2O9OA

Crystal structure of the buffalo secretory signalling glycoprotein at 2.8 a resolution
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3-like protein 1
publication title Structure of the buffalo secretory signalling glycoprotein at 2.8 A resolution
pubmed doi rcsb
molecule tags Signaling protein
total genus 124
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2006-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2o9oA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2o9oA01
1BVZA 1NOWA 1MQQA 1G01A 5AYBA 3VGGA 3SCNA 3AS0A 1V08A 1M53A 3BAYA 1UD4A 1XSJA 3KEHA 5LA0A 1J18A 2FDMA 4P8XA 1E6QM 5AYIA 2BVYA 4FLRA 1DWJM 2QMKA 2PWFA 3W53A 1OWQA 4D1JA 1UWSA 3W6LA 2G8ZA 5KEZA 2XWEA 4W87A 2DSVA 2BXZA 2C8NA 2XVPA 3OGSA 5AY7A 2WYSA 1EQCA 3ARQA 2WCAA 3DYMA 2O9OA 1LL6A 3MUIA 4CN6A 3RPMA 3PN8A 5ABGA 1VFMA 2YLAA 4UQEA 3ARZA 4AIOA 3WD1A 4PMYA 1JF6A 1LL7A 3KL0A 1CECA 1DWAM 2V3EA 2E3ZA 2DGAA 4PTXA 1W3KA 3SCQA 1CGUA 3VDAA 4AY1A 4HU0A 2EEXA 1QHOA 4AD0A 1BTCA 3CUHA 1QI0A 2WMIB 1QNSA 2Z1KA 5IHSA 3OZPA 4UZSA 2XG9A 4UFKA 1OGGA 4MDPA 3GM8A 1JAKA 4QAWA 1ISWA 2UY2A 3N17A 2GSJA 1HP4A 1CEOA 4Q7NA 1OT1A 2Y4SA 2A3AA 2WNWA 1CXKA 3SUUA 4LX4A 4UQCA 4F8XA 2VZSA 3GBEA 1L8NA 2WCGA 1PX3A 2J8GA 3F4VA 2HVMA 4JFSA 4UOQA 3MMWA 3WUBA 2BV9A 4PMRA 3RDKA 1RH9A 2Y5EA 3FHQA 3SUSA 1BYBA 5CGMA 5GQBA 3VILA 2PWHA 3AZTA 2BXYA 5A6AA 5C70A 1V02A 3CIVA 2VVSA 4M8UA 2VTFA 3UR7A 3PZVA 3MSDA 5IXEA 3NYDA 4CCEA 1DP0A 3RMEA 4WF7A 2V3FA 3F5JA 3AS1A 3CZJA 5FIPA 5HNNA 1UA3A 1UR1A 2E9BA 1UWRA 3ZM8A 1GJUA 3M46A 1MYRA 2FHFA 5C71A 3OZOA 3TTQA 1C7TA 1E5JA 4JIEA 4WKFA 3W25A 4W86A 4DWSC 3I3BA 5ABEA 5I24A 4IUGA 3CZGA 3HN3A 3VIFA 3U7VA 5A8PA 1V3LA 3WD3A 1R7OA 3W26A 4GPNA 1K9TA 4Z2KA 2VJXA 8A3HA 3A4AA 4PCTA 3B9DA 4HMDA 3LPPA 5HXMA 1PX8A 1E4IA 3B9AA 1H2JA 3O6AA 3QHMA 3VGHA 3KL3A 1ODUA 2C0HA 4W7UA 5JBDA 3SCUA 5D8WA 3CHFA 2CEQA 1UQZA 4GQQA 3F5LA 4JKMA 4QDMA 3EMZA 1UD8A 4W89A 4P7LA 4S3KA 2J4GA 4TVDA 3WQ8A 4D6CA 1UR8A 3ARVA 2CKSA 4OBSA 3WY1A 1NQ6A 2X05A 1C92A 1W1PA 5A8MA 4J7RA 2XFYA 5GNYA 4PMOA 3MS8A 4HA3A 3PZMA 3CUGA 1MXDA 3AIRA 1UD6A 1Y7VA 4JKKA 2G3JA 5A69A 1NWRA 1FH7A 4AMCA 2D3NA 4CD4A 1Q6EA 1J9YA 3DYPA 3ARSA 4W8BA 5BCAA 4CU6A 3UERA 1HJVA 3ZOAA 1TE1A 3CPUA 3UR8A 3CUIA 4D6HA 2UWFA 2DQXA 3MSGA 3L4UA 4JCLA 4CU7A 4DUXA 2VNCA 2WMGA 1HVXA 1FP9A 4B16A 4OKDA 3UCQA 1MW0A 3VNYA 1HL8A 3ZJKA 3BAWA 4PUEA 5E0CA 5CLTA 1QBBA 1UR0A 3VDHA 4ATWA 1VIWA 1WO2A 3CHEA 1XH2A 1X6NA 5CPTA 3BCDA 1OGSA 3AMKA 1NP0A 1EGZA 2YL9A 1M03A 2XIIA 3I3DA 2DIEA 1GOKA 4M81A 3TTSA 3VINA 1CENA 1LWJA 1FHDA 1NH6A 1XH1A 1ZBVA 1IV8A 1GONA 1GW1A 2UY5A 4JZ5A 4V28A 2BHYA 4MJ4A 3ALGA 4BQ3A 3MUAA 1DTUA 1H0GA 2WMJA 2JALA 3WL0A 2VOTA 3CZLA 2AAAA 3OLGA 4CUCA 2VRJA 1QNOA 5EB8A 4MPKA 1CIUA 3W29A 1GPFA 3ALFA 2Y8KA 4Z2IA 4BQ5A 4XUYA 3WNMA 4AXNA 2EPMX 4AD5A 1E9LA 1GCYA 3GH7A 4HZ6A 4AIUA 4WSJA 3ZJ8A 1CYGA 1AMYA 2OLHA 2DPEA 2TAAA 2VUYA 2FHCA 1E1EA 4WIWA 4M82A 1I1XA 1ZS2A 4PMDA 4PMZA 3VGEA 2E40A 2QPSA 2YA0A 2J7GA 2OYMA 4JKLA 1JXJA 4UQ9A 2RGMA 4AD1A 3UETA 5M03A 1FA2A 1GHRA 1WP6A 1H0IA 2D23A 3AHXA 4NZCA 4AWEA 1EOKA 3N1AA 3VIIA 1J01A 1H4PA 1VJZA 4YPJA 1FOBA 4AEFA 1BLIA 2VX6A 2W4XA 4OJYA 5A6SA 2EQDA 4UCFA 1CBGA 3J7HA 2J7DA 2VZTA 3DYOA 4E2OA 4AZ5A 2VCBA 1W9VA 3ARYA 3VM7A 1PZ2A 3AZRA 3VU2A 3FXYA 2VI0A 1H5VA 3OLIA 4ZFMA 1Z32X 1GZJA 3D5HA 2D0HA 1GOQA 2WHMA 4UTFA 3CZKA 2CXGA 1E4NA 3VPLA 1WDPA 5KZ6A 3ARTA 2Z1SA 4NRRA 1BPLB 4U33A 2EPOA 3WNLA 1CGTA 3VM5A 4BA0A 1Q4NX 1OM0A 2BS9A 3WNOA 2ZUSA 4BF7A 2J7FA 4X0VA 2WC7A 4X9YA 2J75A 4PRWA 3RILA 1UOKA 4UOJA 3DHPA 2ZUTA 2UY4A 1BG9A 4GINA 4KRUA 1J10A 2XSBA 3WDPP 2VL4A 1V3JA 3GYCA 2OWCA 1E55A 1E4MM 3MUY1 3GXDA 5E6YA 5DF0A 3WNPA 1DWHM 1XSIA 1FHLA 2J8FA 3DHUA 3BSGA 3TONA 2CERA 1W9UA 3VO0A 5F7UA 1QI4A 3NSXA 3T2PA 1QHZA 3WFLA 1H49A 4IPLA 2XVNA 2XHYA 1Q6CA 4H8HA 2BY2A 2BHZA 3WBAA 2O9PA 1HJQA 4J3WA 3VGDA 4PMVA 3U5YA 3ZO9A 5M3WA 2ZX5A 3GDBA 1GNXA 3A4WA 1W9BM 1IZJA 1UZ1A 3WMBA 3AHZA 2WVSA 2WC3A 4UFIA 5BWFA 3PZNA 4HOXA 4E4PA 4QLLA 4DWSD 1B30A 3WF3A 4CD8A 1MW3A 1WDSA 1KWGA 4CD6A 1KQYA 3AOFA 3QR3A 3L4YA 2YDQA 4HMEA 5FL0A 5D8ZA 3CTTA 3SCOA 1A47A 4QFUA 2YOCA 2B31A 5HPCA 1W3LA 4KH2A 1BSIA 5A2BA 2DIJA 3T09A 1UKSA 1AQ0A 4JCMA 2BY0A 3AMLA 3M07A 1G1YA 4P7QA 3K46A 3B8SA 2VRKA 2WMKA 3II1A 2AOSA 1GOWA 2VX5A 5A6BD 3M7SA 4QLKA 1GVYA 1R7AA 1PX4A 3ZSTA 3W81A 2ESCA 1SFSA 2WPGA 1LQ0A 2F61A 2J74A 2XVLA 6A3HA 1KR0A 1PAMA 2BVDA 5JUVA 3VIHA 1Q6FA 7A3HA 3L4VA 1E43A 2VVNA 3FN9A 4OIFA 1IT0A 3G6LA 1KWKA 1LL4A 2E0PA 5E0FA 2A3EA 3WDIA 4CVWA 5GPRA 3VKKA 3WDQA 1GOIA 2QHAA 3K8KA 3VVGA 1OGBA 4N42A 3BAJA 4F66A 4PCSA 2D0FA 3RM8A 3T2QA 1BYDA 1VRXA 1JXKA 1JNDA 1XYZA 2XUCA 3D3AA 3O2LA 2WVUA 1WE5A 1WDQA 1KGXA 1ZJBA 9CGTA 1X6LA 1AQMA 3WDRA 3WQWA 1J0IA 1O6IA 2D24A 4DWSA 1OD0A 5ABFA 1W9XA 4FF5A 4D6GA 1CDGA 3VMOA 3W38A 3BGAA 3AMCA 5CJ5A 4WSKA 4LXFA 1ISYA 2XSAA 2ZXQA 2W62A 3NSMA 3ZMRA 1XH0A 4JFVA 3IJ8A 4ZE5A 3JUGA 1UKQA 3BAXA 1D7FA 1MQPA 3GH4A 5JIWA 1JDAA 5I2UA 1W9PA 1ZBCA 4H8UA 1XYFA 2E9LA 2EJ1A 3T0BA 1JFHA 5D9NA 2ZX6A 3LPGA 4PMQA 1E0VA 5I0DA 3RCNA 5E70A 1PZ3A 1UH4A 2J78A 4AD2A 1G0CA 2D1ZA 1V03A 3WEZA 1DEDA 3PZ9A 1QPKA 3CMJA 4ZXLA 4AZ7A 1J0YA 2FGLA 1GOMA 4NSBA 1HL9A 2O92A 2YA2A 1C3FA 1ITCA 4LYQA 3KE0A 3TTYA 1UWQA 1MVYA 3BAKA 4J3XA 2JF6A 1QI3A 1H09A 4AZGA 3E1F1 5CSUA 4HOZA 2V5DA 3SUWA 2VC9A 3AHYA 4S3JA 2ZUWA 1ITXA 1VF8A 4WJXA 1BGGA 1SMAA 3MV01 3UG5A 1UR4A 1JYNA 1ISXA 1QI2A 3BLPX 4TVCA 1HXJA 1KXHA 3RIKA 2CHOA 2C7FA 3AYRA 1CXEA 4BS0A 1SYTA 1US2A 1HNYA 3POCA 2OSXA 1UWUA 3EDDA 3GNRA 4L4PA 2DT0A 3ZQ9A 4EKJA 3S2CA 4D6FA 4HPGA 1FFRA 1TCMA 4J3SA 3EYPA 1EIBA 3W82A 2YL5A 1JYXA 4WLCA 2WK2A 1KFWA 1B3VA 3L2LA 3AYSA 4AD3A 3AMDA 3WDJA 1M01A 1JD7A 4LYRA 3MO4A 1JI1A 4E8CA 1G5AA 1HIZA 1MW2A 3POHA 2CCRA 1JZ3A 2VQTA 1B31A 2XFFA 1JF5A 1PEZA 1CGYA 5A2AA 1E6NA 4GI6A 4JFWA 1JL8A 2VURA 1UKOA 1KGUA 3WD4A 2D0GA 3SCRA 3FY1A 4AW7A 1BG4A 2EPLX 1JI2A 2ZWYA 1HKMA 4JL1A 3VGBA 4AZBA 3WNNA 2QLYA 1EDGA 4P7OA 2XGBA 4E8DA 3QGVA 1U33A 2BY1A 3EDEA 4QLJA 1US3A 3WQ6A 4CCCA 4W84A 2J62A 4ACYA 3W27A 1E15A 1RP9A 2Y2WA 2WHKA 1E6ZA 4TXEA 4MNMA 4MB1A 1IZKA 1V6YA 1UR2A 3EMCA 4GIAA 4V27A 3LPFA 3WH9A 5I79A 1VFUA 2CPUA 3N15A 4AZ6A 1WZMA 3MKKA 4PYSA 5JBEA 4HZ8A 4DWSB 4PBGA 2A3CA 1C7SA 2NW0A 5ABFB 3ARPA 3NDYA 5D4YA 5FL1A 2PWGA 3GXFA 3KL5A 1W9DM 1NOUA 2XM1A 2AMGA 1ZBKA 2JEPA 1I75A 2WMFA 3B9EA 3A47A 3RM9A 2EXOA 3IAPA 3OB8A 3AQUA 4GZEA 5A6JA 3CUJA 2E9MA 1HJSA 4H04A 5D9PA 4PMUA 3OIHA 1QVBA 3VGFA 1CXIA 3SEPA 2GDVA 3AIEA 3U7BA 3WN6A 3BCFA 1TZ7A 1UWTA 4DUWA 5CZKA 3BH4A 1W2PA 1QI5A 5IFPA 1E4LA 1E6XM 4NI3A 1QW8A 3AS2A 2WKGA 4AC1X 1D3CA 4PEEA 3PZQA 2VZOA 4Z2GA 4GO8A 4D6EA 3K8LA 3W24A 4AISA 1RD6A 3GNOA 2PC8A 1R85A 2W66A 4W93A 2J7EA 4CN4A 4ACZA 1EQPA 1HP5A 1VFOA 2GVYA 4JL2A 4U3CA 1E6SM 2BFGA 4D72A 3T08A 1O7AA 2FGZA 4D1IA 1GQLA 2WLZA 4DUVA 1MW1A 1M7XA 3W37A 2YLLA 3WENA 4D6JA 4PTMA 2CKRA 3SCPA 4Z2LA 3ZR6A 4W5UA 1XCXA 4UFHA 1B1YA 2J47A 1PPIA 2O9RA 2VT0A 2GDUA 1LG1A 3W0KA 1XV8A 2ZUUA 2WBKA 1BYCA 2WHLA 1OCQA 3LPOA 4V2XA 4FMVA 1GQJA 4AZHA 5CQ1A 1AVAA 5FKYA 5CXPA 3VDCA 3AICA 3CHDA 4CN1A 1UD5A 2JEQA 4CKQA 3CO4A 2ZICA 4B3KA 1K9FA 4U31A 4HOWA 1TVPA 2CYGA 5D9OA 3HMCA 5A6KA 1VB9A 3N11A 4RE2A 4DM2A 4MTVA 5EBAA 2W67A 1GQIA 2OSYA 3FHAA 5GNXA 1JG9A 3VD9A 4M80A 2YL8A 1K9DA 2VCCA 4GKLA 4W7VA 5BYWA 5A8QA 3DC0A 3OA5A 3WL1A 4U2ZA 1HKJA 3L4ZA 4TX8A 1B90A 1EHAA 1XC6A 2DH3A 2PWDA 1OIFA 3N18A 3VIMA 1CPUA 4M24A 4MAVA 4MB3A 1DWGM 3OLEA 1B3ZA 2OYKA 2DT2A 1DHKA 2ZXDA 2E8ZA 3S6TA 1J0ZA 3WF1A 4ATLA 4TX6A 3VIJA 4GI8A 1W1TA 3PTMA 1C93A 4IPNB 4WKAA 3AISA 2OWWA 1UKTA 3PTKA 1JDDA 4KGLA 1JZ4A 3VMPA 1V0KA 1XSKA 3WF4A 3GZAA 1BHGA 4A3YA 1HX0A 3CHCA 3SURA 4ZENA 5D9MA 2G3IA 4IM4A 3AI0A 1CLXA 5BXRA 1V6WA 1V3HA 1R87A 1BGAA 1JZ5A 4CVUA 2X0HA 2ZOXA 4WKHA 5A94A 3KZSA 1FH9A 3VUPA 3WUEA 3ARXA 4PTVA 1ESWA 3VD4A 4QP0A 2VQUA 5AC4A 1W1VA 1V0NA 2D3LA 3BMVA 5BROA 3VIOA 4W8LA 1SMDA 1KBBA 4H8VA 1QW9A 1KBKA 1CLVA 1YHTA 5I3DA 1OSEA 3CH9A 3THCA 4UQDA 1B0IA 2JIWA 2WAGA 5C8BB 2FHBA 3BXWA 2DH2A 3OG2A 1WDRA 4JAWA 1ODZA 2JIEA 2D2OA 2W5FA 3W4RA 3GNPA 4NF7A 2XVGA 1KGWA 2BY3A 1A3HA 4JFTA 4Q22A 3TOPA 1OINA 1WB0A 1F4AA 1EOMA 1OT2A 2IUZA 1TA3A 3GH5A 4PUDA 1UG6A 3OGRA 4Y7EA 1KQZA 4AZCA 4CD7A 1J12A 1E56A 2IXUA 2F2HA 4W5ZA 4ACZB 2FH6A 2VX4A 3SCSA 1D2KA 4UQAA 1ZBWA 1PIGA 2X2YA 4KWUA 2J7BA 4MAZA 1JZ8A 2GJPA 4UFMA 5BXSA 5CPSA 1TR1A 2CBJA 3WBEA 3WH8A 2CNCA 1RPKA 1KXVA 3WD2A 4QCEA 2WWCA 3T2OA 4LQ1A 2DT3A 4F79A 1MFVA 3WH5A 1XD1A 2D22A 2J7CA 3MMDA 1TFVA 1JYVA 3TA9A 4PTWA 2X1IA 3ARUA 4P8UA 1S46A 4BZYA 4R5EA 1V6VA 3WQ4A 3A6OA 3N04A 3K4AA 3OBAA 4B3LA 1WKYA 4YHGA 2GJRA 3EDFA 5A3HA 3UEQA 4AD4A 4AYSA 2GK1A 4B9ZA 3BC9A 1BQCA 5BXPA 3AROA 1EO7A 3VD5A 3VTRA 1K9EA 5JBFA 4RE3A 4AZIA 1CWYA 3AIUA 2X0YA 1QHPA 1B3WA 2EO7A 1N82A 2J79A 5A1AA 2GUYA 1NWTA 1V3IA 1GQKA 5TD4A 3AIVA 3VDBA 1HN1A 4FLQA 2WXDM 3GXMA 4MJ2A 2ZXBA 4AEEA 1OBAA 4XZBA 4YN5A 2ZX8A 1CTNA 1E0WA 1VEOA 3PZUA 2WCSA 2WM0A 4KRTA 4U5KA 1P6WA 2EPKX 2YA1A 3EBVA 1ZB5A 2XFRA 2YKKA 5IFTA 2DSKA 8CGTA 3K1DA 4GQRA 2CITA 1MFUA 1NWSA 3W28A 2ZWZA 4GO9A 1W3HA 2ZUMA 5A6LA 3T0DA 1V6UA 4H2CA 1DWFM 3PZIA 4C7GA 3ZT7A 5I78A 2J77A 3SUVA 3WFZA 1WAWA 2WWDA 5I6SA 1HJXA 3WQVA 1NP2A 2G3NA 4MNJA 1V3KA 3VX1A 1UKPA 3WIJA 2DDXA 1WZKA 2E8YA 1BVNP 4XZWA 3NJ3A 4U5IA 2ZXAA 3AHTA 3VNZA 1UQYA 3AXXA 3EMQA 1OB0A 1ISVA 1ISZA 2PBGA 5A6BA 5I23A 2V3DA 4H41A 1UUQA 4P8VA 3NSNA 5BXTA 1WZAA 4RL3A 1QNRA 1V0MA 1EO5A 1M04A 4LPCA 2WVVA 5E09A 2ZIDA 2BHUA 3UG3A 5FCZA 2X8RA 5A6MA 1CZ1A 1E71M 4B15A 4GZIA 4EE9A 4L4OA 1LJYA 2FH8A 2MANA 1TA3B 2NT0A 3N12A 4AZCB 3RM4A 4GI9A 2WW5A 4OUEA 4Z2HA 2PBOA 1VEPA 2QMJA 1OIMA 1JIBA 3AFBA 3AXIA 1KCLA 3OLDA 5DFAA 2W92A 2V38A 2YL6A 3WEOA 2ZX7A 1XGZA 1NARA 5DT7A 2XIBA 3IK2A 3VIGA 2ZUVA 1CXLA 3IJ9A 2GJXB 5I5RA 5ABHA 3G6MA 3KWXA 4D6IA 2F8QA 7CGTA 4ZXOA 2WMHA 4XV0A 3SCTA 4ZEPA 4LYPA 3IAQA 4MB5A 4HTYA 2EBNA 3AHVA 3ZJ7A 4OBRA 3WELA 1W2VA 3APGA 1ECEA 4PSPA 4M56A 1R8LA 2G41A 1PBGA 3L4WA 3PZGA 5ECUA 4B9YA 4UOZA 3U57A 4BQ2A 1ZU8A 2PF0A 2D20A 1HVQA 5HPOA 2G3MA 2GK1B 4ZE4A 2CETA 4IISA 2Y8VA 2WHJA 1E1FA 2VO5A 3VMNA 4MADA 7TAAA 2WSPA 4UR9A 4XB3A 4OZOA 3N9KA 2XGIA 1CXHA 5GNZA 1W1YA 2IXVA 1L0PA 2YDRA 1GHSA 2VR4A 2XM2A 1LG2A 2QPUA 1UH3A 3FAWA 1Q6DA 3EDJA 4W7WA 4ATDA 1VAHA 4J27A 5E9AA 3WF2A 5IHRA 1E6PA 5CGTA 5DO8A 4C7DA 4MB4A 2YDSA 3BAIA 3FNDA 5HOSA 2PB1A 2BNJA 2CIPA 4FLOA 2WVTA 4MNLA 3IJ7A 1PIFA 2W61A 1C90A 1E72M 1TUXA 1V6XA 2XPKA 3L4XA 1EH9A 1B3YA 2CESA 4MDOA 1OD8A 1UZ4A 4WK9A 4U2YA 5HBFA 4OOUA 1V0LA 4N0RA 3WD0A 4PN2A 3ECQA 2YBTA 3SCWA 3ZR5A 1LWHA 1QNPA 1QOXA 4GZJA 1F4HA 5LA1A 2DSUA 1HKKA 1UHVA 2WKLA 5CPQA 4PMNA 2OSWA 3LMYA 1GJWA 5IDIA 3ZSSA 1V3MA 1JDCA 2XVKA 3OGVA 4HZ7A 4F9JA 6TAAA 1E3ZA 3SIMA 1LF1A 4TTUA 1E0XA 1TVNA 4JHOA 2WZEA 4X0NA 1KB3A 3FAXA 2DSWA 1J0JA 2WVVB 1E6RA 2PI6A 3NUKA 3NCOA 1NOFA 1WCGA 4HPHA 4TUFA 4F9DA 3W6MA 1JYWA 2NSXA 1FFQA 3A3HA 2XWDA 3F5KA 4J28A 5FOOA 3AS3A 1UD3A 3AZSA 1QBAA 5JH8A 3BSHA 4R27A 3ZJ6A 4A3HA 1EXPA 4ML4A 3WDHA 1AQHA 2WSKA 3NDZA 1X1NA 1UR9A 1H1NA 1B2YA 4QCFA 6CGTA 3K4DA 2ZUNA 3MU7A 2WB5A 5DEZA 3PTQA 3WUGA 4CU8A 1KXTA 4EK7A 4FLSA 4U3AA 2WLYA 5JIPA 3QOKA 1MWOA 1EA9C 3NIYA 1FP8A 3MV11 2O9TA 3PHAA 1H11A 2DEPA 2WZHA 4UFJA 3CBWA 4KGJA 2QV4A 2DT1A 2JF7A 3L4TA 3TTOA 4EANA 3IANA 3T0AA 1GOOA 3WKZA 3O9NA 1XCWA 3VIKA 3ZT5A 1DWIM 3CUFA 5CSYA 2CHNA 1EDQA 3PZTA 5CG0A 2XJ7A 5A2CA 3M6DA 3CZ8A 2QF8A 2VRQA 3CMGA 3VOCA 5EFFA 3A4XA 3PZOA 5AC5A 2NT1A 3ZIZA 1W3JA 1UH2A 1VFFA 2GFTA 1E73M 4AIEA 5LYRA 3FW6A 5CLWA 3EDKA 2V3GA 4M1RA 2WC4A 1B9ZA 1VBRA 1C8YA 3UESA 2DSZA 2VCAA 4KMQA 2VZVA 1BF2A 4UNIA 1J0HA 3PBGA 1XD0A 1XHGA 1G9HA 2VZUA 1KCKA 1GVIA 5I77A 1HJWA 2A3BA 4DM1A 1CGWA 1HKIA 3RJYA 1KXQA 4J3VA 2JFEX 4HA4A 5DMYA 1EDTA 3BLKA 3VX0A 4CD5A 4P7RA 3TP4A 3N13A 3QOMA 4CGTA 4PMXA 2Q8XA 1WZLA 5BRQA 5HDRA 1U2YA 5M5DA 3AXHA 2RGLA 2VR5A 2W63A 1G94A 4A4AA 4P7NA 4BCEA 3ARWA 1UA7A 2YJQA 3HJEA 4FK9A 1JD9A 3AMGA 5M17A 1FH8A 1Q6GA 1B3XA 4NRSA 4CCDA 2V5CA 2E4TA 3GBDA 5EMYA 2J7HA 1NWUA 4J3TA 1BAGA 1JZ7A 1XRVA 2EPNA 4MNKA 3WNKA 1UWIA 4JFUA 3WMSA 1GORA 3WEMA 2J25A 1TG7A 4UFLA 1V02E 1H3GA 4GXPA 3BMWA 4D71A 1C8XA 1R86A 1VEMA 4LGXA 1GUVA 1MXGA 2HISA 3CZEA 3DECA 4HA1A 3WH7A 4J3UA 1NM9A 3QHNA 4XX6A 1H41A 1W91A 4W88A 1JNEA 3AIWA 3I3EA 2CBIA 3SUTA 1JZ2A 1HJUA 1WPCA 1CGVA 1JGIA 2W91A 2WMIA 3U5UA 1UD2A 3VD7A 1W32A 3THDA 3WH6A 1E40A 1I1WA 4JHZA 2GJXA 1J11A 3AIQA 3RJXA 3SCVA 1ZJAA 1QNQA 1MQRA 4EAMA 2XTKA 2PWEA 1JFXA 5E6ZA 1CGXA 1BFNA 2WZIA 3QHOA 4HMCA 4K68A 3VIPA 4UZUA 4TOQA 4BQ4A 2VX7A 3K8MA 1EHNA 4PSRA 3CLWA 4HU8A 4OOZA 3ARRA 1VENA 1JAEA 4P8WA 1RP8A 3WSUA 2JE8A 2Y24A 5A8NA 4RE4A 2WBGA 4URIA 4W85A 4Z2JA 1WNOA 4D6DA 3VD3A 5FD0A 1PJ9A 5A8OA 3L2MA 1K6AA 2G4FA 2CBUA 1C91A 2WANA 1CXFA 3WQ5A 5EFDA 1TMQA 4UQBA 3MANA 3UG4A 3WF0A 2VMFA 1HF6A 1U30A 1UYQA 3WMCA 4C7FA 2X09A 1J0KA 2UY3A 1ZL1A 4M29A 1SR0A 5BRPA 3GTNA 4TTGA 3CGTA 1E3XA 2OWXA 1BYAA 1JZ6A 2BVTA 3WUFA 1YQ2A 2A3HA 1E70M 4HP5A 2OYLA 4TVUA 1C8QA 4W8AA 4YHEA 2ZE0A 2ZX9A 4H7VA 3MUZ1 1KR1A 2XYLA 3RO8A 3AJ7A 3HU7A 5A95A 3AIBA 3ZT6A 1HT6A 2YBUA 1CNVA 5DT5A 2YIHA 1E5NA 5LA2A 1LLOA 3MMUA 1VJSA 1VBUA 2CBVA 3GXIA
chains in the Genus database with same CATH superfamily
1NOWA 1CW2A 1ML1A 2D2HA 2VEKA 5AYBA 4UIOA 3AS0A 1M53A 1J18A 3O5FA 2X1TA 5HW8A 2BVYA 5FACA 7ODCA 1YTKA 1UMYA 3W53A 1OWQA 2QPXA 2PE4A 1TCDA 4PUUA 4MKNA 2XVPA 2P5NA 2XH0A 1R30A 1OYAA 4CN6A 3QZEA 4UQEA 3A13A 1JF6A 3CQHA 5M1TA 5KSWA 2E3ZA 5TAOA 2DGAA 3GZ3A 3Q37A 4PTXA 4AIBA 1FKLA 2EEXA 5HJXA 3L65A 3DESA 1X97A 2V63A 2PV2A 3CUHA 2NXIA 2WMIB 1QNSA 2R1KA 1FKFA 3RYSA 1L6YA 2OZTA 1OGGA 1ISWA 1I8JA 2GSJA 2QZRA 1LDCA 3EOSA 5K7JA 2Y4SA 1CXKA 1KCXA 3UXDA 2GWGA 4A3RA 2VZSA 2PTDA 1DJXA 5C9RA 3MMWA 1VKFA 2A21A 3WUBA 1QR7A 4JN6A 3FHQA 3SUSA 5JH2A 1QATA 5A6AA 3CIVA 3NQCA 4M8UA 3PZVA 3MSDA 4CCEA 3EEZA 4YTQA 3I68A 3W7OA 2CLIA 4QX4A 4DJFA 3VAVA 3APTA 2V3FA 3URAA 2UBPC 2YXXA 1OYBA 3CZJA 5HNNA 1GJPA 3ZM8A 3DGRA 4XKMA 4F2UA 1Q3NA 1RQBA 1EL3A 3OZOA 2OMAA 1C7TA 4JIEA 1RBOB 4M19A 2ZRYA 3NYZA 1NMVA 4I7WA 5ABEA 4JTKA 4IUGA 3MHGA 4XK2A 3HN3A 3VIFA 3U7VA 3WD3A 2EGZA 4O8RA 4ZPWR 4Z2KA 4H01A 2VJXA 8A3HA 4LB3A 4HMDA 1FWHC 2HDJA 1E4IA 3B9AA 3W7RA 3QHMA 3VGHA 4ODKA 3TXVA 1ODUA 2PZNA 4KW2A 4UB9A 5JBDA 3SCUA 1XINA 1WOAA 1UQZA 3OQ8A 4ADSA 5HR6A 2PC4A 4L6OA 1G7UA 5LHEA 3UPMA 1YX1A 3RR4A 3EMZA 2DUXA 4ITZA 4NAFB 2HWGA 3UWWA 3UCCA 4TW6A 2IW0A 1R3YA 3ARVA 2FFIA 1TREA 1A5OC 2X05A 1C92A 3W7IA 1U22A 4J7RA 3ODKA 4YU1A 1XC4A 4CQBA 2GVLA 4DAIA 4PMOA 3I6CA 2OCZA 2RH9A 3MP3A 3AIRA 1XIHA 1Y7VA 4QG9A 1Q6EA 1W6TA 3ARSA 1QAPA 4CU6A 1LWIA 1ZY9A 3UERA 1HJVA 2OQLA 1EC7A 1B57A 3CUIA 3V5OA 4D6HA 1KM4A 3L4UA 4CU7A 4HIBA 1M7OA 1POJA 3E5BA 4GYKA 1HVXA 1FP9A 4NHVA 4B16A 3WLRA 3JS3A 3UCQA 3TYUA 1MW0A 3VNYA 5D32A 3T4CA 3U0HA 4PMJA 1QBBA 3VDHA 3W7NA 4O57A 4XVDA 1JCNA 5C7HA 3W2MA 2H6RA 4QG8A 5HWJA 2RQSA 3GHRA 5CPTA 4XD6A 1OGSA 2JKEA 5B7YA 1M03A 4IG2B 2RUDA 2Y7EA 1Q85A 2CZVA 3NRKA 3PVFA 3TTSA 3VINA 2Z2UA 4ADUA 1UCWA 4UTWC 3QSRA 5J6EA 1XH1A 1J4RA 3IIPA 3ONBA 1JJKA 2KAUC 2UY5A 1TJRA 3ALGA 3T6CA 4G1NA 2JALA 2PPPA 3WL0A 3QY8A 2OVLA 2AAAA 4R34A 2V5LA 3THAA 1QNOA 3CV6A 5K4ZA 3W88A 2FZDA 2EPMX 4AD5A 4MJMA 3GH7A 4M6UA 3SRKA 4ERIA 2VFFA 4S3EA 4L1WA 4RZBA 4DRPA 1K8ZA 4QAIA 4XWUA 1F8MA 4PMDA 4AX6A 1ZUAX 3VGEA 3E0VA 2QPSA 1XICA 2J7GA 1RBLA 4LUSB 4ZB0A 1OZQA 3E0LA 2G95A 4HA0A 1GHRA 1D3HA 1V7AA 2D23A 4AXKA 3LGDA 4AWEA 3PR9A 3N1AA 3WJWA 2RUQA 1VJZA 3PA7A 3GNNA 2VX6A 3FSTA 4OJYA 4IMCA 2EG7A 2PCEA 3S9IA 2FZBA 1FKSA 1EPVA 1XBXA 1HKVA 4ICMA 3G1DA 2GL5A 2Y0FA 2DZWA 1W9VA 3GDKA 3VM7A 1WBHA 3FXYA 2BMBA 5J5RA 1I60A 3OLIA 7PTDA 2XP8A 3ENLA 3QH2A 2D0HA 3I65A 3NQ8A 3CZKA 5IRPA 4GCAA 2ZRWA 7TIMA 3ARTA 1BPLB 3R58A 1CGTA 4X2PA 1EJSC 2XPAA 2BS9A 4N9BA 4ZQMA 1IR2A 4PFHA 1PKLA 3TKFA 4S38A 4DJDC 2J7FA 4X9YA 2J75A 4PRWA 5IOBA 3LY0A 3RILA 2CHRA 4IMEA 2UY4A 2NVDA 1BG9A 4R3UA 4YVXA 1J10A 5LGZA 3WDPP 1V3JA 4FEZA 1YKWA 3M5YA 3PUDA 3GXDA 5DCBA 4PRTA 2E1WA 4R7JA 1I2NA 3WNPA 4ZCWA 5A5WA 1YNYA 4EPDC 2X7VA 1TELA 1AZ2A 5J8LA 3W6YA 3W2LA 3P80A 4IPLA 4BWLA 1VFTA 4XBKA 1KFJA 1PCWA 2XHYA 4GXMA 4PC8A 5I06A 4DF0A 4TO8A 5LNVA 3QV8A 1UJPA 3BZJA 5T91A 2RSEA 1GNXA 5D09A 3LDVA 4N4QA 3E2RA 2CLKA 1R38A 5HW7A 1TV5A 5CZSA 1S2WA 4UFIA 3PZNA 4I6KA 3VNLA 4JOMA 1VYRA 3THUA 1SZNA 3OJGA 4DWSD 1FKWA 1D6OA 3PAOA 3WF3A 2FVLA 3ZWSA 5K9DA 4GACA 3BLLA 3BZGA 5BZAA 3WBYA 3WJYA 3QR3A 8RUCA 2YGYA 3L4YA 4HMEA 1E44A 3CTTA 3SCOA 1A47A 4O0KA 1B4EA 4ZO7A 4LU0A 2YOCA 3QV6A 1SJDA 3TDFA 1W3LA 2BODX 4IQDA 2Y78A 2OO6A 3LHWA 3T09A 1UKSA 4ILSA 1DTNA 1QFEA 2XP5A 3NO3A 5RUBA 4ZQCA 1KBIA 3II1A 4UTIA 2HNHA 3W1LA 2Z1BA 5CPNA 1A7XA 1J8VA 4A22A 1GVYA 1PX4A 3CC1A 2WPGA 4XISA 1ZALA 2WSRA 4S3DA 1FDJA 3ICJA 4RPPA 4Q4OA 1KR0A 1TWSA 3P0XA 4YTTA 2X16A 2BVDA 4L5ZA 2FPVA 2VVNA 3G6LA 1KWKA 1R5YA 5FEWA 2OKOA 3SFKA 3WDIA 4TYOA 3WCZA 3K8KA 2ISVA 3VVGA 3IARA 1OGBA 4REQA 3GNXA 4N42A 3LRKA 2D0FA 3RM8A 4OECA 1ZAHA 1ADOA 1GGOA 4O2TA 1XIEA 2AWGA 1JPMA 1ZHAA 1FWBC 3G1AA 3HV9A 3MC5A 4C6LA 1CLKA 3EX4A 4ASTA 3C56A 4QQ3A 2X40A 5D2XA 1AQMA 1UOZA 2Y70A 4DWSA 1BD0A 2HK1A 1Q45A 4D6GA 1CDGA 3L12A 3G8RA 3AMCA 4B4FA 3NPUA 2XSAA 4JFVA 5FI8A 2Q6ZA 4NYYA 1UKQA 5I7GA 4EPEC 3K4WA 1MQPA 1JDAA 3RFAA 3CQJA 3B7XA 3UWZA 3W73A 3G3MA 5G4EA 3T0BA 4IHCA 1OX4B 3L0NA 3FLUA 5I0DA 3OG3A 3ANUA 4HU3A 3KOXA 1PHQA 4HN8A 3R94A 4JTFA 1GTHA 2HS8A 1QPKA 5BW6A 1ICSA 1ME9A 4AZ7A 4N02A 1QO5A 3WQEA 2O92A 4IQ2A 1J6YA 1K8XA 4BKNA 3TTYA 4UWMA 4NASA 3SI9A 4YVVA 1O68A 2V5BA 3BAKA 1FWGC 1QI3A 1H09A 4AZGA 4U86A 3E1F1 1J79A 1X8CA 5CSUA 4V15A 1PCKA 4BJHA 3EB4A 2DZAA 2E6FA 2VC9A 1QCWA 2ZUWA 1TO3A 3K30A 2IPGA 1BGGA 2AQVA 4ZVJA 1JYNA 1ISXA 3BK0A 4L7ZA 3UWEA 4TVCA 4R0XA 2CHOA 3KW3A 2VCDA 1CT5A 1FHVA 1GKPA 4B2DD 4E3VA 1U5JA 3POCA 2NXGA 2OSXA 4NP7A 3GNRA 2WKJA 4L4PA 4EKJA 3Q67A 4H6RA 1UPMB 3HTWA 4O17A 1FFRA 3D0CA 3TR2A 3UPWA 2Q02A 3G77A 3EYPA 3B4UA 3GG7A 1EIBA 1XGDA 3NZGA 5AHLA 1B3VA 3L2LA 3AYSA 4IPJA 4LUTB 3MO4A 1X96A 1XF0A 4GIRA 2CCRA 1MEWA 1B31A 1JF5A 1PEZA 3NO1A 3LXAA 4GI6A 1KGUA 1TKKA 2A6NA 1ICQA 3H7RA 2DZXA 4X3ZA 2CZFA 3V75A 3QC3A 2I7GA 2PLMA 4AW7A 5J5DA 2YFOA 4JL1A 3WNNA 1NVMA 2OO0A 3BOXA 1EDGA 4P7OA 4H9XA 3DKLA 3WQ6A 2PTZA 3PM6A 4MWAA 3QGKC 4YWIA 1JQVA 5BU9A 1E6ZA 4TXEA 9RUBA 4E5TA 1UR2A 1JDFA 4GIAA 4QIUA 3AYVA 5I79A 2CPUA 3DFNA 1EB3A 4PYSA 3UJSA 3H24A 1C7SA 1Y0EA 4IMGA 3VKAA 5ABFB 4RKAA 3GXFA 1ICPA 4OV4A 4H9UA 1TPEA 2A2IA 3B9EA 1TTIA 3MCMA 1IYXA 3IAPA 4IT1A 3H2OA 4DYEA 4LSBA 2H8ZA 3C86A 4J2PA 3PRDA 1IXQA 1LRTA 3BPWA 4PMUA 1O4UA 4FOJA 2ASHA 3WN6A 2PWVA 4KQZA 1QTWA 1TZ7A 1UWTA 4FI4A 4EXAA 3UA4A 2WKGA 4NY2A 4PEEA 4Z2GA 3K8LA 1R9XA 3W24A 7ENLA 3ES8A 4AISA 2PC8A 5AYYA 1R85A 4IOTA 4ES4A 4AY7A 1EPXA 2PDGA 2FJUB 4LNCA 4A8LA 4ACZA 1HP5A 1VFOA 3RLGA 4IPXA 4GYPC 4MUZA 4LAZA 4I90A 3DCPA 3CWOX 2KE0A 1Z41A 1MW1A 3M0JA 4QNWA 2YLLA 3W74A 2CLLA 3EOEA 1XCXA 3N3MA 1B1YA 1CB2A 5HJYA 4JGDA 1PPIA 3H21A 2XIJA 2O9RA 4FXJA 1SJAA 4XIMA 3VXGA 1XWYA 4DRMA 1BYCA 4JYDA 1R3WA 3NR0A 2X7WA 1AVAA 1VJIA 2PV3A 2OQHA 1SR9A 4DLMA 1KM0A 4GVFA 2PLKA 3KTXA 4NZFA 3O6DA 1Z89A 3CO4A 4QJ4B 2ZICA 1P7TA 9XIMA 1AK5A 4IIEA 3W2NA 3T1GA 5A6KA 3N11A 3MI2A 3DN5A 3C2EA 4DM2A 2Z6IA 1GYNA 3RLUA 5GNXA 2MNTA 4LY8A 1ROUA 5U7SA 2YL8A 1K9DA 4I7VA 3RITA 4GKLA 5A8QA 3OA5A 4ZFCA 3WL1A 2ODOA 2IPWA 4TX8A 1B90A 1EHAA 1XC6A 3AYTA 4J35A 3N18A 4F0LA 1UIPA 4DO5A 4H8NA 2H9AB 2GVEA 1DHKA 2QCFA 2BGNE 4ATLA 2ZRXA 3WF1A 3INPA 2B7PA 2P3EA 4IMFA 2OWWA 3AISA 4CQAA 1MEIA 1JZ4A 4JYEA 3L5LA 2Z0IA 5LXXA 1TJ0A 5D9MA 2G3IA 4IM4A 3AI0A 3BOLA 1P43A 4L9XA 1IXNA 2X0HA 3PBVA 3M0ZA 3R0DA 3WUEA 3SN0A 3NEVA 5F4XA 2I14A 4XO6A 2AAMA 1IF2A 3BARA 1W1VA 2C3ZA 3EKLA 3MQTA 2X1UA 5BROA 3VIOA 4G7EA 2REQB 1IGSA 3MMTA 3NGFA 3PR2A 1SMDA 5KETA 1FWIC 5I3DA 3R8GA 1XDMA 1TMLA 4UQDA 3T05A 3EPNA 5C8BB 2Z7KA 3IGHX 1YATA 4QBXA 3U2OA 3WK0A 1ODZA 2JIEA 2D2OA 4NF7A 1OINA 3VCRA 1F4AA 4JD4A 1X1ZA 3OGRA 4Y7EA 4DYKA 3UJRA 1SO5A 4CD7A 5TIMA 3LI0A 3DG6A 2F2HA 1K70A 2V5KA 3UZYA 4LUIA 3GW0A 3GYEA 1PIGA 4KWUA 4IQLA 1VZWA 4IGMA 4UFMA 5BXSA 3HZ3A 3WLIA 3KVKA 3BWWA 1O12A 3ZLGA 1AW2A 1TX2A 3BL3A 1K8YA 1DORA 5C2CA 1KXVA 4JPGA 3A22A 1XLEA 1Q6QA 2WWCA 4LQ1A 1MI3A 1SZFA 2DT3A 4QE4A 4JX5A 3M4HA 4F79A 4KIEA 1MFVA 1U83A 4ZSTA 3UPBA 3HPZA 1TFVA 3DX5A 1K02A 2ZBTA 2W27A 5I3FA 3ARUA 4BZYA 4R5EA 2F7FA 4DJEC 3OBAA 1EEPA 2FB2A 4YHGA 3TCZA 3UWVA 4HHMA 2Y63A 5KZMA 1V93A 2RDWA 1Z6KA 1OFRA 2Y5JA 3PC0A 1DXFA 4AYSA 3NQBA 4B5VA 1EO7A 1YW5A 1I0DA 3ABXA 1QHPA 1B3WA 3ID7A 4HPNA 3AWNA 3ANYA 2F21A 5A1AA 3BW3A 4LVFA 1EC9A 4S1FA 5EU9A 1FKRA 4Z0SA 1OZMA 1HN1A 1G4TA 3GKAA 3RRAA 4MG4A 1OBAA 4YN5A 1ZFJA 3T8QA 5T9CE 3S6DA 1SSGA 1SZEA 2Y88A 3DFHA 1P6WA 2V0TA 1P6BA 4C6PA 2EPKX 1ZB5A 3NQMA 2PZ0A 2XFRA 1GK8A 4AC7C 8CGTA 4GQRA 2QUUA 3W7MA 2GJLA 4Q32A 2P1FA 2A4AA 4KWOA 2ZUMA 2GGIA 4H2CA 5FAJA 4YWSA 4GZ7A 2HTMA 1ZGDA 2J77A 3SUVA 3SZ8A 2WOQA 1PYMA 1VRDA 3G1FA 3BO9A 3KXQA 5I6SA 3D6NA 4R9OA 1UKPA 2H90A 3WLJA 3N3TA 3WIJA 2DDXA 3NQFA 2E8YA 1PHWA 3AUJA 4XZWA 1E1CB 4U5IA 2ZXAA 4X60A 1TV2A 1D8CA 4OTKA 1Q7MA 4J4NA 1R3TA 2ITKA 2PBGA 4DHGA 2A6LA 5I23A 2V82A 2GDQA 1ZENA 3LHYA 4AQLA 3NSNA 1A5UA 1M04A 5E09A 3LM7A 3A5FA 3H12A 3TMLA 5EL1A 1OK4A 1QASA 2PF8A 1S1RA 5TNVA 3UP8A 1ONXA 2RURA 4GI9A 3LCFA 3SBFA 1KFCA 2PBOA 3GPKA 2GVGA 2G96A 3UZWA 3GHUA 4BEUA 1OC5A 2VOMA 1KCLA 1REQA 3E5PA 1LM1A 4QEHA 3ITYA 2W92A 1H7PA 2FYMA 3KRBA 3R0UA 4Q4SA 4CEUC 3IJ6A 3H53A 1XGZA 2M2AA 1TTQA 3MB9A 3V0UA 3LA4A 1Q65A 5ABHA 4ZXOA 3BVJA 3WLOA 3ME3A 3SCTA 3C8NA 3SGZA 4LYPA 3OZMA 3TFXA 2ZTJA 2JGYA 2EBNA 3ZJ7A 3KOYA 3VYLA 2ZDRA 4DZ3A 3O5PA 3P5YA 3PZGA 4B9YA 1WYIA 1DBTA 3F7JA 1BKFA 3PRBA 1DJQA 2GK1B 2KR7A 4Q4KA 2CETA 4IISA 1PKYA 2YYUA 3BG9A 1JRBA 2VYOA 4MGGA 4YS1A 2WSPA 2PA6A 1H1ZA 3R43A 3PFRA 4OZOA 2XGIA 4Q3MA 3KCEA 4O4WA 1ZPTA 1LRQA 1SO6A 4Z1CA 1W1YA 2IXVA 2FAPA 4ONVA 3H4WA 4N6EA 2YDRA 1IGWA 1HG3A 1UH3A 3BLFA 3LCGA 4HNTA 2NZLA 5E9AA 3IIZA 1E6PA 4C7DA 4MB4A 2YDSA 4WOZA 4EOUA 2CIPA 2WVTA 3Q4DA 4MNLA 2QS8A 2W61A 3VNJA 1LP6A 1TUXA 3L4XA 1B3YA 5KZDA 4MDOA 4NZ4A 1UZ4A 2Y61A 4ZMGA 4U2YA 5FSEC 3OEXA 4OOUA 3IV3A 3ECQA 2XGZA 1R9HA 4LH8A 1F3EA 4C5ZA 3H9RB 4BF5A 4B4HA 1WBJA 4K7YA 4PMNA 3H6OA 4RDWA 5IDIA 5I3JA 1BEUA 5DO2A 3CIXA 2XVKA 4F9JA 2DZUA 4ZO9A 3TR9A 3KAIA 1LF1A 3P0WA 3NL2A 1KB3A 2WVVB 3CAQA 4DJDA 3VKJA 3TN4A 2ZZ4A 3RX4A 4CNTA 3W6MA 5HW6A 2ACSA 3IGUA 5E9XA 1NDZA 3MSYA 3LSBA 3AS3A 3G3DA 2OELA 3VAWA 3M5VA 1QBAA 3MI6A 4RZ4A 3ZJ6A 1EXPA 1JEZA 1K7FA 4FSAA 3NDZA 1ONRA 4O12A 2PTWA 3BW2A 3D46A 4NJKA 1B2YA 3C2VA 5G1YA 3MU7A 3HA1A 2P8BA 3MWAA 3QRHA 4N2YA 1MRQA 1KXTA 4B3ZA 5C5YA 2WLYA 2QDHA 4LANA 7REQA 1M7PA 3NIYA 2DQWA 3CL6A 1FHUA 3TOYA 2E67A 3VDGA 3S5NA 4DO4A 2DT1A 1XX1A 3REQA 2Z24A 4H9VA 1LBFA 3GDTA 3O9NA 1QPRA 2OJPA 5DX7A 3FVDA 2Z26A 1BKHA 3ZT5A 4NYUA 5CSYA 1Z9AA 4GX9A 5A2CA 3CZ8A 2VRQA 3CMGA 2ZZ3A 4JTJA 1WV2A 2C1GA 1L6SA 4DAFA 3EOUA 4HSOA 5AC5A 2NT1A 3QR1A 2CLMA 4IL2A 1UH2A 3LCIA 1VFFA 2GFTA 3HQ1A 1V77A 3KCJA 2MF9A 3SFWA 2V3GA 3FJ4A 5D04C 3QZ6A 4GQ0A 4GOAA 4JYFA 1VBRA 1C8YA 2TSYA 2GQ8A 1IWPA 4KMQA 3W75A 2ISFA 1JR1A 4H9TA 7XIMA 1QPFA 1XD0A 3EXSA 4PTNA 4WJ8A 1HJWA 3GC5A 4Y6GA 5HANA 4DM1A 4JTRA 3IWPA 3RJYA 1A3WA 3G1HA 1UC5A 2IS7A 1EDTA 3CV1A 3T81A 3B9OA 3VX0A 3PWGA 3N34A 3Q94A 4F48A 5HWMA 1NDYA 4P7RA 3UW6A 3TC5A 5EMJA 3F2CA 3RK8A 5M5DA 4C1KA 2RGLA 1DYSA 2W63A 3TW6A 1DE6A 2I17A 4P7NA 4BCEA 3ARWA 3HJEA 3QXBA 2FJKA 3KBNA 4X2RA 4FK9A 1JD9A 2PTXA 3AMGA 5E93A 3KRUA 2KX9A 1F74A 1B3XA 1L1PA 3GBDA 1BVWA 2VC5A 2J7HA 2ZQUA 3JU2A 4UTUA 2EPNA 3GG1A 3TQVA 5AOUA 1UZDA 1TG7A 4WGXA 4NJHA 3W7EA 4D71A 5EKYA 5BMWA 1FWAC 4H1ZA 4GGBA 4HA1A 4L61A 3VE9A 1FJDA 1SFLA 1Q13A 3L2IA 2DZVA 3IV8A 3UA3A 2J6VA 4NNBA 4XX6A 2F6XA 1W91A 3CGNA 4W88A 1JNEA 1A0EA 2X2GA 4RE0A 2GJNA 1TVLA 3I3EA 2CBIA 3SUTA 3VNDA 2DFAA 2DUZA 4YCPA 2RUCA 1QNVA 1TCOC 3NQ6A 1WPCA 2PLJA 1XRFA 5D30A 1G4EA 3VD7A 4NVTA 4OBTA 4TX0A 3WX7A 2O4MA 3WH6A 1E40A 3T9PA 3W1RA 3W7LA 4JHZA 1M7JA 1E9IA 3SCVA 1QNQA 1PL9A 3NQ2A 2XTKA 5E6ZA 4QJ1A 4I7UA 4WR3A 2XN1A 4DRJA 1BFNA 3V16A 4K68A 2QUMA 2Y5SA 2HMCA 2PDKA 3O5OA 3CLWA 3U4AA 2GQ3A 6TIMA 4ML9A 3LNMA 4OOZA 3ARRA 4Q8OA 2X1RA 2YCLA 1L2UA 1GW9A 2WBGA 4O13A 1S5NA 4AHQA 3HFYA 3AXMA 2RHGA 3FOKA 5FD0A 4MYXA 5A8OA 1DIOA 2CBUA 2G4FA 1GVFA 1HUVA 1EJTC 4KT2A 1C91A 1KKOA 4FNTA 5FEZA 3N2MA 5AZ1A 3WQ5A 1QO2A 1TMQA 4HNUA 1PKMA 4KFNA 1QOQA 2XZ7A 5T9BG 2J13A 3F1QA 3WF0A 2A0NA 2VMFA 3HPSA 3PB2A 3LEPA 1U30A 1H62A 1RCXB 1W5QA 2QXWA 5HJLA 2QCLA 1W56A 4MLRA 5CCZA 1JZ6A 5HNTA 3PPHA 1FCUA 4QISA 3NO5A 2BVTA 3MT1A 1YQ2A 1G6CA 3UG8A 2DVXA 4C1NB 5BXJA 3UZ5A 1C8QA 4DIAA 1WUEA 3TVAA 4H7CA 5A95A 4LAKA 1HT6A 1A53A 3UI4A 2YIHA 3MJYA 3EZ4A 3FJNA 4KCWA 4PL2A 5CC5A 1VD6A 1RV8A 2R82A 2F4EA 2Z1XA 4D8LA 4NXKA 4B5WA 1G01A 2BDQA 3VGGA 4Q33A 2Q8LA 3O16A 3TLQA 3KEHA 5KTLA 1IWAA 3OOQA 2BGQA 5AYIA 3N4FA 2WNNA 4FLRA 1DWJM 2VDGA 5G1TA 4D1JA 4FIQA 2G8ZA 3DFSA 4G56A 3TJLA 4W87A 2BXZA 1EQCA 3ARQA 1LL6A 1VR6A 4QNEA 2Z00A 4GVGA 3RPMA 2EJAA 4HNOA 1A5AA 5ABGA 1JCTA 4Q4RA 2P53A 1OQFA 2OR2A 4JN8A 3WD1A 1LL7A 1CECA 2V3EA 5A8GA 2HVNA 1W3KA 4R9XA 3B4YA 1JVWA 3SCQA 3VDAA 1RR2A 4AY1A 4HU0A 1YTDA 1SFTA 1TYGA 1QHOA 3KBMA 1YPFA 2AKMA 3LB0A 1IIHA 2Z1KA 3NOEA 4UZSA 1A5BA 4KPLA 4MDPA 4G50A 3ZZ1A 1GYLA 3N17A 1RJQA 1HP4A 3STEA 4Q7NA 4FXFA 1RA5A 4EAYA 5MKGA 4ZO6A 2A3AA 2WNWA 3BG3A 1R6WA 4PB3A 4F8XA 3GBEA 2Y8UA 2J8GA 3MKCA 4GH3A 3F4VA 3KUMA 5AB3A 3UF9A 1XLDA 4UOQA 3N19B 1FKDA 1OFPA 4H7ZA 2PWHA 3TCEA 5C70A 1ZRQA 1Q5MA 4GY0A 2VVSA 1YPIA 2ZDSA 1P0DA 2FPYA 1F3TA 4FAMA 3NYDA 4IFRA 4O1EA 3ONCA 3RMEA 2OX1A 3S8HA 3HPFA 3G1YA 3FJLA 3FEMA 3TLLA 1I9CB 1UR1A 3IVSA 3KAGA 4JEJA 2FHFA 4Q8VA 3O5JA 5C71A 3TTQA 1V7YA 3MUCA 1QDSA 3GU0A 3CZGA 3TZNA 1V3LA 2ABBA 4IUOA 3R5EA 1JPHA 3LPPA 3ZXWA 4DRKA 4IQJA 1XIIA 2C0HA 2FIQA 3QPYA 1A80A 4HQVA 4NNCA 1SPQA 5XIMA 3URNA 4AF0B 1YLVA 3F5LA 4A8NA 4KCTA 2DG9A 1UD8A 4W89A 2FVKA 2XIQA 4R53A 1ADDA 2J4GA 4TVDA 4D6CA 4OBSA 3CUXA 2C15A 4AWSA 4WDXA 2QDGA 1Q8JA 4OQVA 6PTDA 2EG6A 2XFYA 4H4IA 4GBUA 2CLPA 4UNKA 5GNYA 1W1IE 3MS8A 3PZMA 1MXDA 4GUIA 3WG6A 2G3JA 3TX9A 4WJEA 2VUNA 2ZR5A 4MMWA 4AMCA 1VFSA 4CD4A 1J9YA 4W8BA 5BCAA 3LQGA 4K8GA 2CXEA 3WQPA 3VZXA 3DOPA 1EX1A 3UR8A 4JICA 1UJQA 2F6UA 1U5HA 4ZR8A 1NTHA 4AVOA 3EKGA 1V8EA 3A4JA 4FF7A 2VEPA 4OKDA 1ECQA 4ZQOA 1HL8A 3ZJKA 3BAWA 2VDHA 4C91A 1AD1A 5CLTA 1AG1O 2I5GA 1XLGA 4ATWA 1FKGA 1F8AB 3LZ5A 1VIWA 1AL8A 1WO2A 1KM3A 4AH7A 2YXGA 5M2FX 1CB7B 1R9YA 4X22A 1NP0A 1EGZA 2WJZA 2WM1A 4AUBA 3OQEA 3CQ0A 2CWXA 2NV2A 4M81A 1H63A 3GKFA 3LENA 1CENA 3LCHA 1LWJA 1TWZA 4D2JA 4O1DA 4GYFA 1IV8A 1GONA 1GW1A 3V0SA 4JTTA 1MSSA 1IT7A 3OPSA 1VHNA 3MUAA 3BV4A 4Q8MA 3L5MA 2ACRA 2VOTA 3GVVA 3W02A 4S3CA 2FKPA 1ENUA 4HN4A 3SN1A 1AODA 1PTAA 1CIUA 3W29A 3ALFA 2E5CA 4XUYA 3WNMA 5D33A 4AXNA 4FS9A 4JIPA 4Y8FA 1E9LA 3H2AA 3MWCA 4HZ6A 4AIUA 4WHBA 3TC3A 1CYGA 1H61A 2OLHA 1EIXA 4K37A 1AH4A 1QJWA 3CO8A 2FHCA 1VGAA 5AHMA 1I1XA 1F7BA 1XBZA 4PMZA 3EX6A 4IJRA 5C55A 1EUAA 4AAJA 4MSSA 4UQ9A 3CV7A 1QRQA 1PO9A 4XAKA 2YW3A 2RGMA 4W9QA 4LAWA 1MUWA 4GY7A 5M03A 3QW3A 4XD4A 2PDNA 2Z29A 4LV9A 4NZCA 3TFCA 2POTA 1EOKA 1H4PA 3BJFA 4QJ5B 1RJRA 3JRKA 5IBXC 2PODA 1BLIA 2FGBA 1JCLA 4DXKA 1TV3A 3J7HA 1TQJA 3DYOA 2V69A 1HL2A 2Y7DA 1PYFA 3ARYA 3UVAA 5DN1A 5KINA 2QJNA 3AZRA 2NQJA 5DIVA 4KFOA 5FJRA 1H5VA 4ZFMA 1Z32X 4XKYA 4DYJA 4C90A 1J5TA 3E2SA 3W23A 2WHMA 2C1IA 3MA8A 1E4NA 2Y7FA 3UWUA 4U33A 3VM5A 4O1AA 4QS6A 1XPYA 5CZ0A 1RUSA 3L0KA 3EY6A 1JNSA 1MMFA 3WNOA 1IT8A 2GWNA 2ZUSA 1FAPA 4X0VA 2WC7A 1UOKA 2BG5A 4UOJA 2ZUTA 4GINA 4KRUA 4QT3A 2VL4A 3GYCA 4LC8A 3UGVA 5KZEA 4KF1A 4NNAA 1A4LA 3VABA 3MUY1 4YIWA 3BQ5A 4C6NA 1TV7A 2YZRA 1DWHM 4EF8A 1FHLA 3DHUA 3JZUA 3T78A 3GQYA 2OU4A 1W9UA 2R1LA 5F7UA 5HWNA 1WXJA 4AU0A 3T2PA 4U4MA 2XVNA 4XAZA 2I16A 1R2TA 3FJ6A 3GU1A 1OG6A 4I9JA 2O0TA 2BHZA 2O9PA 3BANA 4KFPA 4PMVA 3ZO9A 5M3WA 4UDMA 2BX7A 1OY0A 4N6FA 3URQA 3QTGA 1IZJA 4K7VA 2ZQVA 2ZTKA 1FXQA 2WC3A 2V5JA 2Y62A 4HOXA 4E4PA 1LOLA 3JYJA 3BMXA 4LC6A 5I3IA 5HWCA 1KWGA 3W3OA 4Z42C 3KADA 4CD6A 3AOFA 3U9IA 5D8ZA 4LW7A 4IL0A 4HJFA 4WD0A 1RLCL 3IUDA 1SUXA 3ABOA 4C6IA 5AN7A 5LNRA 1LUCA 3TTEA 3R1ZA 4F0RA 1AQ0A 3AMLA 1A5KC 3RLVA 1IE7C 3M0MA 2VRKA 4R88A 2GOUA 2WMKA 4JIHA 4RDZA 2YB4A 3U6WA 2E7FA 1GOWA 4KEMA 2VX5A 3G24A 1R7AA 3ZSTA 1ROTA 4TV6A 1FWFC 2PDBA 1SFSA 2VFGA 3IGSA 1LQ0A 2J74A 3P5ZA 3QV7A 2GUBA 4ZOBA 3WQGA 1PAMA 4PCNA 4WY0B 3VIHA 7A3HA 1IR1A 4GUHA 5LKYA 5E0FA 3QTPA 5GPRA 3H7VA 1QUMA 3OVGA 3WDQA 4NKCA 1GOIA 3CPGA 4HU4A 3NNTA 3MPGA 3BAJA 1S5TA 3U2ZA 3IK8A 3T2QA 1A5NC 1JNDA 1JXKA 2XUCA 2TODA 2YPIA 5F1VA 2WVUA 4LBRA 1KGXA 1MO0A 1ZJBA 2B7OA 1Y5WA 3V1PA 1XLHA 4Q8UA 1G4PA 3G1VA 1ME8A 3WQWA 1O6IA 4WVXA 4ZTXA 3MHFA 3V3WA 5TF0A 3RUBL 1EFZA 1RALA 3VMOA 3LHUA 3IPWA 3QQWA 2ICSA 3UR2A 3TJIA 4ORIA 4QTGA 1XH0A 3DFOA 4AEOA 3QQ0A 3QW4B 4WX2A 3T0CA 1ZBCA 4PCFA 2LGOA 2EJ1A 1JFHA 3FYOA 2TMDA 2ZX6A 5D9NA 2BOEX 1LTDA 3RCNA 3R11A 4F4RA 3NM3A 5E70A 1PZ3A 4OE7A 5CAKA 1G0CA 1B9BA 1V03A 2UZ9A 2LJ4A 5CPMA 5BMXA 2FGLA 3NOYA 5AVHA 2YA2A 1ITCA 3WLKX 1FWCC 1X7IA 1F9CA 4J3XA 2HBVA 5ABTA 1NELA 4L6DA 4E6MA 1FD9A 4KCUA 4HOZA 2A7NA 5KITA 3BW4A 3AHYA 1P0NA 4AYGA 2CW6A 3VE7A 3KLLA 3GIPA 1SMAA 3MV01 2EAWA 3AC0A 4HSHA 1UR4A 2ZC1A 1KXHA 1XLIA 2YDAA 3TH6A 3IS4A 3NL5A 4LAMA 1HNYA 3EDDA 2PDQA 3P14A 5CH9A 4GISA 4MZ8A 2F23A 3MVTA 4I5UA 4LCSA 3UZZA 5IM51 2H8XA 3DBPA 1YE4A 4J3SA 1JYXA 4WLCA 1KFWA 1ZP3A 4XBSA 3CXOA 3B0UX 1I6NA 1M01A 4LYRA 4E8CA 3RO6A 5DCEA 1G5AA 1MW2A 2YW4A 3POHA 3O63A 4WSHA 1SO3A 2XFFA 5A2AA 1E6NA 2JKPA 2VURA 1VFHA 1G7VA 1Q7QA 3I6RA 1BRLA 1FWRA 1OFQA 4US5D 1SZRA 2HNEA 4FALA 3EA1A 2PTYA 3TJXA 1JI2A 4TNSA 2ZWYA 3LYEA 3OO2A 3OVPA 4E8DA 4M0XA 3U48A 3QGVA 2BY1A 4QLJA 1US3A 4Y9OA 3N6JA 1JVNA 1UR3M 4FNQA 1E15A 2WHKA 2X42A 3TE9A 1EC8A 4KIRA 4C6EA 1EZWA 2ZRUA 5HA7A 4V27A 3WH9A 3NWRA 5JBEA 3PB0A 4HZ8A 4PBGA 2A3CA 2IQDA 2NW0A 1DE5A 2J27A 3ARPA 3NDYA 4RW3A 5FL1A 2PWGA 3W85A 3FYYA 1NOUA 2JEPA 2CU0A 2YCIX 3JVAA 3A47A 4GQBA 4S3BA 1G4SA 3RM9A 2EXOA 1F76A 3AQUA 5FJOA 4IFKA 3GR7A 2WJFA 1W1A1 4IQEA 5LGXA 3VGFA 1CXIA 3U7BA 3IHZA 2AL2A 4GG9A 1QI5A 5IFPA 1E6XM 4Q8WA 4NI3A 2FLIA 2VZOA 4GO8A 1AA1B 4L9YA 1TWDA 4MSPA 5G2WA 4H2HA 2PP3A 3OTRA 4DN1A 5CJMA 4F0SA 2W66A 4W93A 2J7EA 1UUOA 1T96A 1E6SM 4FNRA 3T08A 3W7JA 1FWSA 5BOOA 4DUVA 4MM1A 2PDUA 3AALA 3EEGA 3CAKA 3M47A 4KWVA 4Z2LA 2HZGA 4UFHA 4JNMA 4E8GA 4PB5A 4IIGA 4Y9NA 2XISA 3SB0A 2V67A 3OVQA 2VT0A 4C6MA 3W0KA 1R2SA 2IKGA 3VZZA 2P0OA 3UQNA 5A6TC 2GGJA 3LPOA 4MY1A 4V2XA 4XSMA 1SO4A 5FKYA 1XLFA 3M5ZA 4ROQA 3CHDA 9XIAA 4CN1A 3C5QA 1UD5A 4IX0A 2JEQA 4CKQA 1EGMA 4B3KA 3TYAA 3W83A 4U31A 3B8VA 4ZB5A 1F73A 4QROA 2Z25A 4HGXA 2CYGA 4AMAA 5D9OA 4JY9A 5EMKA 4A2SA 4ZGYA 4HTBA 1GQIA 4UTTC 5HINA 1JG9A 3VD9A 3ZR4A 3P62A 5I03A 4W7VA 4LRSA 3DC0A 1O5QA 2DH3A 3DENA 3MI3A 4GNKB 4MAVA 4MB3A 3GXTA 3TN3A 4MVAA 1B3ZA 2OYKA 2DT2A 2ZXDA 2E8ZA 4B5UA 2ZRZA 3VIJA 1XP3A 4CNSA 1S2TA 4RV3A 4WKAA 2ZZ6A 1UKTA 3PTKA 4KGLA 3VMPA 1OC6A 4ZQRA 4MFEA 3GG8A 2XN2A 3CHCA 3ATZA 4RCXA 1FDZA 2DORA 3C3NA 1IZCA 3CB8A 1V3HA 2D2GA 1BGAA 1RBAA 1R3VA 3SIZA 4CVUA 4C6OA 4J2MA 5LIWX 4EWND 2ZOXA 4WKHA 4YTUA 3KZSA 5A94A 4TW7A 4JR5A 3CGMA 3DZ1A 4RPQA 1VHCA 1V0NA 5ENLA 5LNWA 2ON3A 1LRNA 3GR4A 1C8VA 2OT1A 1US0A 3GVQA 2QCDB 4H8VA 1YHTA 3CH9A 3THCA 4NZ5A 3GUGA 1KM6A 1XUUA 2FHBA 3BXWA 2DH2A 4JAWA 1D7IA 3GNPA 3WK2A 1KGWA 2BY3A 1R46A 2QT3A 1A3HA 4Q22A 3H2NA 5CKSA 1PZ1A 5FJJA 4GFSA 3UD6A 4B5SA 1Z8AA 3B04A 1VS1A 2ABAA 4PUDA 5PTDA 5C9ZA 2B81A 2E6DA 1FKIA 1J12A 4JY8A 1E56A 3N6HA 4W5ZA 3PANA 2QKFA 2VX4A 3HG3A 1ZBWA 2X2YA 3QMSA 3R89A 3BURA 1TR1A 3WBEA 1SZGA 4WQ6A 4MWAE 4XIAA 1RPKA 2W79A 4LAUA 3WD2A 4BK9A 4Z08A 5JXQA 1KTNA 3T2OA 4GQGA 2XIOA 1HKWA 3KS5A 3M41A 2QUNA 2D22A 1P5QA 2J7CA 3VOHA 2PDCA 3IJQA 3FA3A 3TA9A 4AX7A 2YB1A 2ISWA 2OQYA 1ZZMA 4JTEA 1S46A 4LVDA 2ZZ7A 4B3LA 2J6XA 1A50A 2AGTA 3EDFA 4YTRA 1WA3A 4ZOAA 3GIQA 3LV6A 1K4HA 5BXPA 3AROA 3VD5A 5JBFA 1K9EA 4AZIA 1K8CA 1Z69A 4DBUA 4LALA 4MHBA 2E09A 1AH3A 3BDKA 1N82A 3W00A 5TD4A 1FXPA 1DKWA 3AIVA 3H2FA 5EMLA 2WXDM 4LAVA 3GXMA 4DZ5A 1X98A 4MJ2A 4ZODA 1D7JA 5I09A 4QSFA 1YNQA 1J4IA 2A3LA 1KT0A 2WCSA 2WM0A 4MKSA 4Z17A 3DC8A 2YA1A 2G5WA 3HURA 4HBKA 3WLLA 5IFTA 4LS0A 1LBLA 2DSKA 3EX2A 2ONEA 2CITA 5FJTA 3WFAA 1MFUA 3NZQA 4HBOA 4RX0A 2ZWZA 4GC4A 4PCPA 1KTBA 3W1AA 2B5UB 3UI5A 3T0DA 1V6UA 1VQTA 2ETNA 4NZJA 3H54A 3KP0A 2ZZ5A 3L0GA 2PPNA 3EA3A 2ALDA 1V3KA 3NA8A 2VEIA 3KBSA 3G0UA 1ZCOA 4KBXA 4S23A 1P0EA 1BVNP 3O5IA 4NL1A 3KCLA 3FFSA 4JYSA 1SGJA 1DQWA 4ZBCA 1DV7A 4GGHA 1OB0A 1AJ0A 3UWQA 4DJFD 5A6BA 3CAWA 1FTXA 1TJPA 3BE7A 1DJGA 4P8VA 4JQ3A 3KRSA 5BXTA 3S5OA 2PDIA 1F61A 2VFIA 1F5ZA 2BHUA 4IIBA 5FCZA 1N7KA 3NQGA 1LCOA 1Q6UA 5A6MA 2YYTA 4O14A 4B15A 1M6JA 4B5XA 4GZIA 1F40A 3WK3A 4L4OA 1LJYA 2MANA 3GLCA 1TA3B 4GIVA 3T07A 4KQNA 5I98A 5CZTA 3N12A 4TQTA 4AZCB 2WW5A 4OUEA 3VCNA 4Z2HA 1VEPA 3TROA 4O16A 5BU6A 5DXXA 3AFBA 4EX4A 3PP7A 3M0IA 3OLDA 1DL3A 4EIVA 2I5QA 5J04A 2NWRA 2V38A 3EWYA 1C9HA 2YL6A 3WEOA 2ZX7A 1O1HA 3QSTA 2XIBA 3IK2A 1CXLA 2IPFA 3IJ9A 2GJXB 5I5RA 2HBXA 2I9EA 3KWXA 4D6IA 4XZMX 2BLEA 2WMHA 4WZHA 3CQKA 1UUMA 4ZEPA 4FX6M 1TQXA 2PU1A 3LLDA 1OFEA 4DRSA 3S9YA 1W54A 3PNZA 3EIPA 1IXPA 2VWTA 5I3KA 3H2MA 1NU5A 3APGA 4DBSA 4PSPA 1HO4A 2RJHA 2DVUA 1HFBA 2PDMA 2XFWA 3QM3A 2D20A 1HVQA 2G3MA 3C0SA 4ZE4A 1XCFA 2VXNA 1MRAA 3R0KA 2ATSA 2WHJA 2VO5A 2BASA 2Q3OA 3C0LA 4MADA 1EX5A 3N25A 1J5SA 3N9KA 3KZPA 1CXHA 4JTGA 4UC5A 1SJCA 5GNZA 4XZ9A 2OOGA 3BLIA 4AG0A 2XM2A 3W1NA 2QPUA 3CYJA 2BOFX 1Q6DA 1W3IA 4J27A 2XIMA 3WF2A 5IHRA 3L66A 1OCBA 4QS5A 1OFAA 2A85A 2PFHA 2AL1A 3GHSA 5DO8A 3KRZA 3FNDA 4EPKA 5HOSA 3CWNA 2N87A 2BNJA 4H00A 3IJ7A 1PIFA 2DP3A 1E72M 1GT8A 3R2GA 5IBXA 2XPKA 2CC0A 1EH9A 2CESA 4P2VA 3LUTA 4WK9A 5K9XA 5EY5A 4O1CA 3WD0A 4PN2A 3GTFA 3KACA 3KVJA 1LWHA 4JN7A 1H7WA 2Z1WA 1GVEA 3C3UA 4I9TA 4GZJA 2ZQSA 4IT6A 1F4HA 1X39A 5LA1A 2PMQA 2Z2BA 3O06A 2WKLA 5CPQA 1SVDA 1GJWA 1XI3A 4RUBA 4O0ZA 1P4CA 3TYDA 2ZZ1A 2I1OA 1PKNA 2IQ0A 3UNDA 4TTUA 1TVNA 3FAXA 2DSWA 1R47A 1E6RA 2PI6A 2ZADA 3NUKA 3NCOA 1NOFA 1WCGA 2P50A 1L6WA 2PD9A 4F2TA 3L67A 1G69A 1FFQA 2MLXA 3A3HA 2XWDA 3KAHA 3PBWA 1UD3A 4ZPTR 3AZSA 3NQAA 3FDGA 3IRDA 4ML4A 3G2GA 3WDHA 3KM8A 1H51A 2WSKA 4L56A 1PDYA 1A5MC 5AHIA 6CGTA 4JFJA 2ZUNA 3QFEA 1P5BA 2R9RA 2C18A 5DEZA 1VCGA 3W7GA 4EXQA 3GDMA 2J66A 2GUUA 3UNTA 1XLJA 3GE7A 2ZVRA 1T7LA 1QWGA 1KTCA 2KZHA 3TEVA 2NQ9A 1EA9C 3C52A 2NVAA 1EBHA 4NZ3A 3CBWA 3ZVHA 1FBAA 3ZWTA 4FPSA 3L4TA 3TTOA 4HK6A 3WKZA 3TNOA 3R8RA 3VIKA 1UIOA 5C54A 4DF1A 2QEZA 2TRSA 3B03A 4ORMA 1XLCA 4GH1A 2R1MA 2DZPA 4LT9A 1BXNA 1DQXA 1Q6OA 1K7EA 5LYRA 3A12A 3EDKA 3HG5A 4S39A 1TX0A 2E1DA 4B5NA 4QEEA 2VHLA 2A79A 2DSZA 5DY2A 4DX3A 1KC7A 2VZVA 3AO0A 4I9MA 4UNIA 3E9AA 2P8CA 1J0HA 3PBGA 3QY7A 4JTIA 1G9HA 2VZUA 5MHBA 1CGWA 1CX9A 2G50A 1ZAJA 5JU6A 4Y2WA 4J3VA 4W9PA 3IRSA 4A29A 3PK7A 4RDVA 5DMYA 3CMFA 3W1TA 4KEVA 3BLKA 2CWNA 1XLBA 3HJZA 3MBDA 4QDPA 4HPXA 3W76A 2GLKA 3QOMA 3TC7A 4PMXA 3GXPA 2Y7GA 4OUIA 5BRQA 1YBQB 2DJXA 1POKA 1UA7A 2OX4A 4PRRA 3O5KA 1YDYA 3D47A 4XUGA 1FKTA 2O4QA 3FYPA 5M17A 3FEQA 4UMBA 4GYJA 1W3NA 1DPMA 3QQ1A 2ISSA 3SN4A 5EMYA 1TPH1 4J3TA 1RD5A 1Y5VA 1XRVA 3R10A 4MNKA 4IT4A 4C6CA 4JFUA 3WMSA 1XDJA 4IH3A 4MPQA 2J25A 1V02E 1OABA 3DU0A 3TU9A 2VGGA 1C8XA 1R86A 1O95A 3HO8A 4YMZA 1GUVA 1MXGA 2HISA 3CAVA 1H7NA 1PVNA 1T0OA 3WLQA 4J3UA 2C16A 3GR8A 3KABA 3TYBA 3E2QA 1H41A 2ZA1A 3IVTA 3TZFA 2ZQTA 1JZ2A 1W5PA 5H6HA 1ZCNA 2QCMA 2WMIA 3I7RA 1UD2A 3U5UA 3SJNA 4OV9A 4KR0B 2OEKA 1KKRA 2XN0A 2X41A 2F2DA 1I1WA 3E74A 3UJ2A 3ABQA 2GJXA 4NZ1A 1J11A 4HK7A 3EB3A 3IKDA 1W17A 4HPJA 1GRJA 4LCRA 1ZJAA 1MQRA 2ZC8A 2PWEA 3IJLA 4MLJA 3MY9A 2R6OA 3QHOA 4DT4A 1C9WA 4L1GA 3VIPA 1XL9A 2JKAA 1H7OA 2HCVA 2DZBA 4FO4A 1LLWA 3SGUA 1RP8A 5D2WA 3WSUA 4DIPA 2Y24A 5A8NA 4RE4A 6REQB 4JHMA 4N9CA 4AY8A 4I6VA 3GVGA 1ZNNA 4L4MA 5AHNA 4A21A 4D6DA 3VD3A 2FZ9A 1K6AA 5C9WA 2HE5A 4HSNA 2NXHA 3W7HA 4DBWA 3LXBA 1F2JA 4NJGA 3KDNA 2BZNA 3NZRA 5K3VA 1HF6A 4WXZA 3WMCA 1J0KA 3M0KA 2AGKA 4M29A 4PUKA 3GTNA 2VWSA 3CH0A 3P81A 3ABSA 4M1BA 2OWXA 3R4IA 1BYAA 4IP5A 4FR1A 4WDTA 3WUFA 2A3HA 4HP5A 1AMKA 3SR7A 1KRMA 3N2BA 3NQEA 2OYLA 1PXGA 4Y8EA 3BJTA 2DZSA 3CASA 1I45A 1KM2A 2YX0A 2XH4A 2ZX9A 4H7VA 3S5YA 4QIBA 1FCBA 3LG3A 4NAFA 3TN6A 3P8JA 2BTMA 1LLOA 1VJSA 1OG0A 4LF1A 2CBVA 4WRHA 3LTSA 1BF6A 3N14A 1OJXA 4BWLC 3PBMA 1S2UA 1PUDA 2QR6A 3A23A 2XP3A 1V08A 1UD4A 1GWJA 1E6QM 3LM3A 4JXCA 1XYAA 4K8EA 3GNDA 3WBXA 1N8IA 2G0WA 1UWSA 3W6LA 3TN5A 4PL1A 5KEZA 2XWEA 4TX9A 3W1QA 3DYMA 2O9OA 3URBA 5EPDA 3MP5A 1KO0A 3A21A 3SQLA 3V0TA 2YLAA 4H6EA 3PF3A 5AC6A 3ARZA 2QQ6A 4AIOA 5HWBA 4PMYA 1F05A 4PZVA 1DWAM 5C0QA 2DVTA 3WJXA 4FX8A 1S38A 1CGUA 3APYA 2NLYA 1M5YA 3R79A 4AD0A 1A5LC 1BTCA 2ADAA 4IG2A 3EXTA 3R8HA 3UQAA 5IHSA 3OZPA 2G37A 2B4GA 4MWAD 2XG9A 4UFKA 3WLSA 1EZ2A 1TPUA 4G7FA 4QAWA 1T11A 3PBUA 2UY2A 2NQZA 1OT1A 2ANUA 2PURA 3E12A 4LX4A 3OHMB 4L9ZA 2HVMA 4JFSA 3WZ0E 4PMRA 3LD5A 3LHVA 2VGBA 1RH9A 2Y5EA 4RNIA 1BYBA 1PE1A 5GQBA 4O8AA 3VILA 4HYVA 2BXYA 1R0MA 4ENLA 1M5WA 3I4KA 4GNVA 3UR7A 4O11A 2R91A 2RDXA 4PR4A 1DP0A 4WF7A 3FVMA 4LUSA 3F5JA 5FIPA 5DQPA 2E9BA 3QMTA 4ERAA 3PS7A 1GJUA 3E96A 3W86A 1MYRA 2GQAA 2C91A 1B5TA 3SRFA 1RVKA 1HW6A 3QYSA 1ZK6A 3W25A 4W86A 4DWSC 3I3BA 4XBJA 3DBNA 3W26A 1YNPA 4L72B 4GPNA 1U1JA 4PULA 5K4XA 4J40A 1BXCA 4K6AA 4DBDA 5C9XA 1DXEA 4PCTA 3MTWA 5HXMA 1QW7A 3VNMA 4IGSA 3KL3A 3GY1A 5REQB 3CL8A 3GU2A 5D8WA 2CEQA 3GS6A 2VEMA 1Q66A 4JKMA 4QDMA 4UTTA 2HJPA 4S3KA 3K1GA 1UR8A 2CKSA 3S2MA 4U28A 1NQ6A 1O60A 5A8MA 4P61A 1JQXA 4HA3A 1S5VA 1EP3A 5A69A 4IQCA 1NWRA 3UR5A 4CEXC 2NUXA 5AECA 1FH7A 1OVDA 2D3NA 3GHTA 4C6QA 1PIIA 4KESA 3ZOAA 1S2CA 3CPUA 1S39A 4JCLA 3MSGA 3NZPA 1KFKA 2VNCA 5JH1A 3I6EA 2X1SA 1EJVC 4O52A 1SM9A 5GJPA 4OT7A 3C6CA 4BEQA 4Q8PA 3L7RA 4PUEA 5E0CA 1UR0A 8TIMA 3O5QA 2QV5A 3LLXA 5GVJA 1X6NA 4LB4A 4TU1A 3QBUA 4YJ5A 3F03K 4X61A 3I3DA 3QKZA 4WDWA 3GSMA 1LORA 4FNPA 1FHDA 4GY1A 3TYZA 4CNNA 4E38A 1NH6A 1OEPA 3CS2A 4GX8A 4JZ5A 2P88A 2NWSA 4BQ3A 3UT0A 1TUFA 1DTUA 1UMLA 2WMJA 1X1OA 5G5IA 3VC6A 3CZLA 2AQOA 3WYZA 3OLGA 5JMUA 3EOLA 4Y9PA 2VRJA 4NIRA 5EB8A 5H8PA 2VD8A 2G3FA 3EWBX 3STFA 2Y8KA 2R1PA 1M3UA 4BQ5A 6XIMA 4DZIA 4JIRA 4ZQPA 4FN2A 3VKBA 4WSJA 1AMYA 3ITTA 2DPEA 4WIWA 2VFDA 1ZS2A 5E5CA 2OZ3A 1W5NA 3QZAA 2OYMA 2YCEA 2OFJA 1MXSA 1O5RA 3OHIA 3W1UA 4AD1A 1EBGA 3UETA 3UFYA 3OYXA 4HNNA 3AHXA 1JPIA 2FMNA 4GABA 3SSJA 1VYSX 3AU6A 4FHAA 3U2CA 3VIIA 4YPJA 2PDLA 3HQPA 4AEFA 1EP1A 1FRBA 2AKZA 3UCDA 1O94A 2EQDA 4U10A 4UCFA 4A8RA 1CBGA 4QR6A 2DW7A 2J7DA 4N4PA 4AZ5A 2VCBA 4OHQA 3LLFA 1IEIA 4RNHA 5KMYA 4ZPVR 1XISA 2VI0A 2GPTA 1TV4A 3V1HA 3E2VA 1NJJA 1J93A 4UTFA 3W87A 2CXGA 2I5IA 5KZ6A 4GWEA 2PDPA 2VEGA 4NRRA 2EPOA 3GTXA 3WNLA 2K8IA 3TXZA 1Y0OA 3HG4A 1JPKA 4BA0A 4Q6XA 1OM0A 3NVDA 4W9OA 4BF7A 3HBLA 1I0BA 3DHPA 5LSMA 3DFQA 2XSBA 4ZQNA 5TBOA 1VIZA 1THFD 2OWCA 1E55A 3BG5A 4Q4MA 4UR7A 2VC7A 5E6YA 2BB0A 1OX4A 5AHFA 1XSIA 2NVCA 2J8FA 2ATMA 3BSGA 2OPJA 3TONA 1EUNA 2CERA 2ZA2A 5AKQA 3VO0A 5LXEA 1ELSA 1QI4A 1QHZA 1H49A 2MLZA 3ITOA 3S83A 2V68A 4H9MA 4IX2A 1N55A 2HVOA 4EF9A 4CNPA 4AB4A 1MDRA 1CCWB 3WBAA 1HJQA 1QXLA 4J3WA 3VGDA 4PUJA 3U5YA 2ZX5A 4NT0A 2IF4A 3GDBA 1LLZA 2HEJA 1KRBC 1W9BM 3ITCA 1UZ1A 4Q4QA 1TTJA 3S46A 4JQ1A 2A7PA 1UASA 2ZKMX 1KBLA 3KFTA 4O1FA 1DJYA 4RZ6A 1MW3A 3G1SA 3RPDA 4LV4A 3M0LA 5F4WA 2DY3A 1F3WA 1FCQA 4IP7A 4KKXA 1J6PA 2Y89A 2XZ9A 2B31A 4WUIA 4N19A 5A2BA 4Y96A 3N2TA 2PS2A 4XD5A 4JCMA 3M07A 1G1YA 3B8SA 3P3BA 3ES7A 4LUTA 1TPWA 2VC6A 3DERA 3PJTA 3MYOA 3M7SA 4A35A 1VPQA 3W81A 4I5RA 3O8AA 3EB2A 3GRIA 4YL2A 5JUVA 1Q6FA 1AH0A 3L4VA 3GX9A 1IT0A 2QCCA 4WDUA 1H1YA 2E5DA 2E0PA 3EX3A 4CVWA 3VKKA 2PDWA 1ZJHA 1KFEA 3L21A 1Q2RA 1L9WA 4WY0F 1FKXA 3MBFA 4B90A 3QF0A 3KOZA 1BYDA 3P2VA 1XYZA 3DKJA 1WKEA 2PP0A 3D3AA 3N9SA 4LEQA 2Q8ZA 3S2NA 1UP3A 9CGTA 4GKTA 4DEFA 3DXIA 3U4FA 4NUWA 2D24A 1QPQA 4A05A 5ABFA 3GD6A 3NPWA 3L23A 5DBTA 3W38A 3ANVA 4WSKA 3W1MA 2RKXA 4LXFA 4M51A 1H5YA 3ZMRA 4U85A 1JUBA 1VH7A 3BAXA 1OCNA 1D7FA 3C0QA 3GH4A 5JIWA 3PWIA 5I2UA 4H8UA 2ACUA 3MO7A 2HSAA 1DIDA 1T6MA 1FY6A 4L4LA 6ENLA 1XXXA 4XAYA 1UH4A 3E6EA 2D1ZA 3WEZA 2QJMA 3BLOA 1XLAA 2QIIA 1DEDA 3QJAA 4ZXLA 3QY6A 1J0YA 4PUNA 1VCVA 1RY0A 4LYQA 3KE0A 4INFA 3KHDA 3I4EA 5BWAA 2JF6A 1QT1A 4JTQA 3IIXA 4GHRA 3LX9A 3C2YA 5DCDA 4DZAA 1JUEA 1AJ2A 4HHHA 1QI2A 3HF3A 1CXEA 4DI8A 4R7OA 3AU2A 1UP2A 3OA3A 4XSLA 1NDVA 1I2RA 3ZQ9A 4MOZA 2M1IA 4S3AA 4V1YA 3N4AA 1EYMA 4ERGA 2QUVA 2XP9A 4OWGA 4AD3A 3AMDA 2BGSA 4PE8A 4L6HA 2FTYA 1JD7A 5EYWA 3THQA 1MZRA 4G8TA 4UTWA 1NF0A 1SU5A 1HIZA 1G67A 4GJ1A 5LZLA 4JFWA 1LBMA 4IF2A 1JL8A 3GAKA 1JUKA 2D0GA 3SAZA 3SCRA 3CIWA 4DJDD 1N1AA 5B8IC 2Z7GA 5AVNA 3SW6A 1BG4A 2EPLX 1OFOA 1HKMA 4AZBA 3S0CA 3MJMA 3NQDA 2H9AA 4O1BA 5JQ9A 2XGBA 3EDEA 4HCDA 5C9UA 2PRHA 4REQB 4CCCA 4ODNA 3ORWA 2J62A 4KS0A 4ACYA 1RP9A 2NX1A 3O07A 4LCQA 4MB1A 3UVIA 1IZKA 1E0TA 1V6YA 3EMCA 4RK8A 3KTSA 5HATA 2PEVA 1VFUA 3KLKA 1GEHA 3LU2A 4H9YA 1WZMA 1VC4A 4DWSB 2POZA 1AFSA 2NQHA 3QLDA 4DELA 1W9DM 3KL5A 3W84A 1ZBKA 3RCYA 3H23A