2O9OA

Crystal structure of the buffalo secretory signalling glycoprotein at 2.8 a resolution
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the buffalo secretory signalling glycoprotein at 2.8 A resolution
pubmed doi rcsb
molecule tags Signaling protein
molecule keywords Chitinase-3-like protein 1
total genus 124
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2006-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2o9oA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2o9oA01
2CYGA 2YIHA 1J0IA 2EPOA 1UKPA 3BMWA 3ZT5A 3BLKA 4XV0A 3NSXA 4TOQA 1OGSA 3PN8A 5EFDA 3O9NA 4GO8A 4AXNA 3GNOA 3T0DA 5IXEA 1BGGA 1HXJA 1L8NA 4CD8A 2OWXA 1NM9A 4B15A 3CHEA 1E5NA 4CVUA 1H3GA 4YN5A 1VENA 3AIVA 2D20A 5A2AA 1UD4A 5A6BD 1TR1A 1V08A 4FLSA 4FLRA 2FHFA 4PTVA 4CGTA 4C7DA 1JYVA 1CGTA 4Z2GA 1LF1A 1PBGA 5FOOA 2J74A 2WBKA 3BCDA 1BG4A 4CN6A 4AZBA 3AZSA 1HJWA 3A6OA 1LG1A 3WQ4A 1C93A 4AZ7A 2E4TA 3WQ8A 4M1RA 4HA3A 3TTYA 4AZCA 2QMKA 4JKMA 4AD3A 4H04A 1CZ1A 5DFAA 1E1FA 3GZAA 3W38A 2WSKA 5FD0A 3MUIA 4MNMA 4U2ZA 1XV8A 1MQQA 5A8OA 4P7NA 1ITXA 1VEMA 1WE5A 1E4MM 3PTMA 3D3AA 3EMCA 4DWSA 2C7FA 4DM2A 4H8HA 4RE2A 3GXIA 1OD0A 2WPGA 3ZSTA 2NW0A 1GVYA 4HA4A 6CGTA 4UQEA 1MXGA 1QOXA 4P7LA 3WMBA 2AOSA 3SCWA 1PJ9A 3ZOAA 2CHOA 2E8ZA 3AI0A 1I75A 2WVTA 3VU2A 1EO5A 5ABHA 4PSRA 3OZOA 3NDYA 3ZIZA 4AD1A 3DHPA 1UWUA 3MSGA 2Y8KA 1E4IA 2YL9A 4AIUA 4PUEA 1WAWA 5GNXA 2GVYA 5I79A 1MWOA 1ODZA 3ALFA 3POHA 1VB9A 5JBEA 3U7BA 1LJYA 3ZJ7A 4PMYA 1UKSA 3ECQA 3W26A 4W7VA 1NARA 4MJ2A 2AAAA 4QLKA 4W93A 5D4YA 1UH2A 3AXIA 4N0RA 2BY1A 1CXIA 1CENA 4C7FA 4UCFA 5I3DA 5HBFA 4CD5A 3WIJA 4MDOA 2J7EA 1H49A 3VD4A 4OZOA 1JNDA 4UOJA 2DQXA 3AS0A 1CGVA 1KXVA 2EPMX 1C8YA 3AMDA 3AHVA 4PMZA 5CSYA 3WQVA 4ZENA 4MADA 1E6QM 2PWHA 4DUVA 5A8QA 4UQ9A 3KL0A 1FH7A 5E70A 2CNCA 2VT0A 4EKJA 3VVGA 1W9PA 2UY2A 1GPFA 4YHGA 3RO8A 1NWUA 1QVBA 1KGXA 4MB1A 1V6WA 3QHMA 4PSPA 4TXEA 5D9PA 1XSIA 3DHUA 3EYPA 3W29A 3GNPA 3K1DA 2FHBA 1EDQA 1HN1A 1CNVA 3A3HA 2CPUA 1ITCA 1E6SM 2CITA 2W91A 2ZUMA 3VTRA 4TVDA 1C7SA 1WZKA 2ZIDA 4OOUA 1GONA 3CZKA 3WQ5A 3MV01 1WDRA 3OLIA 3DYPA 4UR9A 5A8NA 3BSGA 2CESA 3SUUA 1OT2A 4W5UA 1ISXA 2YKKA 2D23A 4D6CA 1V0LA 2WCAA 2E40A 5EMYA 3CO4A 2FGLA 2ZXQA 3RCNA 1UWSA 2Q8XA 1OBAA 5JIWA 1QHOA 2V3GA 1SMDA 1GJUA 2QV4A 4GZIA 1DWGM 1UZ1A 1KBBA 5AYIA 3WH8A 3AROA 1CBGA 5FL0A 2ZUWA 1WZMA 1E73M 1V3JA 3PZGA 5M3WA 2GDVA 3GXFA 5GQBA 2XFYA 1TA3A 4HPHA 2GJXA 3IJ8A 2WVVB 1QNOA 4ACYA 3SURA 1H09A 2VRKA 5I6SA 1QNRA 2JFEX 5EB8A 2CBIA 1JD9A 2BV9A 2VR5A 2G3IA 2VOTA 3FAXA 3EDEA 3L4TA 2WXDM 4UFIA 3BAYA 1FA2A 7A3HA 1OIMA 1E0XA 1E70M 1WZLA 1BQCA 3VIGA 5CGMA 3MKKA 4PMVA 3VIIA 3TTOA 3ARWA 3VGEA 2IXVA 2YA1A 3O2LA 5GNZA 4D6FA 1WCGA 4KGJA 4BCEA 5D8ZA 3PBGA 1X1NA 4ZFMA 3VDBA 1XD0A 5IFTA 4MPKA 3BAXA 1QI2A 5IFPA 5AC5A 3IANA 3WF1A 1JYNA 2ZWYA 1GUVA 2WAGA 2OLHA 3FW6A 3VD7A 1JFHA 4UQAA 4D6GA 2ZXDA 3AXHA 3M46A 4BQ4A 1BPLB 3EMQA 1GNXA 1CECA 1B1YA 1AVAA 3AHZA 3WF2A 4JKLA 2EPLX 2J8FA 2F61A 3AJ7A 3QGVA 4IISA 1MW1A 3MMUA 2EJ1A 3LPPA 1EGZA 2XJ7A 2G3JA 3T2PA 1ISVA 1PPIA 2FHCA 1GQLA 2J75A 5BWFA 1K9TA 4H8VA 1UA7A 1DHKA 4PTMA 4Z2LA 5A8MA 3BAJA 4IPLA 4PEEA 3WF3A 2JE8A 5CSUA 3AMKA 1UWQA 2W4XA 2XSBA 2D0FA 1C7TA 1FH9A 1GOWA 4GO9A 1J0KA 2Z1SA 3AYRA 2HVMA 1E4NA 4D6HA 5A8PA 2YL8A 4JFVA 5BROA 1CTNA 3WDIA 2WVSA 1UR9A 1PIGA 3MANA 4PN2A 4JFWA 4QP0A 1FH8A 4LXFA 4U31A 5LA0A 3VIMA 3L2LA 2QLYA 3ZO9A 1J0ZA 1E55A 3FY1A 4F8XA 1NWRA 4CCCA 2OSXA 3RMEA 1UKQA 2XVLA 5ECUA 1UD3A 4KGLA 2ZUNA 1R86A 1FP9A 3IAPA 5I23A 3PZOA 4MB5A 1H1NA 2WVVA 3VGDA 1BVZA 1HT6A 3RIKA 1DP0A 3T09A 1JNEA 4UTFA 2F2HA 3G6MA 1QNQA 3W0KA 4ZE4A 1KWGA 1VBRA 2ZXBA 2YJQA 5A94A 1MFUA 3BLPX 3CUIA 2WC7A 4NZCA 3RM8A 1HKJA 1JZ5A 2VZUA 3OG2A 4OIFA 2CBJA 2A3EA 3KE0A 1EA9C 3RJXA 3W82A 1LWHA 4ZE5A 1GOMA 4PRWA 3HU7A 3KWXA 3WUGA 1E71M 3KEHA 2E9BA 3AISA 3WKZA 1V6XA 2DSZA 3IK2A 1PX3A 2WCSA 3AMGA 2BVDA 2DSKA 3II1A 3O6AA 1LWJA 1M03A 4Q7NA 1KQZA 4GZJA 2PWGA 4JHOA 4LQ1A 2Y2WA 4WJXA 1R85A 3OBAA 1KGWA 1CWYA 1JZ7A 1NQ6A 2WHJA 1JYXA 4EANA 4MAVA 4AIEA 2VL4A 2ZX5A 2W67A 1HP5A 2BS9A 4J7RA 3QHNA 1UD8A 1VAHA 1KR0A 1UG6A 3AICA 3IJ7A 2WZHA 2WW5A 1E1EA 1I1WA 3VIJA 2CBVA 3EBVA 1E6RA 5A6LA 2FGZA 3CUHA 4LPCA 3WDPP 2RGLA 1J0JA 3WUFA 1LL7A 1MW0A 4QCFA 2D1ZA 1G94A 4D6EA 4D6JA 2YA0A 1W3JA 3VKKA 4Z2JA 3D5HA 1V02A 4XZBA 3I3EA 4W8LA 3WBAA 4ATWA 5CLWA 2Y8VA 3N13A 1XRVA 1JZ6A 3WDHA 3VMNA 1VJZA 2WWDA 2IXUA 3ARYA 4MB4A 2ZX8A 3VPLA 3WSUA 3EDFA 4QAWA 3NCOA 1FHLA 3PZIA 1CYGA 2GSJA 1BYCA 2V3FA 3WH6A 4D6IA 2WHKA 3AYSA 4J3UA 3FNDA 4OOZA 3T0BA 1IZKA 1TFVA 5F7UA 2O9OA 1V6VA 2XFFA 4PBGA 1GQKA 1E3XA 4J28A 1XH1A 4BF7A 1QHZA 3CZLA 3A4AA 5A1AA 3VIPA 1JZ3A 4B3KA 4M81A 3ARXA 4PMDA 5C71A 4AZIA 1OIFA 4HU8A 1JDAA 1B31A 3F5KA 2WKLA 1W2PA 3WNLA 4AWEA 2WKGA 1HX0A 3WNKA 4U3AA 1AQMA 3SCNA 4H8UA 1C8QA 1EHAA 3WFLA 2O9PA 1JF6A 2XSAA 1U30A 3MMWA 4TTUA 1GW1A 4DWSD 1J9YA 3N1AA 1EH9A 3MV11 1HJVA 2A3BA 3CZ8A 1V6YA 4KRTA 5D9OA 4Y7EA 3WH9A 3WNMA 2RGMA 3TP4A 3BAKA 2WWCA 1RP8A 4P8WA 1CGXA 2EPNA 4AEFA 3G6LA 3DYOA 2OYKA 3VD3A 3UERA 1B0IA 3FN9A 1MYRA 2O9TA 5C70A 1JD7A 1W91A 1XYFA 3MUY1 2YL5A 3L4ZA 1R7OA 1EQCA 2VVSA 3K4AA 3L4YA 4P8XA 4WK9A 4L4PA 2PF0A 1H5VA 2CBUA 3CHCA 2DIEA 2PBGA 4B9ZA 2WM0A 1DWIM 3SEPA 2Y4SA 3AZRA 4PMRA 2X05A 3F5LA 2BHZA 3HMCA 2F8QA 3PHAA 3GXMA 1A47A 1CLXA 1UYQA 3W4RA 3OB8A 2XVPA 1V02E 3EDKA 4CD6A 1TA3B 3HJEA 3KZSA 4HZ8A 5IDIA 2D0HA 2OWWA 2V5CA 1UWRA 4F9DA 1J12A 2EEXA 2OYMA 3ARSA 2O9RA 4CU7A 3N18A 1W3HA 1UD6A 2XTKA 5HDRA 2ESCA 4WSKA 2VRQA 1XCXA 4AMCA 3WFZA 4TVCA 2VNCA 1FHDA 4F9JA 2BY0A 4UQCA 4UQDA 3VMOA 3N15A 1EHNA 2VZTA 2GFTA 1MFVA 4N42A 4U5KA 1HVXA 1LQ0A 1JI2A 5M5DA 2E9MA 3WMCA 1JAKA 1PZ2A 3WD3A 4JL2A 4WKFA 2VR4A 2WHMA 1OSEA 4P7RA 2BY2A 3A4WA 2XM1A 3AIRA 2IUZA 1W32A 4AD0A 2D24A 5HNNA 4EAMA 3OZPA 1W1PA 3SUTA 1R87A 1H41A 1O7AA 4ZXOA 3SCTA 2VX5A 2HISA 1HF6A 1JG9A 4DM1A 3UESA 2DSVA 1TMQA 4JIEA 5E0FA 1V6UA 1DWFM 5FL1A 2WMJA 4M56A 1J0HA 1Q6FA 4D1JA 1ZJBA 1V3LA 2WMHA 5JBFA 2W63A 3T08A 1MVYA 4ML4A 4LYRA 1BGAA 2CHNA 1GVIA 3PZUA 1W1YA 1W1VA 1V3KA 1QNPA 2DT2A 1XCWA 2OSYA 1SFSA 4AD2A 3WF4A 3ZMRA 3DECA 4FLQA 5A95A 3NSMA 1G1YA 2CETA 2JIEA 2J7DA 4NRRA 5AYBA 1BFNA 2DPEA 4K68A 4PYSA 1N82A 1CXHA 4W84A 1EQPA 4BQ5A 1OWQA 3VNYA 1ZJAA 4HOZA 3MS8A 1QI3A 4UFHA 3UR8A 3UETA 4CVWA 3VIOA 4F79A 1RD6A 4H2CA 3QHOA 2OWCA 4GPNA 2WBGA 4S3JA 4R27A 2DSWA 1P6WA 1WO2A 1H11A 3U7VA 3AIQA 4TVUA 4NSBA 1UA3A 2WK2A 3PZNA 1XSJA 1J01A 3S6TA 4PMUA 4QLLA 4PMQA 2W92A 2A3AA 1IZJA 4OJYA 2PWFA 4MNKA 1FFRA 5FKYA 4KH2A 4U3CA 3I3BA 1KB3A 4PUDA 4GKLA 1SMAA 4MTVA 4AD5A 2GK1B 2ZX6A 2QPUA 5BRQA 2E9LA 2WCGA 2BXZA 3PZMA 1NH6A 1HNYA 3NJ3A 3CUFA 2E3ZA 3AMLA 4P7OA 6TAAA 1W3LA 1RH9A 2GJRA 1VBUA 2VI0A 1I1XA 1Q6CA 4BA0A 1G01A 3AHTA 1KCKA 2YL6A 4AEEA 2QHAA 1SYTA 4D71A 4MJ4A 2TAAA 4D72A 5I77A 1ZBWA 2DH2A 3GNRA 1LL4A 2EO7A 4TX8A 3CZJA 4AZHA 2XM2A 1M7XA 2YBTA 1WZAA 1BAGA 4KMQA 3TTSA 4FK9A 5LYRA 3PZ9A 1UWTA 5HPCA 3UG4A 2PWEA 2W62A 4H7VA 4W89A 1L0PA 2ZX7A 1AQ0A 3WUEA 4A3YA 5ABFA 4GQRA 2NT0A 2VCAA 3PZVA 4TX6A 4W85A 1WDPA 1HVQA 3VX1A 4DWSB 2VQUA 1Q6GA 1QI4A 4PTXA 3OGVA 3QOMA 3ZT6A 3OGRA 2J8GA 1OINA 4OBRA 1BF2A 5A3HA 1KWKA 5GPRA 4UFJA 3BAIA 4QCEA 4MNJA 1E56A 1UH3A 1MW3A 1K9DA 1OGBA 1G5AA 3GM8A 3RM4A 2JIWA 4J3XA 1EOMA 1VFFA 2UY4A 1JXJA 4JZ5A 4E8CA 4AZCB 1CLVA 1KQYA 2PC8A 3SCPA 2ZUVA 4JCMA 1GOKA 4HZ6A 4DUXA 1JIBA 1UQZA 3K8KA 1V0KA 4UOQA 1AQHA 5FCZA 4BQ2A 1CGUA 3WNNA 8CGTA 2VJXA 1CGWA 1JI1A 1XGZA 3MMDA 5LA2A 4AZ6A 3ZJKA 3WBEA 4ATLA 4WKHA 2XG9A 3WH7A 1FFQA 1G0CA 1NP0A 3UG5A 1MW2A 2W66A 4LYPA 1XHGA 1BVNP 4NF7A 1E40A 1CXKA 2OSWA 5I0DA 1EDGA 5CG0A 3BH4A 1CEOA 1B90A 3N12A 5I78A 3WELA 1E3ZA 1MQPA 1JL8A 4KRUA 1IV8A 2X09A 3FAWA 1KFWA 1WP6A 3B9AA 1E15A 1EIBA 2ZE0A 4P7QA 3K8MA 5M03A 3OLEA 1IT0A 3CZEA 2D22A 1HL9A 4Z2HA 1BSIA 3OA5A 1VF8A 2VX7A 1VFUA 2WMIB 5BCAA 2QF8A 1JF5A 1V0MA 3CHFA 5E09A 3WD2A 4XB3A 2VRJA 5IHRA 4GINA 2D2OA 5JH8A 3AMCA 4UFLA 4HU0A 2CIPA 1UKOA 4Z2KA 3PZQA 4E8DA 2CKSA 4YHEA 3W24A 1WDQA 1U33A 5E6ZA 5CLTA 1TE1A 2J79A 4H41A 1B3YA 1M53A 3TONA 4HOXA 1D2KA 5BXSA 4NRSA 1NWSA 2JF6A 2CCRA 1W9VA 2VQTA 4E4PA 5BXPA 3VUPA 5A6KA 4A3HA 3U5UA 4FF5A 5LA1A 1F4AA 4M82A 3VOCA 3JUGA 2J7GA 4U5IA 3NUKA 2MANA 5DF0A 3RPMA 1JAEA 3TA9A 2BY3A 3M7SA 4QDMA 4OUEA 1W2VA 3CZGA 5CJ5A 2DDXA 5M17A 3QR3A 5CQ1A 4FLOA 3WENA 5I2UA 4B16A 2X2YA 5KZ6A 4J27A 2YLLA 2XVKA 3AS1A 1KXQA 1PZ3A 3WD0A 2J4GA 2XPKA 1WKYA 1JDCA 4J3SA 2XGIA 4GXPA 3NYDA 3W81A 2VZOA 2XGBA 3W6LA 1GJWA 3CGTA 4ACZB 3CUJA 2WC4A 4AW7A 1NP2A 2BXYA 1W9DM 4GIAA 1HKKA 2GJPA 1E72M 1U2YA 4PMNA 2VVNA 1OD8A 4MB3A 2YDSA 1ECEA 4AISA 1J10A 4TTGA 5JBDA 3VM7A 2G4FA 2GJXB 2A3CA 1W9BM 3WH5A 1CIUA 2J77A 1CXLA 2BNJA 4LYQA 1NWTA 3ARZA 2WANA 4AD4A 3GDBA 4W5ZA 1GOOA 5CPSA 3CBWA 1ZB5A 2J7CA 4W7WA 5CPQA 5A69A 3QOKA 3MO4A 5DT5A 2D3LA 1UH4A 2WLYA 1DWHM 2YDQA 3B8SA 3L2MA 2BHYA 1K6AA 1E4LA 3ZR6A 2ZUSA 2ZX9A 3WL0A 1ZS2A 1FOBA 1UR2A 4W8AA 4AYSA 5I5RA 3K46A 4QLJA 4BZYA 3BMVA 1D3CA 1V03A 3UG3A 4MDPA 1AMYA 4GQQA 5JUVA 2PWDA 2VC9A 4TUFA 1C91A 4J3VA 3L4XA 3AZTA 2YBUA 4B9YA 1H4PA 3N17A 1JZ8A 3VNZA 2VCCA 3DYMA 1OM0A 3IJ9A 4ZEPA 1B3ZA 2QPSA 1E6XM 3NDZA 3VMPA 4XZWA 1GHRA 1VJSA 3VD9A 2CKRA 4A4AA 3W25A 2YOCA 3VGFA 2C8NA 3THDA 3WDQA 3APGA 3SUSA 3M6DA 2JALA 1US2A 4DUWA 1ZBVA 1CDGA 2YLAA 4X9YA 2CXGA 2PI6A 4HA1A 2ZOXA 2VX6A 3AHYA 3ZT7A 2GUYA 4P8VA 3IAQA 8A3HA 1UR8A 4CUCA 2YA2A 3VGHA 1NOWA 4URIA 3VGBA 5HXMA 2FDMA 4WIWA 5CZKA 3K4DA 1HKIA 5E0CA 3CMJA 5ABFB 4HZ7A 1VEOA 1XSKA 4PCSA 5D9MA 4R5EA 2D0GA 2XIIA 1JDDA 3OLGA 5A2CA 3OLDA 3AIBA 2VZVA 1VRXA 4GZEA 3CIVA 3VX0A 1GOQA 2PB1A 1B30A 7CGTA 1C92A 1OGGA 3AIWA 1FP8A 1NOUA 4RE4A 3WL1A 1UQYA 5A6SA 2G8ZA 5GNYA 1MQRA 3SCRA 4P8UA 3KL5A 3SCVA 2NT1A 4QFUA 1V3MA 2J7HA 1HJXA 5A6AA 4RE3A 1V0NA 1H2JA 1UUQA 1XYZA 3ARRA 1KXHA 2ZUUA 2G3MA 2DIJA 2WMGA 1VFOA 4U2YA 2GK1A 4GI6A 1CPUA 1QW8A 4OBSA 2Z1KA 4JL1A 2EQDA 1X6LA 1B9ZA 3PTQA 5D8WA 3HN3A 4UZSA 1LL6A 2VUYA 3WNPA 1S46A 1B3WA 1BLIA 2XIBA 2VZSA 3NSNA 4U33A 1E43A 2V3DA 3GBEA 1RPKA 1ZL1A 4JCLA 1RP9A 2BVYA 2QMJA 3T2OA 3CPUA 7TAAA 3PTKA 3ALGA 1Q6DA 1HJSA 2ZUTA 3EDDA 3WEMA 1H0GA 1GCYA 1ESWA 1M01A 2DGAA 3S2CA 3WD4A 1X6NA 3SCUA 3DC0A 1JXKA 5BXRA 1ISYA 3T2QA 1UD5A 2WZEA 3W28A 1TVPA 3SIMA 3UEQA 5KEZA 1EDTA 3RM9A 3A47A 3N9KA 3CMGA 3W37A 6A3HA 1F4HA 2G3NA 4HMEA 4EE9A 3A4XA 1O6IA 5BXTA 1US3A 4GI9A 2WMKA 4PMOA 2Y24A 5CPTA 1E9LA 1KCLA 5EFFA 1TVNA 3W6MA 2VO5A 3EDJA 2J78A 3ZJ8A 4W87A 2J7FA 2VMFA 2CERA 3WQ6A 3AS3A 4WKAA 1D7FA 5BRPA 1JYWA 1B3VA 5DEZA 1ZU8A 1GQIA 3K8LA 3UR7A 1V3IA 5DO8A 2XWEA 3GBDA 3J7HA 2JF7A 3ARTA 3TOPA 4V27A 1QNSA 5C8BB 3VDAA 1ODUA 4MNLA 1HJQA 4JFUA 2O92A 3AIUA 4ZXLA 2E8YA 4M24A 1E0WA 5A6MA 5DT7A 1LLOA 3SCSA 1B3XA 1A3HA 3GH7A 1Y7VA 2DEPA 4YPJA 1ZBCA 3OGSA 1C8XA 1BG9A 4PMXA 2GDUA 2VCBA 4BQ3A 2XFRA 1MXDA 1OCQA 3ZJ6A 4IPNB 4C7GA 4J3WA 5I24A 4LX4A 1Q6EA 1KGUA 1G9HA 3L4UA 4F66A 3GH5A 4M8UA 1GOIA 5FIPA 3ZSSA 1EOKA 1PX8A 1UKTA 1C3FA 3M07A 4X0NA 3N04A 1HKMA 3ZQ9A 1DEDA 5HOSA 3SCQA 1OT1A 3MUAA 4CN1A 1BYBA 4JHZA 1GQJA 3F4VA 4EK7A 1E6PA 1W9UA 1E5JA 1GZJA 2WMIA 1WNOA 4CKQA 3PZTA 4UQBA 4AZ5A 2WZIA 1Q4NX 4V2XA 4L4OA 4M29A 3KL3A 1QI0A 1M04A 5EBAA 1J0YA 4GI8A 2XVGA 1HP4A 3BSHA 3MSDA 1R7AA 3N11A 1QHPA 5E6YA 1EO7A 2G41A 3ZM8A 1J18A 5TD4A 3RJYA 3ARVA 2XUCA 4JFTA 5HPOA 1TCMA 2FH6A 3AOFA 3LMYA 1QBBA 3W27A 4HPGA 4UFKA 2VTFA 3AFBA 4UZUA 5AC4A 1J11A 1V3HA 1UZ4A 2WHLA 2W5FA 3CUGA 1QBAA 2OYLA 2DSUA 2CEQA 3MUZ1 4W86A 1HJUA 1JZ4A 3WMSA 2JEPA 3BAWA 4WSJA 2E0PA 4LGXA 1TUXA 2WC3A 3FXYA 3B9DA 1W3KA 4D1IA 4JKKA 3L4VA 2X0YA 2DH3A 1NOFA 4D6DA 1XC6A 5DMYA 2BFGA 3VILA 3CHDA 2BHUA 1BYDA 3VO0A 5ABEA 3BGAA 1BHGA 1PIFA 4UNIA 3VDCA 1BTCA 2ZICA 3ZR5A 4AC1X 4KWUA 1DTUA 5AY7A 1WPCA 5JIPA 1SR0A 4CCEA 3LPGA 3POCA 3ARQA 2VX4A 1DWAM 1WDSA 2FH8A 1PEZA 1BYAA 1KR1A 3SUVA 1UWIA 5IHSA 3WF0A 3U57A 4CCDA 1W1TA 1KBKA 2J7BA 3FHQA 4NI3A 1LG2A 3SCOA 1UHVA 2XVNA 2C0HA 4Z2IA 1YQ2A 2XHYA 3I3DA 3AQUA 4E2OA 1E0VA 2VURA 3WUBA 3VIFA 3WDJA 4V28A 5D9NA 1PX4A 1OB0A 4UOZA 3THCA 3GXDA 2WYSA 2W61A 3MU7A 4HMDA 3VDHA 3FHAA 1C90A 1QW9A 4CD7A 3B9EA 1JGIA 3U5YA 3WNOA 2J47A 4IUGA 4W8BA 4WF7A 3GH4A 3E1F1 5CGTA 2D3NA 2AMGA 4M80A 3AHXA 1UR0A 3NIYA 4CN4A 2WLZA 3WEZA 9CGTA 4PCTA 2BVTA 4WLCA 5BYWA 3TTQA 1UD2A 1TZ7A 2JEQA 5A6BA 3F5JA 4BS0A 3WQWA 2V5DA 1UOKA 2EXOA 5E9AA 2Y5EA 1VFMA 3T0AA 2DT0A 1XH0A 3SUWA 3VD5A 1TG7A 3BC9A 1ISWA 4FMVA 3VINA 3WY1A 1QI5A 4MAZA 4RL3A 2J25A 3GYCA 3BCFA 3BXWA 3WN6A 1R8LA 4Q22A 4AZGA 1EXPA 2WNWA 2ZWZA 4J3TA 1HL8A 4ACZA 1QPKA 2EBNA 1GORA 4CU8A 3EMZA 1ISZA 4IM4A 3UCQA 4X0VA 1W9XA 2V3EA 2DT1A 1VEPA 1E6NA 1JFXA 4HTYA 4JAWA 3CLWA 4S3KA 3GTNA 5A6JA 4HMCA 4HP5A 2A3HA 3WD1A 3AXXA 3W53A 4W7UA 3CH9A 1HIZA 1GHSA 4OKDA 2DT3A 5ABGA 3ARPA 1UR1A 2WMFA 1YHTA 3VIHA 1XH2A 1XD1A 3ARUA 2YDRA 3WEOA 1H0IA 4HOWA 3VM5A 4AIOA 2UY3A 2X1IA 5A2BA 1UR4A 1DWJM 1ZBKA 2UWFA 4DWSC 2X8RA 3LPFA 2WB5A 1Z32X 2WSPA 3LPOA 1WB0A 4JFSA 1PAMA 4CD4A 1CXEA 1CXFA 1KXTA 2V38A 2B31A 3CTTA 2EPKX 2WVUA 3WDRA 3AS2A 1VIWA 3RILA 2XYLA 1K9EA 1CGYA 2XWDA 4PTWA 2NSXA 4CU6A 3RDKA 2ZXAA 1E6ZA 2J62A 4W88A 4XX6A 2PBOA 3AIEA 4XUYA 5CXPA 2X0HA 3L4WA 3OIHA 3VGGA 1JZ2A 4AY1A 3VIKA 1B2YA 1K9FA 4ATDA 4UFMA 2UY5A 4B3LA
chains in the Genus database with same CATH superfamily
4WOQA 1XQKA 4NZ3A 1RQHA 3E5PA 3NSXA 3O9NA 3GNOA 1JCTA 1NDWA 1KT0A 1HXJA 2GDQA 1V5XA 3RGCA 3PBVA 4CD8A 4MUZA 1C9WA 4B15A 2ZRXA 4CVUA 4WXZA 2DVTA 4N9CA 3VE9A 4I5XA 3C2EA 1PYFA 1E9YB 2OX4A 3USZA 4B91A 4N6EA 5AC7A 2XP8A 4C6EA 4KEZA 3VC6A 2A5HA 5C2CA 5I3FA 4LJ3A 4B5VA 3BCDA 3P62A 1C93A 1LM1A 4M1RA 4DO7A 4DF0A 4H04A 4TV5A 5DFAA 1JCNA 4OVXA 4IPPA 1E1FA 2WSKA 3H24A 4C1NB 1P0EA 2E67A 4U2ZA 3EEZA 1MQQA 5A8OA 4AVOA 1ITXA 3ONBA 3STGA 1QU4A 3CM4A 3D3AA 3S2JA 3O6YX 1AJZA 4DWSA 3V3WA 1I0DA 4MWAB 2PDXA 4QG9A 3V75A 2NW0A 4HA4A 4PBFA 1MXGA 2PWVA 1QOXA 4P7LA 2AOSA 3W7HA 1EB3A 2O7SA 1IXPA 3UXIA 3O5IA 4LAKA 3BW2A 5LNRA 4DRJA 3F4WA 3F2BA 3H8AA 3R1ZA 3NDYA 3LRLA 4AD1A 3KVMA 1P1XA 2Q3OA 3ITTA 2HXUA 2HZGA 2HQAA 1CT5A 4PUEA 5AOUA 1WAWA 5GNXA 1S2TA 3GFXA 3CUXA 1DJXA 1SO3A 5HWBA 3W86A 1A5MC 4HU3A 2YXGA 5A5WA 2PURA 3O16A 4MJ2A 1PUDA 5D4YA 1UH2A 1CXIA 4DPPA 2H3BA 4CD5A 4LAOA 1H49A 1UWAA 4QT3A 3SADA 4IMAA 2DFAA 1S2AA 4KERA 1A50A 5CSYA 3LBOA 3FFSA 4O8AA 4EXBA 2JGQA 3CYJA 5H91A 1ELSA 3H2AA 3B9OA 1H7XA 2PV1A 1FH7A 5E70A 2PBCA 1SZFA 1UBSA 4XUGA 4EKJA 3GNDA 1TSIA 3AU6A 3RO8A 1KGXA 1DJZA 4G2DA 3QHMA 1H7OA 2Z2BA 1DQWA 3GDKA 5D9PA 3SJNA 2YCLB 3W29A 3B3DA 2CPUA 1E6SM 1XLIA 3EX1A 2W91A 2ZUMA 3EB4A 3GE7A 1FKLA 1WZKA 2ZIDA 4MFDA 3HV8A 4JR5A 3UA4A 1WDRA 1D7KA 4ZVJA 3OLIA 3DYPA 2GWGA 2D23A 2HS6A 2O55A 1V0LA 2WCAA 2ISFA 2PODA 3O5FA 4WHBA 4J3ZA 4IUOA 3TR2A 2ZXQA 3EX4A 4LSBA 2C71A 3TQKA 2Q8XA 3BQ6A 3OYZA 5JIWA 1ME8A 3HF3A 2QEZA 1SMDA 4NT0A 2PN0A 1AQFA 5G1TA 4B5XA 4GZIA 4AWSA 4LEFA 1UZ1A 1KBBA 3WH8A 1H51A 3AROA 5FL0A 4E2VA 3GW0A 1WZMA 3WQEA 2X41A 3PZGA 5M3WA 3SQLA 5CBJA 2B7QA 2XFYA 4EP8C 3CGMA 5A6TC 2JFEX 5EB8A 4UTWC 4DZHA 2WXDM 2YYUA 4ODMA 1BQCA 4E4FA 1PZ0A 3MKKA 3UPBA 4PCFA 3VGEA 3RAOA 1FWFC 1EZWA 5ABTA 4JTAA 1PKLA 3CASA 5D8ZA 3PBGA 1XD0A 1BRLB 1IXOA 5IFPA 1DJGA 2ZFAA 3IANA 3CEPA 2V30A 1GUVA 3FW6A 4HHPA 1JFHA 2OZ8A 2ZQUA 4D6GA 3M46A 5KINA 2Q3RA 4JKLA 2ZADA 5FSEC 4NILA 2F61A 5JQ9A 1QZ2A 5CPNA 3RRAA 3WG6A 4RDZA 2XJ7A 2G3JA 3T2PA 5HQLA 1ISVA 1PPIA 3LI0A 1TIWA 2GOKA 4H8VA 1DHKA 3UZZA 4Z2LA 1P1MA 5KZMA 3WF3A 3NTYA 2ZRWA 2UZ5A 3AMKA 2Y63A 3MY9A 2QCEA 3UWZA 3MCNA 2INFA 3QV9A 2D0FA 4RV8A 4JFKA 4B5UA 1C7TA 3DERA 1NTHA 3NEVA 3HQOA 4IPIA 1T96A 4KCTA 1HO4A 4DYEA 4D6HA 1US0A 3UPMA 4JFVA 3GTIA 1VGAA 4H01A 3WDIA 2WVSA 4A6GA 3O06A 4JFWA 4QP0A 1Q13A 3ZO9A 1J0ZA 3FY1A 4K8HA 3MP5A 1QUMA 2G96A 3LS9A 3BPWA 1GZGA 4LF2A 4KGLA 4AF0A 4MB5A 1H1NA 2WVVA 4Q8QA 3PWGA 4PODA 5F1UA 1G69A 5AKQA 3W0KA 1P43A 4HCDA 3BLPX 4NZCA 2E68A 2GVGA 4OIFA 2CBJA 1ZENA 1I2PA 1LORA 2A3EA 3PF3A 1EA9C 5RUBA 3HU7A 2QT3A 3RPDA 3KWXA 1EJUC 3WUGA 3BW4A 2QJJA 4S2CA 3WJXA 2E9BA 4DN1A 1V6XA 4FI4A 5CPLA 2DSZA 3IK2A 5BMXA 1PX3A 4MY9A 1K7XA 3A5VA 3O6AA 3I65A 4GGHA 1M03A 5AVNA 3UWUA 1R85A 2QCFA 6TIMA 3W84A 1NIUA 2W27A 4NAEA 1LQ2A 3S47A 4I6KA 2VL4A 1F6YA 2R1LA 1HP5A 1YRRA 3AICA 1OJXA 4MIMA 1I1WA 2QNEA 3EBVA 3KBNA 4GQGA 3WBYA 3IVUA 4KRZA 4H9MA 1J0JA 2H6RA 3WUFA 2RDXA 3RU6A 1LCOA 2D1ZA 2FMNA 1G94A 4B2DA 2YA0A 1A7XA 5I98A 3EEGA 1XX1A 1HZYA 4Z2JA 1XKYA 4UCGA 1V02A 3W7EA 2HRWA 1MEHA 3TSBA 1BKSA 1M6JA 2XH4A 4W8LA 4W9QA 4RDWA 2Y8VA 1UW9A 3BQ5A 1JZ6A 3WDHA 3CXOA 2JGYA 1RA5A 4ZOBA 2IXUA 3ARYA 4C6FA 1MSSA 4QAWA 2XN2A 5F2GA 1CYGA 3MCMA 2ZZ1A 4ZQRA 4D6IA 4A8RA 2W3ZA 4NIRA 2OTDA 1T5AA 1TFVA 2DY3A 3NZPA 2O9OA 4IXXA 1XF0A 2BX7A 4RK8A 2QF7A 2P50A 5G4WA 4YTRA 2G97A 3A4AA 2AGTA 5A1AA 1UBPC 4B3KA 1C29A 4M81A 5C71A 4PMDA 2CHRA 3U2OA 3LGEA 3MBFA 3TYAA 1MZHA 3AUJA 4IGMA 4Z0SA 2I5QA 2UZ9A 2GUUA 3F5KA 3CL8A 1QAPA 3CAVA 1MNSA 4C6KA 3C2VA 4IFKB 4U3AA 3WBXA 1BF6A 1C8QA 4GACA 2XU2A 3GKFA 1TCOC 3N1AA 2BZNA 3HJZA 5EBUA 3SB0A 3CZ8A 4CNNA 2Z1BA 4Y7EA 3WH9A 3WNMA 3BAKA 2GGJA 1RP8A 3MUCA 2B5UB 1CGXA 1XIIA 1TTQA 4ECLA 4MVAA 1J6YA 1B0IA 1MYRA 3HPXA 2XPBA 3TW6A 4H7CA 2YL5A 1R7OA 5C2GA 3ANYA 1JRBA 1VLWA 3DBPA 4L4PA 5G1MA 2V9DA 3CHCA 1KNWA 2L5HA 2WM0A 4QS6A 1DWIM 4HN4A 3SEPA 5JH2A 3AZRA 2BHZA 4Q8PA 1JPIA 3HMCA 1Q6RA 4G8TA 4UXDA 2XZ7A 3GTXA 2YCJA 1F8AB 4LWWA 1KA9F 4ZOEA 3GXMA 4ZA0A 3GTHA 3W4RA 3OB8A 2MNRA 3DU0A 1WDDA 2Y89A 3HJEA 4JTTA 1R2SA 3O0KA 5T26A 2ZRUA 3TDFA 4ERAA 2V5CA 4F9DA 5BXJA 3PUGA 1T41A 1S5WA 4CU7A 3N18A 1W3HA 4LANA 1UD6A 3NZQA 5HDRA 3UI4A 2ESCA 1XS2A 4DZ3A 3KCEA 2JKEA 3WFZA 3TYUA 4AMCA 3UR2A 4F9JA 1XXXA 3MSRA 4UQDA 2F84A 3VMOA 3N15A 3GX9A 2GFTA 1MFVA 2TSYA 1HVXA 2OO0A 3EWXA 1BD0A 3OA3A 1QFEA 4H7ZA 1JI2A 4H9VA 4NXKA 3IRDA 4UTUA 5AC8A 2X16A 4Z1CA 3IKDA 2VR4A 2Z6IA 3A4WA 3URNA 5LNWA 2XM1A 2PDWA 4IT1A 2OELA 1PB0A 4BFAA 5E0KA 2Y88A 1MUMA 4Q8OA 3OZPA 1Q7MA 3L23A 4ZXOA 3O6CA 4LC8A 3PSVA 3WQDA 2PDIA 2HISA 1JG9A 4XBJA 3IV3A 3B0UX 5FL1A 1A5SA 2AAMA 1J0HA 5T91A 2E28A 3P0WA 4EVZA 4ML4A 5DY3A 1BGAA 2Y0FA 3GU2A 4OHQA 1XLHA 1AL7A 3TMQA 3W07A 1GT8A 1W1YA 1W1VA 4L6OA 2DT2A 4AD2A 4XZMX 3WF4A 1MDRA 3DECA 4FLQA 5A95A 1G1YA 3S5ZA 3WH0A 1FKIA 1E1CB 4L56A 4Q4MA 4R3UA 5HINA 2DPEA 3O05A 3BJTA 1WOAA 1X8FA 1TJ2A 2FZBA 2J88A 3WK3A 3GYEA 3LHYA 4REQB 1EL3A 5AHEA 3KP0A 1QXLA 3S5YA 3R6IA 4QJ1A 4H2CA 1X7FA 2OWCA 5FEWA 8XIMA 1KO0A 2WBGA 1P6WA 4Z1DA 2QPXA 1WO2A 1Y5VA 3AIQA 4TVUA 4C6JA 1MZRA 3Q65A 1KCZA 3BG5A 4MZYA 4PMUA 2M08A 4PMQA 2TODA 3R43A 2PWFA 4MNKA 4P61A 1FFRA 1SFLA 3I3BA 3O5QA 4DRHA 2OO6A 2DVUA 4AD5A 3L5LA 2GK1B 2J9YA 4D8ZA 2ZQVA 2E9LA 4KETA 1VP5A 2BXZA 3TTEA 1DL3A 1FWJC 3GWQA 3MVTA 1JPMA 3S46A 2E3ZA 1W3LA 2Z29A 3EOUA 2VI0A 1ROTA 1I1XA 4B92A 1G01A 2YL6A 2QHAA 1IEIA 4WGHA 1VFHA 1OG0A 2TAAA 4D72A 4IQEA 1ZBWA 4L5ZA 2XM2A 4FNQA 2YBTA 3EY6A 2PTYA 1FTXA 3BURA 4CEXC 5HPCA 3PZ9A 2ADAA 4W89A 1AQ0A 1OVDA 2I5GA 5LNVA 2PDCA 2NT0A 1WDPA 2Z28A 3CMFA 3UWVA 5AB3A 2FPVA 4DWSB 3SR7A 1QI4A 3TSDA 2VOMA 4OBRA 1PTAA 5A3HA 3N34A 4N6FA 3WLKX 4JYDA 1AH0A 1GKRA 1TJ0A 1ADOA 3DCPA 1K9DA 4HYRA 1OGBA 5D09A 5HANA 4AZCB 1S3HA 5J5DA 4ZL1A 2ZUVA 1DJIA 1XDMA 1JIBA 3DFQA 4UOQA 5FCZA 4BQ2A 1ZCNA 1B6CA 1CGUA 8CGTA 4TV6A 1CGWA 1JI1A 1Q8AA 2ASHA 1EP2A 5LA2A 3PAJA 3WBEA 1OEPA 4ATLA 1VCGA 2FPTA 3LDVA 4MZ1A 5FJPA 1U79A 1G0CA 1OK6A 4AF0B 1NP0A 3UG5A 1VPYA 2XINA 2BOEX 4LTSA 1XHGA 1E9ZB 1WOBA 1M5YA 1LUCA 1XLFA 3NL6A 1CEOA 5CGQA 4AH7A 3IIPA 2Y70A 4ZR8A 4IICA 3GVQA 1V7AA 4FS9A 2ZQTA 3DKLA 4GUGA 1E15A 4LB4A 5M03A 2R94A 1IT0A 3CZEA 2RURA 2GOUA 1DIKA 2D22A 4IGNA 4Z2HA 1BSIA 1VF8A 2QUMA 4LY4A 1VFUA 1JF5A 1V0MA 1FUYA 2VRJA 4J5NA 4UIOA 1DJQA 3RMJA 2D2OA 3BJSA 5JH8A 3KLKA 3AMCA 2DORA 2POTA 3P5YA 4HU0A 5JH1A 2BASA 3RNDA 4Z2KA 5D37A 4E8DA 3F1QA 4LVGA 1ZY9A 3NO1A 1KRMA 5C9XA 1AW5A 1WDQA 3QSTA 4UUIA 5CLTA 1F3XA 4S2BA 3TC7A 3QFEA 2J79A 3E12A 1AH3A 5J04A 1OZQA 1KFEA 4HNVA 1YNPA 1W9VA 2F9RA 5HR7A 3VOCA 2J7GA 4U5IA 2ACUA 3W7PA 3B97A 3RPMA 5AC6A 3TA9A 1IEQA 4X2RA 1SJCA 2Z2AA 1KV5A 1H5YA 4WJ8A 3WENA 4DJFD 4XD4A 4NX5A 5REQB 3NQGA 3S4TA 1LRTA 2YLLA 4J27A 2XVKA 1KXQA 3WD0A 1ZQ5A 2YW3A 1GJWA 2WC4A 3R0UA 3WLIA 3RHGA 5AECA 4FX6M 3STCA 2Z7KA 1HKKA 4GIAA 4PMNA 4RZ5A 1OD8A 3R0KA 2YDSA 5HMEA 4TTGA 2PLKA 2GJXB 4LEQA 2A3CA 6XIAA 3B05A 4CLMA 3HPSA 4LYQA 2PV2A 4BWLC 3WZ0E 4AD4A 5CPSA 4FNSA 3TQVA 2V81A 4C6QA 4E38A 4NU7A 5CPQA 5A69A 1QJWA 3URQA 2D3LA 4LUSA 3P3BA 2WLYA 1TTJA 3B8SA 3INPA 4INFA 1Y0EA 1WKDA 3ZVIA 2F2KA 4I5RA 2A4AA 4JFMA 1ZS2A 1UR2A 3ZLFA 4W8AA 4AYSA 5I5RA 4HBKA 3BMVA 4K2SA 1D3CA 4ODRA 4GQQA 2BVWA 3QZ6A 2EULA 1YDYA 4TUFA 1XLMA 3LSBA 3E6EA 3FVMA 3C8FA 4LW7A 1R30A 1JZ8A 3VNZA 3HPAA 3VOHA 2VCCA 3HMJG 3GG7A 4ZEPA 1B3ZA 2QPSA 3KOFA 3NDZA 3VMPA 1EUAA 3CT7A 3VD9A 2PCQA 1AW1A 4RZBA 4O14A 1MRAA 1XC4A 2XGZA 4Y9MA 4JYFA 3V4BA 2YOCA 4HNUA 4C6DA 3WDQA 2JALA 4FP1A 2CLOA 4DUWA 1ZBVA 4IZGA 1JUKA 3W85A 3IJ6A 2O4MA 2PI6A 3URBA 3AHYA 1XYBA 3PJUA 3DBNA 4K7YA 3GHTA 4F2TA 1HKVA 2C15A 4BEQA 3NFUA 3UQIA 4URIA 2D9FA 2FDMA 4PZVA 1Y5WA 5CZKA 3K4DA 4DBWA 3JVAA 3MCOA 3UP8A 1XSKA 4DUOA 5D9MA 3GC2A 3EPOA 3H2FA 3OLDA 4I9JA 4A8NA 1DOSA 4HBOA 1XFBA 3ANUA 3CIVA 4C6PA 2Q71A 4E3VA 4XBKA 4RE4A 4HPNA 2VDHA 1NFGA 1SW0A 3A9BA 1AFSA 3GW3A 3NVDA 4QJ5B 3I4EA 1HGWA 1S5TA 1V3MA 2WJEA 5A6AA 1Z6KA 3FV9A 4KR0B 1XYZA 3OYXA 4GH3A 2DIJA 3TXZA 2WMGA 2DZAA 1FHUA 1ONXA 2ZR6A 4C6OA 4OBSA 2EQDA 3PTQA 3U8GA 2PTDA 1UUMA 3TFXA 3CAKA 3U9IA 3LUOA 3R8GA 1BLIA 2VZSA 5EPDA 4U33A 3NDOA 1RPKA 1XGDA 4L9YA 1EJRC 2VEFA 7TAAA 3S8HA 1ZZMA 3ALGA 3FYPA 3W76A 3Q2DA 1GG0A 5HW6A 2I16A 3WEMA 3GSMA 1GCYA 4YTQA 3IARA 1G4PA 2Y61A 3LMZA 3WD4A 4NQ1A 3NZ1A 5I7GA 1JXKA 3IIZA 1M68A 1ONWA 2J13A 3RK8A 4HCLA 3TAKA 4QT2A 1O4UA 3O5DA 5HJXA 1UP0A 1L2QA 4MZ8A 2KI3A 3RM9A 3AUOA 4HMEA 4UDMA 3A4XA 5BXTA 4F0SA 2WMKA 2PTZA 2Y24A 4V1YA 4C1KA 4CQAA 4Y9OA 4XKYB 2E5CA 1Q6LA 5K9XA 3RR4A 2R24A 3OVRA 2J78A 4UNLA 2H9AA 2M2AA 5HW7A 3OZYA 4GC4A 4JTEA 3TOYA 2NWRA 2CERA 4PE8A 4WKAA 3NPVA 3CQJA 1UJPA 3KBSA 2QDEA 1F76A 1R9ZA 3TJXA 1KFCA 2XWEA 3J7HA 2ZVRA 3O5MA 3ARTA 4IG2B 2XP3A 3THQA 4V27A 1QNSA 5C8BB 4TNSA 1HJQA 3AIUA 4X60A 3G1HA 3ZS4A 1REQB 4QXIA 5T9BG 1T11A 2CW6A 1Y7VA 1G4SA 1YNQA 1FCUA 3MBDA 3OOQA 1RXOB 3OGSA 3C3NA 2WJFA 3UXKA 1XP3A 3G0SA 2GDUA 5DCEA 2VM8A 2HE5A 3ZVHA 3KOZA 4C7GA 1GTHA 4J3WA 3W9ZA 2VC6A 1XLGA 2RFGA 1A80A 1L1PA 4H3DA 2V5KA 4YL2A 3H7VA 4G1KA 2HS8A 3ZWSA 4UMAA 5J5RA 5HOSA 1OT1A 3LM7A 1RBLA 3MUAA 4CN1A 1EJVC 1V8EA 1GQJA 3ZXWA 4ZBCA 3DGBA 3FYOA 2CWXA 4GGBA 3PZTA 4HYVA 4AZ5A 4I8DA 1HL2A 4L4OA 4M29A 1M04A 3FJLA 4H19A 3LBCA 4HTBA 5HJLA 2Y7GA 4WQ6A 3MSDA 1R7AA 2PUZA 5E6YA 1EO7A 5FF0A 1KM2A 4FNTA 5FJOA 1W5NA 3A4JA 4DPQA 3ARVA 2XUCA 4A3QA 3P80A 5AC4A 1J11A 3A13A 3G1SA 2W5FA 1WYIA 3CUGA 4Q4OA 4PCNA 5AHFA 3REQB 2OYLA 1GYNA 3MJYA 2CEQA 2V5BA 3WJZA 1N8FA 3WMSA 1TUXA 3FXYA 3B06A 2GVLA 1OFDA 4JKKA 1V93A 4GFSA 3M41A 3IKGA 4PGLA 2PZNA 5DMYA 1C9HA 3CHDA 1XR2A 2D2HA 3VO0A 4YWSA 4QROA 1BHGA 3LCIA 4MPQA 4XO7A 1ICQA 4UNIA 4B4FA 2ZICA 3G1XA 3R13A 3LUTA 1DTUA 4NJGA 2CLPA 1WPCA 5JIPA 4H6RA 4U10A 3POCA 3WJWA 3E9AA 5KZEA 1WBJA 1OF8A 3LCWA 2FH8A 1SQ7A 4XAPA 1J2WA 2GPTA 3PRBA 5IHSA 2CZEA 3W7KA 1EX1A 3E5BA 2Q02A 3TC6A 2HNHA 3U57A 3FS2A 3SGUA 1OX4A 2J7BA 1D7HA 1TPEA 5EGRA 2XHYA 1E0VA 3WDJA 3PFRA 3M0ZA 1OB0A 4UOZA 2HPMA 3GXDA 2IKJA 2F2DA 3H54A 3MU7A 4HMDA 3GR7A 3FHAA 3SW6A 3H70A 3NL5A 1LLZA 3CB3A 4GUHA 3E1F1 5CGTA 1Q1CA 9CGTA 5CAKA 1U5VA 3O1NA 3TTQA 1F74A 1TZ9A 4G7FA 5LHEA 5A6BA 5DRCA 3RLHA 1YE6A 4ICNA 2XP6A 2W9MA 3SY8A 1UOKA 3WLOA 1FWTA 4O52A 1T0OA 2C0AA 3URAA 2QJGA 1XH0A 4A35A 3BC9A 1ISWA 1G67A 1QI5A 4B5TA 1XCFA 3NOEA 2NX1A 3BCFA 4AX6A 4AZGA 4MGGA 3SQMA 4ACZA 2EBNA 2QS8A 3T40A 3PS7A 1GORA 1PKYA 4S3AA 3DKJA 1ISZA 4PFMA 4X0VA 1W9XA 1K3UA 2QJHA 1E6NA 3BGGA 4C6CA 2QDGA 1JFXA 2ODOA 1IT7A 4HTYA 5FF4A 4JAWA 3S83A 5A6JA 3QV7A 4HP5A 2QV5A 2A3HA 1SSGA 1HIZA 2DT3A 2WMFA 4QNEA 3WEOA 1H0IA 5LNUA 2X1IA 1JCYA 2FFCA 1KTCA 1KBJA 1QOPA 3R4IA 4DWSC 1GJPA 3LPFA 3MTWA 4ZO6A 1GVQA 4IIGA 4IT4A 1WKEA 1X39A 1Z48A 3JU2A 1SO6A 4CD4A 2CLFA 1GVSA 2NLIA 2P5NA 3TNBA 4BF5A 3GFZA 4V1XA 4TX9A 3CTTA 3KBMA 2BG5A 2EPKX 2WVUA 1VIWA 4XD3A 2XYLA 3GUGA 1R3YA 3V0SA 3KX6A 5I3HA 2NSXA 2LLEA 4CU6A 3HFYA 5EY5A 2J62A 5HMDA 4W88A 1YPXA 2PBOA 4XUYA 2X0HA 1X96A 1SR9A 3O63A 1GZ1A 3OODA 4AY1A 1K9FA 2PGRA 4ATDA 3GXPA 4UFMA 2UY5A 3PRAA 4DB7A 2CYGA 1J0IA 1YW1A 3BMWA 3BLKA 3L68A 1OGSA 4A22A 5EFDA 4GO8A 3L0KA 4O12A 1BGGA 4XKYA 5IXEA 4LCSA 1UZHA 4FIQA 1NM9A 4K8GA 1H3GA 3PULA 4GHRA 3TEVA 1FKKA 3B04A 2EG8A 4PCPA 3UW6A 1EZ2A 5A6BD 2KGJA 2J27A 2E1DA 4Y96A 1V08A 4FLSA 4FOKA 4EF9A 3OVPA 1FWIC 2FHFA 4LC6A 4PTVA 3O5OA 2J74A 1BG4A 2Z7GA 1ZGDA 3WO8A 3VFLA 3AZSA 1HJWA 3WQ4A 4W9OA 3M0LA 1JR1A 2E4TA 3PWIA 3TTYA 4JKMA 4JIPA 1WUFA 1RLDA 1EGMA 1QW7A 4IPJA 2V5LA 3RX4A 3S3GA 4FR6A 2RJGA 4MNMA 3BO9A 3ZR4A 2VWTA 4RW5A 4DF2A 5LGZA 2DG3A 3AWOA 3G1FA 3NEHA 1U83A 4CNUA 2PF8A 5F4XA 2UBPC 2DZVA 3NQBA 2WPGA 1GVYA 6CGTA 2NXGA 4M7TA 4UQEA 3ME3A 3W7NA 5K7JA 1UMYA 3RUBL 4JNYA 3MQTA 4MYAA 3ZOAA 2E8ZA 2WVTA 4LH8A 4FXFA 1EO5A 5ABHA 4JBRA 3OZOA 4Q4SA 3UVIA 3ZIZA 1R9YA 3DHPA 5H8UA 1IXQA 1UWUA 4C5YA 2Y8KA 2YL9A 4O1EA 2GVYA 2DW7A 4I7VA 4PFHA 2PE4A 1W1A1 1MWOA 1NSGA 2BGNE 1ADDA 4Q8TA 4ZCWA 3ZJ7A 1UKSA 4D8AA 4OECA 1A5LC 1XW8A 3LTSA 1GG1A 3DFYA 3QPZA 3AXIA 2QGHA 3KRUA 1T40A 3H21A 3WLNA 3WIJA 3KRSA 4NNCA 2ON3A 1KBLA 4Q8NA 3AS0A 4O4WA 1CGVA 3LLXA 1TPFA 2EPMX 4JTCA 1IWBA 4S38A 1YDNA 4AUBA 5I06A 3N6QA 3WQVA 4YVXA 3EOLA 4DUVA 4H6QA 3C2RA 3KL0A 3BCJA 4KWOA 3ITYA 1XM3A 1J93A 3UJ2A 4Q8UA 2X1UA 4ZTXA 4F48A 4AYGA 5AHIA 5CZ0A 3TAOA 1J5TA 4E2BA 5L6UA 4TXEA 2HPIA 3DHUA 3SSZA 3E96A 5HW8A 2Y62A 2FHBA 1EDQA 1S5MA 2DUAA 4G6CA 3TFCA 2D69A 3U48A 3CZKA 4PMJA 3SZ8A 4DLMA 3LNPA 4Z17A 2V69A 3QTGA 4MGVA 2CESA 3KAGA 2CC0A 4W5UA 4D6CA 1PE1A 3P84A 5HNTA 5FA5A 2DZTA 4NHVA 2FGLA 1OBAA 5H1WA 1TQJA 4I9TA 5AYIA 4EPBC 3T0CA 1SZGA 1XIFA 1XWYA 3EWZA 1V3JA 3LXCA 4LU0A 5SWUA 3H26A 3GXFA 1O68A 3OW1A 3BG3A 2IKIA 3BLOA 3IJ8A 2WVVB 3QR0A 3SURA 4X22A 4XAFA 2VRKA 5I6SA 1QNRA 1DE6A 3V7PA 2I56A 1W1IE 2G3IA 2D2JA 2FVMA 4GJ1A 3IIVA 2BOFX 7A3HA 1E0XA 5DXXA 2XH7A 3VIGA 5CGMA 4EXQA 5B8IC 2A6LA 4DRIA 3VIIA 3NPUA 1ONEA 2FVLA 4D6FA 3VDBA 4TR9A 1FDYA 3G22A 1O94A 2P53A 1F2JA 3DI1A 2OFNA 3KVKA 4AWTA 3WF1A 1JYNA 1XUZA 2NQ5A 4LUYA 2WAGA 3NQEA 4ZO9A 5DBUA 4BQ4A 1CECA 1LQAA 2QZRA 3WF2A 4KWWA 3I6RA 3MMTA 4PBEA 3EWYA 3TV8A 4PL2A 1FCQA 4F2BA 3MMUA 2EJ1A 1Q2SA 4QISA 5C7VA 4Q3MA 1TO3A 4CQDA 2J75A 5BWFA 1UA7A 2OT1A 4PTMA 1IEVA 3NXLA 3DFNA 5CSUA 1XG3A 1EJSC 1UWQA 2B7NA 4R9OA 1PWLA 3W2NA 4LB3A 5C9RA 1JQXA 5DMNA 1FH9A 4GO9A 2Z1SA 3AYRA 3B4UA 1BWKA 5TNVA 5A8PA 4L6DA 2PDPA 3E2SA 2Z00A 4JEJA 3OVGA 3VNJA 4Q8VA 2ZZ3A 5HWCA 2PTWA 4LXFA 5LA0A 3VIMA 4J2MA 1TE6A 3OOBA 3JR2A 1OX5A 2OSXA 3RMEA 1EJ7L 2XVLA 1FHVA 1R86A 2YZRA 1FP9A 3IAPA 5I23A 4NUWA 3PZOA 2O7QA 2F6KA 5XIMA 2TMDA 2PPPA 4GCXA 5DIUA 1RAKA 3T09A 1JNEA 4UTFA 3G6MA 1Q6OA 4IIBA 2P8BA 5A94A 4RNIA 1FKRA 1AD1A 3OG2A 3B40A 4OGZA 5I3IA 3KE0A 5CKSA 5L9FA 3LGDA 4Q4RA 1LWHA 4DROA 4DAFA 4ZE5A 1L6SA 1GOMA 4PRWA 3OBEA 3QGAC 3AISA 4WDXA 4NP7A 3NI6A 3L5AA 3L7RA 2UV8G 2WCSA 4O57A 2V2CA 3II1A 4JICA 3H6OA 4Q7NA 1KQZA 4GZJA 4LQ1A 3O5KA 2VWSA 4IP4A 3WQGA 5HAOA 1JYXA 4KKXA 3ABXA 4PUMA 3TLLA 4HBEA 2ZX5A 1VRDA 2W67A 4J7RA 4DRMA 3QHNA 1VAHA 3UPWA 4TQTA 2Z4GA 2YDAA 1E1EA 3VIJA 1TVLA 3MWAA 3UYIA 1E6RA 2GJNA 3CUHA 3N2XA 4LPCA 4C6MA 3NO3A 1LWIA 1LL7A 3FSUA 1MW0A 2WQDA 3E2QA 5EL1A 4JDBA 2Z0IA 4D6EA 5AFDA 3PPCA 4RXGA 4PUKA 1AZ2A 2VDIA 2FLIA 3N13A 3AXMA 1XRVA 1SO5A 3VMNA 1VJZA 3CQHA 4MB4A 2ZDSA 3VPLA 5HATA 4LV4A 2P8CA 1BYCA 1V4YA 2QCMA 4GX8A 3AYSA 4G2PA 1W56A 3G3MA 1O1ZA 1YX1A 2C1IA 3T0BA 3W7LA 2KR7A 1V6VA 4KWSA 1GQKA 3TCZA 4IT6A 1OFEA 1XH1A 2EG7A 3ENLA 3NXFA 1UIPA 4GQBA 3FJ6A 2ISSA 1JZ3A 1NU5A 1YTEA 1VPXA 4AZIA 1OIFA 2X1RA 3CPGA 1JDAA 2FZDA 3UT0A 2PLCA 3H2CA 4OV4A 5C2XA 2WKLA 4G5DA 1SUXA 2WKGA 3WNKA 2E25A 4H8UA 2XSXA 1EHAA 4HVXA 2O9PA 1JF6A 2XSAA 4MOZA 3MJMA 3R8RA 1TREA 1GW1A 2Q8LA 2IMRA 3MV11 1EH9A 3QN3A 3EOOA 1ZAHA 3BOFA 2A3BA 1TX2A 3BV4A 1KFJA 5D9OA 3O5PA 4M51A 5CEWA 4ZPWR 4P8WA 2NQJA 2EPNA 3EIPA 4AEFA 3G77A 5FACA 3VZYA 5REQA 2OYKA 2XZ9A 3UERA 4I3GA 2O9TA 1EWDA 4XAYA 3ERPA 3F7JA 4GY1A 2NX3A 3L4ZA 2ZZ7A 2VVSA 5C5YA 4P8XA 4RUBA 3IIOA 4B9ZA 3LZ5A 4REQA 1K4HA 1P6CA 2Y4SA 4ZFCA 2PC4A 3QQ0A 4F0RA 7TIMA 1ME7A 4FN2A 2F8QA 4DO5A 3T6CA 1FKJA 1UYQA 1RHCA 1VFTA 3C52A 2XVPA 4ZB2A 2AGKA 2VHLA 4DJED 5IDIA 4HJFA 4H6EA 5E93A 2OYMA 1R2TA 1JPHA 4NNAA 3PBUA 3TN3A 3L2IA 3N2BA 3IRSA 1NFPA 1OYBA 3QRHA 4TVCA 3MYOA 2A7PA 4I7UA 2JZVA 4ORIA 3LCHA 1MI3A 2PZ0A 3M0VA 2QCDA 3R5EA 4BY3A 3JZEA 1TWWA 4HKPA 2XP9A 1EJTC 3P60A 2Q6ZA 3WMCA 4JL2A 3DFTA 3N4EA 4MLJA 1RK6A 3DI0A 2FTPA 3TYBA 2D24A 1PV8A 2QDDA 2FYMA 1CLKA 1XLLA 1FKSA 1DJHA 3FA4A 2C79A 2I7GA 4QQUA 1R87A 1O7AA 1ZPTA 4Q4KA 4JFIA 1AZ1A 1U5HA 5FAJA 1FWDC 1QMLA 3UESA 4JIEA 1V6UA 1FKTA 3RLUA 1DWFM 3UA3A 3GS6A 2REQA 4D1JA 1EYEA 1NDVA 3PK7A 1ZJBA 3MDYB 3BOLA 2AQOA 4LYRA 2CHNA 3IGSA 3S2LA 1V3KA 1H61A 1KW1A 2Y7FA 3H2EA 2OSYA 5D33A 1SFSA 4ZZ9A 1O95A 4O10A 2Z26A 4K8EA 3ZMRA 3V1PA 3NSMA 4J4KA 4GUFA 4RPPA 2JIEA 3EAUA 3MI2A 3FXGA 4JX6A 4IQJA 1JPDX 3PNZA 2O56A 1OWQA 3VNYA 2C14A 4M1BA 1QI3A 4UFHA 2FJKA 2INZA 5HWJA 2C18A 3HO8A 1LT8A 3QC0A 4JTIA 1POJA 3UR5A 1V51A 5D2XA 1JJKA 4HT3A 3WLLA 3QHOA 2YGYA 3PR9A 4QG6A 1PTDA 3UXAA 3EGJA 4XWUA 1ENUA 1XLCA 4R27A 2DSWA 2VGIA 3U7VA 1H11A 1EP1A 4ENLA 1R47A 3LERA 1T8XA 1VH7A 4E5TA 1J01A 1EPVA 1TMLA 2PDNA 3FJ4A 3GU9A 4QLLA 1IZJA 4OJYA 3STEA 3DGRA 4KH2A 4U3CA 3MKVA 2YBVA 1TWZA 4XK2A 1WXYA 4R34A 2QPUA 4FZIA 4MKVA 2WCGA 2KFWA 4O1CA 1NH6A 1HNYA 3P2VA 5CPMA 3AMLA 6TAAA 3M5VA 3CWHA 1VBUA 2NLYA 2PMQA 4BA0A 4MY8A 3AU2A 1R9XA 1SYTA 4B90A 4O17A 2NUXA 3V16A 4D71A 4IXHA 3IGUA 4MJ4A 4DVOA 5BOFA 2A7RA 5CC6A 2KE0A 4IWWA 3T9PA 3W73A 3VAWA 5I77A 4F2UA 3GNRA 4IQDA 1UROA 3S1WA 1B57A 3N4AA 3E0LA 2EO7A 2QAPA 4Q7BA 2TYSA 3CQKA 4AZHA 1F73A 1M7XA 3G8EA 4GVHA 2ZRVA 2CLEA 1UP3A 3C0JA 5LYRA 3TTSA 3GXTA 3T4CA 4Y9NA 1K8CA 4H7VA 3VZXA 3WUEA 4A3YA 1Q65A 2VCAA 5DX7A 4W85A 4WDUA 4BHYA 1JQVA 2ABAA 1HQTA 4LUTA 2R14A 1B5TA 3OGVA 3ZT6A 4HU4A 1W1ZA 2J8GA 1LOLA 4UFJA 4A8IA 3DZ1A 3TK7A 3QM3A 4MNJA 1MW3A 3V5CA 1Q4WA 2VC5A 1R3RA 4DYKA 2ACSA 4JTSA 4LNCA 4F0KA 1JXJA 2OU4A 2RAGA 3S1VA 1CLVA 4C65A 1KQYA 4GBUA 1RCOB 3SCPA 1GOKA 2VXNA 3K8KA 1AQHA 3CQIA 4CNSA 1F40A 3MPGA 1I6NA 1XGZA 3MMDA 4AZ6A 1VPQA 1YDVA 3QFWA 4R0XA 5AHNA 4HPJA 1PYMA 3T81A 3FAPA 4PH6A 4A2SA 3C6CA 1RV8A 1UPMB 3HOJA 4OBTA 1MW2A 2BDQA 3HGOA 4LYPA 1BVNP 2OSWA 1E40A 3GVWA 5I0DA 1XLJA 4HPXA 3EWBX 1KLZA 1B90A 4EXAA 3LXAA 3PBMA 2OCZA 4J4NA 1JL8A 2F23A 2RSEA 4L80A 5BWAA 5GPGA 1WP6A 3GXNA 3CWOX 4P7QA 3OLEA 2QJMA 3OHIA 4E3TA 4U86A 4LBRA 3FYYA 1KM1A 2P3EA 2WMIB 4UR8A 4XB3A 1YLVA 2Y7DA 4GINA 3LCXA 4UFLA 4F0MA 4GUIA 5DRIA 3TJIA 3PZQA 4NAFB 3DX5A 1FQ0A 4JN6A 3FA3A 4J4OA 1GW9A 5G2IA 3TONA 1T8QA 3EX3A 3KAIA 2V8ZA 4HK6A 3M0KA 2FZ8A 3C3UA 2X30A 5BXPA 1SGJA 3CL6A 5HMSA 5LA1A 4MWAC 1N1AA 4QBXA 4R7JA 2WNQA 2MANA 2WJZA 4RJEA 1J4RA 3TQPA 3TN5A 3M0JA 4ZQPA 1FWHC 1PO9A 1YXYA 4KIEA 1FY6A 3ITGA 4M6QA 4OUEA 3CZGA 5M17A 3NQVA 3QR3A 1L6FA 1SSDA 2X2YA 2GVEA 1BXCA 1F61A 3AS1A 1V79A 3KXQA 2J24A 3W2JA 1M65A 1JDCA 1WKYA 2XGIA 4UTMA 3NYDA 4Q7IA 2VZOA 2XGBA 1VD6A 2RDTA 3W6LA 1XBZA 2OKOA 2IKGA 1GYMA 2PDUA 2NUYA 1U2YA 2H90A 2VVNA 4DZ5A 3G1AA 1ECEA 4AB4A 4AISA 3MP4A 3VA8A 3CPRA 2G4FA 2WZTA 5E9XA 1W9BM 1ECQA 1CIUA 2J77A 2BNJA 4NI8A 4LUTB 4S3DA 3ARZA 5XIAA 1OX4B 5G4EA 2WANA 3GDBA 1GOOA 3CBWA 5DMMA 3SSJA 1ZB5A 2J7CA 3QEZA 1DJYA 4N02A 2VFHA 2BHYA 3PPGA 1R3VA 2LPVA 2ZUSA 1M1BA 3OPSA 1FOBA 2P3ZA 3S0CA 4HN8A 4QLJA 4LS1A 1XYMA 4MDPA 1AMYA 4LAVA 1R9HA 1YE4A 4US6A 1LBFA 1C91A 4DLFA 2YBUA 1VFSA 1BXBA 4K39A 3I6EA 2PDMA 1E6XM 2QAFA 4XZWA 1GHRA 4ODOA 1VJSA 4O19A 4KT2A 5I00A 3VKAA 2ZKMX 2F6XA 3E2RA 3VGFA 1DQXA 6REQA 5G2HA 4AVNA 3L12A 3FGCA 3APGA 2HBVA 2DZPA 4J2PA 4LUIA 4X9YA 2CXGA 3NAVA 1PCWA 2FZ9A 2VX6A 1Q7QA 4DYJA 4PTNA 4ICMA 2IPGA 3ZT7A 3TCEA 3RFWA 1V77A 1EWEA 4AWUA 1DIEA 4QJ4B 4GK8A 4LCRA 4DZAA 4OUIA 4OWGA 5B80A 5IRPA 4RE0A 2V2HA 1F5ZA 2F21A 4WIWA 3W7IA 1XPYA 3L67A 1WX0A 3MP3A 3NVTA 5E0CA 3CNYA 1KM3A 3EB3A 4PEKA 1K6WA 4HZ7A 2ZQ0A 5D75A 1F6KA 4O28A 2D0GA 3OLGA 2YCLA 2FJUB 2GGEA 3GU0A 4O1DA 3LB0A 1GOQA 3KW3A 2PB1A 1B30A 1C92A 3GLCA 1TWIA 4WY0A 4IH3A 4LY8A 3ORWA 2A2IA 3REQA 3KACA 5A6SA 2QCGA 1PDYA 4S3BA 3ABQA 1EC8A 3QH2A 4GXWA 4TX0A 1BQGA 2I9UA 1I45A 3UZ5A 4ALDA 4LVAA 1U1UA 5BU6A 4BR1A 3HG5A 1H50A 1V0NA 1H2JA 2R1NA 1PBKA 4E8GA 1DIDA 1WQ5A 2ZUUA 4G7EB 3PB0A 1HXVA 1DBTA 3ZVHB 4GI6A 1QW8A 2QR6A 2YXXA 4PUNA 1X6LA 2EG6A 4JYSA 1OFBA 2AQVA 1N8WA 2G95A 4UZSA 4U85A 5EMKA 4KPLA 1S46A 1E43A 2J6VA 2PS2A 3GBEA 1ZL1A 1R3QA 4JCLA 1RP9A 4ZTYA 1Q6DA 2PSNA 1HJSA 3ISIX 4XAKA 2VC7A 1M01A 2DGAA 3KCJA 1ALDA 5C54A 1X6NA 3CS2A 3DC0A 3SECA 1GEQA 1WXJA 2PLJA 3T2QA 4ERGA 3L66A 1X97A 1YNYA 2WZEA 2FQIA 3F4CA 4FAPA 3GNXA 3GIQA 3SIMA 5CAHA 3E02A 3L0GA 4ZPVR 3LM3A 4L1WA 3N9KA 3K5XA 3CMGA 1F4HA 5BZAA 2QCLA 1IEWA 3NA8A 1VLIA 4LF1A 1GEHA 3KCLA 4PMOA 2PD5A 1E9LA 3IJDA 1TVNA 4IMCA 1EA0A 1REQA 3B8DA 3EDJA 3PBWA 5LKYA 4X9SA 3TSMA 4W87A 2HMCA 2VMFA 3TW7A 4JIQA 1J2BA 4Q8WA 1QWGA 3WQ6A 4QSFA 4S3GA 3N2CA 5BRPA 1JYWA 1B3VA 2VFGA 3W75A 5GJMA 1BKHA 3UR7A 4BK9A 5DY2A 4JTRA 2Z2UA 4BI7A 3I4KA 1RQEA 2F38A 2VFIA 4MNLA 4JFUA 2O92A 4ZXLA 2E8YA 3BVJA 1C8VA 1LLOA 3SCSA 4UTTA 2G3FA 4GOAA 3GH7A 4QIBA 1XKJA 1FAPA 5H6HA 2DEPA 3MHGA 4EAYA 3CIWA 1ZBCA 4PMXA 4JYEA 4HNTA 1MXDA 3ZJ6A 4IPNB 1S1RA 1G6CA 3Q4DA 4LX4A 1Q6EA 4F66A 4DT4A 2VR2A 2HTMA 4LBSA 2ISVA 3ZSSA 1EOKA 1UKTA 3BLLA 4DXVA 4HMNA 1HKMA 1DEDA 3W6YA 1V6TA 3SCQA 2DUZA 3GKAA 4FSAA 3F4VA 3CIXA 1E5JA 1J4HA 3NGFA 1GZJA 2WMIA 1AK5A 1GQNA 1DXFA 2VFDA 4GVFA 4CKQA 3WLTA 1Q66A 3N29A 1Q4NX 3S9YA 4V2XA 4ZSUA 2XIMA 3DG3A 2XVGA 3BSHA 3TDBA 4ODNA 5MKGA 1QHPA 3WBWA 2G41A 3ZM8A 5TD4A 3B03A 1VZWA 3U4FA 3GU1A 4JFTA 1TCMA 2WNZA 2R8WA 3AOFA 1OFOA 3LMYA 3FJNA 4HPGA 4UFKA 1PL9A 2VTFA 1UZ4A 3SO7A 1SZRA 1QBAA 2DSUA 1HJUA 3F2DA 4WY0B 4X61A 3QW4B 3C2OA 3V0UA 4CEUC 3R94A 4GJJA 2ZR5A 2E0PA 4LGXA 3DESA 3B9DA 1W3KA 4XTIA 2DQWA 5EYWA 1IIHA 3DFHA 3LU2A 3UZYA 1RVGA 2FB3A 3C4UA 1R3SA 3N14A 3KAHA 1LBLA 3SBFA 4Z42C 2BHUA 2YCKX 4NJJA 3BGAA 2CZ5A 1J8VA 4C6IA 3VDCA 1BTCA 5CPOA 3ZR5A 4AC1X 5AY7A 3HGSA 1L6GA 3SJ3A 3HG3A 2OODA 3GRIA 3CGNA 1POKA 3ARQA 2HE8A 4YJ5A 5FF2A 1BYAA 4MFEA 4RR4A 4JQ3A 1HTIA 6XIMA 2Y8UA 3NOYA 3VFCA 3M16A 5D32A 1KBKA 5D04C 5MHBA 5A8GA 3SCOA 1UHVA 3IK4A 2XVNA 2C0HA 2BGSA 2X40A 1YQ2A 3I3DA 3AQUA 2VURA 3UZXA 5JMUA 4FXJA 4H9XA 1KKOA 1PX4A 3D46A 3S1UA 5CSSA 5F1VA 2R82A 1KCXA 1UC4A 4JN8A 3W71A 1C90A 1QW9A 3GO2A 1JGIA 1PHWA 3WNOA 1Z42A 3C0SA 1G7VA 1L6WA 1A4MA 5TQLA 1QASA 3M5ZA 1RJRA 4RLIA 3NZRA 4WD0A 4M80A 3AHXA 4XISA 4CN4A 2DZBA 4WLCA 3IV8A 4LUSB 4EWND 1TZ7A 2J66A 3F5JA 1AUSL 3GG1A 1H63A 2V5DA 3FOKA 1ZFJA 4K7VA 2Y5EA 4C60A 1VFMA 3M5XA 2DJLA 6ENLA 2DT0A 3LTPA 1TG7A 4FMVA 4MAZA 3OU8A 3GYCA 3CU2A 3WN6A 2WNWA 1SFJA 2ZWZA 1HL8A 2MUCA 1EXBA 1QPKA 3SRFA 1S5VA 2QCHA 4IM4A 4NAFA 2Y7EA 3NWRA 4C6NA 2DT1A 3V35A 4Q6XA 4JXCA 3CLWA 4S3KA 3GTNA 3AXXA 3W53A 4Z1YA 2CXEA 2Y85A 3ARPA 4KIRA 4JFLA 3DXIA 2YDRA 4HOWA 3VM5A 2A21A 1M9HA 2UY3A 1YPIA 3U0HA 1UR4A 1ZBKA 2UWFA 3HQPA 2RH9A 4PRTA 3IVTA 3LD5A 7ODCA 1JCMP 3P61A 1WB0A 3W2KA 1CXFA 1CXEA 3BK0A 3GDTA 1ICSA 2V38A 2P10A 2B31A 3SY1A 2R1PA 3G3DA 1TCDA 1EBHA 5HMFA 3AS2A 4P2VA 5DBTA 4QR6A 5AYXA 4MLRA 3ZYZA 3SGGA 3RDKA 1E6ZA 3HA1A 2PFHA 4XX6A 1OFRA 3OIHA 3U2ZA 4MYXA 3VIKA 1DV7A 1QPNA 3FDGA 3PPFA 2PDYA 1RJQA 1SZNA 2YIHA 1EPXA 3S1GA 1UKPA 1FWWA 3ZT5A 2MLZA 4GABA 4TOQA 4AXNA 3A5FA 3LCFA 1L8NA 3S5NA 3EOEA 5CCZA 3CHEA 5GVJA 1P0NA 1DHPA 4YN5A 4FF7A 3AIVA 1D6OA 2D20A 3LYEA 4J40A 2EPHA 4LT9A 2OEJA 2RDUA 1YMYA 4JTQA 4FLRA 3W02A 4CGTA 1WAUA 4C7DA 1CGTA 4Z2GA 1LF1A 4GBDA 1PBGA 3WQCA 3N2OA 2NVAA 2PCEA 3O5GA 3SN1A 1ZALA 3A6OA 1LG1A 3AALA 4AZ7A 3OJGA 3WQ8A 2QMKA 3STFA 2OOGA 4AD3A 3HQ1A 2H9AB 4EOUA 1HGYA 3MUIA 1FWNA 1KM4A 4N9BA 5D03A 2RKXA 4P7NA 1WE5A 1E4MM 3PTMA 2FDSA 3W7QA 1O5XA 1NDYA 3EMCA 4S3FA 1HFBA 2C91A 2C7FA 4DM2A 4H8HA 2M1IA 4RNHA 3GXIA 5AHLA 2EKGA 1CW2A 3ZSTA 4HNNA 1YBQA 3RX3A 3P6LA 3WMBA 1NAL1 3XINA 3SCWA 3C0QA 1VS1A 1PJ9A 2CHOA 2VFEA 1I75A 3VU2A 4HHLA 1EYWA 1IGSA 1K7FA 4Z08A 4KEMA 3MW7A 3IPWA 2YR1A 9XIMA 4ADTA 2XP7A 4YS1A 2HSAA 1VB9A 4NNRA 2QJIA 5JBEA 1LJYA 5FAGA 4JIRA 3ECQA 4ML9A 3W26A 1NARA 4QLKA 1MO0A 1QNVA 2E6DA 1WA3A 3H4WA 1CENA 4C7FA 4UCFA 5I3DA 5HBFA 4MDOA 1WDWA 2J7EA 3VD4A 3R25A 4OZOA 4UOJA 3T42A 2DQXA 1NJJA 3A23A 7XIMA 5DCBA 1A0EA 1C8YA 3AMDA 2ISWA 4Q4PA 4PMZA 1FX6A 2VENA 3UZJA 4MKNA 1E6QM 1XRSA 4O4VA 5A8QA 4UQ9A 4MKSA 3AYVA 1GVFA 4XD5A 3WLJA 3OO2A 2UY2A 4PL1A 2ZTJA 3CV2A 3UJRA 3PAOA 4YHGA 3UQBA 2AKZA 1NWUA 5J6EA 1W1B1 4S3EA 5LHFA 2WO5A 2E5DA 4MB1A 3KZPA 2H8ZA 1IR2A 3TLQA 3NQMA 5KITA 3RYSA 1XSIA 1K8ZA 3EYPA 4R53A 2ZC1A 4OE7A 1CNVA 3A3HA 3JYMA 2YPIA 2GGGA 4TVDA 3OHMB 3MKCA 4HD5A 1GONA 3WQ5A 1UCWA 2I1OA 3OQ8A 3LCGA 3UVAA 3BARA 5G2WA 2PGFA 5A8NA 3BSGA 4L1XA 1TJ1A 3RFAA 1H7PA 5IBXA 4DBUA 1ISXA 3W1AA 3H22A 4AG0A 3RCNA 1UWSA 4CNTA 4AC7C 4L65A 1QHOA 3G0UA 3CAWA 2QV4A 1YBQB 5CSRA 3P93A 4H2HA 1UZDA 2VD9A 2ZUWA 1E73M 3GHSA 4UWMA 2SFPA 3M7WA 3VOJA 5FF3A 3LHWA 5KTLA 4ACYA 2QKFA 4FOUA 5FJRA 1M3UA 4GCAA 4UC5A 1CB2A 2VGGA 4U84A 4JTGA 4K6AA 4Z0JA 2VOTA 3M44A 3FA5A 3EA1A 2X7VA 4FAMA 4UFIA 3BAYA 4RDYA 1KFBA 3LTYA 4IMGA 1E70M 1WZLA 4LAUA 2LKNA 3OZMA 3O5RA 4QZVB 4PMVA 5FJUA 2IXVA 2NXHA 4XZNX 2RJHA 2YA1A 5GNZA 3IGXA 3NURA 1WCGA 2G50A 4BCEA 1X1NA 2Y5JA 1OCJA 3EPNA 1VBJA 1KTNA 4MPKA 1RR2A 3BAXA 1QI2A 4C90A 3QV8A 3UYCA 3W1XA 3W7GA 3LBMA 3SIZA 4M3PA 5LSMA 4TO8A 1P6BA 3A9IA 3VD7A 3F4DA 4UQAA 2BSLA 5C9UA 2V82A 1BPLB 3EMQA 1B1YA 1AD4A 2EPLX 2J8FA 3D3FA 3AJ7A 9RUBA 1TZZA 4IISA 1I2OA 4JY8A 4H00A 5HWNA 2FHCA 4O11A 3HG4A 3RLVA 3WMLA 2ZVIA 2ALDA 1A0CA 3G0XA 1KC7A 2W6RA 3BAJA 3UBPC 1B9BA 3TYEA 1W3TA 1OADA 2WZMA 1G7UA 4LV9A 5D02A 4KCVA 5ECVA 3NYZA 3O15A 4QNWA 4IGHA 3M43A 4WDTA 2DIKA 1PIIA 3WQOA 2GGHA 2XFWA 1K8YA 4IP5A 1EC9A 1LLWA 3LCLA 2HVMA 3QR1A 4IPXA 2ZR4A 5I3KA 4UTKA 3UF8A 5BROA 4F0LA 2ACQA 1H62A 1FH8A 3HQNA 1UP2A 3L2LA 1I0BA 3ONCA 4JTUA 2QLYA 1XDLA 1U1HA 4KWVA 1KM5A 3N2MA 4F8XA 3A3WA 3MI3A 4CCCA 3KTSA 1AL8A 5ECUA 2ZUNA 3D47A 4X63A 3IUDA 3VGDA 1RLCL 1XLBA 5FEXA 2MPHA 1BVZA 1HT6A 4JTJA 1D7IA 2Q01A 2F2HA 2QVNA 3MUXA 5KMYA 4NX0A 1QNQA 4ZE4A 1VBRA 2ZXBA 2HWGA 2YJQA 5LGXA 1MFUA 4JFJA 2VUNA 3CUIA 3JZUA 2WC7A 1A4LA 2VZUA 1YDOA 3NQ2A 4KEUA 3FCPA 3W82A 3FEMA 4NAEB 2ZA3A 2I14A 1E71M 3QY6A 4DXXA 2PDFA 3WKZA 4FO4A 5C9ZA 4JGDA 1TTPA 4GNVA 1LYXA 3CEUA 2DSKA 3UQAA 1R3TA 4EACA 1CX9A 3C2FA 3L9CA 1TQXA 4G1NA 1JCHB 4JTFA 1KM6A 2HJPA 4WJXA 4JTDA 3OBAA 1KGWA 3K13A 1CWYA 4GYPC 4B4HA 1NQ6A 4AIEA 3KRZA 1HKWA 5LXXA 4HSOA 2WPBA 3IACA 1UD8A 2OT0A 1NQKA 3P81A 4FIRA 1UG6A 3IJ7A 5DN1A 2WZHA 3L65A 4JQ4A 2CBVA 2FGZA 3T7VA 1IT8A 3CT2A 2QGYA 3W1TA 2CZVA 3WDPP 2RGLA 3LV6A 1XICA 3MHUA 4NZ5A 4QCFA 2WOQA 4FALA 1Z9AA 4WDWA 4GZ7A 4C02B 4DBEA 2QUUA 2PDQA 4MUPA 3DENA 3I3EA 3WBAA 4ATWA 5CLWA 1OYCA 2E5BA 1OFQA 4BWLA 3WSUA 3EDFA 4FX8A 2HNEA 1LT7A 1FHLA 1LOSA 3PZIA 3O6DA 1D8CA 4Q4QA 2ISDA 2V3FA 1NSJA 1EFZA 3R2GA 4J3UA 3QZEA 1IZKA 3E3HA 4V33A 1R0MA 4M6UA 3VKDA 2DV0A 1ZP3A 2FB2A 3CZLA 1IE7C 4O50A 3VIPA 4DBSA 4MHBA 3ARXA 4BKNA 4UBPC 1DQUA 3DC8A 4DO4A 3QY8A 4S39A 4HU8A 4O16A 4JTHA 1W2PA 3WNLA 4AWEA 1HX0A 4KW2A 1AQMA 4FOJA 3GTYX 1JVNA 2F4EA 4KBXA 3MMWA 4TTUA 1J9YA 1HJVA 3W7RA 1V6YA 2Y6ZA 3UCCA 1X1ZA 2DVXA 3OG3A 2WWCA 2IPFA 3VD3A 3FN9A 4HSNA 2JQXA 2OX1A 4FNPA 4QGCA 1XYFA 2HBXA 3W1LA 5I3GA 3L4YA 2FZNA 2PRMA 2PF0A 1H5VA 2CBUA 3O5JA 2DIEA 2PBGA 3DG7A 1KTBA 1Y8BA 1JDFA 4YNGA 4CQCA 8TIMA 2X05A 3F5LA 1T99A 1IYXA 4GISA 1Q63A 1IWAA 1N55A 3GUWA 4KQNA 1TPB1 3BG9A 5G1YA 1A47A 3B8UA 1V02E 3EDKA 3KZSA 1PCKA 2D0HA 1JUBA 4FR1A 1OFPA 2EEXA 3AWNA 4YLWA 3W3OA 1IEXA 4UNKA 2V5JA 4LVFA 3TZNA 4HK7A 4PTDA 4R85A 4RCXA 2I9EA 5C7HA 2R1KA 3U3HA 4N9DA 1ITQA 1JUEA 2VRQA 3ODKA 3MA8A 5FEPA 1MRQA 1OQFA 2BY0A 1T6MA 4O1AA 4W9PA 1EHNA 4IOTA 4N42A 1AJ0A 2E9MA 3LENA 3ZLHA 1PZ2A 2XIQA 1O1HA 4WKFA 2KO7A 2WHMA 1QPFA 1OSEA 3S6DA 3W74A 3UI6A 4A2RA 1KFLA 2BY2A 3SRHA 3AIRA 4PRRA 1Q45A 4EF8A 1W6TA 3QXBA 1ZNNA 3S5OA 2HK0A 2VELA 1S3TC 1S2VA 3F4NA 3GVGA 4H9UA 4EAMA 1W1PA 3QW3A 3WJSA 3JW7A 2ZRZA 4PULA 3T4WA 3SCTA 3QZAA 3NQDA 4DM1A 4O8RA 3NQ6A 2DSVA 3ES7A 5E0FA 1P7TA 2CU0A 2G37A 2H3DA 2Z1XA 1B4KA 4UMCA 2C1GA 3UJSA 1ONRA 3M6YA 2WMHA 4Q32A 4EPEC 2IW0A 4F40A 3T08A 1MVYA 4NY2A 3NQ7A 1XQLA 3OEXA 3G18A 4LS0A 1TX0A 3EZ4A 2YSWA 3PZUA 2GLKA 1NDZA 3PVFA 3TWAA 1SZEA 2EF9A 2J9ZA 4AFYA 2JK2A 3LK6A 2CETA 3PY2A 1XLKA 2OR2A 2J7DA 4NRRA 4K37A 2PDHA 3KS5A 1BFNA 5D38A 4PYSA 3LGGA 2JBMA 3EA3A 4XTDA 4ODQA 4W84A 2W0UA 4FXRA 4BQ5A 3UF9A 1FWGC 1DXEA 5CG7A 4HOZA 3MS8A 3UR8A 3UETA 1SJAA 4UTLA 4L3NA 4Y8EA 4IL0A 1RD6A 4L9ZA 2VGFA 1TPUA 1WKFA 3G1DA 3E2VA 2QQ6A 5DO2A 3CYVA 4NJIA 3UWYA 4Q8MA 4IGSA 4S3JA 3CH0A 3HPZA 4ZQMA 2WK2A 4MM1A 4Y9PA 3S6TA 4LRTA 3FGCB 5I09A 2EJAA 2A3AA 2IF4A 1FVPA 1EEXA 5E1QA 5FKYA 1XJBA 1KB3A 3PP7A 4PUDA 4DJDD 4GKLA 3HG2A 2ALRA 1SMAA 2ZE3A 4DZIA 3V36A 2ZX6A 2P76A 4PC8A 4FNRA 5F2LA 3T07A 3VZZA 5D2WA 3NJ3