2O9OA

Crystal structure of the buffalo secretory signalling glycoprotein at 2.8 a resolution
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
361
structure length
361
Chain Sequence
b'YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3-like protein 1
publication title Structure of the buffalo secretory signalling glycoprotein at 2.8 A resolution
pubmed doi rcsb
molecule tags Signaling protein
total genus 124
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2006-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2o9oA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2o9oA01
1JNEA 1HVQA 4B3LA 5CPSA 1EO7A 1UKPA 3MU7A 1E0VA 4UFKA 3CGTA 3M6DA 1LG2A 4DWSC 2GFTA 1SYTA 1CZ1A 1H2JA 2WVVB 5CJ5A 2WHKA 1J9YA 4ML4A 1Q6GA 5C70A 2DH3A 5A95A 1E3XA 2EXOA 1UR2A 2J62A 1W1PA 1BVZA 1CXIA 2EQDA 3W29A 3VU2A 2CYGA 4AY1A 3PTMA 3AZSA 3EMQA 1OWQA 1QNQA 1NWSA 2D3LA 5GNYA 4ATDA 2FGZA 3W81A 4P8UA 3N9KA 4QLJA 4V28A 2FDMA 1UQZA 3VMOA 5JIWA 3VD5A 4AZ5A 2DPEA 1M53A 2G3NA 1HJSA 2VO5A 1TE1A 3SCTA 2QF8A 1HKIA 5D8ZA 3DYMA 3ARQA 3AHVA 2WMHA 1VRXA 2XVKA 4X0VA 6A3HA 4KGLA 2OYMA 2ZX9A 1UH3A 2VOTA 3VOCA 1KXQA 1WKYA 3L4VA 3W24A 1QOXA 3BAIA 3WKZA 1I1XA 4ZEPA 2Y4SA 1V3LA 3WNLA 4ZXLA 2ZX5A 5D8WA 2ZE0A 3VD7A 5C8BB 1V08A 2VVSA 4JL2A 4XB3A 4CD4A 2X09A 1E6PA 1NARA 3W6LA 1JAEA 2YL5A 3TA9A 2XGBA 1ZBCA 3IANA 2YLLA 1C3FA 3AOFA 5KZ6A 2O9OA 3O9NA 4TX8A 4DM1A 5CSUA 4UTFA 1W32A 3DYOA 2BVDA 1JZ4A 1JYVA 2GK1A 1H1NA 4D1JA 5A8OA 5FOOA 1GJWA 2WBKA 3UR8A 4AXNA 3ARZA 2RGLA 1GNXA 1DWGM 1DEDA 3WH9A 3CBWA 2G3IA 3IJ7A 1US2A 2VT0A 4ATLA 2E40A 4HOZA 2WVSA 4QCEA 1OINA 2E4TA 7A3HA 4Z2LA 3WBEA 2VL4A 2VNCA 2JE8A 2UWFA 3ZOAA 2GVYA 4S3JA 1D2KA 2Y8VA 3VO0A 5LYRA 4HU0A 1FFRA 2VRKA 4FLSA 3AXXA 3SCPA 4MAZA 1ZB5A 1DP0A 3VPLA 4WKAA 2BXZA 3OLEA 3PZOA 3RM9A 2IXVA 3WUGA 1HJWA 1CIUA 2J7GA 4JFVA 4J3SA 4UFJA 1NWRA 1VB9A 2X1IA 2DT1A 2JFEX 1FHLA 3LMYA 3IJ8A 3VDHA 4E8CA 1W3HA 5HNNA 3WMCA 5E9AA 3VM7A 2BHUA 1XSKA 5BRPA 2WCAA 2FH6A 4IUGA 5A69A 4JHOA 1B9ZA 3WNNA 2WHLA 3F5KA 1CXHA 4AIEA 1JF5A 3BC9A 5JIPA 1KGUA 1XH0A 5DT7A 2YKKA 2W91A 1W2VA 3UESA 1CGTA 3K4AA 3WUFA 1KFWA 4F9DA 2YIHA 4B9ZA 3T2PA 4IPLA 3VILA 3ALGA 3L4XA 3QOMA 4WKHA 4QLKA 5KEZA 1HX0A 1YHTA 1TA3B 2ZUVA 3OGRA 3A4XA 2IUZA 1UH2A 2WZHA 4AZ6A 1XH1A 4ZXOA 2JF7A 1FA2A 3CZEA 5AY7A 3GXMA 1JYXA 3VIIA 1QI3A 4AIOA 4MJ2A 3MUY1 1MWOA 1W9VA 4BQ2A 3QOKA 2TAAA 1SR0A 1QNPA 1OT1A 1UYQA 3L2MA 4D6EA 1EHAA 4MB5A 4WF7A 2D1ZA 5D4YA 1JZ8A 1QHOA 4ZENA 1ODZA 5BXPA 1ZU8A 4DUXA 2PWDA 1B2YA 2EJ1A 4LQ1A 4H8VA 2VTFA 1OBAA 2RGMA 4U3CA 2EPKX 2PWFA 3UG3A 1V6UA 1JFHA 3TTSA 1QNRA 2O92A 1GPFA 5EB8A 2XHYA 3WH8A 4GINA 3CTTA 1UKQA 4EKJA 1BYCA 5A6JA 3U5UA 2WWDA 4WSJA 2CPUA 2XFRA 3M7SA 2O9PA 4HMEA 3BLKA 1NWTA 3GXDA 5IHRA 1GW1A 1H5VA 1E70M 1E6ZA 1LF1A 4NZCA 2UY2A 1MW3A 1UWRA 2FHCA 3VX0A 3CMJA 3AHXA 4LXFA 4AISA 1W1TA 1VENA 3AROA 1W3JA 1E1FA 1KBKA 3WQWA 2EBNA 1ZL1A 4GZJA 1H4PA 3AIQA 4X9YA 1GHRA 4JIEA 1OCQA 1NOUA 4UFLA 1C8QA 5BWFA 5ABEA 3DECA 1E71M 3W6MA 2EPLX 3A6OA 4W7VA 3WD2A 2BY3A 3W4RA 3SEPA 3L4UA 5D9MA 4AMCA 5ABHA 5CLWA 1PJ9A 3UG4A 2VC9A 3VD3A 4H7VA 3SCSA 2V3EA 1DWHM 2EPMX 1GJUA 3WN6A 4KWUA 1X6LA 3ALFA 4K68A 3LPGA 3KZSA 3AMKA 3W0KA 4U5IA 3GH7A 4J3TA 5IXEA 1BF2A 3B9EA 5M17A 1ZBVA 1TUXA 1JI2A 2J77A 5JUVA 1E56A 1E6XM 1V3HA 5IFTA 2WMGA 1UD4A 3ZJ8A 2A3EA 2Y8KA 4PBGA 3K8MA 3FN9A 2V3GA 3VNYA 2WSPA 3AHZA 4Z2HA 4YN5A 3KL3A 5JH8A 5BRQA 2BY1A 1VBRA 5D9NA 1UWTA 3THDA 4S3KA 3BAWA 3HJEA 3ARRA 3VMNA 1OGGA 1GOMA 1UR1A 4LYRA 3CHEA 4UOJA 3OLDA 1X1NA 3EDEA 2GDUA 4HA1A 2G41A 3AHYA 1I75A 2OYLA 2PB1A 3APGA 1F4HA 1W1YA 1BG9A 4ZFMA 2DH2A 3AMDA 4MAVA 3N15A 1QW8A 1PPIA 3WD0A 1BQCA 1MXGA 2D0FA 3FAWA 3JUGA 4UCFA 3PBGA 5E0CA 1EA9C 5FL1A 3UCQA 5ABFB 2B31A 1L0PA 1QVBA 4CN1A 4IPNB 4XZBA 4OBSA 3BAJA 1CGXA 2O9TA 4OZOA 1K6AA 2OWXA 5A6MA 2ZX6A 1PAMA 4UQDA 3B8SA 2QMKA 4GQQA 3VGGA 2VURA 5LA0A 2E3ZA 1GVYA 2WNWA 3ZT6A 1PBGA 2WMFA 3WH6A 4DM2A 3AIRA 4EANA 1EQPA 3I3DA 1OM0A 3N18A 3PZVA 4MNKA 1M7XA 1V6VA 2WB5A 1OT2A 3A47A 3VIGA 4C7GA 4AWEA 2X0YA 3M46A 1E0XA 3L4TA 5BXRA 3WDJA 3CUJA 2CERA 1JGIA 2XYLA 4D6CA 2YL9A 2YLAA 3CUHA 1X6NA 1C7TA 2F8QA 4FLOA 3MUAA 2WK2A 1OSEA 1HNYA 2OWCA 3WQ6A 3EYPA 4P7OA 5BROA 1ZS2A 3W28A 2W61A 3POCA 5BYWA 1BSIA 4UFMA 3WQVA 2VVNA 4QP0A 3WNKA 4BCEA 4W5ZA 1W9XA 4QDMA 3AIBA 3BH4A 1E6NA 1ISVA 2J8FA 3U7VA 2BY2A 3W26A 4Q7NA 5M3WA 1MQQA 4WLCA 1W9BM 2DGAA 2J78A 4FLRA 4UOQA 1B3VA 2FH8A 3WQ8A 3HMCA 1WZMA 1QHPA 1E40A 3T0BA 1QPKA 4N42A 4URIA 3SCNA 4KGJA 1QBBA 3WFLA 4TUFA 2EEXA 5CSYA 1DWJM 4HPHA 3MSGA 2NT1A 1OGSA 4UZSA 1R8LA 3AMCA 4IM4A 3WIJA 1XYFA 3PZGA 4GIAA 3VIPA 2VX5A 1FFQA 1UR0A 3CHFA 3AIUA 4PRWA 5EFFA 3PZQA 1VFMA 3OLGA 2XUCA 2CKSA 4GZEA 1IZKA 3UERA 3AS1A 4C7DA 3PZNA 3OA5A 5M5DA 3K4DA 4CVUA 1K9EA 5EBAA 4A4AA 2CNCA 1W91A 2WC7A 5A2CA 4AD2A 5CGMA 1G01A 2QLYA 5A2AA 2Z1SA 3QHOA 1G5AA 1VJZA 2ZOXA 2GJXA 2AAAA 3GTNA 1UD2A 5CLTA 1Q6DA 4Z2JA 2NW0A 4AC1X 1TG7A 5A8NA 5HPOA 3VINA 4AZHA 1QNSA 3W82A 1GORA 3WEMA 5JBEA 2XSBA 1KBBA 3IJ9A 4MJ4A 3SCUA 3WL0A 1MFVA 3AQUA 1V6WA 5E6ZA 3ZM8A 5M03A 4UQEA 2J4GA 2W62A 3AJ7A 3AS2A 4GI8A 3ZT5A 3FY1A 1UD5A 1QI5A 4AZIA 1H41A 1BVNP 3TONA 1EHNA 3CLWA 3GH4A 1CXKA 5CPTA 4EAMA 3VIFA 5GQBA 1P6WA 1JDDA 1VAHA 4BQ3A 1J12A 5I24A 1BTCA 2FGLA 4B15A 3BMWA 4MB4A 2VCCA 1JDCA 4W8LA 3AIWA 1SMAA 2VZUA 2VZSA 4U2ZA 1GQLA 2J7EA 3CZGA 2ZX7A 2Y5EA 1LG1A 2XFYA 4DUWA 4EE9A 5I5RA 2VI0A 2BHYA 3L4WA 3ZMRA 2DT2A 3W53A 4W87A 4TVDA 5BCAA 2NT0A 2OSXA 5AC5A 2ZUMA 4AZCB 3DHPA 1W2PA 4CCCA 3ARTA 4JCMA 4KRUA 4AD0A 4CD6A 1E4LA 1EQCA 3MSDA 4TTGA 4QAWA 5A2BA 5I77A 2QPSA 1CWYA 3I3EA 1PIFA 3VNZA 2X05A 5I79A 1PEZA 1JD9A 2GSJA 2WWCA 3PZMA 5D9OA 4CN6A 2J7CA 3BCDA 4L4OA 2VQTA 1S46A 5AYBA 3ZJ6A 4CN4A 4QCFA 1CGYA 4DWSA 1LWHA 2XTKA 1A47A 4M29A 4MB3A 5A6BA 1B3WA 3BSHA 4FK9A 1RP9A 3ARWA 2WBGA 4P7QA 5HXMA 3U57A 3UR7A 4OBRA 4D6DA 1HJXA 2Y2WA 4PMDA 3N17A 4UQ9A 3ZIZA 4J27A 1LQ0A 4M81A 2HISA 2W5FA 1FP8A 1JXKA 2A3AA 5DT5A 2CETA 4FLQA 1MW0A 3BAXA 5FD0A 2JEPA 4RE3A 1V02E 3MO4A 3EDDA 4DUVA 4GI9A 4D71A 3VIMA 1NP2A 1EH9A 3RIKA 1CECA 2BS9A 1OD0A 5F7UA 2XVPA 4E8DA 1IZJA 2J8GA 3N11A 1WP6A 1JDAA 3ZQ9A 1F4AA 3BCFA 4W93A 4MNMA 1EDGA 4XV0A 2G4FA 4PMXA 4M82A 1JYWA 1V3KA 3QHNA 4H2CA 1PX8A 4UFIA 5DF0A 1R7AA 6TAAA 3WH5A 3NSMA 3SCRA 2JIWA 2VJXA 2ZXAA 4NRRA 4W89A 3T0DA 3SUTA 1HJUA 4YHGA 5GPRA 4GXPA 1DWAM 1L8NA 1VFUA 1UOKA 1KXVA 1FH7A 1ZBWA 1U30A 3O6AA 2ZUTA 4AZGA 1EGZA 5CZKA 1KWGA 2XWDA 3ZO9A 1UA7A 1XGZA 1XC6A 4RE4A 4TVUA 4B9YA 1VIWA 1KQZA 5A1AA 2WLYA 4WKFA 1CYGA 2DIJA 1H49A 5CGTA 3BXWA 1HL8A 1HJVA 1Q6CA 3QHMA 1VBUA 2ZICA 2CHOA 2XIIA 3OGSA 5DO8A 3WF0A 4PCSA 4HA4A 1XRVA 5LA2A 3CMGA 3SUUA 3BLPX 4GPNA 3WUBA 4W7WA 3L4ZA 1UG6A 1PX4A 3FHQA 4HOWA 4TXEA 3S2CA 3ARUA 2V3FA 3VM5A 2WHJA 1W3LA 3VUPA 3GDBA 1V3IA 5FL0A 1CXEA 2XM1A 4E2OA 2E8ZA 2WPGA 3PHAA 1XCWA 1VFOA 3PZIA 3WY1A 3T08A 1W9UA 2D24A 4UZUA 2DEPA 1E4NA 4D72A 3GNRA 3VIOA 4C7FA 3WDPP 4NRSA 4DWSD 2XIBA 3LPFA 5A6BD 1RH9A 1C8YA 1Q6EA 4UQAA 2ZUNA 4AEEA 1SFSA 1C93A 2WVUA 5D9PA 1TFVA 4B3KA 1J0JA 2XVNA 5AYIA 3K8LA 1GUVA 3RPMA 4W8AA 4HOXA 4D6JA 2CITA 3NYDA 1RP8A 1N82A 2PWEA 4H41A 1B3YA 3AMGA 1TR1A 2WC4A 2V5CA 3NDZA 1LLOA 1WDSA 1CGVA 1U33A 3GBEA 2UY5A 1K9DA 1LL6A 1BYBA 2VX7A 3DYPA 2GJXB 2YDRA 2WMKA 1ISWA 1DTUA 2WCSA 4JFSA 4LYPA 2ZXDA 3N13A 1BYDA 2AOSA 3G6LA 2ZUSA 4P7RA 1R7OA 3D5HA 3CZLA 1UD6A 3N12A 1E4MM 1Q4NX 1WCGA 4Z2KA 3ZJ7A 1OGBA 1QNOA 3A4WA 2WC3A 1GQKA 2DSKA 1V3MA 1J01A 2C8NA 1GQJA 2DQXA 2WKGA 2BFGA 3AI0A 1HIZA 5EMYA 2VX6A 2DIEA 3WBAA 4D6IA 1GQIA 3VIJA 1QBAA 3FHAA 3D3AA 1UZ4A 3WMSA 1UZ1A 3GM8A 4PSPA 1GONA 1MXDA 3FW6A 1KQYA 4D6GA 2D2OA 2X8RA 3L4YA 5A94A 5FCZA 3VGDA 2D22A 1KR0A 2A3HA 2J74A 2W67A 3MV11 2J79A 2WZEA 4QLLA 2CBIA 1B31A 1I1WA 4W5UA 3PTQA 2YDQA 4F66A 5A8MA 4X0NA 1GCYA 4PYSA 3ZSTA 5GNZA 1NH6A 1UD3A 1MFUA 2OYKA 3VGHA 1MYRA 1TZ7A 1WAWA 2BVTA 1UHVA 1V0NA 3NSNA 4M80A 3FNDA 4Y7EA 3W37A 3SUVA 2YBTA 4J28A 4GKLA 1UR8A 2GK1B 4HZ7A 2WANA 1CGUA 3RJYA 1A3HA 1E72M 4ZE5A 4R5EA 1JZ5A 4HZ6A 4MDOA 4PUDA 4CU7A 5CG0A 3FXYA 3VD9A 2PWGA 1B3ZA 5A8QA 4MNLA 3VIHA 2D0GA 3U5YA 3VD4A 2A3BA 1E6SM 2OWWA 2XFFA 2CESA 1HKJA 1BGGA 3OGVA 1LL4A 2PBGA 1V6YA 1CPUA 3AISA 1GOOA 3WNOA 1AMYA 1M03A 2XPKA 4AW7A 5I3DA 4EK7A 3WF1A 2XVLA 3RMEA 2EPNA 1JZ3A 1XSJA 3AZTA 3WUEA 4PTMA 1OIMA 1TMQA 1DHKA 4FF5A 3CPUA 4OOUA 4IISA 5A3HA 1TA3A 1EIBA 5ABGA 3MKKA 3ECQA 2ZWZA 4OJYA 1AQHA 1EXPA 3RDKA 3T09A 1AQ0A 4AD3A 2G8ZA 3WEOA 4J3WA 3AS3A 2X2YA 1JXJA 4BS0A 1GOIA 2DSZA 3L2LA 4AD1A 2D23A 4RL3A 1CDGA 5E6YA 1VFFA 3RM4A 4Q22A 1ODUA 2W63A 4WJXA 5BXTA 2CKRA 2WM0A 4U3AA 4M8UA 3GXIA 3WF3A 1JIBA 1HVXA 1OD8A 1ESWA 5AC4A 3ZR6A 3GZAA 4D6HA 3CZ8A 3PN8A 5C71A 1E55A 2JALA 3MS8A 4PMOA 3OLIA 1XCXA 3SCWA 1KXHA 3BAYA 3WDIA 4W8BA 1ITCA 2WCGA 4J7RA 3MUZ1 4UOZA 4F8XA 4PMUA 3DHUA 4MADA 1C92A 1BHGA 1C8XA 3WENA 4GO8A 3BMVA 1GHSA 1JZ6A 4D6FA 1VF8A 3RJXA 3PZUA 3AYSA 2ESCA 3U7BA 4R27A 1U2YA 2VUYA 2FHFA 2YBUA 1B1YA 2V3DA 3ARYA 4M56A 1CENA 4TTUA 4CGTA 2Z1KA 1V0MA 3EBVA 4ZE4A 3K8KA 5E70A 1G1YA 3MMWA 1SMDA 3E1F1 4UFHA 5HOSA 2ZX8A 2J47A 1HJQA 4ACZA 4AD5A 1RD6A 1VJSA 2UY4A 1M04A 1MQPA 4WSKA 5IHSA 1H3GA 3WFZA 1OB0A 3ARXA 3WF2A 2J7DA 3MUIA 1WDRA 3CH9A 3G6MA 2VQUA 3F4VA 3KEHA 5E09A 4U2YA 4A3HA 2HVMA 1UWSA 4WIWA 1ISYA 1H09A 2D0HA 1KB3A 4HP5A 2ZUUA 5E0FA 4HPGA 1CLXA 2E0PA 3PZ9A 4XX6A 4A3YA 3WDHA 3GXFA 3UEQA 4LYQA 3WD1A 3AYRA 4OUEA 1LWJA 9CGTA 3ZR5A 1CXLA 2VCAA 4J3XA 4MB1A 1G94A 2YA2A 4CKQA 3BAKA 3SURA 3M07A 2ZXQA 1GOKA 1W9DM 2EPOA 3CIVA 3VDCA 4MTVA 1UUQA 4QFUA 3RM8A 5I23A 3F5JA 3WNMA 4HZ8A 1BFNA 2WSKA 1E6QM 1FH8A 4OIFA 4W88A 1HP5A 2WVTA 2PWHA 1BLIA 1PZ2A 1UR4A 4CU8A 3EMCA 2X0HA 3KL5A 4GI6A 2A3CA 1AVAA 1R85A 3WQ5A 8A3HA 3J7HA 4MDPA 5JBDA 4U33A 4P8XA 3N04A 1E15A 3ZJKA 2W66A 3A3HA 1PIGA 2W92A 1E4IA 1HKKA 3F5LA 5ABFA 4LGXA 1CXFA 2EO7A 2J7HA 3PZTA 4V2XA 4CD5A 2F2HA 3OIHA 3NDYA 2DDXA 4LX4A 3CZJA 2CBJA 4BF7A 1RPKA 2Y24A 3WMBA 3WL1A 1ITXA 1O7AA 2PF0A 4CD7A 2J75A 1UR9A 4MPKA 4Z2IA 3OBAA 2VZTA 2YA0A 1JYNA 1BGAA 1VEPA 1XD1A 3MMUA 5I78A 1E5JA 3K46A 3AXIA 5I2UA 6CGTA 3B9DA 3II1A 3CO4A 1HT6A 1UWIA 1EDQA 2V38A 1NOWA 2YL8A 2QV4A 3NIYA 1V03A 5LA1A 1KCLA 1E6RA 4GQRA 4M24A 3SCOA 1H11A 1QI4A 5JBFA 1B30A 3RO8A 3IAPA 4XUYA 3AS0A 4H8HA 1G0CA 4HMDA 2G3MA 1FOBA 2E9LA 1FHDA 1H0IA 3CZKA 1UWUA 4UR9A 1EOKA 1YQ2A 3AFBA 2UY3A 3ZT7A 1QI0A 2VCBA 3GYCA 2C7FA 3VDBA 1E1EA 3WSUA 3OG2A 1IV8A 3KL0A 1J0YA 2BHZA 1V0KA 4P7NA 4UNIA 3RILA 4KH2A 3WF4A 4WK9A 2GJPA 1CGWA 1ISZA 4J3VA 1WNOA 1W9PA 1IT0A 2WMIA 4U5KA 4NF7A 3SUWA 1WPCA 3CUIA 1WZLA 2VZVA 1NQ6A 2XWEA 2VR4A 4MNJA 3GNOA 3FAXA 4V27A 1UWQA 2Q8XA 3VGEA 2VMFA 2J7FA 3WD3A 5DMYA 1PZ3A 3AIVA 1JL8A 3TTYA 3WQ4A 3VGBA 4PMVA 2VRQA 2D20A 2VRJA 2WZIA 1FH9A 3TOPA 5A8PA 1JD7A 4CCDA 3WD4A 1KCKA 3W38A 4HMCA 2GDVA 1VEOA 3EDJA 3SCQA 1DWIM 1R86A 5FIPA 1OIFA 3EDKA 1QHZA 2GJRA 1JNDA 5DEZA 2WW5A 2XJ7A 3W27A 4YHEA 3SIMA 3IAQA 1CEOA 1MVYA 4XZWA 2WVVA 1PX3A 1WDPA 1JG9A 1V6XA 1DWFM 1XD0A 4PN2A 2ZXBA 2CHNA 2PI6A 3OB8A 2CBVA 3CHCA 3OZPA 4CVWA 5A6KA 3LPPA 3POHA 2WHMA 3VVGA 1B90A 1O6IA 3QGVA 2QHAA 1AQMA 2MANA 4PEEA 2ZWYA 3WEZA 8CGTA 1TVNA 3GNPA 1TCMA 2QMJA 2YA1A 4JHZA 5BXSA 1W1VA 1JZ7A 5TD4A 4PUEA 3VDAA 1GZJA 1NOFA 4H8UA 4BA0A 3ARVA 4AZBA 3MV01 2VR5A 2XG9A 3I3BA 3KWXA 1Y7VA 3O2LA 1XYZA 4KRTA 2G3JA 4U31A 4PTWA 1M01A 3AZRA 1K9TA 4ACYA 1KWKA 2YL6A 5ECUA 4GO9A 1ECEA 3S6TA 2AMGA 4JKLA 4ACZB 3AIEA 1QI2A 1D7FA 1MW1A 1J11A 3TTQA 1J0HA 4PTXA 1V0LA 4E4PA 2BV9A 4TX6A 4OKDA 1BYAA 4YPJA 5HBFA 4AYSA 1K9FA 5IDIA 1NWUA 2J7BA 1HF6A 2O9RA 1CNVA 1R87A 4CCEA 5CPQA 1Q6FA 3GBDA 4M1RA 1EDTA 3T2OA 4JCLA 3BSGA 4JFUA 3QR3A 4P8VA 1ZJAA 2BY0A 2WYSA 3MMDA 5A6SA 5A6LA 1TVPA 2YJQA 4AZCA 2CEQA 1CBGA 2WLZA 7TAAA 1WZKA 1JFXA 2BNJA 3SUSA 1B0IA 1HL9A 2XGIA 1E9LA 3LPOA 1XV8A 4BZYA 1J10A 1LJYA 3HU7A 2OSWA 1BAGA 2VX4A 1E73M 3AHTA 4BQ5A 4PSRA 2XVGA 1C90A 4PTVA 1CLVA 4HU8A 1JF6A 3WDQA 1UD8A 2PBOA 3UG5A 3GH5A 3NCOA 3AXHA 2XSAA 5A6AA 1FP9A 1V02A 1C91A 4JFWA 2E8YA 1UKOA 1QW9A 3VTRA 1KGWA 3K1DA 4PCTA 3CUFA 1MW2A 2D3NA 1GOWA 1XH2A 4RE2A 4NI3A 1J0KA 4F9JA 3MANA 1ISXA 1XHGA 2ZIDA 1UQYA 5FKYA 2GUYA 4GZIA 3VKKA 4Z2GA 2XM2A 2DSWA 3NUKA 5HPCA 4AIUA 1HN1A 1NP0A 1LL7A 2FHBA 2JIEA 3A4AA 1UA3A 3AMLA 2BVYA 4JAWA 4UQCA 4CD8A 2F61A 2C0HA 2NSXA 2DT3A 4B16A 4PMZA 3CUGA 1KXTA 5CQ1A 3NSXA 3WELA 4JKMA 4AEFA 4AZ7A 4PMRA 4HTYA 1EO5A 3WNPA 4H04A 3WH7A 1WO2A 2WXDM 3TP4A 1US3A 1KGXA 3RCNA 4DWSB 3TTOA 3ARSA 3VMPA 3WDRA 1NM9A 3EDFA 1JZ2A 2WAGA 2DSUA 5I6SA 4P7LA 2W4XA 1D3CA 1GVIA 3EMZA 2DT0A 4W7UA 1J0IA 1WB0A 3OZOA 4CU6A 2DSVA 1WZAA 2CIPA 4LPCA 3AICA 4TVCA 1G9HA 2CBUA 1WDQA 3IK2A 4JFTA 3NJ3A 4P8WA 2ZUWA 5EFDA 3SCVA 3HN3A 1BG4A 4W84A 2QPUA 4L4PA 4PMQA 1H0GA 3THCA 2JF6A 4PMNA 1UH4A 4KMQA 1WE5A 3UETA 4JZ5A 2E9MA 1J18A 3KE0A 1ZJBA 4W86A 4W85A 3VGFA 5I0DA 3PTKA 1E3ZA 3T2QA 1E5NA 2JEQA 7CGTA 2BXYA 4D1IA 3W25A 3T0AA 4TOQA 5HDRA 1GOQA 1UKTA 2YDSA 1B3XA 2CXGA 2J25A 3VIKA 1EOMA 1XSIA 4F79A 2CCRA 2V5DA 1C7SA 2WMIB 4BQ4A 4N0RA 1ZBKA 1HKMA 2IXUA 4JL1A 5GNXA 1V3JA 3DC0A 1VEMA 2OSYA 1BPLB 3ARPA 1E43A 3ZSSA 5IFPA 1E0WA 1Z32X 4AD4A 1KR1A 1UKSA 2PC8A 5CXPA 4PMYA 2WKLA 3VX1A 4J3UA 1JAKA 1HP4A 4JKKA 3CHDA 4UQBA 1HXJA 1CTNA 4OOZA 3BGAA 3B9AA 2OLHA 2VZOA 1W3KA 2E9BA 1JI1A 4HA3A 4ATWA 5DFAA 2WMJA 3N1AA 2YOCA 4CUCA 4NSBA 1MQRA 4FMVA 1J0ZA
chains in the Genus database with same CATH superfamily
1HVQA 4IFKB 2ACQA 3RHGA 3M6DA 1W5MA 1F61A 4NJIA 2GFTA 1XIDA 1H2JA 3O5MA 3EOEA 1HQTA 3RMJA 2RQSA 2P0IA 3S6OA 4DELA 5A95A 1TPWA 1W1PA 4LCSA 3PBVA 3O06A 3WK0A 5LGZA 3PAJA 5C9ZA 1K77A 3ZLFA 2D3LA 3L2IA 2OZ8A 4JTQA 4V28A 4YYFA 2YCEA 1UQZA 3VMOA 1DQUA 3VD5A 4AZ5A 3BV4A 2DPEA 1XKJA 1HJSA 2VO5A 3SCTA 2QF8A 2PDBA 2OO0A 4KCTA 3LNMA 5K4XA 3AHVA 2XVKA 6A3HA 4WY0A 3W01A 4KGLA 2OYMA 2K8IA 1C9WA 4DJDD 2VOTA 3H12A 4R0XA 4BI6A 3TJXA 3KOWA 3K2GA 4DZHA 3QVQA 3ES8A 4ZPVR 1P5QA 3WKZA 4ZEPA 3ZVHA 1V3LA 3WCZA 4ZXLA 1PZ0A 1PYFA 3VZXA 4C60A 4R7WA 1XKYA 2X09A 1XBVA 1NARA 3W6LA 1HXVA 3I6RA 4M3PA 2XGBA 5HUAA 3IANA 2VC5A 4MM1A 2DP3A 4OUIA 4UTFA 3UFYA 1T8XA 4JOMA 1F6YA 3IGUA 1W32A 5HWCA 4JTRA 3MC5A 3W86A 1SZFA 4RDWA 1H1NA 4UUIA 2DG4A 4ICMA 4RNIA 5IOBA 5HJYA 5FOOA 1B4KA 2X7WA 3UWUA 1GJWA 1AW5A 4LB4A 3P7YA 3BE7A 4HVXA 3C2FA 2G3IA 1D6OA 1US2A 2VT0A 4ATLA 4QCEA 2ZYFA 2E4TA 4GBDA 2REQB 2IMRA 1UP0A 1GKPA 1LLWA 3FAPA 1YXYA 3ZOAA 1TWDA 4LAMA 1D2KA 1TRDA 5D2WA 4PULA 4DEFA 2QQ6A 3VO0A 5LYRA 1FFRA 3W88A 3TSBA 4AY7A 1A5BA 4PEKA 4FLSA 4NZ3A 2G50A 3PPHA 1OK4A 1W1B1 3W2LA 3UWWA 1HJWA 1CIUA 2J7GA 3GX9A 4FNTA 1ADOA 3IJ8A 4E8CA 2BB0A 2QPXA 4AVOA 4EIVA 1W3HA 3H2OA 1LTDA 5E9AA 2Z7KA 1P0EA 1DBTA 4JHOA 3TWBA 3WNNA 1EZ2A 4AIEA 4PL2A 3VFLA 1KGUA 1XH0A 4HA0A 2ZVRA 2YKKA 2BDQA 2W91A 4GUIA 1RCQA 4JTCA 5I00A 1Q1CA 4F9DA 2YIHA 3E2QA 4IPLA 3BZGA 1GYMA 2WJZA 3NVDA 4GLEA 4GZ7A 1PTDA 3GYEA 1YHTA 3LRKA 3OGRA 3LCGA 1U83A 3A4XA 2WZHA 4FXJA 1XH1A 2OQHA 1GEQA 1I8JA 2QDHA 4DBWA 1SR0A 1OT1A 3CAVA 3NZGA 3LCIA 3WLMA 3WLTA 3USBA 2XIJA 2D1ZA 4QAIA 1I4NA 1W26A 3CU2A 3UF8A 3A21A 3WQDA 1P0BA 3UA3A 4H8VA 2VTFA 1OBAA 3H6OA 4GE8A 1TPB1 1MRQA 2H9AA 3QFEA 4Q4MA 1JFHA 5F2IA 2O92A 1W17A 5CPOA 4GINA 3DKJA 1UKQA 4EKJA 5IRPA 2CPUA 2O9PA 4XWUA 3Q67A 3GXDA 3E5BA 4K7YA 1RPXA 3T0CA 1KM6A 1UWRA 5HW7A 3AHXA 1M65A 3EB3A 1SU5A 3AJXA 2EBNA 4JIEA 1OCQA 1NOUA 4MMWA 3QF0A 2OFJA 3W1XA 7REQA 1E71M 1NTHA 3GHRA 3LHVA 4DO4A 1LBLA 1WKDA 3W4RA 1AZ2A 1WXJA 5I98A 1AG1O 3L4UA 3P82A 4CQ8A 3TXVA 5ABHA 4ZB0A 3BW4A 4PB4A 3VD3A 3CXOA 3SCSA 4PBEA 2OQLA 2PCQA 4KWUA 4K1WA 2NUWA 4KBXA 3QC3A 3AMKA 3TQVA 4B5XA 1D7IA 4WDTA 4U5IA 4LTSA 2XP6A 5I3FA 5H8UA 1ZBVA 1I0BA 5M17A 3UNTA 1B5TA 5XIMA 3GG8A 1ZY9A 4PBGA 4JNMA 1NVMA 4IGSA 4GD0A 4YN5A 3L21A 5D9NA 2HDJA 1OEPA 3PJWA 1KCZA 3CHVA 1OGGA 1GOMA 2ASHA 1NDZA 3CHEA 1J4EA 1WUEA 2PTDA 2EKGA 2G41A 1QUMA 1D9EA 1S5NA 1BG9A 3OU8A 1U5VA 2Z27A 3AMDA 1PPIA 2VGIA 4QG6A 2D0FA 3FAWA 3W84A 5E0CA 1EA9C 3V0UA 3T4WA 3TU9A 5ABFB 2B31A 3NQ7A 3S2JA 2R9RA 4IQ2A 3QKEA 4CN1A 2Q01A 1ZCOA 5EYWA 4IPNB 4X60A 1LUCA 1TV7A 2DUXA 3C2RA 3TUUA 3VKJA 1FWAC 1P1MA 5EMLA 3TJLA 4HBEA 3RITA 2PDHA 3C2VA 2P76A 1XIMA 2Q8LA 5C9WA 4JTKA 2DU2A 3MJMA 4DIPA 3VAWA 1EWEA 2V5KA 4W9OA 3G1AA 1XI3A 4O1FA 1PBGA 2HPMA 3WH6A 4L72B 2WSQA 3RCYA 3WQOA 4EANA 2BOGX 2AMXA 1EQPA 3I3DA 5D30A 5LIKX 3LHWA 4J1OA 3PZVA 1M7XA 3A47A 3HQ1A 1FJDA 2BWGA 4C7GA 4AWEA 3M46A 2YXGA 2NLYA 3TCZA 2XYLA 4D6CA 4I90A 4DHGA 3HZ3A 4O53A 2F8QA 3MUAA 3BARA 2CLPA 1Q65A 3UCDA 3DGBA 4GABA 4IUOA 2HROA 1VR6A 4P7OA 4FB7A 1ZS2A 4XZMX 4IT6A 3W28A 1X8CA 1BSIA 3MCMA 3WQVA 2VVNA 4Q4KA 4W5ZA 1F5ZA 1W9XA 2IF4A 1H50A 3SO7A 3TAKA 2J8FA 3NEVA 1NEYA 4WLCA 2D9FA 1W9BM 2DGAA 3ITGA 1B3VA 2QEZA 3GKFA 4L1WA 1HG3A 2FIQA 1E40A 2JGQA 4JBRA 3T0BA 4NAFA 4H9MA 4HTBA 4HYVA 1OG0A 2CC0A 2EGZA 2ICSA 4KGJA 4UMAA 4L61A 4XZLX 4HMNA 4TUFA 4E2BA 5GVJA 2HWGA 3EXTA 3TJIA 1J4IA 3AMCA 3WIJA 1UBSA 1U1JA 3PZGA 3AXKA 4QR6A 2P3ZA 2F2KA 4F0HA 1Y65A 4DAIA 5EFFA 3OLGA 3THAA 1RQEA 5G4WA 3SFWA 1U5HA 1ZJHA 3UERA 4RLIA 3G1RA 2GQAA 3T40A 3RCMA 2QDDA 2JBMA 2WC7A 3WQFA 5A2CA 3GVQA 3PWIA 3W7RA 1TX0A 2FKEA 5FEWA 2J9YA 4GG9A 4G8TA 3QHOA 4O4VA 1A3XA 1LT8A 2BLEA 1UD2A 1POJA 3WQEA 3B06A 2E6YA 2VN1A 3PSWA 3BANA 4AZHA 3W82A 3F1QA 3M5YA 4NNRA 1XC4A 2ZZ3A 1JRCA 4MJ4A 1H63A 2CWNA 3SCUA 3WL0A 1UASA 4H9ZA 3AQUA 3ATZA 3SZ8A 4UQEA 2J4GA 5C0QA 3PULA 3TYEA 2W62A 3AJ7A 3AS2A 3SJ3A 3FY1A 1UD5A 3OG3A 4WDWA 4I5RA 4AZIA 3C52A 5HUOA 3FK4A 1EHNA 1V77A 1LWIA 4K36A 2B7NA 4MFEA 4KRZA 1YBQA 1JCLA 1W5PA 4V1YA 5I24A 5I3KA 2PDPA 4IMCA 4B15A 3QQ0A 1BRLB 4W8LA 3BW3A 2EJAA 3V18A 3EB2A 2VZSA 1GQLA 3E0LA 3R0KA 2ZX7A 3GTHA 2Y5EA 5FF7A 1QW7A 3N2TA 1A53A 1J79A 4ODPA 2VOMA 1KM3A 5FACA 3KFTA 3SR7A 3ZMRA 1XINA 1KLZA 4W87A 4TVDA 5BCAA 1FWWA 4Z42C 4AZCB 3L0KA 4ODOA 3RNDA 1OFRA 1W2PA 3M0IA 4IH3A 3G77A 1XIGA 1FKRA 4QAWA 2OOGA 2ISFA 1PIFA 2BXVA 3UJEA 3VNZA 2X05A 1KM1A 1R38A 1PEZA 4DIAA 1JD9A 1V79A 3W83A 2GSJA 1BKHA 2WWCA 3PZMA 4CN6A 1KFCA 3DX5A 2R1KA 3BCDA 4L4OA 2FVMA 3JYMA 4ITZA 3IK8A 2ACRA 1S46A 5KZMA 3EEZA 4IOTA 4AWSA 1CGYA 3WLHA 1B3WA 3BSHA 4FK9A 2ZRYA 1ZUAX 4HNVA 3UZWA 1IIHA 3DG3A 4DXVA 7ODCA 1HJXA 2J6XA 4NUWA 4J27A 4LYKA 1JXKA 2CETA 2OPJA 1MW0A 1C9DA 3MO4A 5SWUA 2YXOA 1AL8A 4GI9A 1EF2A 5KETA 5LNVA 3DHDA 5CAKA 2ZE3A 3TW7A 3RIKA 2BS9A 1X98A 3SECA 4E8DA 3LRLA 1WP6A 4RXFA 1NDWA 3S47A 4YCOA 3EPOA 4UC5A 1JYWA 2GSHA 2ZZ5A 3QHNA 2NUXA 3JZUA 4UFIA 3TZNA 1AJ2A 4IP4A 2RUSA 4IMFA 1UCWA 2LPVA 1TTJA 3NQDA 4XD4A 2E1DA 3G3MA 2JIWA 4AF0A 2ZXAA 2PURA 4NRRA 4W89A 4UTIA 4ROQA 4YHGA 5GPRA 3MCOA 1FWDC 1UOKA 2PZ0A 4E4FA 4LEQA 5HTGA 1ZBWA 4I7UA 5I3JA 5AVHA 4MPQA 5B8IC 2XWDA 1JPIA 1XGZA 2NLIA 1O5KA 4B9YA 4EP8C 3W6YA 4ZVJA 1KM0A 3UCCA 1T41A 2DIJA 1OC7A 1QFEA 2DZTA 3MYPA 2KO7A 3BXWA 1Q2RA 1XLBA 3SQLA 2ABAA 3WF0A 4P61A 3H55A 4CQCA 1LRTA 4BR1A 5LA2A 3SRHA 3E74A 4TR9A 4W7WA 4IQDA 2J27A 5BRBA 3FHQA 1F7BA 1EXBA 4GVGA 1R2RA 3VM5A 3O5QA 1W3LA 3VUPA 3GDBA 2GL5A 2WPGA 3TCEA 1EGVA 3OYXA 4N2YA 3R94A 1E4NA 4D72A 3GNRA 3VC6A 2HV5A 1X8FA 4C7FA 1C9HA 2GWGA 3FA4A 3LPFA 4AX6A 3I6TA 4O1DA 2IW0A 1Q6EA 3W23A 4UQAA 2ZUNA 4LVAA 2WVUA 5D9PA 4KQNA 4CNPA 3BZJA 5AYIA 1GUVA 4W8AA 1F3WA 1N82A 5DN1A 2V5CA 1H62A 3FEQA 1PKLA 1UBPC 1GZGA 2UY5A 4HNTA 1BYBA 4LUTB 4LV4A 3DYPA 3OVQA 1ZAJA 2YDRA 2TMDA 1ISWA 1DTUA 4LYPA 2YYUA 1QPLA 4MZYA 4H4IA 2Z4GA 3CZLA 1UD6A 2QUTA 1Q4NX 1PBKA 4GVHA 4GMEA 1XLGA 4ZZ9A 4S23A 3OQEA 4WRHA 4ODNA 3HJZA 5C7VA 2VX6A 2HRWA 1NF7A 3WBAA 4JFMA 3W1MA 1BWVA 5DLCA 3D3AA 1FKBA 1OFBA 3WG6A 3RR4A 5HK4A 2I14A 3FW6A 3LI0A 1VPQA 2D22A 4MKVA 1RXOB 1YW5A 3RRAA 2A3HA 5CSSA 3I7RA 3DXIA 2ANUA 1JUEA 2H3DA 4W5UA 1H5YA 1P1XA 1ZRQA 3S2NA 1GCYA 4PYSA 3TMLA 3W7GA 3ZSTA 1X39A 1NH6A 2OYKA 3HGRA 3BG5A 3AYVA 1DJWA 1UHVA 3BWWA 1V0NA 4G1NA 3FNDA 1FWRA 4AVFA 3KLKA 5FJJA 1R6WA 2J66A 1CGUA 3RJYA 1E72M 1DJIA 4L6HA 1D3GA 1WOBA 2Y88A 4CU7A 1RJRA 4LAKA 4IWWA 3FXYA 2PWGA 3KVKA 3LGGA 1C8VA 3I6CA 4E38A 2PD5A 3UPBA 2YW3A 4MNLA 1EBGA 3U5YA 4ADUA 3OJGA 1SW7A 3E0VA 2A3BA 4BHYA 2XFFA 1ONWA 2CESA 1HKJA 6XIAA 3OGVA 1AW2A 2W3ZA 2EG7A 1AMYA 4C6MA 1G4EA 4N19A 3PFRA 4ZO7A 1ZFJA 4JTLA 3EKZA 3WUEA 4L65A 1OIMA 3DERA 4M6UA 3RGCA 2FZ9A 5A3HA 4MY9A 2A6LA 4XISA 1EIBA 2Y63A 4PMJA 2DW7A 5ABGA 3U3HA 2ZWZA 5HAOA 3RDKA 1TWSA 3T09A 4J3WA 3AS3A 1DE5A 1JXJA 2DSZA 4AD1A 2D23A 3G1FA 4RL3A 3KRUA 4LSBA 1TMLA 4WCJA 3BDKA 1NDVA 1VFFA 4ZMGA 3LCLA 4Q22A 3UI4A 5DITA 4UTLA 5FF3A 2HNEA 2KAUC 3GHUA 3GXIA 3WF3A 2Z29A 3W76A 3CH0A 3UWYA 1ESWA 4XZ9A 3ZR6A 3H9RB 4C6NA 4AEOA 1W3NA 1L2UA 3M43A 4DYEA 1YX1A 4S3EA 3UWQA 2PMQA 4ZCWA 1EP1A 2J24A 2FZNA 1ITCA 4Z1BA 3ODKA 3GFYA 4DT4A 3QBUA 1MRAA 2WCGA 4F8XA 4N4PA 1C8XA 3WENA 3BMVA 1EJTC 4D6FA 1VF8A 3B4UA 3PZUA 3IUDA 4X3ZA 1U2YA 4NZFA 1RK6A 3PBYA 4CGTA 1JDFA 3K8KA 5E70A 1G1YA 3E1F1 4G2DA 4W4QA 4ADTA 1NAL1 4AD5A 1HJQA 2J88A 3UGVA 4WSKA 1EEXA 3WFZA 3ARXA 1A4LA 2J7DA 4UDMA 1WDRA 3L0NA 4MVAA 1FBAA 1BKSA 3CH9A 2VQUA 4DBUA 3BO9A 3FKRA 3TH6A 5E09A 3E0IA 2XZ9A 4AAJA 3KAIA 5D33A 4A3HA 1BVWA 2GQ9A 2RAGA 3QV8A 3UPWA 5FJIA 1IEQA 2D0HA 1DJXA 3N9RA 3MMTA 3TYCA 2FGBA 4XX6A 4A3YA 1Z48A 4LYQA 2QCHA 4OUEA 5HWNA 1K02A 1G94A 3QY6A 4KF1A 3ABSA 3W85A 2YBVA 2BG5A 4O28A 3GIYA 3CIVA 4C6EA 1U1UA 4GRSA 3B0VC 3BLOA 4MTVA 1UUQA 5I23A 1FKTA 4IJRA 3WNMA 2WO5A 1BFNA 3BG3A 3EZ4A 4OIFA 4ERAA 4DRSA 3KX6A 4W88A 1IZCA 4PUUA 5DANA 1AJZA 4IFRA 2PDGA 5AC8A 1AVAA 1R85A 1TPC1 2QCNA 4ZQCA 4MDPA 5DQPA 4ASTA 5DMLA 1FWGC 4P8XA 3S5OA 3N04A 1E15A 3SW6A 3WK3A 3EAUA 1Q7MA 1HKKA 4H2HA 2QW5A 1TIMA 4V2XA 3G1YA 2ZZ4A 2QJHA 3W1RA 3T42A 4L9YA 4LX4A 3CZJA 1XW8A 2GZXA 4OQVA 4HJWA 1O7AA 2NXIA 2RJGA 1W5OA 2PF0A 1A5NC 2J75A 4LV9A 3TYBA 1T6MA 1BGAA 1XD1A 3HMJG 1E5JA 1MDLA 3K46A 2FJKA 1UROA 2PP1A 3AXIA 5I2UA 6CGTA 2ZQVA 3II1A 1EJRC 1HT6A 1UWIA 3NIYA 5LA1A 2A4AA 3ISIX 4FR1A 4HB7A 3SCOA 1QI4A 3DKLA 1JQXA 5JBFA 2ZDSA 3OW1A 3AS0A 5C9XA 2RFGA 3C61A 1S2WA 4KFOA 3DESA 1FOBA 1WDDA 1UWUA 4OV9A 5DY3A 2QCGA 4E8GA 4FXRA 3TW6A 1AQFA 1G4PA 1QI0A 2VCBA 3GYCA 5A5WA 2C7FA 2O56A 2R14A 3IJDA 5CBJA 1Q7ZA 5I06A 2GDQA 1ONEA 3OG2A 5KMYA 2BHZA 1W8SA 3WQGA 1XBXA 3RILA 1NF0A 3UQIA 1HO1A 2I57A 5BU9A 4ROPA 1M68A 1ZP3A 1W9PA 3GTYX 4U5KA 3CB8A 1UUMA 4AB4A 3PSVA 2NVDA 2Q6ZA 1NQ6A 1I2NA 2PODA 1UWQA 3VGEA 2BGNE 3A9IA 1PZ3A 1CB7B 3SGUA 1O1HA 5CSRA 3QH2A 3KACA 2IKGA 3VGBA 2WZIA 3EA1A 3CEUA 3M1ZA 1FWCC 1JD7A 3VI2A 3W38A 3WJSA 4HMCA 4QROA 3LUTA 5JXQA 2WKJA 4F2TA 2N87A 3WLNA 4IFKA 5C2GA 1FQ0A 3IRSA 1JNDA 1ITUA 2XJ7A 3W27A 3B8IA 1EYEA 4YHEA 2YFNA 2PDXA 3RR1A 4XZWA 2HK1A 3BLIA 3KAHA 3KAOA 1JG9A 2CHNA 5EY5A 3OB8A 1EGMA 4MYXA 5CZJA 2PP0A 2V2HA 5A6KA 3POHA 3VVGA 4NZ1A 3KWSA 4PE8A 1B90A 3CQJA 2PGEA 3KCJA 4IL0A 4IJCA 4D8LA 2ZZ7A 3GNPA 4ERGA 4D8ZA 4LVDA 1WXYA 4RZ5A 1EL3A 1BXBA 3NQMA 4ZO6A 5BXSA 1JZ7A 5REQA 1IGWA 3R8RA 3ITTA 1NOFA 1UJPA 4NQ1A 4BA0A 4AZBA 3QLLA 2HSAA 3MV01 2XG9A 4FNQA 1ELSA 4XVEA 1DTNA 3Q45A 4A8IA 4PFMA 1LZOA 2YDAA 1XYZA 3TIMA 1SR9A 4KRTA 4O8AA 1YW1A 2G3JA 4U31A 3KBMA 3HPFA 3AZRA 1MEWA 1ECEA 2D2GA 4ACZB 1FKGA 3BURA 4JTHA 2C13A 4KPLA 2AQVA 3TTQA 4ZOBA 1V6TA 2BV9A 3NPWA 4OKDA 4JIHA 5HNUA 3M0VA 3MDUA 5HBFA 1TJRA 3N14A 4YPJA 4AYSA 1NWUA 1RCXB 3TX9A 2O9RA 4HCHA 4QX4A 5CPQA 3GBDA 1PIIA 3PR2A 1EDTA 3T2OA 4HPNA 4JCLA 4XIMA 4XO6A 4A2RA 3N73A 2BY0A 2A7PA 3W7OA 2YJQA 3R0UA 4F0KA 3NO5A 7TAAA 1WZKA 4XD6A 3NEHA 1HL9A 1TZ9A 3DFTA 4NVTA 5GJMA 1K7EA 4Q8UA 1XV8A 2QCFA 4OECA 1LJYA 4KCVA 5IBXA 3HOJA 4PSRA 1XGDA 5AZ0A 2XVGA 1HO4A 3C56A 1XISA 1EFZA 3WDQA 3L5LA 6ENLA 1F3XA 3NCOA 4PUNA 3LCHA 2HXTA 4FZIA 3ABOA 4JICA 3VTRA 1LQ2A 3NG3A 2G3FA 4QQUA 3N6HA 4X2PA 2D3NA 4NYYA 4I6VA 4RE2A 3ITOA 1J0KA 3TFXA 5EMUA 2JKPA 4GZIA 1LOSA 2Z25A 4Z2GA 3W7MA 1KBIA 4AIUA 3AU6A 1XXXA 2JIEA 3OTRA 4J9JA 3AMLA 4J3ZA 2YX0A 2VGGA 4UQCA 2F61A 1K8CA 4C6IA 3S1WA 2IPFA 2GVEA 4LW7A 2GVJA 3CUGA 1KBLA 4BK9A 1I2OA 3OOBA 3ITLA 4IHCA 4HKPA 4RKAA 2XU2A 4HTYA 3O8AA 1EO5A 3WNPA 1VFLA 4JGDA 1A0CA 4A3RA 1KGXA 1WXZA 4DWSB 1UWAA 1H51A 1Z9AA 3VMPA 3WDRA 1NM9A 1JRBA 5I02A 3EPMA 3EDFA 5ENLA 4D9PA 5I6SA 1YDOA 5GPGA 4FX8A 5CEWA 4EAYA 1GVIA 4JYSA 3KCOA 1OF6A 3EMZA 2HCVA 5DCBA 3R25A 4F40A 4LPCA 3BOXA 4TVCA 3I4KA 1EC7A 3IK2A 1X1ZA 3NJ3A 2ZUWA 5EFDA 1XF0A 2QJJA 1BG4A 4W84A 4PMQA 3LOTA 4GCAA 1UH4A 4ZB2A 3UETA 2CLKA 4HNCA 3M44A 1ZJBA 5AKQA 1X97A 5G4HC 3E0FA 3UZXA 2V69A 2JEQA 3ABZA 3VCNA 3BPWA 3ITVA 4D1IA 2OU4A 3W25A 3EWYA 1G6CA 4IJBA 4WX2A 5HDRA 3CWOX 1UKTA 5H8MA 4S2BA 1XSIA 3EOUA 3AU2A 5AN7A 2WQDA 4XTDA 2PV3A 5GNXA 1V3JA 1VEMA 1R0MA 3DFOA 3GU9A 1Z32X 4AD4A 1PKMA 4LCRA 2FTWA 3OPSA 2WKLA 2R1LA 4J3UA 4JKKA 2MNTA 3BG9A 1MDRA 4UQBA 1CTNA 2V81A 3SRFA 2FTPA 3BGAA 3G24A 4DRKA 5D02A 2VHLA 1PKYA 1POKA 3V0SA 3O15A 4MUZA 3N1AA 2RJHA 3TLLA 3FYOA 4KEVA 1MQRA 4LAUA 3VDGA 2NV1A 1XIJA 2HS6A 4B3LA 3AYTA 5EA9A 1EO7A 1L9WA 3MU7A 1E0VA 1SFJA 4UFKA 3DG6A 3CGTA 3BVJA 3IUIA 4S3DA 1VPXA 3URNA 1TJ1A 5DELA 2LLEA 4DWSC 3IVUA 4Y8FA 1RJQA 3NOEA 1BVZA 3NQ6A 2C6QA 1PCWA 2EQDA 3ICJA 1UMYA 1ZHAA 3VU2A 1TQJA 4AY1A 3EMQA 1QPNA 1QNQA 5K9DA 4UTWA 1IEWA 2PLKA 2DVUA 5GNYA 2YCJA 5ECVA 2MUCA 2QUUA 3N9KA 3TNOA 1A0EA 3ZLGA 1M53A 3MKVA 3S8HA 5FEZA 1VRDA 4QJ1A 1OFOA 4IMGA 1N7KA 4O0KA 5T26A 1FTXA 5G1MA 1Q6RA 1VRXA 3SSJA 1FKXA 1EUAA 5G2WA 3C0SA 3UZ5A 5EMMA 1B54A 2AQOA 5EGRA 4GX8A 4GC4A 2ZX5A 2ZE0A 3VD7A 5C8BB 2VVSA 4JL2A 4CD4A 2B5UB 1K6WA 1JAEA 3PPCA 4FPSA 3CUZA 3AOFA 4LCQA 3I7QA 2O9OA 4TX8A 4DM1A 2Q09A 3V1PA 4IGHA 2NXHA 3CV1A 3NYZA 3MQTA 4YVVA 4PFHA 5G5IA 3KM8A 1E9IA 2A6NA 5CZ0A 2GK1A 2DQWA 3OVGA 4YWIA 1XLJA 5MKGB 1TCOC 3SN1A 3IJQA 2Y89A 3H21A 2OTDA 2B0MA 2IQTA 2PDIA 3ARZA 2RGLA 1G69A 3WLLA 3WH9A 1DEDA 1EWDA 3CBWA 3IJ7A 2NXGA 2E40A 2WVSA 4LAVA 4Z08A 3PNUA 4BF9A 1OINA 3I7SA 1TTIA 1P6CA 1L2QA 4CNTA 4R85A 4UIOA 4HSNA 2X1UA 2JE8A 4GIYA 3WLSA 3Q58A 2JKEA 2VRKA 4EPDC 1MNSA 3W2NA 4IQCA 4DLMA 1WBJA 4L64A 1W31A 3VPLA 2DJLA 1GYNA 3PZOA 3WUGA 1DE6A 1F2JA 1NWRA 4H9YA 2X1IA 1XQKA 3W2KA 4H6EA 7ENLA 3VM7A 1EF3A 1XSKA 3G8EA 3HURA 4EF8A 2FH6A 1O5XA 5A69A 5LGXA 1B9ZA 3L12A 5C7HA 1TPVA 2E5BA 5DT7A 3G5EA 4IMAA 1PHWA 4M51A 5HWBA 3K4AA 3HF3A 3OO2A 3WUFA 4B9ZA 4AWUA 1TV4A 5HMEA 4LJ3A 1M1BA 5KEZA 1QWGA 2GQ8A 1UR3M 2ZVIA 5EU9A 3UYCA 4HN4A 1S5TA 3UXLA 1JYXA 4H1ZA 3NPUA 3ORWA 4AIOA 1A80A 4E0CA 3PWGA 4O8RA 3GRIA 1IIGA 3SGZA 1VYPX 1QHOA 4ZENA 4O1AA 1ODZA 5BXPA 4DZIA 1ZU8A 1ONRA 3GR7A 2PWDA 1A0DA 4LQ1A 3URQA 1IYXA 1R47A 2RGMA 2VENA 4KCWA 2PWFA 3PNZA 3UG3A 4I7VA 4L56A 1T11A 1KC7A 4R9XA 1QNRA 3EX3A 4GQ0A 3TOYA 4POCA 5EB8A 2ZBTA 3VE9A 2XHYA 3HIJA 4WSJA 4XSMA 2XFRA 2A0NA 1JPKA 2VD8A 2I17A 3QSTA 1BEUA 1SO6A 3HPAA 2GYIA 1DXIA 5IHRA 1GW1A 2QCEA 2PPNA 3RX2A 5CKSA 3VX0A 2OMAA 3CMJA 2NVAA 2ZQSA 1O12A 2VELA 4J2MA 1KBKA 5HR6A 3L7RA 3QTPA 3WQWA 4I5UA 1SGJA 1H4PA 3AIQA 4X9YA 3LMZA 5D2VA 1C8QA 1KM4A 1PKNA 3SY5A 2WJDA 1RY0A 3A6OA 3TQ0A 1BRLA 2INZA 4AMCA 4EPKA 1PJ9A 1IEXA 2CLHA 2VC9A 3EWCA 4CLMA 2V3EA 4HJFA 3WN6A 4Z17A 3IKDA 4K68A 3UZZA 1EJSC 1P7TB 1F40A 4GFSA 4J3TA 1VBHA 1B57A 3B9EA 4TYOA 5JUVA 3E3HA 4Z1AA 1S3HA 2ISSA 1K4HA 1JNSA 1RVGA 2HNHA 2ITKA 4C1NB 3K8MA 3CC1A 2V3GA 2WSPA 1VCFA 4MY1A 3KL3A 1FUYA 2BBFA 3EA3A 3S5ZA 3UW6A 2BY1A 1UWTA 4S3KA 3BAWA 5I3HA 1P6BA 4KIRA 4NXSA 3QXBA 1W37A 3R43A 4LEFA 4O13A 3C3UA 5B7YA 3NNTA 4YLWA 4ODKA 3OBEA 4I5XA 3U4FA 3N4EA 4XVDA 1TIWA 2BZNA 1F6PA 1W1YA 3S0CA 4RDZA 2DH2A 1R3VA 1MXGA 3JUGA 4LVGA 3PBGA 6XIMA 4B5VA 4DBEA 3GAYA 3DHFA 3E96A 3UCQA 1Q7QA 2HTMA 1QVBA 1DJHA 1ZAIA 1BXCA 1GK8A 2I16A 4R88A 4XZBA 5AHNA 2DZUA 1ML1A 1YTDA 2QIWA 1K6AA 2QJMA 1GZ1A 5E1QA 5A6MA 2ZX6A 3B8SA 2QMKA 1AH0A 3MHUA 5LA0A 1OX4A 2WNWA 4NI8A 1V7AA 1JUKA 3KW3A 1CW2A 1OJXA 2TYSA 1XYCA 3GSMA 4RUBA 4LT9A 2WZMA 2WB5A 3CQKA 2DZXA 3VIGA 1T0OA 3SDOA 3WDJA 3CUJA 4OV4A 4MZ1A 1EJUC 3PB0A 2YL9A 3HB9A 2PPOA 1UPPA 4L4LA 1BWKA 3EYPA 3NQEA 3POCA 5BYWA 1WX0A 4HT3A 4BCEA 2G5WA 4WHBA 4EPEC 4BWLC 3AIBA 3F2BA 2CHRA 4RNFA 3U7VA 5M3WA 3H2NA 2QF7A 4FLRA 2PLCA 7TIMA 4UOQA 4JQ4A 3RO6A 3TQKA 2FH8A 3QPEA 3ENLA 1QHPA 3RLUA 1Z8AA 3TV8A 4L4MA 1ADSA 3SCNA 2C14A 1QBBA 5KITA 1IT8A 1S3TC 4FXSA 4Q4SA 3PY2A 2UV8G 4YTRA 5HJXA 5D32A 3AWOA 3ME3A 4IM4A 1K7XA 2FB3A 1TE6A 2OZTA 1FFQA 2EG6A 1UR0A 3AIUA 4PRWA 3T81A 3PZQA 3THUA 4ZSTA 1RAKA 2CKSA 4ADSA 2H8ZA 3BJFA 3VK5A 1FWIC 3PZNA 3OA5A 5FJUA 4PCPA 5EBAA 4REQB 3MJYA 5H8PA 5CGMA 3C8FA 2FYMA 5EBUA 1MUCA 4NYUA 5A2AA 4XO7A 5EPDA 1VJZA 4XD3A 4IQLA 2WNQA 1Q6DA 5CLTA 3W75A 3T0TA 4AC1X 5HPOA 3VINA 1QNSA 1GORA 1S5VA 3M41A 5JBEA 2XSBA 1Q8JA 3IJ9A 4LF2A 3HO8A 4R33A 4L6DA 3R79A 1P5BA 2W9MA 2POTA 3G2GA 4JQ3A 3TTEA 1JCMP 1V6WA 3ZM8A 2A85A 3H26A 2VR2A 2PUZA 1GVRA 4J35A 2W6RA 3HTWA 1EUNA 4HIBA 1CB2A 1BVNP 4HNOA 2NQJA 3TLQA 3TONA 2CXEA 3ERPA 3CLWA 2J8TA 3GG0A 2J9XA 4O1EA 1Q6OA 1CXKA 3BOLA 1GRJA 4FP1A 3LZ5A 4ZQOA 5HMDA 4O12A 1JDDA 3GIPA 4S38A 3CIWA 4IIEA 2BVWA 1J12A 2C1GA 5KZDA 2XIQA 4MB4A 1PB0A 2WOQA 3AIWA 3EWZA 2VZUA 1B6CA 3QGAC 3KDNA 1EIXA 2FVLA 4FNSA 4U2ZA 1YNPA 2X41A 3LG3A 4DUWA 5D2XA 4DXKA 5I5RA 3VUSA 2VI0A 2BHYA 4AWTA 1XUZA 3W53A 3JR2A 3P0XA 4I7WA 2OSXA 3UQAA 3U2CA 2ZRVA 4I9AA 4O16A 4ML9A 3ARTA 4JCMA 5E0KA 1FKDA 1PV8A 1OC6A 3E9AA 5A2BA 4RZBA 3I3EA 1CWYA 1SZRA 4DVOA 5KZEA 3A5FA 5I79A 3D47A 4I9TA 3PG9A 1TVLA 1MZHA 2ZRWA 3IV3A 4RE0A 4DJFC 3IIZA 3ES7A 4WY0F 4CQBA 2VEFA 5HKGA 3ZJ6A 3COTA 2ZZ6A 3T44A 5A6BA 2PRHA 1A47A 2XTKA 4M29A 2XPBA 1RP9A 4ZQPA 3VC5A 3WJXA 3W7CA 4JHMA 4FOUA 4UQ9A 1QPOA 4GJ1A 2Z2UA 1R3RA 4LNYA 1PL9A 3G1XA 2A3AA 3BAXA 4YTSA 4IP5A 3S9ZA 3M0LA 4YYCA 2JQXA 4G50A 1XG4A 2XVPA 1IZJA 2J8GA 1TCDA 4L1XA 1SW3A 2YCLA 4MNMA 1EDGA 1S39A 1XRSA 4XV0A 4PMXA 4DRNA 1IXOA 2FZMA 4A05A 5J5RA 4G7FA 2VEPA 4JTIA 4JTGA 5DF0A 1TWWA 4CQ9A 2OFNA 3NQBA 6TAAA 5I09A 4LB3A 2C18A 3NSMA 4A3QA 3NGJA 3GUWA 1TPFA 3EWBX 2DZPA 4XAKA 3V16A 2FTYA 1DWAM 4JX6A 2DVTA 3TFCA 1KXVA 1FH7A 3M6YA 4NY2A 3FOKA 2EAWA 4DZ2A 5CZKA 2CLEA 3GDMA 2OJPA 3TNBA 2POZA 1UA7A 4TVUA 1VIWA 3WFAA 1KQZA 2WLYA 4TX0A 2V9DA 4LRTA 4IPIA 4DO5A 1H49A 3FCPA 1VBUA 4C5YA 1FWHC 3OGSA 5DO8A 1J6OA 1XRVA 4QIUA 3RX3A 1FVPA 4A8LA 6ALDA 3GG1A 3CMGA 3EKLA 3WUBA 3QSRA 3FDGA 3B9NA 3SI9A 4B3ZA 1UG6A 2DZSA 3M7WA 3MY9A 3ARUA 2V3FA 2HK0A 4XD5A 4WDXA 5F4WA 1D7JA 1ZENA 3N2BA 3V5FA 3JVAA 4JTJA 3BICA 1QK0A 1XCWA 3PZIA 3MW7A 1W9UA 1TPEA 2CU0A 4ZL1A 3NR0A 1TX2A 2Z1WA 5A6BD 3PA7A 2RHGA 2HE5A 2X30A 4FF7A 3H54A 4J4OA 3N6JA 1KFKA 1TFVA 4B3KA 4J2PA 3RPMA 2CLLA 3S42A 3TE9A 1CT5A 2PWEA 1B3YA 1ZP4A 4O1CA 1GVFA 3FJ4A 1KTBA 4AY8A 2RDWA 4H83A 2ZTJA 5DCEA 1LLOA 3VOHA 1CGVA 3GBEA 2R8WA 1LL6A 2UZ9A 1ICQA 2OKTA 4NZ5A 4CNSA 3KVJA 2WMKA 4A2SA 2GUBA 2WCSA 1YPFA 3XISA 3VNKA 3G6LA 2ZUSA 4ZR8A 3M47A 4LBSA 2BMBA 3QJAA 3P8IA 4DJDC 1JVWA 2I56A 1OGBA 1QNOA 2WC3A 4TO8A 2DSKA 3CYVA 1V3MA 1T96A 1M5WA 2WKGA 1EC8A 1HIZA 3FKKA 5EMYA 3UP8A 3H22A 1VCGA 4XAZA 4PUWA 1GQIA 3VIJA 4WY0B 4OE7A 1QASA 3FHAA 4JFJA 3U48A 3WMSA 2CLMA 3TXZA 1GONA 3VAVA 3VNLA 4B91A 3ZVHB 3DU0A 5PTDA 1WKFA 4GNKB 4QLLA 2CBIA 5LIXX 1G7VA 4C1LA 1B31A 1BL4A 2GGIA 5K3VA 2YDQA 5A8MA 4Q6XA 4ICNA 4WXZA 2TPSA 4GKTA 1UD3A 3GDKA 3VGHA 5F2GA 1MYRA 2VUNA 3SAZA 4DJFD 3O5IA 4PA8A 3SUVA 2QUVA 4UR8A 1UR8A 5J04A 4HZ7A 4F48A 1A3HA 4ZE5A 3E02A 4K37A 1RA5A 4R5EA 1JZ5A 4MDOA 3ITYA 4YTQA 3O5JA 5AC7A 1SFLA 2RDTA 4BY3A 1B3ZA 1CX9A 3VIHA 2CLFA 2I9EA 5JQ9A 2O4QA 1E6SM 5XIAA 1QRQA 1LL4A 3D0CA 4IFOA 1CPUA 2HS8A 1B4EA 3B8DA 4QT2A 2KX9A 3E49A 3G22A 4FOKA 4Z0JA 4IGMA 4PTMA 1TMQA 1TA3A 3PUDA 1YATA 3MKKA 4Q7BA 4GUGA 3JU2A 2ZZ2A 4YU1A 3VOGA 2PDFA 2R1PA 4Y90A 3ZR4A 3WK2A 3SM0A 3URAA 3V75A 3QPZA 3TN4A 3RM4A 4I8DA 2PAJA 1GVEA 2W63A 1PWLA 2DFAA 5D03A 4HYRA 3PRAA 4U3AA 4M8UA 4XQ6A 4EX4A 3Q65A 1SSGA 4OU1A 2OT1A 1YPXA 4OFCA 4S3FA 3L66A 5FF4A 1E55A 4PC8A 4Q4PA 4N9EA 1GQNA 2WSYA 4PTNA 1OX5A 4ORIA 3BAYA 2MLXA 4EWJA 2WNZA 3M0KA 4ZO9A 4J7RA 1C92A 2HBXA 1RR2A 5D2TA 3RJXA 1OQFA 3EX2A 4AQLA 2VUYA 4N4QA 5AHEA 4XUGA 1B1YA 1VCVA 2IQDA 2E1WA 2B81A 4P5UA 4LOCA 3QM3A 2FMNA 2NX3A 2XN0A 2JZVA 4ACZA 1A5SA 3NM3A 4C6KA 1M04A 1MQPA 2P10A 2ZA1A 3W07A 5IHSA 3PP7A 4HHHA 3CUXA 4V15A 3EKGA 1AH3A 2R82A 3PTDA 3PRDA 4QG9A 1W8GA 1MUMA 2H9AB 3UA4A 3G6MA 1LRQA 4E3VA 1DQWA 4ZA0A 1SJCA 1FAPA 5AHFA 3MVIA 1UWSA 3GVGA 4WIWA 4HK6A 4DJEA 2KFWA 1RV8A 1DQXA 2ZUUA 3R8GA 3PZ9A 1VC4A 3UEQA 4RW5A 3TR9A 1R2SA 4ZODA 4EXQA 4WQ6A 3TC3A 2YA2A 3BAKA 5MF5A 1BSLA 3U6WA 3VKCA 2ZXQA 3GG7A 4A8RA 3NTPA 3LA4A 1W1ZA 1J96A 3VDCA 7REQB 3QRHA 3BSMA 4QJ4B 4QIBA 3RM8A 3A24A 4QFUA 4AH7A 5D09A 3F5JA 4HZ8A 1FH8A 2QULA 1DOSA 4IQJA 2PWHA 1BLIA 1PZ2A 1LM1A 3LENA 1YXCA 2Y8UA 2TSYA 4JTUA 4U33A 4AU0A 3APYA 3E38A 2ZTKA 3Q4DA 3ZJKA 2W66A 1VLIA 3V0TA 2Y61A 4LGXA 1OFAA 1QO5A 3P8JA 4ORMA 2EO7A 2ZCGA 3PZTA 3OIHA 3P84A 1KT1A 2DDXA 1LYXA 4BF7A 1JPMA 3NQAA 4HCLA 1ITXA 4IF2A 1K1DA 3A23A 2A3LA 4CD7A 1HUVA 3W00A 4Z2IA 1IHIA 3A4JA 2VZTA 2QJGA 3MMUA 5I78A 4KEUA 1GPWA 1OADA 3B9DA 3DCPA 3A12A 3CO4A 1N8FA 2F23A 2V38A 2L5HA 2YL8A 2QV4A 2X1SA 1KCLA 4WD0A 4DI8A 1E6RA 4JIPA 2FKPA 4M24A 4G9PA 1H11A 4RW3A 2FMOA 4KWVA 3IAPA 1OCBA 2E28A 3PAOA 4JX4A 2PRMA 3CZKA 4IPJA 3SN4A 1YQ2A 1NELA 3L0GA 3P67A 2HVOA 3ZT7A 2CZ5A 4WJ8A 3W73A 1YTEA 4F2UA 1FDJA 3P62A 3EIPA 4DJED 3WSUA 1IV8A 1J0YA 4FSAA 1K4GA 3W7NA 4P7NA 2NQ5A 4KH2A 1DJZA 2GJPA 1CGWA 1BWLA 2A7NA 3QV9A 4QRNA 5TQLA 3K30A 3U4AA 1IT0A 3RUBL 3CL7A 4J40A 1WPCA 4R3UA 4L9ZA 3RU8X 3WK1A 3QZEA 3INPA 1YYAA 2X1RA 2VR4A 4MNJA 3GNOA 2HMCA 3FAXA 1PUDA 4GNVA 3KUMA 5DMYA 3AIVA 3L67A 1WDWA 3NZRA 1XL9A 3GVVA 4DPPA 3WQ4A 3CEPA 2A5HA 3G1HA 2VRQA 1QO2A 2PDKA 4E4UA 3TOPA 2E6DA 2AL2B 1KCKA 5C54A 3E2VA 4ICCX 1R86A 1SZEA 2F6UA 3FYPA 4GCXA 3OODA 3EDKA 1QHZA 3C4UA 2YB4A 3RN6A 4KR0B 1XPGA 3HQNA 3HPZA 2PWUA 3UXAA 2WW5A 4MWAE 2Y7GA 5B80A 3LSCA 4NXKA 1NFGA 3SIMA 1PX3A 4OGZA 1V6XA 2HBVA 3LBCA 2HPIA 1XD0A 2HZGA 2PI6A 2CBVA 4L5ZA 1ITQA 3E6EA 5HQEA 1K70A 1A5KC 4CVWA 1KTCA 1T7LA 3A64A 2WHMA 4LUSB 4JD4A 3ZFHA 2RDXA 4GX9A 2MANA 3GD6A 2ZWYA 4PEEA 1XLLA 4C6BA 5H1WA 1FDZA 1KCXA 1W1VA 5TD4A 3KOFA 3BV7A 1JCXA 3S3GA 1S2CA 3ARVA 1YXDA 1XYAA 2VR5A 3PANA 4K38A 4ODLA 1Y5XA 4I3GA 1DIEA 3KWXA 4IIBA 3B7XA 4DF2A 4HSOA 5BNKA 3WBXA 3CQ0A 1QDSA 3HM7A 1ROTA 1EX1A 4PTWA 4R34A 1ZJIA 1K9TA 1I60A 1WKEA 3BQ5A 5FJPA 3TYUA 3H7VA 1PTAA 2AMGA 5JH2A 4I6KA 1DIOA 1MW1A 1J11A 1XICA 2B7QA 3IGSA 1V0LA 3DOPA 2Z26A 1BYAA 1K9FA 5IDIA 1WV2A 2J7BA 4EPBC 1G4TA 2E25A 1CNVA 4YXGA 3H7UA 1R87A 3IGHX 4L1GA 1HW6A 1VYRA 4YTUA 4JFUA 3QR3A 4P8VA 5A6LA 3SN0A 3H4GA 4E2VA 3MWCA 3O7UA 2B7OA 1JFXA 2BNJA 4C6PA 5MKGA 2XGIA 3UVAA 1E9LA 2V82A 4NJHA 3STCA 2VX4A 1E73M 3AHTA 2RKXA 4BQ5A 2P8CA 1YBQB 2FZDA 1C90A 4E3TA 4F3HA 1CLVA 1NU5A 2PBOA 3UG5A 5E9XA 3CV7A 3AXHA 1O95A 5A6AA 1FP9A 2E8YA 5HMFA 3CTLA 1QW9A 1V93A 1J2BA 2PWVA 3K1DA 4PCTA 4C5ZA 4XAFA 3C2EA 3QW4B 3CUFA 3M5ZA 5BMXA 4YL2A 1GOWA 1XH2A 2UBPC 3NQGA 4A22A 4YS1A 1XHGA 1GWJA 4C6OA 3VKKA 2H8XA 3SIZA 1W1IE 2XM2A 5HWMA 2F21A 3WLIA 3HFYA 2BVYA 4JAWA 5ABTA 4CD8A 4HU4A 1SSDA 1PINA 4Q8TA 2QJNA 5F1VA 3GHTA 3TSDA 4KQZA 4F0RA 5HQMA 2BSLA 3STEA 3RLHA 4GH1A 4JKMA 3E12A 4N6FA 1JVNA 1J93A 1NY1A 1RALA 4TU1A 4H04A 1WO2A 4ODMA 4H7CA 3MI3A 2PEVA 1US3A 5FJOA 3RCNA 5L6UA 4HCDA 4DB7A 1VHNA 3OA3A 3P3BA 2QUNA 2OOFA 1JZ2A 1REQA 3EY6A 1KNWA 3U0HA 1AMKA 4PRTA 1PXGA 4DBDA 1D3CA 3C6CA 5RUBA 2PDUA 3ANUA 3LU2A 4H19A 1R46A 3XIMA 5CJNA 4CU6A 4CCZA 1WZAA 3CM4A 3KXQA 1KRAC 3AICA 3R11A 1G9HA 2QCDA 2CBUA 3GE7A 1UP3A 1FKWA 1R9XA 1K3UA 3FVDA 1ALDA 4G6CA 4FAPA 2QPUA 4G5DA 3GXTA 1QR7A 5E5CA 1H0GA 4PMNA 4DO6A 1LOQA 3B0UX 2VDHA 2VP8A 4Q8NA 3HG4A 2WNNA 4US6A 3MCNA 2NQ9A 3LS9A 3F2DA 1E3ZA 3T2QA 4D2JA 2AKMA 1XCFA 3OIXA 2YZ5A 5EKYA 2YDSA 4Y9MA 6PTDA 4MJMA 3VIKA 1EOMA 4NZJA 2VGFA 2CCRA 3T4CA 2V5DA 2WMIB 4BQ4A 2IXUA 3G1DA 3QTGA 1BPLB 3ARPA 1RJPA 1MNZA 4UTMA 4ONVA 1KFEA 1A5UA 3V4BA 4GY1A 3O5DA 1KR1A 1UKSA 1DYSA 5E93A 2GQ3A 5MHBA 4L7ZA 3DG7A 3VX1A 4JTAA 3TN3A 4V33A 2X2GA 2D2JA 1TR9A 3QW3A 3W70A 2P0OA 1AFSA 1SJAA 4K39A 6REQB 3L9CA 2E9BA 5DFAA 2WMJA 3DBNA 4LNCA 3O5KA 4CUCA 4NSBA 4YJ5A 4RCXA 5CPSA 1UKPA 2Y6ZA 1ZALA 1F3EA 2E7FA 1H7XA 1LG2A 2PDWA 3DZ1A 1SYTA 1MMFA 5CJ5A 3IIOA 2DH3A 1E3XA 1ZCNA 4Q7IA 2J62A 1CXIA 1KRBC 5KTLA 3GU2A 3W29A 4TNSA 4HPJA 1BQGA 5HINA 3PTMA 3AZSA 1ADDA 1NWSA 4PB5A 4ATDA 4C1NA 3BLLA 4P8UA 3W81A 2QIIA 4QLJA 1DKWA 2FDMA 4GISA 3UJFA 5JIWA 4M6PA 2OGJA 2QV5A 1PYMA 3SRKA 1V5XA 1E1CA 1R9HA 1IX5A 5D8ZA 2WMHA 2DIKA 2ZX9A 3R10A 3VOCA 3C2YA 1OC5A 3CO8A 3UI6A 3L4VA 4GVFA 4DRMA 3BAIA 3IIXA 1I1XA 2FLIA 2Z00A 1HGWA 2VFEA 3WNLA 5G1YA 3UD6A 4AG0A 3NZQA 5D8WA 1V08A 5DIVA 5M2FX 1E6PA 5JVLA 5KINA 3RPDA 3H2AA 1ZBCA 2YLLA 3VOJA 3HGJA 3O9NA 3VKDA 5CBIA 1F74A 1LORA 4DZAA 3E2SA 3DYOA 4N9CA 4WXYA 2BVDA 1JZ4A 2H90A 3PR9A 4WOZA 5A8OA 4MLRA 3BTNA 2WBKA 3UR8A 4A29A 3CS2A 4AXNA 3KS5A 1GNXA 1XM3A 2J6VA 3OOQA 4UTUA 1IEVA 2W27A 4HOZA 3MA8A 3BMXA 3NQFA 2Z28A 1DHPA 4Z2LA 4NT0A 3WBEA 2VL4A 2VNCA 3P14A 4MLJA 1QPQA 4GUHA 2GVYA 3W7DA 2Y8VA 4HPXA 3GPKA 3WYZA 3V35A 3TK7A 3AXXA 1PZ1A 3SCPA 1SZNA 1AD4A 3B97A 1ZB5A 1T99A 1DP0A 1LBFA 1ME9A 2GLKA 2GOKA 5F2LA 4AHQA 4DZ3A 5DIUA 2BXZA 3OLEA 1H1ZA 3OQ8A 3LLDA 1OFDA 5FA5A 4JFVA 2JGYA 2Y7DA 2JFEX 3LMYA 3VDHA 1GG1A 3U2OA 3W1AA 4HK7A 4Y6GA 1VLWA 1QPFA 2B7PA 4NJJA 1H7WA 3ZXWA 3AAMA 3MBFA 3BUVA 3IACA 1AODA 3BC9A 4X2RA 5JIPA 3W7LA 3NL5A 4WGHA 4QM1A 4B5UA 5I3IA 4XSLA 4S39A 2V67A 2PDQA 4JQ2A 3TR2A 2ZR5A 3KHDA 1KFWA 1O5RA 3T2PA 3QQWA 3L4XA 4ENLA 3SJNA 2I7GA 2Y85A 4WKHA 4QLKA 3V3WA 2ACSA 4H9TA 3H70A 3VABA 4C91A 2IUZA 4IIDA 5HW8A 4AZ6A 1UMLA 4ZXOA 1FA2A 1UPMB 3GXMA 3TCSA 2PLMA 1XLMA 3W7PA 4DY1A 4XAPA 4Y9AA 4WGXA 3RFWA 3MUY1 1MWOA 3QOKA 2TAAA 1QNPA 1Q13A 1UYQA 4D6EA 1EHAA 1HGYA 4REQA 1QXLA 4NJGA 1XBZA 4CQDA 5D4YA 4DUXA 2IKIA 2OX4A 3K5XA 3TYZA 2EPKX 1V6UA 4C6CA 2LGOA 3UVIA 2P4VA 4PGLA 4M19A 3TC5A 1GPFA 3B9OA 3RYSA 3CTTA 1BYCA 4I9JA 5A6JA 3U5UA 2WWDA 2JKAA 4H9XA 3H4WA 1X7FA 3CQHA 3M7SA 4HMEA 4LS0A 3BLKA 3OVRA 4N02A 1NWTA 1E70M 3G1VA 4IMDA 3GS6A 2UY2A 1MW3A 2EHHA 2FHCA 4JY9A 1OVDA 3I10A 3UG8A 1VENA 1L6GA 1W3JA 1XIIA 4ZBCA 1ZL1A 3ITCA 1XDMA 4Z1YA 3KP1A 2NWSA 4JPGA 2VYOA 1Q45A 5BWFA 5ABEA 5K2ZA 2HVNA 4GFIA 3NZ1A 3T6CA 4DYJA 3W6MA 1FKFA 2AQWA 3S2MA 4ZS6A 1TYGA 4H7VA 4FNUA 2EPMX 4H6RA 3RRXA 4DPQA 3KZSA 4LAYA 2Y5SA 3D46A 3LTSA 3ELFA 4LAOA 5IXEA 1MEHA 1LT7A 5G2IA 1TUXA 4MWAC 2J77A 1Z69A 2EPHA 3O16A 1V3HA 5IFTA 4FS9A 2WMGA 1OG6A 1M3UA 1UD4A 3V36A 3ZJ8A 1K7FA 2Y8KA 4FI4A 1J5TA 1MXSA 5BXJA 3VNJA 3VNYA 3KDOA 1QAPA 5D38A 4H3DA 4OVXA 3HJEA 4B92A 4HQVA 3VMNA 3VFCA 3OLDA 1X1NA 3EX1A 4NNBA 3LHYA 3AHYA 1I75A 1J6PA 2PB1A 1RBLA 3N9SA 3APGA 1F4HA 4DRPA 2E5DA 4DAFA 2EF9A 3GKAA 5DY2A 3UGRA 3O6CA 1BQCA 4FN2A 4BF8A 1H1YA 2D2HA 4UCFA 1XRFA 4KKXA 4LY4A 4MZ8A 3QR0A 5FL1A 4JS3A 3LCXA 1L0PA 1M5YA 4FALA 3NL2A 3S5YA 3UF9A 2NUYA 1L6YA 2MPHA 2Y1HA 2OVLA 1GVSA 3R12A 2O9TA 4JTDA 4OZOA 3IRDA 4LALA 2OWXA 1PAMA 3FYYA 4GQQA 3CIXA 4NAEB 3BLEA 1Q85A 4AVNA 4O15A 3ZT6A 3LNPA 3OVPA 3FEMA 3K4WA 1JJKA 4HK5A 4YCPA 4DROA 2QAPA 3AIRA 3FSUA 1NFPA 1XIBA 4DN1A 3N18A 2C71A 2W79A 5D75A 1EBHA 4NJKA 2YCIX 4MNKA 4YVPA 1OT2A 3AALA 2X0YA 1E0XA 3L4TA 1S2UA 5BXRA 2PPGA 3WJWA 4GC3A 1JGIA 1J2WA 1HKVA 1A5CA 2YLAA 4FLOA 2F7FA 2WK2A 1IR2A 1HNYA 4LUIA 3RPTA 4MWAA 2OWCA 3UNDA 5CC3A 1ENUA 1HFBA 5LNUA 4UWMA 5BROA 1VBJA 2W61A 1O66A 4HU3A 4UFMA 4YTTA 4QP0A 3R0DA 3WNKA 4ZOCA 4PUJA 1JCJA 3NWRA 4QDMA 3GTXA 3R2GA 1E6NA 1ISVA 5LSMA 2BY2A 2BGSA 4Q7NA 3GVRA 4MG4A 1FWSA 3DDMA 1MQQA 1VFTA 2J78A 3PWAA 4Q8MA 3DFSA 4LU0A 1RCOB 1GTHA 3HMCA 1UUOA 3KVLA 1WZMA 2BTMA 3H2FA 4W9QA 2FFIA 1L6WA 4URIA 2WM1A 2VCDA 2XISA 4H00A 2YR1A 4ES4A 3P5YA 3M0ZA 1NMWA 1M7PA 2C3ZA 3WFLA 4ECLA 3V5OA 3O63A 3TYAA 2WV8A 4XKYA 4MKSA 3B0YA 1VFSA 3QR1A 4HPHA 3MSGA 2GOUA 1OGSA 4UZSA 4RR4A 3BLFA 4MGGA 3PG8A 4WZHA 5F4SA 4GIAA 3VIPA 2VX5A 1YPIA 4UNKA 2QR6A 4GYPA 1GEHA 1TSIA 5CJMA 1SJBA 1T40A 1Z6KA 3CHFA 3QC0A 3QQ1A 1IF2A 5I3GA 4C90A 2XUCA 5LXEA 4GZEA 4DI9A 4R9OA 4EXAA 3AS1A 1K9EA 2V5BA 4XTIA 1HL2A 4DYKA 1S38A 3UBPC 4AD2A 1G01A 1TB3A 3KAGA 4I9MA 4GIEA 2OO6A 3GDTA 3LN3A 1G5AA 4JTSA 4BKNA 3W87A 4FO4A 2MLYA 2DZAA 2AAAA 3CYJA 4IXXA 1YE4A 2OCZA 1FCVA 1J4RA 3N3MA 4Z2JA 1BF6A 5JMUA 3NL3A 1L6SA 4ZGYA 3IGXA 5REQB 1MFVA 1K8ZA 3DFNA 5E6ZA 1DJYA 4XG1A 1XWYA 1JDEA 4MOZA 3F4WA 3IWPA 2OR2A 4GI8A 1JUBA 1GVQA 4NNAA 1I2QA 1QI5A 2F84A 2ZA2A 4KWSA 1H41A 3F4DA 2QDEA 3LHTA 3GH4A 3OZYA 4I8YA 5CPTA 2DJXA 3U2ZA 3VIFA 2E77A 3GDRA 5GQBA 1TTPA 2X7VA 1Q6LA 3KP0A 4QS5A 1ZAHA 4MWAD 3PS7A 2ZDRA 2FGLA 3BMWA 4DUOA 3W2MA 3IIPA 1SQ7A 3BMBA 4AUBA 3NQCA 3W7QA 3CZGA 3N29A 1LG1A 3LX9A 5K7JA 1VP5A 2XFYA 4M0XA 3OHIA 2WQPA 2Y5JA 3L4WA 3HQOA 1LP6A 4BFAA 4CCCA 3T7VA 2QCCA 1E9ZB 4AD0A 3R6IA 1E4LA 4C6LA 3IHZA 3KADA 5I77A 4ZQMA 2VEIA 2HEJA 3HG5A 3APTA 3O6DA 3KOZA 4KESA 3FLUA 3S46A 2X1TA 5AYBA 4K1GA 4CN4A 4D8AA 5DMNA 4QCFA 2QUMA 1LWHA 3EWWA 2Y7FA 3PRBA 2V63A 1YDYA 3ARWA 2C91A 3FGCA 4G7EB 3CQIA 4OBRA 4D6DA 3CWNA 2Y2WA 4ALDA 4PMDA 1I2PA 5GJNA 4OT7A 3ZIZA 1HZYA 1LQ0A 2RSEA 3EGJA 3HBLA 2HISA 2W5FA 1FP8A 1RA0A 4W9TA 2O7QA 5DT5A 2Q8ZA 1UJQA 4FLQA 4HGXA 4FIRA 3AUJA 1TQXA 2C0AA 5I7GA 4TW7A 4DUVA 1AW1A 3VIMA 4GGQA 2M2AA 2DUZA 5F7UA 3FDKA 3B0PA 3NURA 2GPTA 1J5SA 1FWTA 5FAGA 2ZR4A 3UJRA 4XK2A 1DJNA 3BCFA 4RX0A 1YADA 5AVNA 1V3KA 1GOXA 4H2CA 1PX8A 3LCFA 4HD5A 5U4NA 4DRHA 3MI2A 4Q4QA 4GK8A 3H24A 4Z0SA 3T0DA 3SUTA 1HJUA 1F76A 4GXPA 4LF1A 4B2DA 4Y2WA 5CGQA 1U30A 3W1TA 1R3SA 2GGJA 2PTXA 4UR7A 1SM9A 5A8GA 1KWGA 5FSDC 3ZO9A 2O7SA 2XP5A 2VD9A 1XC6A 4RE4A 4JIIX 1W1A1 1CYGA 3GAKA 3USZA