1FKDA

Fk-506 binding protein: three-dimensional structure of the complex with the antagonist l-685,818
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 BINDING PROTEIN
publication title FK-506-binding protein: three-dimensional structure of the complex with the antagonist L-685,818.
pubmed rcsb
source organism Homo sapiens
molecule tags Cis-trans isomerase
total genus 25
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1992-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkdA00
1QPFA 1J4IA 3KAFA 4JFLA 1KT1A 3PA7A 1PINA 1PBKA 1A7XA 2FAPA 3I6CA 2M2AA 2PBCA 3UQAA 3CGMA 5HUAA 4ODPA 1P5QA 3KABA 4JFJA 3RFWA 1FKLA 3NRKA 4R0XA 1ZCNA 2K8IA 3LUOA 1J4HA 1L1PA 1D7HA 1C9HA 1FKGA 3O5MA 4JYSA 3O5QA 4ODLA 3IKGA 1TCOC 4DRMA 4ODKA 2Q5AA 2FKEA 2L2SA 2PV3A 4C02B 1FJDA 4DIPA 2RUDA 2AWGA 3WH0A 5HW7A 4DH0A 5BXJA 3UQIA 3KZ7A 4ODRA 5HTGA 4LAYA 1ZK6A 1KT0A 4N19A 2D9FA 2XPBA 4TNSA 5D75A 5DIUA 4U86A 2DG3A 3PRDA 4ODNA 3O5GA 4FN2A 4DRPA 4DT4A 1FKTA 5HT1A 2KI3A 3O5JA 4IQ2A 2MNTA 3B7XA 1N1AA 2F4EA 3KAGA 2LPVA 2DG9A 3O5KA 3TCZA 3UQBA 4TW8A 3OOBA 1FAPA 2XPAA 3IKDA 2RUQA 2RUCA 4TW7A 1NSGA 4ODOA 2KE0A 1J4RA 1R9HA 1Q6IA 3FAPA 4DRJA 3TC5A 1FKIA 4MGVA 1EYMA 2KO7A 1QZ2A 4O2TA 4GGQA 4BF8A 1J6YA 1B6CA 1YATA 2LJ4A 2XP5A 2JZVA 2UZ5A 2XP4A 2ZQUA 3ODKA 4LAVA 4DROA 2MLYA 4U85A 2XP7A 1Q1CA 5HWBA 2XP8A 4FAPA 4IPXA 4DZ2A 1HXVA 4TW6A 4DRQA 4DRNA 3JYMA 4G50A 3NTPA 1BL4A 4DRKA 2M08A 1FKHA 2PV1A 2ZQSA 4GIVA 3CGNA 3EY6A 2IF4A 4DZ3A 2RURA 5B8IC 3KACA 1FKFA 1Q6HA 3UI6A 2ZQTA 4J4OA 4JFMA 1FKSA 3MDYB 4TYOA 2VN1A 1M5YA 5HWCA 1EQ3A 1FKDA 3O5FA 4MSPA 3KAHA 4QT2A 2RSEA 3H9RB 4J4NA 2OFNA 3O5EA 1ROTA 2PPNA 3IK8A 4JFKA 2Y78A 4ODQA 3O5DA 5HW8A 3O5PA 1F40A 5DIVA 4DRHA 1D7JA 2ZR5A 1ROUA 4QIBA 1FD9A 2MF9A 1JNTA 2ZR4A 4G2PA 2MLXA 2KGJA 3O5RA 2XP9A 2PPPA 2F2DA 1YW5A 4LAWA 2RQSA 2DG4A 2VCDA 1JNSA 2MPHA 5GPGA 1Y0OA 2MLZA 2PPOA 3NI6A 2KFWA 3JXVA 3KADA 2PV2A 2ITKA 3O5OA 4TX0A 1NMWA 2F21A 4W9OA 4W9PA 1FKKA 4DRIA 5HKGA 1D7IA 2LGOA 4IQCA 5J6EA 2KR7A 2XP3A 3UI5A 2XP6A 1T11A 3O5IA 1BKFA 1F8AB 1FKJA 2N87A 3RGCA 3VAWA 4QT3A 5I98A 3GPKA 5DITA 3IHZA 3O5LA 1D6OA 1Q6UA 3KCEA 3TDBA 2M1IA 3JYJA 1FKBA 4ITZA 4LAXA 2ZQVA 4U84A 3UI4A 1QPLA 3PRBA 2LKNA 3UF8A 4ODMA 4W9QA 5HW6A 1JVWA 4NNRA 1NMVA 1W26A 4JFIA 1FKRA 2ZR6A 1U79A 3KAIA
chains in the Genus database with same CATH superfamily
1E6RA 4LGXA 2YBUA 3CZ8A 3I6CA 3ARYA 2M2AA 3ARXA 3ARRA 3RFWA 1FKLA 1ZCNA 1J4HA 1D7HA 3CHFA 3WD0A 2FKEA 2L2SA 4NZCA 1FJDA 1K9TA 3WH0A 2YBTA 4HBEA 3FXYA 2A3BA 4ODRA 3UQIA 1ZK6A 1KT0A 4PTMA 4U86A 3PRDA 2DT3A 3AS2A 4DRPA 4WKHA 3O5JA 1EIBA 5DF0A 3GU0A 2MNTA 3B9AA 1E44A 3TCZA 2O9OA 3O5KA 3OA5A 1ZU8A 1J4RA 2WLYA 1ZBWA 1E6ZA 2WK2A 4O2TA 2A3CA 4AY1A 1H0GA 1OWQA 1Q1CA 1ZBKA 2IUZA 3JYMA 4DRKA 1FKHA 4HBOA 2EULA 5B8IC 1FKSA 5GPRA 1HKKA 1W9UA 1EQ3A 1FKDA 4MSPA 2FDMA 1LL4A 1FFRA 1H0IA 1HKJA 1W1VA 3IK8A 2Y78A 3BXWA 3O5DA 3O5PA 4Z2GA 5DIVA 3WQWA 1D7JA 2DT2A 4QIBA 2ZR4A 2PPPA 1ITXA 1JNSA 2MPHA 3ALFA 1ZBVA 2B5UB 4NSBA 3NI6A 4L72B 2ITKA 3G6LA 4W9OA 1LL7A 1D7IA 4IQCA 4P8XA 2KR7A 3ARVA 3O5IA 3RGCA 3VAWA 1JNDA 1D6OA 3KCEA 3O5LA 4U84A 1X6LA 3UI4A 4WK9A 1QPLA 1KFWA 3UF8A 1UR9A 3ARTA 1U79A 3G6MA 3BMBA 1GPFA 4JFLA 1KT1A 1TFVA 1P5QA 4JFJA 3WD4A 2K8IA 3ALGA 4MNJA 1C9HA 4JYSA 4DRMA 4ODKA 4C02B 4DIPA 2AWGA 3ARUA 3ARZA 5HW7A 3WKZA 1X6NA 5HTGA 3KZ7A 1W1YA 2DG3A 4DT4A 1FKTA 3B7XA 4DWSD 3KAGA 2LPVA 2DG9A 4TW8A 2RUQA 1EDQA 1NSGA 2QF8A 1Q6IA 3WIJA 4DRJA 3TC5A 1FKIA 4MGVA 4P8UA 4Z2KA 2A3EA 2DSVA 1J6YA 1B6CA 2ZQUA 1GUVA 1LG2A 1SR0A 4KQZA 5HBFA 4FAPA 4DZ2A 4DRQA 1JNEA 4DRNA 3RMEA 3NTPA 2M08A 4MAVA 4GIVA 3WQVA 2O92A 2G41A 1E6PA 2RURA 4QZVB 1Q6HA 4JFMA 1ZL1A 3MDYB 4TYOA 2VN1A 5HWCA 1W9PA 3KAHA 3PR9A 3H9RB 4JFKA 1F40A 5HW8A 4L3NA 2DT0A 4KR0B 1JNTA 4IT4A 2MLXA 2XP9A 4LAWA 2DG4A 1ZB5A 2AOSA 1NWSA 1Y0OA 4ZPWR 2P4VA 2ETNA 1O6IA 1WNOA 3JXVA 1NMWA 2F21A 3RM8A 4DRIA 2LGOA 2XP3A 4S3KA 1VF8A 1T11A 1BKFA 2N87A 4QT3A 1NWTA 1E6NA 2A3AA 4ODMA 4NNRA 1FKRA 2ZR6A 1CTNA 4DZ3A 1J4IA 2PBCA 1E9LA 3KABA 3ARSA 4Z2HA 1L1PA 5DO2A 3O5MA 2G8ZA 3IKGA 1TCOC 1LL6A 3CHDA 2DT1A 5BXJA 2D9FA 2XPBA 4TNSA 5D75A 3ARPA 1HKMA 4FN2A 4Z2LA 4P8WA 5HT1A 5JH8A 2KI3A 3GTYX 4IQ2A 1N1AA 3UQBA 5DEZA 3WD3A 1FAPA 3IKDA 1XHGA 1R9HA 2KE0A 1EYMA 2PN0A 1HJWA 1HJVA 1YATA 2LJ4A 2XP5A 3ODKA 4LAVA 2MLYA 2WLZA 1SYTA 5HWBA 1HXVA 2DSZA 4TW6A 3CGNA 2IF4A 4MNMA 3KACA 1FKFA 4ZPTR 3W4RA 1M5YA 1HKIA 2WM0A 3PRAA 4DWSA 3O5FA 1NWRA 1D2KA 4J4NA 4ZPVR 2OFNA 4ODQA 3AS1A 1ZBCA 2MF9A 4G2PA 2KGJA 3O5RA 4DWSB 2F2DA 2RQSA 4R5EA 3EIPA 1W1TA 5GPGA 2PI6A 4IT6A 4ML4A 5GQBA 2MLZA 3O5OA 2KFWA 4TX0A 1FKKA 4URIA 5HKGA 4W5UA 1RD6A 3CH9A 5J6EA 3UI5A 1JCHB 1FKJA 5DITA 3IHZA 1Q6UA 2B31A 3TDBA 2M1IA 4ITZA 1FKBA 4WJXA 1NMVA 3AROA 2DSWA 1QPFA 1UR8A 4Q7NA 4XAKA 3KAFA 3RM9A 3PA7A 4MNKA 1PINA 1PBKA 3WD1A 1A7XA 2FAPA 3UQAA 3CGMA 5HUAA 1WAWA 2F23A 4ODPA 4Z2IA 3NRKA 4R0XA 3LUOA 1FKGA 3O5QA 4ODLA 2Q5AA 2PV3A 2RUDA 4DH0A 1W1PA 4S3JA 1GRJA 4LAYA 4N19A 5DIUA 1FFQA 1GOIA 3CHEA 4ODNA 3O5GA 1HJXA 4HARA 1E15A 2F4EA 3ARQA 4UDMA 3OOBA 3WL1A 1IX5A 1LQ0A 3RM4A 2XPAA 2DSUA 4MTVA 2RUCA 4TW7A 4ODOA 3FAPA 4DWSC 2ESCA 2KO7A 1OGBA 1QZ2A 4BF8A 4GGQA 4Z2JA 2JZVA 2UZ5A 2XP4A 3ARWA 3WL0A 4DROA 4U85A 2XP7A 2XP8A 3B9EA 4IPXA 1LJYA 1WB0A 4G50A 1BL4A 2PV1A 2ZQSA 4P8VA 3EY6A 4MPKA 1NH6A 3UI6A 2ZQTA 4J4OA 3B9DA 4MNLA 4QT2A 2RSEA 3QOKA 3B8SA 1LG1A 3O5EA 1ROTA 2PPNA 4WKFA 1EHNA 4DRHA 2ZR5A 1ROUA 1FD9A 1YW5A 2DPEA 1W9VA 2VCDA 1XRVA 1NWUA 3AS0A 2PPOA 3KADA 3FY1A 2PV2A 3WD2A 2OLHA 4W9PA 4WKAA 2XP6A 4Q22A 5I98A 1F8AB 4ZS6A 3CHCA 3GPKA 4WIWA 3AQUA 4LAXA 3JYJA 2ZQVA 3PRBA 2LKNA 4W9QA 1OGGA 1JVWA 5HW6A 4JFIA 1W26A 3AS3A 3KAIA
chains in the Genus database with same CATH topology
1E6RA 4LGXA 2YBUA 3CZ8A 3I6CA 3ARYA 2M2AA 3ARXA 3ARRA 3RFWA 1FKLA 1ZCNA 1J4HA 1D7HA 3CHFA 3WD0A 2FKEA 2L2SA 4NZCA 1FJDA 1K9TA 3WH0A 2YBTA 4HBEA 3FXYA 2A3BA 4ODRA 3UQIA 1ZK6A 1KT0A 4PTMA 4U86A 3PRDA 2DT3A 3AS2A 4DRPA 4WKHA 3O5JA 1EIBA 5DF0A 2MNTA 3B9AA 3TCZA 2O9OA 3O5KA 3OA5A 1ZU8A 1J4RA 2WLYA 1ZBWA 1E6ZA 2WK2A 4O2TA 2A3CA 4AY1A 1H0GA 1OWQA 1Q1CA 1ZBKA 2IUZA 3JYMA 4DRKA 1FKHA 4HBOA 5B8IC 1FKSA 5GPRA 1HKKA 1W9UA 1EQ3A 1FKDA 4MSPA 2FDMA 1LL4A 1FFRA 1H0IA 1HKJA 1W1VA 3IK8A 2Y78A 3BXWA 3O5DA 3O5PA 4Z2GA 5DIVA 3WQWA 1D7JA 2DT2A 4QIBA 2ZR4A 2PPPA 1ITXA 1JNSA 2MPHA 3ALFA 1ZBVA 4NSBA 3NI6A 4L72B 2ITKA 3G6LA 4W9OA 1LL7A 1D7IA 4IQCA 4P8XA 2KR7A 3ARVA 3O5IA 3RGCA 3VAWA 3O5LA 1JNDA 1D6OA 3KCEA 4U84A 1X6LA 3UI4A 4WK9A 1QPLA 1KFWA 3UF8A 1UR9A 3ARTA 1U79A 3G6MA 1GPFA 4JFLA 1KT1A 1TFVA 1P5QA 4JFJA 3WD4A 2K8IA 3ALGA 4MNJA 1C9HA 4JYSA 4DRMA 4ODKA 4C02B 4DIPA 2AWGA 3ARUA 3ARZA 5HW7A 3WKZA 1X6NA 5HTGA 3KZ7A 1W1YA 2DG3A 4DT4A 1FKTA 3B7XA 4DWSD 3KAGA 2LPVA 2DG9A 4TW8A 2RUQA 1EDQA 1NSGA 2QF8A 1Q6IA 3WIJA 4DRJA 3TC5A 1FKIA 4MGVA 4P8UA 4Z2KA 2A3EA 2DSVA 1J6YA 1B6CA 2ZQUA 1GUVA 1LG2A 1SR0A 4KQZA 5HBFA 4FAPA 4DZ2A 4DRQA 1JNEA 4DRNA 3RMEA 3NTPA 2M08A 4MAVA 4GIVA 3WQVA 2O92A 2G41A 1E6PA 2RURA 4QZVB 1Q6HA 4JFMA 1ZL1A 3MDYB 4TYOA 2VN1A 5HWCA 1W9PA 3KAHA 3PR9A 3H9RB 4JFKA 1F40A 5HW8A 4L3NA 2DT0A 4KR0B 1JNTA 4IT4A 2MLXA 2XP9A 4LAWA 2DG4A 1ZB5A 2AOSA 1NWSA 1Y0OA 4ZPWR 1O6IA 1WNOA 3JXVA 1NMWA 2F21A 3RM8A 4DRIA 2LGOA 2XP3A 4S3KA 1VF8A 1T11A 1BKFA 2N87A 4QT3A 1NWTA 1E6NA 2A3AA 4ODMA 4NNRA 1FKRA 2ZR6A 1CTNA 4DZ3A 1J4IA 2PBCA 1E9LA 3KABA 3ARSA 4Z2HA 1L1PA 5DO2A 3O5MA 2G8ZA 3IKGA 1TCOC 1LL6A 3CHDA 2DT1A 5BXJA 2D9FA 2XPBA 4TNSA 5D75A 3ARPA 1HKMA 4FN2A 4Z2LA 4P8WA 5HT1A 5JH8A 2KI3A 4IQ2A 1N1AA 3UQBA 5DEZA 3WD3A 1FAPA 3IKDA 1XHGA 1R9HA 2KE0A 1EYMA 1HJWA 1HJVA 1YATA 2LJ4A 2XP5A 3ODKA 4LAVA 2MLYA 2WLZA 1SYTA 5HWBA 1HXVA 2DSZA 4TW6A 3CGNA 2IF4A 4MNMA 3KACA 1FKFA 4ZPTR 3W4RA 1M5YA 1HKIA 2WM0A 3PRAA 4DWSA 3O5FA 1NWRA 1D2KA 4J4NA 4ZPVR 2OFNA 4ODQA 3AS1A 1ZBCA 2MF9A 4G2PA 2KGJA 3O5RA 4DWSB 2F2DA 2RQSA 4R5EA 1W1TA 5GPGA 2PI6A 4IT6A 4ML4A 5GQBA 2MLZA 3O5OA 2KFWA 4TX0A 1FKKA 4URIA 5HKGA 4W5UA 1RD6A 3CH9A 5J6EA 3UI5A 1FKJA 5DITA 3IHZA 1Q6UA 2B31A 3TDBA 2M1IA 4ITZA 1FKBA 4WJXA 1NMVA 3AROA 2DSWA 1QPFA 1UR8A 4Q7NA 4XAKA 3KAFA 3RM9A 3PA7A 4MNKA 1PINA 1PBKA 3WD1A 1A7XA 2FAPA 3UQAA 3CGMA 5HUAA 1WAWA 4ODPA 4Z2IA 3NRKA 4R0XA 3LUOA 1FKGA 3O5QA 4ODLA 2Q5AA 2PV3A 2RUDA 4DH0A 1W1PA 4S3JA 4LAYA 4N19A 5DIUA 1FFQA 1GOIA 3CHEA 4ODNA 3O5GA 1HJXA 4HARA 1E15A 2F4EA 3ARQA 3OOBA 3WL1A 1IX5A 1LQ0A 3RM4A 2XPAA 2DSUA 4MTVA 2RUCA 4TW7A 4ODOA 3FAPA 4DWSC 2ESCA 2KO7A 1OGBA 1QZ2A 4BF8A 4GGQA 4Z2JA 2JZVA 2UZ5A 2XP4A 3ARWA 3WL0A 4DROA 4U85A 2XP7A 2XP8A 3B9EA 4IPXA 1LJYA 1WB0A 4G50A 1BL4A 2PV1A 2ZQSA 4P8VA 3EY6A 4MPKA 1NH6A 3UI6A 2ZQTA 4J4OA 3B9DA 4MNLA 4QT2A 2RSEA 3QOKA 3B8SA 1LG1A 3O5EA 1ROTA 2PPNA 4WKFA 1EHNA 4DRHA 2ZR5A 1ROUA 1FD9A 1YW5A 2DPEA 1W9VA 2VCDA 1XRVA 1NWUA 3AS0A 2PPOA 3KADA 3FY1A 2PV2A 3WD2A 2OLHA 4W9PA 4WKAA 2XP6A 4Q22A 5I98A 1F8AB 4ZS6A 3CHCA 3GPKA 4WIWA 3AQUA 4LAXA 3JYJA 2ZQVA 3PRBA 2LKNA 4W9QA 1OGGA 1JVWA 5HW6A 4JFIA 1W26A 3AS3A 3KAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QPF A;  1J4I A;  3KAF A;  4JFL A;  1KT1 A;  3PA7 A;  1PIN A;  1PBK A;  1A7X A;  2FAP A;  3I6C A;  2M2A A;  2PBC A;  3UQA A;  3CGM A;  5HUA A;  4ODP A;  1P5Q A;  3KAB A;  4JFJ A;  3RFW A;  1FKL A;  3NRK A;  4R0X A;  1ZCN A;  2K8I A;  3LUO A;  1J4H A;  1L1P A;  1D7H A;  1C9H A;  1FKG A;  3O5M A;  4JYS A;  3O5Q A;  4ODL A;  3IKG A;  1TCO C;  4DRM A;  4ODK A;  2Q5A A;  2FKE A;  2L2S A;  2PV3 A;  4C02 B;  1FJD A;  4DIP A;  2RUD A;  2AWG A;  3WH0 A;  5HW7 A;  4DH0 A;  5BXJ A;  3UQI A;  3KZ7 A;  4ODR A;  5HTG A;  4LAY A;  1ZK6 A;  1KT0 A;  4N19 A;  2D9F A;  2XPB A;  4TNS A;  5D75 A;  5DIU A;  4U86 A;  2DG3 A;  3PRD A;  4ODN A;  3O5G A;  4FN2 A;  4DRP A;  4DT4 A;  1FKT A;  5HT1 A;  2KI3 A;  3O5J A;  4IQ2 A;  2MNT A;  3B7X A;  1N1A A;  2F4E A;  3KAG A;  2LPV A;  2DG9 A;  3O5K A;  3TCZ A;  3UQB A;  4TW8 A;  3OOB A;  1FAP A;  2XPA A;  3IKD A;  2RUQ A;  2RUC A;  4TW7 A;  1NSG A;  4ODO A;  2KE0 A;  1J4R A;  1R9H A;  1Q6I A;  3FAP A;  4DRJ A;  3TC5 A;  1FKI A;  4MGV A;  1EYM A;  2KO7 A;  1QZ2 A;  4O2T A;  4GGQ A;  4BF8 A;  1J6Y A;  1B6C A;  1YAT A;  2LJ4 A;  2XP5 A;  2JZV A;  2UZ5 A;  2XP4 A;  2ZQU A;  3ODK A;  4LAV A;  4DRO A;  2MLY A;  4U85 A;  2XP7 A;  1Q1C A;  5HWB A;  2XP8 A;  4FAP A;  4IPX A;  4DZ2 A;  1HXV A;  4TW6 A;  4DRQ A;  4DRN A;  3JYM A;  4G50 A;  3NTP A;  1BL4 A;  4DRK A;  2M08 A;  1FKH A;  2PV1 A;  2ZQS A;  4GIV A;  3CGN A;  3EY6 A;  2IF4 A;  4DZ3 A;  2RUR A;  5B8I C;  3KAC A;  1FKF A;  1Q6H A;  3UI6 A;  2ZQT A;  4J4O A;  4JFM A;  1FKS A;  3MDY B;  4TYO A;  2VN1 A;  1M5Y A;  5HWC A;  1EQ3 A;  1FKD A;  3O5F A;  4MSP A;  3KAH A;  4QT2 A;  2RSE A;  3H9R B;  4J4N A;  2OFN A;  3O5E A;  1ROT A;  2PPN A;  3IK8 A;  4JFK A;  2Y78 A;  4ODQ A;  3O5D A;  5HW8 A;  3O5P A;  1F40 A;  5DIV A;  4DRH A;  1D7J A;  2ZR5 A;  1ROU A;  4QIB A;  1FD9 A;  2MF9 A;  1JNT A;  2ZR4 A;  4G2P A;  2MLX A;  2KGJ A;  3O5R A;  2XP9 A;  2PPP A;  2F2D A;  1YW5 A;  4LAW A;  2RQS A;  2DG4 A;  2VCD A;  1JNS A;  2MPH A;  5GPG A;  1Y0O A;  2MLZ A;  2PPO A;  3NI6 A;  2KFW A;  3JXV A;  3KAD A;  2PV2 A;  2ITK A;  3O5O A;  4TX0 A;  1NMW A;  2F21 A;  4W9O A;  4W9P A;  1FKK A;  4DRI A;  5HKG A;  1D7I A;  2LGO A;  4IQC A;  5J6E A;  2KR7 A;  2XP3 A;  3UI5 A;  2XP6 A;  1T11 A;  3O5I A;  1BKF A;  1F8A B;  1FKJ A;  2N87 A;  3RGC A;  3VAW A;  4QT3 A;  5I98 A;  3GPK A;  5DIT A;  3IHZ A;  3O5L A;  1D6O A;  1Q6U A;  3KCE A;  3TDB A;  2M1I A;  3JYJ A;  1FKB A;  4ITZ A;  4LAX A;  2ZQV A;  4U84 A;  3UI4 A;  1QPL A;  3PRB A;  2LKN A;  3UF8 A;  4ODM A;  4W9Q A;  5HW6 A;  1JVW A;  4NNR A;  1NMV A;  1W26 A;  4JFI A;  1FKR A;  2ZR6 A;  1U79 A;  3KAI A; 
#chains in the Genus database with same CATH topology
 1E6R A;  4LGX A;  2YBU A;  3CZ8 A;  3I6C A;  3ARY A;  2M2A A;  3ARX A;  3ARR A;  3RFW A;  1FKL A;  1ZCN A;  1J4H A;  1D7H A;  3CHF A;  3WD0 A;  2FKE A;  2L2S A;  4NZC A;  1FJD A;  1K9T A;  3WH0 A;  2YBT A;  4HBE A;  3FXY A;  2A3B A;  4ODR A;  3UQI A;  1ZK6 A;  1KT0 A;  4PTM A;  4U86 A;  3PRD A;  2DT3 A;  3AS2 A;  4DRP A;  4WKH A;  3O5J A;  1EIB A;  5DF0 A;  3GU0 A;  2MNT A;  3B9A A;  1E44 A;  3TCZ A;  2O9O A;  3O5K A;  3OA5 A;  1ZU8 A;  1J4R A;  2WLY A;  1ZBW A;  1E6Z A;  2WK2 A;  4O2T A;  2A3C A;  4AY1 A;  1H0G A;  1OWQ A;  1Q1C A;  1ZBK A;  2IUZ A;  3JYM A;  4DRK A;  1FKH A;  4HBO A;  2EUL A;  5B8I C;  1FKS A;  5GPR A;  1HKK A;  1W9U A;  1EQ3 A;  1FKD A;  4MSP A;  2FDM A;  1LL4 A;  1FFR A;  1H0I A;  1HKJ A;  1W1V A;  3IK8 A;  2Y78 A;  3BXW A;  3O5D A;  3O5P A;  4Z2G A;  5DIV A;  3WQW A;  1D7J A;  2DT2 A;  4QIB A;  2ZR4 A;  2PPP A;  1ITX A;  1JNS A;  2MPH A;  3ALF A;  1ZBV A;  2B5U B;  4NSB A;  3NI6 A;  4L72 B;  2ITK A;  3G6L A;  4W9O A;  1LL7 A;  1D7I A;  4IQC A;  4P8X A;  2KR7 A;  3ARV A;  3O5I A;  3RGC A;  3VAW A;  1JND A;  1D6O A;  3KCE A;  3O5L A;  4U84 A;  1X6L A;  3UI4 A;  4WK9 A;  1QPL A;  1KFW A;  3UF8 A;  1UR9 A;  3ART A;  1U79 A;  3G6M A;  3BMB A;  1GPF A;  4JFL A;  1KT1 A;  1TFV A;  1P5Q A;  4JFJ A;  3WD4 A;  2K8I A;  3ALG A;  4MNJ A;  1C9H A;  4JYS A;  4DRM A;  4ODK A;  4C02 B;  4DIP A;  2AWG A;  3ARU A;  3ARZ A;  5HW7 A;  3WKZ A;  1X6N A;  5HTG A;  3KZ7 A;  1W1Y A;  2DG3 A;  4DT4 A;  1FKT A;  3B7X A;  4DWS D;  3KAG A;  2LPV A;  2DG9 A;  4TW8 A;  2RUQ A;  1EDQ A;  1NSG A;  2QF8 A;  1Q6I A;  3WIJ A;  4DRJ A;  3TC5 A;  1FKI A;  4MGV A;  4P8U A;  4Z2K A;  2A3E A;  2DSV A;  1J6Y A;  1B6C A;  2ZQU A;  1GUV A;  1LG2 A;  1SR0 A;  4KQZ A;  5HBF A;  4FAP A;  4DZ2 A;  4DRQ A;  1JNE A;  4DRN A;  3RME A;  3NTP A;  2M08 A;  4MAV A;  4GIV A;  3WQV A;  2O92 A;  2G41 A;  1E6P A;  2RUR A;  4QZV B;  1Q6H A;  4JFM A;  1ZL1 A;  3MDY B;  4TYO A;  2VN1 A;  5HWC A;  1W9P A;  3KAH A;  3PR9 A;  3H9R B;  4JFK A;  1F40 A;  5HW8 A;  4L3N A;  2DT0 A;  4KR0 B;  1JNT A;  4IT4 A;  2MLX A;  2XP9 A;  4LAW A;  2DG4 A;  1ZB5 A;  2AOS A;  1NWS A;  1Y0O A;  4ZPW R;  2P4V A;  2ETN A;  1O6I A;  1WNO A;  3JXV A;  1NMW A;  2F21 A;  3RM8 A;  4DRI A;  2LGO A;  2XP3 A;  4S3K A;  1VF8 A;  1T11 A;  1BKF A;  2N87 A;  4QT3 A;  1NWT A;  1E6N A;  2A3A A;  4ODM A;  4NNR A;  1FKR A;  2ZR6 A;  1CTN A;  4DZ3 A;  1J4I A;  2PBC A;  1E9L A;  3KAB A;  3ARS A;  4Z2H A;  1L1P A;  5DO2 A;  3O5M A;  2G8Z A;  3IKG A;  1TCO C;  1LL6 A;  3CHD A;  2DT1 A;  5BXJ A;  2D9F A;  2XPB A;  4TNS A;  5D75 A;  3ARP A;  1HKM A;  4FN2 A;  4Z2L A;  4P8W A;  5HT1 A;  5JH8 A;  2KI3 A;  3GTY X;  4IQ2 A;  1N1A A;  3UQB A;  5DEZ A;  3WD3 A;  1FAP A;  3IKD A;  1XHG A;  1R9H A;  2KE0 A;  1EYM A;  2PN0 A;  1HJW A;  1HJV A;  1YAT A;  2LJ4 A;  2XP5 A;  3ODK A;  4LAV A;  2MLY A;  2WLZ A;  1SYT A;  5HWB A;  1HXV A;  2DSZ A;  4TW6 A;  3CGN A;  2IF4 A;  4MNM A;  3KAC A;  1FKF A;  4ZPT R;  3W4R A;  1M5Y A;  1HKI A;  2WM0 A;  3PRA A;  4DWS A;  3O5F A;  1NWR A;  1D2K A;  4J4N A;  4ZPV R;  2OFN A;  4ODQ A;  3AS1 A;  1ZBC A;  2MF9 A;  4G2P A;  2KGJ A;  3O5R A;  4DWS B;  2F2D A;  2RQS A;  4R5E A;  3EIP A;  1W1T A;  5GPG A;  2PI6 A;  4IT6 A;  4ML4 A;  5GQB A;  2MLZ A;  3O5O A;  2KFW A;  4TX0 A;  1FKK A;  4URI A;  5HKG A;  4W5U A;  1RD6 A;  3CH9 A;  5J6E A;  3UI5 A;  1JCH B;  1FKJ A;  5DIT A;  3IHZ A;  1Q6U A;  2B31 A;  3TDB A;  2M1I A;  4ITZ A;  1FKB A;  4WJX A;  1NMV A;  3ARO A;  2DSW A;  1QPF A;  1UR8 A;  4Q7N A;  4XAK A;  3KAF A;  3RM9 A;  3PA7 A;  4MNK A;  1PIN A;  1PBK A;  3WD1 A;  1A7X A;  2FAP A;  3UQA A;  3CGM A;  5HUA A;  1WAW A;  2F23 A;  4ODP A;  4Z2I A;  3NRK A;  4R0X A;  3LUO A;  1FKG A;  3O5Q A;  4ODL A;  2Q5A A;  2PV3 A;  2RUD A;  4DH0 A;  1W1P A;  4S3J A;  1GRJ A;  4LAY A;  4N19 A;  5DIU A;  1FFQ A;  1GOI A;  3CHE A;  4ODN A;  3O5G A;  1HJX A;  4HAR A;  1E15 A;  2F4E A;  3ARQ A;  4UDM A;  3OOB A;  3WL1 A;  1IX5 A;  1LQ0 A;  3RM4 A;  2XPA A;  2DSU A;  4MTV A;  2RUC A;  4TW7 A;  4ODO A;  3FAP A;  4DWS C;  2ESC A;  2KO7 A;  1OGB A;  1QZ2 A;  4BF8 A;  4GGQ A;  4Z2J A;  2JZV A;  2UZ5 A;  2XP4 A;  3ARW A;  3WL0 A;  4DRO A;  4U85 A;  2XP7 A;  2XP8 A;  3B9E A;  4IPX A;  1LJY A;  1WB0 A;  4G50 A;  1BL4 A;  2PV1 A;  2ZQS A;  4P8V A;  3EY6 A;  4MPK A;  1NH6 A;  3UI6 A;  2ZQT A;  4J4O A;  3B9D A;  4MNL A;  4QT2 A;  2RSE A;  3QOK A;  3B8S A;  1LG1 A;  3O5E A;  1ROT A;  2PPN A;  4WKF A;  1EHN A;  4DRH A;  2ZR5 A;  1ROU A;  1FD9 A;  1YW5 A;  2DPE A;  1W9V A;  2VCD A;  1XRV A;  1NWU A;  3AS0 A;  2PPO A;  3KAD A;  3FY1 A;  2PV2 A;  3WD2 A;  2OLH A;  4W9P A;  4WKA A;  2XP6 A;  4Q22 A;  5I98 A;  1F8A B;  4ZS6 A;  3CHC A;  3GPK A;  4WIW A;  3AQU A;  4LAX A;  3JYJ A;  2ZQV A;  3PRB A;  2LKN A;  4W9Q A;  1OGG A;  1JVW A;  5HW6 A;  4JFI A;  1W26 A;  3AS3 A;  3KAI A; 
#chains in the Genus database with same CATH homology
 1E6R A;  4LGX A;  2YBU A;  3CZ8 A;  3I6C A;  3ARY A;  2M2A A;  3ARX A;  3ARR A;  3RFW A;  1FKL A;  1ZCN A;  1J4H A;  1D7H A;  3CHF A;  3WD0 A;  2FKE A;  2L2S A;  4NZC A;  1FJD A;  1K9T A;  3WH0 A;  2YBT A;  4HBE A;  3FXY A;  2A3B A;  4ODR A;  3UQI A;  1ZK6 A;  1KT0 A;  4PTM A;  4U86 A;  3PRD A;  2DT3 A;  3AS2 A;  4DRP A;  4WKH A;  3O5J A;  1EIB A;  5DF0 A;  2MNT A;  3B9A A;  3TCZ A;  2O9O A;  3O5K A;  3OA5 A;  1ZU8 A;  1J4R A;  2WLY A;  1ZBW A;  1E6Z A;  2WK2 A;  4O2T A;  2A3C A;  4AY1 A;  1H0G A;  1OWQ A;  1Q1C A;  1ZBK A;  2IUZ A;  3JYM A;  4DRK A;  1FKH A;  4HBO A;  5B8I C;  1FKS A;  5GPR A;  1HKK A;  1W9U A;  1EQ3 A;  1FKD A;  4MSP A;  2FDM A;  1LL4 A;  1FFR A;  1H0I A;  1HKJ A;  1W1V A;  3IK8 A;  2Y78 A;  3BXW A;  3O5D A;  3O5P A;  4Z2G A;  5DIV A;  3WQW A;  1D7J A;  2DT2 A;  4QIB A;  2ZR4 A;  2PPP A;  1ITX A;  1JNS A;  2MPH A;  3ALF A;  1ZBV A;  4NSB A;  3NI6 A;  4L72 B;  2ITK A;  3G6L A;  4W9O A;  1LL7 A;  1D7I A;  4IQC A;  4P8X A;  2KR7 A;  3ARV A;  3O5I A;  3RGC A;  3VAW A;  3O5L A;  1JND A;  1D6O A;  3KCE A;  4U84 A;  1X6L A;  3UI4 A;  4WK9 A;  1QPL A;  1KFW A;  3UF8 A;  1UR9 A;  3ART A;  1U79 A;  3G6M A;  1GPF A;  4JFL A;  1KT1 A;  1TFV A;  1P5Q A;  4JFJ A;  3WD4 A;  2K8I A;  3ALG A;  4MNJ A;  1C9H A;  4JYS A;  4DRM A;  4ODK A;  4C02 B;  4DIP A;  2AWG A;  3ARU A;  3ARZ A;  5HW7 A;  3WKZ A;  1X6N A;  5HTG A;  3KZ7 A;  1W1Y A;  2DG3 A;  4DT4 A;  1FKT A;  3B7X A;  4DWS D;  3KAG A;  2LPV A;  2DG9 A;  4TW8 A;  2RUQ A;  1EDQ A;  1NSG A;  2QF8 A;  1Q6I A;  3WIJ A;  4DRJ A;  3TC5 A;  1FKI A;  4MGV A;  4P8U A;  4Z2K A;  2A3E A;  2DSV A;  1J6Y A;  1B6C A;  2ZQU A;  1GUV A;  1LG2 A;  1SR0 A;  4KQZ A;  5HBF A;  4FAP A;  4DZ2 A;  4DRQ A;  1JNE A;  4DRN A;  3RME A;  3NTP A;  2M08 A;  4MAV A;  4GIV A;  3WQV A;  2O92 A;  2G41 A;  1E6P A;  2RUR A;  4QZV B;  1Q6H A;  4JFM A;  1ZL1 A;  3MDY B;  4TYO A;  2VN1 A;  5HWC A;  1W9P A;  3KAH A;  3PR9 A;  3H9R B;  4JFK A;  1F40 A;  5HW8 A;  4L3N A;  2DT0 A;  4KR0 B;  1JNT A;  4IT4 A;  2MLX A;  2XP9 A;  4LAW A;  2DG4 A;  1ZB5 A;  2AOS A;  1NWS A;  1Y0O A;  4ZPW R;  1O6I A;  1WNO A;  3JXV A;  1NMW A;  2F21 A;  3RM8 A;  4DRI A;  2LGO A;  2XP3 A;  4S3K A;  1VF8 A;  1T11 A;  1BKF A;  2N87 A;  4QT3 A;  1NWT A;  1E6N A;  2A3A A;  4ODM A;  4NNR A;  1FKR A;  2ZR6 A;  1CTN A;  4DZ3 A;  1J4I A;  2PBC A;  1E9L A;  3KAB A;  3ARS A;  4Z2H A;  1L1P A;  5DO2 A;  3O5M A;  2G8Z A;  3IKG A;  1TCO C;  1LL6 A;  3CHD A;  2DT1 A;  5BXJ A;  2D9F A;  2XPB A;  4TNS A;  5D75 A;  3ARP A;  1HKM A;  4FN2 A;  4Z2L A;  4P8W A;  5HT1 A;  5JH8 A;  2KI3 A;  4IQ2 A;  1N1A A;  3UQB A;  5DEZ A;  3WD3 A;  1FAP A;  3IKD A;  1XHG A;  1R9H A;  2KE0 A;  1EYM A;  1HJW A;  1HJV A;  1YAT A;  2LJ4 A;  2XP5 A;  3ODK A;  4LAV A;  2MLY A;  2WLZ A;  1SYT A;  5HWB A;  1HXV A;  2DSZ A;  4TW6 A;  3CGN A;  2IF4 A;  4MNM A;  3KAC A;  1FKF A;  4ZPT R;  3W4R A;  1M5Y A;  1HKI A;  2WM0 A;  3PRA A;  4DWS A;  3O5F A;  1NWR A;  1D2K A;  4J4N A;  4ZPV R;  2OFN A;  4ODQ A;  3AS1 A;  1ZBC A;  2MF9 A;  4G2P A;  2KGJ A;  3O5R A;  4DWS B;  2F2D A;  2RQS A;  4R5E A;  1W1T A;  5GPG A;  2PI6 A;  4IT6 A;  4ML4 A;  5GQB A;  2MLZ A;  3O5O A;  2KFW A;  4TX0 A;  1FKK A;  4URI A;  5HKG A;  4W5U A;  1RD6 A;  3CH9 A;  5J6E A;  3UI5 A;  1FKJ A;  5DIT A;  3IHZ A;  1Q6U A;  2B31 A;  3TDB A;  2M1I A;  4ITZ A;  1FKB A;  4WJX A;  1NMV A;  3ARO A;  2DSW A;  1QPF A;  1UR8 A;  4Q7N A;  4XAK A;  3KAF A;  3RM9 A;  3PA7 A;  4MNK A;  1PIN A;  1PBK A;  3WD1 A;  1A7X A;  2FAP A;  3UQA A;  3CGM A;  5HUA A;  1WAW A;  4ODP A;  4Z2I A;  3NRK A;  4R0X A;  3LUO A;  1FKG A;  3O5Q A;  4ODL A;  2Q5A A;  2PV3 A;  2RUD A;  4DH0 A;  1W1P A;  4S3J A;  4LAY A;  4N19 A;  5DIU A;  1FFQ A;  1GOI A;  3CHE A;  4ODN A;  3O5G A;  1HJX A;  4HAR A;  1E15 A;  2F4E A;  3ARQ A;  3OOB A;  3WL1 A;  1IX5 A;  1LQ0 A;  3RM4 A;  2XPA A;  2DSU A;  4MTV A;  2RUC A;  4TW7 A;  4ODO A;  3FAP A;  4DWS C;  2ESC A;  2KO7 A;  1OGB A;  1QZ2 A;  4BF8 A;  4GGQ A;  4Z2J A;  2JZV A;  2UZ5 A;  2XP4 A;  3ARW A;  3WL0 A;  4DRO A;  4U85 A;  2XP7 A;  2XP8 A;  3B9E A;  4IPX A;  1LJY A;  1WB0 A;  4G50 A;  1BL4 A;  2PV1 A;  2ZQS A;  4P8V A;  3EY6 A;  4MPK A;  1NH6 A;  3UI6 A;  2ZQT A;  4J4O A;  3B9D A;  4MNL A;  4QT2 A;  2RSE A;  3QOK A;  3B8S A;  1LG1 A;  3O5E A;  1ROT A;  2PPN A;  4WKF A;  1EHN A;  4DRH A;  2ZR5 A;  1ROU A;  1FD9 A;  1YW5 A;  2DPE A;  1W9V A;  2VCD A;  1XRV A;  1NWU A;  3AS0 A;  2PPO A;  3KAD A;  3FY1 A;  2PV2 A;  3WD2 A;  2OLH A;  4W9P A;  4WKA A;  2XP6 A;  4Q22 A;  5I98 A;  1F8A B;  4ZS6 A;  3CHC A;  3GPK A;  4WIW A;  3AQU A;  4LAX A;  3JYJ A;  2ZQV A;  3PRB A;  2LKN A;  4W9Q A;  1OGG A;  1JVW A;  5HW6 A;  4JFI A;  1W26 A;  3AS3 A;  3KAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...