1FKDA

Fk-506 binding protein: three-dimensional structure of the complex with the antagonist l-685,818
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title FK-506-binding protein: three-dimensional structure of the complex with the antagonist L-685,818.
pubmed rcsb
source organism Homo sapiens
molecule tags Cis-trans isomerase
molecule keywords FK506 BINDING PROTEIN
total genus 25
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1992-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkdA00
3O5LA 4JFIA 4R0XA 4DRHA 5HWCA 2ZR5A 1ROTA 2M08A 1PBKA 1W26A 1D6OA 2XP3A 3NRKA 4IPXA 5B8IC 5BXJA 2XP7A 2D9FA 3NTPA 3O5KA 3LUOA 3O5IA 1QPFA 3RFWA 1J4IA 1FJDA 4DRIA 2ZQUA 1FKBA 1NSGA 4W9OA 2MLYA 5J6EA 1BKFA 1Q6IA 1ZK6A 2F4EA 4IQCA 2Q5AA 1QPLA 3CGNA 4JFKA 1FD9A 2RUDA 3O5DA 4ITZA 3TC5A 3UI5A 2PV2A 4N19A 1FAPA 1A7XA 1FKSA 3TDBA 3MDYB 2MLXA 1FKKA 2M2AA 4ODRA 1P5QA 1Q6HA 4GGQA 3IK8A 1F8AB 2RQSA 1FKHA 3KABA 3WH0A 2PBCA 3ODKA 2FKEA 2LJ4A 2ZQTA 3UI6A 3UI4A 4DT4A 2L2SA 4W9QA 4DIPA 2LGOA 5HW6A 3PRDA 3PRBA 2Y78A 3OOBA 4DRNA 4G2PA 2PV3A 4GIVA 1ZCNA 2ZQSA 4J4NA 4U84A 5HWBA 1PINA 4NNRA 2PPOA 3I6CA 4TX0A 3UQBA 4O2TA 2ZR6A 4U86A 1YATA 4ODLA 4TW6A 3CGMA 3KADA 5HTGA 3O5QA 4MSPA 5D75A 1NMWA 4ODMA 1FKIA 5I98A 3O5PA 1EQ3A 1FKTA 2MLZA 3KAFA 4ODKA 1B6CA 2RURA 4QT3A 3KCEA 2MF9A 2KFWA 2ITKA 2LPVA 2XP6A 2PPPA 3KAIA 4DZ3A 2F21A 2UZ5A 2RUQA 2ZQVA 3UQIA 1FKGA 2K8IA 1KT1A 4TNSA 2FAPA 2XPAA 4ODQA 3RGCA 4LAYA 3O5OA 4W9PA 1JNSA 4JFJA 4U85A 3KZ7A 4G50A 4DRKA 4DRJA 4JFMA 5HKGA 2AWGA 5HT1A 4DRQA 3EY6A 1J4HA 1J4RA 3O5MA 3O5JA 1JNTA 4ODNA 1Q6UA 1Y0OA 4J4OA 2VCDA 2DG3A 5HUAA 2ZR4A 3H9RB 2IF4A 3UF8A 5HW8A 4ODOA 3GPKA 2F2DA 1KT0A 1FKFA 2N87A 4QT2A 5DITA 2KE0A 2PPNA 4BF8A 1HXVA 4LAVA 2JZVA 1FKLA 3O5EA 4LAXA 5HW7A 4MGVA 1D7HA 3KAGA 3PA7A 1N1AA 4ODPA 4TW7A 4DRPA 4FAPA 1QZ2A 2XP4A 1YW5A 3KAHA 3KACA 1D7JA 3VAWA 2RSEA 4JYSA 1NMVA 2KGJA 5DIVA 2DG4A 2XP8A 4C02B 2M1IA 3JXVA 3O5RA 1EYMA 2KR7A 4IQ2A 1J6YA 1FKJA 4QIBA 2MPHA 2DG9A 3FAPA 5GPGA 2XPBA 1FKRA 4JFLA 1F40A 4DROA 1R9HA 1L1PA 2VN1A 2RUCA 3IKGA 1U79A 3NI6A 4TW8A 1TCOC 3B7XA 2MNTA 1JVWA 3IHZA 2KO7A 2LKNA 1D7IA 2XP5A 4FN2A 1FKDA 4LAWA 4DH0A 3JYJA 3TCZA 1C9HA 2XP9A 3IKDA 3O5GA 4TYOA 4DZ2A 1BL4A 1T11A 1Q1CA 3UQAA 2PV1A 3JYMA 1M5YA 1ROUA 2KI3A 4DRMA 3O5FA 2OFNA 5DIUA
chains in the Genus database with same CATH superfamily
4DRHA 1ROTA 1LL6A 4IPXA 3NRKA 1D6OA 5BXJA 1LJYA 2XP7A 3PR9A 3LUOA 1J4IA 1FJDA 4URIA 1ZK6A 4NZCA 2Q5AA 2RUDA 2PV2A 3ARUA 3ARPA 3IK8A 1FKHA 3AQUA 3KABA 3ODKA 4Q7NA 3UI4A 2LJ4A 3ARTA 4MNLA 3CHFA 2LGOA 5HW6A 3PRDA 4GIVA 5HWBA 1PINA 4NNRA 4Z2KA 4U86A 1FKIA 3O5PA 2G41A 1B6CA 4QT3A 1FFRA 2PPPA 1D2KA 3KAIA 2F21A 4P8WA 2ZQVA 2XPAA 4ODQA 3O5OA 4S3KA 4W9PA 3ALFA 1EDQA 4G50A 1W1VA 4DRJA 2AOSA 5HKGA 5HT1A 1J4HA 1JNTA 1JNEA 2VCDA 4HARA 5HUAA 1UR9A 4ODOA 3OA5A 5DITA 4W5UA 1OGGA 3B9AA 5HW7A 4LAXA 4MGVA 4HBOA 4TW7A 4FAPA 1QZ2A 1EHNA 3KAHA 3WL1A 3VAWA 5GQBA 2KGJA 2XP8A 2M1IA 3O5RA 1FKJA 2XPBA 4IT6A 1XHGA 1R9HA 2RUCA 3IKGA 3NI6A 2MNTA 3IHZA 2KO7A 2LKNA 1GOIA 1H0GA 2XP9A 3IKDA 2PV1A 1M5YA 4MNJA 3O5FA 2OFNA 4DROA 3O5LA 4JFIA 4R0XA 3RM9A 4DWSC 1NWRA 1PBKA 2M08A 3B9DA 1NWSA 3O5KA 1QPFA 2P4VA 2ZQUA 2MLYA 1Q6IA 3WD3A 4JFKA 1ZB5A 1ZBCA 3TC5A 3WQVA 4L72B 2DT3A 3AS3A 4N19A 3TDBA 3MDYB 2WM0A 2DT0A 2RQSA 3ARZA 3WH0A 1W1YA 1E6RA 2L2SA 4DIPA 1NWUA 1W1TA 3OOBA 4DRNA 1ZCNA 2DSWA 2ZQSA 3AS1A 4TX0A 4NSBA 1YATA 2WK2A 1WB0A 3ARYA 4MSPA 1W9PA 5D75A 3AS2A 4P8UA 2EULA 2LPVA 2XP6A 1UR8A 4R5EA 1O6IA 2UZ5A 3RM4A 3UQIA 1KT1A 4TNSA 4LAYA 3BXWA 1E15A 3KZ7A 1XRVA 4DRKA 2A3CA 1SYTA 4JFMA 1HKIA 2AWGA 4ML4A 4WK9A 1J4RA 3O5JA 4L3NA 4J4OA 2DSZA 1LL4A 2IF4A 4P8XA 3GPKA 5HBFA 2N87A 4BF8A 3PRAA 3ARSA 1D7HA 3WD0A 4DRPA 1LG1A 1RD6A 1D7JA 1NMVA 5DIVA 2B5UB 1J6YA 4QIBA 2MPHA 3FAPA 5DO2A 1X6NA 1L1PA 2VN1A 1VF8A 2ESCA 1TCOC 1JVWA 2DT1A 1LL7A 1HKJA 1D7IA 4DH0A 3CHDA 3JYJA 3WD1A 3O5GA 4DZ2A 1T11A 2WLZA 1KFWA 2B31A 3JYMA 3WQWA 2YBTA 5DIUA 1HKMA 5HWCA 4XAKA 2ZR5A 2DT2A 2XP3A 3ARRA 3G6MA 3RM8A 4W9OA 1NSGA 3QOKA 4IQCA 1HJWA 1QPLA 3CGNA 2DSUA 3O5DA 4ITZA 2WLYA 4Q22A 4MPKA 3ARWA 1W9UA 1FAPA 1A7XA 4ODRA 1P5QA 3G6LA 4WKFA 1F8AB 3B9EA 2PBCA 3AS0A 2ZQTA 4DT4A 4WIWA 4Z2LA 4W9QA 4MAVA 1E44A 2Y78A 3PRBA 1IX5A 2PV3A 4U84A 1JCHB 3ARQA 3CH9A 4ODLA 1E6PA 3CGMA 1E6NA 5I98A 1EQ3A 1GUVA 2MLZA 2RURA 2F23A 4P8VA 4ZPVR 3KCEA 2KFWA 3RMEA 4DZ3A 2K8IA 5DEZA 4PTMA 1LQ0A 3GTYX 4DWSD 3GU0A 4DWSA 3EY6A 3CHEA 3O5MA 5GPRA 2DPEA 3CHCA 1Y0OA 2DG3A 2DSVA 4Z2GA 2O9OA 2ZR4A 3ALGA 5HW8A 1OGBA 1ZBWA 1FKFA 2PPNA 2IUZA 1W9VA 2JZVA 3O5EA 4ZS6A 3ARVA 4S3JA 2XP4A 1SR0A 1YW5A 1GPFA 3KACA 3B8SA 1HJVA 4JYSA 3FY1A 4UDMA 1HKKA 4IQ2A 1E6ZA 1EYMA 3CZ8A 5GPGA 1ZU8A 1F40A 1NWTA 3AROA 4TW8A 3ARXA 4FN2A 1FKDA 1OWQA 1W1PA 3TCZA 4TYOA 4WKHA 1Q1CA 3UQAA 2KI3A 4DRMA 4LGXA 4DWSB 2QF8A 1W26A 4ZPTR 5B8IC 3FXYA 2D9FA 3NTPA 3O5IA 3RFWA 4DRIA 1HJXA 1FKBA 5J6EA 1BKFA 2F4EA 1WAWA 1ZL1A 1ITXA 4IT4A 4ZPWR 2ETNA 1FD9A 1NH6A 3UI5A 3W4RA 1ZBKA 1EIBA 1FFQA 1FKSA 2MLXA 1FKKA 2M2AA 1ZBVA 1Q6HA 4WJXA 2G8ZA 4GGQA 3WD2A 2FKEA 1H0IA 3UI6A 2A3AA 4WKAA 4Z2IA 4G2PA 4J4NA 3WD4A 2PI6A 2PPOA 3I6CA 3UQBA 4O2TA 2ZR6A 4QZVB 1GRJA 4TW6A 4MTVA 3KADA 5HTGA 3O5QA 3WL0A 1NMWA 4ODMA 2A3BA 1FKTA 3KAFA 2FDMA 4ODKA 1X6LA 2PN0A 1JNDA 1WNOA 2MF9A 2ITKA 2RUQA 1FKGA 2O92A 2FAPA 4Z2JA 3RGCA 5DF0A 3WIJA 4AY1A 1JNSA 4JFJA 4U85A 2YBUA 4DRQA 4MNKA 4ODNA 1Q6UA 1TFVA 1E9LA 3H9RB 3UF8A 2F2DA 1KT0A 4QT2A 2KE0A 1HXVA 4LAVA 1FKLA 4HBEA 3KAGA 3PA7A 2OLHA 1N1AA 4KR0B 4ODPA 2RSEA 3EIPA 2DG4A 4C02B 3JXVA 2KR7A 2DG9A 1K9TA 1FKRA 4JFLA 1U79A 3BMBA 3B7XA 1CTNA 4Z2HA 2XP5A 4LAWA 5JH8A 1C9HA 4MNMA 1BL4A 3WKZA 1LG2A 1ROUA 2A3EA 4KQZA
chains in the Genus database with same CATH topology
4DRHA 1ROTA 1LL6A 4IPXA 3NRKA 1D6OA 5BXJA 1LJYA 2XP7A 3PR9A 3LUOA 1J4IA 1FJDA 4URIA 1ZK6A 4NZCA 2Q5AA 2RUDA 2PV2A 3ARUA 3ARPA 3IK8A 1FKHA 3AQUA 3KABA 3ODKA 4Q7NA 3UI4A 2LJ4A 3ARTA 4MNLA 3CHFA 2LGOA 5HW6A 3PRDA 4GIVA 5HWBA 1PINA 4NNRA 4Z2KA 4U86A 1FKIA 3O5PA 2G41A 1B6CA 4QT3A 1FFRA 2PPPA 1D2KA 3KAIA 2F21A 4P8WA 2ZQVA 2XPAA 4ODQA 3O5OA 4S3KA 4W9PA 3ALFA 1EDQA 4G50A 1W1VA 4DRJA 2AOSA 5HKGA 5HT1A 1J4HA 1JNTA 1JNEA 2VCDA 4HARA 5HUAA 1UR9A 4ODOA 3OA5A 5DITA 4W5UA 1OGGA 3B9AA 5HW7A 4LAXA 4MGVA 4HBOA 4TW7A 4FAPA 1QZ2A 1EHNA 3KAHA 3WL1A 3VAWA 5GQBA 2KGJA 2XP8A 2M1IA 3O5RA 1FKJA 2XPBA 4IT6A 1XHGA 1R9HA 2RUCA 3IKGA 3NI6A 2MNTA 3IHZA 2KO7A 2LKNA 1GOIA 1H0GA 2XP9A 3IKDA 2PV1A 1M5YA 4MNJA 3O5FA 2OFNA 4DROA 3O5LA 4JFIA 4R0XA 3RM9A 4DWSC 1NWRA 1PBKA 2M08A 3B9DA 1NWSA 3O5KA 1QPFA 2ZQUA 2MLYA 1Q6IA 3WD3A 4JFKA 1ZB5A 1ZBCA 3TC5A 3WQVA 4L72B 2DT3A 3AS3A 4N19A 3TDBA 3MDYB 2WM0A 2DT0A 2RQSA 3ARZA 3WH0A 1W1YA 1E6RA 2L2SA 4DIPA 1NWUA 1W1TA 3OOBA 4DRNA 1ZCNA 2DSWA 2ZQSA 3AS1A 4TX0A 4NSBA 1YATA 2WK2A 1WB0A 3ARYA 4MSPA 1W9PA 5D75A 3AS2A 4P8UA 2LPVA 2XP6A 1UR8A 4R5EA 1O6IA 2UZ5A 3RM4A 3UQIA 1KT1A 4TNSA 4LAYA 3BXWA 1E15A 3KZ7A 1XRVA 4DRKA 2A3CA 1SYTA 4JFMA 1HKIA 2AWGA 4ML4A 4WK9A 1J4RA 3O5JA 4L3NA 4J4OA 2DSZA 1LL4A 2IF4A 4P8XA 3GPKA 5HBFA 2N87A 4BF8A 3PRAA 3ARSA 1D7HA 3WD0A 4DRPA 1LG1A 1RD6A 1D7JA 1NMVA 5DIVA 1J6YA 4QIBA 2MPHA 3FAPA 5DO2A 1X6NA 1L1PA 2VN1A 1VF8A 2ESCA 1TCOC 1JVWA 2DT1A 1LL7A 1HKJA 1D7IA 4DH0A 3CHDA 3JYJA 3WD1A 3O5GA 4DZ2A 1T11A 2WLZA 1KFWA 2B31A 3JYMA 3WQWA 2YBTA 5DIUA 1HKMA 5HWCA 4XAKA 2ZR5A 2DT2A 2XP3A 3ARRA 3G6MA 3RM8A 4W9OA 1NSGA 3QOKA 4IQCA 1HJWA 1QPLA 3CGNA 2DSUA 3O5DA 4ITZA 2WLYA 4Q22A 4MPKA 3ARWA 1W9UA 1FAPA 1A7XA 4ODRA 1P5QA 3G6LA 4WKFA 1F8AB 3B9EA 2PBCA 3AS0A 2ZQTA 4DT4A 4WIWA 4Z2LA 4W9QA 4MAVA 3PRBA 2Y78A 1IX5A 2PV3A 4U84A 3ARQA 3CH9A 4ODLA 1E6PA 3CGMA 1E6NA 5I98A 1EQ3A 1GUVA 2MLZA 2RURA 4P8VA 4ZPVR 3KCEA 2KFWA 3RMEA 4DZ3A 2K8IA 5DEZA 4PTMA 1LQ0A 4DWSD 4DWSA 3EY6A 3CHEA 3O5MA 5GPRA 2DPEA 3CHCA 1Y0OA 2DG3A 2DSVA 4Z2GA 2O9OA 2ZR4A 3ALGA 5HW8A 1OGBA 1ZBWA 1FKFA 2PPNA 2IUZA 1W9VA 2JZVA 3O5EA 4ZS6A 3ARVA 4S3JA 2XP4A 1SR0A 1YW5A 1GPFA 3KACA 3B8SA 1HJVA 4JYSA 3FY1A 1HKKA 4IQ2A 1E6ZA 1EYMA 3CZ8A 5GPGA 1ZU8A 1F40A 1NWTA 3AROA 4TW8A 3ARXA 4FN2A 1FKDA 1OWQA 1W1PA 3TCZA 4TYOA 4WKHA 1Q1CA 3UQAA 2KI3A 4DRMA 4LGXA 4DWSB 2QF8A 1W26A 4ZPTR 5B8IC 3FXYA 2D9FA 3NTPA 3O5IA 3RFWA 4DRIA 1HJXA 1FKBA 5J6EA 1BKFA 2F4EA 1WAWA 1ZL1A 1ITXA 4IT4A 4ZPWR 1FD9A 1NH6A 3UI5A 3W4RA 1ZBKA 1EIBA 1FFQA 1FKSA 2MLXA 1FKKA 2M2AA 1ZBVA 1Q6HA 4WJXA 2G8ZA 4GGQA 3WD2A 2FKEA 1H0IA 3UI6A 2A3AA 4WKAA 4Z2IA 4G2PA 4J4NA 3WD4A 2PI6A 2PPOA 3I6CA 3UQBA 4O2TA 2ZR6A 4QZVB 4TW6A 4MTVA 3KADA 5HTGA 3O5QA 3WL0A 1NMWA 4ODMA 2A3BA 1FKTA 3KAFA 2FDMA 4ODKA 1X6LA 1JNDA 1WNOA 2MF9A 2ITKA 2RUQA 1FKGA 2O92A 2FAPA 4Z2JA 3RGCA 5DF0A 3WIJA 4AY1A 1JNSA 4JFJA 4U85A 2YBUA 4DRQA 4MNKA 4ODNA 1Q6UA 1TFVA 1E9LA 3H9RB 3UF8A 2F2DA 1KT0A 4QT2A 2KE0A 1HXVA 4LAVA 1FKLA 4HBEA 3KAGA 3PA7A 2OLHA 1N1AA 4KR0B 4ODPA 2RSEA 2DG4A 4C02B 3JXVA 2KR7A 2DG9A 1K9TA 1FKRA 4JFLA 1U79A 3B7XA 1CTNA 4Z2HA 2XP5A 4LAWA 5JH8A 1C9HA 4MNMA 1BL4A 3WKZA 1LG2A 1ROUA 2A3EA 4KQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5L A;  4JFI A;  4R0X A;  4DRH A;  5HWC A;  2ZR5 A;  1ROT A;  2M08 A;  1PBK A;  1W26 A;  1D6O A;  2XP3 A;  3NRK A;  4IPX A;  5B8I C;  5BXJ A;  2XP7 A;  2D9F A;  3NTP A;  3O5K A;  3LUO A;  3O5I A;  1QPF A;  3RFW A;  1J4I A;  1FJD A;  4DRI A;  2ZQU A;  1FKB A;  1NSG A;  4W9O A;  2MLY A;  5J6E A;  1BKF A;  1Q6I A;  1ZK6 A;  2F4E A;  4IQC A;  2Q5A A;  1QPL A;  3CGN A;  4JFK A;  1FD9 A;  2RUD A;  3O5D A;  4ITZ A;  3TC5 A;  3UI5 A;  2PV2 A;  4N19 A;  1FAP A;  1A7X A;  1FKS A;  3TDB A;  3MDY B;  2MLX A;  1FKK A;  2M2A A;  4ODR A;  1P5Q A;  1Q6H A;  4GGQ A;  3IK8 A;  1F8A B;  2RQS A;  1FKH A;  3KAB A;  3WH0 A;  2PBC A;  3ODK A;  2FKE A;  2LJ4 A;  2ZQT A;  3UI6 A;  3UI4 A;  4DT4 A;  2L2S A;  4W9Q A;  4DIP A;  2LGO A;  5HW6 A;  3PRD A;  3PRB A;  2Y78 A;  3OOB A;  4DRN A;  4G2P A;  2PV3 A;  4GIV A;  1ZCN A;  2ZQS A;  4J4N A;  4U84 A;  5HWB A;  1PIN A;  4NNR A;  2PPO A;  3I6C A;  4TX0 A;  3UQB A;  4O2T A;  2ZR6 A;  4U86 A;  1YAT A;  4ODL A;  4TW6 A;  3CGM A;  3KAD A;  5HTG A;  3O5Q A;  4MSP A;  5D75 A;  1NMW A;  4ODM A;  1FKI A;  5I98 A;  3O5P A;  1EQ3 A;  1FKT A;  2MLZ A;  3KAF A;  4ODK A;  1B6C A;  2RUR A;  4QT3 A;  3KCE A;  2MF9 A;  2KFW A;  2ITK A;  2LPV A;  2XP6 A;  2PPP A;  3KAI A;  4DZ3 A;  2F21 A;  2UZ5 A;  2RUQ A;  2ZQV A;  3UQI A;  1FKG A;  2K8I A;  1KT1 A;  4TNS A;  2FAP A;  2XPA A;  4ODQ A;  3RGC A;  4LAY A;  3O5O A;  4W9P A;  1JNS A;  4JFJ A;  4U85 A;  3KZ7 A;  4G50 A;  4DRK A;  4DRJ A;  4JFM A;  5HKG A;  2AWG A;  5HT1 A;  4DRQ A;  3EY6 A;  1J4H A;  1J4R A;  3O5M A;  3O5J A;  1JNT A;  4ODN A;  1Q6U A;  1Y0O A;  4J4O A;  2VCD A;  2DG3 A;  5HUA A;  2ZR4 A;  3H9R B;  2IF4 A;  3UF8 A;  5HW8 A;  4ODO A;  3GPK A;  2F2D A;  1KT0 A;  1FKF A;  2N87 A;  4QT2 A;  5DIT A;  2KE0 A;  2PPN A;  4BF8 A;  1HXV A;  4LAV A;  2JZV A;  1FKL A;  3O5E A;  4LAX A;  5HW7 A;  4MGV A;  1D7H A;  3KAG A;  3PA7 A;  1N1A A;  4ODP A;  4TW7 A;  4DRP A;  4FAP A;  1QZ2 A;  2XP4 A;  1YW5 A;  3KAH A;  3KAC A;  1D7J A;  3VAW A;  2RSE A;  4JYS A;  1NMV A;  2KGJ A;  5DIV A;  2DG4 A;  2XP8 A;  4C02 B;  2M1I A;  3JXV A;  3O5R A;  1EYM A;  2KR7 A;  4IQ2 A;  1J6Y A;  1FKJ A;  4QIB A;  2MPH A;  2DG9 A;  3FAP A;  5GPG A;  2XPB A;  1FKR A;  4JFL A;  1F40 A;  4DRO A;  1R9H A;  1L1P A;  2VN1 A;  2RUC A;  3IKG A;  1U79 A;  3NI6 A;  4TW8 A;  1TCO C;  3B7X A;  2MNT A;  1JVW A;  3IHZ A;  2KO7 A;  2LKN A;  1D7I A;  2XP5 A;  4FN2 A;  1FKD A;  4LAW A;  4DH0 A;  3JYJ A;  3TCZ A;  1C9H A;  2XP9 A;  3IKD A;  3O5G A;  4TYO A;  4DZ2 A;  1BL4 A;  1T11 A;  1Q1C A;  3UQA A;  2PV1 A;  3JYM A;  1M5Y A;  1ROU A;  2KI3 A;  4DRM A;  3O5F A;  2OFN A;  5DIU A; 
#chains in the Genus database with same CATH topology
 4DRH A;  1ROT A;  1LL6 A;  4IPX A;  3NRK A;  1D6O A;  5BXJ A;  1LJY A;  2XP7 A;  3PR9 A;  3LUO A;  1J4I A;  1FJD A;  4URI A;  1ZK6 A;  4NZC A;  2Q5A A;  2RUD A;  2PV2 A;  3ARU A;  3ARP A;  3IK8 A;  1FKH A;  3AQU A;  3KAB A;  3ODK A;  4Q7N A;  3UI4 A;  2LJ4 A;  3ART A;  4MNL A;  3CHF A;  2LGO A;  5HW6 A;  3PRD A;  4GIV A;  5HWB A;  1PIN A;  4NNR A;  4Z2K A;  4U86 A;  1FKI A;  3O5P A;  2G41 A;  1B6C A;  4QT3 A;  1FFR A;  2PPP A;  1D2K A;  3KAI A;  2F21 A;  4P8W A;  2ZQV A;  2XPA A;  4ODQ A;  3O5O A;  4S3K A;  4W9P A;  3ALF A;  1EDQ A;  4G50 A;  1W1V A;  4DRJ A;  2AOS A;  5HKG A;  5HT1 A;  1J4H A;  1JNT A;  1JNE A;  2VCD A;  4HAR A;  5HUA A;  1UR9 A;  4ODO A;  3OA5 A;  5DIT A;  4W5U A;  1OGG A;  3B9A A;  5HW7 A;  4LAX A;  4MGV A;  4HBO A;  4TW7 A;  4FAP A;  1QZ2 A;  1EHN A;  3KAH A;  3WL1 A;  3VAW A;  5GQB A;  2KGJ A;  2XP8 A;  2M1I A;  3O5R A;  1FKJ A;  2XPB A;  4IT6 A;  1XHG A;  1R9H A;  2RUC A;  3IKG A;  3NI6 A;  2MNT A;  3IHZ A;  2KO7 A;  2LKN A;  1GOI A;  1H0G A;  2XP9 A;  3IKD A;  2PV1 A;  1M5Y A;  4MNJ A;  3O5F A;  2OFN A;  4DRO A;  3O5L A;  4JFI A;  4R0X A;  3RM9 A;  4DWS C;  1NWR A;  1PBK A;  2M08 A;  3B9D A;  1NWS A;  3O5K A;  1QPF A;  2P4V A;  2ZQU A;  2MLY A;  1Q6I A;  3WD3 A;  4JFK A;  1ZB5 A;  1ZBC A;  3TC5 A;  3WQV A;  4L72 B;  2DT3 A;  3AS3 A;  4N19 A;  3TDB A;  3MDY B;  2WM0 A;  2DT0 A;  2RQS A;  3ARZ A;  3WH0 A;  1W1Y A;  1E6R A;  2L2S A;  4DIP A;  1NWU A;  1W1T A;  3OOB A;  4DRN A;  1ZCN A;  2DSW A;  2ZQS A;  3AS1 A;  4TX0 A;  4NSB A;  1YAT A;  2WK2 A;  1WB0 A;  3ARY A;  4MSP A;  1W9P A;  5D75 A;  3AS2 A;  4P8U A;  2EUL A;  2LPV A;  2XP6 A;  1UR8 A;  4R5E A;  1O6I A;  2UZ5 A;  3RM4 A;  3UQI A;  1KT1 A;  4TNS A;  4LAY A;  3BXW A;  1E15 A;  3KZ7 A;  1XRV A;  4DRK A;  2A3C A;  1SYT A;  4JFM A;  1HKI A;  2AWG A;  4ML4 A;  4WK9 A;  1J4R A;  3O5J A;  4L3N A;  4J4O A;  2DSZ A;  1LL4 A;  2IF4 A;  4P8X A;  3GPK A;  5HBF A;  2N87 A;  4BF8 A;  3PRA A;  3ARS A;  1D7H A;  3WD0 A;  4DRP A;  1LG1 A;  1RD6 A;  1D7J A;  1NMV A;  5DIV A;  2B5U B;  1J6Y A;  4QIB A;  2MPH A;  3FAP A;  5DO2 A;  1X6N A;  1L1P A;  2VN1 A;  1VF8 A;  2ESC A;  1TCO C;  1JVW A;  2DT1 A;  1LL7 A;  1HKJ A;  1D7I A;  4DH0 A;  3CHD A;  3JYJ A;  3WD1 A;  3O5G A;  4DZ2 A;  1T11 A;  2WLZ A;  1KFW A;  2B31 A;  3JYM A;  3WQW A;  2YBT A;  5DIU A;  1HKM A;  5HWC A;  4XAK A;  2ZR5 A;  2DT2 A;  2XP3 A;  3ARR A;  3G6M A;  3RM8 A;  4W9O A;  1NSG A;  3QOK A;  4IQC A;  1HJW A;  1QPL A;  3CGN A;  2DSU A;  3O5D A;  4ITZ A;  2WLY A;  4Q22 A;  4MPK A;  3ARW A;  1W9U A;  1FAP A;  1A7X A;  4ODR A;  1P5Q A;  3G6L A;  4WKF A;  1F8A B;  3B9E A;  2PBC A;  3AS0 A;  2ZQT A;  4DT4 A;  4WIW A;  4Z2L A;  4W9Q A;  4MAV A;  1E44 A;  2Y78 A;  3PRB A;  1IX5 A;  2PV3 A;  4U84 A;  1JCH B;  3ARQ A;  3CH9 A;  4ODL A;  1E6P A;  3CGM A;  1E6N A;  5I98 A;  1EQ3 A;  1GUV A;  2MLZ A;  2RUR A;  2F23 A;  4P8V A;  4ZPV R;  3KCE A;  2KFW A;  3RME A;  4DZ3 A;  2K8I A;  5DEZ A;  4PTM A;  1LQ0 A;  3GTY X;  4DWS D;  3GU0 A;  4DWS A;  3EY6 A;  3CHE A;  3O5M A;  5GPR A;  2DPE A;  3CHC A;  1Y0O A;  2DG3 A;  2DSV A;  4Z2G A;  2O9O A;  2ZR4 A;  3ALG A;  5HW8 A;  1OGB A;  1ZBW A;  1FKF A;  2PPN A;  2IUZ A;  1W9V A;  2JZV A;  3O5E A;  4ZS6 A;  3ARV A;  4S3J A;  2XP4 A;  1SR0 A;  1YW5 A;  1GPF A;  3KAC A;  3B8S A;  1HJV A;  4JYS A;  3FY1 A;  4UDM A;  1HKK A;  4IQ2 A;  1E6Z A;  1EYM A;  3CZ8 A;  5GPG A;  1ZU8 A;  1F40 A;  1NWT A;  3ARO A;  4TW8 A;  3ARX A;  4FN2 A;  1FKD A;  1OWQ A;  1W1P A;  3TCZ A;  4TYO A;  4WKH A;  1Q1C A;  3UQA A;  2KI3 A;  4DRM A;  4LGX A;  4DWS B;  2QF8 A;  1W26 A;  4ZPT R;  5B8I C;  3FXY A;  2D9F A;  3NTP A;  3O5I A;  3RFW A;  4DRI A;  1HJX A;  1FKB A;  5J6E A;  1BKF A;  2F4E A;  1WAW A;  1ZL1 A;  1ITX A;  4IT4 A;  4ZPW R;  2ETN A;  1FD9 A;  1NH6 A;  3UI5 A;  3W4R A;  1ZBK A;  1EIB A;  1FFQ A;  1FKS A;  2MLX A;  1FKK A;  2M2A A;  1ZBV A;  1Q6H A;  4WJX A;  2G8Z A;  4GGQ A;  3WD2 A;  2FKE A;  1H0I A;  3UI6 A;  2A3A A;  4WKA A;  4Z2I A;  4G2P A;  4J4N A;  3WD4 A;  2PI6 A;  2PPO A;  3I6C A;  3UQB A;  4O2T A;  2ZR6 A;  4QZV B;  1GRJ A;  4TW6 A;  4MTV A;  3KAD A;  5HTG A;  3O5Q A;  3WL0 A;  1NMW A;  4ODM A;  2A3B A;  1FKT A;  3KAF A;  2FDM A;  4ODK A;  1X6L A;  2PN0 A;  1JND A;  1WNO A;  2MF9 A;  2ITK A;  2RUQ A;  1FKG A;  2O92 A;  2FAP A;  4Z2J A;  3RGC A;  5DF0 A;  3WIJ A;  4AY1 A;  1JNS A;  4JFJ A;  4U85 A;  2YBU A;  4DRQ A;  4MNK A;  4ODN A;  1Q6U A;  1TFV A;  1E9L A;  3H9R B;  3UF8 A;  2F2D A;  1KT0 A;  4QT2 A;  2KE0 A;  1HXV A;  4LAV A;  1FKL A;  4HBE A;  3KAG A;  3PA7 A;  2OLH A;  1N1A A;  4KR0 B;  4ODP A;  2RSE A;  3EIP A;  2DG4 A;  4C02 B;  3JXV A;  2KR7 A;  2DG9 A;  1K9T A;  1FKR A;  4JFL A;  1U79 A;  3BMB A;  3B7X A;  1CTN A;  4Z2H A;  2XP5 A;  4LAW A;  5JH8 A;  1C9H A;  4MNM A;  1BL4 A;  3WKZ A;  1LG2 A;  1ROU A;  2A3E A;  4KQZ A; 
#chains in the Genus database with same CATH homology
 4DRH A;  1ROT A;  1LL6 A;  4IPX A;  3NRK A;  1D6O A;  5BXJ A;  1LJY A;  2XP7 A;  3PR9 A;  3LUO A;  1J4I A;  1FJD A;  4URI A;  1ZK6 A;  4NZC A;  2Q5A A;  2RUD A;  2PV2 A;  3ARU A;  3ARP A;  3IK8 A;  1FKH A;  3AQU A;  3KAB A;  3ODK A;  4Q7N A;  3UI4 A;  2LJ4 A;  3ART A;  4MNL A;  3CHF A;  2LGO A;  5HW6 A;  3PRD A;  4GIV A;  5HWB A;  1PIN A;  4NNR A;  4Z2K A;  4U86 A;  1FKI A;  3O5P A;  2G41 A;  1B6C A;  4QT3 A;  1FFR A;  2PPP A;  1D2K A;  3KAI A;  2F21 A;  4P8W A;  2ZQV A;  2XPA A;  4ODQ A;  3O5O A;  4S3K A;  4W9P A;  3ALF A;  1EDQ A;  4G50 A;  1W1V A;  4DRJ A;  2AOS A;  5HKG A;  5HT1 A;  1J4H A;  1JNT A;  1JNE A;  2VCD A;  4HAR A;  5HUA A;  1UR9 A;  4ODO A;  3OA5 A;  5DIT A;  4W5U A;  1OGG A;  3B9A A;  5HW7 A;  4LAX A;  4MGV A;  4HBO A;  4TW7 A;  4FAP A;  1QZ2 A;  1EHN A;  3KAH A;  3WL1 A;  3VAW A;  5GQB A;  2KGJ A;  2XP8 A;  2M1I A;  3O5R A;  1FKJ A;  2XPB A;  4IT6 A;  1XHG A;  1R9H A;  2RUC A;  3IKG A;  3NI6 A;  2MNT A;  3IHZ A;  2KO7 A;  2LKN A;  1GOI A;  1H0G A;  2XP9 A;  3IKD A;  2PV1 A;  1M5Y A;  4MNJ A;  3O5F A;  2OFN A;  4DRO A;  3O5L A;  4JFI A;  4R0X A;  3RM9 A;  4DWS C;  1NWR A;  1PBK A;  2M08 A;  3B9D A;  1NWS A;  3O5K A;  1QPF A;  2ZQU A;  2MLY A;  1Q6I A;  3WD3 A;  4JFK A;  1ZB5 A;  1ZBC A;  3TC5 A;  3WQV A;  4L72 B;  2DT3 A;  3AS3 A;  4N19 A;  3TDB A;  3MDY B;  2WM0 A;  2DT0 A;  2RQS A;  3ARZ A;  3WH0 A;  1W1Y A;  1E6R A;  2L2S A;  4DIP A;  1NWU A;  1W1T A;  3OOB A;  4DRN A;  1ZCN A;  2DSW A;  2ZQS A;  3AS1 A;  4TX0 A;  4NSB A;  1YAT A;  2WK2 A;  1WB0 A;  3ARY A;  4MSP A;  1W9P A;  5D75 A;  3AS2 A;  4P8U A;  2LPV A;  2XP6 A;  1UR8 A;  4R5E A;  1O6I A;  2UZ5 A;  3RM4 A;  3UQI A;  1KT1 A;  4TNS A;  4LAY A;  3BXW A;  1E15 A;  3KZ7 A;  1XRV A;  4DRK A;  2A3C A;  1SYT A;  4JFM A;  1HKI A;  2AWG A;  4ML4 A;  4WK9 A;  1J4R A;  3O5J A;  4L3N A;  4J4O A;  2DSZ A;  1LL4 A;  2IF4 A;  4P8X A;  3GPK A;  5HBF A;  2N87 A;  4BF8 A;  3PRA A;  3ARS A;  1D7H A;  3WD0 A;  4DRP A;  1LG1 A;  1RD6 A;  1D7J A;  1NMV A;  5DIV A;  1J6Y A;  4QIB A;  2MPH A;  3FAP A;  5DO2 A;  1X6N A;  1L1P A;  2VN1 A;  1VF8 A;  2ESC A;  1TCO C;  1JVW A;  2DT1 A;  1LL7 A;  1HKJ A;  1D7I A;  4DH0 A;  3CHD A;  3JYJ A;  3WD1 A;  3O5G A;  4DZ2 A;  1T11 A;  2WLZ A;  1KFW A;  2B31 A;  3JYM A;  3WQW A;  2YBT A;  5DIU A;  1HKM A;  5HWC A;  4XAK A;  2ZR5 A;  2DT2 A;  2XP3 A;  3ARR A;  3G6M A;  3RM8 A;  4W9O A;  1NSG A;  3QOK A;  4IQC A;  1HJW A;  1QPL A;  3CGN A;  2DSU A;  3O5D A;  4ITZ A;  2WLY A;  4Q22 A;  4MPK A;  3ARW A;  1W9U A;  1FAP A;  1A7X A;  4ODR A;  1P5Q A;  3G6L A;  4WKF A;  1F8A B;  3B9E A;  2PBC A;  3AS0 A;  2ZQT A;  4DT4 A;  4WIW A;  4Z2L A;  4W9Q A;  4MAV A;  3PRB A;  2Y78 A;  1IX5 A;  2PV3 A;  4U84 A;  3ARQ A;  3CH9 A;  4ODL A;  1E6P A;  3CGM A;  1E6N A;  5I98 A;  1EQ3 A;  1GUV A;  2MLZ A;  2RUR A;  4P8V A;  4ZPV R;  3KCE A;  2KFW A;  3RME A;  4DZ3 A;  2K8I A;  5DEZ A;  4PTM A;  1LQ0 A;  4DWS D;  4DWS A;  3EY6 A;  3CHE A;  3O5M A;  5GPR A;  2DPE A;  3CHC A;  1Y0O A;  2DG3 A;  2DSV A;  4Z2G A;  2O9O A;  2ZR4 A;  3ALG A;  5HW8 A;  1OGB A;  1ZBW A;  1FKF A;  2PPN A;  2IUZ A;  1W9V A;  2JZV A;  3O5E A;  4ZS6 A;  3ARV A;  4S3J A;  2XP4 A;  1SR0 A;  1YW5 A;  1GPF A;  3KAC A;  3B8S A;  1HJV A;  4JYS A;  3FY1 A;  1HKK A;  4IQ2 A;  1E6Z A;  1EYM A;  3CZ8 A;  5GPG A;  1ZU8 A;  1F40 A;  1NWT A;  3ARO A;  4TW8 A;  3ARX A;  4FN2 A;  1FKD A;  1OWQ A;  1W1P A;  3TCZ A;  4TYO A;  4WKH A;  1Q1C A;  3UQA A;  2KI3 A;  4DRM A;  4LGX A;  4DWS B;  2QF8 A;  1W26 A;  4ZPT R;  5B8I C;  3FXY A;  2D9F A;  3NTP A;  3O5I A;  3RFW A;  4DRI A;  1HJX A;  1FKB A;  5J6E A;  1BKF A;  2F4E A;  1WAW A;  1ZL1 A;  1ITX A;  4IT4 A;  4ZPW R;  1FD9 A;  1NH6 A;  3UI5 A;  3W4R A;  1ZBK A;  1EIB A;  1FFQ A;  1FKS A;  2MLX A;  1FKK A;  2M2A A;  1ZBV A;  1Q6H A;  4WJX A;  2G8Z A;  4GGQ A;  3WD2 A;  2FKE A;  1H0I A;  3UI6 A;  2A3A A;  4WKA A;  4Z2I A;  4G2P A;  4J4N A;  3WD4 A;  2PI6 A;  2PPO A;  3I6C A;  3UQB A;  4O2T A;  2ZR6 A;  4QZV B;  4TW6 A;  4MTV A;  3KAD A;  5HTG A;  3O5Q A;  3WL0 A;  1NMW A;  4ODM A;  2A3B A;  1FKT A;  3KAF A;  2FDM A;  4ODK A;  1X6L A;  1JND A;  1WNO A;  2MF9 A;  2ITK A;  2RUQ A;  1FKG A;  2O92 A;  2FAP A;  4Z2J A;  3RGC A;  5DF0 A;  3WIJ A;  4AY1 A;  1JNS A;  4JFJ A;  4U85 A;  2YBU A;  4DRQ A;  4MNK A;  4ODN A;  1Q6U A;  1TFV A;  1E9L A;  3H9R B;  3UF8 A;  2F2D A;  1KT0 A;  4QT2 A;  2KE0 A;  1HXV A;  4LAV A;  1FKL A;  4HBE A;  3KAG A;  3PA7 A;  2OLH A;  1N1A A;  4KR0 B;  4ODP A;  2RSE A;  2DG4 A;  4C02 B;  3JXV A;  2KR7 A;  2DG9 A;  1K9T A;  1FKR A;  4JFL A;  1U79 A;  3B7X A;  1CTN A;  4Z2H A;  2XP5 A;  4LAW A;  5JH8 A;  1C9H A;  4MNM A;  1BL4 A;  3WKZ A;  1LG2 A;  1ROU A;  2A3E A;  4KQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...