA 4L72B 4R0XA 1X6NA 2VCDA 4S3KA 1W9VA 2A3AA 1FKLA 1OGBA 2M1IA 3UQIA 4W5UA 4IT6A 3NTPA 1FKFA 2KGJA 2KI3A 1X6LA 4ITZA 2ITKA 1FD9A 2ZQSA 4WK9A 5GQBA 1HKIA 4DRJA 3O5KA 4GIVA 4LAXA 4DWSD 1UR8A 1LJYA 1Q1CA 1W26A 2DSWA 1LL7A 4IQ2A 3WH0A 2L2SA 4LAYA 2A3EA 3CHEA 2DG3A 4Q7NA 3ARSA 2D9FA 1FKSA 1J4RA 4URIA 1W1YA 3KACA 2M2AA 4MTVA 3KZ7A 1HJVA 1FFQA 4J4NA 3B7XA 3PRBA 5DIUA 3ARVA 4G50A 3WD3A 2RUCA 5GPRA 2DSZA 2LGOA 2XP6A 4TW6A 1YATA 1NSGA 4ODNA 1JNSA 3ALGA 2LJ4A 1XHGA 2RURA 4IT4A 2ZR5A 5HWBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9O A;  2DG9 A;  1C9H A;  2MLZ A;  1JVW A;  4DRK A;  1QZ2 A;  2F2D A;  2XP9 A;  3OOB A;  3O5D A;  1HXV A;  2PPP A;  5HWC A;  2PV2 A;  3UI4 A;  2PV1 A;  4DRN A;  4JFI A;  1L1P A;  2LKN A;  1FKI A;  4QIB A;  2MF9 A;  2XP5 A;  1FKT A;  3JYJ A;  5HKG A;  1NMW A;  2RQS A;  2RUQ A;  1F40 A;  3H9R B;  1QPF A;  4JFK A;  1ZK6 A;  3CGM A;  4ODR A;  2MLX A;  5HW7 A;  3O5L A;  3RFW A;  4ODO A;  1R9H A;  1BL4 A;  2PPO A;  3O5R A;  4FAP A;  4TW7 A;  2ZR4 A;  3O5I A;  2MNT A;  3NRK A;  2FKE A;  4TYO A;  1YW5 A;  5HW6 A;  3KAI A;  2Y78 A;  1ROU A;  1Q6H A;  2XP3 A;  1J6Y A;  3JYM A;  3ODK A;  3UI6 A;  1Q6U A;  2RUD A;  3IKG A;  1D7H A;  4JFM A;  2XP7 A;  2IF4 A;  5GPG A;  4DRI A;  3O5E A;  5HW8 A;  5BXJ A;  5I98 A;  1FKR A;  2KFW A;  3LUO A;  4JYS A;  3TC5 A;  1KT1 A;  4QT2 A;  4J4O A;  2XPB A;  2KO7 A;  1PIN A;  2Q5A A;  1EYM A;  1J4I A;  4LAV A;  2XP4 A;  4FN2 A;  4DRH A;  4DRM A;  1P5Q A;  1D6O A;  2LPV A;  4IQC A;  4ODM A;  4MSP A;  1FAP A;  2MPH A;  2VCD A;  3CGN A;  4R0X A;  3KAG A;  4U84 A;  2ZQV A;  1NMV A;  4U86 A;  4U85 A;  3RGC A;  1PBK A;  3O5J A;  2PPN A;  1FKL A;  3MDY B;  4GGQ A;  3KAB A;  1D7J A;  2PV3 A;  2KE0 A;  3UQB A;  2M1I A;  1FKK A;  3UQI A;  4W9Q A;  1Q6I A;  3NTP A;  4ODP A;  3O5F A;  1FKF A;  2KGJ A;  2KI3 A;  1KT0 A;  3KAH A;  4DRO A;  5B8I C;  4ITZ A;  2OFN A;  5DIV A;  1N1A A;  2ITK A;  4ODQ A;  3JXV A;  4W9P A;  1FD9 A;  2ZQS A;  4JFL A;  2XPA A;  2ZR6 A;  3NI6 A;  1FKH A;  4DRJ A;  3TDB A;  1FKG A;  3O5K A;  4GIV A;  4LAX A;  4IPX A;  5D75 A;  4DZ3 A;  3KCE A;  1ZCN A;  1J4H A;  2ZQT A;  4QT3 A;  4DRP A;  4DZ2 A;  1Q1C A;  3O5M A;  1W26 A;  3UI5 A;  4IQ2 A;  3WH0 A;  1FJD A;  2L2S A;  1Y0O A;  2VN1 A;  1A7X A;  4ODL A;  4LAY A;  4DIP A;  1FKB A;  4MGV A;  3EY6 A;  2PBC A;  3O5Q A;  5DIT A;  2DG4 A;  2DG3 A;  4G2P A;  1M5Y A;  1U79 A;  2D9F A;  1FKJ A;  1FKS A;  1J4R A;  2M08 A;  4TX0 A;  3TCZ A;  4BF8 A;  3I6C A;  3O5O A;  3PA7 A;  5HT1 A;  3KAC A;  4DRQ A;  2F4E A;  3UQA A;  1QPL A;  3O5G A;  2M2A A;  1EQ3 A;  4DT4 A;  1F8A B;  4DH0 A;  1TCO C;  1BKF A;  1FKD A;  3KZ7 A;  3GPK A;  4J4N A;  1T11 A;  3B7X A;  4JFJ A;  4LAW A;  2JZV A;  2ZQU A;  4O2T A;  5HTG A;  2K8I A;  1B6C A;  3PRB A;  2KR7 A;  5DIU A;  4TNS A;  4G50 A;  2N87 A;  2RUC A;  2F21 A;  4TW8 A;  2FAP A;  3IKD A;  4C02 B;  1ROT A;  3FAP A;  5J6E A;  2RSE A;  3KAF A;  2LGO A;  4NNR A;  2XP6 A;  4TW6 A;  1YAT A;  1NSG A;  1D7I A;  2AWG A;  4ODN A;  3KAD A;  3VAW A;  1JNS A;  3PRD A;  2LJ4 A;  1JNT A;  3UF8 A;  2RUR A;  2XP8 A;  2ZR5 A;  3O5P A;  2MLY A;  3IHZ A;  5HUA A;  2UZ5 A;  4N19 A;  3IK8 A;  5HWB A;  4ODK A; 
#chains in the Genus database with same CATH topology
 4W9O A;  2MLZ A;  2F2D A;  2XP9 A;  3O5D A;  1HXV A;  2PPP A;  3BMB A;  3ARZ A;  3CZ8 A;  4P8V A;  2PN0 A;  1L1P A;  4HBE A;  4DRN A;  4Z2L A;  1FKI A;  1WAW A;  3AS2 A;  1FKT A;  1LG1 A;  2RUQ A;  1QPF A;  3CGM A;  4ODR A;  3GU0 A;  4ZPV R;  1SYT A;  1R9H A;  1BL4 A;  4FAP A;  4TW7 A;  1W1T A;  3KAI A;  1ROU A;  2B5U B;  2XP3 A;  4WKH A;  1Q6U A;  2DT3 A;  1W1V A;  4ML4 A;  4DWS A;  4HBO A;  1O6I A;  4J4O A;  1ZBW A;  2PI6 A;  4LAV A;  1D6O A;  2LPV A;  4DRQ A;  1FAP A;  4U84 A;  3KAG A;  4U85 A;  1NMV A;  1PBK A;  1D7J A;  2PV3 A;  2KE0 A;  4PTM A;  2O92 A;  4P8X A;  1CTN A;  4W9Q A;  3ARR A;  1K9T A;  4KR0 B;  2OFN A;  3PR9 A;  2XPA A;  3NI6 A;  1FKH A;  1EDQ A;  3PRA A;  3TDB A;  3WQW A;  3ARQ A;  4IPX A;  1ZCN A;  1ZL1 A;  4MNK A;  4DRP A;  3RM4 A;  1FJD A;  1Y0O A;  2VN1 A;  1A7X A;  1FKB A;  2PBC A;  1W9U A;  5DIT A;  1FKJ A;  2F23 A;  2OLH A;  3TCZ A;  3I6C A;  3O5O A;  2WLY A;  3G6L A;  2F4E A;  3UQA A;  1QPL A;  1EQ3 A;  3ARU A;  4DH0 A;  1TCO C;  2DT1 A;  3GPK A;  2DSV A;  1GUV A;  2K8I A;  5HBF A;  1B6C A;  1NWR A;  2KR7 A;  4WJX A;  4TNS A;  2N87 A;  3CH9 A;  4TW8 A;  5J6E A;  2RSE A;  4NNR A;  2EUL A;  3PRD A;  3UF8 A;  3O5P A;  2UZ5 A;  4N19 A;  3AQU A;  1JCH B;  3AS1 A;  2PV2 A;  3EIP A;  2PV1 A;  1E6Z A;  1ZBV A;  2MF9 A;  5HKG A;  3G6M A;  1NMW A;  2RQS A;  3H9R B;  3B9D A;  5HW7 A;  2YBU A;  1W9P A;  3RFW A;  4ODO A;  2ZR4 A;  2A3C A;  2MNT A;  2FDM A;  2FKE A;  1YW5 A;  5HW6 A;  1Q6H A;  4AY1 A;  3WD2 A;  3UI6 A;  3ARO A;  4ZPW R;  5I98 A;  2XP7 A;  1W1P A;  1NWT A;  5BXJ A;  2QF8 A;  1PIN A;  1OWQ A;  1E6R A;  4DT4 A;  4WIW A;  3CGN A;  3WL0 A;  4U86 A;  3MDY B;  4GGQ A;  3KAB A;  1HKJ A;  1HKM A;  2ETN A;  4MAV A;  1Q6I A;  3O5F A;  3KAH A;  3ARX A;  4DRO A;  4NZC A;  4W9P A;  4ZPT R;  4JFL A;  1E6P A;  5D75 A;  1J4H A;  1HJW A;  4QT3 A;  3O5M A;  2WM0 A;  2YBT A;  4ODL A;  4DIP A;  2B31 A;  3ARW A;  1TFV A;  1GPF A;  1ZB5 A;  3EY6 A;  2DG4 A;  2G8Z A;  5DO2 A;  4G2P A;  1U79 A;  2M08 A;  4TX0 A;  4BF8 A;  2DT0 A;  1SR0 A;  1F8A B;  3ART A;  1T11 A;  4JFJ A;  1NH6 A;  4LAW A;  2JZV A;  4O2T A;  1ZBK A;  4C02 B;  2FAP A;  3FAP A;  3KAF A;  1H0G A;  4Z2I A;  4DRK A;  3VAW A;  5HWC A;  2AWG A;  1OGG A;  2XP8 A;  4NSB A;  5HUA A;  3IHZ A;  4ODK A;  4XAK A;  2DG9 A;  1C9H A;  3WKZ A;  1QZ2 A;  3OOB A;  1ITX A;  3RM8 A;  4JFI A;  2LKN A;  3WQV A;  1NWS A;  4QIB A;  2XP5 A;  4Z2K A;  3JYJ A;  3AS0 A;  1LG2 A;  4JFK A;  1LQ0 A;  4P8U A;  4UDM A;  1E15 A;  1D2K A;  2PPO A;  3B9A A;  3NRK A;  4LGX A;  4Z2G A;  2IUZ A;  4TYO A;  1RD6 A;  2Y78 A;  5JH8 A;  4HAR A;  4MPK A;  3JYM A;  1HJX A;  4Z2J A;  2RUD A;  3B9E A;  3IKG A;  5GPG A;  2IF4 A;  4DRI A;  1FKR A;  3FXY A;  3LUO A;  4JYS A;  5DF0 A;  1KT1 A;  4QT2 A;  2KO7 A;  4DWS C;  4FN2 A;  4WKA A;  1P5Q A;  4IQC A;  1F40 A;  4MSP A;  2MPH A;  1GOI A;  2ZQV A;  3RGC A;  3O5J A;  2PPN A;  3UQB A;  1LL6 A;  2DSU A;  2WK2 A;  1FKK A;  4S3J A;  2DPE A;  4ODP A;  4Q22 A;  1KT0 A;  2AOS A;  5B8I C;  2WLZ A;  1N1A A;  4ODQ A;  5DIV A;  3JXV A;  2ZR6 A;  4DWS B;  3RME A;  1WB0 A;  4WKF A;  3CHD A;  1FKG A;  4DZ3 A;  3KCE A;  3FY1 A;  2ZQT A;  3B8S A;  4DZ2 A;  3WD1 A;  3UI5 A;  4MGV A;  3WD0 A;  3O5Q A;  3WD4 A;  3WL1 A;  1JND A;  4MNM A;  1M5Y A;  5DEZ A;  3CHC A;  3PA7 A;  5HT1 A;  3O5G A;  1FFR A;  1GRJ A;  3AS3 A;  1BKF A;  1FKD A;  3ARY A;  2ZQU A;  3GTY X;  5HTG A;  1E6N A;  1H0I A;  2G41 A;  2F21 A;  3IKD A;  1ROT A;  2O9O A;  1NWU A;  2ESC A;  3BXW A;  1D7I A;  3KAD A;  4MNJ A;  1XRV A;  3QOK A;  1JNT A;  1ZU8 A;  2DT2 A;  4ZS6 A;  4L3N A;  2MLY A;  1WNO A;  4P8W A;  3IK8 A;  1ZBC A;  1JVW A;  1IX5 A;  3UI4 A;  3ALF A;  2A3B A;  3ARP A;  3WIJ A;  3OA5 A;  4MNL A;  1LL4 A;  1ZK6 A;  1KFW A;  2MLX A;  3O5L A;  1E9L A;  1JNE A;  3O5R A;  3CHF A;  4KQZ A;  1UR9 A;  3O5I A;  1EHN A;  4Z2H A;  3RM9 A;  1VF8 A;  1J6Y A;  3ODK A;  1E44 A;  4QZV B;  1HKK A;  1D7H A;  4JFM A;  5HW8 A;  3O5E A;  2KFW A;  4R5E A;  3TC5 A;  1EIB A;  2XPB A;  2Q5A A;  1EYM A;  1J4I A;  2XP4 A;  3W4R A;  4DRH A;  4DRM A;  4ODM A;  4L72 B;  4R0X A;  1X6N A;  2VCD A;  4S3K A;  2P4V A;  1W9V A;  2A3A A;  1FKL A;  1OGB A;  2M1I A;  3UQI A;  4W5U A;  4IT6 A;  3NTP A;  1FKF A;  2KGJ A;  2KI3 A;  1X6L A;  4ITZ A;  2ITK A;  1FD9 A;  2ZQS A;  4WK9 A;  5GQB A;  1HKI A;  4DRJ A;  3O5K A;  4GIV A;  4LAX A;  4DWS D;  1UR8 A;  1LJY A;  1Q1C A;  1W26 A;  2DSW A;  1LL7 A;  4IQ2 A;  3WH0 A;  2L2S A;  4LAY A;  2A3E A;  3CHE A;  2DG3 A;  4Q7N A;  3ARS A;  2D9F A;  1FKS A;  1J4R A;  4URI A;  1W1Y A;  3KAC A;  2M2A A;  4MTV A;  3KZ7 A;  1HJV A;  1FFQ A;  4J4N A;  3B7X A;  3PRB A;  5DIU A;  3ARV A;  4G50 A;  3WD3 A;  2RUC A;  5GPR A;  2DSZ A;  2LGO A;  2XP6 A;  4TW6 A;  1YAT A;  1NSG A;  4ODN A;  1JNS A;  3ALG A;  2LJ4 A;  1XHG A;  2RUR A;  4IT4 A;  2ZR5 A;  5HWB A; 
#chains in the Genus database with same CATH homology
 4W9O A;  2MLZ A;  2F2D A;  2XP9 A;  3O5D A;  1HXV A;  2PPP A;  3ARZ A;  3CZ8 A;  4P8V A;  1L1P A;  4HBE A;  4DRN A;  4Z2L A;  1FKI A;  1WAW A;  3AS2 A;  1FKT A;  1LG1 A;  2RUQ A;  1QPF A;  3CGM A;  4ODR A;  4ZPV R;  1SYT A;  1R9H A;  1BL4 A;  4FAP A;  4TW7 A;  1W1T A;  3KAI A;  1ROU A;  2XP3 A;  4WKH A;  1Q6U A;  2DT3 A;  1W1V A;  4ML4 A;  4DWS A;  4HBO A;  1O6I A;  4J4O A;  1ZBW A;  2PI6 A;  4LAV A;  1D6O A;  2LPV A;  4DRQ A;  1FAP A;  4U84 A;  3KAG A;  4U85 A;  1NMV A;  1PBK A;  1D7J A;  2PV3 A;  2KE0 A;  4PTM A;  2O92 A;  4P8X A;  1CTN A;  4W9Q A;  3ARR A;  1K9T A;  4KR0 B;  2OFN A;  3PR9 A;  2XPA A;  3NI6 A;  1FKH A;  1EDQ A;  3PRA A;  3TDB A;  3WQW A;  3ARQ A;  4IPX A;  1ZCN A;  1ZL1 A;  4MNK A;  4DRP A;  3RM4 A;  1FJD A;  1Y0O A;  2VN1 A;  1A7X A;  1FKB A;  2PBC A;  1W9U A;  5DIT A;  1FKJ A;  2OLH A;  3TCZ A;  3I6C A;  3O5O A;  2WLY A;  3G6L A;  2F4E A;  3UQA A;  1QPL A;  1EQ3 A;  3ARU A;  4DH0 A;  1TCO C;  2DT1 A;  3GPK A;  2DSV A;  1GUV A;  2K8I A;  5HBF A;  1B6C A;  1NWR A;  2KR7 A;  4WJX A;  4TNS A;  2N87 A;  3CH9 A;  4TW8 A;  5J6E A;  2RSE A;  4NNR A;  3PRD A;  3UF8 A;  3O5P A;  2UZ5 A;  4N19 A;  3AQU A;  3AS1 A;  2PV2 A;  2PV1 A;  1E6Z A;  1ZBV A;  2MF9 A;  5HKG A;  3G6M A;  1NMW A;  2RQS A;  3H9R B;  3B9D A;  5HW7 A;  2YBU A;  1W9P A;  3RFW A;  4ODO A;  2ZR4 A;  2A3C A;  2MNT A;  2FDM A;  2FKE A;  1YW5 A;  5HW6 A;  1Q6H A;  4AY1 A;  3WD2 A;  3UI6 A;  3ARO A;  4ZPW R;  5I98 A;  2XP7 A;  1W1P A;  1NWT A;  5BXJ A;  2QF8 A;  1PIN A;  1OWQ A;  1E6R A;  4DT4 A;  4WIW A;  3CGN A;  3WL0 A;  4U86 A;  3MDY B;  4GGQ A;  3KAB A;  1HKJ A;  1HKM A;  4MAV A;  1Q6I A;  3O5F A;  3KAH A;  3ARX A;  4DRO A;  4NZC A;  4W9P A;  4ZPT R;  4JFL A;  1E6P A;  5D75 A;  1J4H A;  1HJW A;  4QT3 A;  3O5M A;  2WM0 A;  2YBT A;  4ODL A;  4DIP A;  2B31 A;  3ARW A;  1TFV A;  1GPF A;  1ZB5 A;  3EY6 A;  2DG4 A;  2G8Z A;  5DO2 A;  4G2P A;  1U79 A;  2M08 A;  4TX0 A;  4BF8 A;  2DT0 A;  1SR0 A;  1F8A B;  3ART A;  1T11 A;  4JFJ A;  1NH6 A;  4LAW A;  2JZV A;  4O2T A;  1ZBK A;  4C02 B;  2FAP A;  3FAP A;  3KAF A;  1H0G A;  4Z2I A;  4DRK A;  3VAW A;  5HWC A;  2AWG A;  1OGG A;  2XP8 A;  4NSB A;  5HUA A;  3IHZ A;  4ODK A;  4XAK A;  2DG9 A;  1C9H A;  3WKZ A;  1QZ2 A;  3OOB A;  1ITX A;  3RM8 A;  4JFI A;  2LKN A;  3WQV A;  1NWS A;  4QIB A;  2XP5 A;  4Z2K A;  3JYJ A;  3AS0 A;  1LG2 A;  4JFK A;  1LQ0 A;  4P8U A;  1E15 A;  1D2K A;  2PPO A;  3B9A A;  3NRK A;  4LGX A;  4Z2G A;  2IUZ A;  4TYO A;  1RD6 A;  2Y78 A;  5JH8 A;  4HAR A;  4MPK A;  3JYM A;  1HJX A;  4Z2J A;  2RUD A;  3B9E A;  3IKG A;  5GPG A;  2IF4 A;  4DRI A;  1FKR A;  3FXY A;  3LUO A;  4JYS A;  5DF0 A;  1KT1 A;  4QT2 A;  2KO7 A;  4DWS C;  4FN2 A;  4WKA A;  1P5Q A;  4IQC A;  1F40 A;  4MSP A;  2MPH A;  1GOI A;  2ZQV A;  3RGC A;  3O5J A;  2PPN A;  3UQB A;  1LL6 A;  2DSU A;  2WK2 A;  1FKK A;  4S3J A;  2DPE A;  4ODP A;  4Q22 A;  1KT0 A;  2AOS A;  5B8I C;  2WLZ A;  1N1A A;  4ODQ A;  5DIV A;  3JXV A;  2ZR6 A;  4DWS B;  3RME A;  1WB0 A;  4WKF A;  3CHD A;  1FKG A;  4DZ3 A;  3KCE A;  3FY1 A;  2ZQT A;  3B8S A;  4DZ2 A;  3WD1 A;  3UI5 A;  4MGV A;  3WD0 A;  3O5Q A;  3WD4 A;  3WL1 A;  1JND A;  4MNM A;  1M5Y A;  5DEZ A;  3CHC A;  3PA7 A;  5HT1 A;  3O5G A;  1FFR A;  3AS3 A;  1BKF A;  1FKD A;  3ARY A;  2ZQU A;  5HTG A;  1E6N A;  1H0I A;  2G41 A;  2F21 A;  3IKD A;  1ROT A;  2O9O A;  1NWU A;  2ESC A;  3BXW A;  1D7I A;  3KAD A;  4MNJ A;  1XRV A;  3QOK A;  1JNT A;  1ZU8 A;  2DT2 A;  4ZS6 A;  4L3N A;  2MLY A;  1WNO A;  4P8W A;  3IK8 A;  1ZBC A;  1JVW A;  1IX5 A;  3UI4 A;  3ALF A;  2A3B A;  3ARP A;  3WIJ A;  3OA5 A;  4MNL A;  1LL4 A;  1ZK6 A;  1KFW A;  2MLX A;  3O5L A;  1E9L A;  1JNE A;  3O5R A;  3CHF A;  4KQZ A;  1UR9 A;  3O5I A;  1EHN A;  4Z2H A;  3RM9 A;  1VF8 A;  1J6Y A;  3ODK A;  4QZV B;  1HKK A;  1D7H A;  4JFM A;  5HW8 A;  3O5E A;  2KFW A;  4R5E A;  3TC5 A;  1EIB A;  2XPB A;  2Q5A A;  1EYM A;  1J4I A;  2XP4 A;  3W4R A;  4DRH A;  4DRM A;  4ODM A;  4L72 B;  4R0X A;  1X6N A;  2VCD A;  4S3K A;  1W9V A;  2A3A A;  1FKL A;  1OGB A;  2M1I A;  3UQI A;  4W5U A;  4IT6 A;  3NTP A;  1FKF A;  2KGJ A;  2KI3 A;  1X6L A;  4ITZ A;  2ITK A;  1FD9 A;  2ZQS A;  4WK9 A;  5GQB A;  1HKI A;  4DRJ A;  3O5K A;  4GIV A;  4LAX A;  4DWS D;  1UR8 A;  1LJY A;  1Q1C A;  1W26 A;  2DSW A;  1LL7 A;  4IQ2 A;  3WH0 A;  2L2S A;  4LAY A;  2A3E A;  3CHE A;  2DG3 A;  4Q7N A;  3ARS A;  2D9F A;  1FKS A;  1J4R A;  4URI A;  1W1Y A;  3KAC A;  2M2A A;  4MTV A;  3KZ7 A;  1HJV A;  1FFQ A;  4J4N A;  3B7X A;  3PRB A;  5DIU A;  3ARV A;  4G50 A;  3WD3 A;  2RUC A;  5GPR A;  2DSZ A;  2LGO A;  2XP6 A;  4TW6 A;  1YAT A;  1NSG A;  4ODN A;  1JNS A;  3ALG A;  2LJ4 A;  1XHG A;  2RUR A;  4IT4 A;  2ZR5 A;  5HWB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...