4DRMA

Evaluation of synthetic fk506 analogs as ligands for fkbp51 and fkbp52: complex of fkbp51 with {3-[(1r)-3-(3,4-dimethoxyphenyl)-1-({[(2s)-1-{[(1s,2r)-2-ethyl-1-hydroxycyclohexyl](oxo)acetyl}piperidin-2-yl]carbonyl}oxy)propyl]phenoxy}acetic acid
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Evaluation of Synthetic FK506 Analogues as Ligands for the FK506-Binding Proteins 51 and 52.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 34
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drmA00
2L2SA 3O5MA 1F8AB 4TW8A 3VAWA 3UQBA 1B6CA 2MPHA 5D75A 3NTPA 1D7JA 3GPKA 2MLXA 4DRPA 1JVWA 2D9FA 1ZK6A 2XP6A 1FD9A 1KT1A 2PPPA 5HWCA 2RUCA 1FKDA 1ROUA 1J6YA 1F40A 1J4IA 4DRKA 1EYMA 3JYJA 2JZVA 1P5QA 3O5EA 2KE0A 2VN1A 4U85A 1NMWA 1JNSA 2XPBA 3JYMA 4IQCA 1T11A 3H9RB 4JFJA 1PINA 2MLZA 2Y78A 4FN2A 4R0XA 4U86A 5DITA 3CGNA 3UI6A 1HXVA 3OOBA 4ODNA 4DROA 3KADA 1FKTA 2Q5AA 1FKIA 1YW5A 2ITKA 4FAPA 2F21A 3O5JA 2FKEA 3I6CA 3IKDA 5HW7A 1ZCNA 3UQIA 3JXVA 3O5PA 2PV1A 3O5QA 4TW6A 1D6OA 2PV3A 2KGJA 1R9HA 2ZQSA 2ZQUA 4DRMA 3UI5A 3KABA 1FKFA 3KAFA 2N87A 4TNSA 1Q6IA 2KI3A 3NRKA 2F4EA 4IPXA 4ODPA 4ODMA 2VCDA 4ODQA 5GPGA 4LAYA 5HUAA 2LJ4A 2MLYA 4W9PA 4GGQA 2DG3A 3IHZA 4J4NA 5B8IC 2RUDA 3PA7A 4DRQA 5DIUA 1D7IA 2XP3A 1Q1CA 3NI6A 3O5GA 2ZQVA 2XP9A 1FKHA 1BL4A 1FKKA 2RQSA 3O5DA 5BXJA 4W9QA 3EY6A 3KACA 4DRNA 4ODRA 4U84A 2MNTA 1FKJA 1L1PA 4J4OA 2AWGA 4NNRA 4TX0A 4DRIA 1FJDA 4QT2A 1FKGA 3RGCA 5HWBA 1C9HA 3O5IA 3ODKA 1Y0OA 3TCZA 1NMVA 4BF8A 4G2PA 4G50A 2ZR5A 2LGOA 2PV2A 3RFWA 2M1IA 1J4HA 5DIVA 4JFKA 4DZ3A 2KFWA 1NSGA 1M5YA 3O5OA 1EQ3A 4DIPA 4JFLA 3TDBA 3B7XA 4ITZA 2M2AA 2RURA 2ZR4A 2XP5A 4MSPA 5HKGA 1PBKA 3TC5A 3KAGA 1TCOC 4LAVA 3IKGA 2MF9A 4IQ2A 4QT3A 2XP8A 3O5FA 1FAPA 3KCEA 4ODLA 2ZR6A 2RSEA 1D7HA 1Q6HA 1ROTA 4QIBA 2DG4A 2KR7A 1JNTA 1Q6UA 1QZ2A 1QPLA 2DG9A 2LPVA 2XPAA 4ODOA 4JYSA 5HT1A 1FKBA 2PPNA 1FKSA 2IF4A 1W26A 5HTGA 3MDYB 4TW7A 1N1AA 4JFMA 4C02B 3UQAA 2KO7A 3PRBA 4W9OA 1FKLA 2K8IA 3UF8A 4DZ2A 2F2DA 2OFNA 3KZ7A 3O5RA 5I98A 3CGMA 3LUOA 4GIVA 5HW8A 3UI4A 5HW6A 1BKFA 1A7XA 2FAPA 2M08A 4N19A 4O2TA 1YATA 1J4RA 3KAIA 4DRHA 4DT4A 2UZ5A 4TYOA 3KAHA 4JFIA 4LAXA 1QPFA 1KT0A 3FAPA 3IK8A 3O5LA 2RUQA 5J6EA 4MGVA 2XP4A 4DRJA 4ODKA 2PBCA 1U79A 2LKNA 2PPOA 2XP7A 3O5KA 4DH0A 3WH0A 3PRDA 4LAWA 1FKRA 2ZQTA
chains in the Genus database with same CATH superfamily
3O5MA 1F8AB 4TW8A 3UQBA 4URIA 4DRPA 1X6LA 2A3EA 3PR9A 4HBOA 5HWCA 1FKDA 1LL6A 4DRKA 1EYMA 4P8XA 2JZVA 1P5QA 1JNSA 4IQCA 3CGNA 1HXVA 3ARRA 2IUZA 1EHNA 1FKIA 1NH6A 1YW5A 2FKEA 1OGBA 2ESCA 3I6CA 2DT0A 3JXVA 2YBTA 4Z2GA 2PV1A 1JNEA 4AY1A 1D6OA 4DRMA 4Z2JA 1FKFA 4TNSA 2N87A 2KI3A 4IPXA 1E15A 5HUAA 2MLYA 3PRAA 4GGQA 4J4NA 4QZVB 3PA7A 2DT3A 1Q1CA 2ZQVA 2XP9A 1FKHA 1FKKA 2RQSA 4DRNA 4Q22A 2OLHA 4U84A 1WNOA 4J4OA 4TX0A 4MAVA 1ZBVA 1FKGA 5HWBA 3GU0A 3O5IA 4Z2KA 1Y0OA 2DT2A 3WQVA 4BF8A 2PV2A 5GQBA 3RFWA 5DIVA 1LL7A 3O5OA 1M5YA 1EQ3A 2DSVA 4ITZA 2RURA 1NWTA 1PBKA 3TC5A 5DO2A 3KAGA 4LAVA 3IKGA 4IQ2A 2F23A 4MNMA 1Q6HA 1ROTA 2KR7A 1QZ2A 5HT1A 4JYSA 1ZU8A 1ZBCA 2PPNA 1W26A 1N1AA 2A3CA 3ARQA 1E6NA 3AS0A 1FKLA 2EULA 5I98A 3LUOA 4GIVA 2QF8A 5JH8A 4DRHA 4O2TA 4JFIA 4ODKA 2PBCA 1U79A 2LKNA 4P8VA 2L2SA 3FY1A 4KQZA 2MPHA 3ARYA 1D7JA 1JVWA 1X6NA 1ZK6A 2RUCA 1JCHB 3BMBA 3O5EA 2KE0A 2PN0A 4U85A 1OGGA 2XPBA 1PINA 5DITA 2WLYA 3OOBA 4ODNA 5HBFA 1OWQA 3IKDA 1ZCNA 4TW6A 2YBUA 3ARXA 1LG2A 2PV3A 4ZS6A 2WLZA 3KABA 4DWSA 1Q6IA 4ODMA 4ODQA 4DWSD 1HKKA 5DIUA 3NI6A 3CHEA 4NZCA 4S3KA 3O5DA 1WAWA 4W9QA 3KACA 2FDMA 2MNTA 2AWGA 1FFQA 2DSUA 3FXYA 4DRIA 3B8SA 1C9HA 3ODKA 1K9TA 1NMVA 1GUVA 2ZR5A 1E6ZA 4Z2HA 1NSGA 4DIPA 4JFLA 2ETNA 3B7XA 1LJYA 4R5EA 1ZL1A 3AS2A 4MSPA 5GPRA 1RD6A 2MF9A 2XP8A 3ARTA 3O5FA 4WJXA 1FAPA 3KCEA 2ZR6A 5DF0A 4QIBA 3RM8A 1QPLA 1FKBA 1W1YA 3MDYB 4C02B 2KO7A 4W9OA 3AQUA 4IT6A 4LGXA 4Z2LA 4DZ2A 2P4VA 5HW8A 5HW6A 3CHCA 2M08A 1J4RA 3G6LA 1KT0A 3O5LA 2RUQA 2PPOA 2XP7A 1FKRA 2ZQTA 3VAWA 5D75A 4MPKA 3NTPA 2MLXA 1JNDA 4Q7NA 2PPPA 2WK2A 1F40A 3WL1A 2PI6A 3JYJA 4HBEA 1HKJA 4L72B 1NMWA 3WD1A 3JYMA 3H9RB 4JFJA 4FN2A 4DWSB 2Y78A 3UI6A 4DROA 3KADA 2B5UB 2Q5AA 2ITKA 4ZPVR 2DPEA 4FAPA 2B31A 5HW7A 2G8ZA 3O5PA 3WD4A 3WD0A 1E9LA 4ML4A 1GRJA 1NWRA 2ZQSA 2ZQUA 1HKMA 3UI5A 1NWSA 5DEZA 3KAFA 3NRKA 1ITXA 4WKAA 2VCDA 5GPGA 4HARA 4W9PA 1LL4A 2DG3A 2RUDA 1LG1A 3O5GA 2XP3A 1BL4A 4Z2IA 5BXJA 1EDQA 3CZ8A 3EIPA 1UR8A 4NNRA 4PTMA 1FJDA 3CH9A 4NSBA 3RGCA 3ARPA 3TCZA 4MNLA 1W9PA 3ARZA 2M1IA 4DZ3A 2KFWA 3ARSA 3RMEA 1GPFA 2M2AA 2ZR4A 4IT4A 2XP5A 2DSWA 1E44A 1W1VA 1TCOC 4QT3A 4P8UA 1KFWA 3OA5A 1JNTA 1Q6UA 2DG9A 2XPAA 3WIJA 1H0GA 2IF4A 4UDMA 3WQWA 3UQAA 4XAKA 3PRBA 2O92A 1ZBWA 2A3BA 3CHFA 1SYTA 3UF8A 1CTNA 4L3NA 3O5RA 3WKZA 3UI4A 3KAIA 4DT4A 1W9VA 2O9OA 1SR0A 1QPFA 3IK8A 1XRVA 5J6EA 4MNKA 2WM0A 1O6IA 1W1TA 4DH0A 4W5UA 3WH0A 3G6MA 4ZPWR 1ZB5A 1B6CA 4P8WA 3GPKA 2D9FA 1W1PA 2XP6A 1FD9A 1KT1A 1J6YA 1ROUA 1J4IA 2AOSA 2VN1A 1T11A 3AS1A 4R0XA 2MLZA 4U86A 1D2KA 3ALGA 1E6PA 1FKTA 2F21A 3O5JA 2DSZA 1H0IA 3UQIA 4MNJA 3O5QA 1LQ0A 2KGJA 1R9HA 1VF8A 4ODPA 2F4EA 2G41A 4MTVA 2A3AA 4LAYA 2LJ4A 3BXWA 3IHZA 5B8IC 4DRQA 3WD2A 4WKFA 1D7IA 1FFRA 1E6RA 3EY6A 4ODRA 1FKJA 1L1PA 1TFVA 1HKIA 1ZBKA 1HJVA 4QT2A 3B9EA 4G2PA 4G50A 2LGOA 1J4HA 3QOKA 4JFKA 3WD3A 1HJWA 3B9AA 4KR0B 3TDBA 3ALFA 5HKGA 2DT1A 1IX5A 1HJXA 1XHGA 1EIBA 3RM4A 3ARWA 3ARUA 1UR9A 4ODLA 4WK9A 2RSEA 1D7HA 2DG4A 2LPVA 3ARVA 4ODOA 1W9UA 3AS3A 1FKSA 5HTGA 1GOIA 4TW7A 1WB0A 4JFMA 3AROA 3B9DA 4WIWA 2K8IA 2F2DA 2OFNA 3KZ7A 1NWUA 3WL0A 3CGMA 4ZPTR 1BKFA 4DWSC 1A7XA 2FAPA 4N19A 4WKHA 1YATA 2UZ5A 4TYOA 3KAHA 4LAXA 4S3JA 3RM9A 3FAPA 4MGVA 3CHDA 2XP4A 4DRJA 3O5KA 3GTYX 3PRDA 3W4RA 4LAWA
chains in the Genus database with same CATH topology
3O5MA 1F8AB 4TW8A 3UQBA 4URIA 4DRPA 1X6LA 2A3EA 3PR9A 4HBOA 5HWCA 1FKDA 1LL6A 4DRKA 1EYMA 4P8XA 2JZVA 1P5QA 1JNSA 4IQCA 3CGNA 1HXVA 3ARRA 2IUZA 1EHNA 1FKIA 1NH6A 1YW5A 2FKEA 1OGBA 2ESCA 3I6CA 2DT0A 3JXVA 2YBTA 4Z2GA 2PV1A 1JNEA 4AY1A 1D6OA 4DRMA 4Z2JA 1FKFA 4TNSA 2N87A 2KI3A 4IPXA 1E15A 5HUAA 2MLYA 3PRAA 4GGQA 4J4NA 4QZVB 3PA7A 2DT3A 1Q1CA 2ZQVA 2XP9A 1FKHA 1FKKA 2RQSA 4DRNA 4Q22A 2OLHA 4U84A 1WNOA 4J4OA 4TX0A 4MAVA 1ZBVA 1FKGA 5HWBA 3O5IA 4Z2KA 1Y0OA 2DT2A 3WQVA 4BF8A 2PV2A 5GQBA 3RFWA 5DIVA 1LL7A 3O5OA 1M5YA 1EQ3A 2DSVA 4ITZA 2RURA 1NWTA 1PBKA 3TC5A 5DO2A 3KAGA 4LAVA 3IKGA 4IQ2A 4MNMA 1Q6HA 1ROTA 2KR7A 1QZ2A 5HT1A 4JYSA 1ZU8A 1ZBCA 2PPNA 1W26A 1N1AA 2A3CA 3ARQA 1E6NA 3AS0A 1FKLA 5I98A 3LUOA 4GIVA 2QF8A 5JH8A 4DRHA 4O2TA 4JFIA 4ODKA 2PBCA 1U79A 2LKNA 4P8VA 2L2SA 3FY1A 4KQZA 2MPHA 3ARYA 1D7JA 1JVWA 1X6NA 1ZK6A 2RUCA 3O5EA 2KE0A 4U85A 1OGGA 2XPBA 1PINA 5DITA 2WLYA 3OOBA 4ODNA 5HBFA 1OWQA 3IKDA 1ZCNA 4TW6A 2YBUA 1LG2A 2PV3A 3ARXA 4ZS6A 2WLZA 3KABA 4DWSA 1Q6IA 4ODMA 4ODQA 4DWSD 1HKKA 5DIUA 3NI6A 3CHEA 4NZCA 4S3KA 3O5DA 1WAWA 4W9QA 3KACA 2FDMA 2MNTA 2AWGA 1FFQA 2DSUA 3FXYA 4DRIA 3B8SA 1C9HA 3ODKA 1K9TA 1NMVA 1GUVA 2ZR5A 1E6ZA 4Z2HA 1NSGA 4DIPA 4JFLA 3B7XA 1LJYA 4R5EA 1ZL1A 3AS2A 4MSPA 5GPRA 1RD6A 2MF9A 2XP8A 3ARTA 3O5FA 4WJXA 1FAPA 3KCEA 2ZR6A 5DF0A 4QIBA 3RM8A 1QPLA 1FKBA 1W1YA 3MDYB 4C02B 2KO7A 4W9OA 3AQUA 4IT6A 4LGXA 4Z2LA 4DZ2A 5HW8A 5HW6A 3CHCA 2M08A 1J4RA 3G6LA 1KT0A 3O5LA 2RUQA 2PPOA 2XP7A 1FKRA 2ZQTA 3VAWA 5D75A 4MPKA 3NTPA 2MLXA 1JNDA 4Q7NA 2PPPA 2WK2A 1F40A 3WL1A 2PI6A 3JYJA 4HBEA 1HKJA 4L72B 1NMWA 3WD1A 3JYMA 3H9RB 4JFJA 4FN2A 4DWSB 2Y78A 3UI6A 4DROA 3KADA 2Q5AA 2ITKA 4ZPVR 2DPEA 4FAPA 2B31A 5HW7A 2G8ZA 3O5PA 3WD4A 3WD0A 1E9LA 4ML4A 1NWRA 2ZQSA 2ZQUA 1HKMA 3UI5A 1NWSA 5DEZA 3KAFA 3NRKA 1ITXA 4WKAA 2VCDA 5GPGA 4HARA 4W9PA 1LL4A 2DG3A 2RUDA 1LG1A 3O5GA 2XP3A 1BL4A 4Z2IA 5BXJA 1EDQA 3CZ8A 1UR8A 4NNRA 4PTMA 1FJDA 3CH9A 4NSBA 3RGCA 3ARPA 3TCZA 4MNLA 1W9PA 3ARZA 2M1IA 4DZ3A 2KFWA 3ARSA 3RMEA 1GPFA 2M2AA 2ZR4A 4IT4A 2XP5A 2DSWA 1W1VA 1TCOC 4QT3A 4P8UA 1KFWA 3OA5A 1JNTA 1Q6UA 2DG9A 2XPAA 3WIJA 1H0GA 2IF4A 3WQWA 3UQAA 4XAKA 3PRBA 2O92A 1ZBWA 2A3BA 3CHFA 1SYTA 3UF8A 1CTNA 4L3NA 3O5RA 3WKZA 3UI4A 3KAIA 4DT4A 1W9VA 2O9OA 1SR0A 1QPFA 3IK8A 1XRVA 5J6EA 4MNKA 2WM0A 1O6IA 1W1TA 4DH0A 4W5UA 3WH0A 3G6MA 4ZPWR 1ZB5A 1B6CA 4P8WA 3GPKA 2D9FA 1W1PA 2XP6A 1FD9A 1KT1A 1J6YA 1ROUA 1J4IA 2AOSA 2VN1A 1T11A 3AS1A 4R0XA 2MLZA 4U86A 1D2KA 3ALGA 1E6PA 1FKTA 2F21A 3O5JA 2DSZA 1H0IA 3UQIA 4MNJA 3O5QA 1LQ0A 2KGJA 1R9HA 1VF8A 4ODPA 2F4EA 2G41A 4MTVA 2A3AA 4LAYA 2LJ4A 3BXWA 3IHZA 5B8IC 4DRQA 3WD2A 4WKFA 1D7IA 1FFRA 1E6RA 3EY6A 4ODRA 1FKJA 1L1PA 1TFVA 1HKIA 1ZBKA 1HJVA 4QT2A 3B9EA 4G2PA 4G50A 2LGOA 1J4HA 3QOKA 4JFKA 3WD3A 1HJWA 3B9AA 4KR0B 3TDBA 3ALFA 5HKGA 2DT1A 1IX5A 1HJXA 1XHGA 1EIBA 3RM4A 3ARWA 3ARUA 1UR9A 4ODLA 4WK9A 2RSEA 1D7HA 2DG4A 2LPVA 3ARVA 4ODOA 1W9UA 3AS3A 1FKSA 5HTGA 1GOIA 4TW7A 1WB0A 4JFMA 3AROA 3B9DA 4WIWA 2K8IA 2F2DA 2OFNA 3KZ7A 1NWUA 3WL0A 3CGMA 4ZPTR 1BKFA 4DWSC 1A7XA 2FAPA 4N19A 4WKHA 1YATA 2UZ5A 4TYOA 3KAHA 4LAXA 4S3JA 3RM9A 3FAPA 4MGVA 3CHDA 2XP4A 4DRJA 3O5KA 3PRDA 3W4RA 4LAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L2S A;  3O5M A;  1F8A B;  4TW8 A;  3VAW A;  3UQB A;  1B6C A;  2MPH A;  5D75 A;  3NTP A;  1D7J A;  3GPK A;  2MLX A;  4DRP A;  1JVW A;  2D9F A;  1ZK6 A;  2XP6 A;  1FD9 A;  1KT1 A;  2PPP A;  5HWC A;  2RUC A;  1FKD A;  1ROU A;  1J6Y A;  1F40 A;  1J4I A;  4DRK A;  1EYM A;  3JYJ A;  2JZV A;  1P5Q A;  3O5E A;  2KE0 A;  2VN1 A;  4U85 A;  1NMW A;  1JNS A;  2XPB A;  3JYM A;  4IQC A;  1T11 A;  3H9R B;  4JFJ A;  1PIN A;  2MLZ A;  2Y78 A;  4FN2 A;  4R0X A;  4U86 A;  5DIT A;  3CGN A;  3UI6 A;  1HXV A;  3OOB A;  4ODN A;  4DRO A;  3KAD A;  1FKT A;  2Q5A A;  1FKI A;  1YW5 A;  2ITK A;  4FAP A;  2F21 A;  3O5J A;  2FKE A;  3I6C A;  3IKD A;  5HW7 A;  1ZCN A;  3UQI A;  3JXV A;  3O5P A;  2PV1 A;  3O5Q A;  4TW6 A;  1D6O A;  2PV3 A;  2KGJ A;  1R9H A;  2ZQS A;  2ZQU A;  4DRM A;  3UI5 A;  3KAB A;  1FKF A;  3KAF A;  2N87 A;  4TNS A;  1Q6I A;  2KI3 A;  3NRK A;  2F4E A;  4IPX A;  4ODP A;  4ODM A;  2VCD A;  4ODQ A;  5GPG A;  4LAY A;  5HUA A;  2LJ4 A;  2MLY A;  4W9P A;  4GGQ A;  2DG3 A;  3IHZ A;  4J4N A;  5B8I C;  2RUD A;  3PA7 A;  4DRQ A;  5DIU A;  1D7I A;  2XP3 A;  1Q1C A;  3NI6 A;  3O5G A;  2ZQV A;  2XP9 A;  1FKH A;  1BL4 A;  1FKK A;  2RQS A;  3O5D A;  5BXJ A;  4W9Q A;  3EY6 A;  3KAC A;  4DRN A;  4ODR A;  4U84 A;  2MNT A;  1FKJ A;  1L1P A;  4J4O A;  2AWG A;  4NNR A;  4TX0 A;  4DRI A;  1FJD A;  4QT2 A;  1FKG A;  3RGC A;  5HWB A;  1C9H A;  3O5I A;  3ODK A;  1Y0O A;  3TCZ A;  1NMV A;  4BF8 A;  4G2P A;  4G50 A;  2ZR5 A;  2LGO A;  2PV2 A;  3RFW A;  2M1I A;  1J4H A;  5DIV A;  4JFK A;  4DZ3 A;  2KFW A;  1NSG A;  1M5Y A;  3O5O A;  1EQ3 A;  4DIP A;  4JFL A;  3TDB A;  3B7X A;  4ITZ A;  2M2A A;  2RUR A;  2ZR4 A;  2XP5 A;  4MSP A;  5HKG A;  1PBK A;  3TC5 A;  3KAG A;  1TCO C;  4LAV A;  3IKG A;  2MF9 A;  4IQ2 A;  4QT3 A;  2XP8 A;  3O5F A;  1FAP A;  3KCE A;  4ODL A;  2ZR6 A;  2RSE A;  1D7H A;  1Q6H A;  1ROT A;  4QIB A;  2DG4 A;  2KR7 A;  1JNT A;  1Q6U A;  1QZ2 A;  1QPL A;  2DG9 A;  2LPV A;  2XPA A;  4ODO A;  4JYS A;  5HT1 A;  1FKB A;  2PPN A;  1FKS A;  2IF4 A;  1W26 A;  5HTG A;  3MDY B;  4TW7 A;  1N1A A;  4JFM A;  4C02 B;  3UQA A;  2KO7 A;  3PRB A;  4W9O A;  1FKL A;  2K8I A;  3UF8 A;  4DZ2 A;  2F2D A;  2OFN A;  3KZ7 A;  3O5R A;  5I98 A;  3CGM A;  3LUO A;  4GIV A;  5HW8 A;  3UI4 A;  5HW6 A;  1BKF A;  1A7X A;  2FAP A;  2M08 A;  4N19 A;  4O2T A;  1YAT A;  1J4R A;  3KAI A;  4DRH A;  4DT4 A;  2UZ5 A;  4TYO A;  3KAH A;  4JFI A;  4LAX A;  1QPF A;  1KT0 A;  3FAP A;  3IK8 A;  3O5L A;  2RUQ A;  5J6E A;  4MGV A;  2XP4 A;  4DRJ A;  4ODK A;  2PBC A;  1U79 A;  2LKN A;  2PPO A;  2XP7 A;  3O5K A;  4DH0 A;  3WH0 A;  3PRD A;  4LAW A;  1FKR A;  2ZQT A; 
#chains in the Genus database with same CATH topology
 3O5M A;  1F8A B;  4TW8 A;  3UQB A;  4URI A;  4DRP A;  1X6L A;  2A3E A;  3PR9 A;  4HBO A;  5HWC A;  1FKD A;  1LL6 A;  4DRK A;  1EYM A;  4P8X A;  2JZV A;  1P5Q A;  1JNS A;  4IQC A;  3CGN A;  1HXV A;  3ARR A;  2IUZ A;  1EHN A;  1FKI A;  1NH6 A;  1YW5 A;  2FKE A;  1OGB A;  2ESC A;  3I6C A;  2DT0 A;  3JXV A;  2YBT A;  4Z2G A;  2PV1 A;  1JNE A;  4AY1 A;  1D6O A;  4DRM A;  4Z2J A;  1FKF A;  4TNS A;  2N87 A;  2KI3 A;  4IPX A;  1E15 A;  5HUA A;  2MLY A;  3PRA A;  4GGQ A;  4J4N A;  4QZV B;  3PA7 A;  2DT3 A;  1Q1C A;  2ZQV A;  2XP9 A;  1FKH A;  1FKK A;  2RQS A;  4DRN A;  4Q22 A;  2OLH A;  4U84 A;  1WNO A;  4J4O A;  4TX0 A;  4MAV A;  1ZBV A;  1FKG A;  5HWB A;  3GU0 A;  3O5I A;  4Z2K A;  1Y0O A;  2DT2 A;  3WQV A;  4BF8 A;  2PV2 A;  5GQB A;  3RFW A;  5DIV A;  1LL7 A;  3O5O A;  1M5Y A;  1EQ3 A;  2DSV A;  4ITZ A;  2RUR A;  1NWT A;  1PBK A;  3TC5 A;  5DO2 A;  3KAG A;  4LAV A;  3IKG A;  4IQ2 A;  2F23 A;  4MNM A;  1Q6H A;  1ROT A;  2KR7 A;  1QZ2 A;  5HT1 A;  4JYS A;  1ZU8 A;  1ZBC A;  2PPN A;  1W26 A;  1N1A A;  2A3C A;  3ARQ A;  1E6N A;  3AS0 A;  1FKL A;  2EUL A;  5I98 A;  3LUO A;  4GIV A;  2QF8 A;  5JH8 A;  4DRH A;  4O2T A;  4JFI A;  4ODK A;  2PBC A;  1U79 A;  2LKN A;  4P8V A;  2L2S A;  3FY1 A;  4KQZ A;  2MPH A;  3ARY A;  1D7J A;  1JVW A;  1X6N A;  1ZK6 A;  2RUC A;  1JCH B;  3BMB A;  3O5E A;  2KE0 A;  2PN0 A;  4U85 A;  1OGG A;  2XPB A;  1PIN A;  5DIT A;  2WLY A;  3OOB A;  4ODN A;  5HBF A;  1OWQ A;  3IKD A;  1ZCN A;  4TW6 A;  2YBU A;  3ARX A;  1LG2 A;  2PV3 A;  4ZS6 A;  2WLZ A;  3KAB A;  4DWS A;  1Q6I A;  4ODM A;  4ODQ A;  4DWS D;  1HKK A;  5DIU A;  3NI6 A;  3CHE A;  4NZC A;  4S3K A;  3O5D A;  1WAW A;  4W9Q A;  3KAC A;  2FDM A;  2MNT A;  2AWG A;  1FFQ A;  2DSU A;  3FXY A;  4DRI A;  3B8S A;  1C9H A;  3ODK A;  1K9T A;  1NMV A;  1GUV A;  2ZR5 A;  1E6Z A;  4Z2H A;  1NSG A;  4DIP A;  4JFL A;  2ETN A;  3B7X A;  1LJY A;  4R5E A;  1ZL1 A;  3AS2 A;  4MSP A;  5GPR A;  1RD6 A;  2MF9 A;  2XP8 A;  3ART A;  3O5F A;  4WJX A;  1FAP A;  3KCE A;  2ZR6 A;  5DF0 A;  4QIB A;  3RM8 A;  1QPL A;  1FKB A;  1W1Y A;  3MDY B;  4C02 B;  2KO7 A;  4W9O A;  3AQU A;  4IT6 A;  4LGX A;  4Z2L A;  4DZ2 A;  2P4V A;  5HW8 A;  5HW6 A;  3CHC A;  2M08 A;  1J4R A;  3G6L A;  1KT0 A;  3O5L A;  2RUQ A;  2PPO A;  2XP7 A;  1FKR A;  2ZQT A;  3VAW A;  5D75 A;  4MPK A;  3NTP A;  2MLX A;  1JND A;  4Q7N A;  2PPP A;  2WK2 A;  1F40 A;  3WL1 A;  2PI6 A;  3JYJ A;  4HBE A;  1HKJ A;  4L72 B;  1NMW A;  3WD1 A;  3JYM A;  3H9R B;  4JFJ A;  4FN2 A;  4DWS B;  2Y78 A;  3UI6 A;  4DRO A;  3KAD A;  2B5U B;  2Q5A A;  2ITK A;  4ZPV R;  2DPE A;  4FAP A;  2B31 A;  5HW7 A;  2G8Z A;  3O5P A;  3WD4 A;  3WD0 A;  1E9L A;  4ML4 A;  1GRJ A;  1NWR A;  2ZQS A;  2ZQU A;  1HKM A;  3UI5 A;  1NWS A;  5DEZ A;  3KAF A;  3NRK A;  1ITX A;  4WKA A;  2VCD A;  5GPG A;  4HAR A;  4W9P A;  1LL4 A;  2DG3 A;  2RUD A;  1LG1 A;  3O5G A;  2XP3 A;  1BL4 A;  4Z2I A;  5BXJ A;  1EDQ A;  3CZ8 A;  3EIP A;  1UR8 A;  4NNR A;  4PTM A;  1FJD A;  3CH9 A;  4NSB A;  3RGC A;  3ARP A;  3TCZ A;  4MNL A;  1W9P A;  3ARZ A;  2M1I A;  4DZ3 A;  2KFW A;  3ARS A;  3RME A;  1GPF A;  2M2A A;  2ZR4 A;  4IT4 A;  2XP5 A;  2DSW A;  1E44 A;  1W1V A;  1TCO C;  4QT3 A;  4P8U A;  1KFW A;  3OA5 A;  1JNT A;  1Q6U A;  2DG9 A;  2XPA A;  3WIJ A;  1H0G A;  2IF4 A;  4UDM A;  3WQW A;  3UQA A;  4XAK A;  3PRB A;  2O92 A;  1ZBW A;  2A3B A;  3CHF A;  1SYT A;  3UF8 A;  1CTN A;  4L3N A;  3O5R A;  3WKZ A;  3UI4 A;  3KAI A;  4DT4 A;  1W9V A;  2O9O A;  1SR0 A;  1QPF A;  3IK8 A;  1XRV A;  5J6E A;  4MNK A;  2WM0 A;  1O6I A;  1W1T A;  4DH0 A;  4W5U A;  3WH0 A;  3G6M A;  4ZPW R;  1ZB5 A;  1B6C A;  4P8W A;  3GPK A;  2D9F A;  1W1P A;  2XP6 A;  1FD9 A;  1KT1 A;  1J6Y A;  1ROU A;  1J4I A;  2AOS A;  2VN1 A;  1T11 A;  3AS1 A;  4R0X A;  2MLZ A;  4U86 A;  1D2K A;  3ALG A;  1E6P A;  1FKT A;  2F21 A;  3O5J A;  2DSZ A;  1H0I A;  3UQI A;  4MNJ A;  3O5Q A;  1LQ0 A;  2KGJ A;  1R9H A;  1VF8 A;  4ODP A;  2F4E A;  2G41 A;  4MTV A;  2A3A A;  4LAY A;  2LJ4 A;  3BXW A;  3IHZ A;  5B8I C;  4DRQ A;  3WD2 A;  4WKF A;  1D7I A;  1FFR A;  1E6R A;  3EY6 A;  4ODR A;  1FKJ A;  1L1P A;  1TFV A;  1HKI A;  1ZBK A;  1HJV A;  4QT2 A;  3B9E A;  4G2P A;  4G50 A;  2LGO A;  1J4H A;  3QOK A;  4JFK A;  3WD3 A;  1HJW A;  3B9A A;  4KR0 B;  3TDB A;  3ALF A;  5HKG A;  2DT1 A;  1IX5 A;  1HJX A;  1XHG A;  1EIB A;  3RM4 A;  3ARW A;  3ARU A;  1UR9 A;  4ODL A;  4WK9 A;  2RSE A;  1D7H A;  2DG4 A;  2LPV A;  3ARV A;  4ODO A;  1W9U A;  3AS3 A;  1FKS A;  5HTG A;  1GOI A;  4TW7 A;  1WB0 A;  4JFM A;  3ARO A;  3B9D A;  4WIW A;  2K8I A;  2F2D A;  2OFN A;  3KZ7 A;  1NWU A;  3WL0 A;  3CGM A;  4ZPT R;  1BKF A;  4DWS C;  1A7X A;  2FAP A;  4N19 A;  4WKH A;  1YAT A;  2UZ5 A;  4TYO A;  3KAH A;  4LAX A;  4S3J A;  3RM9 A;  3FAP A;  4MGV A;  3CHD A;  2XP4 A;  4DRJ A;  3O5K A;  3GTY X;  3PRD A;  3W4R A;  4LAW A; 
#chains in the Genus database with same CATH homology
 3O5M A;  1F8A B;  4TW8 A;  3UQB A;  4URI A;  4DRP A;  1X6L A;  2A3E A;  3PR9 A;  4HBO A;  5HWC A;  1FKD A;  1LL6 A;  4DRK A;  1EYM A;  4P8X A;  2JZV A;  1P5Q A;  1JNS A;  4IQC A;  3CGN A;  1HXV A;  3ARR A;  2IUZ A;  1EHN A;  1FKI A;  1NH6 A;  1YW5 A;  2FKE A;  1OGB A;  2ESC A;  3I6C A;  2DT0 A;  3JXV A;  2YBT A;  4Z2G A;  2PV1 A;  1JNE A;  4AY1 A;  1D6O A;  4DRM A;  4Z2J A;  1FKF A;  4TNS A;  2N87 A;  2KI3 A;  4IPX A;  1E15 A;  5HUA A;  2MLY A;  3PRA A;  4GGQ A;  4J4N A;  4QZV B;  3PA7 A;  2DT3 A;  1Q1C A;  2ZQV A;  2XP9 A;  1FKH A;  1FKK A;  2RQS A;  4DRN A;  4Q22 A;  2OLH A;  4U84 A;  1WNO A;  4J4O A;  4TX0 A;  4MAV A;  1ZBV A;  1FKG A;  5HWB A;  3O5I A;  4Z2K A;  1Y0O A;  2DT2 A;  3WQV A;  4BF8 A;  2PV2 A;  5GQB A;  3RFW A;  5DIV A;  1LL7 A;  3O5O A;  1M5Y A;  1EQ3 A;  2DSV A;  4ITZ A;  2RUR A;  1NWT A;  1PBK A;  3TC5 A;  5DO2 A;  3KAG A;  4LAV A;  3IKG A;  4IQ2 A;  4MNM A;  1Q6H A;  1ROT A;  2KR7 A;  1QZ2 A;  5HT1 A;  4JYS A;  1ZU8 A;  1ZBC A;  2PPN A;  1W26 A;  1N1A A;  2A3C A;  3ARQ A;  1E6N A;  3AS0 A;  1FKL A;  5I98 A;  3LUO A;  4GIV A;  2QF8 A;  5JH8 A;  4DRH A;  4O2T A;  4JFI A;  4ODK A;  2PBC A;  1U79 A;  2LKN A;  4P8V A;  2L2S A;  3FY1 A;  4KQZ A;  2MPH A;  3ARY A;  1D7J A;  1JVW A;  1X6N A;  1ZK6 A;  2RUC A;  3O5E A;  2KE0 A;  4U85 A;  1OGG A;  2XPB A;  1PIN A;  5DIT A;  2WLY A;  3OOB A;  4ODN A;  5HBF A;  1OWQ A;  3IKD A;  1ZCN A;  4TW6 A;  2YBU A;  1LG2 A;  2PV3 A;  3ARX A;  4ZS6 A;  2WLZ A;  3KAB A;  4DWS A;  1Q6I A;  4ODM A;  4ODQ A;  4DWS D;  1HKK A;  5DIU A;  3NI6 A;  3CHE A;  4NZC A;  4S3K A;  3O5D A;  1WAW A;  4W9Q A;  3KAC A;  2FDM A;  2MNT A;  2AWG A;  1FFQ A;  2DSU A;  3FXY A;  4DRI A;  3B8S A;  1C9H A;  3ODK A;  1K9T A;  1NMV A;  1GUV A;  2ZR5 A;  1E6Z A;  4Z2H A;  1NSG A;  4DIP A;  4JFL A;  3B7X A;  1LJY A;  4R5E A;  1ZL1 A;  3AS2 A;  4MSP A;  5GPR A;  1RD6 A;  2MF9 A;  2XP8 A;  3ART A;  3O5F A;  4WJX A;  1FAP A;  3KCE A;  2ZR6 A;  5DF0 A;  4QIB A;  3RM8 A;  1QPL A;  1FKB A;  1W1Y A;  3MDY B;  4C02 B;  2KO7 A;  4W9O A;  3AQU A;  4IT6 A;  4LGX A;  4Z2L A;  4DZ2 A;  5HW8 A;  5HW6 A;  3CHC A;  2M08 A;  1J4R A;  3G6L A;  1KT0 A;  3O5L A;  2RUQ A;  2PPO A;  2XP7 A;  1FKR A;  2ZQT A;  3VAW A;  5D75 A;  4MPK A;  3NTP A;  2MLX A;  1JND A;  4Q7N A;  2PPP A;  2WK2 A;  1F40 A;  3WL1 A;  2PI6 A;  3JYJ A;  4HBE A;  1HKJ A;  4L72 B;  1NMW A;  3WD1 A;  3JYM A;  3H9R B;  4JFJ A;  4FN2 A;  4DWS B;  2Y78 A;  3UI6 A;  4DRO A;  3KAD A;  2Q5A A;  2ITK A;  4ZPV R;  2DPE A;  4FAP A;  2B31 A;  5HW7 A;  2G8Z A;  3O5P A;  3WD4 A;  3WD0 A;  1E9L A;  4ML4 A;  1NWR A;  2ZQS A;  2ZQU A;  1HKM A;  3UI5 A;  1NWS A;  5DEZ A;  3KAF A;  3NRK A;  1ITX A;  4WKA A;  2VCD A;  5GPG A;  4HAR A;  4W9P A;  1LL4 A;  2DG3 A;  2RUD A;  1LG1 A;  3O5G A;  2XP3 A;  1BL4 A;  4Z2I A;  5BXJ A;  1EDQ A;  3CZ8 A;  1UR8 A;  4NNR A;  4PTM A;  1FJD A;  3CH9 A;  4NSB A;  3RGC A;  3ARP A;  3TCZ A;  4MNL A;  1W9P A;  3ARZ A;  2M1I A;  4DZ3 A;  2KFW A;  3ARS A;  3RME A;  1GPF A;  2M2A A;  2ZR4 A;  4IT4 A;  2XP5 A;  2DSW A;  1W1V A;  1TCO C;  4QT3 A;  4P8U A;  1KFW A;  3OA5 A;  1JNT A;  1Q6U A;  2DG9 A;  2XPA A;  3WIJ A;  1H0G A;  2IF4 A;  3WQW A;  3UQA A;  4XAK A;  3PRB A;  2O92 A;  1ZBW A;  2A3B A;  3CHF A;  1SYT A;  3UF8 A;  1CTN A;  4L3N A;  3O5R A;  3WKZ A;  3UI4 A;  3KAI A;  4DT4 A;  1W9V A;  2O9O A;  1SR0 A;  1QPF A;  3IK8 A;  1XRV A;  5J6E A;  4MNK A;  2WM0 A;  1O6I A;  1W1T A;  4DH0 A;  4W5U A;  3WH0 A;  3G6M A;  4ZPW R;  1ZB5 A;  1B6C A;  4P8W A;  3GPK A;  2D9F A;  1W1P A;  2XP6 A;  1FD9 A;  1KT1 A;  1J6Y A;  1ROU A;  1J4I A;  2AOS A;  2VN1 A;  1T11 A;  3AS1 A;  4R0X A;  2MLZ A;  4U86 A;  1D2K A;  3ALG A;  1E6P A;  1FKT A;  2F21 A;  3O5J A;  2DSZ A;  1H0I A;  3UQI A;  4MNJ A;  3O5Q A;  1LQ0 A;  2KGJ A;  1R9H A;  1VF8 A;  4ODP A;  2F4E A;  2G41 A;  4MTV A;  2A3A A;  4LAY A;  2LJ4 A;  3BXW A;  3IHZ A;  5B8I C;  4DRQ A;  3WD2 A;  4WKF A;  1D7I A;  1FFR A;  1E6R A;  3EY6 A;  4ODR A;  1FKJ A;  1L1P A;  1TFV A;  1HKI A;  1ZBK A;  1HJV A;  4QT2 A;  3B9E A;  4G2P A;  4G50 A;  2LGO A;  1J4H A;  3QOK A;  4JFK A;  3WD3 A;  1HJW A;  3B9A A;  4KR0 B;  3TDB A;  3ALF A;  5HKG A;  2DT1 A;  1IX5 A;  1HJX A;  1XHG A;  1EIB A;  3RM4 A;  3ARW A;  3ARU A;  1UR9 A;  4ODL A;  4WK9 A;  2RSE A;  1D7H A;  2DG4 A;  2LPV A;  3ARV A;  4ODO A;  1W9U A;  3AS3 A;  1FKS A;  5HTG A;  1GOI A;  4TW7 A;  1WB0 A;  4JFM A;  3ARO A;  3B9D A;  4WIW A;  2K8I A;  2F2D A;  2OFN A;  3KZ7 A;  1NWU A;  3WL0 A;  3CGM A;  4ZPT R;  1BKF A;  4DWS C;  1A7X A;  2FAP A;  4N19 A;  4WKH A;  1YAT A;  2UZ5 A;  4TYO A;  3KAH A;  4LAX A;  4S3J A;  3RM9 A;  3FAP A;  4MGV A;  3CHD A;  2XP4 A;  4DRJ A;  3O5K A;  3PRD A;  3W4R A;  4LAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...