2O9OA

Crystal structure of the buffalo secretory signalling glycoprotein at 2.8 a resolution
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3-like protein 1
publication title Structure of the buffalo secretory signalling glycoprotein at 2.8 A resolution
pubmed doi rcsb
molecule tags Signaling protein
total genus 124
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2006-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2o9oA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2o9oA01
4CVWA 3ZR6A 1W9DM 5A2AA 1JZ8A 5A2BA 1GOMA 1PX4A 4TVUA 1JXKA 1FH8A 3OGVA 2VR5A 3RM9A 4HZ7A 2D3NA 2J78A 3MMWA 1TVPA 3CIVA 2D22A 2XIIA 4XX6A 4M56A 1JL8A 2EPLX 5A6MA 2YA1A 1BYAA 3VGFA 3AIBA 4W7UA 1RP8A 3EMQA 1MQQA 2OSXA 3ZR5A 1R85A 4H8VA 3WD3A 4MDPA 3LPFA 3QOKA 3DYOA 1G9HA 2QF8A 1W9PA 3PZ9A 4FF5A 2XVNA 1N82A 1GJUA 3QHMA 1KB3A 1JF5A 1H4PA 2W67A 3QOMA 5JUVA 1O7AA 2VX7A 3AHVA 4U31A 3N12A 4TX6A 3TTOA 1QBBA 2PWDA 2FHBA 1TVNA 3CBWA 1GOKA 2V5CA 3SCOA 1V3LA 1R7OA 5D4YA 3W27A 4H8HA 1ZBVA 2WK2A 3OBAA 4P7OA 2DEPA 2WXDM 4W7WA 2VRJA 2J7BA 2ZUUA 3GM8A 1CGYA 3UERA 3G6MA 5I0DA 3OLIA 4H8UA 4HOZA 1S46A 3NDYA 1NP2A 1UKSA 4P7QA 2W4XA 4MNMA 3CUGA 3WUEA 2WSPA 1W2VA 2J4GA 3S2CA 4TX8A 2FGLA 3VPLA 1GQJA 2BXYA 5I2UA 2VRQA 1UD8A 3WDRA 3SCSA 1M04A 4S3KA 1HJVA 4HTYA 4F79A 4W84A 4U2YA 4KGJA 4RE3A 4H41A 3CUFA 1SR0A 4ATLA 1SYTA 4QLLA 5AY7A 1D7FA 2YA2A 1BF2A 1PX3A 2VT0A 5AC5A 3AROA 2EPNA 3WH9A 2BY3A 1A47A 1RP9A 1UD2A 4JZ5A 3GZAA 1CENA 2FH8A 3VUPA 1AQMA 1J11A 4X0NA 5E0FA 1BVZA 2HISA 3QR3A 1HN1A 4KGLA 3WL0A 1UWRA 2Z1KA 2GJRA 4B9YA 4M81A 1HL8A 1KWKA 4TTUA 4TXEA 2PB1A 1UOKA 4NI3A 1CLXA 1V3JA 1WCGA 3NUKA 3VIJA 1UYQA 3FY1A 1JIBA 4MB3A 3WSUA 1F4AA 2Y24A 2VZUA 1LWHA 3F5JA 3AMLA 5C70A 1GQKA 1JYXA 1CXFA 1E3XA 5GNZA 3NYDA 1KXVA 1JDCA 3CHDA 3PZQA 3VMOA 3BMVA 5A6BA 2X8RA 4H7VA 4QAWA 3ARTA 1H49A 3ARZA 1VIWA 1NWSA 3CMJA 4OZOA 2XGIA 5CZKA 1G94A 4F66A 4WF7A 1JFHA 3AHXA 4GQRA 1QBAA 2IXUA 2VC9A 1E40A 2XVLA 4UFIA 4UOQA 3WD0A 1E15A 2WKGA 3F4VA 2ZX7A 4LPCA 1C90A 4Z2LA 3DECA 3ARYA 4LYPA 1XRVA 1E3ZA 1XH0A 2BHUA 4AZ5A 3VIPA 4XB3A 4QLJA 2V38A 2WVUA 4S3JA 2EQDA 1UR9A 1V03A 1U33A 1WDSA 4JL2A 3RIKA 1W1YA 2VL4A 1QHPA 1EDGA 5FL0A 4W88A 1Q6CA 1ISWA 4J3WA 4KMQA 3EMCA 1ITCA 2YDQA 4D6GA 3VD3A 1V6YA 2ZXDA 4FLRA 1ZU8A 5DO8A 5A69A 1E55A 2X1IA 1JAEA 2BXZA 1OB0A 1VJSA 2J7EA 3POCA 4CD4A 2YIHA 3AHYA 3RCNA 1V08A 1US3A 4V28A 3BH4A 5I79A 2ZX9A 4ZE5A 3T08A 5IXEA 3WMBA 3EBVA 3W82A 2IUZA 1UG6A 1DWIM 1ECEA 1J0KA 3CMGA 1CGTA 4LYRA 3B9DA 1UR1A 4PTXA 2VVNA 1B3VA 4CN4A 3IJ7A 1EGZA 4QFUA 1MW0A 3PBGA 5HDRA 3SUUA 5AC4A 1VFUA 1KBBA 1UD3A 3TTSA 4JKKA 5BCAA 3MSGA 1M53A 3BAJA 1B31A 3W6MA 2WWCA 4CD7A 2CBVA 4GI9A 3WF2A 2VQTA 1QI5A 1CGUA 3B8SA 1R7AA 1C3FA 4Z2JA 2CNCA 4HU0A 5LA0A 4JAWA 3RM4A 1P6WA 1M03A 3GBDA 4F9JA 1J0IA 2DSWA 1DEDA 3WDJA 2Y8VA 4UOJA 4X0VA 4XV0A 3AS3A 1B0IA 1CEOA 2FHFA 3N11A 5GNXA 4FK9A 2CERA 2QPSA 3VNZA 4E8DA 1ISZA 2J25A 2WBKA 3NCOA 4W8AA 4H2CA 4AEEA 1E6PA 3SCRA 3U57A 2VNCA 2XUCA 3RILA 4AD1A 2O9TA 3PTMA 2WLZA 4URIA 3D3AA 5A6AA 2ZXQA 5KZ6A 2CKSA 2YDRA 5E09A 4RE4A 1WZMA 4ZFMA 2NW0A 3DYPA 5D9OA 4OOZA 3ZO9A 2NSXA 3NSNA 1B1YA 2XWEA 1U30A 1G01A 3GDBA 1OGSA 4PMQA 3VDHA 3WKZA 4J3UA 4ACYA 2X0HA 3EDDA 1CXEA 1BGGA 2F61A 4K68A 2X0YA 3AMKA 3KL5A 3VIFA 5A8QA 4UFKA 4GZEA 5ABFA 3LPOA 1HXJA 3SCNA 4ZENA 1GZJA 1BYBA 4YN5A 5BXPA 4AIUA 2J77A 5HBFA 1MFVA 3G6LA 3ARQA 2O9OA 2V3DA 4LXFA 3CLWA 2CIPA 2WB5A 5LA2A 3W4RA 3BAWA 4AC1X 1UR2A 1HP4A 3VGDA 1CXIA 2VZSA 4P8UA 3K8KA 1BYCA 1QHZA 3FW6A 2G3JA 1J0JA 1GPFA 3B9AA 3ZIZA 3CHCA 5ABEA 3BGAA 4Z2GA 1JZ5A 1GCYA 3VIKA 1ODZA 3AQUA 5A2CA 5I5RA 3I3DA 2V3FA 4MJ4A 1H0GA 1PAMA 1ZS2A 4C7FA 3F5LA 2RGMA 2W63A 1B3YA 3CH9A 1GHSA 2XHYA 1FH7A 3NSXA 6CGTA 1PZ2A 1E73M 5I24A 1JF6A 4JFTA 5I23A 2YL9A 3AI0A 1Z32X 6TAAA 2OSYA 4E4PA 1QNQA 3GH5A 4B3KA 3BLPX 4MB1A 2WVSA 1ZJAA 3GXDA 7A3HA 2DSKA 3AIWA 1DHKA 3VVGA 4CD6A 3CZEA 3N18A 1V6UA 3SCTA 3HJEA 2VX6A 2CCRA 1KR1A 1KGXA 2BVTA 2WNWA 5CLWA 3WF1A 1ISVA 5A6SA 3JUGA 5A6BD 1BFNA 1FFQA 1JNEA 4UQEA 4M29A 3VM5A 5DEZA 1KQZA 5A8MA 3UESA 1W3JA 3IJ8A 4HA3A 4HPGA 3PTQA 1ESWA 1MXDA 1UKQA 4MADA 3UG5A 2J8FA 4CCEA 2EJ1A 1B3XA 1HKKA 1NOWA 3VM7A 1V02E 4MNJA 4J3XA 4HP5A 1US2A 4BZYA 1AQHA 3IANA 1H1NA 1J0ZA 3VIOA 4J3VA 1E0VA 1NM9A 3CZKA 3HMCA 4UQ9A 4UCFA 3TP4A 1UD4A 4BQ5A 3B9EA 1LLOA 4OOUA 3N04A 4HMEA 1J12A 2VCBA 3WY1A 2WM0A 1SMDA 3WQWA 1DWFM 3WNPA 2VZOA 5CPTA 3K1DA 4D6CA 4M24A 3DHPA 3ARPA 3AS0A 1EIBA 2DGAA 1GOWA 1W9UA 3MANA 3W81A 1KCLA 3RMEA 2CHNA 4GPNA 1XH2A 3NSMA 1ZB5A 5E9AA 1DWJM 3BC9A 3M7SA 3IJ9A 1QI3A 3WFLA 4EKJA 3RJXA 2FH6A 5IDIA 3PZUA 1KXTA 2PWGA 3WNLA 4CGTA 3A6OA 4OJYA 3KE0A 3GH7A 1JXJA 4KH2A 5D9MA 2ZE0A 3M07A 1C8YA 1H11A 2OLHA 4GXPA 1PPIA 3WF0A 5JIWA 2VOTA 2JF6A 4X9YA 1W91A 1CTNA 4MPKA 2ZOXA 3ARSA 4DWSB 1HNYA 4AISA 1JI2A 1UUQA 4J3SA 3ALFA 2VX5A 2WANA 4GO9A 3WDPP 1WDRA 3ZQ9A 3WEMA 4HPHA 1NWTA 4AD2A 3IK2A 4F9DA 2GUYA 2J7CA 1UZ1A 5M03A 4MNLA 4AZCB 3GYCA 3ZJ7A 4AD4A 4MAZA 1JD7A 1W3LA 2E9MA 3EYPA 3RM8A 3TA9A 2JALA 4WKAA 2YA0A 1LWJA 1VB9A 3GXFA 3WH5A 2JIEA 1LG1A 3AMGA 3VO0A 2VX4A 1GW1A 3GNRA 3FXYA 3K8MA 4KWUA 3ZSSA 4Z2HA 5LYRA 4QP0A 1UKPA 3AMDA 1Q6EA 4JFUA 5CLTA 1WDQA 3A47A 1HP5A 3AISA 4BQ4A 3FHAA 5I78A 2AAAA 5BYWA 1K6AA 3KEHA 1XC6A 3ZT5A 3SCWA 3TONA 3ALGA 4IUGA 4P8WA 1E71M 2WBGA 1W1VA 1JZ3A 1GQLA 3WENA 2D24A 8CGTA 3WD1A 3POHA 3WL1A 1DWAM 4PMNA 4ATDA 5A94A 1OBAA 1BG4A 3UEQA 2GVYA 4JIEA 3PZOA 1J0HA 2J74A 4IPNB 5IFPA 5ABGA 3UG3A 4PMRA 1E70M 3ZSTA 2XFFA 1XCXA 4AYSA 1C8QA 5CQ1A 2YBUA 4AZHA 4FLSA 1MW1A 3ZJ6A 2WW5A 5FOOA 1GVIA 1CBGA 5E6YA 4WSKA 3UETA 1UWSA 4R5EA 3U5YA 1JAKA 4TUFA 4D72A 1E1FA 3GBEA 4GKLA 4BCEA 5HNNA 2VRKA 1K9TA 3MKKA 4W89A 4PUDA 5FCZA 1V0NA 2DSUA 4JCLA 4P7LA 1M01A 1YQ2A 1C7TA 4M82A 2CETA 1GUVA 3SIMA 1HKIA 1HVQA 2DT0A 2CXGA 2A3EA 2V3GA 1Y7VA 2O9PA 3MS8A 3WFZA 2JEPA 5JBEA 4XUYA 1KXHA 3VGEA 4AW7A 3AYSA 3L2LA 1CIUA 2J7FA 4TOQA 3VMPA 5ABFB 1EDQA 4D6DA 1EHNA 4KRUA 1RD6A 4D6FA 5E70A 2PWEA 2OYKA 1TFVA 3BAXA 2CKRA 3A4AA 3N9KA 1JYWA 4UNIA 2UY3A 1OCQA 1PBGA 4DWSA 1XYZA 5BWFA 1AMYA 3W29A 1U2YA 2DPEA 4UFHA 4PTWA 1UD5A 4WKFA 1J10A 1V6VA 4DM1A 2X05A 1OD0A 3NIYA 4BQ3A 3WH8A 3II1A 2GDVA 1QNSA 1OGBA 2G8ZA 3OZPA 1FOBA 4BF7A 1O6IA 1B90A 1J9YA 2D0FA 4ZXOA 1BGAA 3EMZA 4AZCA 5CGMA 4D6IA 4Z2IA 2WVTA 5BRQA 2FHCA 2XFRA 3MU7A 1VENA 3BAYA 1H3GA 2XM2A 5M3WA 3K8LA 1HX0A 3KWXA 2YLAA 1B2YA 2WAGA 2XIBA 4W8LA 3MUAA 3O6AA 1E56A 1UZ4A 2WMGA 3OGSA 5IHRA 3BAKA 1PJ9A 4PEEA 1MQRA 4XZBA 2CYGA 4QDMA 3W37A 2ESCA 2A3CA 2YBTA 3BAIA 3QHNA 2VJXA 4PN2A 1GONA 5EFDA 4HA4A 5JBDA 1HVXA 2OYLA 4AZBA 2WHJA 2CESA 4CUCA 2GDUA 3RJYA 3GNOA 3SUWA 1PIGA 4GO8A 4DUVA 1BG9A 1WKYA 2WHMA 1NP0A 3OG2A 3CHFA 4YPJA 1TZ7A 2XFYA 2O9RA 3AIQA 2PI6A 1ODUA 2GK1B 3ZJ8A 2DIJA 4F8XA 3WH7A 1TR1A 3VGHA 4CN1A 4AMCA 3WDIA 2GJPA 4BA0A 1C7SA 2JE8A 3VKKA 2DSVA 4W93A 1W1PA 1JFXA 4D1JA 1CWYA 4HZ6A 1NOUA 2E8YA 2B31A 2UY4A 2PF0A 4W87A 1CGVA 2WC3A 3VGGA 1E6QM 3AHTA 2QMJA 3T0DA 4JFWA 3VD4A 3RDKA 2VI0A 4LQ1A 3SCVA 3PTKA 3GTNA 2VR4A 3SUSA 2E0PA 2W61A 1VEMA 4PUEA 3NDZA 4B16A 2AOSA 5M5DA 2WZEA 4IISA 4PRWA 2WCAA 1E6NA 5TD4A 4UQAA 5IHSA 1B3ZA 1F4HA 2PC8A 2DT1A 5JIPA 1TA3B 4A3HA 1BLIA 2Y8KA 1KBKA 4HU8A 2OWWA 1XH1A 5IFTA 1AVAA 4U5IA 1HF6A 2QHAA 3ECQA 1GOOA 3ZT7A 1J0YA 1E5JA 4UQDA 2AMGA 3FNDA 1GVYA 1LL4A 4ZE4A 2XSBA 3FN9A 1CXHA 3WMSA 1EA9C 2VZVA 3WNOA 3OB8A 3N17A 4HA1A 1TUXA 3W25A 3CUJA 2OWCA 2JF7A 5M17A 1QHOA 3L2MA 3THCA 2WC7A 4AD5A 2XG9A 1HJUA 2WMHA 3K46A 3AIEA 5ECUA 4ZXLA 3CZGA 4N42A 1H5VA 5CPSA 2E8ZA 3WQ8A 1MW2A 4UZSA 1EXPA 1NARA 3OA5A 4GI6A 4FMVA 4WIWA 4UFLA 1OT1A 4NZCA 2E9BA 3AICA 3N1AA 5DFAA 4PTMA 1QNRA 2ZIDA 3AS2A 3L4ZA 4PMVA 3AS1A 2EPMX 2QPUA 1X1NA 1H0IA 2BY2A 4P7NA 1Q4NX 1XSJA 4AD3A 3CTTA 6A3HA 2WZIA 4GQQA 4CD5A 3BSHA 3WUFA 1QW9A 3WD2A 2WCSA 2BV9A 1UA3A 1V3IA 1BYDA 2BVYA 5GNYA 3DHUA 3IAPA 4Q22A 4WKHA 5A95A 2GFTA 3WELA 2NT1A 4PMXA 4U33A 2ZICA 3WQ6A 5BRPA 2WPGA 5CG0A 1WPCA 1JZ7A 1NWRA 1E6XM 2YLLA 4WLCA 4YHEA 4V2XA 4PYSA 1XCWA 1QI4A 2CBJA 2WHLA 3VDCA 3L4WA 2W92A 1XSKA 2D0HA 1I75A 4UFJA 3PZNA 1V0MA 5FKYA 3LPGA 3AHZA 2ZX5A 1E0XA 3W24A 1JG9A 2HVMA 1KR0A 1FHDA 4DWSD 3CGTA 2ZX6A 4QCEA 1UH2A 2J7DA 2D23A 1GOQA 3VILA 3HU7A 1VFMA 1CDGA 2GK1A 1W3HA 3O9NA 4XZWA 1VFOA 1QNOA 2W91A 1WZKA 4M80A 1W9BM 5A8NA 2D2OA 4AZ7A 4CKQA 1SFSA 1QNPA 4U3CA 2DT2A 2V3EA 4QCFA 4BQ2A 3A4WA 2CPUA 4IM4A 1E4MM 1V6XA 4HMCA 2UY5A 3WN6A 3AJ7A 4AD0A 2WHKA 4W5UA 4AZ6A 1MVYA 3OGRA 1VRXA 1VF8A 1TMQA 2EO7A 1UKTA 1B9ZA 3OIHA 2CITA 3WNMA 2W5FA 1PX8A 4AIEA 9CGTA 2XJ7A 1JZ6A 4CU8A 1UR8A 4AIOA 3VINA 1UH3A 1FHLA 1EOKA 5DT5A 1Q6FA 1TA3A 4Z2KA 4MDOA 1HKMA 4ML4A 1EO5A 5BXTA 2WMJA 1UWUA 5JBFA 2BNJA 5E0CA 1OIMA 2UWFA 2YOCA 2EPOA 2VO5A 3KL3A 2WVVB 4W7VA 3J7HA 3ARVA 3A4XA 1MXGA 2E4TA 2VVSA 4A4AA 3I3BA 5HPCA 1ITXA 1SMAA 1WNOA 3WEOA 3AZSA 1NH6A 5I77A 2CBIA 1FFRA 3DC0A 2W62A 3VX1A 1J18A 1E72M 1GORA 1FA2A 2F2HA 4TTGA 3VIHA 1R86A 2CHOA 4AY1A 1UR0A 3WBAA 2C7FA 2J75A 3T2QA 4YHGA 4LYQA 2PWFA 3M6DA 3SUTA 2YL8A 3EDEA 3SCUA 3FAXA 4EANA 2Z1SA 2YL5A 1RH9A 1WP6A 1JDAA 4J27A 5A3HA 3A3HA 1K9EA 5EB8A 3SURA 4ACZA 1EQCA 4OBSA 3W0KA 3IAQA 1JGIA 2YJQA 3L4TA 3BSGA 2JEQA 4B3LA 4TVCA 3PZMA 3AMCA 2X2YA 4AXNA 3ARRA 2ZXBA 1CZ1A 1E5NA 1IT0A 3VX0A 3VNYA 1OIFA 1FH9A 2ZWYA 1BSIA 3LMYA 4UQCA 5DF0A 4CVUA 5DMYA 2YL6A 4MNKA 2WKLA 3NJ3A 4GZIA 5JH8A 1V3MA 4L4PA 5AYIA 2G4FA 3AIUA 3TTQA 2WZHA 4DUXA 4V27A 1EDTA 4D6HA 3W28A 1HJSA 1BHGA 1BTCA 1PZ3A 1FP8A 2XSAA 5D9PA 1QI2A 1VBRA 3AOFA 2OWXA 3CUHA 3AFBA 4DUWA 5A8OA 4PTVA 1E6SM 3BLKA 2VURA 4U5KA 3KZSA 3WEZA 3CZLA 1LQ0A 2OYMA 3CZ8A 1E4IA 2WMKA 4OBRA 3ARXA 4PMYA 1UKOA 2ZUTA 4L4OA 1XD1A 2NT0A 3CPUA 3T0AA 2D3LA 4RE2A 3WF3A 1QOXA 1HJQA 3T2PA 5BXSA 1RPKA 2Y4SA 4HMDA 3MMDA 1CPUA 2VCAA 3I3EA 4PMDA 1WB0A 4TVDA 4P7RA 2WC4A 2ZXAA 3K4AA 4PCSA 3U7VA 1Q6GA 4BS0A 1UR4A 1L0PA 3ZOAA 2D1ZA 2J8GA 3VD5A 1ZBCA 1G5AA 3GXIA 3LPPA 3GNPA 3MV11 2XWDA 3L4YA 5A8PA 2QMKA 3SEPA 1UA7A 2Y5EA 2EBNA 2MANA 1GOIA 4JFSA 3WUGA 1GJWA 1VJZA 3VTRA 4WJXA 1H09A 3PZGA 1V3HA 3AXXA 2ZUNA 1VEPA 4ZEPA 1I1WA 3GXMA 4DWSC 3WQVA 2ZWZA 1XSIA 3FAWA 4HOXA 3AZRA 5DT7A 3APGA 4UZUA 5EBAA 1VAHA 4D6JA 2E40A 1UD6A 1V3KA 1D2KA 4UTFA 1CYGA 1OGGA 1BVNP 1K9FA 4E8CA 8A3HA 2BY0A 4U3AA 1CGWA 3AZTA 3TTYA 1CGXA 3RO8A 5D8ZA 2DH2A 1WE5A 2IXVA 5BXRA 2WYSA 4JKMA 1UQZA 2WVVA 3U5UA 3ZM8A 3CHEA 1M7XA 5D8WA 1UQYA 4OIFA 4H04A 4N0RA 4IPLA 3PZIA 4W5ZA 4CU7A 1KGWA 3L4UA 3W53A 2G3NA 3UG4A 4PSRA 1HT6A 3EDFA 2BHZA 5FL1A 3BCDA 4PMZA 2J79A 3WDQA 2DT3A 2D20A 1V6WA 1HKJA 1DP0A 2DH3A 3QHOA 3WMCA 2A3HA 3VDAA 4M1RA 1W9VA 4UFMA 5EFFA 1C8XA 4HOWA 2XYLA 2YKKA 4NRSA 4E2OA 3UR7A 3PHAA 4JHZA 4D6EA 3ZMRA 1YHTA 1IZKA 2DIEA 2DSZA 1V0LA 3W6LA 2VUYA 1KQYA 5BROA 1C91A 4A3YA 2WMIB 4FLOA 5HPOA 2ZUMA 1JD9A 2BY1A 2BHYA 7TAAA 4KRTA 4JHOA 5E6ZA 5HXMA 1A3HA 3VIMA 3WNKA 3D5HA 1R8LA 4W8BA 2DQXA 1MQPA 2F8QA 1UH4A 4CD8A 2UY2A 4CU6A 1HIZA 5CSUA 1L8NA 5CSYA 1ZBKA 5FIPA 3SCPA 2VQUA 1KFWA 1H2JA 1WDPA 2CEQA 2J47A 4J7RA 2BVDA 3BXWA 1NWUA 3WBEA 3WNNA 1UWIA 1CLVA 1ZBWA 1BAGA 2OSWA 1DWHM 4MB5A 1E4NA 5I6SA 3WDHA 1WAWA 3MUZ1 2PBOA 2QV4A 3AXIA 3PZVA 1BPLB 1LJYA 1E4LA 3ZT6A 5A1AA 2WSKA 5CJ5A 1MWOA 4C7DA 1ISYA 5A6JA 1NQ6A 3EDKA 1KWGA 1XHGA 2E3ZA 3BCFA 2ZUWA 3O2LA 3N13A 1LG2A 2C8NA 4GINA 3SCQA 1KXQA 2D0GA 2FGZA 1I1XA 1E9LA 4JL1A 4B15A 4D1IA 5LA1A 3VMNA 1DTUA 3L4VA 2BS9A 3OLGA 4Y7EA 3U7BA 4UOZA 2XGBA 2RGLA 3VIGA 2J7HA 1JI1A 3MMUA 1JYNA 4Q7NA 4CN6A 2BFGA 1K9DA 1PEZA 4LGXA 1DWGM 2XVPA 2GJXB 1XYFA 4MB4A 2JIWA 1MFUA 3FHQA 5C71A 1QPKA 3VU2A 4OKDA 3MUIA 3WQ5A 4PSPA 3BMWA 2Q8XA 4LX4A 1C92A 1R87A 4PMOA 2VMFA 1CXKA 2GSJA 1OT2A 1GHRA 5I3DA 5GQBA 2JFEX 2EEXA 3THDA 1QVBA 3E1F1 3K4DA 3AXHA 1JZ2A 3WQ4A 1JYVA 1WO2A 2ZUVA 4DM2A 4PCTA 2X09A 4ATWA 3GH4A 1W1TA 1NOFA 1VBUA 4PBGA 3N15A 2WCGA 4UQBA 4AZGA 4AEFA 3L4XA 1E6RA 1W9XA 4MJ2A 1EH9A 3AIRA 4D71A 1B30A 3ZJKA 1CNVA 3TOPA 5C8BB 1QI0A 1D3CA 2E9LA 5A6KA 3F5KA 3VOCA 1ZL1A 1AQ0A 5AYBA 2G3IA 1EQPA 4ACZB 3T2OA 4WK9A 1EO7A 3VD9A 1C93A 2DDXA 4GI8A 2CBUA 1W2PA 1E43A 3MO4A 2G41A 1OINA 1OD8A 4RL3A 3AIVA 4NSBA 4QLKA 4U2ZA 3VD7A 4M8UA 2W66A 1UWQA 2PBGA 1LF1A 3AYRA 2WMIA 1XD0A 4W86A 3CUIA 1LL7A 2WLYA 1EHAA 1J01A 1QW8A 1LL6A 1XGZA 2ZX8A 5EMYA 2EPKX 2J62A 5CXPA 3VGBA 1BQCA 1JNDA 4GIAA 4WSJA 3SUVA 5ABHA 3VIIA 4NF7A 2G3MA 2XM1A 4NRRA 1G0CA 1XV8A 2XVGA 3WF4A 4R27A 3CO4A 4UR9A 1PIFA 3T09A 1V02A 5KEZA 4J3TA 4MAVA 3PZTA 1IV8A 7CGTA 2J7GA 3DYMA 1V0KA 1EOMA 4HZ8A 4FLQA 4EK7A 5GPRA 1X6NA 1TE1A 1CECA 4PMUA 3ARUA 2O92A 1MW3A 4MTVA 1OSEA 1GNXA 2ZUSA 3RPMA 3WIJA 3OLEA 3W26A 4B9ZA 5CGTA 1HL9A 1Q6DA 1CXLA 3WUBA 3CZJA 1VEOA 1TG7A 1HJWA 4CCCA 1UHVA 1JDDA 2WMFA 1W3KA 3W38A 4J28A 2C0HA 2Y2WA 2YDSA 4P8VA 3VDBA 4GZJA 1E0WA 5CPQA 1WZLA 1ISXA 1GQIA 4EAMA 2VCCA 4W85A 2FDMA 3WD4A 1MYRA 1E6ZA 2XTKA 3T0BA 1VFFA 4AZIA 2GJXA 3UCQA 1H41A 3OZOA 3MUY1 3HN3A 4C7GA 2XVKA 1E1EA 4JFVA 5FD0A 1ZJBA 1OWQA 5A6LA 3MV01 3UR8A 5D9NA 4AWEA 3OLDA 3PN8A 2PWHA 3S6TA 4CCDA 4OUEA 3WH6A 1B3WA 1WZAA 2A3BA 1JZ4A 1IZJA 3QGVA 1UWTA 4EE9A 4JCMA 1W32A 2QLYA 2V5DA 2VTFA 4P8XA 1FP9A 2TAAA 3KL0A 2EXOA 1HJXA 3ARWA 3EDJA 1G1YA 1X6LA 2A3AA 1KGUA 1KCKA 5F7UA 2VZTA 1OM0A 2XPKA 3M46A 3MSDA 2WWDA 4JKLA 5HOSA 1TCMA
chains in the Genus database with same CATH superfamily
3M0XA 1JZ8A 3G1HA 2NUWA 4W9TA 1PX4A 1GYMA 1FH8A 2QDEA 2VR5A 4D9PA 3L9CA 2OQHA 1HKVA 4OGZA 1TVPA 1PZ0A 3CIVA 3EY6A 2D22A 2XIIA 2ACSA 5A6TC 2YA1A 5HMEA 5T9CE 1BYAA 3B3DA 2FKPA 1KKOA 3AIBA 3UWWA 1PE1A 1RP8A 4NHVA 3KAIA 1MQQA 3SAZA 1R85A 3GVWA 2OCZA 3R5EA 3QOKA 3GLCA 3DYOA 1G9HA 1ZAHA 3QHMA 1FJDA 1H4PA 4RPPA 6REQA 4FX6M 5DCEA 4U31A 5AVHA 3NPXA 4KR0B 4C6IA 1A50A 1QBBA 3NR0A 2FHBA 3CBWA 1FTXA 2V5CA 3M4HA 1V3LA 3TN5A 5IRPA 5EA9A 2GGEA 3OBAA 4I8YA 2DEPA 4ZBCA 3O5DA 2VRJA 4GK8A 3W85A 2J7BA 2ZUUA 3KLKA 1LBLA 1VHCA 3G6MA 1HG3A 3OLIA 4AG0A 4UTKA 3UXDA 1UKSA 1SSDA 1ADDA 5DMMA 1A4MA 3WLLA 3S2CA 4WJEA 1XIBA 3GY1A 1EWEA 3GK0A 1ZSXA 2DZVA 1GVOA 2VRQA 1EUNA 1MSSA 3PANA 4DX3A 1SU5A 3QZEA 5JH1A 4W84A 3MKCA 4U2YA 4RE3A 3ZS4A 3G1VA 1RLCL 2WZMA 3REQB 2G4JA 1HXVA 4KT2A 1D7FA 2QKFA 3HPFA 3OIXA 3IKGA 3WH9A 3SQLA 3U0HA 1A47A 4B2DD 1UD2A 4JZ5A 4XAYA 2QVNA 4TMBA 1HO4A 3VUPA 1AQMA 1YBQA 2Z7KA 2ALRA 4DPPA 3VYLA 3VOJA 4N02A 4D8AA 3GWQA 1UWRA 2GJRA 3S83A 4B9YA 1PKMA 2PB1A 1S1RA 1QK0A 1C29A 1WCGA 4FA3A 4MB3A 1F4AA 1LWHA 1GKPA 1J4IA 3AMLA 3B8TA 2OVLA 1CXFA 1LRTA 3AXMA 1XPYA 4B5UA 2W0UA 1KXVA 3S6OA 3KABA 1J6YA 3UR2A 3VMOA 5A6BA 1TCDA 1NWSA 4WY0F 4OZOA 2XGIA 4F66A 4WF7A 1JFHA 2AQOA 2FZ8A 2QUTA 3W72A 2XVLA 4UOQA 4YNGA 2OMAA 2ZX7A 4LPCA 3BPWA 3FKKA 5B7ZA 3TV8A 1E3ZA 4IXHA 1FWSA 3PG8A 2ZYFA 4JTCA 2V0TA 4S3JA 2MNRA 1U33A 4HNVA 1XBXA 1W1YA 1HL2A 1P5BA 3C8NA 3QGKC 3KFTA 1A53A 1G7VA 4I90A 2PCQA 4JPGA 1EDGA 4W88A 4ODOA 1ISWA 4I5UA 2GVJA 1ITCA 2YDQA 3WJXA 3NQVA 4NNBA 5IBXA 4D6GA 4XO6A 4FLRA 3DXIA 4ZMGA 1EBHA 1S5MA 2X1IA 2BXZA 1KW1A 1VJSA 2OO0A 1DVJA 3IUHA 4V28A 3DBNA 5I79A 3RO6A 3S1WA 2ZX9A 1EPVA 2OB3A 1EJRC 3T08A 3EBVA 2IPJA 3UXIA 3MCNA 1DWIM 1ECEA 4HNLA 4GUFA 3P61A 1TELA 3WJWA 4A2SA 3IJ7A 3IPWA 5DMNA 4CNUA 4QFUA 2PV3A 1VFUA 1KBBA 3TTSA 1LROA 2X16A 5BCAA 4KIRA 3W6MA 3L21A 1YMYA 2EAWA 3LLFA 5KSWA 2YW4A 3WF2A 5D2TA 3B8SA 1R7AA 1JQVA 1DIEA 1OFRA 3FCPA 1P6WA 3NO1A 4UTMA 3FA3A 3F4WA 5G2HA 4GIYA 2Y8VA 1M7OA 4X0VA 2O7SA 2QAFA 4XV0A 3REQA 3AS3A 5G4WA 4A8LA 4N19A 3N11A 4JFJA 2CERA 2AL2A 2J25A 4IGSA 3MWCA 4W8AA 2Y1HA 3SCRA 2VNCA 5CG7A 4GI4A 2I16A 3RILA 1TMHA 3B0PA 3NNTA 3E38A 2ZXQA 1IZCA 4GGBA 1A49A 4RE4A 3M47A 4Z1CA 1P0NA 2V8ZA 3I68A 3GDBA 4O0QA 4PMQA 1K02A 3TA6A 3ORWA 4B5VA 2F61A 3CJPA 4NZJA 5BU9A 4R7JA 4B91A 4DNHA 3IV8A 5ABFA 1YADA 4BKNA 4EXQA 1G69A 1QATA 4F0KA 1BYBA 4YN5A 3GHSA 3EXSA 1TRDA 1H60A 2ZRYA 4R88A 3WO8A 3BCJA 2NXGA 2FB3A 4LANA 2V3DA 3UF8A 2OO6A 4WX2A 2CIPA 5DRCA 3W4RA 3BAWA 3T78A 1L8PA 3VGDA 1EP1A 4IGMA 5HUAA 1QHZA 4JX4A 2G3JA 4WXZA 5LIXX 3CHCA 3XIMA 3BGAA 3TC7A 4MLRA 2ZR4A 1JZ5A 4RX0A 3EB4A 3UI4A 1FY6A 1KM2A 3CO8A 1LM1A 3P2VA 3TQPA 3NQBA 4MZYA 3R58A 3W2NA 3M64A 1I0DA 1AJZA 1T7LA 3CH9A 2XHYA 2ATMA 3WCZA 6CGTA 1F8IA 4O17A 1H1ZA 3R79A 1F6YA 3W1LA 1NDVA 2OSYA 6TAAA 4AFYA 5G4HC 3GH5A 3BLPX 5HNUA 3HGJA 4U28A 2XP4A 2VN1A 3MHUA 3IEBA 1DHKA 3I7RA 4RR4A 4GYPA 4H1ZA 3SCTA 4MM1A 3F4NA 3TJ4A 4EPEC 2PE4A 2VX6A 3B8UA 2BVTA 1WBJA 4LU0A 1MDRA 1ISVA 1EF3A 4LFYA 5A6SA 1FFQA 3VE9A 4M29A 1GTEA 4MKVA 4PRRA 5DEZA 1KQZA 3KVKA 5K9XA 3NTYA 1FWGC 4YJ5A 2F38A 3IJ8A 4HPGA 1FRBA 3COTA 1DORA 3UG5A 3UWUA 1B3XA 3TYEA 1HKKA 1NOWA 1XISA 3GXTA 3LCFA 1V02E 1US2A 4BZYA 1QK2A 1V6TA 3W2UA 1EJ7L 3T4CA 3TTEA 2CLIA 4J3VA 1E0VA 4UQ9A 4UCFA 1UD4A 2VC5A 3B9EA 1LLOA 4OOUA 1LT7A 1ZENA 3WY1A 2KAUC 1B4KA 3B0XA 1SMDA 4HHLA 3KVJA 1ZQ5A 3N2CA 2Z1WA 3C6CA 3SFWA 4NY2A 4XQ6A 1S5WA 3W81A 2CHNA 5EBUA 2PDXA 1XH2A 1YX1A 2X41A 3M7SA 4JBRA 1JUKA 4EKJA 3RJXA 1Y5VA 3PZUA 4DB7A 3A6OA 3RPDA 3GH7A 1JXJA 4NXSA 3P3BA 1MO0A 2PGWA 1H11A 3SJ3A 1Q63A 3IGXA 2FZ9A 3BW3A 5JIWA 5A5WA 1DJYA 4X9YA 3IGSA 4MPKA 3THAA 2QUUA 4DWSB 3WLPA 4J3SA 3CPGA 2PLJA 3DUGA 1GYLA 1PSCA 2OZTA 3WDPP 3L5MA 5FAGA 2QEZA 1RD5A 1L9WA 1AZ2A 3IK2A 2F23A 1XLGA 2RUDA 1XBVA 4AD4A 1P0DA 1NU5A 1JD7A 3H2FA 1W3LA 3ZWSA 2E9MA 3EYPA 1R9HA 3RM8A 3HJZA 3TA9A 1VS1A 3BWWA 2YA0A 4PE8A 3WG6A 3WH5A 2R1MA 4JTDA 3GPKA 2QDGA 3OVQA 1T40A 4KWUA 3NEVA 3A64A 3IJDA 4JEJA 4U4MA 4Z2HA 2HXUA 1ZPTA 5LYRA 4QP0A 1Y0EA 4JFUA 3TQKA 3WLNA 3FHAA 2XH7A 3PJUA 5BOFA 3KEHA 1OFAA 3DHDA 4Y8EA 3ZT5A 2WPBA 1EFZA 2NWRA 5FEPA 3T9PA 4P8WA 1E71M 2WSRA 1JZ3A 3DKJA 4IPXA 4IH3A 3WENA 1NY1A 5CCZA 2QCDB 3FXGA 4ORIA 4NILA 7ENLA 1DWAM 4H2HA 1FKTA 4EPKA 1LYXA 3KM8A 4KCTA 2VFDA 4FO4A 3VXGA 3E0IA 2RHGA 2OFJA 1BG4A 3V3WA 4DO6A 2BODX 4NNAA 2J74A 3WJSA 5IFPA 3UG3A 3URNA 4PMRA 1E70M 4ZOEA 2XFFA 1AA1B 1FKWA 1XCXA 2J27A 3LRLA 1C8QA 3ERPA 2IQ0A 4XWUA 4FLSA 3ZJ6A 5AYYA 1B54A 4LSBA 3UETA 4PCNA 2ZDRA 3O6CA 4R5EA 2G50A 1JAKA 1AH0A 2Y0FA 3BLOA 4FNRA 1K9TA 4W89A 2Y70A 4HD5A 4TNSA 2C79A 4P7LA 3CAVA 5CEWA 2YYTA 4ZOAA 1GUVA 1N8FA 1PDYA 1HVQA 1R9YA 4Q3MA 4DY1A 2A3EA 1G4PA 3NURA 1IHIA 1Y7VA 2GQ3A 3B8VA 4H19A 1W8GA 2MLXA 2ZZ7A 3L2LA 5K4XA 1CIUA 5C9ZA 1FKRA 5HQLA 1BKHA 1EDQA 4IQJA 5FAJA 1EHNA 2FZNA 1IWAA 1QTWA 1YDVA 1WKFA 2PWUA 3BJFA 1JUEA 1TFVA 4HK5A 3B0YA 3UU0A 3FSUA 2CKRA 2XZ7A 3A4AA 1FBAA 1JYWA 2DUZA 3U48A 1SZGA 4DWSA 1XYZA 2EG7A 2QIWA 3MWAA 3BL3A 1U2YA 2DPEA 4QS6A 4UFHA 4PTWA 1RVKA 5KZDA 1FVPA 2QUMA 3E74A 1J10A 1A3XA 4LVAA 4WRHA 3UCCA 3NIYA 3UZXA 3WH8A 3ITVA 1OGBA 1P6BA 1FOBA 3FAPA 4E0CA 3QPZA 4ZXOA 4LAUA 3SN1A 4IJCA 4JTQA 4Z2IA 2WVTA 1N2VA 4ADUA 4WOQA 4NNRA 1VENA 3LV6A 3WLOA 4QTGA 2XM2A 4FNTA 4FALA 4H6QA 1H62A 2GUBA 4DBEA 2WAGA 5DANA 3MUAA 4RCXA 2NQ5A 3O6AA 1E56A 4K8GA 3RU8X 3UWZA 1FWNA 5LXXA 2ACUA 3OGSA 4J3ZA 1R38A 3C2VA 3GNXA 5IHRA 1ME9A 1PJ9A 4PEEA 4XZBA 2CYGA 1ZJIA 4L72B 1G4EA 1Y65A 2YBTA 3BAIA 4H9VA 4FI4A 5BWAA 5HINA 1O94A 5TBOA 3PVFA 3W1TA 1IR2A 1Q2RA 3DFYA 1D3GA 3OZMA 1SW3A 3VOIA 3GTXA 2DG9A 3EX3A 3R13A 1X8FA 1TJ1A 1PIGA 4DUVA 3MA8A 2QCDA 1GEQA 2AWGA 4YPJA 1TZ7A 3KLLA 2IKGA 4JNYA 4OUIA 4XZNX 2UV8G 4QROA 1MMFA 4F0LA 3ABRA 2PI6A 1ODUA 4HCLA 1H5YA 3DESA 2DIJA 3N9SA 1AK5A 1TR1A 4J9JA 4DI9A 2ZR5A 4WR3A 2GJPA 3T1GA 1ZCCA 2DSVA 4WDWA 1W1PA 3CL8A 2PGFA 1NOUA 2B31A 3IKDA 2ZTJA 4XBSA 2CZVA 1ZHAA 4JIRA 5H6HA 3VGGA 1Q1CA 2QMJA 3B40A 3VD4A 2E68A 2YB1A 1D8CA 3SCVA 5KZMA 2E0PA 1RHCA 3LQGA 3ZLGA 4I6VA 2MLZA 4DAIA 1WA3A 2OODA 4PRWA 2WCAA 5TD4A 4YWIA 2CLOA 3LYEA 2PEVA 2OWWA 3CV7A 1AVAA 1EJTC 3AUJA 3ECQA 3FNDA 3WLKX 4ZE4A 3PNZA 3QPEA 2XSBA 4K8HA 2X7WA 3KOYA 1BRLA 1CB7B 3UA4A 1JR1A 3NL2A 4HA1A 3LHZA 3UNDA 4FXSA 2VP8A 8TIMA 3CUJA 5EMMA 3H24A 3RNDA 2X1RA 1K8ZA 3ABQA 2FGBA 1ZP3A 4NAFB 4L9ZA 1Z42A 4C6QA 4UTJA 3MDUA 3THCA 4AD5A 2CLPA 1O5XA 4QX4A 4AY7A 5ECUA 4JYSA 4X2PA 3BGGA 1KM4A 1M5WA 4W9PA 1WBHA 2REQB 5BNKA 4Z1BA 1NARA 3OA5A 3H7RA 4JN6A 1KFEA 1F2JA 3KVLA 4NZCA 2LKNA 2XIJA 1JRCA 4PTMA 4AHPA 2Y63A 5FSDC 3FOKA 3L4ZA 3USZA 4PMVA 3O15A 2BY2A 4OWGA 3M7WA 2OXNA 4C6EA 5C9UA 3UXAA 4E38A 4H9ZA 1OEPA 3JYJA 3NYZA 4GQQA 3W6YA 3OZYA 3PAJA 3K30A 4Q6JA 3UJ2A 2WCSA 2BV9A 3LBOA 5GJNA 2BVYA 3CQKA 1R2TA 3W7EA 4Y9PA 1TV5A 4JTGA 4EOUA 3DERA 3KHJA 4FXRA 1UR3M 4DF1A 1F3XA 4NQ1A 5DXYA 4PMXA 2P8CA 3WQ6A 3LU2A 5BRPA 3C5QA 4C1NB 3PWIA 5IDZA 1NWRA 2P0OA 1E6XM 2E5DA 4ADTA 1QI4A 4AIBA 4Q6XA 4TW7A 3VDCA 1V51A 1FKLA 3CT2A 1OC6A 3SM0A 2ZX5A 4GA8A 4B5NA 3CGTA 4QCEA 3WQEA 4PMJA 3RXZA 1TX0A 2DV0A 3IIOA 2NXHA 1WZKA 4GE8A 2PGEA 3APTA 4CKQA 1SFSA 3TKFA 5CAHA 1QNPA 1VLWA 3A4WA 2X1SA 2DZAA 4H6EA 1V6XA 3O5GA 1JCLA 2R94A 1U22A 3UPMA 2H3BA 2UY5A 3WN6A 4ZO7A 4I5XA 2E7FA 3N6QA 4HSNA 4WXYA 4M6QA 1PDZA 3N25A 5AHNA 2PZNA 3PNUA 1VF8A 3RHGA 3TH6A 1FCQA 2FQIA 3KAHA 2CITA 3A3XA 4KFOA 9CGTA 1EX5A 2Y5SA 4IIGA 6TIMA 1UH3A 3C2OA 1FHLA 5DT5A 4MDOA 1TQXA 5HWBA 4JFIA 1K3UA 2XH0A 1NELA 2BNJA 3NFUA 4S3CA 4HBKA 1XINA 3KL3A 2E28A 1RJPA 2IQDA 1Q7ZA 4L80A 3I3BA 1TB3A 1U5VA 5HPCA 1ITXA 4NAFA 1WNOA 3WEOA 2ACRA 4FR6A 3DC0A 3URAA 2RDXA 1J18A 1E72M 4CQBA 1FA2A 2PS2A 4REQB 3BOLA 1JCTA 2V68A 2QZRA 4AY1A 1XKYA 2UZ5A 1UR0A 4R7OA 3TYDA 3T2QA 1OYCA 2REQA 3QGAC 2PWFA 3M6DA 2FVLA 3CS2A 4EF8A 2R91A 2YSWA 4E8GA 3SUTA 2YL8A 3FSTA 3HB9A 5DCBA 3TYZA 3O0KA 4ZTYA 2G5WA 1K77A 4M6VA 3OHMB 3H8AA 3IAQA 2YJQA 4FB7A 1WKDA 1NFGA 4B3LA 4TVCA 1F76A 4L65A 2X2YA 1RY0A 2WNQA 4IG2A 3ARRA 2ZXBA 4Q4MA 3D3FA 3VCRA 3VX0A 2L5HA 2ZWYA 1BSIA 4NU7A 3LMYA 4UQCA 1G4TA 2YL6A 4GZIA 2WKLA 4MVAA 2ZA2A 5TNVA 5HMDA 2H8XA 1V3MA 4C1NA 1RLDA 1JVNA 3LTPA 3LERA 4ODLA 4NZFA 3W7PA 1EDTA 4IJBA 4D6HA 2ZZ5A 2DZUA 1BTCA 5MKGA 3R89A 1OZMA 2XSAA 5D9PA 2ZRXA 2PDCA 4YYCA 5I98A 3ONBA 3HG5A 3A5VA 4MJZA 3B4UA 1DIOA 3CZ8A 4UR8A 4BWLC 4RZ6A 3ARXA 3UD6A 1IQ8A 1UKOA 3BUVA 2ZUTA 2NT0A 3D6NA 3LXCA 3WBXA 2GPTA 3M0YA 4GUIA 2A6NA 5BU6A 4MUZA 2UBPC 2GZXA 4UTTC 3TLLA 3I3EA 4E2DA 4P7RA 1R3WA 4P5UA 3OYXA 5EL1A 1QPQA 1L0PA 1L6WA 2HEJA 4OTKA 1FXQA 3GR4A 2I14A 1DJZA 4DXKA 3MV11 5F1VA 2C18A 2Y5EA 3N3MA 4ZQPA 3GNDA 2G95A 1VBHA 2X40A 2ZZ4A 4W4QA 4WJXA 3GTIA 1V3HA 4DYKA 1Y0OA 4IT4A 2MF9A 2VWSA 2ZWZA 3FAWA 1J4RA 4HOXA 3W01A 3MHFA 4UTFA 1CYGA 3LHVA 3SRDA 3SECA 4XTDA 4YU1A 3AZTA 3TTYA 1CGXA 3CB3A 1OJXA 4PUMA 3L7RA 5BXRA 3W23A 3B7XA 5CZSA 3HPXA 4J4OA 5D2YA 4H04A 4N0RA 4K2SA 4QIBA 4W5ZA 2ZQTA 4CU7A 3GW3A 3TJIA 3L4UA 2VOMA 5DXXA 5HWMA 3A5FA 3V75A 5EU9A 3G8RA 1HT6A 4O53A 1TR9A 3EDFA 2BHZA 1PYFA 4REQA 3BCDA 3WQDA 4LH8A 2EG6A 1AJ2A 2OR2A 2J79A 1OFBA 2J6VA 2PDIA 4ENLA 1FWFC 3M0HA 2V2HA 1HKJA 3FA4A 3SN4A 5KITA 2A3HA 1NVMA 1DIDA 1GZGA 1IIHA 2R82A 4XZHA 1M68A 2Y62A 4UFMA 1UPMB 1NFPA 4HOWA 1FWEC 3R43A 2ZA3A 3HV9A 2YXGA 1L2QA 1CW2A 1YHTA 1V0LA 4B5XA 2DP3A 5BROA 4ZZ9A 1E9IA 3SRFA 2QJIA 5L6UA 4GH3A 5TIMA 1C91A 4A3YA 2EPHA 2WMIB 4O18A 2QDHA 4NAEB 3ODKA 2ZUMA 1YRRA 2CC0A 1EX1A 4DZHA 3E2SA 5E6ZA 1PHWA 5AC6A 4EVZA 1RAKA 2F8QA 5HJLA 7REQB 3VNMA 3O5OA 2KI3A 4F4RA 3V5CA 4A8RA 3ELFA 2QCMA 4ZL1A 4J7RA 4Y6GA 3VABA 1NWUA 1ICQA 4DXXA 5I6SA 3WQOA 4US6A 3W71A 2QV4A 4MFEA 3PZVA 3NM1A 3QQ0A 2EJAA 5A6JA 3PFMA 5FESA 4I3GA 3EDKA 1KWGA 3BCFA 1LRQA 3IV3A 4RZ5A 1LG2A 2PU1A 2C8NA 3VZYA 2FGZA 3MP3A 4JL1A 4Q32A 5LA1A 1UBSA 5DMLA 2Z7GA 2BS9A 2TYSA 4G7EB 4Y7EA 3ANYA 4UOZA 4Q7NA 3HFYA 5HA7A 4CN6A 3NQGA 3UBPC 4LGXA 4IJRA 2VDHA 1XYFA 4MB4A 2FYMA 2PDUA 3FHQA 4KIEA 3GC5A 1OQFA 4E2VA 4DIPA 3BZJA 4FHAA 3MVTA 1UMLA 3BMWA 3KOWA 1XLIA 4F3HA 1R87A 4RUBA 3L0GA 1CXKA 3IJIA 4KF1A 4U84A 3RRAA 1N7KA 1CX9A 5GQBA 3A4JA 3THDA 4Z08A 2J9ZA 1FCBA 2E6DA 1RCOB 3AXHA 1JZ2A 2VWTA 4DM2A 3KADA 1KLYA 4E4FA 2X09A 3MO7A 3GFZA 4IL2A 3W2KA 1NOFA 3KWSA 3KRZA 3S2LA 2NVAA 1EJVC 5HMFA 2JBMA 4M19A 2WV8A 3UVIA 1W9XA 1K7XA 2P1FA 4JYEA 1Q6QA 3MT1A 4GH1A 3STEA 5C8BB 2RJGA 1QI0A 1W5PA 1XX1A 1B9BA 1I2NA 1IGWA 4N6EA 5J8LA 4ACZB 3TAKA 4L6OA 3VD9A 1C93A 3C2EA 4DN1A 5GJMA 3KCOA 3O8AA 1TJRA 3I6TA 4GYJA 1OINA 4RL3A 3AIVA 4GY7A 5CGQA 4QLKA 4WDTA 1RXOB 1NF0A 1UP2A 3GIYA 2O4MA 2YX0A 2PBGA 3VZZA 3IARA 4WZHA 3AYRA 2WMIA 3H23A 3JR2A 1A0EA 4NAEA 2GSEA 1RK6A 3LCIA 1NSJA 4W86A 2Q01A 5FACA 1NDWA 1JNDA 4GIAA 4WSJA 2NXIA 1A5BA 7REQA 4A6GA 1Q8AA 2XM1A 1XV8A 1FQ0A 3W1MA 1FAPA 3TIMA 3WF4A 1G4SA 4S38A 3E02A 4IFOA 3EX2A 2AGTA 3NQMA 1J96A 1XLEA 1GK8A 2V5JA 1V0KA 4DZIA 1XYAA 1K1DA 2PODA 1CECA 3GQYA 4PMUA 4ZPWR 4MTVA 1KD0A 5E0KA 2XISA 4OU1A 4QQ3A 2OOGA 1Q6DA 3WUBA 1JEZA 2RDUA 4X9SA 1JDDA 1EQ3A 1R9XA 3EIPA 3ES8A 4S23A 3E2RA 3O07A 1ZAJA 1W3KA 4GJ1A 4J28A 3ABZA 2C0HA 2HWGA 5CPQA 1WZLA 3GVQA 3O1NA 3W7QA 4G7EA 1GQIA 4EAMA 3C0LA 4JR5A 2FDMA 1MYRA 2XTKA 4NZ4A 1Q85A 3T0BA 1VFFA 4Y2WA 2VUNA 3C4UA 2F9RA 1H41A 3MUY1 3N2TA 5FJOA 4I9JA 1S2AA 1W5QA 5CKSA 4TYOA 3NVDA 3QC0A 3OLDA 5J5DA 3PN8A 3S6TA 4CCDA 1XUZA 2HBVA 4OUEA 2BXVA 2A3BA 1XIGA 1IZJA 2FPVA 4US5D 4EIVA 3NI6A 2P10A 2QLYA 2V5DA 4K7YA 4P8XA 3MW7A 4QSHA 1J6OA 2TAAA 3KL0A 4MUPA 5D2XA 4A8IA 3NGFA 1HJXA 3QZAA 2B4GA 1WOAA 4O2TA 4JDYA 1OM0A 3UZWA 2LJ4A 2OLAA 3M46A 3MSDA 4H8NA 4O15A 1S1PA 3CXOA 4L4LA 2GUUA 3FFSA 3M5YA 4ICMA 5LSMA 1JXKA 1EYWA 4QJ1A 1BEUA 3YPIA 5LIYX 5CSSA 5D04C 3RLUA 3R10A 3GHRA 1W8SA 5DELA 3HG2A 4IT6A 4LF2A 3WLJA 3M0KA 3LTSA 5TF0A 3PUGA 4GYFA 5A6MA 3MBDA 3VGFA 4WQ6A 4WVXA 3GO2A 3SDOA 2QUVA 2OSXA 4CEUC 3HPZA 4O1EA 5H8UA 3WD3A 4MDPA 2QF8A 1W31A 3K4WA 1GJUA 1KB3A 1QOQA 1KRAC 2W67A 4Z0SA 5JUVA 4DUOA 3RR1A 3AHVA 2RQSA 3MKVA 3QW3A 4TX6A 4L9XA 2I1OA 3MI6A 3CEPA 1OC5A 3A22A 2XP6A 4DEFA 4AWTA 3H26A 2J88A 2Y6ZA 1ONWA 3W27A 2VXNA 4P7OA 4DJFC 1W1ZA 1VYRA 2GOUA 1PTAA 1P1XA 4GISA 5CC3A 2C19A 1X1OA 5I0DA 2EKGA 1QO5A 4HOZA 4DJDD 3NDYA 1NP2A 1E1CB 1DOSA 2W4XA 3QBUA 4MNMA 2ISSA 2WSPA 1W2VA 2J4GA 2R1LA 2D2HA 4FNPA 2P4VA 2POTA 3RLHA 5CH9A 5I2UA 2DZTA 1TV3A 3M41A 2GOKA 5C55A 3GNNA 3WH0A 3IJLA 1KTCA 1S2CA 5A8GA 5K9CA 3W86A 3CWHA 2VCDA 3LZ3A 4IT1A 3JU2A 4F79A 2PTDA 3B06A 4Z1YA 4H41A 1SYTA 3W7NA 4QLLA 4XAGA 3V1HA 3EB2A 2R1PA 4NT0A 1JNTA 1BF2A 4HJFA 4DELA 1RP9A 3GZAA 3SO7A 4LBSA 2PA6A 3RU6A 3GKFA 4X0NA 1BVZA 3FYOA 2HISA 3P5YA 3WX7A 2Z1KA 1QPOA 3GYEA 4ERIA 1UOKA 4IHCA 1CLXA 1VH7A 2OZ3A 4S3GA 4CNSA 1V3JA 3NPUA 3FY1A 2Y24A 4JICA 5CAKA 4FIQA 5C70A 1AW5A 1JYXA 1E9ZB 4TU1A 2L2SA 4JNMA 3MUCA 2X42A 1XUUA 1IT7A 3SIZA 3EEZA 4RK8A 1Q6IA 4HB7A 4H7VA 4QAWA 3R8HA 3KRUA 3TXVA 3ARZA 3SGUA 3UFYA 1JULA 1EEPA 2KX9A 5CZKA 4A3QA 3TFCA 4QQUA 2IXUA 2VC9A 1F5ZA 4UFIA 1Q7MA 2WKGA 5EGRA 5XINA 4JD4A 3F4VA 1OF8A 1XRVA 1I0BA 1EJWC 4QLJA 5E9XA 2V38A 2WVUA 2EQDA 4AVNA 1GW9A 1V03A 2CLHA 1ZFJA 5G5IA 2VL4A 4IPIA 2WJZA 4ZO8A 1QHPA 2P88A 3TCEA 5FL0A 3W1QA 1BSLA 4J3WA 2DUAA 3HG3A 1N8WA 3UG8A 1XG4A 1TV8A 3VD3A 3A9BA 4G8TA 3TC5A 4XAZA 3E2QA 1E55A 4E6MA 2INEA 3OODA 4CD4A 4ZQMA 3AHYA 4Y8FA 1V08A 4AX6A 1XRFA 4O1AA 3RLGA 3BH4A 2PDJA 5K7JA 2ONEA 4ZE5A 3WMBA 1HZYA 2VFHA 2IUZA 1IWPA 4ZFCA 1UG6A 1CGTA 2C3ZA 1TPC1 2HQAA 2CZFA 1UR1A 4PTXA 3LEPA 3V0SA 3M0IA 1HFBA 3LK6A 4JTRA 4V1YA 3HQOA 1E1CA 4C91A 4GX9A 4PB4A 3PBGA 5HDRA 3SUUA 5AC4A 4C6FA 4JTJA 4AMAA 2B7QA 1WAUA 3U2ZA 3GG1A 1OYAA 4KFNA 4ZPVR 3C2RA 1XLDA 4GI9A 3M0MA 1CGUA 4Z2JA 5J04A 4HU0A 5LA0A 3RM4A 3GBDA 4O0KA 4F9JA 3P14A 1J0IA 4R33A 3WDJA 2A7NA 1KRBC 2PD9A 3IGHX 4A3RA 3EZ4A 3VKCA 2WKJA 1EC9A 5ENLA 1B0IA 1XRSA 4JTKA 4U86A 2FHFA 5GNXA 4FK9A 3R0KA 4KWVA 3VNZA 4G50A 4AEEA 3GVGA 4AVOA 2WLZA 4G1KA 3D3AA 5DCDA 5A6AA 5FF7A 5KZ6A 2YDRA 5E09A 2V30A 3DYPA 3W7MA 5CC7A 2XWEA 1U30A 1G01A 4H7CA 5EMKA 1UZDA 4G2PA 3WKZA 2ISWA 4P2VA 3QC3A 6XIAA 2HE5A 2X0HA 4XAFA 1EGVA 3NZQA 4PODA 4QJ5B 1R5YA 5ABTA 4K68A 2D69A 2HNEA 3ITGA 1OFEA 1XLFA 6PTDA 2BLEA 5HTGA 1LRNA 5HBFA 1S38A 1MFVA 3G6LA 2C14A 4FX7A 4LUYA 4NJKA 2I57A 2V81A 4QG6A 3FDGA 3LXBA 5FEXA 5LA2A 5DLCA 4ZGYA 1HP4A 1CXIA 3M6YA 4HPNA 1XIFA 1RV8A 2Z24A 3H22A 4P8UA 3K8KA 4O8AA 1SUXA 1IR1A 1J0JA 4K39A 2PDMA 2AAMA 4RW5A 3AQUA 3I3DA 4XZIA 2MNTA 1H0GA 2ITKA 1IEWA 4LRSA 4Y9AA 1SJCA 3QH2A 2W63A 3KUMA 1GRJA 3PUEA 1BVWA 2ZKMX 1FH7A 3R12A 1PZ2A 1HGYA 3UW6A 3UNTA 3K1GA 2V69A 1QNQA 3U2CA 3BG9A 3RPTA 4GACA 3SADA 2Z29A 2XP9A 2GDQA 2QCNA 2R1NA 1JNSA 2DSKA 3KS5A 1TPFA 4CD6A 1V6UA 4NJJA 1KR1A 1PBKA 4AQLA 5CLWA 3OHIA 4DVOA 3WF1A 1B4EA 4LCSA 5A6BD 4KEMA 5CBIA 3VM5A 2ZRZA 3GS6A 2HMCA 5A8MA 4LF1A 3UPWA 3EAUA 3R25A 2Z6IA 4AB4A 2R8WA 3T8LA 3PTQA 3PR9A 1ESWA 1MXDA 1UKQA 1AH3A 4MADA 2J8FA 2OX1A 1QUMA 3KZPA 4MNJA 2QQ6A 2PDYA 3GG8A 1AQHA 3IANA 3PTDA 1H1NA 3VIOA 1NM9A 3CZKA 4HN4A 4BQ5A 2VEMA 4KW2A 3FIGA 1TPEA 2KE0A 2VCBA 4IP4A 4RPQA 2WM0A 1TWDA 3QTPA 3WQWA 5U4NA 1DWFM 5BOOA 3OJGA 2VZOA 5FJUA 1JPHA 3K1DA 4N9DA 1WXJA 4QDPA 5PTDA 1OY0A 1EEXA 1RCQA 2DGAA 1RUSA 1KCLA 5DY2A 3OOQA 3N19B 4M7TA 3NVTA 1ZB5A 3F03K 5E9AA 1DWJM 3RITA 3NO5A 3IJ9A 3WFLA 2FH6A 5IDIA 3QSTA 4AVFA 3TSMA 4CGTA 3WNLA 3NZ1A 1R47A 1EZWA 1TKKA 2XP7A 4KH2A 3RFWA 4FP1A 4ADSA 4LC6A 3MDWA 2OLHA 2NX3A 4GXPA 3M5VA 1VJIA 1IIGA 1PPIA 2HBXA 3WF0A 4I7WA 5F4SA 2VOTA 1YATA 5XIAA 1YXDA 3I4EA 2RDTA 1HNYA 2DQWA 1UUQA 3TYUA 3O5QA 3JS3A 1RALA 2VX5A 2NLIA 3CV2A 3TLQA 3ZZ1A 3G2GA 1D6OA 4F9DA 3NQFA 2OELA 5C2XA 1QOPA 5M03A 4MNLA 4AZCB 4ZODA 2OEJA 1TV2A 5D02A 4YYFA 1LDCA 4LVGA 1ZALA 4H3DA 2ON3A 3HG4A 1QAPA 2AQVA 2BX7A 4V33A 3RCYA 4HZMA 1WUFA 3VZXA 1LG1A 3ITTA 4MZ8A 2VX4A 5AYZA 1GW1A 1GWJA 3OA3A 1O95A 4UMBA 3MP4A 3ZSSA 2VFEA 1WDQA 9XIAA 3A47A 3AISA 4BQ4A 3LUOA 4XD4A 4Z0JA 4DRNA 4BI5A 2CWXA 3ZR4A 2PP0A 3EX4A 4PRTA 3C3UA 3T07A 1EJSC 3HQNA 3WK1A 1W1VA 2QJHA 1E51A 5C2GA 1R46A 1J2BA 4RE0A 4LS0A 4PMNA 2HS8A 4ATDA 3G1XA 5A94A 4F2TA 3NQ2A 4MJMA 4YVXA 2P3ZA 3URQA 2JGQA 2NLYA 3SQSA 2GVYA 3TQVA 3FJ4A 3E6EA 3PZOA 1J0HA 4JIEA 5L9FA 2DY3A 1W1A1 4IX2A 1F8AB 4AYSA 1XBZA 5F4XA 1NMWA 2NV9A 2YBUA 5JMUA 1MW1A 2WW5A 1VD6A 3LHYA 4L1GA 2Z6JA 2Q5AA 1S2VA 4UIOA 4BWLA 4D72A 2PRLA 4GKLA 3C8FA 1EYMA 4POCA 5TQLA 4LEQA 4PUDA 4B3ZA 4DJEC 1SGJA 2MUCA 2J13A 3DFTA 3FGCB 2DSUA 5C2CA 3F2DA 4E2BA 1P43A 3OW1A 3MP5A 3BW4A 1KLZA 2CETA 3GFYA 4XZ9A 4UTTA 2DT0A 1R30A 3UWYA 3MS8A 1DJHA 1GVQA 1YDYA 1YNQA 5H2ZA 1V77A 3ABXA 3M0ZA 4AW7A 1LZOA 4TOQA 4RDZA 1VR6A 2XSXA 3IRDA 5DIUA 4KRUA 1RD6A 2OYKA 5HJYA 1JDEA 1RQBA 4M3PA 3LCGA 4QAIA 4IQCA 1FWRA 1IEIA 4TIMA 1OCQA 1PBGA 1T5AA 1X1ZA 4FIRA 3H4GA 1AMYA 1BXCA 1Q7QA 3GG0A 2PPOA 4RKAA 5JU6A 1V6VA 1XLMA 4DM1A 3M0LA 2AGKA 4NZ3A 5I00A 3RRXA 2GDVA 3QY6A 2H9AB 4IMDA 2A85A 4KWOA 3DIPA 1O6IA 1J9YA 2D0FA 3P7YA 4I9TA 4AZCA 3PJTA 1P0BA 3AJXA 4D6IA 2IPWA 5BRQA 3DG6A 1PL9A 3JZUA 3KX6A 1GKRA 1H3GA 1TV7A 4QXIA 2YLAA 4K1WA 4DO4A 1XBYA 1A5UA 3GTHA 1Z6KA 3WJZA 1MQRA 5GPGA 1F9CA 4OV4A 1M7PA 2A3CA 3NGJA 3F1QA 3QHNA 4PN2A 3UCDA 1HVXA 1FD9A 5EKYA 2OYLA 3GD6A 1EP2A 4QG9A 1LLZA 4AH7A 1A80A 2GDUA 3QVQA 3GNOA 3SUWA 1DL3A 5AECA 5XIMA 3OG2A 3CHFA 2QCFA 3MJMA 2XFYA 4DBSA 1RQEA 5IM51 4L64A 3WQGA 4C6MA 2NQLA 1K4HA 3BV4A 1FWIC 4AMCA 4GX8A 3VKKA 2FTPA 2CZEA 3TCZA 3LNMA 2LLEA 1CWYA 4QNEA 1FHUA 3CU2A 4L1XA 2UY4A 3H2EA 4N9BA 1UC4A 1E6QM 1DXEA 3T0DA 4JFWA 4LEFA 3RDKA 3P8IA 2VI0A 3DN5A 2BP1A 3PTKA 1EF2A 2RSEA 1HKWA 1IE7C 1ZTVA 2EGZA 3SUSA 2QW5A 3H12A 4GUJA 4B16A 2Y7FA 2DZXA 3FGCA 1E6NA 4ZQRA 4UQAA 4IGHA 3WFAA 1F4HA 4GQ0A 4ZA0A 4CQ8A 4BEQA 1F07A 3MI2A 1KBKA 4A05A 1ZCOA 3UYCA 3DG3A 1P7TB 2QCGA 4UQDA 4C6JA 2LPVA 4F48A 1LL4A 1X96A 3LCHA 1CXHA 5F4WA 3S5OA 1OK4A 3WMSA 2GGGA 5D30A 1EA9C 1VCFA 3WNOA 4K6AA 3UZJA 3N17A 2JF7A 5M17A 2H3DA 3F4DA 2VEGA 3UZYA 1PZ1A 2Z2BA 3NOEA 2XG9A 5HR6A 4J35A 3AIEA 1JUBA 4ZXLA 4KCVA 2Y61A 3KBNA 3QFEA 4N42A 3W2JA 2E8ZA 2YPIA 3WQ8A 2PRMA 3PWAA 4F0SA 4LNCA 1VGAA 4UFLA 2B81A 1OT1A 2FJUB 2E9BA 5KETA 2H9AA 3AU2A 1SO5A 2I9UA 3D47A 4QT2A 1TJ2A 2EKCA 3JYMA 4ZO9A 2ZIDA 1L1PA 3NL5A 2EPMX 2QPUA 8XIAA 2ABAA 1QWGA 1Q6LA 3CTTA 3LGEA 6A3HA 4CD5A 3BSHA 1EXBA 1QW9A 3WQFA 3PRBA 1UA3A 3DHUA 4Q22A 2GFTA 3V18A 3MDYB 5E93A 5LZLA 5LHEA 4U33A 2YBVA 3LCWA 4GD0A 2ZICA 5D2WA 2XIOA 3ITOA 4GGHA 1XIJA 2RURA 2XGZA 3S1GA 3GXNA 4YXGA 4WLCA 2V5KA 3FEQA 4PYSA 3LM3A 3EA1A 2WHLA 2HVNA 2W92A 2BZNA 2D0HA 3FJLA 1I75A 4UFJA 4YWSA 1V0MA 5FKYA 2TODA 2W3ZA 1OZQA 1FWTA 1JG9A 4H6RA 1A5AA 4DWSD 4H00A 2ZX6A 1J5SA 1GOQA 3DKLA 1PS9A 4RXFA 3HU7A 1VFMA 3O9NA 1W3HA 3BLFA 1VKFA 1YDOA 4HT3A 4O1BA 5A8NA 2FMNA 2D2OA 2PRHA 2QJGA 3GR8A 1ZP4A 2YXOA 2HXTA 4ZPTR 4U3CA 2V3EA 4BQ2A 2E25A 2CPUA 4A22A 4QM1A 4JX5A 5K4ZA 3VOHA 1PTDA 1LQ2A 4BI7A 4WGXA 1Z3NA 4DZAA 3BG3A 4W5UA 4AZ6A 1PXGA 3OGRA 1I2OA 2F21A 1B9ZA 4QZVB 1FDYA 1KRMA 3WNMA 3CNYA 1EA0A 4WHBA 4C6NA 5AHEA 2XJ7A 4BK9A 4CU8A 1UR8A 2IW0A 1EOKA 2G37A 4Z2KA 1YXYA 1HKMA 2QJNA 4ML4A 2YGYA 5CJMA 5BXTA 3QLLA 1CCWB 4C6LA 2QGHA 1FKJA 3QMTA 3P8JA 1W3TA 2UWFA 3VDGA 2IQTA 1UWAA 3NPVA 1EP3A 4CQCA 3PBWA 1MXGA 5ECVA 1PV8A 2P0IA 3O6YX 3CLMA 4HMNA 4H9YA 3QV9A 1IYXA 1R86A 4DHGA 2BGSA 7ODCA 2TSYA 1TMLA 5AHLA 2PFHA 4UBPC 3SCUA 4O28A 5EMUA 1RH9A 1WP6A 4DRPA 2PF8A 3HQPA 3A3HA 1EQCA 4GC4A 1JCJA 4L3NA 4DT4A 4IIEA 2JEQA 5FEWA 2ZQSA 3LTYA 2EG8A 2HS6A 4PEKA 3BLIA 1X98A 4A2RA 1FDZA 1M1BA 2VDGA 2XINA 1E5NA 4ODMA 1FH9A 4B4FA 5DMYA 1UUOA 1MZRA 2QVHA 4HYRA 3PULA 4L4PA 4YVVA 4JHMA 1BXBA 4DUXA 3W1UA 2OT1A 4V27A 3GU9A 4ZSUA 5JQ9A 1HJSA 1CB2A 1FP8A 3LCXA 3PM6A 1QI2A 5CJNA 3AOFA 2OWXA 3ZXWA 3QR0A 1UBPC 1MUCA 1TVLA 2VURA 3ICJA 4DLMA 2BOGX 4Q4KA 3KZSA 3WEZA 3CZLA 2ZVIA 3OTRA 3QTGA 1NDZA 3CPUA 3ZYZA 3ZVHB 1XGDA 1QOXA 4DJFA 1HJQA 4G6CA 4KPLA 1ONEA 3H2OA 2Y4SA 3PBMA 1CPUA 2XH2A 4TVDA 3TOYA 1XM3A 2ZXAA 1H1YA 1XCFA 4PCSA 3SW6A 3GDKA 4BS0A 3KAOA 1UR4A 2PDQA 4HPJA 1KCXA 3V5OA 4IPJA 3S1XA 3TSBA 4QGCA 3L4YA 4MSPA 1UA7A 1YPXA 2WQDA 2G97A 1VJZA 4ZB5A 1H09A 4ORMA 1DBTA 1W26A 5I3FA 3AXXA 2ZUNA 3SGZA 4PUKA 1BKFA 4HHPA 1I1WA 1PYMA 3HGRA 3VE7A 3APGA 1KV8A 3B4YA 3DEQA 1VAHA 3IIVA 4D6JA 1XYLA 1D2KA 3UQBA 1BVNP 2QCHA 2BY0A 1CGWA 3GR7A 3QV6A 4G7FA 4BEUA 5LGXA 3SN0A 3ZM8A 4D8ZA 4YS1A 1W5OA 3QYQA 4IPLA 3PZIA 1H7PA 3GU0A 3W02A 2NQJA 1KM6A 2G3NA 4GZ7A 1PCKA 3UR5A 3IK4A 5DIVA 5FL1A 5IBXC 1DIKA 4NYUA 3TNBA 3WDQA 1NAL1 3VC5A 2J9XA 3E3HA 2DH3A 5MF5A 3QHOA 5FJRA 1L6GA 5AHMA 2Q3OA 1W9VA 4MWAC 5EFFA 1C8XA 4FNUA 4TW8A 2YKKA 3E0VA 2QR6A 2Q02A 3G0SA 4EWND 4XBJA 3ZMRA 5C54A 4PFMA 4C65A 3ONCA 1GVEA 5FF3A 3WMLA 2Y85A 1V7YA 2A1YA 4YTUA 5HPOA 3H7VA 2BY1A 2BHYA 5DO2A 1XF0A 4KRTA 4JHOA 1A3HA 4O8RA 4TV6A 3WNKA 4OQVA 4W8BA 3MUXA 2DQXA 1AFSA 1MQPA 4LALA 1L6YA 1HIZA 1ZBKA 4YTTA 1WDPA 1BXNA 1IGSA 3BXWA 2PDGA 1LT8A 1ZBWA 4PL2A 2O7QA 1DWHM 4MB5A 3WLHA 3EPMA 4R3UA 1WAWA 3AXIA 1BPLB 1DPMA 5A1AA 2WSKA 3B97A 4C7DA 1ISYA 1XIHA 4MY9A 3HPSA 3ANUA 1XHGA 3EWXA 3N2BA 3USBA 3W7KA 3ZVHA 4RW3A 3C0QA 4GINA 3KDOA 3SCQA 1E9LA 4B15A 1FWAC 1XFCA 4PULA 3S9ZA 5T9BG 4AY8A 3T81A 1TJPA 2DIKA 3MMUA 4Q4QA 2YZRA 2PBCA 2NVDA 2BFGA 1K9DA 2BWGA 1DWGM 3O5EA 4NZ5A 3CQIA 2JIWA 3E5BA 1OCNA 3VU2A 1VPXA 4OKDA 3PP7A 3WQ5A 4PSPA 2D2GA 2Q8XA 1DV7A 4IMEA 1KNWA 4PMOA 2Y88A 2QPXA 6ENLA 2VMFA 2QF7A 4GQGA 4QDWA 2DG4A 2RDWA 5I3DA 4GYKA 4FXJA 2ZE3A 4QG8A 2D9FA 9RUBA 3TUUA 2Z2UA 3WQ4A 2HROA 1WO2A 4ATWA 4QITA 2FFCA 1W1TA 4PBGA 1E0UA 4AZGA 3SSZA 1E6RA 1Y8BA 4E3VA 4D71A 4IGNA 3QW4B 3Q2DA 3ZJKA 1E0TA 3GVVA 3UVAA 2Q8ZA 4R7WA 3MY9A 3QXBA 3BURA 4O10A 1T8XA 3R94A 1O60A 4KWSA 4WK9A 4GYPC 3KTCA 1SM9A 1VCGA 1F73A 3IVTA 1G6CA 1RR2A 3EWYA 4GI8A 2CBUA 3W1XA 2VGIA 3S47A 5CPNA 3SY1A 4NJIA 3VD7A 4MGVA 1TWSA 1ELSA 2W66A 3GDMA 1UWQA 4LAMA 1LF1A 1O12A 3UJEA 1PIIA 1QO2A 1LL7A 2WLYA 1J01A 1QW8A 2FAPA 4GIVA 1MXSA 1XGZA 4PL1A 2YYUA 3D46A 3VGBA 1V5XA 4GUGA 5AC8A 1DJXA 3ATYA 4NF7A 3UYIA 4F40A 4CQ9A 3OYZA 4NRRA 2XVGA 4UR9A 3T09A 5KEZA 4J3TA 4MAVA 1B6CA 2VFGA 5CPLA 4HZ8A 5GPRA 4HNNA 2GL5A 4HCHA 1KRCC 1TE1A 3CPRA 3NQ7A 3B8WA 2E5CA 1MW3A 1OSEA 3QSRA 1GNXA 3W26A 4C90A 2ZZ1A 4B9ZA 1QPNA 1PTGA 1GG0A 3UI6A 1NQKA 1VEOA 3O5PA 4CCCA 4EF9A 1UHVA 3DBPA 4GWEA 2WMFA 1C9WA 1F05A 4YLWA 3W38A 1P6CA 1V7AA 3L12A 2YDSA 5KMYA 4JFMA 4IPPA 1AD1A 3VCCA 1E0WA 3RGCA 2JZVA 2VCCA 3KCJA 3O0FA 3WD4A 1E6ZA 2V5BA 3S1UA 4MHBA 4AZIA 4C60A 2QAPA 3UY7A 3Q4DA 1N8IA 4JTHA 5FSEC 3OZOA 1XG3A 3HN3A 4C7GA 2XVKA 1OCJA 3FX4A 4AHQA 1U1HA 1ZJBA 4HJWA 4IICA 2XFWA 4IZGA 1Q4WA 3HURA 3KBSA 1B3WA 1YNPA 3F7JA 1JZ4A 3B04A 3S9YA 3WJYA 2QDDA 3CUZA 4L61A 1OF6A 4IF2A 3THUA 3EDJA 3DGRA 1G1YA 1X6LA 2A3AA 2DG3A 1KGUA 2BVWA 3VA8A 3VNLA 3N4AA 2ISVA 2WJEA 1TIMA 5G1TA 2WWDA 5EMLA 4Y9OA 5HOSA 2OGJA 3TWBA 4R85A 3LLDA 2D73A 2VGBA 2POZA 1GOXA 3ZR6A 1W9DM 5A2AA 4S2CA 1DQWA 1GOMA 4KEVA 3CAKA 2V82A 2M08A 2E6AA 3NDOA 4HZ7A 2J78A 3MMWA 4QE1A 4QE4A 4CCZA 4IX0A 3WLRA 4HTBA 4XX6A 3G8EA 2H90A 4JY9A 3MZ2A 1R3QA 4PH6A 3EMQA 4H8VA 5LNVA 3LPFA 2XVNA 1N82A 3W3OA 3TQ0A 3TDBA 2P53A 2ZTKA 2PPPA 1VIZA 4L5ZA 4ASTA 3UF9A 3GC4A 4O1FA 4RNFA 1XL9A 4DYEA 4XD3A 3KBWA 3M0JA 3E0FA 4Q7IA 4AF0B 1TVNA 2GJLA 2BSLA 5D4YA 4H8HA 3MCOA 4FNQA 1K03A 2WXDM 4W7WA 3S0CA 3A23A 1CGYA 1V79A 3UERA 4QR6A 2FMOA 1MI3A 2AMXA 5BW6A 4H8UA 1WX0A 1S46A 1R3TA 4FOUA 4P7QA 3AO0A 4ZB0A 3AUOA 4TX8A 4FSAA 2FGLA 1GQJA 1UD8A 2QULA 2D2JA 3SCSA 4DZ2A 4HKPA 1HJVA 3SB0A 4X3ZA 4HTYA 2IS7A 1F74A 1YYAA 3CMFA 2VENA 3RUBL 4ATLA 3RX4A 2F6UA 1RQHA 5AY7A 3NZRA 3O5RA 2YA2A 2VT0A 3AROA 2EPNA 3K2GA 1R3YA 1CENA 3P93A 3BQ6A 4HA0A 2FH8A 4XO7A 1J11A 4K37A 5K2ZA 1DE6A 4FOKA 4PTNA 4TQTA 5I7GA 3QR3A 3UJSA 1HN1A 3M0VA 4KGLA 1LORA 3WL0A 3TN4A 3T44A 4DYJA 4IQ2A 4M81A 3R7MA 2KO7A 4TTUA 4GNVA 4ZB2A 4GRSA 4MKSA 3VIJA 4IIFA 2BBFA 3KVMA 1JIBA 1QJWA 5MHBA 4JOMA 2VZUA 2G0WA 1OYBA 4I9MA 3LNPA 3LCLA 3IIZA 1H63A 4B5WA 4HNCA 3ABOA 4OBTA 1R3RA 1JDCA 1F7BA 3CHDA 4DJEA 2W6RA 4MY8A 3EA3A 2X8RA 1F8MA 1UP0A 3FYPA 1VIWA 4GJJA 1G94A 2X1UA 4ROPA 4GGQA 3TJXA 4GQRA 4DF2A 5HW7A 4XD6A 4JNZA 4ZO6A 1E40A 4DZ5A 3WD0A 1E15A 3SQMA 3AU6A 1C90A 4Z2LA 3RAOA 4R0XA 1VFTA 3T05A 4MF4A 1FKSA 3E5PA 2BHUA 3KTXA 4JTTA 4XB3A 2M1IA 1ONRA 4AUBA 4M0XA 1DKWA 4FAMA 4JL2A 3S2MA 2F4EA 1XICA 1XPGA 1Q6CA 1Q6OA 2B5UB 1F61A 4WDUA 3UA3A 3UZ5A 2QCCA 1JCMP 3GXPA 4K3ZA 4W9QA 5GJPA 4AF0A 1ZU8A 5DO8A 5A69A 2NUXA 1X6UA 1JAEA 1OB0A 2J7EA 3POCA 1GVRA 5H8PA 2G3FA 3OPSA 3EPOA 5JXQA 3VKJA 3RCNA 3T0TA 4JEQA 1US3A 1US0A 1CT5A 1KV5A 5IXEA 3W82A 5I3IA 2XP8A 3FV9A 3CMGA 4LYRA 1R0MA 1KO0A 4D8LA 3B8IA 4ZVJA 4CNTA 2VVNA 1B3VA 1YPFA 3FVDA 3KAGA 4CN4A 1FCUA 3QJAA 4R34A 3TJLA 3PY2A 1MW0A 2V67A 2WNNA 4O4WA 2KGJA 1M53A 3BAJA 1B31A 2F6XA 4CD7A 3R6IA 4GXMA 2VQTA 2CU0A 5AB3A 1C3FA 4DBWA 4HBOA 1K7EA 4XIMA 4JAWA 5AYXA 3TR2A 3FA5A 1XI3A 1EGMA 4L6DA 3UPBA 4UOJA 3BG5A 3G1YA 4K36A 5LKYA 4UNKA 3RLVA 3FJNA 2ZADA 3KP1A 3G77A 1ISZA 4DRQA 2WBKA 3EA2A 5CPMA 3A24A 4DXVA 1E6PA 3U57A 3W9ZA 4A8NA 2XUCA 4AD1A 1W0MA 2CKSA 3NOYA 3F2CA 1WZMA 4ZFMA 2YCLB 4F2UA 5EMJA 5D9OA 4OOZA 1OCBA 2NSXA 3NAVA 1B1YA 3GU2A 2ZC8A 1Q13A 1W1IE 1BF6A 3W7LA 3EPNA 4YCPA 4ACYA 1LUCB 1CXEA 4J1OA 3L5LA 2X0YA 3AMKA 3KL5A 1Z48A 1SQ7A 3VIFA 4K1GA 1S5NA 4GNKB 4GZEA 4FR1A 4XVEA 3LPOA 2OT0A 3WBYA 3SCNA 4ZENA 4LV4A 5BXPA 1V8EA 3CV1A 2PDPA 1IWBA 4AIUA 2J77A 5FI8A 1KM3A 3ARQA 3QKZA 1QCWA 2O9OA 1VBJA 5HQEA 2PPNA 1BTMA 4IXXA 4NI8A 3CLWA 3PPCA 2WB5A 3EOSA 2VDIA 4AC1X 1UR2A 3CWOX 3WQPA 2PGRA 2VZSA 2ZRVA 2ZR6A 1BYCA 1HW6A 1AZ1A 1F3WA 1GPFA 2CLMA 3B9AA 3GAYA 4Z2GA 3BTNA 1OFQA 4F0HA 4IMCA 4I8DA 4C5YA 5A2CA 5HR7A 2V3FA 1ZS2A 2FB2A 3F5LA 4TMCA 1B3YA 3N9RA 1GHSA 3M43A 3G3DA 1E73M 3AALA 4O54A 5I24A 3GW0A 5I23A 3AI0A 2FVKA 3NM3A 2I5QA 4Q8MA 4B3KA 4MB1A 4ERGA 1ZJAA 3EWUA 3GXDA 7A3HA 1VLIA 2SFPA 2Z25A 4LWWA 4QJ3B 2BB0A 3W83A 3N18A 1L2UA 1HO1A 3HJEA 1KGXA 3I7QA 5B7YA 3CV6A 4Z1AA 1A0CA 1ZY9A 1T96A 3UESA 1W3JA 2V63A 3CB8A 4HA3A 2VKZG 1VBGA 3NZGA 3U4AA 3GSMA 4Q33A 4Q7BA 3QPYA 4CCEA 2EJ1A 3VM7A 1LWIA 4N4PA 4G1NA 2ASHA 3EOUA 3ITLA 4ICNA 3TP4A 1SO6A 3LI1A 1KFJA 5GVJA 1Z89A 2ZC1A 1MEWA 4DI8A 3BW2A 4C6PA 1J12A 2W9MA 2QCEA 3WNPA 3GRIA 3IUDA 1YW5A 3A13A 5CPTA 1SJBA 4JIPA 4D6CA 3VOGA 4LS2A 1UROA 1TRIA 3DHPA 2GVGA 3AS0A 1EIBA 4CNNA 1KTBA 1W9UA 3MANA 4WEVX 1H50A 4E5TA 3NSMA 3BC9A 3QLDA 5HW6A 4XAKA 1QI3A 5HT1A 2BMBA 3WYZA 2RAGA 3AC0A 2PWGA 1T6MA 1ZK6A 1LUCA 4OJYA 3KE0A 3LBMA 5AHFA 3G5EA 2C16A 3QMRA 4NJGA 3GC2A 3MTWA 3EX6A 3VNJA 3W07A 5HNTA 2HK1A 4NZ1A 1TUFA 2JF6A 1W91A 1SFLA 1CTNA 4NVTA 2ZOXA 4FF7A 4F0RA 3ARSA 4AISA 1JI2A 3BDKA 2JK2A 1DJNA 4GO9A 4JQ1A 1YTEA 3ZQ9A 4HPHA 4MG4A 1NWTA 5KZEA 4GVGA 2PDWA 4YIWA 3H4WA 4HARA 2GUYA 2J7CA 4LCRA 4PUUA 2DVXA 4DQWA 4LAWA 2A3LA 5I3KA 3G24A 3B0VC 4PR4A 4UTWA 1XW8A 2Y7DA 2GSHA 2RJHA 1XDJA 3BANA 1H51A 1LWJA 1VB9A 3GXFA 2A21A 2JIEA 3O05A 3AMGA 3VO0A 3L0NA 2Y5JA 2VM8A 3GNRA 3O7UA 3TXZA 3TMLA 4C5ZA 3BOXA 4OVXA 1DE5A 3AMDA 3LY0A 1HP5A 4MWAB 2QYGA 5I78A 3IACA 1K70A 5BYWA 1Q5MA 2A6LA 1VC4A 3F2BA 1XC6A 1KM5A 2RKXA 3GHUA 3SCWA 3TONA 3NL3A 4JFLA 2WBGA 4WOZA 1NJJA 2IKJA 1BWKA 8CGTA 5CBBA 3POHA 4ML9A 4PTDA 3WL1A 4JTSA 3QZ6A 5AKQA 3LSCA 3M5ZA 1SW7A 4WY0B 3T40A 4JDBA 3P84A 1JJKA 3ZWTA 1T11A 1F3TA 1YNYA 1SZNA 3G1FA 2MPHA 3TX9A 4CNOA 4JTFA 5ABGA 3DFQA 3GHTA 1DXIA 2PDNA 3ZSTA 4I6KA 3RR4A 5CQ1A 4AZHA 3GKAA 1UB3A 5D03A 1H61A 2AL2B 1FKXA 4JIHA 1U79A 1GVIA 1BQGA 1TWWA 2KFWA 1ZUAX 1HQTA 1WQ5A 3I6RA 4WSKA 3VNIA 5E5CA 1UWSA 3U5YA 5FJIA 2QUNA 4OECA 3MI3A 4JN7A 1JCXA 3MKKA 1NF7A 5FCZA 1V0NA 3QY7A 3WLQA 1I6NA 4OE7A 5BMWA 3HO8A 4JCLA 1DHPA 1QFEA 1YQ2A 5HMSA 1C7TA 2GJNA 3MHGA 2QT3A 1BL4A 1HKIA 1RBAA 5HQMA 3STPA 2V3GA 3I4KA 2M2AA 1PHQA 2O9PA 2O55A 3WBWA 3P6LA 4GKTA 4YVPA 3AAMA 3WFZA 4XUYA 1KXHA 3VGEA 2P50A 1KBJA 2J7FA 5B8IC 5ABFB 1Z41A 2ZZ6A 3H55A 4D6DA 4D6FA 2R6OA 1XLJA 3UT0A 3W73A 2ZA1A 4XSLA 1K4GA 2YZ5A 3HOJA 4O1DA 2GGHA 4UNIA 2UY3A 3WK3A 2GQ9A 3BARA 5BWFA 4GVIA 4JQ4A 3W87A 1TWZA 5HK4A