2O9OA

Crystal structure of the buffalo secretory signalling glycoprotein at 2.8 a resolution
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the buffalo secretory signalling glycoprotein at 2.8 A resolution
pubmed doi rcsb
molecule tags Signaling protein
molecule keywords Chitinase-3-like protein 1
total genus 124
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2006-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2o9oA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2o9oA01
1W1PA 3WQWA 3ZOAA 3W81A 1QVBA 2B31A 1H1NA 3WH9A 2FGZA 4F79A 4TUFA 2WWDA 1EHNA 2OSWA 4AMCA 4JKKA 1BYCA 4GQRA 1BVNP 4N42A 3WF4A 4WKFA 4W85A 3WEMA 1CTNA 1EQPA 3OIHA 3WF1A 1JYXA 1B3ZA 4AY1A 3FAXA 1UD8A 1XYZA 4E2OA 3M6DA 2ZWYA 3WDJA 1VEPA 3VDCA 1ZBWA 1RP8A 2FGLA 1CGUA 3DC0A 1BYBA 3J7HA 1KCLA 1JF5A 1JAKA 2DT1A 3AICA 3BLPX 2DT0A 1L0PA 4HZ7A 2YOCA 3MSGA 3O6AA 1VBUA 3AZSA 1O6IA 3SCVA 9CGTA 4CN6A 3EDEA 2BY3A 2WVVB 4TXEA 2OYMA 2DIJA 4PMYA 2CYGA 5A69A 3KEHA 3WUEA 5TD4A 1UR1A 4MAZA 3B9AA 1GOMA 2X0YA 5FOOA 1QNRA 2CBUA 4DUVA 2XTKA 4HMCA 2V38A 5LA2A 2WHKA 3W37A 4ATDA 1EDQA 3VINA 1V0LA 4UZUA 5DT5A 3WEOA 3DYOA 3SUTA 1KXTA 5IDIA 2YA0A 4P8UA 2NT1A 2VJXA 1TCMA 2W66A 1EA9C 2A3CA 2D23A 3BCDA 4AD0A 5CLWA 5IHSA 1QW8A 4HZ6A 4U2ZA 4U31A 1FHLA 4MJ2A 2VCBA 2UWFA 4PTWA 2VL4A 3SCWA 4PMRA 5FIPA 2D1ZA 5KZ6A 4W7UA 3OBAA 1O7AA 3DYPA 4U3CA 3OA5A 5F7UA 4HU0A 1MQRA 3MV01 3PTKA 4DUXA 3CH9A 1S46A 3VD5A 3UG3A 5EFDA 7A3HA 2WVVA 2XFFA 4H41A 3GBDA 3ZT6A 3VX1A 5A6SA 1IT0A 4P7LA 4KRUA 1SR0A 1G9HA 4ATLA 2F2HA 1V0KA 3UETA 2YKKA 3GNOA 3L4TA 1J18A 1CIUA 1PZ2A 5AYBA 1ZS2A 3VIJA 5D9MA 1W3JA 1K9DA 2EXOA 2J47A 4FLRA 4ACZB 3WNNA 1V3IA 2XVPA 3RO8A 5M3WA 4NI3A 3K46A 3SCNA 1E6NA 3PZGA 3T0AA 1HT6A 2V3GA 1BHGA 1B3VA 1OIMA 2WZEA 1YQ2A 2YL5A 1E6ZA 4RE3A 3SCOA 3RM4A 3QHOA 5BRQA 4B9YA 2DSZA 2IUZA 3CZGA 2EPNA 5BXRA 1X1NA 2GK1B 1UA7A 1EHAA 2BS9A 4M29A 1P6WA 3AYSA 3AJ7A 3VPLA 3GNRA 2ZUMA 3L4VA 4J3XA 1CGXA 1OSEA 5E6YA 5BYWA 2ZUWA 3VGDA 2CESA 1FHDA 4PTXA 1VAHA 3CZ8A 2DSUA 1KXVA 3PZOA 4IPNB 3W38A 4H8VA 2WCSA 3N17A 4C7FA 5BXTA 3DECA 3SCSA 1GW1A 1HXJA 4Y7EA 1J01A 4Q7NA 4M81A 1CZ1A 1M7XA 3AQUA 1VJSA 3VX0A 3HMCA 3AIQA 3CZEA 1HKKA 3VIKA 4BF7A 4CGTA 4CCCA 1KR0A 5A6LA 4UFJA 3KL5A 5A2AA 1CGYA 3N18A 2BVTA 3F5LA 2CPUA 4UNIA 4HU8A 1JG9A 3B8SA 2W67A 2WM0A 1HKJA 4YN5A 1H09A 1XRVA 1OD0A 4H04A 1W9VA 1XCXA 5CPTA 3VU2A 1R7AA 2WANA 2Z1KA 3AS3A 3ZR5A 2GVYA 4TVUA 4WF7A 4CD6A 1XHGA 1ITCA 3WBEA 5GNXA 3IAQA 3EDJA 1VF8A 1WZMA 3EDKA 2VX7A 5C71A 3W25A 3PTMA 1SMDA 2GJRA 1JD7A 1JXJA 1B9ZA 3PZIA 4URIA 1UD5A 3I3EA 4ZE4A 4CD7A 3AS2A 1C91A 3CTTA 3CUFA 3CGTA 6TAAA 2DH3A 3OLIA 1E6RA 3DHPA 3JUGA 1US3A 1TZ7A 1UH4A 5HOSA 2D0GA 1OB0A 2W91A 5A2CA 4X0VA 1HF6A 3VNYA 4H8UA 4CU6A 5I77A 4QCFA 1OWQA 5BROA 2D24A 3AXHA 2J7DA 1NOUA 1GOQA 3GH4A 3WQ5A 1TG7A 2Y24A 1BFNA 4AWEA 3ARZA 5A8OA 1JFHA 3AMGA 3FHAA 1GQJA 4P7RA 1CGVA 4PEEA 3U5UA 3VILA 5JUVA 1QHOA 4D6HA 1V3MA 2BY2A 3MU7A 4LX4A 4PMQA 1JL8A 1JNEA 1EXPA 5CPQA 2YA2A 3WEZA 3VIFA 3AMLA 3WQ6A 2ZUVA 1NQ6A 1NOFA 4A3YA 4D72A 4UCFA 3CIVA 4AW7A 3MV11 1HVXA 3WMBA 2ZX7A 3BAWA 1I1XA 1FP9A 5I5RA 1CXLA 2J62A 3AMDA 4XX6A 2AMGA 2YDSA 2XYLA 1J9YA 3KL0A 4AZHA 4AZ7A 1XH2A 1KGUA 1WO2A 1WDPA 4B9ZA 4FK9A 3WNKA 1VEOA 3MUAA 4D1JA 3EMZA 2CITA 5BXSA 1OT1A 3WQVA 2PWGA 3MMWA 3ZJ7A 4F9DA 1HVQA 1CXHA 1KCKA 3A4WA 3IJ9A 2OWWA 1KXQA 3TTSA 1BG9A 2BFGA 3GH5A 4CD4A 1KBKA 2WPGA 2X05A 1J10A 1E4NA 1JZ2A 2JEQA 4CD5A 1H11A 2VVNA 2YIHA 2OSYA 3ARSA 2WMHA 5EFFA 3RM8A 1XD1A 3PZVA 1EO7A 3HN3A 5JBFA 1PX3A 3IANA 4J3TA 4JHZA 4UQEA 5D9OA 1U33A 5CGTA 1OIFA 2ZX5A 1UR9A 1GOOA 3L2LA 2G8ZA 7CGTA 1B1YA 4PSRA 4BCEA 4OUEA 2PWHA 1JAEA 4TOQA 5ABHA 1R85A 1Q6DA 1VENA 1SFSA 3VIHA 5AY7A 3ZJKA 2OYKA 3FXYA 1GCYA 2FDMA 2VCAA 3KL3A 4BQ2A 2A3AA 1D2KA 1W3LA 4X0NA 1JF6A 1UA3A 4PMUA 4MADA 4PMNA 2PI6A 3CUIA 3D5HA 1GHRA 1DWAM 1VFFA 1H41A 4J3WA 3W27A 4WK9A 3WD1A 3BC9A 3RM9A 3AIUA 3CPUA 4GPNA 3AXXA 4PMDA 2XFYA 2VZTA 3LMYA 4M1RA 1BQCA 4FF5A 1MYRA 1W3HA 1W9BM 4U33A 1MW0A 1SMAA 1JDAA 4XUYA 3OGRA 3OZPA 1HL9A 1NOWA 3NJ3A 4WIWA 3TONA 2WB5A 2WW5A 4P8XA 3T2QA 3HJEA 3ALFA 3SUUA 2WVSA 3RCNA 1ZU8A 3U7VA 1C8YA 2GJXB 5EB8A 5IFTA 1HJSA 2JEPA 3WUGA 2DQXA 4D6EA 3II1A 1W32A 4Q22A 3K1DA 2XHYA 4JCLA 1BLIA 3PN8A 3T2PA 1KB3A 3ZJ6A 2YBTA 1ZB5A 1GHSA 1UWTA 1V6UA 1LLOA 4EANA 1XC6A 3K8LA 1PZ3A 4HP5A 4P7QA 1M01A 1MFVA 2F8QA 1XV8A 1OGGA 4E8DA 4A4AA 4AC1X 3WIJA 4B15A 4J3UA 3PZUA 4OBRA 2A3HA 2E9LA 2VURA 3WELA 4AXNA 1FH9A 1ZJBA 5HPOA 5JH8A 2JIWA 1WP6A 4FMVA 2XFRA 3ARWA 5HBFA 2XVLA 2J79A 4W7WA 1WKYA 2J7BA 4WSKA 3AIWA 5A94A 2VR5A 2IXVA 3VGBA 2EPKX 4UR9A 1ZBKA 3WNOA 4JZ5A 2XVNA 5AYIA 4WJXA 4BQ5A 1SYTA 4UQCA 2ZUTA 2CNCA 1KWKA 1ECEA 2WWCA 5HDRA 1M53A 1E6SM 4HPGA 3RPMA 3CUHA 1XH0A 2E8YA 2GJXA 5M5DA 3T2OA 1E0XA 2VZSA 4MTVA 2WMJA 2PBOA 3ZT5A 3SCUA 3WDRA 2DDXA 4DM2A 1KFWA 4MNLA 4AYSA 1J11A 2VO5A 1VEMA 1PX4A 1DWHM 3QOMA 5DFAA 1LG2A 4TX6A 3WDPP 2PWEA 2VRJA 1W9DM 5BRPA 1QNQA 2VZOA 2BVYA 3A47A 4DM1A 3GXMA 2VC9A 1QNOA 4PCTA 3OG2A 2GUYA 3N15A 5A6BA 2J77A 4AD5A 3MUZ1 4PMXA 3NSXA 2WHJA 8A3HA 3VGEA 4LXFA 2WHMA 5A8PA 4PMZA 4S3JA 3SCPA 3VM5A 4MAVA 3POHA 2WNWA 2VNCA 3BH4A 2O9OA 3M46A 3VDAA 4FLQA 3AS0A 2D2OA 3AHYA 1J0HA 1BGAA 4P8VA 3RILA 2EBNA 3BMVA 4XB3A 3L4YA 1ZBVA 2QMKA 2DT3A 3OLGA 2Q8XA 3AIRA 4M24A 4UFHA 4LQ1A 5ABFB 4UOJA 1E0VA 4MNMA 1NWUA 3EDFA 1V3LA 3APGA 1CXEA 3BGAA 2CHNA 3K4AA 4CD8A 1E43A 1ISXA 1E40A 2EPLX 4TX8A 1KQZA 4MB1A 2EPMX 1ISWA 2UY3A 3VDBA 3N11A 1Q4NX 1MXGA 5D9PA 1F4HA 1CWYA 1G01A 3NCOA 3ALGA 1E6QM 1W91A 1RPKA 2CKSA 1WDQA 3BCFA 1TUXA 2XM2A 1F4AA 1H5VA 1TE1A 4CN4A 2J7GA 1JDCA 4V28A 1ZL1A 4W7VA 4MNJA 5FL1A 2BV9A 5LA0A 3N13A 1OGSA 4PN2A 1J0KA 2WCAA 1OGBA 3A6OA 4ZENA 1R7OA 2WVUA 5DO8A 2V3FA 3WDQA 3W4RA 2E8ZA 4TVCA 1GONA 2QPUA 1DWJM 1QBAA 4PUDA 2WLYA 3RMEA 4DWSD 4E4PA 4W88A 4QFUA 5KEZA 1JXKA 5E0CA 1B3XA 2G4FA 5IHRA 2NT0A 3VGGA 4M80A 2CIPA 5I23A 5ABFA 3CLWA 5GPRA 1JYNA 3ARUA 1E72M 1E73M 3G6LA 4JIEA 5A3HA 1CPUA 1W1YA 1HX0A 4AD4A 3W6LA 2ZUUA 1H0IA 5GNYA 4WSJA 2G41A 4JHOA 4JL2A 1E9LA 3TA9A 4UOQA 3MS8A 1E55A 1QHPA 2ZXBA 3MMUA 4F9JA 3AFBA 2J8FA 3ARQA 4WLCA 1WZAA 2Y8VA 3WQ8A 5FD0A 2W92A 4KMQA 1A47A 1M04A 1R87A 4RL3A 3VKKA 3CBWA 1E6XM 4UQAA 4UQBA 4AEEA 3ARTA 3AHTA 1QBBA 4PCSA 1MW3A 3L4ZA 3O9NA 5E09A 3L2MA 2G3IA 4J7RA 3GXDA 2OWCA 5ECUA 3IK2A 2HVMA 2X2YA 4DUWA 1V08A 1Q6EA 5I0DA 1DWFM 4QLKA 4JFSA 4AZIA 2C7FA 3WF2A 1HKIA 4C7DA 1C7TA 1V6VA 5E9AA 4ZE5A 3G6MA 3SUWA 3ARVA 3CO4A 4JKMA 2E9MA 3T0BA 4J28A 1LF1A 1W9PA 3LPGA 3VD4A 3ZSSA 1LQ0A 3W26A 3BAXA 3K4DA 4AZCB 2ESCA 3CHFA 1DWIM 4GZIA 1FFQA 1CLVA 2ZUSA 4W87A 1GNXA 4W84A 5A6AA 4UFLA 2CETA 2WMIA 3WMSA 4LYPA 2WMKA 2J75A 2D22A 5LYRA 4MPKA 3WNMA 1C8XA 3WD4A 1US2A 3VVGA 1UWIA 3LPPA 1E1FA 5D4YA 1GJWA 1NWSA 5LA1A 4NZCA 3RJXA 3A4AA 4PTMA 3D3AA 2WC3A 1BAGA 4GQQA 1E5JA 2J78A 4ZXOA 3VMPA 1UD4A 4JFVA 3FHQA 4R5EA 2QLYA 1W2VA 1KXHA 4W5UA 5I6SA 1UUQA 1HNYA 1Q6GA 2BXZA 1NARA 2XWEA 3OLEA 5GNZA 3IJ8A 3GH7A 2FH8A 1OT2A 2WYSA 5ABGA 4U5IA 4EKJA 5I2UA 2JF7A 1VRXA 2W62A 3F5JA 4ACZA 4HTYA 2O9RA 4AIUA 2DIEA 2XGIA 1B2YA 5CSYA 3VUPA 1PX8A 1B30A 2XPKA 2ZE0A 1UH2A 1E15A 4M8UA 5CLTA 4AEFA 2VRKA 2GJPA 3VIIA 4GI6A 1UD2A 3AZRA 5BCAA 2QF8A 5A6JA 1OD8A 1KBBA 3THCA 2JALA 1QW9A 4AIEA 4CVUA 5DMYA 1E4LA 3CUJA 4QLJA 1CLXA 3OLDA 2ZWZA 3M7SA 3CHDA 1PIFA 3GBEA 2W61A 1E4MM 1JFXA 1UQZA 4NRSA 3NYDA 3RJYA 2NSXA 1QPKA 4AD1A 1GQKA 5FKYA 5AC5A 2Y8KA 4V27A 3W0KA 3S2CA 3N12A 2VMFA 2PB1A 2WK2A 1CGTA 4CU7A 3N9KA 4UFKA 4ZFMA 1GVIA 5A6MA 3B9EA 1V6WA 4P7NA 4EAMA 5BXPA 3W29A 5CXPA 3VTRA 1D7FA 1LL7A 1H3GA 4XV0A 1AMYA 1OINA 2AOSA 2Z1SA 2Y5EA 3WH8A 1LWHA 4CUCA 3HU7A 2XIBA 3EMQA 4IPLA 4AZ6A 4LGXA 5E70A 1B0IA 4OIFA 5C70A 4BQ3A 1UH3A 3QHNA 2VRQA 1HJWA 1H49A 1VBRA 2E4TA 4TTUA 1E3ZA 1NM9A 2G3MA 1LG1A 4X9YA 5JIWA 3DYMA 2ZX6A 1IZKA 3ARXA 1QI3A 2V3EA 3IAPA 2X8RA 4GZJA 1Q6FA 2D0FA 1MW2A 4MB3A 5EBAA 4PRWA 1IZJA 4BQ4A 2A3EA 3TP4A 2J25A 1H4PA 1MXDA 3NDYA 1EOMA 4PMVA 3CZKA 2VX4A 2ZIDA 1CDGA 5I24A 3BAYA 2YL9A 4EE9A 1VFUA 4HPHA 1E1EA 3ZM8A 4UFIA 2XJ7A 4MB5A 3VIOA 2G3JA 2E0PA 4CN1A 3WL0A 2GDUA 3A3HA 2WBKA 2XIIA 1BPLB 3O2LA 5HPCA 1JZ7A 3NIYA 3VIGA 1BSIA 1TVPA 4OZOA 1KWGA 2WXDM 2O92A 1I1WA 1LL6A 1WCGA 1HJXA 2JFEX 4TTGA 1PAMA 4HZ8A 3MANA 2BHZA 1RH9A 4DWSA 3BAKA 4Z2GA 3GXFA 4W8BA 1GQLA 4PYSA 1ZJAA 4AZCA 1K9TA 3CHCA 1EIBA 2QHAA 2E3ZA 4KH2A 1AQMA 1Q6CA 3W6MA 4JFTA 1UKQA 4UZSA 2QV4A 7TAAA 4W5ZA 1UWSA 3OGSA 3ZIZA 1V3JA 4JCMA 2EEXA 2G3NA 4J27A 5I78A 3VNZA 3CHEA 1M03A 1V0MA 3W24A 4D1IA 4LYRA 3AYRA 4XZWA 3VOCA 1QI5A 1LWJA 2XG9A 3TTOA 1DTUA 3MUIA 4L4PA 3PBGA 2O9TA 1CBGA 1PBGA 1WDSA 1QHZA 3AIVA 2ZICA 4UQDA 4D6CA 3PTQA 3W82A 4GO8A 2OWXA 1UZ4A 5AC4A 1MQPA 1V03A 2QPSA 5M03A 5I3DA 1KGXA 2VI0A 3VMNA 5CG0A 2YJQA 5D8WA 2DEPA 2J74A 3PZQA 1BGGA 2GDVA 1W9XA 2F61A 1J12A 5D8ZA 1PEZA 1G94A 4PSPA 3SCTA 3PHAA 1HL8A 4RE2A 1G5AA 4KRTA 3KZSA 1UKTA 1JNDA 4BS0A 1GUVA 4IUGA 2GSJA 2YLAA 4S3KA 1CGWA 4MJ4A 4FLSA 3POCA 4W86A 1J0IA 3K8MA 3UERA 1V6XA 2FHFA 1MFUA 3WUBA 1W9UA 4GZEA 4K68A 1QI0A 3ZMRA 3T08A 2CKRA 2ZUNA 5DT7A 3RDKA 4OJYA 2FHCA 4CKQA 3TTQA 5DEZA 1E4IA 3SEPA 4DWSB 3SUVA 1J0JA 4QP0A 1R8LA 3WKZA 2D3NA 1UR4A 2UY4A 1HP4A 1VFMA 2JE8A 1CXIA 1CYGA 1DHKA 3LPOA 2NW0A 1YHTA 2WMGA 1JZ4A 1J0ZA 1E3XA 1GVYA 1UQYA 2WKGA 4D6GA 1XSKA 2VCCA 1E70M 3VD3A 1JZ6A 3U57A 3PZ9A 1QI2A 1C7SA 1LL4A 3BAJA 3W53A 5M17A 2E40A 2DSWA 3MO4A 1E56A 2RGMA 4M56A 3CMGA 2VX5A 1VIWA 3U7BA 3LPFA 6CGTA 5A6KA 3WH6A 3WY1A 1TFVA 3SCRA 3UCQA 1E71M 1V02A 4HMEA 2Y2WA 1B3WA 2WSPA 2XGBA 2XVGA 2VZVA 2PWDA 1HJQA 4R27A 1GQIA 3BSGA 2O9PA 2OYLA 3UG5A 1HIZA 2WAGA 3AISA 5BWFA 1A3HA 1VJZA 1BG4A 2XSBA 1ODZA 4D6FA 4LPCA 2WC4A 3I3BA 1KR1A 2PBGA 1B31A 2VVSA 1EGZA 1HP5A 3GNPA 3N1AA 3WL1A 2V3DA 1WPCA 3WD0A 3RIKA 5IXEA 3CMJA 3AMCA 3VD9A 2FHBA 4MNKA 1UWUA 4D71A 1LJYA 1WNOA 2DSVA 5FL0A 3VIPA 1RP9A 5A1AA 1ISYA 2PF0A 1WB0A 4U3AA 2WC7A 4Z2JA 1KQYA 1FFRA 1JI2A 1JZ8A 3QHMA 3NDZA 2CBJA 5CGMA 4V2XA 4ZXLA 2CBIA 3QGVA 3WF3A 2YL6A 2J7HA 1OCQA 2E9BA 1UZ1A 2ZXQA 4C7GA 2XM1A 3FAWA 2DPEA 2WSKA 3W28A 3WD3A 2D20A 4B16A 3SCQA 1UKSA 5DF0A 3M07A 2J7CA 3MSDA 3WD2A 1TR1A 2J7FA 3AHVA 1UYQA 5JBEA 3WQ4A 1E5NA 1CEOA 2HISA 4ACYA 1EOKA 1AVAA 1N82A 1MVYA 1XSJA 2BVDA 1ISVA 3SUSA 4W8AA 2W4XA 3EMCA 3N04A 4D6IA 2BNJA 4Z2HA 1W3KA 4PBGA 3AIBA 1XYFA 1JZ3A 4OOZA 1ZBCA 4JFWA 4AISA 4UOZA 2YBUA 3TTYA 3WH5A 3ARPA 2YLLA 3ZJ8A 1EO5A 2WMFA 2VUYA 3BLKA 2EJ1A 4PTVA 5A8MA 3WN6A 4FLOA 3GXIA 5CZKA 3L4XA 1DWGM 1Y7VA 1NH6A 2MANA 3VO0A 1JIBA 2XSAA 1FH7A 2C0HA 1FA2A 3BMWA 3OZOA 4AIOA 4HA4A 2W5FA 1UD3A 3WENA 3ZQ9A 1C90A 4JAWA 3VGHA 3PZMA 1ISZA 3WMCA 1XSIA 1JYVA 2PWFA 1RD6A 1QI4A 4OBSA 3ZO9A 3AHXA 1VB9A 2YA1A 4E8CA 5HNNA 4F8XA 4B3KA 4UQ9A 3VM7A 2AAAA 4GKLA 2BY0A 5E6ZA 1HJUA 3WNPA 5FCZA 1TA3B 1QOXA 4CVWA 1TVNA 4EK7A 4D6DA 3EBVA 2JF6A 1EDGA 2D3LA 4KGJA 1OM0A 4H2CA 2W63A 1W2PA 2UY5A 3KWXA 2EO7A 1BF2A 2QMJA 4AZGA 2VR4A 4GIAA 2ZX9A 2CCRA 2X09A 1HJVA 5CPSA 3T09A 3WF0A 1UR2A 4J3VA 2YDQA 1D3CA 1HN1A 3NUKA 1XCWA 3FN9A 3SURA 2OSXA 1EDTA 1WZKA 2WZHA 4AD3A 2CBVA 5A8NA 3B9DA 1V02E 4WKAA 3WBAA 4AD2A 3GZAA 5JIPA 2A3BA 1W1TA 3EDDA 3QOKA 4KGLA 4H8HA 3NSNA 3AXIA 2XWDA 3AMKA 3CZJA 2ZOXA 4W89A 1B90A 3A4XA 2VOTA 1JDDA 4B3LA 2X0HA 4OKDA 4QLLA 1QNPA 5HXMA 3L4WA 4YHEA 4U2YA 2PC8A 4U5KA 1K9EA 1JZ5A 1DP0A 1MQQA 1AQ0A 3BXWA 2BHUA 1L8NA 2Y4SA 4Z2IA 1TMQA 1TA3A 3BSHA 3UEQA 2JIEA 4HOXA 4UFMA 3VGFA 3UR8A 3AZTA 3FY1A 4KWUA 2WMIB 1CXKA 8CGTA 2V5DA 3QR3A 3IJ7A 1FOBA 1JI1A 3WUFA 4YHGA 3VIMA 1UKOA 5JBDA 2BHYA 2WCGA 2WKLA 4QAWA 1C3FA 3VDHA 4CCEA 4DWSC 3MMDA 1PPIA 5A8QA 3NSMA 1H2JA 2J7EA 3MUY1 4ATWA 1NP0A 2VZUA 1WZLA 3AOFA 5CSUA 1CECA 2DSKA 3ZT7A 1E6PA 1JGIA 2X1IA 2CHOA 2YL8A 1GOIA 1X6LA 5A95A 2XUCA 3I3DA 4BA0A 1HKMA 3GDBA 1JD9A 1GOKA 1GZJA 1XGZA 1E0WA 1FP8A 3AI0A 1PIGA 2CERA 2VQUA 3WDHA 1CENA 1MW1A 3ARYA 1V0NA 4PMOA 5ABEA 4HMDA 1DEDA 5CQ1A 2BXYA 3ECQA 3KE0A 1BTCA 1UR8A 4M82A 4H7VA 3PZTA 2VT0A 3PZNA 3S6TA 3FW6A 1FH8A 3GTNA 4XZBA 1WAWA 1XH1A 5D9NA 5E0FA 4NSBA 3VD7A 3OB8A 2GK1A 2UY2A 1UG6A 1CNVA 3UR7A 1IV8A 4OOUA 2VX6A 3L4UA 3F4VA 1ESWA 1UKPA 4BZYA 1U30A 2OLHA 1V3HA 1BVZA 1J0YA 3WFLA 2CEQA 1GJUA 4JFUA 4IISA 1XD0A 3BAIA 4N0RA 1EH9A 2C8NA 1ITXA 1R86A 1PJ9A 1OBAA 4GXPA 3UESA 4W93A 1CXFA 2RGLA 1UWRA 4QDMA 1VFOA 4A3HA 2D0HA 1WE5A 5EMYA 3MKKA 4NF7A 3DHUA 3AHZA 3T0DA 3K8KA 4W8LA 1C93A 2DH2A 1UD6A 1G0CA 4YPJA 4CCDA 3THDA 4UTFA 1JYWA 2TAAA 4GI8A 2WZIA 4L4OA 5I79A 1V3KA 4MB4A 1K6AA 4JL1A 3WFZA 5GQBA 2WVTA 4ML4A 3F5KA 4MDPA 1I75A 1WDRA 4TVDA 1NWRA 2DGAA 1GORA 3TOPA 4HA1A 1K9FA 2V5CA 2VTFA 4HA3A 5IFPA 3WDIA 4GINA 4JKLA 4AZBA 4MDOA 1H0GA 4IM4A 6A3HA 1B3YA 2WBGA 3GYCA 3WSUA 1UOKA 1V6YA 3WNLA 4AZ5A 2BY1A 2GFTA 2CXGA 3FNDA 3ARRA 4HOWA 1C92A 3SIMA 2J4GA 4Z2LA 5A2BA 3U5YA 3GM8A 1X6NA 3ZR6A 4QCEA 2EQDA 3WH7A 2ZXAA 3AROA 1AQHA 1ODUA 2VQTA 3VMOA 3CZLA 1GOWA 1Z32X 2ZX8A 4CU8A 4RE4A 2WLZA 2EPOA 4D6JA 4P8WA 3EYPA 2J8GA 2WHLA 2XVKA 3ZSTA 1MWOA 2FH6A 1G1YA 1NWTA 1NP2A 3CUGA 5CJ5A 1GPFA 4LYQA 1C8QA 1U2YA 1UR0A 4GI9A 1EQCA 1KGWA 4ZEPA 2IXUA 4WKHA 3AS1A 4HOZA 3UG4A 1BYAA 1UHVA 3OGVA 2YDRA 1UWQA 1W1VA 3AIEA 4Z2KA 4GO9A 4J3SA 1QNSA 3E1F1 5C8BB 4P7OA 4NRRA 4PUEA 4F66A 5A6BD 1BYDA 2DT2A 2ZXDA
chains in the Genus database with same CATH superfamily
3ZOAA 2XPBA 3CO8A 4TUFA 5AHEA 2PCQA 4IXHA 3QQWA 4FZIA 3WEMA 2WSRA 1EQPA 3OIHA 3GAKA 3FAXA 2DZWA 3C3NA 1REQA 1GPWA 4FO4A 1XYZA 3RLUA 3JR2A 3VDCA 3WDJA 2QT3A 3RU6A 4TIMA 1RP8A 2J6XA 1CGUA 3UI4A 1M1BA 1NEYA 1EUNA 3J7HA 4N4QA 1XLAA 2DT1A 3ITGA 3BLPX 2Y8UA 1OFQA 1ZENA 2YOCA 4NU7A 3CWOX 2A6NA 1TV7A 2QJMA 1VBUA 3OHIA 2QGYA 4WVXA 1VPQA 3SCVA 4R9OA 3EDEA 2BY3A 3USBA 3LV5A 4TXEA 4I9TA 4O0ZA 2DIJA 2CYGA 1K4HA 1XFCA 2RAGA 5A69A 3KEHA 2VWSA 4RX0A 3W87A 1QNRA 3XINA 2CBUA 3KWSA 3MWAA 1QMLA 5LA2A 1OQFA 2X30A 2HTMA 3M41A 2ZZ5A 3D47A 2QCLA 2YCIX 1EJ7L 3VINA 4UZUA 1VHCA 5DT5A 2ZZ3A 3OW1A 4B4FA 5CZ0A 2NT1A 3P14A 4ZPWR 2OCZA 3I4KA 3I6EA 1JCHB 5CLWA 3VAWA 4U31A 3NOYA 4GVIA 2VCBA 1WA3A 3W2KA 2FZMA 2V2CA 3PJUA 3PWGA 5F7UA 1MQRA 2EG7A 4FNSA 1R9HA 3BOLA 2Q3OA 5U7SA 2O55A 3B8WA 2DVTA 4Y90A 4H4IA 4NXSA 2ZZ1A 3GBDA 1SR0A 5HWBA 1XGEA 4CCZA 3GNOA 3L4TA 1OC5A 1NDWA 2F6XA 5D9MA 2J8TA 2EXOA 4LV9A 2FZDA 4NI3A 3K46A 3O5PA 5C2GA 3UXIA 3T0AA 1TKKA 1XBYA 1BHGA 1B3VA 3TDBA 4EACA 1OIMA 1XCFA 5HQEA 4BEQA 1YQ2A 4WHBA 4IJCA 3N14A 3U6WA 2BWGA 4F40A 3D46A 5HNTA 4B9YA 2PGEA 3FGCA 2GK1B 1UA7A 3TQ0A 3N9SA 2VC6A 1P6WA 2QPXA 1R3SA 3AJ7A 2ZFAA 3N4EA 3L4VA 1CGXA 5KINA 3MDYB 1OSEA 4JTFA 3VCCA 2IW0A 4JY8A 4ZTYA 3EWBX 3NRKA 1P0KA 1FHDA 1HW6A 1KXVA 3PZOA 3N34A 1F07A 3N17A 4LY8A 3DECA 1VHNA 4DHGA 4RLIA 3LM7A 4MWAD 2RKXA 4QE1A 3AQUA 3GW3A 1EYMA 2PFHA 3VX0A 3VZYA 3CZEA 1UUOA 3VIKA 4CGTA 1XX1A 4F0SA 2PPGA 1TIMA 2EJAA 3P61A 5A6LA 3FEQA 2BVTA 5FJIA 1QPLA 2V30A 1EX1A 1GEHA 4UNIA 3OG3A 2H8XA 4HA0A 2W67A 2WM0A 1VLIA 2A6LA 3CQJA 1TPVA 1DQWA 3LHZA 4HSOA 1L6SA 3JZUA 4H04A 1PE1A 2Z1KA 3HOJA 4OBTA 2I1OA 1FWNA 4Q3MA 2GWNA 3PULA 1VIZA 5FF7A 1VF8A 1WZMA 3EDKA 2VX7A 4LS2A 4ADSA 2E67A 1RZMA 3TN3A 5D2XA 1OZMA 4ZE4A 1DORA 1TWIA 3CUFA 1T5AA 2DH3A 1GVRA 4JN6A 4ORIA 3S46A 1MRQA 1TZ7A 1UH4A 2E77A 1OB0A 5GJMA 1XLLA 4H8UA 2VOMA 2KZHA 4K8HA 4DJDC 5TAOA 1U5JA 5AZ1A 1ADOA 4NQ1A 1NOUA 3UD6A 2AL1A 3LU2A 1EZ2A 2QULA 1TG7A 3VKJA 4MMWA 3B04A 4ZOAA 2W3ZA 1R5YA 5A8OA 2QUMA 3AMGA 3FHAA 4P7RA 2XFWA 4LAXA 3U5UA 3WLIA 5E0KA 4AY7A 1GKQA 1JL8A 4PMQA 3L5AA 1C9WA 4EVZA 2J9YA 2RDXA 3WEZA 1S2TA 2XGZA 4XZ9A 4GGHA 4DPQA 2ZUVA 2P5NA 4Z1YA 1JRCA 1NY1A 3GNNA 4IFKB 1Q6RA 1ZY9A 3C0LA 3WMBA 2ZX7A 1I1XA 1Z41A 2C1IA 1FHVA 1CXLA 2J62A 4IIEA 1NTHA 2AMGA 2ZZ7A 4AZ7A 1XH2A 4XKYA 1WDPA 4B9ZA 3MQTA 1XR2A 4FK9A 2ACUA 3VKBA 1FWIC 3DFNA 1L2QA 3CV1A 3GDLA 1ONXA 1GYMA 4ERAA 3HPFA 3EMZA 2OMAA 1OT1A 3MMWA 3A4WA 1EP2A 2OWWA 4NT0A 1BG9A 2WQPA 4Q8WA 3FS2A 2WPGA 3UWYA 2X05A 3UXLA 1E4NA 2PP0A 3BARA 1F6KA 1H11A 2PP1A 2VVNA 1J6YA 3U2ZA 3ARSA 2WMHA 4X60A 5EFFA 3RM8A 5DCDA 5JBFA 1Y5XA 4JHZA 4G5DA 3HQ1A 1N7KA 1UR9A 3I6RA 3NTYA 3NQVA 1JAEA 5FI8A 3NO5A 4G1KA 1VENA 1SFSA 3LI1A 2OYKA 3W1NA 2A3AA 5HNUA 1D2KA 1W3LA 3PUDA 3QZ6A 1DJWA 3LCFA 1XIDA 3CUIA 3D5HA 1DWAM 2V8ZA 4JNMA 1THFD 5CZJA 4A22A 3WD1A 4YTQA 4QJ3B 5CPNA 4U86A 2XFYA 1A3WA 4AX7A 2P50A 1MYRA 2Z6JA 1W9BM 2ALRA 1JDAA 2CZEA 1HL9A 5H6HA 2DY3A 1UW9A 3LBOA 1TWSA 3SRKA 4K1WA 3FA3A 3QVQA 3HJEA 3DIPA 2GJXB 3H7UA 5BMXA 4PTDA 3Q2DA 3KM8A 1LROA 3L12A 3UF9A 5G2IA 3QSRA 4WGHA 2XHYA 3ITTA 3PN8A 4JCLA 1ZFJA 3NZGA 1KB3A 2YBTA 1UWTA 2X7VA 3OOQA 4JN7A 4EANA 1XC6A 4ZO7A 1O94A 4P7QA 2F8QA 4G2DA 3TW6A 1OGGA 4E8DA 4A4AA 2W9MA 3PUEA 4ODMA 1FWHC 4B15A 3EWWA 3H23A 5HR7A 2VEPA 1JGMA 3G1YA 2A3HA 2GJNA 1IYXA 2E9LA 3DFYA 4AXNA 3IUDA 3GVVA 2JIWA 4MYXA 2QCGA 3URBA 4WRHA 3TNBA 4GMEA 2XVLA 1D7JA 3GIPA 4ZSUA 5FJJA 3W7EA 3G1RA 4LEFA 1P1MA 3KAGA 2VR5A 3NO3A 4OQVA 2H3DA 3TCEA 3G1SA 1BRLB 3NO1A 2YX0A 5CGQA 1YXCA 4GWEA 4V33A 1KWKA 5HDRA 4QG6A 1WV2A 4NUWA 4HPGA 2V81A 3OODA 3KCLA 3MHFA 2E8YA 5M5DA 4Y6GA 2VZSA 3QKEA 2WMJA 3ZT5A 4YL2A 3CTLA 3UXKA 3WDRA 1GG0A 1UIPA 5CJNA 3SFWA 4AF0B 1A5BA 3KRBA 3QY6A 3VNIA 1F73A 1DWHM 7REQB 1LG2A 3QLDA 1KCZA 3W73A 2XZ9A 2VRJA 2HNHA 1QAPA 5BRPA 1QNQA 3GXMA 3W2MA 3H4XA 3KP1A 3ABZA 4PCTA 1OCNA 1NSGA 1FKJA 3SFKA 2RHGA 3GE7A 3O1NA 3XISA 3MUZ1 4RNIA 2ETNA 5A8PA 4PMZA 3TC6A 1JDFA 2OO0A 3S42A 2WNWA 2DZXA 2VEMA 2H9AA 1H63A 4ZO9A 4LAYA 1J0HA 4NX0A 2EBNA 5AC8A 3W86A 2QMKA 3OLGA 2Q8XA 4GCXA 1U83A 1F6YA 3AIRA 4Q4PA 1CX9A 3WLNA 3T07A 1RCXB 3T0CA 1NWUA 1J4HA 3E2RA 3K4AA 4CD8A 2Z4GA 3KTCA 1E43A 1R6WA 1Q7QA 3MUXA 4EF8A 1E40A 3EEZA 2BOEX 4YVXA 3T05A 3T1GA 2HXTA 1S2CA 4IMAA 3QY7A 1N2VA 1OCBA 2UY3A 2PLMA 2F6UA 2D2HA 1OX6A 3UGRA 2CKSA 3BCFA 5FJTA 3SSJA 1O66A 4LWWA 1F4AA 4BI7A 3NR0A 4C1NB 1TE1A 5G4WA 4CN4A 1FWTA 4V28A 4W7VA 4MNJA 5FL1A 3WH0A 3ELFA 4I9JA 2XP5A 3N13A 4PZVA 2J6VA 2FFCA 1O5XA 2LGOA 1H60A 2P1FA 1SW7A 4FOKA 1R7OA 2WVUA 5DO8A 2V0TA 1AW2A 4JTQA 3ID7A 1DWJM 4PUDA 4G50A 1Q45A 3RX4A 3UF8A 4O1EA 2ZZ6A 3GUGA 4E4PA 4TW6A 1DQUA 4QTGA 4QQUA 4Q4QA 5IHRA 4EAYA 4UXDA 3GNDA 4LYKA 2IKHA 3Q58A 2XIMA 2CLKA 4JTGA 4X22A 3GU1A 5ABFA 1YEYA 3ARUA 1DTNA 3G6LA 5AHFA 4XAGA 1HX0A 2XN0A 4AD4A 3LK6A 3GB6A 4JHOA 6PTDA 2J9ZA 2X16A 1E9LA 7ODCA 2VGGA 3LHTA 5H8MA 3OHMB 1FKGA 4PH6A 1DJXA 3ARQA 3NG3A 2Q01A 4WLCA 2PWVA 3DN5A 4NJIA 2Y8VA 2GYIA 1NMWA 3MI3A 3E74A 3NGFA 1DV7A 4S3DA 3CBWA 4TYOA 1E6XM 1Q6HA 4UQBA 3UW6A 4E4UA 3QYSA 3ZZ1A 2AMXA 5DLCA 4ODKA 5M1TA 4BWLA 3FYYA 2X2YA 3C86A 1Q6EA 1DWFM 4QLKA 5CKSA 1PTGA 3CEUA 3B0UX 3UT0A 3HBLA 1HKIA 1YW5A 4C7DA 4MJZA 3B8TA 5C9RA 3SADA 4P2VA 2PPNA 3K2GA 1UUMA 1A53A 3G0SA 4DPPA 1S2AA 4MZYA 3BSMA 3P3BA 1ICSA 4WOZA 1XRFA 1Z8AA 1W9PA 3LPGA 4A8RA 4DBUA 4B4HA 2PGRA 3RUBL 4ODNA 4AZCB 5HKGA 1DWIM 5KITA 3RLVA 4RV3A 4ODRA 5HUPA 1A4LA 1PWLA 4W84A 4GBUA 4ZB0A 1AL7A 4DRJA 3LCLA 2F2KA 4UFLA 2CETA 4DJFA 2PRLA 3WMSA 4O4VA 2WMKA 3SI9A 2J75A 3W00A 4MPKA 1XIMA 3VVGA 1HFBA 1Y5WA 3NQ6A 5LA1A 3A4AA 3D3AA 4GQQA 4O13A 4Y9OA 3GRIA 2A79A 2ZQVA 1Q6LA 5C2CA 3USZA 4JFVA 5FF4A 1W2VA 3S0CA 3LI0A 1UUQA 1HNYA 1Q6GA 1OYBA 3PWAA 3GH7A 2FH8A 5JXQA 1P6CA 2WYSA 2XIJA 3W2NA 1WXJA 3CUZA 3LEPA 3QEZA 1XDJA 3RCMA 2W62A 1F3TA 4IT6A 2O9RA 3OQ8A 3OBKA 5H1WA 4AIUA 1OX4A 2XGIA 1B2YA 1ZCOA 4IG2B 5CSYA 5G2HA 4XSMA 3FJ4A 4RPQA 4ES4A 1UH2A 4JFIA 1NFGA 4AEFA 1PHWA 1QK2A 2VRKA 3QKZA 2IPWA 5K9XA 3NXLA 3HQPA 4GLEA 2FZBA 4IGHA 1QW9A 4GVHA 4AIEA 4CVUA 5DMYA 3GXTA 2G3FA 1CLXA 2ZWZA 4JGDA 3LTYA 1UQZA 3IJIA 3MPGA 1IT7A 4NL1A 1GVEA 1Q6OA 1QPKA 1GQKA 1XFBA 3R5EA 3S2CA 3SRHA 1AD4A 3M0YA 3GAYA 2YFNA 1XIFA 3VE9A 1GVIA 5A6MA 1R30A 3KOWA 4ZSTA 5DBTA 4M6VA 1D7FA 3GWQA 4M6PA 1LL7A 3GC2A 4BF5A 1H3GA 1Y8BA 1OINA 4I7WA 4FB7A 3WH8A 3QZAA 2G97A 3GHSA 3HGRA 4UTLA 2C14A 4IFRA 1YDVA 1RVKA 1XRSA 1SSDA 1H49A 4DIAA 2X1UA 4JTCA 2Q5AA 4S3GA 1SO5A 1A5LC 2PU0A 1E3ZA 3B9NA 5D2WA 1YE6A 3H4WA 1UCWA 2KI3A 1Q6FA 2AKMA 4MB3A 1MXDA 4PMVA 3WLMA 4RNJA 2HK1A 4DLFA 1UC4A 3TQKA 1VFUA 3GC4A 2X2GA 5D32A 3ZM8A 3NZPA 1XKJA 3RK8A 4HSHA 4NI8A 3JRKA 4PB5A 2ZR4A 1OF8A 2QDGA 2Y89A 3TN4A 1BPLB 3UNTA 1JZ7A 3O5MA 1TVPA 1KWGA 2DG4A 1LL6A 4CEUC 3IVSA 3NURA 2JFEX 1PAMA 4HZ8A 1RH9A 4DWSA 3GXFA 3LZ3A 1Q4WA 4R9XA 4OVXA 2ZA3A 3CHCA 1XLDA 2E3ZA 2QHAA 1Q6CA 4L1XA 1HQTA 4FP1A 1TWWA 4UZSA 2G95A 3BANA 2QV4A 1O95A 1M6JA 3WZ0E 4JCMA 2EEXA 3JVAA 4J27A 4IP7A 3VNZA 1MEWA 2F2DA 3E12A 4PCPA 5C9UA 1LWJA 3MA8A 3H2MA 4O0QA 1JVWA 4JDBA 4NJGA 5C7HA 3BLIA 3LA4A 4RPPA 4AH7A 1VQTA 1R2RA 2O9TA 3MMTA 1CBGA 1PBGA 3L68A 2E6FA 4ZOEA 3AIVA 2ZICA 4C6KA 4H9MA 1UZ4A 5AC4A 1MQPA 1GJPA 1RSCA 5HR6A 1KGXA 1KM4A 2YJQA 5D8WA 5J8LA 1NAL1 2DEPA 4DUOA 2DZPA 3IGUA 1K4GA 3WCZA 3JYJA 4EPDC 1M65A 4Q4OA 2VHLA 3B8VA 1TMHA 4PSPA 3SCTA 4RE2A 4C6LA 1OC7A 2TYSA 3KZSA 4A8IA 1AH4A 3TLQA 4YTTA 2I5IA 2RDUA 3K8MA 2FHFA 2PP3A 2MPHA 5EMLA 3IHZA 1MFUA 3WUBA 4IXXA 5G2WA 1JCXA 5I3JA 3ZMRA 1G4PA 2OJPA 5FEWA 5DT7A 1Z42A 3V5OA 3MJMA 4IPXA 3TTQA 5DEZA 4AG0A 1XICA 3SEPA 5MF5A 1ZP3A 3SUVA 1A4MA 2NZLA 2YB4A 1QOQA 1B6CA 3N19B 1UR4A 1HP4A 3WQFA 1CYGA 1IGWA 1YHTA 2EULA 2VGBA 1A5KC 5HK4A 1PTDA 1AH0A 1E3XA 4J1OA 3UJRA 5AHNA 2K8IA 3ME3A 4IMGA 3ENLA 2MNTA 2V82A 4Q4RA 3W7CA 3GK0A 1QI2A 4GYKA 4RUBA 1LL4A 2I5QA 4Q7IA 3IRSA 2VCDA 2DSWA 3MO4A 2XU2A 2M08A 4MWAC 1DJZA 1X6UA 3U7BA 2F4EA 1XLFA 3WY1A 3SCRA 2HE5A 4YLWA 4IT4A 1B3WA 2XVGA 3BL3A 4ODQA 1AK5A 2ZE3A 2XISA 4W9PA 4E4FA 2OYLA 2I16A 5FACA 3ANUA 1HIZA 3AISA 1HKWA 5KTLA 2XSBA 1REQB 4WY0B 1IF2A 4OTKA 2E25A 3AWOA 3I7RA 4D6FA 4XKMA 5ECVA 2PBGA 2PS2A 4GYJA 1HP5A 4O1FA 1GWJA 3KW3A 1WPCA 3WD0A 4KFOA 2HNEA 2HRWA 4JQ3A 3UQBA 3AMCA 1UWUA 3ES7A 3OVQA 4HMNA 5H91A 1WNOA 4O1AA 4MGGA 4Z1CA 5A1AA 2WC7A 3NDZA 3QHMA 2CBJA 3W7HA 5CGMA 3PUGA 4ZXLA 2CBIA 5D02A 3BZJA 3QGVA 1S5MA 4H9UA 4C7GA 2XM1A 3FAWA 1FD9A 1VBHA 4N6FA 4PCFA 1XPYA 7ENLA 3LHUA 5AHIA 2ZR6A 3SCQA 9RUBA 2J7CA 1G69A 4Y96A 4O8RA 2HE8A 4JTKA 2AL2B 4NHVA 2OOFA 3S8HA 4HU3A 3DBNA 1E5NA 4QHRA 2HISA 3M47A 4DF2A 1R3WA 4MUZA 5EGRA 1N82A 4QT3A 4LAWA 3NXFA 1FAPA 5REQB 3N04A 3DG7A 4QG8A 2PPOA 1TREA 1TPB1 3UZZA 3AIBA 1CCWB 4IWWA 3HF3A 2QAPA 1FWWA 3ZYZA 2P53A 4UTMA 3T6CA 3VFCA 3WH5A 3TFXA 4ZBCA 3TR2A 2YLLA 4NY2A 1EO5A 2WMFA 3BLKA 3WN6A 3UWWA 1SPQA 3TMLA 1Y7VA 4N19A 2ZZ2A 1NH6A 2MANA 3VO0A 1FH7A 3E38A 2NXGA 4HA4A 1D6OA 2J27A 1GVQA 2HV5A 1ISZA 3WMCA 3L0KA 3PJWA 2Y7GA 5C9XA 1ROTA 4OBSA 1KKOA 3AHXA 3F03K 1VB9A 3M0JA 5E93A 1POKA 3KZ7A 1YKWA 4F8XA 3NL2A 3MBDA 4D9PA 1VCGA 4KESA 3B40A 4DJEA 4YIWA 1BTMA 1ZLPA 3WNPA 4UBPC 4DVOA 2MLXA 2XH0A 4EK7A 4KCUA 3MSYA 3C6CA 4GD0A 3EBVA 4FXSA 2Q02A 1EDGA 5J5RA 3GD6A 1LOLA 3TFCA 1BF2A 3H26A 2QMJA 2DG9A 3PBUA 2X09A 1E9YB 2PDMA 2RUSA 1UR2A 3GTYX 3NUKA 1ALDA 4RW3A 1Y0EA 4Z1BA 1PS9A 5A8NA 3ZLGA 1N8WA 5CSSA 3NVDA 4WKAA 1AQFA 3URAA 3WQDA 4AD2A 1JDEA 2ODOA 2E09A 3S6OA 5FJUA 3N6JA 4GGBA 3GFXA 2TRSA 2A3BA 3UYCA 4F2UA 2WZMA 4KIEA 4H8HA 1V77A 2Y0FA 3BLEA 1NDVA 3V1PA 2ZOXA 3GYEA 2X0HA 4OKDA 4WUIA 5HXMA 3U4AA 4YHEA 1KTNA 4U5KA 1K9EA 1JZ5A 3CQKA 3T78A 1RK5A 3LV6A 1VBGA 5DMMA 1YTDA 2BP1A 3BXWA 4Q4MA 4J40A 3RPTA 2FYMA 4Z2IA 1IIGA 4M0XA 4KEUA 1EF2A 3ZWSA 3UEQA 3GO2A 4IP5A 2JIEA 4UFMA 3UR8A 3AZTA 9XIMA 3FY1A 1UBPC 1OABA 2V5DA 1LT7A 2ZA2A 3IJ7A 3YPIA 4YU1A 3BQ6A 5CC6A 1L6YA 3KLKA 3S2LA 3VIMA 5JBDA 5AZ0A 2BHYA 2WKLA 4QAWA 3B05A 4CCEA 4DWSC 3R79A 1PPIA 4WOQA 4S23A 3SR7A 1H2JA 2J7EA 2GQ8A 4EXBA 2YXOA 4NXKA 2DSKA 4RCXA 1OFDA 3Q65A 2NQZA 3I3DA 1HKMA 4FEZA 3S5ZA 3B4YA 2AWGA 4DEFA 3RNDA 4DF1A 3A21A 1GGOA 4XQ6A 2HVNA 1D9EA 1HGWA 1OEPA 3BW4A 2Z1WA 4PMOA 1H7NA 3C0SA 5CQ1A 5C55A 5DIVA 4O1BA 1PKYA 4H7VA 1J8VA 4CQ8A 3GX9A 3DFQA 1R2SA 3H2OA 4OWGA 4XZBA 1WAWA 4TV6A 4N7QA 3WG6A 3OB8A 2ZA1A 3IIZA 4K7YA 1UB3A 1GT8A 4OOUA 3VKCA 1S1RA 1VD6A 3F4VA 4BZYA 4X2RA 3WFLA 4Z1DA 3G1HA 4ADTA 3EXRA 3GXNA 1RALA 2C8NA 2VR2A 2CLFA 1LLZA 3H6OA 4M7TA 3PB2A 3N4FA 2REQA 3T0TA 2VUNA 5LNRA 3W1QA 4IMCA 3FV9A 1J79A 4I5RA 3MKKA 4FNUA 4OFCA 3EWUA 3WQPA 3OZYA 4NF7A 4PEKA 2R6OA 2R94A 4WZHA 5CPLA 4ROQA 2Z24A 1SU5A 2WZIA 5I79A 1MRAA 1TQJA 4B5TA 6XIMA 1XYBA 1F7BA 4GFIA 2WVTA 4ML4A 1QPOA 2QZRA 5BRBA 4MIMA 4O12A 1K9FA 3G77A 2V5CA 2VTFA 1U1UA 3ITVA 1TWDA 3NM3A 3RFAA 4AZBA 4A6GA 4N6EA 2ZRXA 1H61A 1FKLA 3WK0A 1V6YA 3AWNA 4TX9A 3FX4A 1TJ0A 1XYCA 1S3HA 3NEVA 2H3BA 3EIPA 2C15A 2INEA 4LBRA 3GS6A 4V15A 3W02A 3W85A 3PRAA 1FX6A 2QJGA 4WDWA 1KD0A 3PJXA 2P8BA 4QCEA 1J4IA 2DV0A 4Q7BA 3S83A 2EQDA 5GPGA 3AROA 3EA2A 3PNUA 1GOWA 4XAZA 2ZX8A 4CU8A 1EEPA 2G0WA 3EYPA 3O7UA 2VD8A 2Z7KA 4F2TA 2R1MA 4OT7A 3KZPA 4LRSA 1MWOA 2OZ8A 5I3KA 1G1YA 1NWTA 5HULA 3Q37A 1SJBA 3LRMA 4LYQA 3TYBA 4JX6A 1EJTC 2OLAA 1K8ZA 1EQCA 4OV9A 2IXUA 4HOZA 2Z28A 1DPMA 1UHVA 3H8AA 4AB4A 1TPFA 4NVTA 3BJFA 4NIRA 1KRBC 2EG6A 2EPHA 4DO5A 4Z2KA 3KCJA 3QYQA 5GJNA 5C8BB 4NRRA 3CQIA 4LALA 5F2LA 2PTDA 3O16A 1Y5VA 1AW5A 1U22A 1W1PA 3LRKA 5I3IA 3VE7A 3N2CA 2WWDA 4AMCA 4JKKA 3P5ZA 3AUJA 4IUOA 3WF4A 4W85A 3QV7A 4GNVA 4GHRA 3WF1A 2V69A 2D73A 1JYXA 3KBJA 1B3ZA 1UROA 3GR8A 4U10A 5JH2A 2X1TA 4AY1A 4IIGA 2ZWYA 4A8LA 5FAJA 1KW1A 2GUUA 5MHBA 3GDKA 2FGLA 2RJHA 1BYBA 4RW5A 1TPDA 1JAKA 3AICA 2GVLA 3MSGA 2GVEA 3AZSA 1O6IA 5F2GA 3S1GA 4EXAA 4NZ4A 3EWXA 4GXWA 2WVVB 3FSUA 4RV8A 1LBLA 4YCPA 4PMYA 4ERGA 3MB9A 5F4WA 5TD4A 1TO3A 3B9AA 1GOMA 1YDNA 1FJDA 4DUVA 4US5A 4XUGA 4OUIA 2V38A 4PUJA 1AFSA 4HBKA 3TC3A 2XN2A 2NX9A 2QCDB 1V0LA 3VFLA 4L6DA 2YFOA 1L1PA 3SUTA 1KXTA 3WFAA 5IDIA 3IS4A 2YXGA 1TCMA 1EA9C 4Y9MA 3VAVA 4CQBA 2OKTA 2VEFA 3W88A 4HZ6A 3KTSA 1FHLA 3W7QA 4MJ2A 2VGIA 4PTWA 2D1ZA 5H2ZA 4W9QA 1O7AA 4B2DA 3DYPA 3OA5A 4DRIA 1YPIA 2VEKA 2I5GA 4OGZA 4FI4A 1I60A 3MV01 3PTKA 3FK4A 3BMXA 2ZRYA 3CH9A 1S46A 3UG3A 7A3HA 3EOUA 2P8CA 2XFFA 2VN1A 1XXXA 3P74A 4H41A 1NMVA 1ICQA 1Q13A 4QNWA 1CB7B 3P6LA 4KRUA 1IQ8A 3R8GA 1V6TA 1GVFA 1G9HA 1KA9F 1FWSA 4ATLA 4FA3A 2F2HA 4GBDA 2Z7GA 4PUMA 3UETA 1CIUA 3VNMA 5E5CA 1PZ2A 5AYBA 3W1RA 1FKHA 3VIJA 1BEUA 4AU0A 1W3JA 1K9DA 4KFPA 2J47A 1NSJA 3TIMA 4FLRA 2NX3A 2O4MA 3U48A 1V3IA 3QPZA 2VFFA 4B5NA 2V3GA 4NYYA 4UMCA 2X1SA 1GYLA 2YDAA 1EYEA 1ZGDA 2YL5A 4RE3A 1NFBA 1OK4A 1WAUA 3RM4A 3M0HA 3QHOA 3BLLA 2R82A 2DSZA 3VI2A 1Q7ZA 5HUOA 4ZZ9A 4I5XA 3VPLA 4LV4A 4HNCA 4J3XA 3VGDA 4QDWA 3IIVA 2GSHA 3ZR4A 4PTXA 1VAHA 3GR4A 1FWAC 3N2OA 3NVTA 3IVTA 2JZVA 2NSOA 3E0VA 3R4IA 1GW1A 1LDCA 1P7TB 3IKGA 1OFOA 1R3QA 2ITKA 4M81A 2GGEA 4L9ZA 3LQGA 3HMCA 3AIQA 4FNPA 3TLLA 4CCCA 2YZ5A 4DJFC 1A80A 1CGYA 1R2TA 4C1KA 3HPSA 3F5LA 3NPXA 3CK5A 4N2YA 3B8SA 3W1PA 1HKJA 2C19A 4YN5A 3UJEA 3CAVA 1OD0A 2D2GA 5DMLA 1W9VA 1XCXA 2WANA 3QM3A 3BMBA 4TVUA 4WEVX 1TV3A 3HMJG 3LCWA 3MDWA 4G7EA 4CD6A 1XHGA 4UNKA 3MKCA 1ITCA 3IAQA 3EDJA 3EWZA 1Q5MA 3QMRA 3UZYA 1WKDA 5CBIA 3ZVHB 3W25A 1W26A 1SMDA 4A2RA 3FGCB 1JD7A 1A0EA 1B9ZA 4XWUA 3PZIA 3I3EA 2IPJA 3GKAA 3CTTA 5AB3A 3CGTA 3HFYA 2PDIA 3V0TA 1QO2A 1HZYA 3VKAA 1PB0A 3S1VA 2D0GA 3ITOA 5EPDA 5D2TA 5A2CA 3VNYA 4CU6A 4JR5A 5BROA 2C91A 1TELA 3CYJA 4YNGA 4S3CA 4GJJA 3U2EA 3E3HA 4D8ZA 3TUUA 2RUQA 2XP8A 4ZPTR 4PEEA 1JPKA 1QHOA 3B0YA 4D6HA 1EP1A 1JJKA 1FWGC 1JCMP 1EXPA 5BOFA 4JTUA 3WLRA 1DJNA 1EA0A 5CPQA 4N9DA 2YA2A 2PDFA 2PD5A 3PK7A 3A4JA 3TROA 3Q4DA 4C6EA 4PRTA 1K7XA 1FXPA 3MV11 4DJDA 1A5CA 3AC0A 2PDBA 2R8WA 3C5QA 3TJ4A 4MY9A 1J9YA 3DFTA 1AJZA 4LC8A 1WO2A 4RE0A 4Y8FA 1P7TA 4XSLA 3CWNA 3WNKA 3MUAA 3DG6A 1M7OA 3DCPA 1BQGA 3WJZA 4R34A 3SECA 2HMCA 3WQVA 3ZJ7A 4F9DA 1HVQA 1CXHA 3L2IA 1WYIA 3SJNA 3TTSA 4F0KA 1X96A 3GH5A 4CD4A 2PAJA 1KBKA 4IIDA 2PGWA 3EPNA 1Q65A 4Q33A 2QR6A 4CD5A 2TSYA 2P3EA 1XD1A 1EO7A 3G0UA 2GL5A 1PX3A 4BI6A 4Q6XA 1TX2A 4XIMA 4UQEA 3R0KA 1U33A 5D9OA 2N87A 4H7CA 4IMEA 2ZX5A 1E0UA 2Y7DA 1B1YA 4BCEA 4GX8A 5ABHA 3W2JA 3DAQA 1FKSA 4HBEA 2P4VA 2VCAA 3KL3A 1YDOA 3L5LA 3E0FA 2X1RA 3B7XA 3PPFA 4GACA 4PMUA 3MCNA 4PMNA 3KBWA 1O5QA 3KFTA 3W01A 1HO1A 3MZ2A 3D0CA 4WK9A 4WXYA 3ZFHA 1EC8A 1H7XA 3CPUA 4LANA 4MF4A 1EJWC 2VZTA 2PURA 1SZFA 3L0GA 3H53A 4FF5A 4HHHA 4R88A 1W3HA 3NM1A 2VKZG 3OGRA 3NJ3A 1VGAA 1LZOA 3TONA 1XLEA 1VZWA 2WW5A 5I03A 4B5UA 2WVSA 1GQNA 3U7VA 2PWUA 1JCYA 5EB8A 2JEPA 4Q4KA 3II1A 1W32A 3KBVA 4C1NA 4LAOA 3TH6A 3K1DA 3M1ZA 5LNWA 3WK2A 2C6QA 1QU4A 1ZB5A 1V6UA 1EKOA 1LLOA 2ZC1A 1XLHA 3K8LA 3OBEA 1DXEA 1O1ZA 3ANYA 1XQKA 3TTEA 1E9IA 4IL2A 1W37A 4O52A 3V5FA 4X9SA 4IICA 5DX7A 4FAPA 3W9ZA 4J3UA 3PZUA 4OBRA 3WELA 2X0SA 4WJ8A 2QQ6A 1WP6A 1XYMA 4HPXA 3ARWA 3CNYA 1NJJA 1KFCA 4H6KA 4GI4A 4W7WA 4LVGA 2WPBA 3W7LA 4UR9A 2PMQA 1ZBKA 3WNOA 3CIWA 2XVNA 4QS5A 1S2UA 4LUTA 2AL2A 2CNCA 1XINA 2RQSA 3BV7A 1M53A 4A8NA 4TV5A 5FEXA 4FIQA 1BWLA 3T2OA 3RFWA 4G7EB 8RUCA 1ZK6A 3SCUA 4JTDA 1PVNA 4C91A 4DYJA 1KFWA 1Q85A 3DBPA 3TZNA 1VEMA 3E96A 2PDKA 5CEWA 3QOMA 4HNNA 1X7IA 4HJFA 4TX6A 2CLEA 1OYAA 1B9BA 3PBMA 1GVSA 5FJPA 4H7ZA 4KETA 2BVYA 3TX9A 1YPXA 3QZEA 1WXZA 3QMTA 3O6YX 4JXCA 2GUYA 1PHQA 3NYZA 3DHDA 5A6BA 4V1XA 1SZRA 1FKRA 1W3IA 2JGQA 4XKYB 5HATA 1SJCA 2DZTA 3A5FA 1IR1A 2WHJA 8A3HA 3CLMA 4DRNA 3TYZA 2WHMA 2MUCA 5AYYA 4S3JA 1DL3A 3DFOA 3WLSA 3AS0A 3TKFA 2P10A 1BGAA 3E6EA 4P8VA 3RILA 7PTDA 3K5XA 1ZBVA 1PKNA 4NZFA 2DT3A 4J3ZA 4UFHA 4LQ1A 5ABFB 4UOJA 3V5CA 1E0VA 3H4GA 4MNMA 4J4NA 3PG9A 2DUAA 2QW5A 1MO0A 3DGRA 1W5QA 2V5KA 4AWUA 4MB1A 1ISWA 3VDBA 3N11A 1MXGA 4ICCX 1PDZA 3EKLA 1R3TA 3V4BA 4TX0A 1CWYA 4FSAA 4H9VA 1FKWA 1RPKA 1CI1A 4ZFCA 3HGJA 3QGAC 4MLJA 2CLPA 3GXPA 3ZLFA 5C9ZA 3NQFA 9XIAA 1JDCA 1FWJC 1RY0A 1ZL1A 2RURA 4I9AA 1MUMA 1D7IA 1TJ2A 2BV9A 3CL7A 5EL1A 4PN2A 1O5KA 1OGSA 1J0KA 1LRTA 4KR0B 4IHCA 4O11A 4M6UA 2FTWA 3UP8A 4C6IA 3M64A 4ZENA 4YYFA 2V3FA 3WDQA 1TR9A 2E8ZA 1GEQA 2WLYA 2EKGA 4C6MA 3RMEA 1RUSA 4A3QA 4K38A 2W0UA 1H62A 5E0CA 2G4FA 3UA3A 1XPGA 4XD4A 1DJIA 1ZTVA 2ADAA 1A49A 4EPEC 4XTDA 4D2JA 3GKFA 3V0UA 5CJMA 3CLWA 3UPBA 2R1NA 1E72M 2GLKA 4LS1A 5A3HA 1CPUA 3PANA 2DW6A 4R33A 3W6LA 2QCDA 1FXQA 5I06A 3G18A 1FKDA 4KCTA 3MS8A 1DHPA 3B4UA 1E55A 3MMUA 3MHUA 4F9JA 3WQ8A 2MLYA 2W92A 4I7VA 4KMQA 4K7VA 3E0LA 4RKAA 1TTPA 4HHLA 1EJSC 2FJKA 4ERIA 5KMYA 3IK4A 3O9NA 5E09A 5DELA 2G3IA 3UWEA 1UWAA 1O4UA 3ABQA 2OWCA 3WLKX 3PNZA 4KF1A 4R7WA 4JEJA 5ECUA 3HA1A 2WJZA 5I0DA 3BG3A 4GNJA 4LUTB 3KADA 1ZAHA 3VUSA 5XINA 3CC1A 4JIQA 1NQKA 4O57A 2A0NA 3NQ7A 4ZE5A 3GUWA 3SUWA 2E9MA 4S38A 1QWKA 1BXBA 2FPTA 2ZCGA 4QRNA 3BAXA 4O1CA 4HB7A 2QJHA 2KFWA 3V7PA 3O5JA 4GZIA 1CLVA 3FYPA 3U4FA 1SO4A 4Q8MA 1YTEA 3EXSA 5A6AA 5D2VA 3WJYA 3WLJA 2XZ7A 3NNTA 3KOXA 4ZQRA 3BLDA 2D22A 4LC6A 5LYRA 3WNMA 3E2QA 2OT1A 5HANA 4MSSA 2BBFA 1NWSA 4E6MA 4NZCA 5AYXA 5I3HA 3UFYA 3CQ0A 1OFEA 3QC3A 4H6QA 3HG5A 2QUVA 1FCVA 1H7RA 1KFBA 4E2VA 4LAMA 1DJYA 5DY3A 1O5RA 4LUSB 3N25A 2YB1A 3PJTA 1KNWA 3G1DA 4TW8A 2OZ3A 2BXZA 4ORMA 2QEZA 3NWRA 1FWDC 1OFBA 4OHQA 5ABGA 3LLDA 2JF7A 2Y6ZA 1UC5A 2HCVA 5HJXA 1P43A 1VRXA 4EPBC 3TNOA 2DIEA 4L1GA 1U1HA 3W1XA 3I6TA 3WLPA 1KTCA 1B30A 3EX6A 1VPXA 1E15A 4M8UA 4O50A 4DX3A 2E1DA 4DRQA 3QR0A 2GJPA 3QSTA 1QOPA 5BCAA 1OD8A 3S5YA 1FWCC 3W1MA 2JALA 2DUXA 4FPSA 1VS1A 3OLDA 3CEPA 3GBEA 2W61A 1JFXA 4UR8A 1SGJA 1H7OA 1IEQA 2Y1HA 4NRSA 2XP9A 5FKYA 1DQXA 3KOYA 1YYAA 2Y8KA 1JCTA 3A64A 2VMFA 1L2UA 2PB1A 4NZ5A 1A3XA 2WK2A 3OU8A 4LUSA 4JFJA 3N9KA 2BVWA 1Q3NA 1LUCB 4X63A 4O17A 3B9EA 3HQNA 3ITLA 2A7RA 3UJSA 5I02A 1DIKA 4P7NA 4EAMA 5BXPA 3W29A 1JRBA 3TXZA 3VDGA 1AMYA 3B06A 4LAZA 2NQ9A 2C16A 2Z1SA 3CT7A 3EMQA 4AZ6A 3TXVA 3LTSA 4ZOCA 1XP3A 4EWND 4Q8OA 4QZVB 8XIMA 4IJRA 4AVOA 3ODKA 4UR7A 3PAJA 2E4TA 4RDWA 3G8RA 4TTUA 3LG3A 2ICSA 4JTRA 2PRMA 1LG1A 3DYMA 2DW7A 5CPOA 1US0A 2D0FA 1YBQB 2G96A 5EBAA 4PRWA 3LD5A 4BQ4A 2J25A 1FTXA 3RMJA 3NDYA 4FX6M 3TV8A 3W75A 3WYZA 4DBWA 1AD1A 3R13A 4M3PA 4FN2A 3GPKA 2YL9A 4EE9A 4GIVA 4GNKB 4JTTA 1XM3A 4LNYA 2E0PA 4CN1A 5G1TA 2L2SA 3A3HA 2QKFA 4PMJA 1BD0A 4JTAA 5HPCA 3S5NA 4NG3A 5F1UA 5D04C 1VCVA 3VIGA 1QASA 3GDRA 1I1WA 2YGYA 1UBSA 4TTGA 1OK6A 2BHZA 3BAKA 4Z2GA 4W8BA 1EGMA 4CNSA 3GHTA 3W7RA 4DZ3A 1KRAC 3C0JA 3FDKA 3QTGA 3DZ1A 1EIBA 2NV9A 3GR7A 4HTBA 4JYDA 3HPZA 1BF6A 4XD3A 4KH2A 3FCPA 1FDJA 1EGVA 3C2YA 1UWSA 3OGSA 2CLIA 1V3JA 4C6JA 1NELA 3CHEA 4H6EA 3H70A 3M43A 3BO9A 4XZWA 1QI5A 4DWDA 4M1BA 1AZ1A 1BKSA 2RUDA 1PZ0A 5GVJA 3DG3A 4CNOA 3A3XA 3LBCA 4C6DA 2C1GA 1J5TA 4JFKA 1R3RA 1V03A 5M03A 5I3DA 3VMNA 4TO8A 5CG0A 3GVQA 3LOTA 4L7ZA 1BGGA 3W07A 4GQGA 4AY8A 1F74A 5XIAA 4QR6A 2E6YA 5IRPA 3PR9A 3QRHA 1B3OA 1S5TA 4KRTA 1UKTA 1JNDA 1GUVA 2YLAA 1K3UA 4QGCA 3SDOA 4FLSA 3S9YA 1V6XA 2I57A 3PFMA 4K68A 2CW6A 1IXPA 4FOUA 2ZUNA 1KC7A 4OJYA 4FR6A 4E8GA 4F4RA 1E4IA 2O7QA 3H22A 3RR1A 4QIBA 2FDSA 1R8LA 2GVGA 3GU9A 3R0UA 2FVLA 4TMCA 3B9OA 4H00A 3LPOA 2NW0A 2WMGA 1WOAA 1J0ZA 1TZZA 1ZHAA 3OVRA 1O68A 4U28A 3I4EA 1I8JA 4D6GA 1XSKA 1DXFA 1H50A 2VCCA 1E70M 3AXMA 3WQGA 3BW3A 3SQLA 3PZ9A 4IT1A 1C7SA 2QDDA 3ONBA 4ZVJA 3I6CA 4DJED 3MI6A 5M17A 3C2VA 4IP4A 2OZ0A 3O5DA 1E56A 1RQEA 4LFYA 2M1IA 4UTJA 2FFIA 1VIWA 4RXFA 2ZC8A 2Y2WA 4BY3A 3S3GA 1DJQA 1ONEA 4L3NA 3FSTA 2UZ9A 5C5YA 4XAKA 3QMSA 1FCUA 1HJQA 1FKKA 4L4MA 2ISDA 3O63A 4ROPA 2WAGA 2E7FA 1A3HA 2PLJA 3UWQA 3UVAA 1XJBA 4B2DD 1BG4A 3EXTA 2WC4A 3I3BA 4TU1A 4Z17A 1Z6KA 3S1XA 5IOBA 4H01A 2VVSA 1JCJA 3N1AA 1XQLA 1XLCA 4PBFA 5IXEA 3T81A 4D71A 1V4YA 2PDCA 1LCOA 5AC6A 2DSVA 1RP9A 1Q6UA 1OFPA 4XAPA 3PB0A 3RX3A 4U3AA 5B7ZA 1FFRA 5CC5A 4IOTA 2PDHA 3QR1A 2I9EA 1IXOA 3PC0A 1OJXA 1RVGA 4JYSA 1MZRA 2D20A 3KCEA 4B16A 2WOQA 5DF0A 2OLSA 3SBFA 3MSDA 1TR1A 3TQPA 2YXXA 3S2NA 3WQ4A 5CC3A 5BNKA 2SFPA 3LLFA 3R58A 4XZNX 2C0AA 1CEOA 2Q8LA 1XYAA 2QCEA 3KS5A 1EOKA 1MVYA 5G4HC 4HVXA 1LRNA 1XLBA 2RDTA 4D6IA 4Q8UA 4QJ5B 3H54A 1V7AA 3SY8A 3M44A 4PBGA 1E51A 3TCSA 3FVMA 1EXBA 1XYFA 1JZ3A 4L9YA 1QTWA 4OOZA 1ZBCA 4JFWA 2ZRUA 2BOFX 4CQCA 2YBUA 1I2PA 3ARPA 3G8EA 3ZJ8A 3DUGA 1QXLA 2POZA 2VUYA 2A5HA 3OIXA 3GXIA 2Q8ZA 2OQYA 3EKGA 3TJIA 3E02A 4GKTA 4PFMA 2QNEA 1IWBA 4S3BA 3BMWA 5FF2A 5EMUA 5DITA 1IEWA 3WENA 5CZSA 1W1B1 4JAWA 4DXVA 1VFTA 1JYVA 2DVXA 1RD6A 1QI4A 4FOJA 4LVAA 2GUBA 1F8MA 3LCHA 4XK2A 3CQHA 4B3KA 3N3MA 2WJFA 2BY0A 1HJUA 3SQSA 4C1LA 1Z44A 1UP3A 2JF6A 4DYEA 2D3LA 4HN8A 1OM0A 1LWIA 3KWXA 2EO7A 2VR4A 2ZX9A 4LH8A 1KKRA 3NZRA 2C13A 3MVTA 1JUKA 5MKGB 2XP7A 1UIOA 3WF0A 1AJ0A 3A23A 4J3VA 3NQ2A 1YBQA 2WO5A 1D3CA 3SURA 3FN9A 3DGBA 2E5DA 1UP2A 3SGZA 1WZKA 2WZHA 3W83A 2CBVA 3B9DA 1V02E 4O14A 1TSIA 1W54A 2YCLB 3KVKA 1DIEA 3M0MA 3VNDA 3A12A 5HMDA 4HPJA 1ENUA 1RPXA 5JIPA 1D3GA 2F9RA 3G24A 4KGLA 3JZEA 3LLXA 3F4WA 2CWXA 2XWDA 3FOKA 1I45A 4GH3A 3A4XA 2NVDA 2YCJA 4UB9A 1FWBC 3T9PA 3IJDA 3W76A 4KW2A 3L4WA 3TK7A 1NDYA 3O5RA 1MQQA 2R1PA 4POCA 3GG8A 2IQTA 1L6WA 1TA3A 4QX4A 3ERPA 2BODX 4DZAA 3KS6A 4HOXA 1W5PA 1TIWA 2VDIA 3V0SA 3PR2A 1CXKA 3HPXA 3BURA 4NJKA 4I7UA 4KWOA 4AVFA 3MTWA 4JX4A 4NNCA 4HNUA 4UDMA 3OA3A 1HTIA 2QGHA 1KM3A 5K7JA 4UTWA 4ZL1A 3MMDA 3JYMA 4C02B 5HNRA 5A8QA 3RR4A 4A3RA 3MUY1 3UJFA 4ATWA 1JEZA 3AOFA 1ADDA 1CECA 3UY8A 3ZT7A 3H21A 2X1IA 2BDQA 3RXZA 2GWGA 2VD9A 3DOPA 1KFLA 1KM2A 5A95A 4JYEA 1JD9A 4IPIA 5LGZA 1E0WA 1M68A 1IR2A 1DE5A 2EAWA 2ACQA 3AI0A 4YTRA 1PIGA 2VQUA 3OTRA 1CENA 5CCZA 1EP3A 4NILA 4HYRA 3U9IA 1ME8A 3ARYA 1V0NA 3OEXA 4G7FA 4HMDA 3R43A 5KZEA 4GUHA 3NL6A 2A1YA 2CZDA 3FJ6A 3LGEA 2VT0A 3IARA 3S6TA 3FW6A 3GTNA 3T7VA 2QIIA 1XH1A 5D9NA 3MCMA 1LQAA 2O56A 3AYTA 3UR7A 3AU2A 1UKPA 2YW3A 2ISWA 1P4CA 2CEQA 2GGIA 8TIMA 1FWFC 4JFUA 4B90A 1TRDA 1D8CA 5HWNA 3N29A 1YNPA 1RBLA 5LKYA 2EHHA 1XUZA 3P2VA 4IGMA 1TJPA 3R10A 4G2PA 1QDSA 1Q63A 4KFNA 4WQ6A 3UESA 4W93A 3CT2A 1UWRA 4QDMA 1GZGA 5I3FA 1VFOA 3QW3A 4A3HA 4PTNA 1WE5A 1EIXA 1RBAA 1BRLA 4NZ3A 2BSLA 4HYWA 2A2IA 2IKGA 3K8KA 3P67A 4BWLC 4MWAA 2TAAA 1EZWA 2IMRA 3LGDA 4MB4A 1EJUC 4JL1A 5K4XA 1NDZA 5GQBA 1F05A 4L5ZA 3F5KA 3W84A 4MDPA 4DF0A 1N1AA 4HSNA 1NWRA 1G6CA 1GORA 3WMLA 1W5OA 3T55A 2DU2A 4GUIA 2KE0A 3H2FA 1SVDA 4FXJA 5IFPA 2A21A 2NQHA 4GINA 4QEEA 4JKLA 4MDOA 1HKVA 1A50A 4IM4A 4UCGA 4TR9A 2Y5JA 4V1YA 2NXHA 1UOKA 3UBPC 2PLKA 3UPMA 3CAWA 3O5FA 1X8CA 3H9RB 3WNLA 4RZBA 1B4KA 3OOBA 4GYFA 4DO4A 2CXGA 3C4UA 3FNDA 4U85A 2QJNA 3P80A 3CPRA 1C92A 3SIMA 2J4GA 3BICA 3KP0A 4KERA 5A2BA 3GZ3A 3KBMA 4AUBA 3U5YA 3UNDA 3GM8A 1M3UA 3DI1A 3KAIA 1HUVA 3WH7A 2ZXAA 3STEA 3ABRA 1AQHA 2XP6A 4CQAA 2G4JA 4LVFA 2VQTA 3VMOA 3CZLA 1X97A 1Z32X 3UZ5A 2G5WA 3OP2A 2WLZA 2EPOA 2ZBTA 5HMSA 1Q2SA 4HBOA 3LCGA 3E9AA 1QZ2A 1TTQA 5H8PA 4QM1A 4M5PA 2FMNA 3GTXA 2ISVA 3W1AA 1C8QA 4FALA 1U2YA 3MCOA 3LUOA 3BJSA 1FVPA 3F1QA 1BWVA 1KGWA 1XW8A 3AS1A 1O1HA 1BVWA 2Q3RA 3M5ZA 3GHUA 1I2OA 3PFRA 4GO9A 2R9RA 1SFJA 4PCNA 1LUCA 1F3XA 2JKEA 1N55A 4F66A 5A6BD 1BYDA 2IPFA 3RLHA 3NDOA 4JNYA 3W81A 2B31A 1H1NA 5LXEA 3WH9A 2FGZA 2WJDA 4F79A 2PDGA 5HUAA 2OSWA 4WY0A 4O4WA 4XZLX 1BVNP 4XVEA 2V2HA 1W5NA 1JNSA 1CTNA 1EUAA 3QN3A 3NA8A 1SFTA 1UD8A 3M6DA 1MUCA 1S1PA 3FAPA 1A0CA 1GW9A 3DC0A 4TMBA 3KTXA 5D37A 2CHRA 1KCLA 3LB0A 1DVJA 1L0PA 2CLMA 5G5IA 1RCQA 1K6WA 1TJ1A 4A3UA 3UXAA 2F38A 4GJ1A 4WR3A 5J6EA 4FXRA 3S5OA 3VOJA 4ODLA 3BK0A 4F3HA 4IFKA 1Z7AA 1CT5A 2H8ZA 4HNVA 2V9DA 3SQMA 3WUEA 3LSCA 3UWVA 1B57A 1UR1A 3E0WA 1A5OC 5K4ZA 2X0YA 4LOCA 5FOOA 2XTKA 3TCZA 1IT8A 1T8QA 1C8VA 1PWMA 2XH4A 3FJLA 3QJAA 1M5YA 1WUFA 1RJQA 2WHKA 3S9IA 1KBJA 4Z08A 4ATDA 1EDQA 2E28A 2NLYA 3MSRA 4HYVA 3W2LA 1KCXA 5EY5A 4QITA 2YA0A 2FZNA 2PDNA 1CW2A 1P5BA 2D23A 3BCDA 4AD0A 1QW8A 4MFDA 4U2ZA 2Z00A 1XKYA 2UWFA 3SN4A 3PSVA 2VL4A 3SCWA 3DI0A 4W7UA 4U3CA 3GTHA 2POTA 5EKYA 1SJAA 3MP3A 3VD5A 1L6GA 4WXZA 3WBYA 4ZA0A 1R46A 3T40A 1ELSA 3LXBA 2A85A 3G3DA 2ACSA 1C9DA 4LTSA 3WQCA 1V5XA 2AQVA 4MM1A 2RDWA 3IGSA 4ACZB 3UWUA 2ZDRA 5M3WA 2FTPA 3R94A 3SCNA 1B54A 1HT6A 4P61A 4GJIA 1E6ZA 4FNRA 4B5VA 1SO3A 5C7VA 1ZJIA 1OHLA 4LSBA 2YYUA 4Y8EA 5BRQA 4MKSA 2IUZA 1Q6IA 4DJDD 3BUVA 2EPNA 1SW0A 2J13A 3A5VA 4LAVA 3RHGA 4AX6A 1KV5A 2BXVA 4M29A 3LGGA 3AYSA 3GNRA 2ZUMA 4JTEA 1WBHA 3V75A 4IF2A 5E6YA 3TYEA 5BYWA 4CNUA 3C3UA 2CESA 3HO8A 3BGGA 4L9XA 4UTUA 3NQGA 3NPVA 2DSUA 3W7PA 3LMZA 4IPNB 3WQOA 2WCSA 1KT1A 1KM1A 3SSZA 5BXTA 5CBJA 3SCSA 1R9ZA 3L66A 5J04A 1HXJA 3LNPA 4S3EA 4Y7EA 1J01A 1CZ1A 1M7XA 3GIYA 5LIKX 3DESA 5BOOA 3K30A 5E1QA 4IX0A 1KR0A 2PRHA 4ZQCA 4UFJA 3NPWA 3KL5A 5A2AA 2G50A 3N18A 2CPUA 3Q45A 3RG6A 4HU8A 1JG9A 1VFSA 1H09A 4PC8A 2A7PA 5CPTA 3VU2A 1R7AA 3R6IA 1RV8A 3O3RA 4S2BA 1GYNA 3DH7A 3ZR5A 2GVYA 4WF7A 4GC3A 2HPMA 4NX5A 4EP8C 2QCNA 4KCVA 4LB4A 1YIXA 5GNXA 4R7JA 4U4MA 2ASHA 2NLIA 1FDZA 3EA1A 1J96A 3PTMA 4NJHA 1QJWA 2GJRA 3CV2A 1JXJA 4W9OA 1S5NA 2FMOA 3GW0A 4URIA 3B03A 1C91A 6TAAA 1XBZA 4O16A 4XVDA 3OLIA 3QQ0A 1RD5A 1US3A 4NNBA 1RJPA 2QDHA 3SRFA 1TUFA 3QQ1A 2YSWA 4X0VA 4QCFA 1OWQA 1PV8A 2XP4A 2D24A 3AXHA 3E2SA 3HJZA 2J7DA 1GOQA 4W9TA 3DERA 3ANVA 3GH4A 4FF7A 3U2CA 1BFNA 4GCAA 5BOEA 4N4PA 3ARZA 1JFHA 3GFZA 4IIBA 3PBYA 2Z1BA 1W1ZA 1V3MA 1VYSX 3DFHA 1JQXA 4FNQA 2INZA 2QYGA 1FBAA 2ZQSA 3VIFA 1L8PA 1AMKA 2F23A 1RLDA 4ZS6A 3FYOA 1SZEA 3SJ3A 3LBMA 4A3YA 4UCFA 3CIVA 2GJLA 3JS3A 5BW6A 3CV7A 3BAWA 4CNTA 1Q66A 1YTKA 5T91A 5I5RA 1ZUAX 2PZNA 2YDSA 3GDTA 5TNVA 4GISA 3IK8A 2XYLA 3KL0A 4AZHA 2J66A 4DZIA 4JFMA 4QISA 1EWEA 4HN4A 5LZLA 3OJGA 4E3TA 1VEOA 3E49A 2EG8A 4JNZA 4F0HA 5BXSA 2W27A 3O5LA 2PWGA 3L67A 3RGCA 1KCKA 3EWDA 1YDYA 3CWHA 1KXQA 3MZNA 2OGJA 1XBXA 1T0OA 2ISFA 3PSWA 4HCHA 3ATZA 1N8FA 1K8YA 5FEZA 2YIHA 3VC6A 3PZVA 2HZGA 4J3TA 5A8GA 3IKDA 1OIFA 1GOOA 4XBKA 2E1WA 1R3VA 5HQLA 2G8ZA 3EPMA 3PRBA 1QNVA 3LXAA 4PSRA 2PWHA 1A7XA 2HS8A 2IQ0A 1OF6A 3F4NA 1Q6DA 4EIVA 1GCYA 2FDMA 1YXYA 1Q6QA 1EYWA 4IJBA 4F0RA 1JF6A 3EB3A 1RA0A 4MADA 2X42A 2XP3A 1VFFA 1H41A 4J3WA 1O60A 1IE7C 3BC9A 3RM9A 3AIUA 4NJJA 5LHEA 1W8GA 4GPNA 3ZS4A 4PMDA 3GQYA 2CZVA 1R9YA 3BTNA 3LMYA 4NP7A 5HAOA 3EWYA 3LY0A 4U33A 1MW0A 1SMAA 3IUIA 3CXOA 4GC4A 3E0IA 4XUYA 3OZPA 5AHMA 1WOBA 2WM1A 2WB5A 1IZCA 1VCFA 4YVPA 4P8XA 3T2QA 1GZ1A 1Z89A 5CAKA 4PUKA 3RCNA 1ZU8A 5IFTA 3KUMA 1HJSA 3WUGA 5H8UA 2DQXA 4LS0A 4D6EA 4Q22A 4I6VA 4KPLA 3T2PA 1LLWA 1T6MA 1ONRA 4PL1A 3RYSA 4LBSA 1GHSA 3NQBA 3O5KA 1ZQ5A 3M5YA 3E2VA 1IIHA 4UNLA 3THAA 4HP5A 1MFVA 2VENA 1XV8A 3UR5A 2NWSA 4AC1X 3OO2A 4G9PA 4BF8A 3EKZA 3WIJA 4EPKA 4RR4A 3OQEA 1FH9A 1ZJBA 5HPOA 5JH8A 3O5IA 2J79A 3AJXA 5BU9A 4FAMA 5K2ZA 2J7BA 3AIWA 4G56A 5A94A 3P8JA 4GY1A 2IXVA 3VGBA 2EPKX 3BLFA 4JZ5A 4QJ1A 4WJXA 4BQ5A 1SYTA 4UQCA 2ZUTA 1DYSA 1ECEA 2WWCA 3BOFA 2V6AA 3V3WA 1E6SM 3R8HA 4IQJA 3CUHA 2GJXA 3VABA 3SGGA 4C6OA 4DIPA 1E0XA 4MTVA 2PDXA 2PBOA 2ZRZA 3P93A 4H6RA 1YNQA 4MNLA 4AYSA 3D3FA 4BJHA 3O5OA 3KVMA 4DBDA 2KX9A 1W1IE 2OODA 1XG4A 5DFAA 4ITZA 3LHYA 3WJXA 3WDPP 1UOZA 4R0XA 2VZOA 4DM1A 3ORWA 2VC9A 1XUUA 2DJXA 3KOFA 1QNOA 3O6DA 1SFLA 3OG2A 1HO4A 1LBMA 2Y62A 4DXKA 1ML1A 3IV3A 3KOZA 4X2PA 3TZFA 3VGEA 4LXFA 3BZGA 4DAIA 2DZAA 1T8XA 3DKLA 2O4QA 4QIUA 1PYMA 2VNCA 3UY7A 2O9OA 3PAOA 1GRJA 4O19A 3VDAA 4FLQA 5HW6A 4KEMA 1I6NA 3TSMA 1GTHA 4XB3A 3L4YA 2YCEA 3UWZA 4WDXA 2W79A 2WV8A 1O12A 1XIJA 2TPSA 3QH2A 4DNMA 3CH0A 5FA5A 5AVNA 1B5TA 3EDFA 1V3LA 3APGA 3W7NA 2PE4A 3BGAA 2CHNA 1L9WA 4TX8A 3TEVA 1KQZA 1CLKA 2P76A 2EPMX 4JTIA 5E9XA 1Q4NX 3NGJA 5D9PA 2PGFA 5B8IC 1F4HA 1G01A 3NCOA 3ALGA 1E6QM 3CL6A 4ZQPA 1XS2A 1WDQA 2I14A 4AHPA 3EX4A 2XM2A 5U4NA 3IIPA 1MZHA 4GXMA 1MUWA 1ZAIA 4AHQA 4QDPA 2VDGA 1UMLA 5LA0A 2WCAA 1R47A 3MWCA 4ICNA 3CM4A 3UCDA 4YVVA 4IPPA 1KFEA 4LCSA 5C0QA 1PDYA 2QPUA 1QBAA 2VEGA 4HHPA 1WQ5A 4DWSD 1ZSXA 5BXJA 4W88A 5KEZA 3F2BA 5EMJA 4S3FA 1B3XA 3LNMA 5G1YA 4JTSA 3IACA 1OG0A 4QT2A 2HBVA 2A3LA 1EQ3A 4M80