1FKDA

Fk-506 binding protein: three-dimensional structure of the complex with the antagonist l-685,818
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title FK-506-binding protein: three-dimensional structure of the complex with the antagonist L-685,818.
pubmed rcsb
source organism Homo sapiens
molecule tags Cis-trans isomerase
molecule keywords FK506 BINDING PROTEIN
total genus 25
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1992-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkdA00
2F21A 2XP4A 3O5FA 2ZQVA 3NTPA 3PRBA 5DITA 4LAWA 5DIVA 2PV2A 3LUOA 4DZ2A 2Q5AA 4ODLA 4TW7A 4DRMA 4DROA 4QT3A 1FKBA 4JYSA 1KT0A 3KAHA 1D7HA 2LJ4A 3IKDA 1Y0OA 2ZR6A 3IHZA 2MLYA 2LPVA 2KO7A 2VN1A 1ZCNA 2MF9A 3O5OA 3TCZA 3UI6A 4DRJA 4DRQA 1PINA 3KABA 2UZ5A 3GPKA 3O5GA 4IQ2A 1D6OA 1BKFA 4ODPA 2RSEA 2XP8A 4FN2A 1FKHA 4W9OA 1D7IA 2M08A 2L2SA 5I98A 4J4OA 4MSPA 5GPGA 5HW6A 4J4NA 3RFWA 3UQIA 4W9PA 1EQ3A 4TYOA 2D9FA 2M2AA 3ODKA 5HTGA 2AWGA 2XP6A 4DRPA 2XP3A 3FAPA 2XP9A 3KAIA 3VAWA 4N19A 1C9HA 1P5QA 5HWCA 4U85A 3KCEA 1J4IA 3O5QA 1A7XA 3PA7A 3JYMA 3O5IA 2ITKA 2XPAA 2FKEA 3O5LA 4GGQA 4JFKA 4LAYA 3UQAA 2XP5A 1J4RA 4ODNA 3KAFA 1QPLA 2RUQA 3CGMA 1ROUA 3CGNA 4JFMA 4DRHA 3EY6A 4U86A 5DIUA 1N1AA 1U79A 1FAPA 2DG4A 5HKGA 1F8AB 1FKSA 1L1PA 3H9RB 4TNSA 3UI4A 4G50A 2N87A 1FKJA 1NSGA 5HWBA 2Y78A 2PPNA 5J6EA 2ZQUA 4LAXA 5D75A 4JFJA 3JXVA 1J4HA 2ZR4A 2PPOA 2K8IA 1M5YA 1QPFA 2KE0A 2FAPA 4DZ3A 2F4EA 3MDYB 1J6YA 4DT4A 2F2DA 2KFWA 1FKFA 1PBKA 2JZVA 4ODQA 3O5JA 1B6CA 2OFNA 1FKLA 4GIVA 4DRIA 1YATA 3OOBA 1FKDA 3NI6A 2RURA 4O2TA 1JNSA 3UQBA 2KGJA 2IF4A 1FJDA 2ZQSA 1TCOC 4QIBA 1ROTA 4G2PA 2MPHA 4FAPA 3KADA 5HW7A 2XPBA 4LAVA 1Q1CA 2DG3A 1ZK6A 3KAGA 3KZ7A 4ITZA 4ODKA 4ODOA 2PPPA 4R0XA 4BF8A 3UI5A 5HUAA 1Q6IA 2MNTA 3I6CA 2PBCA 2RQSA 1Q6UA 1FD9A 1FKIA 4NNRA 4QT2A 1W26A 1NMVA 3O5KA 1BL4A 5B8IC 3O5DA 1T11A 4DRKA 4DRNA 1NMWA 3O5RA 2DG9A 2KI3A 2KR7A 5HW8A 2M1IA 2VCDA 2MLZA 3O5PA 4TW8A 2RUCA 5BXJA 4U84A 3JYJA 1D7JA 4IQCA 3IKGA 3RGCA 1Q6HA 1R9HA 2ZQTA 4ODMA 4IPXA 1EYMA 4TX0A 2PV1A 3TDBA 1FKKA 1JVWA 3UF8A 4C02B 4DIPA 1FKGA 3IK8A 4JFIA 1QZ2A 4JFLA 4TW6A 4W9QA 1HXVA 3NRKA 3B7XA 4DH0A 3KACA 3PRDA 1F40A 1FKTA 3O5MA 1FKRA 2RUDA 1KT1A 2MLXA 5HT1A 3WH0A 4MGVA 4ODRA 2ZR5A 2PV3A 2LKNA 3O5EA 2XP7A 3TC5A 1JNTA 1YW5A 2LGOA
chains in the Genus database with same CATH superfamily
3WD3A 2ZQVA 2DT3A 5DIVA 4Z2GA 3LUOA 2Q5AA 4TW7A 1FKBA 4MNMA 2DSWA 1EDQA 3IKDA 2A3BA 1E6RA 2MLYA 4DRJA 2YBTA 2MF9A 2DT1A 3UI6A 1PINA 4P8WA 2RSEA 4W9OA 1D7IA 1EHNA 4MSPA 2XP6A 1W1YA 1XHGA 1P5QA 2G41A 4U85A 3O5QA 2A3EA 4JFJA 4IT4A 3JYMA 3O5IA 2ITKA 2XPAA 1LG2A 1ZBWA 3ARRA 4ODNA 3KAFA 1QPLA 4IT6A 1CTNA 4JFMA 5DIUA 4NZCA 1N1AA 1JCHB 5HKGA 3B9AA 1GRJA 4WIWA 1FKJA 4ZS6A 3ARXA 5J6EA 2ZQUA 3GTYX 3RMEA 1FFRA 4S3KA 5DEZA 2KE0A 2KFWA 1FKFA 3BXWA 1B6CA 2OFNA 1FKLA 3WQVA 4AY1A 4DRIA 3OOBA 1FKDA 1NWUA 1SR0A 4XAKA 2RURA 1JNSA 1LJYA 2DSUA 3CHDA 1FJDA 4ZPTR 4QIBA 3AROA 1D2KA 4Q7NA 1E6PA 2DG3A 1HKIA 1OGGA 2PBCA 4MAVA 1FKIA 1H0IA 3O5KA 2G8ZA 5GQBA 2KR7A 2QF8A 4HBOA 2MLZA 4MTVA 1ZU8A 2RUCA 4TW8A 4U84A 2DSVA 3JYJA 4W5UA 1D7JA 3QOKA 4P8UA 3RGCA 2ZQTA 4IPXA 1EYMA 4TX0A 1JVWA 1GOIA 1OWQA 3IK8A 4UDMA 3OA5A 1ZBCA 5GPRA 4NSBA 1W9VA 1FKTA 3WH0A 2IUZA 1E9LA 3AQUA 4Z2LA 1O6IA 2LKNA 2DT0A 1VF8A 5DITA 2PV2A 4DRMA 4QT3A 4JYSA 2LJ4A 1IX5A 2ZR6A 2VN1A 1E6ZA 4DZ2A 1HKKA 4DWSD 4DRPA 3KABA 1OGBA 5HBFA 1LL4A 2L2SA 2P4VA 2A3CA 4J4OA 2B5UB 1EQ3A 4TYOA 3WD0A 1KFWA 2AWGA 2OLHA 2XP9A 3ARTA 3VAWA 4P8XA 5HWCA 3KCEA 2WLYA 4MPKA 2XP5A 3ARPA 4QZVB 3WIJA 3CGNA 4ZPWR 3ARZA 2PI6A 3UI4A 1NSGA 3FY1A 5HWBA 1LG1A 1HJVA 3ALGA 4LAXA 1XRVA 3ALFA 1HKMA 1NH6A 3MDYB 2JZVA 2WK2A 4MNKA 2F23A 3NI6A 4Q22A 4HARA 1TCOC 1UR8A 5HW7A 2XPBA 2WLZA 3KZ7A 3PR9A 4BF8A 4ITZA 2PPPA 4NNRA 4QT2A 1W26A 5DF0A 1NMVA 4DRKA 1NMWA 4LGXA 5HW8A 2M1IA 3O5PA 5BXJA 4WKHA 3ARYA 3TDBA 1UR9A 3UF8A 1FKKA 1HJWA 4C02B 4JFIA 1QZ2A 2PN0A 4JFLA 4KR0B 3B7XA 4DH0A 3PRDA 2ESCA 3O5MA 2RUDA 1KT1A 2MLXA 4P8VA 5HT1A 4PTMA 3WQWA 3PRAA 1HKJA 2PV3A 3O5EA 2LGOA 3O5FA 1H0GA 3NTPA 4LAWA 3KAHA 1D7HA 4WJXA 3IHZA 2LPVA 1ZCNA 3O5OA 1ZBKA 4DRHA 3O5GA 4IQ2A 3ARUA 1D6OA 1BKFA 2XP8A 3G6MA 2M08A 2DSZA 5HW6A 3RFWA 3UQIA 4URIA 4W9PA 2M2AA 1HJXA 5HTGA 3AS0A 1W1PA 3KAIA 4N19A 4KQZA 1ITXA 1J4IA 4L72B 3PA7A 1A7XA 4GGQA 3O5LA 4LAYA 2EULA 4L3NA 3FXYA 3CH9A 3UQAA 1J4RA 1GPFA 2RUQA 2DG4A 1U79A 1FAPA 1F8AB 1FKSA 4G50A 1NWTA 2N87A 2Y78A 2PPNA 5D75A 3JXVA 4WK9A 2ZR4A 2PPOA 4DWSB 1ZB5A 2YBUA 4HBEA 3WL1A 4Z2HA 1ZBVA 2FAPA 4DZ3A 2F4EA 1J6YA 2ETNA 4ODQA 3O5JA 4GIVA 1YATA 1E6NA 3UQBA 4S3JA 2IF4A 5DO2A 1ROTA 1Q1CA 3KAGA 1ZK6A 4ODKA 4ODOA 1NWSA 5HUAA 1WB0A 1Q6IA 3RM4A 1WAWA 3I6CA 2RQSA 1LL6A 3O5DA 2DT2A 1W9UA 2DG9A 2KI3A 1TFVA 2VCDA 4ML4A 3AS3A 4IQCA 1FFQA 3IKGA 1Q6HA 1R9HA 4ODMA 1FKGA 1ZL1A 4WKAA 1RD6A 4TW6A 1W1VA 4W9QA 4DWSA 1HXVA 1FKRA 4MGVA 5JH8A 1JNDA 3ARWA 1K9TA 3CHFA 2F21A 2XP4A 3PRBA 1LQ0A 3CHEA 4ODLA 4DROA 1KT0A 4ZPVR 1Y0OA 2KO7A 3TCZA 1WNOA 4DRQA 4Z2JA 1W9PA 2UZ5A 3GPKA 4ODPA 3WKZA 4FN2A 1FKHA 2A3AA 5I98A 5GPGA 4J4NA 1GUVA 3WL0A 2D9FA 3ODKA 2XP3A 3FAPA 2B31A 1C9HA 3ARSA 1SYTA 2FKEA 4JFKA 1E15A 1JNEA 3WD2A 3CGMA 1ROUA 3CZ8A 3EY6A 4U86A 1L1PA 3H9RB 4TNSA 2DPEA 3WD4A 4Z2KA 3W4RA 3B8SA 1J4HA 3CHCA 2K8IA 1M5YA 1QPFA 2FDMA 4DT4A 2F2DA 1X6NA 4MNLA 1PBKA 3ARQA 2O9OA 2AOSA 3WD1A 3B9EA 1EIBA 1NWRA 4O2TA 3B9DA 2KGJA 2ZQSA 4MNJA 4Z2IA 3EIPA 4G2PA 2MPHA 4FAPA 3KADA 4LAVA 4R0XA 3UI5A 2MNTA 1W1TA 3AS1A 1Q6UA 1FD9A 1E44A 5B8IC 1BL4A 1T11A 4DRNA 3RM8A 3O5RA 4WKFA 3BMBA 4DWSC 2O92A 2PV1A 4DIPA 4R5EA 1X6LA 2WM0A 3ARVA 3AS2A 3G6LA 3NRKA 3KACA 1F40A 3GU0A 4ODRA 2ZR5A 2XP7A 3RM9A 3TC5A 1JNTA 1YW5A 1LL7A
chains in the Genus database with same CATH topology
3WD3A 2ZQVA 2DT3A 5DIVA 4Z2GA 3LUOA 2Q5AA 4TW7A 1FKBA 4MNMA 2DSWA 1EDQA 3IKDA 2A3BA 1E6RA 2MLYA 4DRJA 2YBTA 2MF9A 2DT1A 3UI6A 1PINA 4P8WA 2RSEA 4W9OA 1D7IA 1EHNA 4MSPA 2XP6A 1W1YA 1XHGA 1P5QA 2G41A 4U85A 3O5QA 2A3EA 4JFJA 4IT4A 3JYMA 3O5IA 2ITKA 2XPAA 1LG2A 1ZBWA 3ARRA 4ODNA 3KAFA 1QPLA 4IT6A 1CTNA 4JFMA 5DIUA 4NZCA 1N1AA 5HKGA 3B9AA 4WIWA 1FKJA 4ZS6A 3ARXA 5J6EA 2ZQUA 3RMEA 1FFRA 4S3KA 5DEZA 2KE0A 2KFWA 1FKFA 3BXWA 1B6CA 2OFNA 1FKLA 3WQVA 4AY1A 4DRIA 3OOBA 1FKDA 1NWUA 1SR0A 4XAKA 2RURA 1JNSA 1LJYA 2DSUA 3CHDA 1FJDA 4ZPTR 4QIBA 3AROA 1D2KA 4Q7NA 1E6PA 2DG3A 1HKIA 1OGGA 2PBCA 4MAVA 1FKIA 1H0IA 3O5KA 2G8ZA 5GQBA 2KR7A 2QF8A 4HBOA 2MLZA 4MTVA 1ZU8A 2RUCA 4TW8A 4U84A 2DSVA 3JYJA 4W5UA 1D7JA 3QOKA 4P8UA 3RGCA 2ZQTA 4IPXA 1EYMA 4TX0A 1JVWA 1GOIA 1OWQA 3IK8A 3OA5A 1ZBCA 5GPRA 4NSBA 1W9VA 1FKTA 3WH0A 2IUZA 1E9LA 3AQUA 4Z2LA 1O6IA 2LKNA 2DT0A 1VF8A 5DITA 2PV2A 4DRMA 4QT3A 4JYSA 2LJ4A 1IX5A 2ZR6A 2VN1A 1E6ZA 4DZ2A 1HKKA 4DWSD 4DRPA 3KABA 1OGBA 5HBFA 1LL4A 2L2SA 2A3CA 4J4OA 1EQ3A 4TYOA 3WD0A 1KFWA 2AWGA 2OLHA 2XP9A 3ARTA 3VAWA 4P8XA 5HWCA 3KCEA 2WLYA 4MPKA 2XP5A 3ARPA 4QZVB 3WIJA 3CGNA 4ZPWR 3ARZA 2PI6A 3UI4A 1NSGA 3FY1A 5HWBA 1LG1A 1HJVA 3ALGA 4LAXA 1XRVA 3ALFA 1HKMA 1NH6A 3MDYB 2JZVA 2WK2A 4MNKA 3NI6A 4Q22A 4HARA 1TCOC 1UR8A 5HW7A 2XPBA 2WLZA 3KZ7A 3PR9A 4BF8A 4ITZA 2PPPA 4NNRA 4QT2A 1W26A 5DF0A 1NMVA 4DRKA 1NMWA 4LGXA 5HW8A 2M1IA 3O5PA 5BXJA 4WKHA 3ARYA 3TDBA 1UR9A 3UF8A 1FKKA 1HJWA 4C02B 4JFIA 1QZ2A 4JFLA 4KR0B 3B7XA 4DH0A 3PRDA 2ESCA 3O5MA 2RUDA 1KT1A 2MLXA 4P8VA 5HT1A 4PTMA 3WQWA 3PRAA 1HKJA 2PV3A 3O5EA 2LGOA 3O5FA 1H0GA 3NTPA 4LAWA 3KAHA 1D7HA 4WJXA 3IHZA 2LPVA 1ZCNA 3O5OA 1ZBKA 4DRHA 3O5GA 4IQ2A 3ARUA 1D6OA 1BKFA 2XP8A 3G6MA 2M08A 2DSZA 5HW6A 3RFWA 3UQIA 4URIA 4W9PA 2M2AA 1HJXA 5HTGA 3AS0A 1W1PA 3KAIA 4N19A 4KQZA 1ITXA 1J4IA 4L72B 3PA7A 1A7XA 4GGQA 3O5LA 4LAYA 4L3NA 3FXYA 3CH9A 3UQAA 1J4RA 1GPFA 2RUQA 2DG4A 1U79A 1FAPA 1F8AB 1FKSA 4G50A 1NWTA 2N87A 2Y78A 2PPNA 5D75A 3JXVA 4WK9A 2ZR4A 2PPOA 4DWSB 1ZB5A 2YBUA 4HBEA 3WL1A 4Z2HA 1ZBVA 2FAPA 4DZ3A 2F4EA 1J6YA 4ODQA 3O5JA 4GIVA 1YATA 1E6NA 3UQBA 4S3JA 2IF4A 5DO2A 1ROTA 1Q1CA 3KAGA 1ZK6A 4ODKA 4ODOA 1NWSA 5HUAA 1WB0A 1Q6IA 3RM4A 1WAWA 3I6CA 2RQSA 1LL6A 3O5DA 2DT2A 1W9UA 2DG9A 2KI3A 1TFVA 2VCDA 4ML4A 3AS3A 4IQCA 1FFQA 3IKGA 1Q6HA 1R9HA 4ODMA 1FKGA 1ZL1A 4WKAA 1RD6A 4TW6A 1W1VA 4W9QA 4DWSA 1HXVA 1FKRA 4MGVA 5JH8A 1JNDA 3ARWA 1K9TA 3CHFA 2F21A 2XP4A 3PRBA 1LQ0A 3CHEA 4ODLA 4DROA 1KT0A 4ZPVR 1Y0OA 2KO7A 3TCZA 1WNOA 4DRQA 4Z2JA 1W9PA 2UZ5A 3GPKA 4ODPA 3WKZA 4FN2A 1FKHA 2A3AA 5I98A 5GPGA 4J4NA 1GUVA 3WL0A 2D9FA 3ODKA 2XP3A 3FAPA 2B31A 1C9HA 3ARSA 1SYTA 2FKEA 4JFKA 1E15A 1JNEA 3WD2A 3CGMA 1ROUA 3CZ8A 3EY6A 4U86A 1L1PA 3H9RB 4TNSA 2DPEA 3WD4A 4Z2KA 3W4RA 3B8SA 1J4HA 3CHCA 2K8IA 1M5YA 1QPFA 2FDMA 4DT4A 2F2DA 1X6NA 4MNLA 1PBKA 3ARQA 2O9OA 2AOSA 3WD1A 3B9EA 1EIBA 1NWRA 4O2TA 3B9DA 2KGJA 2ZQSA 4MNJA 4Z2IA 4G2PA 2MPHA 4FAPA 3KADA 4LAVA 4R0XA 3UI5A 2MNTA 1W1TA 3AS1A 1Q6UA 1FD9A 5B8IC 1BL4A 1T11A 4DRNA 3RM8A 3O5RA 4WKFA 4DWSC 2O92A 2PV1A 4DIPA 4R5EA 1X6LA 2WM0A 3ARVA 3AS2A 3G6LA 3NRKA 3KACA 1F40A 4ODRA 2ZR5A 2XP7A 3RM9A 3TC5A 1JNTA 1YW5A 1LL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F21 A;  2XP4 A;  3O5F A;  2ZQV A;  3NTP A;  3PRB A;  5DIT A;  4LAW A;  5DIV A;  2PV2 A;  3LUO A;  4DZ2 A;  2Q5A A;  4ODL A;  4TW7 A;  4DRM A;  4DRO A;  4QT3 A;  1FKB A;  4JYS A;  1KT0 A;  3KAH A;  1D7H A;  2LJ4 A;  3IKD A;  1Y0O A;  2ZR6 A;  3IHZ A;  2MLY A;  2LPV A;  2KO7 A;  2VN1 A;  1ZCN A;  2MF9 A;  3O5O A;  3TCZ A;  3UI6 A;  4DRJ A;  4DRQ A;  1PIN A;  3KAB A;  2UZ5 A;  3GPK A;  3O5G A;  4IQ2 A;  1D6O A;  1BKF A;  4ODP A;  2RSE A;  2XP8 A;  4FN2 A;  1FKH A;  4W9O A;  1D7I A;  2M08 A;  2L2S A;  5I98 A;  4J4O A;  4MSP A;  5GPG A;  5HW6 A;  4J4N A;  3RFW A;  3UQI A;  4W9P A;  1EQ3 A;  4TYO A;  2D9F A;  2M2A A;  3ODK A;  5HTG A;  2AWG A;  2XP6 A;  4DRP A;  2XP3 A;  3FAP A;  2XP9 A;  3KAI A;  3VAW A;  4N19 A;  1C9H A;  1P5Q A;  5HWC A;  4U85 A;  3KCE A;  1J4I A;  3O5Q A;  1A7X A;  3PA7 A;  3JYM A;  3O5I A;  2ITK A;  2XPA A;  2FKE A;  3O5L A;  4GGQ A;  4JFK A;  4LAY A;  3UQA A;  2XP5 A;  1J4R A;  4ODN A;  3KAF A;  1QPL A;  2RUQ A;  3CGM A;  1ROU A;  3CGN A;  4JFM A;  4DRH A;  3EY6 A;  4U86 A;  5DIU A;  1N1A A;  1U79 A;  1FAP A;  2DG4 A;  5HKG A;  1F8A B;  1FKS A;  1L1P A;  3H9R B;  4TNS A;  3UI4 A;  4G50 A;  2N87 A;  1FKJ A;  1NSG A;  5HWB A;  2Y78 A;  2PPN A;  5J6E A;  2ZQU A;  4LAX A;  5D75 A;  4JFJ A;  3JXV A;  1J4H A;  2ZR4 A;  2PPO A;  2K8I A;  1M5Y A;  1QPF A;  2KE0 A;  2FAP A;  4DZ3 A;  2F4E A;  3MDY B;  1J6Y A;  4DT4 A;  2F2D A;  2KFW A;  1FKF A;  1PBK A;  2JZV A;  4ODQ A;  3O5J A;  1B6C A;  2OFN A;  1FKL A;  4GIV A;  4DRI A;  1YAT A;  3OOB A;  1FKD A;  3NI6 A;  2RUR A;  4O2T A;  1JNS A;  3UQB A;  2KGJ A;  2IF4 A;  1FJD A;  2ZQS A;  1TCO C;  4QIB A;  1ROT A;  4G2P A;  2MPH A;  4FAP A;  3KAD A;  5HW7 A;  2XPB A;  4LAV A;  1Q1C A;  2DG3 A;  1ZK6 A;  3KAG A;  3KZ7 A;  4ITZ A;  4ODK A;  4ODO A;  2PPP A;  4R0X A;  4BF8 A;  3UI5 A;  5HUA A;  1Q6I A;  2MNT A;  3I6C A;  2PBC A;  2RQS A;  1Q6U A;  1FD9 A;  1FKI A;  4NNR A;  4QT2 A;  1W26 A;  1NMV A;  3O5K A;  1BL4 A;  5B8I C;  3O5D A;  1T11 A;  4DRK A;  4DRN A;  1NMW A;  3O5R A;  2DG9 A;  2KI3 A;  2KR7 A;  5HW8 A;  2M1I A;  2VCD A;  2MLZ A;  3O5P A;  4TW8 A;  2RUC A;  5BXJ A;  4U84 A;  3JYJ A;  1D7J A;  4IQC A;  3IKG A;  3RGC A;  1Q6H A;  1R9H A;  2ZQT A;  4ODM A;  4IPX A;  1EYM A;  4TX0 A;  2PV1 A;  3TDB A;  1FKK A;  1JVW A;  3UF8 A;  4C02 B;  4DIP A;  1FKG A;  3IK8 A;  4JFI A;  1QZ2 A;  4JFL A;  4TW6 A;  4W9Q A;  1HXV A;  3NRK A;  3B7X A;  4DH0 A;  3KAC A;  3PRD A;  1F40 A;  1FKT A;  3O5M A;  1FKR A;  2RUD A;  1KT1 A;  2MLX A;  5HT1 A;  3WH0 A;  4MGV A;  4ODR A;  2ZR5 A;  2PV3 A;  2LKN A;  3O5E A;  2XP7 A;  3TC5 A;  1JNT A;  1YW5 A;  2LGO A; 
#chains in the Genus database with same CATH topology
 3WD3 A;  2ZQV A;  2DT3 A;  5DIV A;  4Z2G A;  3LUO A;  2Q5A A;  4TW7 A;  1FKB A;  4MNM A;  2DSW A;  1EDQ A;  3IKD A;  2A3B A;  1E6R A;  2MLY A;  4DRJ A;  2YBT A;  2MF9 A;  2DT1 A;  3UI6 A;  1PIN A;  4P8W A;  2RSE A;  4W9O A;  1D7I A;  1EHN A;  4MSP A;  2XP6 A;  1W1Y A;  1XHG A;  1P5Q A;  2G41 A;  4U85 A;  3O5Q A;  2A3E A;  4JFJ A;  4IT4 A;  3JYM A;  3O5I A;  2ITK A;  2XPA A;  1LG2 A;  1ZBW A;  3ARR A;  4ODN A;  3KAF A;  1QPL A;  4IT6 A;  1CTN A;  4JFM A;  5DIU A;  4NZC A;  1N1A A;  1JCH B;  5HKG A;  3B9A A;  1GRJ A;  4WIW A;  1FKJ A;  4ZS6 A;  3ARX A;  5J6E A;  2ZQU A;  3GTY X;  3RME A;  1FFR A;  4S3K A;  5DEZ A;  2KE0 A;  2KFW A;  1FKF A;  3BXW A;  1B6C A;  2OFN A;  1FKL A;  3WQV A;  4AY1 A;  4DRI A;  3OOB A;  1FKD A;  1NWU A;  1SR0 A;  4XAK A;  2RUR A;  1JNS A;  1LJY A;  2DSU A;  3CHD A;  1FJD A;  4ZPT R;  4QIB A;  3ARO A;  1D2K A;  4Q7N A;  1E6P A;  2DG3 A;  1HKI A;  1OGG A;  2PBC A;  4MAV A;  1FKI A;  1H0I A;  3O5K A;  2G8Z A;  5GQB A;  2KR7 A;  2QF8 A;  4HBO A;  2MLZ A;  4MTV A;  1ZU8 A;  2RUC A;  4TW8 A;  4U84 A;  2DSV A;  3JYJ A;  4W5U A;  1D7J A;  3QOK A;  4P8U A;  3RGC A;  2ZQT A;  4IPX A;  1EYM A;  4TX0 A;  1JVW A;  1GOI A;  1OWQ A;  3IK8 A;  4UDM A;  3OA5 A;  1ZBC A;  5GPR A;  4NSB A;  1W9V A;  1FKT A;  3WH0 A;  2IUZ A;  1E9L A;  3AQU A;  4Z2L A;  1O6I A;  2LKN A;  2DT0 A;  1VF8 A;  5DIT A;  2PV2 A;  4DRM A;  4QT3 A;  4JYS A;  2LJ4 A;  1IX5 A;  2ZR6 A;  2VN1 A;  1E6Z A;  4DZ2 A;  1HKK A;  4DWS D;  4DRP A;  3KAB A;  1OGB A;  5HBF A;  1LL4 A;  2L2S A;  2P4V A;  2A3C A;  4J4O A;  2B5U B;  1EQ3 A;  4TYO A;  3WD0 A;  1KFW A;  2AWG A;  2OLH A;  2XP9 A;  3ART A;  3VAW A;  4P8X A;  5HWC A;  3KCE A;  2WLY A;  4MPK A;  2XP5 A;  3ARP A;  4QZV B;  3WIJ A;  3CGN A;  4ZPW R;  3ARZ A;  2PI6 A;  3UI4 A;  1NSG A;  3FY1 A;  5HWB A;  1LG1 A;  1HJV A;  3ALG A;  4LAX A;  1XRV A;  3ALF A;  1HKM A;  1NH6 A;  3MDY B;  2JZV A;  2WK2 A;  4MNK A;  2F23 A;  3NI6 A;  4Q22 A;  4HAR A;  1TCO C;  1UR8 A;  5HW7 A;  2XPB A;  2WLZ A;  3KZ7 A;  3PR9 A;  4BF8 A;  4ITZ A;  2PPP A;  4NNR A;  4QT2 A;  1W26 A;  5DF0 A;  1NMV A;  4DRK A;  1NMW A;  4LGX A;  5HW8 A;  2M1I A;  3O5P A;  5BXJ A;  4WKH A;  3ARY A;  3TDB A;  1UR9 A;  3UF8 A;  1FKK A;  1HJW A;  4C02 B;  4JFI A;  1QZ2 A;  2PN0 A;  4JFL A;  4KR0 B;  3B7X A;  4DH0 A;  3PRD A;  2ESC A;  3O5M A;  2RUD A;  1KT1 A;  2MLX A;  4P8V A;  5HT1 A;  4PTM A;  3WQW A;  3PRA A;  1HKJ A;  2PV3 A;  3O5E A;  2LGO A;  3O5F A;  1H0G A;  3NTP A;  4LAW A;  3KAH A;  1D7H A;  4WJX A;  3IHZ A;  2LPV A;  1ZCN A;  3O5O A;  1ZBK A;  4DRH A;  3O5G A;  4IQ2 A;  3ARU A;  1D6O A;  1BKF A;  2XP8 A;  3G6M A;  2M08 A;  2DSZ A;  5HW6 A;  3RFW A;  3UQI A;  4URI A;  4W9P A;  2M2A A;  1HJX A;  5HTG A;  3AS0 A;  1W1P A;  3KAI A;  4N19 A;  4KQZ A;  1ITX A;  1J4I A;  4L72 B;  3PA7 A;  1A7X A;  4GGQ A;  3O5L A;  4LAY A;  2EUL A;  4L3N A;  3FXY A;  3CH9 A;  3UQA A;  1J4R A;  1GPF A;  2RUQ A;  2DG4 A;  1U79 A;  1FAP A;  1F8A B;  1FKS A;  4G50 A;  1NWT A;  2N87 A;  2Y78 A;  2PPN A;  5D75 A;  3JXV A;  4WK9 A;  2ZR4 A;  2PPO A;  4DWS B;  1ZB5 A;  2YBU A;  4HBE A;  3WL1 A;  4Z2H A;  1ZBV A;  2FAP A;  4DZ3 A;  2F4E A;  1J6Y A;  2ETN A;  4ODQ A;  3O5J A;  4GIV A;  1YAT A;  1E6N A;  3UQB A;  4S3J A;  2IF4 A;  5DO2 A;  1ROT A;  1Q1C A;  3KAG A;  1ZK6 A;  4ODK A;  4ODO A;  1NWS A;  5HUA A;  1WB0 A;  1Q6I A;  3RM4 A;  1WAW A;  3I6C A;  2RQS A;  1LL6 A;  3O5D A;  2DT2 A;  1W9U A;  2DG9 A;  2KI3 A;  1TFV A;  2VCD A;  4ML4 A;  3AS3 A;  4IQC A;  1FFQ A;  3IKG A;  1Q6H A;  1R9H A;  4ODM A;  1FKG A;  1ZL1 A;  4WKA A;  1RD6 A;  4TW6 A;  1W1V A;  4W9Q A;  4DWS A;  1HXV A;  1FKR A;  4MGV A;  5JH8 A;  1JND A;  3ARW A;  1K9T A;  3CHF A;  2F21 A;  2XP4 A;  3PRB A;  1LQ0 A;  3CHE A;  4ODL A;  4DRO A;  1KT0 A;  4ZPV R;  1Y0O A;  2KO7 A;  3TCZ A;  1WNO A;  4DRQ A;  4Z2J A;  1W9P A;  2UZ5 A;  3GPK A;  4ODP A;  3WKZ A;  4FN2 A;  1FKH A;  2A3A A;  5I98 A;  5GPG A;  4J4N A;  1GUV A;  3WL0 A;  2D9F A;  3ODK A;  2XP3 A;  3FAP A;  2B31 A;  1C9H A;  3ARS A;  1SYT A;  2FKE A;  4JFK A;  1E15 A;  1JNE A;  3WD2 A;  3CGM A;  1ROU A;  3CZ8 A;  3EY6 A;  4U86 A;  1L1P A;  3H9R B;  4TNS A;  2DPE A;  3WD4 A;  4Z2K A;  3W4R A;  3B8S A;  1J4H A;  3CHC A;  2K8I A;  1M5Y A;  1QPF A;  2FDM A;  4DT4 A;  2F2D A;  1X6N A;  4MNL A;  1PBK A;  3ARQ A;  2O9O A;  2AOS A;  3WD1 A;  3B9E A;  1EIB A;  1NWR A;  4O2T A;  3B9D A;  2KGJ A;  2ZQS A;  4MNJ A;  4Z2I A;  3EIP A;  4G2P A;  2MPH A;  4FAP A;  3KAD A;  4LAV A;  4R0X A;  3UI5 A;  2MNT A;  1W1T A;  3AS1 A;  1Q6U A;  1FD9 A;  1E44 A;  5B8I C;  1BL4 A;  1T11 A;  4DRN A;  3RM8 A;  3O5R A;  4WKF A;  3BMB A;  4DWS C;  2O92 A;  2PV1 A;  4DIP A;  4R5E A;  1X6L A;  2WM0 A;  3ARV A;  3AS2 A;  3G6L A;  3NRK A;  3KAC A;  1F40 A;  3GU0 A;  4ODR A;  2ZR5 A;  2XP7 A;  3RM9 A;  3TC5 A;  1JNT A;  1YW5 A;  1LL7 A; 
#chains in the Genus database with same CATH homology
 3WD3 A;  2ZQV A;  2DT3 A;  5DIV A;  4Z2G A;  3LUO A;  2Q5A A;  4TW7 A;  1FKB A;  4MNM A;  2DSW A;  1EDQ A;  3IKD A;  2A3B A;  1E6R A;  2MLY A;  4DRJ A;  2YBT A;  2MF9 A;  2DT1 A;  3UI6 A;  1PIN A;  4P8W A;  2RSE A;  4W9O A;  1D7I A;  1EHN A;  4MSP A;  2XP6 A;  1W1Y A;  1XHG A;  1P5Q A;  2G41 A;  4U85 A;  3O5Q A;  2A3E A;  4JFJ A;  4IT4 A;  3JYM A;  3O5I A;  2ITK A;  2XPA A;  1LG2 A;  1ZBW A;  3ARR A;  4ODN A;  3KAF A;  1QPL A;  4IT6 A;  1CTN A;  4JFM A;  5DIU A;  4NZC A;  1N1A A;  5HKG A;  3B9A A;  4WIW A;  1FKJ A;  4ZS6 A;  3ARX A;  5J6E A;  2ZQU A;  3RME A;  1FFR A;  4S3K A;  5DEZ A;  2KE0 A;  2KFW A;  1FKF A;  3BXW A;  1B6C A;  2OFN A;  1FKL A;  3WQV A;  4AY1 A;  4DRI A;  3OOB A;  1FKD A;  1NWU A;  1SR0 A;  4XAK A;  2RUR A;  1JNS A;  1LJY A;  2DSU A;  3CHD A;  1FJD A;  4ZPT R;  4QIB A;  3ARO A;  1D2K A;  4Q7N A;  1E6P A;  2DG3 A;  1HKI A;  1OGG A;  2PBC A;  4MAV A;  1FKI A;  1H0I A;  3O5K A;  2G8Z A;  5GQB A;  2KR7 A;  2QF8 A;  4HBO A;  2MLZ A;  4MTV A;  1ZU8 A;  2RUC A;  4TW8 A;  4U84 A;  2DSV A;  3JYJ A;  4W5U A;  1D7J A;  3QOK A;  4P8U A;  3RGC A;  2ZQT A;  4IPX A;  1EYM A;  4TX0 A;  1JVW A;  1GOI A;  1OWQ A;  3IK8 A;  3OA5 A;  1ZBC A;  5GPR A;  4NSB A;  1W9V A;  1FKT A;  3WH0 A;  2IUZ A;  1E9L A;  3AQU A;  4Z2L A;  1O6I A;  2LKN A;  2DT0 A;  1VF8 A;  5DIT A;  2PV2 A;  4DRM A;  4QT3 A;  4JYS A;  2LJ4 A;  1IX5 A;  2ZR6 A;  2VN1 A;  1E6Z A;  4DZ2 A;  1HKK A;  4DWS D;  4DRP A;  3KAB A;  1OGB A;  5HBF A;  1LL4 A;  2L2S A;  2A3C A;  4J4O A;  1EQ3 A;  4TYO A;  3WD0 A;  1KFW A;  2AWG A;  2OLH A;  2XP9 A;  3ART A;  3VAW A;  4P8X A;  5HWC A;  3KCE A;  2WLY A;  4MPK A;  2XP5 A;  3ARP A;  4QZV B;  3WIJ A;  3CGN A;  4ZPW R;  3ARZ A;  2PI6 A;  3UI4 A;  1NSG A;  3FY1 A;  5HWB A;  1LG1 A;  1HJV A;  3ALG A;  4LAX A;  1XRV A;  3ALF A;  1HKM A;  1NH6 A;  3MDY B;  2JZV A;  2WK2 A;  4MNK A;  3NI6 A;  4Q22 A;  4HAR A;  1TCO C;  1UR8 A;  5HW7 A;  2XPB A;  2WLZ A;  3KZ7 A;  3PR9 A;  4BF8 A;  4ITZ A;  2PPP A;  4NNR A;  4QT2 A;  1W26 A;  5DF0 A;  1NMV A;  4DRK A;  1NMW A;  4LGX A;  5HW8 A;  2M1I A;  3O5P A;  5BXJ A;  4WKH A;  3ARY A;  3TDB A;  1UR9 A;  3UF8 A;  1FKK A;  1HJW A;  4C02 B;  4JFI A;  1QZ2 A;  4JFL A;  4KR0 B;  3B7X A;  4DH0 A;  3PRD A;  2ESC A;  3O5M A;  2RUD A;  1KT1 A;  2MLX A;  4P8V A;  5HT1 A;  4PTM A;  3WQW A;  3PRA A;  1HKJ A;  2PV3 A;  3O5E A;  2LGO A;  3O5F A;  1H0G A;  3NTP A;  4LAW A;  3KAH A;  1D7H A;  4WJX A;  3IHZ A;  2LPV A;  1ZCN A;  3O5O A;  1ZBK A;  4DRH A;  3O5G A;  4IQ2 A;  3ARU A;  1D6O A;  1BKF A;  2XP8 A;  3G6M A;  2M08 A;  2DSZ A;  5HW6 A;  3RFW A;  3UQI A;  4URI A;  4W9P A;  2M2A A;  1HJX A;  5HTG A;  3AS0 A;  1W1P A;  3KAI A;  4N19 A;  4KQZ A;  1ITX A;  1J4I A;  4L72 B;  3PA7 A;  1A7X A;  4GGQ A;  3O5L A;  4LAY A;  4L3N A;  3FXY A;  3CH9 A;  3UQA A;  1J4R A;  1GPF A;  2RUQ A;  2DG4 A;  1U79 A;  1FAP A;  1F8A B;  1FKS A;  4G50 A;  1NWT A;  2N87 A;  2Y78 A;  2PPN A;  5D75 A;  3JXV A;  4WK9 A;  2ZR4 A;  2PPO A;  4DWS B;  1ZB5 A;  2YBU A;  4HBE A;  3WL1 A;  4Z2H A;  1ZBV A;  2FAP A;  4DZ3 A;  2F4E A;  1J6Y A;  4ODQ A;  3O5J A;  4GIV A;  1YAT A;  1E6N A;  3UQB A;  4S3J A;  2IF4 A;  5DO2 A;  1ROT A;  1Q1C A;  3KAG A;  1ZK6 A;  4ODK A;  4ODO A;  1NWS A;  5HUA A;  1WB0 A;  1Q6I A;  3RM4 A;  1WAW A;  3I6C A;  2RQS A;  1LL6 A;  3O5D A;  2DT2 A;  1W9U A;  2DG9 A;  2KI3 A;  1TFV A;  2VCD A;  4ML4 A;  3AS3 A;  4IQC A;  1FFQ A;  3IKG A;  1Q6H A;  1R9H A;  4ODM A;  1FKG A;  1ZL1 A;  4WKA A;  1RD6 A;  4TW6 A;  1W1V A;  4W9Q A;  4DWS A;  1HXV A;  1FKR A;  4MGV A;  5JH8 A;  1JND A;  3ARW A;  1K9T A;  3CHF A;  2F21 A;  2XP4 A;  3PRB A;  1LQ0 A;  3CHE A;  4ODL A;  4DRO A;  1KT0 A;  4ZPV R;  1Y0O A;  2KO7 A;  3TCZ A;  1WNO A;  4DRQ A;  4Z2J A;  1W9P A;  2UZ5 A;  3GPK A;  4ODP A;  3WKZ A;  4FN2 A;  1FKH A;  2A3A A;  5I98 A;  5GPG A;  4J4N A;  1GUV A;  3WL0 A;  2D9F A;  3ODK A;  2XP3 A;  3FAP A;  2B31 A;  1C9H A;  3ARS A;  1SYT A;  2FKE A;  4JFK A;  1E15 A;  1JNE A;  3WD2 A;  3CGM A;  1ROU A;  3CZ8 A;  3EY6 A;  4U86 A;  1L1P A;  3H9R B;  4TNS A;  2DPE A;  3WD4 A;  4Z2K A;  3W4R A;  3B8S A;  1J4H A;  3CHC A;  2K8I A;  1M5Y A;  1QPF A;  2FDM A;  4DT4 A;  2F2D A;  1X6N A;  4MNL A;  1PBK A;  3ARQ A;  2O9O A;  2AOS A;  3WD1 A;  3B9E A;  1EIB A;  1NWR A;  4O2T A;  3B9D A;  2KGJ A;  2ZQS A;  4MNJ A;  4Z2I A;  4G2P A;  2MPH A;  4FAP A;  3KAD A;  4LAV A;  4R0X A;  3UI5 A;  2MNT A;  1W1T A;  3AS1 A;  1Q6U A;  1FD9 A;  5B8I C;  1BL4 A;  1T11 A;  4DRN A;  3RM8 A;  3O5R A;  4WKF A;  4DWS C;  2O92 A;  2PV1 A;  4DIP A;  4R5E A;  1X6L A;  2WM0 A;  3ARV A;  3AS2 A;  3G6L A;  3NRK A;  3KAC A;  1F40 A;  4ODR A;  2ZR5 A;  2XP7 A;  3RM9 A;  3TC5 A;  1JNT A;  1YW5 A;  1LL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...