4DRMA

Evaluation of synthetic fk506 analogs as ligands for fkbp51 and fkbp52: complex of fkbp51 with {3-[(1r)-3-(3,4-dimethoxyphenyl)-1-({[(2s)-1-{[(1s,2r)-2-ethyl-1-hydroxycyclohexyl](oxo)acetyl}piperidin-2-yl]carbonyl}oxy)propyl]phenoxy}acetic acid
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evaluation of Synthetic FK506 Analogues as Ligands for the FK506-Binding Proteins 51 and 52.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 34
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drmA00
2M2AA 4J4OA 2KFWA 1ZK6A 3GPKA 4DROA 4DRMA 1J4HA 2VN1A 2MLXA 1Y0OA 2LPVA 2KE0A 1BL4A 3KCEA 4W9QA 1FJDA 4JFKA 4DIPA 4U86A 2RQSA 3PA7A 1N1AA 2F4EA 1QPFA 1TCOC 3RGCA 2ZQTA 5HW7A 4NNRA 5DIUA 3H9RB 2RUCA 1F40A 4ODPA 2RURA 2KR7A 3FAPA 3KAIA 4W9OA 1NSGA 4C02B 1NMVA 1FKHA 1BKFA 3KACA 2FKEA 2LGOA 2LJ4A 2ZR4A 3O5PA 2RSEA 3CGNA 5HW6A 1P5QA 2OFNA 3B7XA 4ODOA 2ITKA 1KT1A 3ODKA 3IKDA 4IPXA 3PRDA 4R0XA 2PPPA 5DITA 1JVWA 4MSPA 3TCZA 5B8IC 1FKDA 1J4RA 4ITZA 4TYOA 1FKKA 5I98A 4QIBA 5D75A 2KI3A 1YW5A 3I6CA 1R9HA 3JYMA 2PPOA 4LAVA 2RUDA 3TC5A 4GIVA 1FKRA 2PV3A 2M1IA 5HUAA 4LAXA 1C9HA 4JFJA 4JFIA 4MGVA 4ODKA 1FKIA 4JFMA 2MPHA 2FAPA 2PV2A 4TW7A 1PBKA 1Q6HA 3JYJA 3KZ7A 3O5DA 2MNTA 1EQ3A 2XP4A 3O5MA 3O5JA 2XPBA 4DRIA 4LAWA 1FD9A 5GPGA 4J4NA 3IHZA 4DRQA 2ZR5A 3JXVA 2PPNA 1NMWA 4DRNA 2JZVA 3KAHA 3O5OA 3O5QA 4GGQA 4W9PA 3KAGA 4DRKA 5J6EA 5HT1A 3O5RA 1JNSA 1ZCNA 1U79A 4LAYA 2Y78A 3UI6A 1W26A 1Q6UA 3NRKA 3O5GA 3UQAA 3O5LA 2MF9A 3WH0A 1T11A 2DG9A 1FKJA 2XP3A 4ODQA 1FKLA 5HWBA 1D6OA 4JYSA 4FAPA 3MDYB 3NTPA 4G2PA 4TW8A 1JNTA 3TDBA 2N87A 2Q5AA 1YATA 2XP5A 3KABA 1D7JA 1FKBA 4DZ3A 4ODNA 4IQCA 1FKFA 3UQIA 1Q6IA 3UF8A 4DH0A 2D9FA 4QT3A 2XP7A 3O5FA 2LKNA 2MLZA 5DIVA 5BXJA 2F2DA 4IQ2A 2ZR6A 2AWGA 1FAPA 1ROUA 2M08A 3IKGA 2K8IA 2MLYA 2ZQUA 5HW8A 2L2SA 1B6CA 1HXVA 3VAWA 1QPLA 5HKGA 4U84A 4ODRA 2PV1A 1QZ2A 2RUQA 1F8AB 2XP9A 4N19A 2UZ5A 2KGJA 3KADA 1EYMA 4O2TA 4DRHA 1D7HA 3RFWA 3UI4A 3O5EA 4DZ2A 3EY6A 1KT0A 3OOBA 2XP8A 1Q1CA 3O5IA 1J4IA 4ODLA 3UI5A 4FN2A 2XPAA 2DG3A 1FKTA 4TX0A 5HWCA 1PINA 1FKSA 3O5KA 1ROTA 4TW6A 4G50A 3KAFA 2F21A 4DRJA 2DG4A 2ZQVA 4QT2A 4DT4A 2XP6A 2PBCA 3CGMA 3NI6A 3IK8A 1D7IA 3PRBA 2IF4A 4JFLA 1FKGA 4U85A 4BF8A 4DRPA 1J6YA 1L1PA 2VCDA 4ODMA 5HTGA 2KO7A 3UQBA 1A7XA 2ZQSA 4TNSA 3LUOA 1M5YA
chains in the Genus database with same CATH superfamily
2M2AA 4DROA 2MLXA 2LPVA 4HBEA 1BL4A 2DT3A 3ALFA 5DIUA 1OGBA 2RUCA 4AY1A 4ODPA 2RURA 4W9OA 1NSGA 1NMVA 1FKHA 2LGOA 3O5PA 2G41A 1SYTA 1W9VA 4ODOA 4WKHA 3IKDA 4IPXA 5HBFA 5DITA 2PPPA 4MSPA 4Q7NA 4TYOA 4QIBA 4LAVA 2EULA 2PV3A 3BXWA 5HUAA 4JFJA 1H0GA 2DPEA 4ODKA 4JFMA 2FAPA 1FFRA 4TW7A 4HBOA 1Q6HA 4LGXA 3JYJA 2A3BA 2MNTA 2XP4A 2DT2A 4P8VA 4PTMA 5GPGA 1RD6A 3IHZA 3WL0A 4W9PA 3ALGA 5J6EA 1HKMA 3O5RA 2QF8A 2Y78A 3UI6A 2DSUA 3NRKA 1FKJA 3ARTA 4S3KA 1FKLA 4HARA 3NTPA 3TDBA 3RM9A 1YATA 4DZ3A 3O5FA 2LKNA 5BXJA 4IQ2A 3CH9A 1FAPA 2DT1A 3ARQA 5HW8A 2L2SA 2ESCA 1K9TA 4P8XA 4QZVB 4WKFA 1F8AB 2XP9A 1E6RA 1EYMA 1UR9A 1EHNA 3RFWA 3O5EA 2XP8A 1LL6A 4WJXA 3ARPA 1HJXA 4TX0A 1PINA 4KQZA 4TW6A 2A3AA 3PRAA 2F23A 4G50A 4DRJA 2ZQVA 3CGMA 3NI6A 3IK8A 3PRBA 4DRPA 4JFLA 1FKGA 4U85A 4Z2HA 2WLZA 4ODMA 3OOBA 3WQVA 3B9EA 3AROA 1Y0OA 4JFKA 2B5UB 4DIPA 1FFQA 2RQSA 1N1AA 1W9PA 1QPFA 3RM8A 2ZQTA 3FAPA 3KAIA 3ARZA 5HW6A 2OFNA 2WLYA 2ITKA 3TCZA 1H0IA 1FKDA 1J4RA 4ITZA 4NSBA 3WD0A 1HKKA 5D75A 2KI3A 1YW5A 1OWQA 3I6CA 1LG2A 2PPOA 4MNLA 2RUDA 3TC5A 4GIVA 1FKRA 2M1IA 4JFIA 1EIBA 2MPHA 1EQ3A 3WL1A 3WD3A 3W4RA 2ZR5A 3JXVA 2JZVA 4GGQA 1W1TA 4MNKA 1ZCNA 1T11A 2DG9A 5HWBA 1HJWA 1JNTA 3KABA 2XP5A 4XAKA 3WD4A 1D7JA 1FKBA 4ODNA 4IQCA 3UQIA 1Q6IA 4DH0A 5DIVA 2F2DA 4P8UA 3FXYA 2DSVA 3VAWA 3GU0A 4U84A 4WK9A 1QZ2A 1JNDA 4MPKA 3WKZA 1D7HA 1HKJA 4MNMA 4DZ2A 2A3CA 3O5IA 3AS1A 2DG3A 1GOIA 1E44A 2F21A 4QT2A 4Q22A 2DSZA 3UQBA 4WIWA 2ZQSA 4TNSA 1M5YA 2KFWA 1X6NA 2DT0A 3GPKA 4DRMA 4Z2GA 2KE0A 3KCEA 4W9QA 2YBTA 1W1PA 2F4EA 3RGCA 1JNEA 5HW7A 3CHDA 4IT4A 4DWSA 3H9RB 4S3JA 1F40A 3RM4A 1TFVA 3KACA 2FKEA 2LJ4A 2RSEA 3CGNA 1NWUA 4L3NA 3B7XA 1E6NA 3GTYX 1E6PA 1KT1A 3ODKA 5DO2A 1JVWA 5B8IC 1NWSA 1FKKA 4ZPVR 2WM0A 3CHCA 3JYMA 2O92A 4ZPWR 1CTNA 1C9HA 4Z2JA 1JCHB 2PV2A 1PBKA 3O5MA 4MNJA 3RMEA 4DRIA 4LAWA 4L72B 1O6IA 4J4NA 3WQWA 1NMWA 2IUZA 3KAHA 4DRNA 1HKIA 3O5QA 1XRVA 3KAGA 5DF0A 4DRKA 5HT1A 1WB0A 1NWRA 1JNSA 4P8WA 3WD2A 1Q6UA 1W1YA 3O5GA 1NWTA 3WH0A 2MF9A 4DWSD 1GPFA 2XP3A 4ODQA 1D6OA 1ZL1A 4JYSA 1LQ0A 3MDYB 4G2PA 4TW8A 1ZBWA 2Q5AA 4DWSB 2D9FA 2G8ZA 3B9AA 1HJVA 2MLZA 3G6MA 4ZPTR 4Z2LA 1ROUA 2M08A 1VF8A 2ZQUA 1ZU8A 4MAVA 1WNOA 4W5UA 1HXVA 5HKGA 2FDMA 4ODRA 1IX5A 3ARYA 3EIPA 3OA5A 2UZ5A 3KADA 1D2KA 4DRHA 3UI4A 1E15A 1E6ZA 5GPRA 3EY6A 1UR8A 3UI5A 4ODLA 4FN2A 1WAWA 1FKTA 1GRJA 5HWCA 1ZBKA 1SR0A 4MTVA 3KAFA 2DG4A 4DT4A 2PBCA 3ARVA 1NH6A 1D7IA 2IF4A 4BF8A 2VCDA 2KO7A 1A7XA 3LUOA 4J4OA 2DSWA 1ZK6A 1J4HA 2VN1A 3G6LA 5GQBA 1FJDA 4U86A 3PA7A 1TCOC 4NNRA 1LJYA 2KR7A 4C02B 2B31A 1W1VA 4KR0B 1BKFA 2ZR4A 4Z2IA 1OGGA 1P5QA 4Z2KA 3PRDA 4R0XA 1E9LA 1ZB5A 1LG1A 3AS0A 5DEZA 5I98A 3CHFA 1R9HA 4NZCA 4URIA 3CZ8A 4ML4A 4LAXA 4MGVA 1ZBCA 2A3EA 1FKIA 3KZ7A 3ARUA 3O5DA 4UDMA 2O9OA 3O5JA 2XPBA 1KFWA 3ARWA 1FD9A 2WK2A 4DWSC 3QOKA 4DRQA 3ARXA 2PPNA 3O5OA 1ITXA 3B8SA 4LAYA 1U79A 1ZBVA 1W26A 3UQAA 3FY1A 2PI6A 3O5LA 4ZS6A 4FAPA 3AS3A 2N87A 3WIJA 3WD1A 1FKFA 1X6LA 3UF8A 3CHEA 4QT3A 2XP7A 1EDQA 3B9DA 1LL7A 2ZR6A 2AWGA 3IKGA 2K8IA 2MLYA 2OLHA 4WKAA 1B6CA 3PR9A 1QPLA 2PV1A 1W9UA 2RUQA 4N19A 2ETNA 2KGJA 4O2TA 1LL4A 3AQUA 1KT0A 3BMBA 1Q1CA 1J4IA 3ARRA 4IT6A 2XPAA 4R5EA 1FKSA 3O5KA 1ROTA 2AOSA 2PN0A 5JH8A 2XP6A 2P4VA 1XHGA 3AS2A 1J6YA 3ARSA 1L1PA 5HTGA 2YBUA 1GUVA
chains in the Genus database with same CATH topology
2M2AA 4DROA 2MLXA 2LPVA 4HBEA 1BL4A 2DT3A 3ALFA 5DIUA 1OGBA 2RUCA 4AY1A 4ODPA 2RURA 4W9OA 1NSGA 1NMVA 1FKHA 2LGOA 3O5PA 2G41A 1SYTA 1W9VA 4ODOA 4WKHA 3IKDA 4IPXA 5HBFA 5DITA 2PPPA 4MSPA 4Q7NA 4TYOA 4QIBA 4LAVA 2PV3A 3BXWA 5HUAA 4JFJA 1H0GA 2DPEA 4ODKA 4JFMA 2FAPA 1FFRA 4TW7A 4HBOA 1Q6HA 4LGXA 3JYJA 2A3BA 2MNTA 2XP4A 2DT2A 4P8VA 4PTMA 5GPGA 1RD6A 3IHZA 3WL0A 4W9PA 3ALGA 5J6EA 1HKMA 3O5RA 2QF8A 2Y78A 3UI6A 2DSUA 3NRKA 1FKJA 3ARTA 4S3KA 1FKLA 4HARA 3NTPA 3TDBA 3RM9A 1YATA 4DZ3A 3O5FA 2LKNA 5BXJA 4IQ2A 3CH9A 1FAPA 2DT1A 3ARQA 5HW8A 2L2SA 2ESCA 1K9TA 4P8XA 4QZVB 4WKFA 1F8AB 2XP9A 1E6RA 1EYMA 1UR9A 1EHNA 3RFWA 3O5EA 2XP8A 1LL6A 4WJXA 3ARPA 1HJXA 4TX0A 1PINA 4KQZA 4TW6A 2A3AA 3PRAA 4G50A 4DRJA 2ZQVA 3CGMA 3NI6A 3IK8A 3PRBA 4DRPA 4JFLA 1FKGA 4U85A 4Z2HA 2WLZA 4ODMA 3OOBA 3WQVA 3B9EA 3AROA 1Y0OA 4JFKA 4DIPA 1FFQA 2RQSA 1N1AA 1W9PA 1QPFA 3RM8A 2ZQTA 3FAPA 3KAIA 3ARZA 5HW6A 2OFNA 2WLYA 2ITKA 3TCZA 1H0IA 1FKDA 1J4RA 4ITZA 4NSBA 3WD0A 1HKKA 5D75A 2KI3A 1YW5A 1OWQA 3I6CA 1LG2A 2PPOA 4MNLA 2RUDA 3TC5A 4GIVA 1FKRA 2M1IA 4JFIA 1EIBA 2MPHA 1EQ3A 3WL1A 3WD3A 3W4RA 2ZR5A 3JXVA 2JZVA 4GGQA 1W1TA 4MNKA 1ZCNA 1T11A 2DG9A 5HWBA 1HJWA 1JNTA 3KABA 2XP5A 4XAKA 3WD4A 1D7JA 1FKBA 4ODNA 4IQCA 3UQIA 1Q6IA 4DH0A 5DIVA 2F2DA 4P8UA 3FXYA 2DSVA 3VAWA 4U84A 4WK9A 1QZ2A 1JNDA 4MPKA 3WKZA 1D7HA 1HKJA 4MNMA 4DZ2A 2A3CA 3O5IA 3AS1A 2DG3A 1GOIA 2F21A 4QT2A 4Q22A 2DSZA 3UQBA 4WIWA 2ZQSA 4TNSA 1M5YA 2KFWA 1X6NA 2DT0A 3GPKA 4DRMA 4Z2GA 2KE0A 3KCEA 4W9QA 2YBTA 1W1PA 2F4EA 3RGCA 1JNEA 5HW7A 3CHDA 4IT4A 4DWSA 3H9RB 4S3JA 1F40A 3RM4A 1TFVA 3KACA 2FKEA 2LJ4A 2RSEA 3CGNA 1NWUA 4L3NA 3B7XA 1E6NA 1E6PA 1KT1A 3ODKA 5DO2A 1JVWA 5B8IC 1NWSA 1FKKA 4ZPVR 2WM0A 3CHCA 3JYMA 2O92A 4ZPWR 1CTNA 1C9HA 4Z2JA 2PV2A 1PBKA 3O5MA 4MNJA 3RMEA 4DRIA 4LAWA 4L72B 1O6IA 4J4NA 3WQWA 1NMWA 2IUZA 3KAHA 4DRNA 1HKIA 3O5QA 1XRVA 3KAGA 5DF0A 4DRKA 5HT1A 1WB0A 1NWRA 1JNSA 4P8WA 3WD2A 1Q6UA 1W1YA 3O5GA 1NWTA 3WH0A 2MF9A 4DWSD 1GPFA 2XP3A 4ODQA 1D6OA 1ZL1A 4JYSA 1LQ0A 3MDYB 4G2PA 4TW8A 1ZBWA 2Q5AA 4DWSB 2D9FA 2G8ZA 3B9AA 1HJVA 2MLZA 3G6MA 4ZPTR 4Z2LA 1ROUA 2M08A 1VF8A 2ZQUA 1ZU8A 4MAVA 1WNOA 4W5UA 1HXVA 5HKGA 2FDMA 4ODRA 1IX5A 3ARYA 3OA5A 2UZ5A 3KADA 1D2KA 4DRHA 3UI4A 1E15A 1E6ZA 5GPRA 3EY6A 1UR8A 3UI5A 4ODLA 4FN2A 1WAWA 1FKTA 5HWCA 1ZBKA 1SR0A 4MTVA 3KAFA 2DG4A 4DT4A 2PBCA 3ARVA 1NH6A 1D7IA 2IF4A 4BF8A 2VCDA 2KO7A 1A7XA 3LUOA 4J4OA 2DSWA 1ZK6A 1J4HA 2VN1A 3G6LA 5GQBA 1FJDA 4U86A 3PA7A 1TCOC 4NNRA 1LJYA 2KR7A 4C02B 2B31A 1W1VA 4KR0B 1BKFA 2ZR4A 4Z2IA 1OGGA 1P5QA 4Z2KA 3PRDA 4R0XA 1E9LA 1ZB5A 1LG1A 3AS0A 5DEZA 5I98A 3CHFA 1R9HA 4NZCA 4URIA 3CZ8A 4ML4A 4LAXA 4MGVA 1ZBCA 2A3EA 1FKIA 3KZ7A 3ARUA 3O5DA 2O9OA 3O5JA 2XPBA 1KFWA 3ARWA 1FD9A 2WK2A 4DWSC 3QOKA 4DRQA 3ARXA 2PPNA 3O5OA 1ITXA 3B8SA 4LAYA 1U79A 1ZBVA 1W26A 3UQAA 3FY1A 2PI6A 3O5LA 4ZS6A 4FAPA 3AS3A 2N87A 3WIJA 3WD1A 1FKFA 1X6LA 3UF8A 3CHEA 4QT3A 2XP7A 1EDQA 3B9DA 1LL7A 2ZR6A 2AWGA 3IKGA 2K8IA 2MLYA 2OLHA 4WKAA 1B6CA 3PR9A 1QPLA 2PV1A 1W9UA 2RUQA 4N19A 2KGJA 4O2TA 1LL4A 3AQUA 1KT0A 1Q1CA 1J4IA 3ARRA 4IT6A 2XPAA 4R5EA 1FKSA 3O5KA 1ROTA 2AOSA 5JH8A 2XP6A 1XHGA 3AS2A 1J6YA 3ARSA 1L1PA 5HTGA 2YBUA 1GUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M2A A;  4J4O A;  2KFW A;  1ZK6 A;  3GPK A;  4DRO A;  4DRM A;  1J4H A;  2VN1 A;  2MLX A;  1Y0O A;  2LPV A;  2KE0 A;  1BL4 A;  3KCE A;  4W9Q A;  1FJD A;  4JFK A;  4DIP A;  4U86 A;  2RQS A;  3PA7 A;  1N1A A;  2F4E A;  1QPF A;  1TCO C;  3RGC A;  2ZQT A;  5HW7 A;  4NNR A;  5DIU A;  3H9R B;  2RUC A;  1F40 A;  4ODP A;  2RUR A;  2KR7 A;  3FAP A;  3KAI A;  4W9O A;  1NSG A;  4C02 B;  1NMV A;  1FKH A;  1BKF A;  3KAC A;  2FKE A;  2LGO A;  2LJ4 A;  2ZR4 A;  3O5P A;  2RSE A;  3CGN A;  5HW6 A;  1P5Q A;  2OFN A;  3B7X A;  4ODO A;  2ITK A;  1KT1 A;  3ODK A;  3IKD A;  4IPX A;  3PRD A;  4R0X A;  2PPP A;  5DIT A;  1JVW A;  4MSP A;  3TCZ A;  5B8I C;  1FKD A;  1J4R A;  4ITZ A;  4TYO A;  1FKK A;  5I98 A;  4QIB A;  5D75 A;  2KI3 A;  1YW5 A;  3I6C A;  1R9H A;  3JYM A;  2PPO A;  4LAV A;  2RUD A;  3TC5 A;  4GIV A;  1FKR A;  2PV3 A;  2M1I A;  5HUA A;  4LAX A;  1C9H A;  4JFJ A;  4JFI A;  4MGV A;  4ODK A;  1FKI A;  4JFM A;  2MPH A;  2FAP A;  2PV2 A;  4TW7 A;  1PBK A;  1Q6H A;  3JYJ A;  3KZ7 A;  3O5D A;  2MNT A;  1EQ3 A;  2XP4 A;  3O5M A;  3O5J A;  2XPB A;  4DRI A;  4LAW A;  1FD9 A;  5GPG A;  4J4N A;  3IHZ A;  4DRQ A;  2ZR5 A;  3JXV A;  2PPN A;  1NMW A;  4DRN A;  2JZV A;  3KAH A;  3O5O A;  3O5Q A;  4GGQ A;  4W9P A;  3KAG A;  4DRK A;  5J6E A;  5HT1 A;  3O5R A;  1JNS A;  1ZCN A;  1U79 A;  4LAY A;  2Y78 A;  3UI6 A;  1W26 A;  1Q6U A;  3NRK A;  3O5G A;  3UQA A;  3O5L A;  2MF9 A;  3WH0 A;  1T11 A;  2DG9 A;  1FKJ A;  2XP3 A;  4ODQ A;  1FKL A;  5HWB A;  1D6O A;  4JYS A;  4FAP A;  3MDY B;  3NTP A;  4G2P A;  4TW8 A;  1JNT A;  3TDB A;  2N87 A;  2Q5A A;  1YAT A;  2XP5 A;  3KAB A;  1D7J A;  1FKB A;  4DZ3 A;  4ODN A;  4IQC A;  1FKF A;  3UQI A;  1Q6I A;  3UF8 A;  4DH0 A;  2D9F A;  4QT3 A;  2XP7 A;  3O5F A;  2LKN A;  2MLZ A;  5DIV A;  5BXJ A;  2F2D A;  4IQ2 A;  2ZR6 A;  2AWG A;  1FAP A;  1ROU A;  2M08 A;  3IKG A;  2K8I A;  2MLY A;  2ZQU A;  5HW8 A;  2L2S A;  1B6C A;  1HXV A;  3VAW A;  1QPL A;  5HKG A;  4U84 A;  4ODR A;  2PV1 A;  1QZ2 A;  2RUQ A;  1F8A B;  2XP9 A;  4N19 A;  2UZ5 A;  2KGJ A;  3KAD A;  1EYM A;  4O2T A;  4DRH A;  1D7H A;  3RFW A;  3UI4 A;  3O5E A;  4DZ2 A;  3EY6 A;  1KT0 A;  3OOB A;  2XP8 A;  1Q1C A;  3O5I A;  1J4I A;  4ODL A;  3UI5 A;  4FN2 A;  2XPA A;  2DG3 A;  1FKT A;  4TX0 A;  5HWC A;  1PIN A;  1FKS A;  3O5K A;  1ROT A;  4TW6 A;  4G50 A;  3KAF A;  2F21 A;  4DRJ A;  2DG4 A;  2ZQV A;  4QT2 A;  4DT4 A;  2XP6 A;  2PBC A;  3CGM A;  3NI6 A;  3IK8 A;  1D7I A;  3PRB A;  2IF4 A;  4JFL A;  1FKG A;  4U85 A;  4BF8 A;  4DRP A;  1J6Y A;  1L1P A;  2VCD A;  4ODM A;  5HTG A;  2KO7 A;  3UQB A;  1A7X A;  2ZQS A;  4TNS A;  3LUO A;  1M5Y A; 
#chains in the Genus database with same CATH topology
 2M2A A;  4DRO A;  2MLX A;  2LPV A;  4HBE A;  1BL4 A;  2DT3 A;  3ALF A;  5DIU A;  1OGB A;  2RUC A;  4AY1 A;  4ODP A;  2RUR A;  4W9O A;  1NSG A;  1NMV A;  1FKH A;  2LGO A;  3O5P A;  2G41 A;  1SYT A;  1W9V A;  4ODO A;  4WKH A;  3IKD A;  4IPX A;  5HBF A;  5DIT A;  2PPP A;  4MSP A;  4Q7N A;  4TYO A;  4QIB A;  4LAV A;  2EUL A;  2PV3 A;  3BXW A;  5HUA A;  4JFJ A;  1H0G A;  2DPE A;  4ODK A;  4JFM A;  2FAP A;  1FFR A;  4TW7 A;  4HBO A;  1Q6H A;  4LGX A;  3JYJ A;  2A3B A;  2MNT A;  2XP4 A;  2DT2 A;  4P8V A;  4PTM A;  5GPG A;  1RD6 A;  3IHZ A;  3WL0 A;  4W9P A;  3ALG A;  5J6E A;  1HKM A;  3O5R A;  2QF8 A;  2Y78 A;  3UI6 A;  2DSU A;  3NRK A;  1FKJ A;  3ART A;  4S3K A;  1FKL A;  4HAR A;  3NTP A;  3TDB A;  3RM9 A;  1YAT A;  4DZ3 A;  3O5F A;  2LKN A;  5BXJ A;  4IQ2 A;  3CH9 A;  1FAP A;  2DT1 A;  3ARQ A;  5HW8 A;  2L2S A;  2ESC A;  1K9T A;  4P8X A;  4QZV B;  4WKF A;  1F8A B;  2XP9 A;  1E6R A;  1EYM A;  1UR9 A;  1EHN A;  3RFW A;  3O5E A;  2XP8 A;  1LL6 A;  4WJX A;  3ARP A;  1HJX A;  4TX0 A;  1PIN A;  4KQZ A;  4TW6 A;  2A3A A;  3PRA A;  2F23 A;  4G50 A;  4DRJ A;  2ZQV A;  3CGM A;  3NI6 A;  3IK8 A;  3PRB A;  4DRP A;  4JFL A;  1FKG A;  4U85 A;  4Z2H A;  2WLZ A;  4ODM A;  3OOB A;  3WQV A;  3B9E A;  3ARO A;  1Y0O A;  4JFK A;  2B5U B;  4DIP A;  1FFQ A;  2RQS A;  1N1A A;  1W9P A;  1QPF A;  3RM8 A;  2ZQT A;  3FAP A;  3KAI A;  3ARZ A;  5HW6 A;  2OFN A;  2WLY A;  2ITK A;  3TCZ A;  1H0I A;  1FKD A;  1J4R A;  4ITZ A;  4NSB A;  3WD0 A;  1HKK A;  5D75 A;  2KI3 A;  1YW5 A;  1OWQ A;  3I6C A;  1LG2 A;  2PPO A;  4MNL A;  2RUD A;  3TC5 A;  4GIV A;  1FKR A;  2M1I A;  4JFI A;  1EIB A;  2MPH A;  1EQ3 A;  3WL1 A;  3WD3 A;  3W4R A;  2ZR5 A;  3JXV A;  2JZV A;  4GGQ A;  1W1T A;  4MNK A;  1ZCN A;  1T11 A;  2DG9 A;  5HWB A;  1HJW A;  1JNT A;  3KAB A;  2XP5 A;  4XAK A;  3WD4 A;  1D7J A;  1FKB A;  4ODN A;  4IQC A;  3UQI A;  1Q6I A;  4DH0 A;  5DIV A;  2F2D A;  4P8U A;  3FXY A;  2DSV A;  3VAW A;  3GU0 A;  4U84 A;  4WK9 A;  1QZ2 A;  1JND A;  4MPK A;  3WKZ A;  1D7H A;  1HKJ A;  4MNM A;  4DZ2 A;  2A3C A;  3O5I A;  3AS1 A;  2DG3 A;  1GOI A;  1E44 A;  2F21 A;  4QT2 A;  4Q22 A;  2DSZ A;  3UQB A;  4WIW A;  2ZQS A;  4TNS A;  1M5Y A;  2KFW A;  1X6N A;  2DT0 A;  3GPK A;  4DRM A;  4Z2G A;  2KE0 A;  3KCE A;  4W9Q A;  2YBT A;  1W1P A;  2F4E A;  3RGC A;  1JNE A;  5HW7 A;  3CHD A;  4IT4 A;  4DWS A;  3H9R B;  4S3J A;  1F40 A;  3RM4 A;  1TFV A;  3KAC A;  2FKE A;  2LJ4 A;  2RSE A;  3CGN A;  1NWU A;  4L3N A;  3B7X A;  1E6N A;  3GTY X;  1E6P A;  1KT1 A;  3ODK A;  5DO2 A;  1JVW A;  5B8I C;  1NWS A;  1FKK A;  4ZPV R;  2WM0 A;  3CHC A;  3JYM A;  2O92 A;  4ZPW R;  1CTN A;  1C9H A;  4Z2J A;  1JCH B;  2PV2 A;  1PBK A;  3O5M A;  4MNJ A;  3RME A;  4DRI A;  4LAW A;  4L72 B;  1O6I A;  4J4N A;  3WQW A;  1NMW A;  2IUZ A;  3KAH A;  4DRN A;  1HKI A;  3O5Q A;  1XRV A;  3KAG A;  5DF0 A;  4DRK A;  5HT1 A;  1WB0 A;  1NWR A;  1JNS A;  4P8W A;  3WD2 A;  1Q6U A;  1W1Y A;  3O5G A;  1NWT A;  3WH0 A;  2MF9 A;  4DWS D;  1GPF A;  2XP3 A;  4ODQ A;  1D6O A;  1ZL1 A;  4JYS A;  1LQ0 A;  3MDY B;  4G2P A;  4TW8 A;  1ZBW A;  2Q5A A;  4DWS B;  2D9F A;  2G8Z A;  3B9A A;  1HJV A;  2MLZ A;  3G6M A;  4ZPT R;  4Z2L A;  1ROU A;  2M08 A;  1VF8 A;  2ZQU A;  1ZU8 A;  4MAV A;  1WNO A;  4W5U A;  1HXV A;  5HKG A;  2FDM A;  4ODR A;  1IX5 A;  3ARY A;  3EIP A;  3OA5 A;  2UZ5 A;  3KAD A;  1D2K A;  4DRH A;  3UI4 A;  1E15 A;  1E6Z A;  5GPR A;  3EY6 A;  1UR8 A;  3UI5 A;  4ODL A;  4FN2 A;  1WAW A;  1FKT A;  1GRJ A;  5HWC A;  1ZBK A;  1SR0 A;  4MTV A;  3KAF A;  2DG4 A;  4DT4 A;  2PBC A;  3ARV A;  1NH6 A;  1D7I A;  2IF4 A;  4BF8 A;  2VCD A;  2KO7 A;  1A7X A;  3LUO A;  4J4O A;  2DSW A;  1ZK6 A;  1J4H A;  2VN1 A;  3G6L A;  5GQB A;  1FJD A;  4U86 A;  3PA7 A;  1TCO C;  4NNR A;  1LJY A;  2KR7 A;  4C02 B;  2B31 A;  1W1V A;  4KR0 B;  1BKF A;  2ZR4 A;  4Z2I A;  1OGG A;  1P5Q A;  4Z2K A;  3PRD A;  4R0X A;  1E9L A;  1ZB5 A;  1LG1 A;  3AS0 A;  5DEZ A;  5I98 A;  3CHF A;  1R9H A;  4NZC A;  4URI A;  3CZ8 A;  4ML4 A;  4LAX A;  4MGV A;  1ZBC A;  2A3E A;  1FKI A;  3KZ7 A;  3ARU A;  3O5D A;  4UDM A;  2O9O A;  3O5J A;  2XPB A;  1KFW A;  3ARW A;  1FD9 A;  2WK2 A;  4DWS C;  3QOK A;  4DRQ A;  3ARX A;  2PPN A;  3O5O A;  1ITX A;  3B8S A;  4LAY A;  1U79 A;  1ZBV A;  1W26 A;  3UQA A;  3FY1 A;  2PI6 A;  3O5L A;  4ZS6 A;  4FAP A;  3AS3 A;  2N87 A;  3WIJ A;  3WD1 A;  1FKF A;  1X6L A;  3UF8 A;  3CHE A;  4QT3 A;  2XP7 A;  1EDQ A;  3B9D A;  1LL7 A;  2ZR6 A;  2AWG A;  3IKG A;  2K8I A;  2MLY A;  2OLH A;  4WKA A;  1B6C A;  3PR9 A;  1QPL A;  2PV1 A;  1W9U A;  2RUQ A;  4N19 A;  2ETN A;  2KGJ A;  4O2T A;  1LL4 A;  3AQU A;  1KT0 A;  3BMB A;  1Q1C A;  1J4I A;  3ARR A;  4IT6 A;  2XPA A;  4R5E A;  1FKS A;  3O5K A;  1ROT A;  2AOS A;  2PN0 A;  5JH8 A;  2XP6 A;  2P4V A;  1XHG A;  3AS2 A;  1J6Y A;  3ARS A;  1L1P A;  5HTG A;  2YBU A;  1GUV A; 
#chains in the Genus database with same CATH homology
 2M2A A;  4DRO A;  2MLX A;  2LPV A;  4HBE A;  1BL4 A;  2DT3 A;  3ALF A;  5DIU A;  1OGB A;  2RUC A;  4AY1 A;  4ODP A;  2RUR A;  4W9O A;  1NSG A;  1NMV A;  1FKH A;  2LGO A;  3O5P A;  2G41 A;  1SYT A;  1W9V A;  4ODO A;  4WKH A;  3IKD A;  4IPX A;  5HBF A;  5DIT A;  2PPP A;  4MSP A;  4Q7N A;  4TYO A;  4QIB A;  4LAV A;  2PV3 A;  3BXW A;  5HUA A;  4JFJ A;  1H0G A;  2DPE A;  4ODK A;  4JFM A;  2FAP A;  1FFR A;  4TW7 A;  4HBO A;  1Q6H A;  4LGX A;  3JYJ A;  2A3B A;  2MNT A;  2XP4 A;  2DT2 A;  4P8V A;  4PTM A;  5GPG A;  1RD6 A;  3IHZ A;  3WL0 A;  4W9P A;  3ALG A;  5J6E A;  1HKM A;  3O5R A;  2QF8 A;  2Y78 A;  3UI6 A;  2DSU A;  3NRK A;  1FKJ A;  3ART A;  4S3K A;  1FKL A;  4HAR A;  3NTP A;  3TDB A;  3RM9 A;  1YAT A;  4DZ3 A;  3O5F A;  2LKN A;  5BXJ A;  4IQ2 A;  3CH9 A;  1FAP A;  2DT1 A;  3ARQ A;  5HW8 A;  2L2S A;  2ESC A;  1K9T A;  4P8X A;  4QZV B;  4WKF A;  1F8A B;  2XP9 A;  1E6R A;  1EYM A;  1UR9 A;  1EHN A;  3RFW A;  3O5E A;  2XP8 A;  1LL6 A;  4WJX A;  3ARP A;  1HJX A;  4TX0 A;  1PIN A;  4KQZ A;  4TW6 A;  2A3A A;  3PRA A;  4G50 A;  4DRJ A;  2ZQV A;  3CGM A;  3NI6 A;  3IK8 A;  3PRB A;  4DRP A;  4JFL A;  1FKG A;  4U85 A;  4Z2H A;  2WLZ A;  4ODM A;  3OOB A;  3WQV A;  3B9E A;  3ARO A;  1Y0O A;  4JFK A;  4DIP A;  1FFQ A;  2RQS A;  1N1A A;  1W9P A;  1QPF A;  3RM8 A;  2ZQT A;  3FAP A;  3KAI A;  3ARZ A;  5HW6 A;  2OFN A;  2WLY A;  2ITK A;  3TCZ A;  1H0I A;  1FKD A;  1J4R A;  4ITZ A;  4NSB A;  3WD0 A;  1HKK A;  5D75 A;  2KI3 A;  1YW5 A;  1OWQ A;  3I6C A;  1LG2 A;  2PPO A;  4MNL A;  2RUD A;  3TC5 A;  4GIV A;  1FKR A;  2M1I A;  4JFI A;  1EIB A;  2MPH A;  1EQ3 A;  3WL1 A;  3WD3 A;  3W4R A;  2ZR5 A;  3JXV A;  2JZV A;  4GGQ A;  1W1T A;  4MNK A;  1ZCN A;  1T11 A;  2DG9 A;  5HWB A;  1HJW A;  1JNT A;  3KAB A;  2XP5 A;  4XAK A;  3WD4 A;  1D7J A;  1FKB A;  4ODN A;  4IQC A;  3UQI A;  1Q6I A;  4DH0 A;  5DIV A;  2F2D A;  4P8U A;  3FXY A;  2DSV A;  3VAW A;  4U84 A;  4WK9 A;  1QZ2 A;  1JND A;  4MPK A;  3WKZ A;  1D7H A;  1HKJ A;  4MNM A;  4DZ2 A;  2A3C A;  3O5I A;  3AS1 A;  2DG3 A;  1GOI A;  2F21 A;  4QT2 A;  4Q22 A;  2DSZ A;  3UQB A;  4WIW A;  2ZQS A;  4TNS A;  1M5Y A;  2KFW A;  1X6N A;  2DT0 A;  3GPK A;  4DRM A;  4Z2G A;  2KE0 A;  3KCE A;  4W9Q A;  2YBT A;  1W1P A;  2F4E A;  3RGC A;  1JNE A;  5HW7 A;  3CHD A;  4IT4 A;  4DWS A;  3H9R B;  4S3J A;  1F40 A;  3RM4 A;  1TFV A;  3KAC A;  2FKE A;  2LJ4 A;  2RSE A;  3CGN A;  1NWU A;  4L3N A;  3B7X A;  1E6N A;  1E6P A;  1KT1 A;  3ODK A;  5DO2 A;  1JVW A;  5B8I C;  1NWS A;  1FKK A;  4ZPV R;  2WM0 A;  3CHC A;  3JYM A;  2O92 A;  4ZPW R;  1CTN A;  1C9H A;  4Z2J A;  2PV2 A;  1PBK A;  3O5M A;  4MNJ A;  3RME A;  4DRI A;  4LAW A;  4L72 B;  1O6I A;  4J4N A;  3WQW A;  1NMW A;  2IUZ A;  3KAH A;  4DRN A;  1HKI A;  3O5Q A;  1XRV A;  3KAG A;  5DF0 A;  4DRK A;  5HT1 A;  1WB0 A;  1NWR A;  1JNS A;  4P8W A;  3WD2 A;  1Q6U A;  1W1Y A;  3O5G A;  1NWT A;  3WH0 A;  2MF9 A;  4DWS D;  1GPF A;  2XP3 A;  4ODQ A;  1D6O A;  1ZL1 A;  4JYS A;  1LQ0 A;  3MDY B;  4G2P A;  4TW8 A;  1ZBW A;  2Q5A A;  4DWS B;  2D9F A;  2G8Z A;  3B9A A;  1HJV A;  2MLZ A;  3G6M A;  4ZPT R;  4Z2L A;  1ROU A;  2M08 A;  1VF8 A;  2ZQU A;  1ZU8 A;  4MAV A;  1WNO A;  4W5U A;  1HXV A;  5HKG A;  2FDM A;  4ODR A;  1IX5 A;  3ARY A;  3OA5 A;  2UZ5 A;  3KAD A;  1D2K A;  4DRH A;  3UI4 A;  1E15 A;  1E6Z A;  5GPR A;  3EY6 A;  1UR8 A;  3UI5 A;  4ODL A;  4FN2 A;  1WAW A;  1FKT A;  5HWC A;  1ZBK A;  1SR0 A;  4MTV A;  3KAF A;  2DG4 A;  4DT4 A;  2PBC A;  3ARV A;  1NH6 A;  1D7I A;  2IF4 A;  4BF8 A;  2VCD A;  2KO7 A;  1A7X A;  3LUO A;  4J4O A;  2DSW A;  1ZK6 A;  1J4H A;  2VN1 A;  3G6L A;  5GQB A;  1FJD A;  4U86 A;  3PA7 A;  1TCO C;  4NNR A;  1LJY A;  2KR7 A;  4C02 B;  2B31 A;  1W1V A;  4KR0 B;  1BKF A;  2ZR4 A;  4Z2I A;  1OGG A;  1P5Q A;  4Z2K A;  3PRD A;  4R0X A;  1E9L A;  1ZB5 A;  1LG1 A;  3AS0 A;  5DEZ A;  5I98 A;  3CHF A;  1R9H A;  4NZC A;  4URI A;  3CZ8 A;  4ML4 A;  4LAX A;  4MGV A;  1ZBC A;  2A3E A;  1FKI A;  3KZ7 A;  3ARU A;  3O5D A;  2O9O A;  3O5J A;  2XPB A;  1KFW A;  3ARW A;  1FD9 A;  2WK2 A;  4DWS C;  3QOK A;  4DRQ A;  3ARX A;  2PPN A;  3O5O A;  1ITX A;  3B8S A;  4LAY A;  1U79 A;  1ZBV A;  1W26 A;  3UQA A;  3FY1 A;  2PI6 A;  3O5L A;  4ZS6 A;  4FAP A;  3AS3 A;  2N87 A;  3WIJ A;  3WD1 A;  1FKF A;  1X6L A;  3UF8 A;  3CHE A;  4QT3 A;  2XP7 A;  1EDQ A;  3B9D A;  1LL7 A;  2ZR6 A;  2AWG A;  3IKG A;  2K8I A;  2MLY A;  2OLH A;  4WKA A;  1B6C A;  3PR9 A;  1QPL A;  2PV1 A;  1W9U A;  2RUQ A;  4N19 A;  2KGJ A;  4O2T A;  1LL4 A;  3AQU A;  1KT0 A;  1Q1C A;  1J4I A;  3ARR A;  4IT6 A;  2XPA A;  4R5E A;  1FKS A;  3O5K A;  1ROT A;  2AOS A;  5JH8 A;  2XP6 A;  1XHG A;  3AS2 A;  1J6Y A;  3ARS A;  1L1P A;  5HTG A;  2YBU A;  1GUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...