1FKDA

Fk-506 binding protein: three-dimensional structure of the complex with the antagonist l-685,818
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 BINDING PROTEIN
publication title FK-506-binding protein: three-dimensional structure of the complex with the antagonist L-685,818.
pubmed rcsb
source organism Homo sapiens
molecule tags Cis-trans isomerase
total genus 25
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1992-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkdA00
4ODNA 1A7XA 1JNTA 4IQCA 4W9PA 2KE0A 4GIVA 3O5FA 4DRJA 2DG9A 1Q6IA 4QT3A 5HW6A 2DG4A 1PBKA 1J6YA 3EY6A 3O5EA 3OOBA 1EYMA 4ODMA 2XP3A 2K8IA 3KAFA 3MDYB 2XP4A 5BXJA 5J6EA 2XP8A 1FKLA 1Q1CA 4TNSA 1NSGA 3UQIA 4FN2A 1PINA 4U86A 4ODLA 4O2TA 1FKRA 4W9QA 4JFKA 3I6CA 2F4EA 1FKGA 4DRPA 4TW8A 2KGJA 2ZQTA 2PPNA 4DIPA 5HKGA 2LGOA 3LUOA 1EQ3A 1BKFA 1FKJA 2MLXA 4TYOA 3O5JA 2IF4A 3RFWA 3TCZA 2MF9A 4C02B 3NI6A 2OFNA 3JXVA 1QPLA 2F2DA 3KAHA 3KZ7A 2MLYA 2KI3A 5HWBA 3KCEA 2ZR6A 2ZQSA 5HTGA 2PPOA 1KT1A 3KABA 2MLZA 1D7IA 1JVWA 1F40A 4JYSA 3TC5A 3KACA 2RURA 1FKTA 2XP9A 1YW5A 2Y78A 4DZ3A 3ODKA 3IK8A 4QIBA 1FKDA 5DIVA 2XPAA 2LJ4A 2VCDA 1FKKA 2PPPA 3GPKA 4DRNA 1TCOC 4ITZA 5B8IC 1FD9A 3IKDA 4TW7A 1J4IA 1KT0A 4DRHA 2PV3A 4JFIA 3WH0A 5HT1A 1J4RA 3CGMA 4ODQA 1FJDA 4ODRA 2FKEA 2F21A 1Y0OA 4J4OA 4DZ2A 4LAVA 2XP7A 2ZQUA 2L2SA 4DRIA 4FAPA 1B6CA 1FKIA 1J4HA 2XP6A 3O5MA 3UI6A 4DT4A 4NNRA 3UQAA 1D7JA 2RUCA 2M08A 2M2AA 4JFMA 2XPBA 5HWCA 4ODOA 1QZ2A 2XP5A 4IPXA 4DH0A 3KAIA 3PA7A 3O5KA 1C9HA 1M5YA 1ZCNA 1ZK6A 2UZ5A 3O5GA 4LAYA 3NTPA 5I98A 1QPFA 2VN1A 1U79A 4JFJA 5HUAA 2DG3A 2ZR4A 1FKBA 2D9FA 3O5QA 1FKFA 3CGNA 2ZR5A 4JFLA 2MPHA 1NMVA 4LAXA 4W9OA 1FKSA 4TW6A 1T11A 3NRKA 4G50A 4QT2A 4BF8A 3IKGA 4MSPA 3IHZA 5GPGA 1F8AB 3B7XA 3PRDA 2N87A 2PV1A 4LAWA 3UQBA 2ITKA 1N1AA 2KFWA 2PV2A 3O5IA 4G2PA 3H9RB 2RSEA 2PBCA 2JZVA 1YATA 4N19A 3O5LA 3TDBA 1W26A 4ODPA 3UF8A 5D75A 3UI5A 4DROA 2ZQVA 2KO7A 1HXVA 3JYJA 4TX0A 3O5RA 1BL4A 1D6OA 2LPVA 2RUQA 4ODKA 2RQSA 4U84A 2KR7A 2M1IA 1L1PA 4U85A 2Q5AA 4IQ2A 4DRKA 5HW7A 1P5QA 1JNSA 3KAGA 3O5OA 5DITA 4J4NA 3RGCA 2FAPA 2MNTA 5HW8A 3VAWA 1Q6HA 1FKHA 3O5DA 3PRBA 5DIUA 4DRMA 1ROTA 1R9HA 1ROUA 3JYMA 1Q6UA 3KADA 1FAPA 4GGQA 3UI4A 4MGVA 3O5PA 1NMWA 2RUDA 4DRQA 3FAPA 2LKNA 1D7HA 4R0XA 2AWGA
chains in the Genus database with same CATH superfamily
1ZBCA 4MTVA 2PI6A 4IQCA 2DSVA 1E6ZA 4LGXA 3WL0A 2B5UB 3OOBA 2XP3A 3KAFA 5BXJA 3ALGA 4URIA 5HBFA 5J6EA 1ZB5A 1FKLA 3UQIA 4FN2A 4U86A 1FKRA 3ARUA 4JFKA 4R5EA 2B31A 5HKGA 1BKFA 1FKJA 2IF4A 2YBUA 3RFWA 2OFNA 3KZ7A 5HWBA 2IUZA 3KCEA 4WKAA 2PPOA 3KABA 1F40A 3RMEA 3ARWA 4P8VA 1EIBA 3AS0A 4S3KA 3ODKA 3IK8A 1W1TA 1FKDA 3RM9A 1NWSA 4KR0B 1TCOC 1E9LA 4JFIA 4ODQA 2FKEA 4J4OA 1IX5A 2L2SA 1JNDA 3WQWA 2XP6A 4NNRA 3UQAA 2M2AA 2XPBA 4HBEA 1QZ2A 4DH0A 3O5KA 5I98A 3O5GA 4JFJA 2DG3A 1H0GA 1FKBA 4P8WA 4W9OA 4TW6A 4BF8A 4MNLA 1F8AB 4P8XA 2PV2A 4HBOA 1LL4A 2PBCA 4XAKA 1W9PA 1YATA 1H0IA 3RM4A 3GU0A 3JYJA 4TX0A 1BL4A 4ODKA 2RQSA 3G6LA 1HKIA 4U85A 3ARZA 3WD3A 5HW7A 3O5OA 3WD2A 2DT0A 4DRMA 1O6IA 1Q6UA 1OWQA 4MGVA 1NMWA 3FAPA 2RUDA 2LKNA 3TCZA 4ODNA 4Q7NA 1JNTA 2FDMA 3B9EA 4MNMA 4MNJA 4DRJA 2DG9A 1Q6IA 4WJXA 3B9DA 1J6YA 3EY6A 2DT3A 1NH6A 2A3BA 1KFWA 4DWSB 3OA5A 1HJVA 4NSBA 4TNSA 1FFQA 3ARSA 2DT1A 4Z2IA 3I6CA 2F4EA 1FKGA 2OLHA 2ZQTA 2A3AA 4TYOA 2MLXA 1CTNA 3FXYA 3JXVA 3KAHA 2KI3A 1RD6A 2ZQSA 2A3EA 2G8ZA 3WQVA 2RURA 1FKTA 2A3CA 1W1VA 1GOIA 4QIBA 5GQBA 4PTMA 1WAWA 2XPAA 2LJ4A 1FKKA 2PPPA 3GPKA 4MNKA 1FD9A 1KT0A 3WH0A 3CGMA 4ODRA 3CHCA 4KQZA 4AY1A 2ZQUA 1B6CA 1FKIA 1J4HA 1LQ0A 3O5MA 3UI6A 3BMBA 2RUCA 2M08A 4JFMA 1X6LA 4Z2JA 3AROA 5HWCA 2AOSA 4ODOA 3BXWA 1LL7A 1ZCNA 1E6RA 2UZ5A 4LAYA 2G41A 3NTPA 4UDMA 2VN1A 5HUAA 3O5QA 1FKFA 3CGNA 3ARVA 3ARPA 4JFLA 2MPHA 1W9VA 3NRKA 3IKGA 3IHZA 5GPGA 3B7XA 2N87A 2PV1A 4DWSA 1ZU8A 1JNEA 4G2PA 3H9RB 4Z2KA 3ARQA 3AQUA 2P4VA 4DROA 3UF8A 1ZBWA 2ZQVA 2KO7A 3B9AA 3O5RA 4DWSD 2KR7A 2M1IA 1E6PA 2Q5AA 4DRKA 1HJWA 4J4NA 1HJXA 2MNTA 5HW8A 3VAWA 1ROTA 1ROUA 3KADA 3WL1A 1WB0A 4W9PA 3RM8A 4GIVA 3O5FA 4IT6A 1SYTA 1PBKA 1SR0A 1NWRA 1EYMA 1ITXA 4ODMA 2K8IA 1K9TA 1X6NA 2XP4A 1Q1CA 3CZ8A 1TFVA 1W1YA 4W9QA 4DRPA 2F23A 1GPFA 1ZBKA 2LGOA 3LUOA 1EQ3A 3WIJA 3O5JA 1OGBA 3NI6A 1QPLA 1LG2A 1VF8A 1KT1A 3PRAA 1JVWA 4L72B 4JYSA 3TC5A 1D2KA 1HKMA 2XP9A 2Y78A 4DZ3A 3WKZA 5DIVA 1LG1A 2EULA 2VCDA 4WIWA 4DRNA 3WD0A 4ITZA 1OGGA 1LJYA 3IKDA 2PV3A 1NWTA 1J4RA 1FJDA 4ZPVR 4LAVA 2XP7A 1JCHB 4HARA 1WNOA 3CHFA 1M5YA 3G6MA 1HKKA 2ZR4A 2D9FA 2DSUA 2ZR5A 4LAXA 1FKSA 1W9UA 4G50A 4ML4A 2DSZA 4MSPA 4LAWA 4MAVA 3CHDA 1N1AA 2KFWA 2O9OA 4W5UA 2RSEA 1FFRA 2WLYA 3O5LA 3UI5A 3WD4A 1D6OA 2LPVA 2RUQA 4U84A 4IQ2A 4DWSC 3RGCA 1FKHA 4Z2HA 5DIUA 1R9HA 2QF8A 3JYMA 3AS2A 3FY1A 3UI4A 4DRQA 1A7XA 5GPRA 2WLZA 3PR9A 2KE0A 4NZCA 1EDQA 4QT3A 5HW6A 2DG4A 5JH8A 3O5EA 2ESCA 1XRVA 4WK9A 3ARTA 3MDYB 2XP8A 2DPEA 1NSGA 1PINA 1E44A 4ODLA 4O2TA 3GTYX 1W1PA 4TW8A 2KGJA 2PPNA 4DIPA 1LL6A 3AS1A 4S3JA 1UR9A 5DEZA 2MF9A 4C02B 4Z2GA 2F2DA 2MLYA 2ZR6A 5HTGA 4Z2LA 2MLZA 1D7IA 3KACA 1NWUA 1GRJA 4L3NA 3ARYA 1EHNA 1E6NA 1YW5A 1XHGA 2YBTA 3WD1A 5DO2A 1HKJA 4ZS6A 5B8IC 5DF0A 4TW7A 1J4IA 1E15A 4DRHA 5HT1A 1GUVA 2F21A 1Y0OA 4DZ2A 4FAPA 4DRIA 3CH9A 4DT4A 1D7JA 1ZL1A 2DT2A 3EIPA 2ETNA 2O92A 2XP5A 4IPXA 3KAIA 3PA7A 1C9HA 1ZK6A 1QPFA 4QZVB 1U79A 4ZPWR 2WK2A 4P8UA 1NMVA 2PN0A 1ZBVA 1T11A 3ARRA 4QT2A 3PRDA 3UQBA 2ITKA 3O5IA 3AS3A 3CHEA 2JZVA 4N19A 3TDBA 1W26A 4ODPA 5D75A 4ZPTR 4Q22A 1HXVA 1UR8A 2WM0A 1L1PA 1JNSA 1P5QA 3KAGA 5DITA 2FAPA 3B8SA 4WKFA 1Q6HA 2DSWA 3O5DA 3PRBA 3ARXA 3W4RA 1FAPA 4GGQA 3ALFA 4MPKA 4WKHA 3O5PA 3QOKA 1D7HA 4R0XA 2AWGA 4IT4A
chains in the Genus database with same CATH topology
1ZBCA 4MTVA 2PI6A 4IQCA 2DSVA 1E6ZA 4LGXA 3WL0A 3OOBA 2XP3A 3KAFA 5BXJA 3ALGA 4URIA 5HBFA 5J6EA 1ZB5A 1FKLA 3UQIA 4FN2A 4U86A 1FKRA 3ARUA 4JFKA 4R5EA 2B31A 5HKGA 1BKFA 1FKJA 2IF4A 2YBUA 3RFWA 2OFNA 3KZ7A 5HWBA 2IUZA 3KCEA 4WKAA 2PPOA 3KABA 1F40A 3RMEA 3ARWA 4P8VA 1EIBA 3AS0A 4S3KA 3ODKA 3IK8A 1W1TA 1FKDA 3RM9A 1NWSA 4KR0B 1TCOC 1E9LA 4JFIA 4ODQA 2FKEA 4J4OA 1IX5A 2L2SA 1JNDA 3WQWA 2XP6A 4NNRA 3UQAA 2M2AA 2XPBA 4HBEA 1QZ2A 4DH0A 3O5KA 5I98A 3O5GA 4JFJA 2DG3A 1H0GA 1FKBA 4P8WA 4W9OA 4TW6A 4BF8A 4MNLA 1F8AB 4P8XA 2PV2A 4HBOA 1LL4A 2PBCA 4XAKA 1W9PA 1YATA 1H0IA 3RM4A 3JYJA 4TX0A 1BL4A 4ODKA 2RQSA 3G6LA 1HKIA 4U85A 3ARZA 3WD3A 5HW7A 3O5OA 3WD2A 2DT0A 4DRMA 1O6IA 1Q6UA 1OWQA 4MGVA 1NMWA 3FAPA 2RUDA 2LKNA 3TCZA 4ODNA 4Q7NA 1JNTA 2FDMA 3B9EA 4MNMA 4MNJA 4DRJA 2DG9A 1Q6IA 4WJXA 3B9DA 1J6YA 3EY6A 2DT3A 1NH6A 2A3BA 1KFWA 4DWSB 3OA5A 1HJVA 4NSBA 4TNSA 1FFQA 3ARSA 2DT1A 4Z2IA 3I6CA 2F4EA 1FKGA 2OLHA 2ZQTA 2A3AA 4TYOA 2MLXA 1CTNA 3FXYA 3JXVA 3KAHA 2KI3A 1RD6A 2ZQSA 2A3EA 2G8ZA 3WQVA 2RURA 1FKTA 2A3CA 1W1VA 1GOIA 4QIBA 5GQBA 4PTMA 1WAWA 2XPAA 2LJ4A 1FKKA 2PPPA 3GPKA 4MNKA 1FD9A 1KT0A 3WH0A 3CGMA 4ODRA 3CHCA 4KQZA 4AY1A 2ZQUA 1B6CA 1FKIA 1J4HA 1LQ0A 3O5MA 3UI6A 2RUCA 2M08A 4JFMA 1X6LA 4Z2JA 3AROA 5HWCA 2AOSA 4ODOA 3BXWA 1LL7A 1ZCNA 1E6RA 2UZ5A 4LAYA 2G41A 3NTPA 2VN1A 5HUAA 3O5QA 1FKFA 3CGNA 3ARVA 3ARPA 4JFLA 2MPHA 1W9VA 3NRKA 3IKGA 3IHZA 5GPGA 3B7XA 2N87A 2PV1A 4DWSA 1ZU8A 1JNEA 4G2PA 3H9RB 4Z2KA 3ARQA 3AQUA 4DROA 3UF8A 1ZBWA 2ZQVA 2KO7A 3B9AA 3O5RA 4DWSD 2KR7A 2M1IA 1E6PA 2Q5AA 4DRKA 1HJWA 4J4NA 1HJXA 2MNTA 5HW8A 3VAWA 1ROTA 1ROUA 3KADA 3WL1A 1WB0A 4W9PA 3RM8A 4GIVA 3O5FA 4IT6A 1SYTA 1PBKA 1SR0A 1NWRA 1EYMA 1ITXA 4ODMA 2K8IA 1K9TA 1X6NA 2XP4A 1Q1CA 3CZ8A 1TFVA 1W1YA 4W9QA 4DRPA 1GPFA 1ZBKA 2LGOA 3LUOA 1EQ3A 3WIJA 3O5JA 1OGBA 3NI6A 1QPLA 1LG2A 1VF8A 1KT1A 3PRAA 1JVWA 4L72B 4JYSA 3TC5A 1D2KA 1HKMA 2XP9A 2Y78A 4DZ3A 3WKZA 5DIVA 1LG1A 2VCDA 4WIWA 4DRNA 3WD0A 4ITZA 1OGGA 1LJYA 3IKDA 2PV3A 1NWTA 1J4RA 1FJDA 4ZPVR 4LAVA 2XP7A 4HARA 1WNOA 3CHFA 1M5YA 3G6MA 1HKKA 2ZR4A 2D9FA 2DSUA 2ZR5A 4LAXA 1FKSA 1W9UA 4G50A 4ML4A 2DSZA 4MSPA 4LAWA 4MAVA 3CHDA 1N1AA 2KFWA 2O9OA 4W5UA 2RSEA 1FFRA 2WLYA 3O5LA 3UI5A 3WD4A 1D6OA 2LPVA 2RUQA 4U84A 4IQ2A 4DWSC 3RGCA 1FKHA 4Z2HA 5DIUA 1R9HA 2QF8A 3JYMA 3AS2A 3FY1A 3UI4A 4DRQA 1A7XA 5GPRA 2WLZA 3PR9A 2KE0A 4NZCA 1EDQA 4QT3A 5HW6A 2DG4A 5JH8A 3O5EA 2ESCA 1XRVA 4WK9A 3ARTA 3MDYB 2XP8A 2DPEA 1NSGA 1PINA 4ODLA 4O2TA 1W1PA 4TW8A 2KGJA 2PPNA 4DIPA 1LL6A 3AS1A 4S3JA 1UR9A 5DEZA 2MF9A 4C02B 4Z2GA 2F2DA 2MLYA 2ZR6A 5HTGA 4Z2LA 2MLZA 1D7IA 3KACA 1NWUA 4L3NA 3ARYA 1EHNA 1E6NA 1YW5A 1XHGA 2YBTA 3WD1A 5DO2A 1HKJA 4ZS6A 5B8IC 5DF0A 4TW7A 1J4IA 1E15A 4DRHA 5HT1A 1GUVA 2F21A 1Y0OA 4DZ2A 4FAPA 4DRIA 3CH9A 4DT4A 1D7JA 1ZL1A 2DT2A 4IPXA 2O92A 2XP5A 3KAIA 3PA7A 1C9HA 1ZK6A 1QPFA 4QZVB 1U79A 4ZPWR 2WK2A 4P8UA 1NMVA 1ZBVA 1T11A 3ARRA 4QT2A 3PRDA 3UQBA 2ITKA 3O5IA 3AS3A 3CHEA 2JZVA 4N19A 3TDBA 1W26A 4ODPA 5D75A 4ZPTR 4Q22A 1HXVA 1UR8A 2WM0A 1L1PA 1JNSA 1P5QA 3KAGA 5DITA 2FAPA 3B8SA 4WKFA 1Q6HA 2DSWA 3O5DA 3PRBA 3ARXA 3W4RA 1FAPA 4GGQA 3ALFA 4MPKA 4WKHA 3O5PA 3QOKA 1D7HA 4R0XA 2AWGA 4IT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ODN A;  1A7X A;  1JNT A;  4IQC A;  4W9P A;  2KE0 A;  4GIV A;  3O5F A;  4DRJ A;  2DG9 A;  1Q6I A;  4QT3 A;  5HW6 A;  2DG4 A;  1PBK A;  1J6Y A;  3EY6 A;  3O5E A;  3OOB A;  1EYM A;  4ODM A;  2XP3 A;  2K8I A;  3KAF A;  3MDY B;  2XP4 A;  5BXJ A;  5J6E A;  2XP8 A;  1FKL A;  1Q1C A;  4TNS A;  1NSG A;  3UQI A;  4FN2 A;  1PIN A;  4U86 A;  4ODL A;  4O2T A;  1FKR A;  4W9Q A;  4JFK A;  3I6C A;  2F4E A;  1FKG A;  4DRP A;  4TW8 A;  2KGJ A;  2ZQT A;  2PPN A;  4DIP A;  5HKG A;  2LGO A;  3LUO A;  1EQ3 A;  1BKF A;  1FKJ A;  2MLX A;  4TYO A;  3O5J A;  2IF4 A;  3RFW A;  3TCZ A;  2MF9 A;  4C02 B;  3NI6 A;  2OFN A;  3JXV A;  1QPL A;  2F2D A;  3KAH A;  3KZ7 A;  2MLY A;  2KI3 A;  5HWB A;  3KCE A;  2ZR6 A;  2ZQS A;  5HTG A;  2PPO A;  1KT1 A;  3KAB A;  2MLZ A;  1D7I A;  1JVW A;  1F40 A;  4JYS A;  3TC5 A;  3KAC A;  2RUR A;  1FKT A;  2XP9 A;  1YW5 A;  2Y78 A;  4DZ3 A;  3ODK A;  3IK8 A;  4QIB A;  1FKD A;  5DIV A;  2XPA A;  2LJ4 A;  2VCD A;  1FKK A;  2PPP A;  3GPK A;  4DRN A;  1TCO C;  4ITZ A;  5B8I C;  1FD9 A;  3IKD A;  4TW7 A;  1J4I A;  1KT0 A;  4DRH A;  2PV3 A;  4JFI A;  3WH0 A;  5HT1 A;  1J4R A;  3CGM A;  4ODQ A;  1FJD A;  4ODR A;  2FKE A;  2F21 A;  1Y0O A;  4J4O A;  4DZ2 A;  4LAV A;  2XP7 A;  2ZQU A;  2L2S A;  4DRI A;  4FAP A;  1B6C A;  1FKI A;  1J4H A;  2XP6 A;  3O5M A;  3UI6 A;  4DT4 A;  4NNR A;  3UQA A;  1D7J A;  2RUC A;  2M08 A;  2M2A A;  4JFM A;  2XPB A;  5HWC A;  4ODO A;  1QZ2 A;  2XP5 A;  4IPX A;  4DH0 A;  3KAI A;  3PA7 A;  3O5K A;  1C9H A;  1M5Y A;  1ZCN A;  1ZK6 A;  2UZ5 A;  3O5G A;  4LAY A;  3NTP A;  5I98 A;  1QPF A;  2VN1 A;  1U79 A;  4JFJ A;  5HUA A;  2DG3 A;  2ZR4 A;  1FKB A;  2D9F A;  3O5Q A;  1FKF A;  3CGN A;  2ZR5 A;  4JFL A;  2MPH A;  1NMV A;  4LAX A;  4W9O A;  1FKS A;  4TW6 A;  1T11 A;  3NRK A;  4G50 A;  4QT2 A;  4BF8 A;  3IKG A;  4MSP A;  3IHZ A;  5GPG A;  1F8A B;  3B7X A;  3PRD A;  2N87 A;  2PV1 A;  4LAW A;  3UQB A;  2ITK A;  1N1A A;  2KFW A;  2PV2 A;  3O5I A;  4G2P A;  3H9R B;  2RSE A;  2PBC A;  2JZV A;  1YAT A;  4N19 A;  3O5L A;  3TDB A;  1W26 A;  4ODP A;  3UF8 A;  5D75 A;  3UI5 A;  4DRO A;  2ZQV A;  2KO7 A;  1HXV A;  3JYJ A;  4TX0 A;  3O5R A;  1BL4 A;  1D6O A;  2LPV A;  2RUQ A;  4ODK A;  2RQS A;  4U84 A;  2KR7 A;  2M1I A;  1L1P A;  4U85 A;  2Q5A A;  4IQ2 A;  4DRK A;  5HW7 A;  1P5Q A;  1JNS A;  3KAG A;  3O5O A;  5DIT A;  4J4N A;  3RGC A;  2FAP A;  2MNT A;  5HW8 A;  3VAW A;  1Q6H A;  1FKH A;  3O5D A;  3PRB A;  5DIU A;  4DRM A;  1ROT A;  1R9H A;  1ROU A;  3JYM A;  1Q6U A;  3KAD A;  1FAP A;  4GGQ A;  3UI4 A;  4MGV A;  3O5P A;  1NMW A;  2RUD A;  4DRQ A;  3FAP A;  2LKN A;  1D7H A;  4R0X A;  2AWG A; 
#chains in the Genus database with same CATH topology
 1ZBC A;  4MTV A;  2PI6 A;  4IQC A;  2DSV A;  1E6Z A;  4LGX A;  3WL0 A;  2B5U B;  3OOB A;  2XP3 A;  3KAF A;  5BXJ A;  3ALG A;  4URI A;  5HBF A;  5J6E A;  1ZB5 A;  1FKL A;  3UQI A;  4FN2 A;  4U86 A;  1FKR A;  3ARU A;  4JFK A;  4R5E A;  2B31 A;  5HKG A;  1BKF A;  1FKJ A;  2IF4 A;  2YBU A;  3RFW A;  2OFN A;  3KZ7 A;  5HWB A;  2IUZ A;  3KCE A;  4WKA A;  2PPO A;  3KAB A;  1F40 A;  3RME A;  3ARW A;  4P8V A;  1EIB A;  3AS0 A;  4S3K A;  3ODK A;  3IK8 A;  1W1T A;  1FKD A;  3RM9 A;  1NWS A;  4KR0 B;  1TCO C;  1E9L A;  4JFI A;  4ODQ A;  2FKE A;  4J4O A;  1IX5 A;  2L2S A;  1JND A;  3WQW A;  2XP6 A;  4NNR A;  3UQA A;  2M2A A;  2XPB A;  4HBE A;  1QZ2 A;  4DH0 A;  3O5K A;  5I98 A;  3O5G A;  4JFJ A;  2DG3 A;  1H0G A;  1FKB A;  4P8W A;  4W9O A;  4TW6 A;  4BF8 A;  4MNL A;  1F8A B;  4P8X A;  2PV2 A;  4HBO A;  1LL4 A;  2PBC A;  4XAK A;  1W9P A;  1YAT A;  1H0I A;  3RM4 A;  3GU0 A;  3JYJ A;  4TX0 A;  1BL4 A;  4ODK A;  2RQS A;  3G6L A;  1HKI A;  4U85 A;  3ARZ A;  3WD3 A;  5HW7 A;  3O5O A;  3WD2 A;  2DT0 A;  4DRM A;  1O6I A;  1Q6U A;  1OWQ A;  4MGV A;  1NMW A;  3FAP A;  2RUD A;  2LKN A;  3TCZ A;  4ODN A;  4Q7N A;  1JNT A;  2FDM A;  3B9E A;  4MNM A;  4MNJ A;  4DRJ A;  2DG9 A;  1Q6I A;  4WJX A;  3B9D A;  1J6Y A;  3EY6 A;  2DT3 A;  1NH6 A;  2A3B A;  1KFW A;  4DWS B;  3OA5 A;  1HJV A;  4NSB A;  4TNS A;  1FFQ A;  3ARS A;  2DT1 A;  4Z2I A;  3I6C A;  2F4E A;  1FKG A;  2OLH A;  2ZQT A;  2A3A A;  4TYO A;  2MLX A;  1CTN A;  3FXY A;  3JXV A;  3KAH A;  2KI3 A;  1RD6 A;  2ZQS A;  2A3E A;  2G8Z A;  3WQV A;  2RUR A;  1FKT A;  2A3C A;  1W1V A;  1GOI A;  4QIB A;  5GQB A;  4PTM A;  1WAW A;  2XPA A;  2LJ4 A;  1FKK A;  2PPP A;  3GPK A;  4MNK A;  1FD9 A;  1KT0 A;  3WH0 A;  3CGM A;  4ODR A;  3CHC A;  4KQZ A;  4AY1 A;  2ZQU A;  1B6C A;  1FKI A;  1J4H A;  1LQ0 A;  3O5M A;  3UI6 A;  3BMB A;  2RUC A;  2M08 A;  4JFM A;  1X6L A;  4Z2J A;  3ARO A;  5HWC A;  2AOS A;  4ODO A;  3BXW A;  1LL7 A;  1ZCN A;  1E6R A;  2UZ5 A;  4LAY A;  2G41 A;  3NTP A;  4UDM A;  2VN1 A;  5HUA A;  3O5Q A;  1FKF A;  3CGN A;  3ARV A;  3ARP A;  4JFL A;  2MPH A;  1W9V A;  3NRK A;  3IKG A;  3IHZ A;  5GPG A;  3B7X A;  2N87 A;  2PV1 A;  4DWS A;  1ZU8 A;  1JNE A;  4G2P A;  3H9R B;  4Z2K A;  3ARQ A;  3AQU A;  2P4V A;  4DRO A;  3UF8 A;  1ZBW A;  2ZQV A;  2KO7 A;  3B9A A;  3O5R A;  4DWS D;  2KR7 A;  2M1I A;  1E6P A;  2Q5A A;  4DRK A;  1HJW A;  4J4N A;  1HJX A;  2MNT A;  5HW8 A;  3VAW A;  1ROT A;  1ROU A;  3KAD A;  3WL1 A;  1WB0 A;  4W9P A;  3RM8 A;  4GIV A;  3O5F A;  4IT6 A;  1SYT A;  1PBK A;  1SR0 A;  1NWR A;  1EYM A;  1ITX A;  4ODM A;  2K8I A;  1K9T A;  1X6N A;  2XP4 A;  1Q1C A;  3CZ8 A;  1TFV A;  1W1Y A;  4W9Q A;  4DRP A;  2F23 A;  1GPF A;  1ZBK A;  2LGO A;  3LUO A;  1EQ3 A;  3WIJ A;  3O5J A;  1OGB A;  3NI6 A;  1QPL A;  1LG2 A;  1VF8 A;  1KT1 A;  3PRA A;  1JVW A;  4L72 B;  4JYS A;  3TC5 A;  1D2K A;  1HKM A;  2XP9 A;  2Y78 A;  4DZ3 A;  3WKZ A;  5DIV A;  1LG1 A;  2EUL A;  2VCD A;  4WIW A;  4DRN A;  3WD0 A;  4ITZ A;  1OGG A;  1LJY A;  3IKD A;  2PV3 A;  1NWT A;  1J4R A;  1FJD A;  4ZPV R;  4LAV A;  2XP7 A;  1JCH B;  4HAR A;  1WNO A;  3CHF A;  1M5Y A;  3G6M A;  1HKK A;  2ZR4 A;  2D9F A;  2DSU A;  2ZR5 A;  4LAX A;  1FKS A;  1W9U A;  4G50 A;  4ML4 A;  2DSZ A;  4MSP A;  4LAW A;  4MAV A;  3CHD A;  1N1A A;  2KFW A;  2O9O A;  4W5U A;  2RSE A;  1FFR A;  2WLY A;  3O5L A;  3UI5 A;  3WD4 A;  1D6O A;  2LPV A;  2RUQ A;  4U84 A;  4IQ2 A;  4DWS C;  3RGC A;  1FKH A;  4Z2H A;  5DIU A;  1R9H A;  2QF8 A;  3JYM A;  3AS2 A;  3FY1 A;  3UI4 A;  4DRQ A;  1A7X A;  5GPR A;  2WLZ A;  3PR9 A;  2KE0 A;  4NZC A;  1EDQ A;  4QT3 A;  5HW6 A;  2DG4 A;  5JH8 A;  3O5E A;  2ESC A;  1XRV A;  4WK9 A;  3ART A;  3MDY B;  2XP8 A;  2DPE A;  1NSG A;  1PIN A;  1E44 A;  4ODL A;  4O2T A;  3GTY X;  1W1P A;  4TW8 A;  2KGJ A;  2PPN A;  4DIP A;  1LL6 A;  3AS1 A;  4S3J A;  1UR9 A;  5DEZ A;  2MF9 A;  4C02 B;  4Z2G A;  2F2D A;  2MLY A;  2ZR6 A;  5HTG A;  4Z2L A;  2MLZ A;  1D7I A;  3KAC A;  1NWU A;  1GRJ A;  4L3N A;  3ARY A;  1EHN A;  1E6N A;  1YW5 A;  1XHG A;  2YBT A;  3WD1 A;  5DO2 A;  1HKJ A;  4ZS6 A;  5B8I C;  5DF0 A;  4TW7 A;  1J4I A;  1E15 A;  4DRH A;  5HT1 A;  1GUV A;  2F21 A;  1Y0O A;  4DZ2 A;  4FAP A;  4DRI A;  3CH9 A;  4DT4 A;  1D7J A;  1ZL1 A;  2DT2 A;  3EIP A;  2ETN A;  2O92 A;  2XP5 A;  4IPX A;  3KAI A;  3PA7 A;  1C9H A;  1ZK6 A;  1QPF A;  4QZV B;  1U79 A;  4ZPW R;  2WK2 A;  4P8U A;  1NMV A;  2PN0 A;  1ZBV A;  1T11 A;  3ARR A;  4QT2 A;  3PRD A;  3UQB A;  2ITK A;  3O5I A;  3AS3 A;  3CHE A;  2JZV A;  4N19 A;  3TDB A;  1W26 A;  4ODP A;  5D75 A;  4ZPT R;  4Q22 A;  1HXV A;  1UR8 A;  2WM0 A;  1L1P A;  1JNS A;  1P5Q A;  3KAG A;  5DIT A;  2FAP A;  3B8S A;  4WKF A;  1Q6H A;  2DSW A;  3O5D A;  3PRB A;  3ARX A;  3W4R A;  1FAP A;  4GGQ A;  3ALF A;  4MPK A;  4WKH A;  3O5P A;  3QOK A;  1D7H A;  4R0X A;  2AWG A;  4IT4 A; 
#chains in the Genus database with same CATH homology
 1ZBC A;  4MTV A;  2PI6 A;  4IQC A;  2DSV A;  1E6Z A;  4LGX A;  3WL0 A;  3OOB A;  2XP3 A;  3KAF A;  5BXJ A;  3ALG A;  4URI A;  5HBF A;  5J6E A;  1ZB5 A;  1FKL A;  3UQI A;  4FN2 A;  4U86 A;  1FKR A;  3ARU A;  4JFK A;  4R5E A;  2B31 A;  5HKG A;  1BKF A;  1FKJ A;  2IF4 A;  2YBU A;  3RFW A;  2OFN A;  3KZ7 A;  5HWB A;  2IUZ A;  3KCE A;  4WKA A;  2PPO A;  3KAB A;  1F40 A;  3RME A;  3ARW A;  4P8V A;  1EIB A;  3AS0 A;  4S3K A;  3ODK A;  3IK8 A;  1W1T A;  1FKD A;  3RM9 A;  1NWS A;  4KR0 B;  1TCO C;  1E9L A;  4JFI A;  4ODQ A;  2FKE A;  4J4O A;  1IX5 A;  2L2S A;  1JND A;  3WQW A;  2XP6 A;  4NNR A;  3UQA A;  2M2A A;  2XPB A;  4HBE A;  1QZ2 A;  4DH0 A;  3O5K A;  5I98 A;  3O5G A;  4JFJ A;  2DG3 A;  1H0G A;  1FKB A;  4P8W A;  4W9O A;  4TW6 A;  4BF8 A;  4MNL A;  1F8A B;  4P8X A;  2PV2 A;  4HBO A;  1LL4 A;  2PBC A;  4XAK A;  1W9P A;  1YAT A;  1H0I A;  3RM4 A;  3JYJ A;  4TX0 A;  1BL4 A;  4ODK A;  2RQS A;  3G6L A;  1HKI A;  4U85 A;  3ARZ A;  3WD3 A;  5HW7 A;  3O5O A;  3WD2 A;  2DT0 A;  4DRM A;  1O6I A;  1Q6U A;  1OWQ A;  4MGV A;  1NMW A;  3FAP A;  2RUD A;  2LKN A;  3TCZ A;  4ODN A;  4Q7N A;  1JNT A;  2FDM A;  3B9E A;  4MNM A;  4MNJ A;  4DRJ A;  2DG9 A;  1Q6I A;  4WJX A;  3B9D A;  1J6Y A;  3EY6 A;  2DT3 A;  1NH6 A;  2A3B A;  1KFW A;  4DWS B;  3OA5 A;  1HJV A;  4NSB A;  4TNS A;  1FFQ A;  3ARS A;  2DT1 A;  4Z2I A;  3I6C A;  2F4E A;  1FKG A;  2OLH A;  2ZQT A;  2A3A A;  4TYO A;  2MLX A;  1CTN A;  3FXY A;  3JXV A;  3KAH A;  2KI3 A;  1RD6 A;  2ZQS A;  2A3E A;  2G8Z A;  3WQV A;  2RUR A;  1FKT A;  2A3C A;  1W1V A;  1GOI A;  4QIB A;  5GQB A;  4PTM A;  1WAW A;  2XPA A;  2LJ4 A;  1FKK A;  2PPP A;  3GPK A;  4MNK A;  1FD9 A;  1KT0 A;  3WH0 A;  3CGM A;  4ODR A;  3CHC A;  4KQZ A;  4AY1 A;  2ZQU A;  1B6C A;  1FKI A;  1J4H A;  1LQ0 A;  3O5M A;  3UI6 A;  2RUC A;  2M08 A;  4JFM A;  1X6L A;  4Z2J A;  3ARO A;  5HWC A;  2AOS A;  4ODO A;  3BXW A;  1LL7 A;  1ZCN A;  1E6R A;  2UZ5 A;  4LAY A;  2G41 A;  3NTP A;  2VN1 A;  5HUA A;  3O5Q A;  1FKF A;  3CGN A;  3ARV A;  3ARP A;  4JFL A;  2MPH A;  1W9V A;  3NRK A;  3IKG A;  3IHZ A;  5GPG A;  3B7X A;  2N87 A;  2PV1 A;  4DWS A;  1ZU8 A;  1JNE A;  4G2P A;  3H9R B;  4Z2K A;  3ARQ A;  3AQU A;  4DRO A;  3UF8 A;  1ZBW A;  2ZQV A;  2KO7 A;  3B9A A;  3O5R A;  4DWS D;  2KR7 A;  2M1I A;  1E6P A;  2Q5A A;  4DRK A;  1HJW A;  4J4N A;  1HJX A;  2MNT A;  5HW8 A;  3VAW A;  1ROT A;  1ROU A;  3KAD A;  3WL1 A;  1WB0 A;  4W9P A;  3RM8 A;  4GIV A;  3O5F A;  4IT6 A;  1SYT A;  1PBK A;  1SR0 A;  1NWR A;  1EYM A;  1ITX A;  4ODM A;  2K8I A;  1K9T A;  1X6N A;  2XP4 A;  1Q1C A;  3CZ8 A;  1TFV A;  1W1Y A;  4W9Q A;  4DRP A;  1GPF A;  1ZBK A;  2LGO A;  3LUO A;  1EQ3 A;  3WIJ A;  3O5J A;  1OGB A;  3NI6 A;  1QPL A;  1LG2 A;  1VF8 A;  1KT1 A;  3PRA A;  1JVW A;  4L72 B;  4JYS A;  3TC5 A;  1D2K A;  1HKM A;  2XP9 A;  2Y78 A;  4DZ3 A;  3WKZ A;  5DIV A;  1LG1 A;  2VCD A;  4WIW A;  4DRN A;  3WD0 A;  4ITZ A;  1OGG A;  1LJY A;  3IKD A;  2PV3 A;  1NWT A;  1J4R A;  1FJD A;  4ZPV R;  4LAV A;  2XP7 A;  4HAR A;  1WNO A;  3CHF A;  1M5Y A;  3G6M A;  1HKK A;  2ZR4 A;  2D9F A;  2DSU A;  2ZR5 A;  4LAX A;  1FKS A;  1W9U A;  4G50 A;  4ML4 A;  2DSZ A;  4MSP A;  4LAW A;  4MAV A;  3CHD A;  1N1A A;  2KFW A;  2O9O A;  4W5U A;  2RSE A;  1FFR A;  2WLY A;  3O5L A;  3UI5 A;  3WD4 A;  1D6O A;  2LPV A;  2RUQ A;  4U84 A;  4IQ2 A;  4DWS C;  3RGC A;  1FKH A;  4Z2H A;  5DIU A;  1R9H A;  2QF8 A;  3JYM A;  3AS2 A;  3FY1 A;  3UI4 A;  4DRQ A;  1A7X A;  5GPR A;  2WLZ A;  3PR9 A;  2KE0 A;  4NZC A;  1EDQ A;  4QT3 A;  5HW6 A;  2DG4 A;  5JH8 A;  3O5E A;  2ESC A;  1XRV A;  4WK9 A;  3ART A;  3MDY B;  2XP8 A;  2DPE A;  1NSG A;  1PIN A;  4ODL A;  4O2T A;  1W1P A;  4TW8 A;  2KGJ A;  2PPN A;  4DIP A;  1LL6 A;  3AS1 A;  4S3J A;  1UR9 A;  5DEZ A;  2MF9 A;  4C02 B;  4Z2G A;  2F2D A;  2MLY A;  2ZR6 A;  5HTG A;  4Z2L A;  2MLZ A;  1D7I A;  3KAC A;  1NWU A;  4L3N A;  3ARY A;  1EHN A;  1E6N A;  1YW5 A;  1XHG A;  2YBT A;  3WD1 A;  5DO2 A;  1HKJ A;  4ZS6 A;  5B8I C;  5DF0 A;  4TW7 A;  1J4I A;  1E15 A;  4DRH A;  5HT1 A;  1GUV A;  2F21 A;  1Y0O A;  4DZ2 A;  4FAP A;  4DRI A;  3CH9 A;  4DT4 A;  1D7J A;  1ZL1 A;  2DT2 A;  4IPX A;  2O92 A;  2XP5 A;  3KAI A;  3PA7 A;  1C9H A;  1ZK6 A;  1QPF A;  4QZV B;  1U79 A;  4ZPW R;  2WK2 A;  4P8U A;  1NMV A;  1ZBV A;  1T11 A;  3ARR A;  4QT2 A;  3PRD A;  3UQB A;  2ITK A;  3O5I A;  3AS3 A;  3CHE A;  2JZV A;  4N19 A;  3TDB A;  1W26 A;  4ODP A;  5D75 A;  4ZPT R;  4Q22 A;  1HXV A;  1UR8 A;  2WM0 A;  1L1P A;  1JNS A;  1P5Q A;  3KAG A;  5DIT A;  2FAP A;  3B8S A;  4WKF A;  1Q6H A;  2DSW A;  3O5D A;  3PRB A;  3ARX A;  3W4R A;  1FAP A;  4GGQ A;  3ALF A;  4MPK A;  4WKH A;  3O5P A;  3QOK A;  1D7H A;  4R0X A;  2AWG A;  4IT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...