1FKDA

Fk-506 binding protein: three-dimensional structure of the complex with the antagonist l-685,818
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cis-trans isomerase
molecule keywords FK506 BINDING PROTEIN
publication title FK-506-binding protein: three-dimensional structure of the complex with the antagonist L-685,818.
pubmed rcsb
source organism Homo sapiens
total genus 25
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1992-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkdA00
5I98A 4TNSA 2KE0A 4MGVA 2XP8A 2XP9A 4GGQA 4TW7A 1EYMA 1ZCNA 2ZQVA 5BXJA 2Q5AA 4DT4A 4ODOA 3RFWA 2KO7A 3UQIA 4G50A 4N19A 5HW7A 1D7JA 1FKTA 2DG4A 2ZR5A 3O5LA 4DZ2A 3O5JA 4DH0A 1J4HA 4BF8A 3H9RB 1FKSA 2PPPA 4ITZA 4TW6A 1JNTA 3O5MA 5DITA 4DRIA 1NMVA 5DIUA 3UQBA 3MDYB 1ROTA 4IQ2A 1FKFA 2K8IA 1BKFA 3JYMA 1A7XA 4C02B 2ZR4A 1FKIA 4DRPA 1J6YA 2FKEA 2UZ5A 1JVWA 3ODKA 4IPXA 4W9OA 3TCZA 3UI6A 5HKGA 4U85A 1NMWA 1YW5A 4DRHA 1F40A 4TW8A 2RURA 2IF4A 5HW6A 4QT2A 5GPGA 4J4NA 4QIBA 3FAPA 4ODMA 3IK8A 3O5GA 3WH0A 1D7HA 4DRJA 2DG3A 2PBCA 3KADA 3O5KA 3UI4A 1NSGA 3O5OA 2RUQA 3O5EA 3OOBA 5HUAA 1QPFA 4R0XA 2VN1A 4DRMA 1FD9A 2F2DA 2LPVA 1BL4A 1Q6IA 4ODLA 4TX0A 1R9HA 5HT1A 4U86A 4ODPA 3TC5A 2FAPA 2KFWA 4O2TA 4ODNA 4DRQA 4W9PA 5HTGA 4FAPA 3UF8A 3O5IA 1PBKA 1W26A 4DRNA 2Y78A 5DIVA 4JFMA 2ZQTA 2PPOA 2M2AA 3PRBA 4QT3A 3LUOA 1FJDA 2XP4A 3IHZA 1P5QA 3GPKA 3PA7A 2M08A 4JFKA 3RGCA 2KI3A 2MLZA 5B8IC 3KAHA 1D6OA 4ODQA 5HW8A 2F4EA 2KGJA 3KCEA 3UI5A 3KAGA 4NNRA 2ITKA 2RQSA 3KACA 4LAXA 1B6CA 3O5PA 2N87A 1KT0A 4TYOA 1J4RA 5HWCA 3CGMA 2PV3A 3O5RA 4LAWA 2XPAA 1ZK6A 2RUCA 2DG9A 4U84A 1PINA 2XP3A 4J4OA 2XP5A 1FKHA 3IKGA 2PV1A 3KABA 3NRKA 1QZ2A 3O5DA 4JFLA 1FAPA 2LGOA 4LAVA 1N1AA 1FKLA 2XP7A 4LAYA 1F8AB 1FKJA 2XPBA 1HXVA 5D75A 3KZ7A 4W9QA 1M5YA 4ODRA 3KAIA 1Q6UA 2MLYA 2VCDA 3JXVA 2OFNA 1FKDA 4IQCA 2ZR6A 3JYJA 1Q6HA 3O5QA 1EQ3A 1QPLA 3O5FA 2LJ4A 2LKNA 4DIPA 2MF9A 4G2PA 5J6EA 2JZVA 3B7XA 4JYSA 1Q1CA 4DROA 2KR7A 2XP6A 4ODKA 1FKGA 1ROUA 4MSPA 5HWBA 1U79A 2RUDA 1YATA 3PRDA 1L1PA 2AWGA 4DZ3A 2MPHA 2PPNA 1D7IA 4JFIA 3UQAA 3KAFA 1J4IA 2L2SA 3NTPA 3EY6A 1FKRA 3TDBA 1FKBA 2MLXA 2PV2A 2M1IA 1KT1A 1FKKA 2ZQUA 3I6CA 1C9HA 2RSEA 3VAWA 1T11A 1TCOC 1JNSA 3CGNA 2D9FA 3IKDA 4FN2A 3NI6A 4GIVA 2MNTA 4DRKA 4JFJA 2F21A 1Y0OA 2ZQSA
chains in the Genus database with same CATH superfamily
5I98A 2KE0A 3BMBA 2XP8A 4MGVA 4TW7A 1EYMA 3CZ8A 2KO7A 3ARRA 4WK9A 3O5LA 4DZ2A 2DSWA 2QF8A 4TW6A 3UQBA 4IQ2A 3WQWA 5DF0A 3JYMA 2ZR4A 1FKIA 1J6YA 4W9OA 3TCZA 4U85A 1F40A 4TW8A 1NH6A 2O92A 4MNKA 5HW6A 4MPKA 1KFWA 4AY1A 4DWSC 3O5EA 3OOBA 1WNOA 1FD9A 3WQVA 2B5UB 2ETNA 3B9AA 4DRQA 1LJYA 4WJXA 1W26A 2YBTA 2Y78A 1GRJA 3ALGA 1FJDA 5HBFA 3IHZA 3EIPA 3G6MA 3RGCA 2KI3A 3KAHA 1W1YA 5HW8A 2AOSA 2WM0A 1E9LA 3UI5A 4NNRA 2RQSA 3WKZA 1EHNA 4NZCA 1J4RA 4TYOA 3AS1A 2XPAA 1ZK6A 2RUCA 1GUVA 3AS0A 3B8SA 2G8ZA 3IKGA 3KABA 1LG2A 1GPFA 2O9OA 1F8AB 5D75A 1Q6UA 1E6ZA 1ZBWA 4IQCA 3JYJA 3CHDA 1FFQA 3CHEA 2DT0A 2LKNA 1HKMA 3B7XA 1E44A 2DSZA 1SYTA 1RD6A 2A3BA 4ODKA 4HARA 2DT3A 1ITXA 4XAKA 2B31A 2DT2A 4MNMA 1EIBA 2M1IA 1FKKA 1JCHB 1C9HA 1T11A 4FN2A 1UR9A 2MNTA 4QZVB 4GGQA 1JNEA 3UQIA 5HW7A 4WIWA 1FKTA 2WLZA 4IT6A 3H9RB 4ITZA 4URIA 3WD3A 5DIUA 1XHGA 1ZU8A 1FKFA 1BKFA 1A7XA 4C02B 4Z2KA 2OLHA 4P8XA 1NMWA 1YW5A 2EULA 4DWSD 5GPGA 3ARZA 4ODMA 4DRJA 3WL1A 2PBCA 3WD4A 3ARSA 1QPFA 2VN1A 4DRMA 2F2DA 2LPVA 4TX0A 2KFWA 4WKHA 4ODNA 5HTGA 1PBKA 4DRNA 5DIVA 4JFMA 1E6NA 2ZQTA 2M2AA 2WK2A 1NWSA 3PRBA 2ESCA 1GOIA 2MLZA 1D6OA 4ODQA 1HKKA 2F4EA 3KAGA 1HJVA 3ARXA 3O5PA 2DSUA 4LAWA 1HKJA 3RM4A 2DG9A 1PINA 4MNJA 2PV1A 2DSVA 1N1AA 3RM9A 4NSBA 4W9QA 5GQBA 4ODRA 3KAIA 2MLYA 1HJWA 3WIJA 1ZL1A 3WL0A 1EQ3A 1QPLA 1HKIA 2JZVA 2G41A 4JYSA 2KR7A 4DWSB 4P8WA 1FKGA 3FY1A 4LGXA 4ZPWR 2RUDA 4P8UA 3PRDA 1L1PA 1LL4A 4JFIA 3UQAA 3KAFA 1J4IA 2L2SA 3EY6A 3TDBA 2ZQUA 1KT1A 3VAWA 1NWTA 4DRKA 4JFJA 1Y0OA 1FKRA 4TNSA 2XP9A 1ZCNA 3GTYX 1E15A 2Q5AA 3ARPA 1ZBKA 4G50A 2A3AA 3O5JA 1UR8A 2PI6A 3RMEA 1FKSA 2PPPA 3ARYA 3MDYB 2K8IA 4Q22A 2P4VA 4DRPA 2FKEA 1JVWA 4IPXA 5HKGA 3UI6A 3CH9A 4R5EA 3AQUA 2RURA 2IF4A 4QT2A 1O6IA 4J4NA 4QIBA 3IK8A 3WH0A 1D7HA 3B9DA 1W9UA 2DG3A 3ARUA 3UI4A 1NSGA 1TFVA 3O5OA 2RUQA 5HUAA 1ZBCA 4R0XA 4ODLA 1BL4A 1Q6IA 3GU0A 1LQ0A 1OWQA 1D2KA 1R9HA 4MAVA 4ODPA 4O2TA 1E6RA 4W9PA 3UF8A 5GPRA 2PPOA 3ARTA 4QT3A 3LUOA 1NWUA 4Z2GA 1P5QA 4MNLA 4JFKA 4KQZA 5B8IC 1E6PA 1W1TA 2WLYA 3KCEA 2ITKA 3WD0A 1FFRA 3KACA 4LAXA 4WKAA 1ZBVA 3O5RA 4J4OA 2XP3A 1FKHA 1QZ2A 4LAVA 1FAPA 2XP7A 2FDMA 1FKJA 2XPBA 2DPEA 4UDMA 3JXVA 2OFNA 1FKDA 1W9VA 1WB0A 1Q6HA 3B9EA 4S3KA 3O5FA 5DEZA 2MF9A 4WKFA 4DWSA 1LL7A 1WAWA 2IUZA 2XP6A 1OGBA 4Z2LA 5HWBA 1U79A 1YATA 4L72B 2PPNA 3NTPA 3I6CA 1LG1A 1TCOC 4GIVA 2D9FA 3NI6A 4ZS6A 1W1VA 2F21A 4ZPVR 2ZQSA 4W5UA 2ZQVA 5BXJA 4DT4A 4ODOA 3RFWA 4N19A 1D7JA 2DG4A 3AS3A 2ZR5A 4DH0A 1J4HA 4BF8A 5DITA 4DRIA 1JNTA 3O5MA 1NMVA 3ARWA 4PTMA 1ROTA 3G6LA 2A3EA 4Q7NA 4Z2JA 1H0GA 4IT4A 3RM8A 1H0IA 2UZ5A 3ODKA 3AS2A 4DRHA 1CTNA 3W4RA 1NWRA 3CHCA 3AROA 3FAPA 3O5GA 3KADA 3O5KA 3WD2A 1X6NA 5DO2A 3ARQA 3PRAA 3TC5A 5HT1A 4L3NA 4U86A 2FAPA 4HBOA 1JNDA 2DT1A 4FAPA 3O5IA 1X6LA 4Z2IA 2XP4A 1VF8A 3QOKA 1W1PA 3GPKA 3PA7A 4KR0B 2M08A 5JH8A 2KGJA 3WD1A 4P8VA 1B6CA 2N87A 1KT0A 5HWCA 3CGMA 2PV3A 4HBEA 4ZPTR 4U84A 2XP5A 3NRKA 3O5DA 4JFLA 2LGOA 4ML4A 1FKLA 4LAYA 4S3JA 1IX5A 1ZB5A 1HXVA 3KZ7A 1W9PA 1M5YA 2VCDA 3PR9A 1LL6A 1EDQA 2ZR6A 1HJXA 3BXWA 2PN0A 3CHFA 3O5QA 3ALFA 1SR0A 2LJ4A 4DIPA 5J6EA 2YBUA 4G2PA 1XRVA 1Q1CA 4DROA 4Z2HA 1ROUA 4MSPA 2A3CA 2AWGA 4DZ3A 3ARVA 2MPHA 1D7IA 3FXYA 3OA5A 2F23A 1FKBA 4MTVA 2MLXA 2PV2A 2RSEA 1JNSA 3CGNA 3IKDA 1K9TA 1OGGA
chains in the Genus database with same CATH topology
5I98A 2KE0A 4MGVA 2XP8A 4TW7A 1EYMA 3CZ8A 2KO7A 3ARRA 4WK9A 3O5LA 4DZ2A 2DSWA 2QF8A 4TW6A 3UQBA 4IQ2A 3WQWA 5DF0A 3JYMA 2ZR4A 1FKIA 1J6YA 4W9OA 3TCZA 4U85A 1F40A 4TW8A 1NH6A 2O92A 4MNKA 5HW6A 4MPKA 1KFWA 4AY1A 4DWSC 3O5EA 3OOBA 1WNOA 1FD9A 3WQVA 4DRQA 3B9AA 1LJYA 4WJXA 1W26A 2YBTA 2Y78A 3ALGA 1FJDA 5HBFA 3IHZA 3G6MA 3RGCA 2KI3A 3KAHA 1W1YA 5HW8A 2AOSA 2WM0A 1E9LA 3UI5A 4NNRA 2RQSA 3WKZA 1EHNA 4NZCA 1J4RA 4TYOA 3AS1A 2XPAA 1ZK6A 2RUCA 1GUVA 3AS0A 3B8SA 2G8ZA 3IKGA 3KABA 1LG2A 1GPFA 2O9OA 1F8AB 5D75A 1Q6UA 1E6ZA 1ZBWA 4IQCA 3JYJA 3CHDA 1FFQA 3CHEA 2DT0A 2LKNA 1HKMA 3B7XA 2DSZA 1SYTA 1RD6A 2A3BA 4ODKA 4HARA 2DT3A 1ITXA 4XAKA 2B31A 2DT2A 4MNMA 1EIBA 2M1IA 1FKKA 1C9HA 1T11A 4FN2A 1UR9A 2MNTA 4QZVB 4GGQA 1JNEA 3UQIA 5HW7A 4WIWA 1FKTA 2WLZA 4IT6A 3H9RB 4ITZA 4URIA 3WD3A 5DIUA 1XHGA 1ZU8A 1FKFA 1BKFA 1A7XA 4C02B 4Z2KA 2OLHA 4P8XA 1NMWA 1YW5A 4DWSD 5GPGA 3ARZA 4ODMA 4DRJA 3WL1A 2PBCA 3WD4A 3ARSA 1QPFA 2VN1A 4DRMA 2F2DA 2LPVA 4TX0A 2KFWA 4WKHA 4ODNA 5HTGA 1PBKA 4DRNA 5DIVA 4JFMA 1E6NA 2ZQTA 2M2AA 2WK2A 1NWSA 3PRBA 2ESCA 1GOIA 2MLZA 1D6OA 4ODQA 1HKKA 2F4EA 3KAGA 1HJVA 3ARXA 3O5PA 2DSUA 4LAWA 1HKJA 3RM4A 2DG9A 1PINA 4MNJA 2PV1A 2DSVA 1N1AA 3RM9A 4NSBA 4W9QA 5GQBA 4ODRA 3KAIA 2MLYA 1HJWA 3WIJA 1ZL1A 3WL0A 1EQ3A 1QPLA 1HKIA 2JZVA 2G41A 4JYSA 2KR7A 4DWSB 4P8WA 1FKGA 3FY1A 4LGXA 4ZPWR 2RUDA 4P8UA 3PRDA 1L1PA 1LL4A 4JFIA 3UQAA 3KAFA 1J4IA 2L2SA 3EY6A 3TDBA 2ZQUA 1KT1A 3VAWA 1NWTA 4DRKA 4JFJA 1Y0OA 1FKRA 4TNSA 2XP9A 1ZCNA 1E15A 2Q5AA 3ARPA 1ZBKA 4G50A 2A3AA 3O5JA 1UR8A 2PI6A 3RMEA 1FKSA 2PPPA 3ARYA 3MDYB 2K8IA 4Q22A 4DRPA 2FKEA 1JVWA 4IPXA 5HKGA 3UI6A 3CH9A 4R5EA 3AQUA 2RURA 2IF4A 4QT2A 1O6IA 4J4NA 4QIBA 3IK8A 3WH0A 1D7HA 3B9DA 1W9UA 2DG3A 3ARUA 3UI4A 1NSGA 1TFVA 3O5OA 2RUQA 5HUAA 1ZBCA 4R0XA 4ODLA 1BL4A 1Q6IA 1LQ0A 1OWQA 1D2KA 1R9HA 4MAVA 4ODPA 4O2TA 1E6RA 4W9PA 3UF8A 5GPRA 2PPOA 3ARTA 4QT3A 3LUOA 1NWUA 4Z2GA 1P5QA 4MNLA 4JFKA 4KQZA 5B8IC 1E6PA 1W1TA 2WLYA 3KCEA 2ITKA 3WD0A 1FFRA 3KACA 4LAXA 4WKAA 1ZBVA 3O5RA 4J4OA 2XP3A 1FKHA 1QZ2A 4LAVA 1FAPA 2XP7A 2FDMA 1FKJA 2XPBA 2DPEA 3JXVA 2OFNA 1FKDA 1W9VA 1WB0A 1Q6HA 3B9EA 4S3KA 3O5FA 5DEZA 2MF9A 4WKFA 4DWSA 1LL7A 1WAWA 2IUZA 2XP6A 1OGBA 4Z2LA 5HWBA 1U79A 1YATA 4L72B 2PPNA 3NTPA 3I6CA 1LG1A 1TCOC 4GIVA 2D9FA 3NI6A 4ZS6A 1W1VA 2F21A 4ZPVR 2ZQSA 4W5UA 2ZQVA 5BXJA 4DT4A 4ODOA 3RFWA 4N19A 1D7JA 2DG4A 3AS3A 2ZR5A 4DH0A 1J4HA 4BF8A 5DITA 4DRIA 1JNTA 3O5MA 1NMVA 3ARWA 4PTMA 1ROTA 3G6LA 2A3EA 4Q7NA 4Z2JA 1H0GA 4IT4A 3RM8A 1H0IA 2UZ5A 3ODKA 3AS2A 4DRHA 1CTNA 3W4RA 1NWRA 3CHCA 3AROA 3FAPA 3O5GA 3KADA 3O5KA 3WD2A 1X6NA 5DO2A 3ARQA 3PRAA 3TC5A 5HT1A 4L3NA 4U86A 2FAPA 4HBOA 1JNDA 2DT1A 4FAPA 3O5IA 1X6LA 4Z2IA 2XP4A 1VF8A 3QOKA 1W1PA 3GPKA 3PA7A 4KR0B 2M08A 5JH8A 2KGJA 3WD1A 4P8VA 1B6CA 2N87A 1KT0A 5HWCA 3CGMA 2PV3A 4HBEA 4ZPTR 4U84A 2XP5A 3NRKA 3O5DA 4JFLA 2LGOA 4ML4A 1FKLA 4LAYA 4S3JA 1IX5A 1ZB5A 1HXVA 3KZ7A 1W9PA 1M5YA 2VCDA 3PR9A 1LL6A 1EDQA 2ZR6A 1HJXA 3BXWA 3O5QA 3CHFA 3ALFA 1SR0A 2LJ4A 4DIPA 5J6EA 2YBUA 4G2PA 1XRVA 1Q1CA 4DROA 4Z2HA 1ROUA 4MSPA 2A3CA 2AWGA 4DZ3A 3ARVA 2MPHA 1D7IA 3FXYA 3OA5A 1FKBA 4MTVA 2MLXA 2PV2A 2RSEA 1JNSA 3CGNA 3IKDA 1K9TA 1OGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I98 A;  4TNS A;  2KE0 A;  4MGV A;  2XP8 A;  2XP9 A;  4GGQ A;  4TW7 A;  1EYM A;  1ZCN A;  2ZQV A;  5BXJ A;  2Q5A A;  4DT4 A;  4ODO A;  3RFW A;  2KO7 A;  3UQI A;  4G50 A;  4N19 A;  5HW7 A;  1D7J A;  1FKT A;  2DG4 A;  2ZR5 A;  3O5L A;  4DZ2 A;  3O5J A;  4DH0 A;  1J4H A;  4BF8 A;  3H9R B;  1FKS A;  2PPP A;  4ITZ A;  4TW6 A;  1JNT A;  3O5M A;  5DIT A;  4DRI A;  1NMV A;  5DIU A;  3UQB A;  3MDY B;  1ROT A;  4IQ2 A;  1FKF A;  2K8I A;  1BKF A;  3JYM A;  1A7X A;  4C02 B;  2ZR4 A;  1FKI A;  4DRP A;  1J6Y A;  2FKE A;  2UZ5 A;  1JVW A;  3ODK A;  4IPX A;  4W9O A;  3TCZ A;  3UI6 A;  5HKG A;  4U85 A;  1NMW A;  1YW5 A;  4DRH A;  1F40 A;  4TW8 A;  2RUR A;  2IF4 A;  5HW6 A;  4QT2 A;  5GPG A;  4J4N A;  4QIB A;  3FAP A;  4ODM A;  3IK8 A;  3O5G A;  3WH0 A;  1D7H A;  4DRJ A;  2DG3 A;  2PBC A;  3KAD A;  3O5K A;  3UI4 A;  1NSG A;  3O5O A;  2RUQ A;  3O5E A;  3OOB A;  5HUA A;  1QPF A;  4R0X A;  2VN1 A;  4DRM A;  1FD9 A;  2F2D A;  2LPV A;  1BL4 A;  1Q6I A;  4ODL A;  4TX0 A;  1R9H A;  5HT1 A;  4U86 A;  4ODP A;  3TC5 A;  2FAP A;  2KFW A;  4O2T A;  4ODN A;  4DRQ A;  4W9P A;  5HTG A;  4FAP A;  3UF8 A;  3O5I A;  1PBK A;  1W26 A;  4DRN A;  2Y78 A;  5DIV A;  4JFM A;  2ZQT A;  2PPO A;  2M2A A;  3PRB A;  4QT3 A;  3LUO A;  1FJD A;  2XP4 A;  3IHZ A;  1P5Q A;  3GPK A;  3PA7 A;  2M08 A;  4JFK A;  3RGC A;  2KI3 A;  2MLZ A;  5B8I C;  3KAH A;  1D6O A;  4ODQ A;  5HW8 A;  2F4E A;  2KGJ A;  3KCE A;  3UI5 A;  3KAG A;  4NNR A;  2ITK A;  2RQS A;  3KAC A;  4LAX A;  1B6C A;  3O5P A;  2N87 A;  1KT0 A;  4TYO A;  1J4R A;  5HWC A;  3CGM A;  2PV3 A;  3O5R A;  4LAW A;  2XPA A;  1ZK6 A;  2RUC A;  2DG9 A;  4U84 A;  1PIN A;  2XP3 A;  4J4O A;  2XP5 A;  1FKH A;  3IKG A;  2PV1 A;  3KAB A;  3NRK A;  1QZ2 A;  3O5D A;  4JFL A;  1FAP A;  2LGO A;  4LAV A;  1N1A A;  1FKL A;  2XP7 A;  4LAY A;  1F8A B;  1FKJ A;  2XPB A;  1HXV A;  5D75 A;  3KZ7 A;  4W9Q A;  1M5Y A;  4ODR A;  3KAI A;  1Q6U A;  2MLY A;  2VCD A;  3JXV A;  2OFN A;  1FKD A;  4IQC A;  2ZR6 A;  3JYJ A;  1Q6H A;  3O5Q A;  1EQ3 A;  1QPL A;  3O5F A;  2LJ4 A;  2LKN A;  4DIP A;  2MF9 A;  4G2P A;  5J6E A;  2JZV A;  3B7X A;  4JYS A;  1Q1C A;  4DRO A;  2KR7 A;  2XP6 A;  4ODK A;  1FKG A;  1ROU A;  4MSP A;  5HWB A;  1U79 A;  2RUD A;  1YAT A;  3PRD A;  1L1P A;  2AWG A;  4DZ3 A;  2MPH A;  2PPN A;  1D7I A;  4JFI A;  3UQA A;  3KAF A;  1J4I A;  2L2S A;  3NTP A;  3EY6 A;  1FKR A;  3TDB A;  1FKB A;  2MLX A;  2PV2 A;  2M1I A;  1KT1 A;  1FKK A;  2ZQU A;  3I6C A;  1C9H A;  2RSE A;  3VAW A;  1T11 A;  1TCO C;  1JNS A;  3CGN A;  2D9F A;  3IKD A;  4FN2 A;  3NI6 A;  4GIV A;  2MNT A;  4DRK A;  4JFJ A;  2F21 A;  1Y0O A;  2ZQS A; 
#chains in the Genus database with same CATH topology
 5I98 A;  2KE0 A;  3BMB A;  2XP8 A;  4MGV A;  4TW7 A;  1EYM A;  3CZ8 A;  2KO7 A;  3ARR A;  4WK9 A;  3O5L A;  4DZ2 A;  2DSW A;  2QF8 A;  4TW6 A;  3UQB A;  4IQ2 A;  3WQW A;  5DF0 A;  3JYM A;  2ZR4 A;  1FKI A;  1J6Y A;  4W9O A;  3TCZ A;  4U85 A;  1F40 A;  4TW8 A;  1NH6 A;  2O92 A;  4MNK A;  5HW6 A;  4MPK A;  1KFW A;  4AY1 A;  4DWS C;  3O5E A;  3OOB A;  1WNO A;  1FD9 A;  3WQV A;  2B5U B;  2ETN A;  3B9A A;  4DRQ A;  1LJY A;  4WJX A;  1W26 A;  2YBT A;  2Y78 A;  1GRJ A;  3ALG A;  1FJD A;  5HBF A;  3IHZ A;  3EIP A;  3G6M A;  3RGC A;  2KI3 A;  3KAH A;  1W1Y A;  5HW8 A;  2AOS A;  2WM0 A;  1E9L A;  3UI5 A;  4NNR A;  2RQS A;  3WKZ A;  1EHN A;  4NZC A;  1J4R A;  4TYO A;  3AS1 A;  2XPA A;  1ZK6 A;  2RUC A;  1GUV A;  3AS0 A;  3B8S A;  2G8Z A;  3IKG A;  3KAB A;  1LG2 A;  1GPF A;  2O9O A;  1F8A B;  5D75 A;  1Q6U A;  1E6Z A;  1ZBW A;  4IQC A;  3JYJ A;  3CHD A;  1FFQ A;  3CHE A;  2DT0 A;  2LKN A;  1HKM A;  3B7X A;  1E44 A;  2DSZ A;  1SYT A;  1RD6 A;  2A3B A;  4ODK A;  4HAR A;  2DT3 A;  1ITX A;  4XAK A;  2B31 A;  2DT2 A;  4MNM A;  1EIB A;  2M1I A;  1FKK A;  1JCH B;  1C9H A;  1T11 A;  4FN2 A;  1UR9 A;  2MNT A;  4QZV B;  4GGQ A;  1JNE A;  3UQI A;  5HW7 A;  4WIW A;  1FKT A;  2WLZ A;  4IT6 A;  3H9R B;  4ITZ A;  4URI A;  3WD3 A;  5DIU A;  1XHG A;  1ZU8 A;  1FKF A;  1BKF A;  1A7X A;  4C02 B;  4Z2K A;  2OLH A;  4P8X A;  1NMW A;  1YW5 A;  2EUL A;  4DWS D;  5GPG A;  3ARZ A;  4ODM A;  4DRJ A;  3WL1 A;  2PBC A;  3WD4 A;  3ARS A;  1QPF A;  2VN1 A;  4DRM A;  2F2D A;  2LPV A;  4TX0 A;  2KFW A;  4WKH A;  4ODN A;  5HTG A;  1PBK A;  4DRN A;  5DIV A;  4JFM A;  1E6N A;  2ZQT A;  2M2A A;  2WK2 A;  1NWS A;  3PRB A;  2ESC A;  1GOI A;  2MLZ A;  1D6O A;  4ODQ A;  1HKK A;  2F4E A;  3KAG A;  1HJV A;  3ARX A;  3O5P A;  2DSU A;  4LAW A;  1HKJ A;  3RM4 A;  2DG9 A;  1PIN A;  4MNJ A;  2PV1 A;  2DSV A;  1N1A A;  3RM9 A;  4NSB A;  4W9Q A;  5GQB A;  4ODR A;  3KAI A;  2MLY A;  1HJW A;  3WIJ A;  1ZL1 A;  3WL0 A;  1EQ3 A;  1QPL A;  1HKI A;  2JZV A;  2G41 A;  4JYS A;  2KR7 A;  4DWS B;  4P8W A;  1FKG A;  3FY1 A;  4LGX A;  4ZPW R;  2RUD A;  4P8U A;  3PRD A;  1L1P A;  1LL4 A;  4JFI A;  3UQA A;  3KAF A;  1J4I A;  2L2S A;  3EY6 A;  3TDB A;  2ZQU A;  1KT1 A;  3VAW A;  1NWT A;  4DRK A;  4JFJ A;  1Y0O A;  1FKR A;  4TNS A;  2XP9 A;  1ZCN A;  3GTY X;  1E15 A;  2Q5A A;  3ARP A;  1ZBK A;  4G50 A;  2A3A A;  3O5J A;  1UR8 A;  2PI6 A;  3RME A;  1FKS A;  2PPP A;  3ARY A;  3MDY B;  2K8I A;  4Q22 A;  2P4V A;  4DRP A;  2FKE A;  1JVW A;  4IPX A;  5HKG A;  3UI6 A;  3CH9 A;  4R5E A;  3AQU A;  2RUR A;  2IF4 A;  4QT2 A;  1O6I A;  4J4N A;  4QIB A;  3IK8 A;  3WH0 A;  1D7H A;  3B9D A;  1W9U A;  2DG3 A;  3ARU A;  3UI4 A;  1NSG A;  1TFV A;  3O5O A;  2RUQ A;  5HUA A;  1ZBC A;  4R0X A;  4ODL A;  1BL4 A;  1Q6I A;  3GU0 A;  1LQ0 A;  1OWQ A;  1D2K A;  1R9H A;  4MAV A;  4ODP A;  4O2T A;  1E6R A;  4W9P A;  3UF8 A;  5GPR A;  2PPO A;  3ART A;  4QT3 A;  3LUO A;  1NWU A;  4Z2G A;  1P5Q A;  4MNL A;  4JFK A;  4KQZ A;  5B8I C;  1E6P A;  1W1T A;  2WLY A;  3KCE A;  2ITK A;  3WD0 A;  1FFR A;  3KAC A;  4LAX A;  4WKA A;  1ZBV A;  3O5R A;  4J4O A;  2XP3 A;  1FKH A;  1QZ2 A;  4LAV A;  1FAP A;  2XP7 A;  2FDM A;  1FKJ A;  2XPB A;  2DPE A;  4UDM A;  3JXV A;  2OFN A;  1FKD A;  1W9V A;  1WB0 A;  1Q6H A;  3B9E A;  4S3K A;  3O5F A;  5DEZ A;  2MF9 A;  4WKF A;  4DWS A;  1LL7 A;  1WAW A;  2IUZ A;  2XP6 A;  1OGB A;  4Z2L A;  5HWB A;  1U79 A;  1YAT A;  4L72 B;  2PPN A;  3NTP A;  3I6C A;  1LG1 A;  1TCO C;  4GIV A;  2D9F A;  3NI6 A;  4ZS6 A;  1W1V A;  2F21 A;  4ZPV R;  2ZQS A;  4W5U A;  2ZQV A;  5BXJ A;  4DT4 A;  4ODO A;  3RFW A;  4N19 A;  1D7J A;  2DG4 A;  3AS3 A;  2ZR5 A;  4DH0 A;  1J4H A;  4BF8 A;  5DIT A;  4DRI A;  1JNT A;  3O5M A;  1NMV A;  3ARW A;  4PTM A;  1ROT A;  3G6L A;  2A3E A;  4Q7N A;  4Z2J A;  1H0G A;  4IT4 A;  3RM8 A;  1H0I A;  2UZ5 A;  3ODK A;  3AS2 A;  4DRH A;  1CTN A;  3W4R A;  1NWR A;  3CHC A;  3ARO A;  3FAP A;  3O5G A;  3KAD A;  3O5K A;  3WD2 A;  1X6N A;  5DO2 A;  3ARQ A;  3PRA A;  3TC5 A;  5HT1 A;  4L3N A;  4U86 A;  2FAP A;  4HBO A;  1JND A;  2DT1 A;  4FAP A;  3O5I A;  1X6L A;  4Z2I A;  2XP4 A;  1VF8 A;  3QOK A;  1W1P A;  3GPK A;  3PA7 A;  4KR0 B;  2M08 A;  5JH8 A;  2KGJ A;  3WD1 A;  4P8V A;  1B6C A;  2N87 A;  1KT0 A;  5HWC A;  3CGM A;  2PV3 A;  4HBE A;  4ZPT R;  4U84 A;  2XP5 A;  3NRK A;  3O5D A;  4JFL A;  2LGO A;  4ML4 A;  1FKL A;  4LAY A;  4S3J A;  1IX5 A;  1ZB5 A;  1HXV A;  3KZ7 A;  1W9P A;  1M5Y A;  2VCD A;  3PR9 A;  1LL6 A;  1EDQ A;  2ZR6 A;  1HJX A;  3BXW A;  2PN0 A;  3CHF A;  3O5Q A;  3ALF A;  1SR0 A;  2LJ4 A;  4DIP A;  5J6E A;  2YBU A;  4G2P A;  1XRV A;  1Q1C A;  4DRO A;  4Z2H A;  1ROU A;  4MSP A;  2A3C A;  2AWG A;  4DZ3 A;  3ARV A;  2MPH A;  1D7I A;  3FXY A;  3OA5 A;  2F23 A;  1FKB A;  4MTV A;  2MLX A;  2PV2 A;  2RSE A;  1JNS A;  3CGN A;  3IKD A;  1K9T A;  1OGG A; 
#chains in the Genus database with same CATH homology
 5I98 A;  2KE0 A;  4MGV A;  2XP8 A;  4TW7 A;  1EYM A;  3CZ8 A;  2KO7 A;  3ARR A;  4WK9 A;  3O5L A;  4DZ2 A;  2DSW A;  2QF8 A;  4TW6 A;  3UQB A;  4IQ2 A;  3WQW A;  5DF0 A;  3JYM A;  2ZR4 A;  1FKI A;  1J6Y A;  4W9O A;  3TCZ A;  4U85 A;  1F40 A;  4TW8 A;  1NH6 A;  2O92 A;  4MNK A;  5HW6 A;  4MPK A;  1KFW A;  4AY1 A;  4DWS C;  3O5E A;  3OOB A;  1WNO A;  1FD9 A;  3WQV A;  4DRQ A;  3B9A A;  1LJY A;  4WJX A;  1W26 A;  2YBT A;  2Y78 A;  3ALG A;  1FJD A;  5HBF A;  3IHZ A;  3G6M A;  3RGC A;  2KI3 A;  3KAH A;  1W1Y A;  5HW8 A;  2AOS A;  2WM0 A;  1E9L A;  3UI5 A;  4NNR A;  2RQS A;  3WKZ A;  1EHN A;  4NZC A;  1J4R A;  4TYO A;  3AS1 A;  2XPA A;  1ZK6 A;  2RUC A;  1GUV A;  3AS0 A;  3B8S A;  2G8Z A;  3IKG A;  3KAB A;  1LG2 A;  1GPF A;  2O9O A;  1F8A B;  5D75 A;  1Q6U A;  1E6Z A;  1ZBW A;  4IQC A;  3JYJ A;  3CHD A;  1FFQ A;  3CHE A;  2DT0 A;  2LKN A;  1HKM A;  3B7X A;  2DSZ A;  1SYT A;  1RD6 A;  2A3B A;  4ODK A;  4HAR A;  2DT3 A;  1ITX A;  4XAK A;  2B31 A;  2DT2 A;  4MNM A;  1EIB A;  2M1I A;  1FKK A;  1C9H A;  1T11 A;  4FN2 A;  1UR9 A;  2MNT A;  4QZV B;  4GGQ A;  1JNE A;  3UQI A;  5HW7 A;  4WIW A;  1FKT A;  2WLZ A;  4IT6 A;  3H9R B;  4ITZ A;  4URI A;  3WD3 A;  5DIU A;  1XHG A;  1ZU8 A;  1FKF A;  1BKF A;  1A7X A;  4C02 B;  4Z2K A;  2OLH A;  4P8X A;  1NMW A;  1YW5 A;  4DWS D;  5GPG A;  3ARZ A;  4ODM A;  4DRJ A;  3WL1 A;  2PBC A;  3WD4 A;  3ARS A;  1QPF A;  2VN1 A;  4DRM A;  2F2D A;  2LPV A;  4TX0 A;  2KFW A;  4WKH A;  4ODN A;  5HTG A;  1PBK A;  4DRN A;  5DIV A;  4JFM A;  1E6N A;  2ZQT A;  2M2A A;  2WK2 A;  1NWS A;  3PRB A;  2ESC A;  1GOI A;  2MLZ A;  1D6O A;  4ODQ A;  1HKK A;  2F4E A;  3KAG A;  1HJV A;  3ARX A;  3O5P A;  2DSU A;  4LAW A;  1HKJ A;  3RM4 A;  2DG9 A;  1PIN A;  4MNJ A;  2PV1 A;  2DSV A;  1N1A A;  3RM9 A;  4NSB A;  4W9Q A;  5GQB A;  4ODR A;  3KAI A;  2MLY A;  1HJW A;  3WIJ A;  1ZL1 A;  3WL0 A;  1EQ3 A;  1QPL A;  1HKI A;  2JZV A;  2G41 A;  4JYS A;  2KR7 A;  4DWS B;  4P8W A;  1FKG A;  3FY1 A;  4LGX A;  4ZPW R;  2RUD A;  4P8U A;  3PRD A;  1L1P A;  1LL4 A;  4JFI A;  3UQA A;  3KAF A;  1J4I A;  2L2S A;  3EY6 A;  3TDB A;  2ZQU A;  1KT1 A;  3VAW A;  1NWT A;  4DRK A;  4JFJ A;  1Y0O A;  1FKR A;  4TNS A;  2XP9 A;  1ZCN A;  1E15 A;  2Q5A A;  3ARP A;  1ZBK A;  4G50 A;  2A3A A;  3O5J A;  1UR8 A;  2PI6 A;  3RME A;  1FKS A;  2PPP A;  3ARY A;  3MDY B;  2K8I A;  4Q22 A;  4DRP A;  2FKE A;  1JVW A;  4IPX A;  5HKG A;  3UI6 A;  3CH9 A;  4R5E A;  3AQU A;  2RUR A;  2IF4 A;  4QT2 A;  1O6I A;  4J4N A;  4QIB A;  3IK8 A;  3WH0 A;  1D7H A;  3B9D A;  1W9U A;  2DG3 A;  3ARU A;  3UI4 A;  1NSG A;  1TFV A;  3O5O A;  2RUQ A;  5HUA A;  1ZBC A;  4R0X A;  4ODL A;  1BL4 A;  1Q6I A;  1LQ0 A;  1OWQ A;  1D2K A;  1R9H A;  4MAV A;  4ODP A;  4O2T A;  1E6R A;  4W9P A;  3UF8 A;  5GPR A;  2PPO A;  3ART A;  4QT3 A;  3LUO A;  1NWU A;  4Z2G A;  1P5Q A;  4MNL A;  4JFK A;  4KQZ A;  5B8I C;  1E6P A;  1W1T A;  2WLY A;  3KCE A;  2ITK A;  3WD0 A;  1FFR A;  3KAC A;  4LAX A;  4WKA A;  1ZBV A;  3O5R A;  4J4O A;  2XP3 A;  1FKH A;  1QZ2 A;  4LAV A;  1FAP A;  2XP7 A;  2FDM A;  1FKJ A;  2XPB A;  2DPE A;  3JXV A;  2OFN A;  1FKD A;  1W9V A;  1WB0 A;  1Q6H A;  3B9E A;  4S3K A;  3O5F A;  5DEZ A;  2MF9 A;  4WKF A;  4DWS A;  1LL7 A;  1WAW A;  2IUZ A;  2XP6 A;  1OGB A;  4Z2L A;  5HWB A;  1U79 A;  1YAT A;  4L72 B;  2PPN A;  3NTP A;  3I6C A;  1LG1 A;  1TCO C;  4GIV A;  2D9F A;  3NI6 A;  4ZS6 A;  1W1V A;  2F21 A;  4ZPV R;  2ZQS A;  4W5U A;  2ZQV A;  5BXJ A;  4DT4 A;  4ODO A;  3RFW A;  4N19 A;  1D7J A;  2DG4 A;  3AS3 A;  2ZR5 A;  4DH0 A;  1J4H A;  4BF8 A;  5DIT A;  4DRI A;  1JNT A;  3O5M A;  1NMV A;  3ARW A;  4PTM A;  1ROT A;  3G6L A;  2A3E A;  4Q7N A;  4Z2J A;  1H0G A;  4IT4 A;  3RM8 A;  1H0I A;  2UZ5 A;  3ODK A;  3AS2 A;  4DRH A;  1CTN A;  3W4R A;  1NWR A;  3CHC A;  3ARO A;  3FAP A;  3O5G A;  3KAD A;  3O5K A;  3WD2 A;  1X6N A;  5DO2 A;  3ARQ A;  3PRA A;  3TC5 A;  5HT1 A;  4L3N A;  4U86 A;  2FAP A;  4HBO A;  1JND A;  2DT1 A;  4FAP A;  3O5I A;  1X6L A;  4Z2I A;  2XP4 A;  1VF8 A;  3QOK A;  1W1P A;  3GPK A;  3PA7 A;  4KR0 B;  2M08 A;  5JH8 A;  2KGJ A;  3WD1 A;  4P8V A;  1B6C A;  2N87 A;  1KT0 A;  5HWC A;  3CGM A;  2PV3 A;  4HBE A;  4ZPT R;  4U84 A;  2XP5 A;  3NRK A;  3O5D A;  4JFL A;  2LGO A;  4ML4 A;  1FKL A;  4LAY A;  4S3J A;  1IX5 A;  1ZB5 A;  1HXV A;  3KZ7 A;  1W9P A;  1M5Y A;  2VCD A;  3PR9 A;  1LL6 A;  1EDQ A;  2ZR6 A;  1HJX A;  3BXW A;  3O5Q A;  3CHF A;  3ALF A;  1SR0 A;  2LJ4 A;  4DIP A;  5J6E A;  2YBU A;  4G2P A;  1XRV A;  1Q1C A;  4DRO A;  4Z2H A;  1ROU A;  4MSP A;  2A3C A;  2AWG A;  4DZ3 A;  3ARV A;  2MPH A;  1D7I A;  3FXY A;  3OA5 A;  1FKB A;  4MTV A;  2MLX A;  2PV2 A;  2RSE A;  1JNS A;  3CGN A;  3IKD A;  1K9T A;  1OGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...