4DRMA

Evaluation of synthetic fk506 analogs as ligands for fkbp51 and fkbp52: complex of fkbp51 with {3-[(1r)-3-(3,4-dimethoxyphenyl)-1-({[(2s)-1-{[(1s,2r)-2-ethyl-1-hydroxycyclohexyl](oxo)acetyl}piperidin-2-yl]carbonyl}oxy)propyl]phenoxy}acetic acid
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
b'GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Evaluation of Synthetic FK506 Analogues as Ligands for the FK506-Binding Proteins 51 and 52.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 34
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drmA00
2VCDA 4ODLA 2KI3A 4TYOA 2PPOA 2D9FA 1FKHA 3KZ7A 1BKFA 3FAPA 3RGCA 1B6CA 4DZ2A 2IF4A 1D7IA 5D75A 3PA7A 3KADA 1FD9A 4DRNA 4FAPA 2DG3A 3KAIA 4DRQA 3O5RA 4JFLA 4GIVA 2PV1A 3RFWA 2KR7A 5DIVA 3O5JA 4MSPA 1D6OA 3IK8A 5HW8A 1FKDA 2DG9A 2MLXA 5HTGA 5I98A 1FKFA 2XPBA 2PV2A 1ZK6A 2FAPA 3CGMA 3UI4A 3ODKA 2KFWA 2Y78A 3JXVA 4R0XA 1NMVA 1PBKA 3PRBA 2RSEA 1KT1A 3IHZA 2ZQVA 3KAFA 3VAWA 1JNSA 1EYMA 1FKBA 3TDBA 5J6EA 1J4RA 1F8AB 3B7XA 2F4EA 3O5GA 2F2DA 2LGOA 3O5EA 1T11A 3O5QA 4O2TA 2XP6A 4TW7A 1HXVA 1PINA 2ZQTA 4DIPA 5HW7A 3NTPA 5HWCA 2LJ4A 4IQ2A 4BF8A 1ZCNA 4ODQA 3UQIA 1YATA 2XP5A 4TX0A 4DROA 1C9HA 1Y0OA 4G50A 3WH0A 1FKIA 2LPVA 4ODOA 1R9HA 3O5FA 1FKRA 4ODKA 1Q6UA 3UI6A 2MNTA 1Q1CA 2PBCA 2ZR5A 4ODNA 4JFJA 1FKSA 2AWGA 4ODMA 2RUDA 4NNRA 4TW6A 1N1AA 2KE0A 4ODRA 5B8IC 1L1PA 4TNSA 1FKJA 1QZ2A 1QPLA 2FKEA 4IQCA 4ITZA 2M1IA 4MGVA 5DITA 4DH0A 3CGNA 4DRIA 2ZQSA 3H9RB 2XP4A 2MF9A 4U85A 5GPGA 5HW6A 2RURA 1ROTA 3KAGA 2M08A 3KCEA 2ZQUA 4J4NA 4DRMA 3IKGA 1YW5A 4TW8A 3OOBA 3MDYB 3I6CA 1A7XA 4W9QA 4LAVA 1J4HA 4DZ3A 5BXJA 1NMWA 1FAPA 2JZVA 1FKGA 2RQSA 5HWBA 2LKNA 3JYMA 1J6YA 2RUCA 1NSGA 1BL4A 4JYSA 2M2AA 2XP7A 2DG4A 1F40A 1U79A 4W9OA 4J4OA 4LAXA 4G2PA 2ZR6A 4C02B 5HUAA 3O5MA 5HKGA 1FKLA 2UZ5A 2ZR4A 1Q6IA 1P5QA 2MLYA 2F21A 2Q5AA 3EY6A 4N19A 3PRDA 4JFKA 2K8IA 2L2SA 3LUOA 4FN2A 4QIBA 2PV3A 4QT3A 5DIUA 2PPPA 4DRJA 2XP3A 1JVWA 1Q6HA 1JNTA 3O5PA 4U86A 3KACA 4GGQA 1QPFA 1FKTA 3UQAA 4DRPA 2VN1A 3O5IA 4JFMA 4W9PA 1FJDA 3O5LA 4DRHA 3JYJA 3UF8A 3NRKA 4QT2A 1KT0A 2PPNA 2MLZA 3UI5A 2KO7A 2RUQA 3O5KA 2MPHA 1M5YA 3O5DA 2XPAA 1ROUA 3KABA 3IKDA 4LAYA 3TCZA 4DT4A 1EQ3A 2KGJA 2XP8A 3NI6A 4U84A 2XP9A 1D7HA 4JFIA 1D7JA 3GPKA 4DRKA 4ODPA 3O5OA 1FKKA 2ITKA 1J4IA 5HT1A 2N87A 3TC5A 4IPXA 3KAHA 4LAWA 3UQBA 1W26A 2OFNA 1TCOC
chains in the Genus database with same CATH superfamily
4TYOA 1RD6A 2WLYA 2D9FA 3KZ7A 3CZ8A 1OGBA 1WB0A 4Z2KA 2WK2A 3AROA 4DRNA 4FAPA 1GPFA 1LL6A 4JFLA 1OGGA 3RFWA 5HW8A 4WJXA 2MLXA 1FKFA 2PV2A 3UI4A 2DSZA 3AS0A 2KFWA 5DO2A 1E6NA 2DSVA 4R0XA 3ARSA 3PRBA 3IHZA 4MNLA 4DWSC 4Z2LA 3KAFA 1JNSA 1EYMA 1EDQA 3ARQA 3O5EA 2ETNA 4O2TA 2XP6A 4DIPA 3NTPA 5HWCA 3UQIA 3ARYA 3WQVA 4TX0A 1Y0OA 4LGXA 3RM8A 1FKRA 2MNTA 1Q1CA 2ZR5A 4TW6A 2RUDA 2B31A 1N1AA 2KE0A 1FKJA 5DITA 4IQCA 4DH0A 3EIPA 3CGNA 2ZQSA 1E6RA 2OLHA 2MF9A 3CHFA 1O6IA 4DRMA 3IKGA 3MDYB 2P4VA 3WD3A 1NMWA 4HBOA 1FKGA 3BMBA 1ZBWA 4Q7NA 4P8WA 3CH9A 2RUCA 4MTVA 1FFQA 1F40A 2G41A 4G2PA 1H0IA 5HUAA 3O5MA 5HKGA 1Q6IA 4URIA 2F21A 3PRDA 4JFKA 2G8ZA 2K8IA 2O92A 3OA5A 4U86A 1JNTA 1WAWA 4GGQA 1QPFA 1FKTA 2DPEA 1EHNA 3B9DA 1LQ0A 3ARUA 4DRHA 3JYJA 2A3BA 1XHGA 4HBEA 2MLZA 4WIWA 4IT4A 3O5DA 3WL1A 2XPAA 3KABA 3IKDA 4DT4A 1EQ3A 1D7HA 4JFIA 4L3NA 4DRKA 3WD2A 1ZBKA 1W9PA 1FKKA 3ALGA 1J4IA 2N87A 4IPXA 3WIJA 4LAWA 4ZPVR 1HXVA 2OFNA 1TCOC 4XAKA 4Z2GA 1FKHA 2IUZA 3AS3A 3RGCA 1LG1A 2IF4A 2DSWA 1D7IA 5D75A 3PA7A 2DG3A 3ARTA 3KAIA 3O5RA 2KR7A 3FXYA 1D6OA 3IK8A 5DF0A 3AS1A 5I98A 4UDMA 3WKZA 1ZK6A 2FAPA 4ZPWR 3PR9A 3ODKA 4L72B 2Y78A 1TFVA 1KFWA 1NMVA 1NWTA 3WQWA 2F23A 1GUVA 4Q22A 3G6MA 1ZB5A 3ARRA 1F8AB 4TW7A 5HW7A 2LJ4A 4IQ2A 4BF8A 3AQUA 2PI6A 4S3KA 3G6LA 2DT3A 1FKIA 4ODOA 4Z2HA 1R9HA 2PBCA 4ODMA 5B8IC 4NNRA 1QZ2A 1QPLA 4ITZA 2M1IA 4WKAA 3CHEA 3H9RB 5HW6A 2RURA 1ROTA 3KAGA 2ZQUA 1YW5A 4TW8A 1A7XA 3ARXA 4W9QA 1J4HA 4DZ3A 1FAPA 5HWBA 1HJVA 1ZU8A 4JYSA 5DEZA 4C02B 2MLYA 2PN0A 5GPRA 4MAVA 1UR8A 4FN2A 4QIBA 2PV3A 2YBTA 1JNEA 1JVWA 1Q6HA 3KACA 3W4RA 1K9TA 4IT6A 4DWSD 4DRPA 1JNDA 3O5LA 3RM4A 3UF8A 2PPNA 1X6NA 5JH8A 1SR0A 1NWRA 4LAYA 2XP8A 3GTYX 1D2KA 2B5UB 4ODPA 1LL4A 3UQBA 2ITKA 1IX5A 3KAHA 1W26A 1SYTA 3RMEA 1W1TA 2KI3A 4ODLA 2PPOA 1BKFA 1B6CA 1LG2A 1W9UA 4P8XA 4WK9A 3KADA 4DRQA 4GIVA 2PV1A 2DT1A 3PRAA 3FY1A 1FKDA 2DG9A 4R5EA 3ARZA 2XPBA 3CGMA 1HJXA 1W1PA 4DWSA 1W1VA 3JXVA 1PBKA 4HARA 1KT1A 2ZQVA 3GU0A 1VF8A 5J6EA 1FKBA 1LL7A 2O9OA 1J4RA 2F2DA 2LGOA 1PINA 4MNKA 1ZCNA 1YATA 1E44A 1C9HA 4MNJA 1E15A 3ARPA 4KR0B 3UI6A 3ARVA 1W9VA 4ODNA 1XRVA 4MNMA 2FKEA 2DT2A 4MGVA 3B9AA 2A3CA 1LJYA 1ITXA 3ARWA 4J4NA 2M08A 4DWSB 2A3AA 3QOKA 3I6CA 1GRJA 5BXJA 1GOIA 2DT0A 4WKFA 1NSGA 1BL4A 2M2AA 2XP7A 4P8VA 1U79A 4J4OA 4LAXA 4ML4A 1FKLA 1E6ZA 4ZS6A 1P5QA 4Z2IA 2L2SA 5DIUA 4S3JA 4DRJA 1X6LA 3O5PA 5GQBA 4W5UA 2VN1A 4W9PA 3AS2A 2QF8A 1W1YA 3NRKA 4PTMA 2KO7A 3O5KA 1E9LA 1M5YA 3TCZA 1HJWA 2YBUA 1E6PA 3NI6A 3BXWA 1HKMA 2XP9A 3GPKA 3O5OA 4AY1A 1ZL1A 2DSUA 2FDMA 1H0GA 4DZ2A 2VCDA 3WD0A 3FAPA 4QZVB 2WM0A 1NH6A 4NZCA 1FD9A 1ZBCA 2WLZA 2ESCA 4Z2JA 5DIVA 3O5JA 4MSPA 5HTGA 3B8SA 3CHDA 3WD1A 2EULA 3WL0A 1HKKA 2RSEA 4P8UA 4WKHA 3VAWA 3TDBA 3O5GA 3B7XA 2F4EA 1ZBVA 3O5QA 1T11A 4ZPTR 2ZQTA 1HKJA 4ODQA 2XP5A 3RM9A 3WH0A 4DROA 4G50A 2LPVA 1OWQA 3O5FA 2AOSA 4ODKA 1NWSA 1Q6UA 1UR9A 1FKSA 2AWGA 4JFJA 1L1PA 4ODRA 4TNSA 5HBFA 4DRIA 2XP4A 4U85A 5GPGA 3KCEA 3OOBA 4LAVA 2JZVA 2RQSA 2LKNA 3JYMA 2A3EA 1J6YA 3CHCA 1NWUA 4NSBA 2DG4A 1FFRA 4W9OA 2ZR6A 2UZ5A 2ZR4A 2Q5AA 3EY6A 4N19A 1HKIA 3LUOA 1EIBA 4QT3A 2PPPA 2XP3A 3UQAA 3O5IA 4JFMA 1JCHB 1FJDA 4QT2A 1KT0A 3UI5A 2RUQA 2MPHA 3WD4A 3ALFA 1ROUA 3B9EA 2KGJA 4U84A 4KQZA 1D7JA 4MPKA 1WNOA 5HT1A 3TC5A 1CTNA
chains in the Genus database with same CATH topology
4TYOA 1RD6A 2WLYA 2D9FA 3KZ7A 3CZ8A 1OGBA 1WB0A 4Z2KA 2WK2A 3AROA 4DRNA 4FAPA 1GPFA 1LL6A 4JFLA 1OGGA 3RFWA 5HW8A 4WJXA 2MLXA 1FKFA 2PV2A 3UI4A 2DSZA 3AS0A 2KFWA 5DO2A 1E6NA 2DSVA 4R0XA 3ARSA 3PRBA 3IHZA 4MNLA 4DWSC 4Z2LA 3KAFA 1JNSA 1EYMA 1EDQA 3ARQA 3O5EA 4O2TA 2XP6A 4DIPA 5HWCA 3UQIA 3ARYA 3WQVA 4TX0A 1Y0OA 4LGXA 3RM8A 1FKRA 2MNTA 1Q1CA 2ZR5A 4TW6A 2RUDA 2B31A 1N1AA 2KE0A 1FKJA 5DITA 4IQCA 4DH0A 3CGNA 2ZQSA 1E6RA 2OLHA 2MF9A 3CHFA 1O6IA 4DRMA 3IKGA 3MDYB 3WD3A 1NMWA 4HBOA 1FKGA 4Q7NA 1ZBWA 4P8WA 3CH9A 2RUCA 4MTVA 1FFQA 1F40A 2G41A 4G2PA 1H0IA 5HUAA 3O5MA 5HKGA 1Q6IA 4URIA 2F21A 3PRDA 4JFKA 2G8ZA 2K8IA 2O92A 3OA5A 4U86A 1JNTA 1WAWA 4GGQA 1QPFA 1FKTA 2DPEA 1EHNA 3B9DA 1LQ0A 3ARUA 4DRHA 3JYJA 2A3BA 1XHGA 4HBEA 2MLZA 4WIWA 4IT4A 3O5DA 3WL1A 2XPAA 3KABA 3IKDA 4DT4A 1EQ3A 1D7HA 4JFIA 4L3NA 4DRKA 3WD2A 1ZBKA 1W9PA 1FKKA 3ALGA 1J4IA 2N87A 4IPXA 3WIJA 4LAWA 4ZPVR 1HXVA 2OFNA 1TCOC 4XAKA 4Z2GA 1FKHA 2IUZA 3AS3A 3RGCA 1LG1A 2IF4A 2DSWA 1D7IA 5D75A 3PA7A 2DG3A 3ARTA 3KAIA 3O5RA 2KR7A 3FXYA 1D6OA 3IK8A 5DF0A 3AS1A 5I98A 3WKZA 1ZK6A 2FAPA 4ZPWR 3PR9A 3ODKA 4L72B 2Y78A 1TFVA 1KFWA 1NMVA 1NWTA 3WQWA 1GUVA 4Q22A 3G6MA 1ZB5A 3ARRA 1F8AB 4TW7A 5HW7A 2LJ4A 4IQ2A 4BF8A 3AQUA 2PI6A 4S3KA 3G6LA 2DT3A 1FKIA 4ODOA 4Z2HA 1R9HA 2PBCA 4ODMA 5B8IC 4NNRA 1QZ2A 1QPLA 4ITZA 2M1IA 4WKAA 3CHEA 3H9RB 5HW6A 2RURA 1ROTA 3KAGA 2ZQUA 1YW5A 4TW8A 1A7XA 3ARXA 4W9QA 1J4HA 4DZ3A 1FAPA 5HWBA 1HJVA 1ZU8A 4JYSA 5DEZA 4C02B 2MLYA 5GPRA 4MAVA 1UR8A 4FN2A 4QIBA 2PV3A 2YBTA 1JNEA 1JVWA 1Q6HA 3KACA 3W4RA 1K9TA 4IT6A 4DWSD 4DRPA 1JNDA 3O5LA 3RM4A 3UF8A 2PPNA 1X6NA 5JH8A 1SR0A 1NWRA 4LAYA 2XP8A 1D2KA 4ODPA 1LL4A 3UQBA 1CTNA 2ITKA 1IX5A 3KAHA 1W26A 1SYTA 3RMEA 1W1TA 2KI3A 4ODLA 2PPOA 1BKFA 1B6CA 1LG2A 1W9UA 4P8XA 4WK9A 3KADA 4DRQA 4GIVA 2PV1A 2DT1A 3PRAA 3FY1A 1FKDA 2DG9A 4R5EA 3ARZA 2XPBA 3CGMA 1HJXA 1W1PA 4DWSA 1W1VA 3JXVA 1PBKA 4HARA 1KT1A 2ZQVA 1VF8A 5J6EA 1FKBA 1LL7A 2O9OA 1J4RA 2F2DA 2LGOA 1PINA 4MNKA 1ZCNA 1YATA 1C9HA 4MNJA 1E15A 3ARPA 4KR0B 3UI6A 3ARVA 1W9VA 4ODNA 1XRVA 4MNMA 2FKEA 2DT2A 4MGVA 3B9AA 2A3CA 1LJYA 1ITXA 3ARWA 4J4NA 2M08A 4DWSB 2A3AA 3QOKA 3I6CA 5BXJA 1GOIA 2DT0A 4WKFA 1NSGA 1BL4A 2M2AA 2XP7A 4P8VA 1U79A 4J4OA 4LAXA 4ML4A 1FKLA 1E6ZA 4ZS6A 1P5QA 4Z2IA 2L2SA 5DIUA 4S3JA 4DRJA 1X6LA 3O5PA 5GQBA 4W5UA 2VN1A 4W9PA 3AS2A 2QF8A 1W1YA 3NRKA 4PTMA 2KO7A 3O5KA 1E9LA 1M5YA 3TCZA 1HJWA 2YBUA 1E6PA 3NI6A 3BXWA 1HKMA 2XP9A 3GPKA 3O5OA 4AY1A 1ZL1A 2DSUA 2FDMA 1H0GA 4DZ2A 2VCDA 3WD0A 3FAPA 4QZVB 2WM0A 1NH6A 4NZCA 1FD9A 1ZBCA 2WLZA 2ESCA 4Z2JA 5DIVA 3O5JA 4MSPA 5HTGA 3B8SA 3CHDA 3WD1A 3WL0A 1HKKA 2RSEA 4P8UA 4WKHA 3VAWA 3TDBA 3O5QA 3B7XA 2F4EA 1ZBVA 3O5GA 1T11A 4ZPTR 2ZQTA 1HKJA 4ODQA 2XP5A 3RM9A 3WH0A 4DROA 4G50A 2LPVA 1OWQA 3O5FA 2AOSA 4ODKA 1NWSA 1Q6UA 1UR9A 1FKSA 2AWGA 4JFJA 1L1PA 4ODRA 4TNSA 5HBFA 4DRIA 2XP4A 4U85A 5GPGA 3KCEA 3OOBA 4LAVA 2JZVA 2RQSA 2LKNA 3JYMA 2A3EA 1J6YA 3CHCA 1NWUA 4NSBA 2DG4A 1FFRA 4W9OA 2ZR6A 2UZ5A 2ZR4A 2Q5AA 3EY6A 4N19A 1HKIA 3LUOA 1EIBA 4QT3A 2PPPA 2XP3A 3UQAA 3O5IA 4JFMA 1FJDA 4QT2A 1KT0A 3UI5A 2RUQA 2MPHA 3WD4A 3ALFA 1ROUA 3B9EA 2KGJA 4U84A 4KQZA 1D7JA 4MPKA 1WNOA 5HT1A 3TC5A 3NTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VCD A;  4ODL A;  2KI3 A;  4TYO A;  2PPO A;  2D9F A;  1FKH A;  3KZ7 A;  1BKF A;  3FAP A;  3RGC A;  1B6C A;  4DZ2 A;  2IF4 A;  1D7I A;  5D75 A;  3PA7 A;  3KAD A;  1FD9 A;  4DRN A;  4FAP A;  2DG3 A;  3KAI A;  4DRQ A;  3O5R A;  4JFL A;  4GIV A;  2PV1 A;  3RFW A;  2KR7 A;  5DIV A;  3O5J A;  4MSP A;  1D6O A;  3IK8 A;  5HW8 A;  1FKD A;  2DG9 A;  2MLX A;  5HTG A;  5I98 A;  1FKF A;  2XPB A;  2PV2 A;  1ZK6 A;  2FAP A;  3CGM A;  3UI4 A;  3ODK A;  2KFW A;  2Y78 A;  3JXV A;  4R0X A;  1NMV A;  1PBK A;  3PRB A;  2RSE A;  1KT1 A;  3IHZ A;  2ZQV A;  3KAF A;  3VAW A;  1JNS A;  1EYM A;  1FKB A;  3TDB A;  5J6E A;  1J4R A;  1F8A B;  3B7X A;  2F4E A;  3O5G A;  2F2D A;  2LGO A;  3O5E A;  1T11 A;  3O5Q A;  4O2T A;  2XP6 A;  4TW7 A;  1HXV A;  1PIN A;  2ZQT A;  4DIP A;  5HW7 A;  3NTP A;  5HWC A;  2LJ4 A;  4IQ2 A;  4BF8 A;  1ZCN A;  4ODQ A;  3UQI A;  1YAT A;  2XP5 A;  4TX0 A;  4DRO A;  1C9H A;  1Y0O A;  4G50 A;  3WH0 A;  1FKI A;  2LPV A;  4ODO A;  1R9H A;  3O5F A;  1FKR A;  4ODK A;  1Q6U A;  3UI6 A;  2MNT A;  1Q1C A;  2PBC A;  2ZR5 A;  4ODN A;  4JFJ A;  1FKS A;  2AWG A;  4ODM A;  2RUD A;  4NNR A;  4TW6 A;  1N1A A;  2KE0 A;  4ODR A;  5B8I C;  1L1P A;  4TNS A;  1FKJ A;  1QZ2 A;  1QPL A;  2FKE A;  4IQC A;  4ITZ A;  2M1I A;  4MGV A;  5DIT A;  4DH0 A;  3CGN A;  4DRI A;  2ZQS A;  3H9R B;  2XP4 A;  2MF9 A;  4U85 A;  5GPG A;  5HW6 A;  2RUR A;  1ROT A;  3KAG A;  2M08 A;  3KCE A;  2ZQU A;  4J4N A;  4DRM A;  3IKG A;  1YW5 A;  4TW8 A;  3OOB A;  3MDY B;  3I6C A;  1A7X A;  4W9Q A;  4LAV A;  1J4H A;  4DZ3 A;  5BXJ A;  1NMW A;  1FAP A;  2JZV A;  1FKG A;  2RQS A;  5HWB A;  2LKN A;  3JYM A;  1J6Y A;  2RUC A;  1NSG A;  1BL4 A;  4JYS A;  2M2A A;  2XP7 A;  2DG4 A;  1F40 A;  1U79 A;  4W9O A;  4J4O A;  4LAX A;  4G2P A;  2ZR6 A;  4C02 B;  5HUA A;  3O5M A;  5HKG A;  1FKL A;  2UZ5 A;  2ZR4 A;  1Q6I A;  1P5Q A;  2MLY A;  2F21 A;  2Q5A A;  3EY6 A;  4N19 A;  3PRD A;  4JFK A;  2K8I A;  2L2S A;  3LUO A;  4FN2 A;  4QIB A;  2PV3 A;  4QT3 A;  5DIU A;  2PPP A;  4DRJ A;  2XP3 A;  1JVW A;  1Q6H A;  1JNT A;  3O5P A;  4U86 A;  3KAC A;  4GGQ A;  1QPF A;  1FKT A;  3UQA A;  4DRP A;  2VN1 A;  3O5I A;  4JFM A;  4W9P A;  1FJD A;  3O5L A;  4DRH A;  3JYJ A;  3UF8 A;  3NRK A;  4QT2 A;  1KT0 A;  2PPN A;  2MLZ A;  3UI5 A;  2KO7 A;  2RUQ A;  3O5K A;  2MPH A;  1M5Y A;  3O5D A;  2XPA A;  1ROU A;  3KAB A;  3IKD A;  4LAY A;  3TCZ A;  4DT4 A;  1EQ3 A;  2KGJ A;  2XP8 A;  3NI6 A;  4U84 A;  2XP9 A;  1D7H A;  4JFI A;  1D7J A;  3GPK A;  4DRK A;  4ODP A;  3O5O A;  1FKK A;  2ITK A;  1J4I A;  5HT1 A;  2N87 A;  3TC5 A;  4IPX A;  3KAH A;  4LAW A;  3UQB A;  1W26 A;  2OFN A;  1TCO C; 
#chains in the Genus database with same CATH topology
 4TYO A;  1RD6 A;  2WLY A;  2D9F A;  3KZ7 A;  3CZ8 A;  1OGB A;  1WB0 A;  4Z2K A;  2WK2 A;  3ARO A;  4DRN A;  4FAP A;  1GPF A;  1LL6 A;  4JFL A;  1OGG A;  3RFW A;  5HW8 A;  4WJX A;  2MLX A;  1FKF A;  2PV2 A;  3UI4 A;  2DSZ A;  3AS0 A;  2KFW A;  5DO2 A;  1E6N A;  2DSV A;  4R0X A;  3ARS A;  3PRB A;  3IHZ A;  4MNL A;  4DWS C;  4Z2L A;  3KAF A;  1JNS A;  1EYM A;  1EDQ A;  3ARQ A;  3O5E A;  2ETN A;  4O2T A;  2XP6 A;  4DIP A;  3NTP A;  5HWC A;  3UQI A;  3ARY A;  3WQV A;  4TX0 A;  1Y0O A;  4LGX A;  3RM8 A;  1FKR A;  2MNT A;  1Q1C A;  2ZR5 A;  4TW6 A;  2RUD A;  2B31 A;  1N1A A;  2KE0 A;  1FKJ A;  5DIT A;  4IQC A;  4DH0 A;  3EIP A;  3CGN A;  2ZQS A;  1E6R A;  2OLH A;  2MF9 A;  3CHF A;  1O6I A;  4DRM A;  3IKG A;  3MDY B;  2P4V A;  3WD3 A;  1NMW A;  4HBO A;  1FKG A;  3BMB A;  1ZBW A;  4Q7N A;  4P8W A;  3CH9 A;  2RUC A;  4MTV A;  1FFQ A;  1F40 A;  2G41 A;  4G2P A;  1H0I A;  5HUA A;  3O5M A;  5HKG A;  1Q6I A;  4URI A;  2F21 A;  3PRD A;  4JFK A;  2G8Z A;  2K8I A;  2O92 A;  3OA5 A;  4U86 A;  1JNT A;  1WAW A;  4GGQ A;  1QPF A;  1FKT A;  2DPE A;  1EHN A;  3B9D A;  1LQ0 A;  3ARU A;  4DRH A;  3JYJ A;  2A3B A;  1XHG A;  4HBE A;  2MLZ A;  4WIW A;  4IT4 A;  3O5D A;  3WL1 A;  2XPA A;  3KAB A;  3IKD A;  4DT4 A;  1EQ3 A;  1D7H A;  4JFI A;  4L3N A;  4DRK A;  3WD2 A;  1ZBK A;  1W9P A;  1FKK A;  3ALG A;  1J4I A;  2N87 A;  4IPX A;  3WIJ A;  4LAW A;  4ZPV R;  1HXV A;  2OFN A;  1TCO C;  4XAK A;  4Z2G A;  1FKH A;  2IUZ A;  3AS3 A;  3RGC A;  1LG1 A;  2IF4 A;  2DSW A;  1D7I A;  5D75 A;  3PA7 A;  2DG3 A;  3ART A;  3KAI A;  3O5R A;  2KR7 A;  3FXY A;  1D6O A;  3IK8 A;  5DF0 A;  3AS1 A;  5I98 A;  4UDM A;  3WKZ A;  1ZK6 A;  2FAP A;  4ZPW R;  3PR9 A;  3ODK A;  4L72 B;  2Y78 A;  1TFV A;  1KFW A;  1NMV A;  1NWT A;  3WQW A;  2F23 A;  1GUV A;  4Q22 A;  3G6M A;  1ZB5 A;  3ARR A;  1F8A B;  4TW7 A;  5HW7 A;  2LJ4 A;  4IQ2 A;  4BF8 A;  3AQU A;  2PI6 A;  4S3K A;  3G6L A;  2DT3 A;  1FKI A;  4ODO A;  4Z2H A;  1R9H A;  2PBC A;  4ODM A;  5B8I C;  4NNR A;  1QZ2 A;  1QPL A;  4ITZ A;  2M1I A;  4WKA A;  3CHE A;  3H9R B;  5HW6 A;  2RUR A;  1ROT A;  3KAG A;  2ZQU A;  1YW5 A;  4TW8 A;  1A7X A;  3ARX A;  4W9Q A;  1J4H A;  4DZ3 A;  1FAP A;  5HWB A;  1HJV A;  1ZU8 A;  4JYS A;  5DEZ A;  4C02 B;  2MLY A;  2PN0 A;  5GPR A;  4MAV A;  1UR8 A;  4FN2 A;  4QIB A;  2PV3 A;  2YBT A;  1JNE A;  1JVW A;  1Q6H A;  3KAC A;  3W4R A;  1K9T A;  4IT6 A;  4DWS D;  4DRP A;  1JND A;  3O5L A;  3RM4 A;  3UF8 A;  2PPN A;  1X6N A;  5JH8 A;  1SR0 A;  1NWR A;  4LAY A;  2XP8 A;  3GTY X;  1D2K A;  2B5U B;  4ODP A;  1LL4 A;  3UQB A;  2ITK A;  1IX5 A;  3KAH A;  1W26 A;  1SYT A;  3RME A;  1W1T A;  2KI3 A;  4ODL A;  2PPO A;  1BKF A;  1B6C A;  1LG2 A;  1W9U A;  4P8X A;  4WK9 A;  3KAD A;  4DRQ A;  4GIV A;  2PV1 A;  2DT1 A;  3PRA A;  3FY1 A;  1FKD A;  2DG9 A;  4R5E A;  3ARZ A;  2XPB A;  3CGM A;  1HJX A;  1W1P A;  4DWS A;  1W1V A;  3JXV A;  1PBK A;  4HAR A;  1KT1 A;  2ZQV A;  3GU0 A;  1VF8 A;  5J6E A;  1FKB A;  1LL7 A;  2O9O A;  1J4R A;  2F2D A;  2LGO A;  1PIN A;  4MNK A;  1ZCN A;  1YAT A;  1E44 A;  1C9H A;  4MNJ A;  1E15 A;  3ARP A;  4KR0 B;  3UI6 A;  3ARV A;  1W9V A;  4ODN A;  1XRV A;  4MNM A;  2FKE A;  2DT2 A;  4MGV A;  3B9A A;  2A3C A;  1LJY A;  1ITX A;  3ARW A;  4J4N A;  2M08 A;  4DWS B;  2A3A A;  3QOK A;  3I6C A;  1GRJ A;  5BXJ A;  1GOI A;  2DT0 A;  4WKF A;  1NSG A;  1BL4 A;  2M2A A;  2XP7 A;  4P8V A;  1U79 A;  4J4O A;  4LAX A;  4ML4 A;  1FKL A;  1E6Z A;  4ZS6 A;  1P5Q A;  4Z2I A;  2L2S A;  5DIU A;  4S3J A;  4DRJ A;  1X6L A;  3O5P A;  5GQB A;  4W5U A;  2VN1 A;  4W9P A;  3AS2 A;  2QF8 A;  1W1Y A;  3NRK A;  4PTM A;  2KO7 A;  3O5K A;  1E9L A;  1M5Y A;  3TCZ A;  1HJW A;  2YBU A;  1E6P A;  3NI6 A;  3BXW A;  1HKM A;  2XP9 A;  3GPK A;  3O5O A;  4AY1 A;  1ZL1 A;  2DSU A;  2FDM A;  1H0G A;  4DZ2 A;  2VCD A;  3WD0 A;  3FAP A;  4QZV B;  2WM0 A;  1NH6 A;  4NZC A;  1FD9 A;  1ZBC A;  2WLZ A;  2ESC A;  4Z2J A;  5DIV A;  3O5J A;  4MSP A;  5HTG A;  3B8S A;  3CHD A;  3WD1 A;  2EUL A;  3WL0 A;  1HKK A;  2RSE A;  4P8U A;  4WKH A;  3VAW A;  3TDB A;  3O5G A;  3B7X A;  2F4E A;  1ZBV A;  3O5Q A;  1T11 A;  4ZPT R;  2ZQT A;  1HKJ A;  4ODQ A;  2XP5 A;  3RM9 A;  3WH0 A;  4DRO A;  4G50 A;  2LPV A;  1OWQ A;  3O5F A;  2AOS A;  4ODK A;  1NWS A;  1Q6U A;  1UR9 A;  1FKS A;  2AWG A;  4JFJ A;  1L1P A;  4ODR A;  4TNS A;  5HBF A;  4DRI A;  2XP4 A;  4U85 A;  5GPG A;  3KCE A;  3OOB A;  4LAV A;  2JZV A;  2RQS A;  2LKN A;  3JYM A;  2A3E A;  1J6Y A;  3CHC A;  1NWU A;  4NSB A;  2DG4 A;  1FFR A;  4W9O A;  2ZR6 A;  2UZ5 A;  2ZR4 A;  2Q5A A;  3EY6 A;  4N19 A;  1HKI A;  3LUO A;  1EIB A;  4QT3 A;  2PPP A;  2XP3 A;  3UQA A;  3O5I A;  4JFM A;  1JCH B;  1FJD A;  4QT2 A;  1KT0 A;  3UI5 A;  2RUQ A;  2MPH A;  3WD4 A;  3ALF A;  1ROU A;  3B9E A;  2KGJ A;  4U84 A;  4KQZ A;  1D7J A;  4MPK A;  1WNO A;  5HT1 A;  3TC5 A;  1CTN A; 
#chains in the Genus database with same CATH homology
 4TYO A;  1RD6 A;  2WLY A;  2D9F A;  3KZ7 A;  3CZ8 A;  1OGB A;  1WB0 A;  4Z2K A;  2WK2 A;  3ARO A;  4DRN A;  4FAP A;  1GPF A;  1LL6 A;  4JFL A;  1OGG A;  3RFW A;  5HW8 A;  4WJX A;  2MLX A;  1FKF A;  2PV2 A;  3UI4 A;  2DSZ A;  3AS0 A;  2KFW A;  5DO2 A;  1E6N A;  2DSV A;  4R0X A;  3ARS A;  3PRB A;  3IHZ A;  4MNL A;  4DWS C;  4Z2L A;  3KAF A;  1JNS A;  1EYM A;  1EDQ A;  3ARQ A;  3O5E A;  4O2T A;  2XP6 A;  4DIP A;  5HWC A;  3UQI A;  3ARY A;  3WQV A;  4TX0 A;  1Y0O A;  4LGX A;  3RM8 A;  1FKR A;  2MNT A;  1Q1C A;  2ZR5 A;  4TW6 A;  2RUD A;  2B31 A;  1N1A A;  2KE0 A;  1FKJ A;  5DIT A;  4IQC A;  4DH0 A;  3CGN A;  2ZQS A;  1E6R A;  2OLH A;  2MF9 A;  3CHF A;  1O6I A;  4DRM A;  3IKG A;  3MDY B;  3WD3 A;  1NMW A;  4HBO A;  1FKG A;  4Q7N A;  1ZBW A;  4P8W A;  3CH9 A;  2RUC A;  4MTV A;  1FFQ A;  1F40 A;  2G41 A;  4G2P A;  1H0I A;  5HUA A;  3O5M A;  5HKG A;  1Q6I A;  4URI A;  2F21 A;  3PRD A;  4JFK A;  2G8Z A;  2K8I A;  2O92 A;  3OA5 A;  4U86 A;  1JNT A;  1WAW A;  4GGQ A;  1QPF A;  1FKT A;  2DPE A;  1EHN A;  3B9D A;  1LQ0 A;  3ARU A;  4DRH A;  3JYJ A;  2A3B A;  1XHG A;  4HBE A;  2MLZ A;  4WIW A;  4IT4 A;  3O5D A;  3WL1 A;  2XPA A;  3KAB A;  3IKD A;  4DT4 A;  1EQ3 A;  1D7H A;  4JFI A;  4L3N A;  4DRK A;  3WD2 A;  1ZBK A;  1W9P A;  1FKK A;  3ALG A;  1J4I A;  2N87 A;  4IPX A;  3WIJ A;  4LAW A;  4ZPV R;  1HXV A;  2OFN A;  1TCO C;  4XAK A;  4Z2G A;  1FKH A;  2IUZ A;  3AS3 A;  3RGC A;  1LG1 A;  2IF4 A;  2DSW A;  1D7I A;  5D75 A;  3PA7 A;  2DG3 A;  3ART A;  3KAI A;  3O5R A;  2KR7 A;  3FXY A;  1D6O A;  3IK8 A;  5DF0 A;  3AS1 A;  5I98 A;  3WKZ A;  1ZK6 A;  2FAP A;  4ZPW R;  3PR9 A;  3ODK A;  4L72 B;  2Y78 A;  1TFV A;  1KFW A;  1NMV A;  1NWT A;  3WQW A;  1GUV A;  4Q22 A;  3G6M A;  1ZB5 A;  3ARR A;  1F8A B;  4TW7 A;  5HW7 A;  2LJ4 A;  4IQ2 A;  4BF8 A;  3AQU A;  2PI6 A;  4S3K A;  3G6L A;  2DT3 A;  1FKI A;  4ODO A;  4Z2H A;  1R9H A;  2PBC A;  4ODM A;  5B8I C;  4NNR A;  1QZ2 A;  1QPL A;  4ITZ A;  2M1I A;  4WKA A;  3CHE A;  3H9R B;  5HW6 A;  2RUR A;  1ROT A;  3KAG A;  2ZQU A;  1YW5 A;  4TW8 A;  1A7X A;  3ARX A;  4W9Q A;  1J4H A;  4DZ3 A;  1FAP A;  5HWB A;  1HJV A;  1ZU8 A;  4JYS A;  5DEZ A;  4C02 B;  2MLY A;  5GPR A;  4MAV A;  1UR8 A;  4FN2 A;  4QIB A;  2PV3 A;  2YBT A;  1JNE A;  1JVW A;  1Q6H A;  3KAC A;  3W4R A;  1K9T A;  4IT6 A;  4DWS D;  4DRP A;  1JND A;  3O5L A;  3RM4 A;  3UF8 A;  2PPN A;  1X6N A;  5JH8 A;  1SR0 A;  1NWR A;  4LAY A;  2XP8 A;  1D2K A;  4ODP A;  1LL4 A;  3UQB A;  1CTN A;  2ITK A;  1IX5 A;  3KAH A;  1W26 A;  1SYT A;  3RME A;  1W1T A;  2KI3 A;  4ODL A;  2PPO A;  1BKF A;  1B6C A;  1LG2 A;  1W9U A;  4P8X A;  4WK9 A;  3KAD A;  4DRQ A;  4GIV A;  2PV1 A;  2DT1 A;  3PRA A;  3FY1 A;  1FKD A;  2DG9 A;  4R5E A;  3ARZ A;  2XPB A;  3CGM A;  1HJX A;  1W1P A;  4DWS A;  1W1V A;  3JXV A;  1PBK A;  4HAR A;  1KT1 A;  2ZQV A;  1VF8 A;  5J6E A;  1FKB A;  1LL7 A;  2O9O A;  1J4R A;  2F2D A;  2LGO A;  1PIN A;  4MNK A;  1ZCN A;  1YAT A;  1C9H A;  4MNJ A;  1E15 A;  3ARP A;  4KR0 B;  3UI6 A;  3ARV A;  1W9V A;  4ODN A;  1XRV A;  4MNM A;  2FKE A;  2DT2 A;  4MGV A;  3B9A A;  2A3C A;  1LJY A;  1ITX A;  3ARW A;  4J4N A;  2M08 A;  4DWS B;  2A3A A;  3QOK A;  3I6C A;  5BXJ A;  1GOI A;  2DT0 A;  4WKF A;  1NSG A;  1BL4 A;  2M2A A;  2XP7 A;  4P8V A;  1U79 A;  4J4O A;  4LAX A;  4ML4 A;  1FKL A;  1E6Z A;  4ZS6 A;  1P5Q A;  4Z2I A;  2L2S A;  5DIU A;  4S3J A;  4DRJ A;  1X6L A;  3O5P A;  5GQB A;  4W5U A;  2VN1 A;  4W9P A;  3AS2 A;  2QF8 A;  1W1Y A;  3NRK A;  4PTM A;  2KO7 A;  3O5K A;  1E9L A;  1M5Y A;  3TCZ A;  1HJW A;  2YBU A;  1E6P A;  3NI6 A;  3BXW A;  1HKM A;  2XP9 A;  3GPK A;  3O5O A;  4AY1 A;  1ZL1 A;  2DSU A;  2FDM A;  1H0G A;  4DZ2 A;  2VCD A;  3WD0 A;  3FAP A;  4QZV B;  2WM0 A;  1NH6 A;  4NZC A;  1FD9 A;  1ZBC A;  2WLZ A;  2ESC A;  4Z2J A;  5DIV A;  3O5J A;  4MSP A;  5HTG A;  3B8S A;  3CHD A;  3WD1 A;  3WL0 A;  1HKK A;  2RSE A;  4P8U A;  4WKH A;  3VAW A;  3TDB A;  3O5Q A;  3B7X A;  2F4E A;  1ZBV A;  3O5G A;  1T11 A;  4ZPT R;  2ZQT A;  1HKJ A;  4ODQ A;  2XP5 A;  3RM9 A;  3WH0 A;  4DRO A;  4G50 A;  2LPV A;  1OWQ A;  3O5F A;  2AOS A;  4ODK A;  1NWS A;  1Q6U A;  1UR9 A;  1FKS A;  2AWG A;  4JFJ A;  1L1P A;  4ODR A;  4TNS A;  5HBF A;  4DRI A;  2XP4 A;  4U85 A;  5GPG A;  3KCE A;  3OOB A;  4LAV A;  2JZV A;  2RQS A;  2LKN A;  3JYM A;  2A3E A;  1J6Y A;  3CHC A;  1NWU A;  4NSB A;  2DG4 A;  1FFR A;  4W9O A;  2ZR6 A;  2UZ5 A;  2ZR4 A;  2Q5A A;  3EY6 A;  4N19 A;  1HKI A;  3LUO A;  1EIB A;  4QT3 A;  2PPP A;  2XP3 A;  3UQA A;  3O5I A;  4JFM A;  1FJD A;  4QT2 A;  1KT0 A;  3UI5 A;  2RUQ A;  2MPH A;  3WD4 A;  3ALF A;  1ROU A;  3B9E A;  2KGJ A;  4U84 A;  4KQZ A;  1D7J A;  4MPK A;  1WNO A;  5HT1 A;  3TC5 A;  3NTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...