5HW7A

Candida albicans fkbp12 apo protein in p21212 space group
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
122
structure length
122
Chain Sequence
b'EELPQIEIVQEGDNTTFAKPGDTVTIHYDGKLTNGKEFDSSRKRGKPFTCTVGVGQVIKGWDISLTNNYGKGGANLPKISKGTKAILTIPPNLAYGPRGIPPIIGPNETLVFEVELLGVNGQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 1
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida albicans (strain sc5314 / atcc mya-2876)
molecule tags Isomerase
total genus 28
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5hw7A00
1FKJA 3ODKA 4FN2A 1NSGA 4QT3A 3LUOA 4TX0A 5HWCA 2XP3A 1BL4A 2MNTA 3H9RB 5HUAA 2ZQVA 4DIPA 4GIVA 2F2DA 2PV1A 4JFLA 1Q6IA 1EYMA 3I6CA 3O5DA 3KAHA 2M2AA 4U85A 1FKSA 3NI6A 3O5PA 1FKDA 2KE0A 4ODNA 5B8IC 4DH0A 1NMWA 2LKNA 3JYJA 4GGQA 3VAWA 3KAIA 2DG3A 1EQ3A 4ODMA 3PRBA 1F40A 1Y0OA 2JZVA 3UI5A 1M5YA 2KFWA 3O5RA 1NMVA 2Q5AA 2MF9A 4JFKA 2PV2A 3RFWA 3KACA 1PBKA 4IQCA 2MPHA 5HW6A 3KAGA 4J4NA 2RUCA 2XP7A 2ZR5A 1KT1A 2RQSA 4LAXA 2ZQUA 1FKLA 1D7JA 1N1AA 1ROTA 3GPKA 4IQ2A 4JYSA 4DRNA 5BXJA 3MDYB 2AWGA 1KT0A 3IHZA 1FKKA 3NTPA 3OOBA 3CGMA 4DZ2A 2XPBA 2RUQA 4DROA 4TNSA 2RURA 4U84A 4DRJA 1W26A 4W9QA 3O5FA 2MLZA 2RUDA 1A7XA 1ZK6A 4JFJA 4NNRA 2M1IA 4G50A 1D7IA 5HTGA 1L1PA 4ITZA 1ROUA 4ODKA 5DIVA 4ODRA 3KABA 5DIUA 1FKGA 2PV3A 3O5OA 4FAPA 2KGJA 1J4IA 3UQBA 4DRPA 1J4HA 5HT1A 2UZ5A 5HW8A 2XP5A 2VN1A 1YATA 1Q6HA 3KADA 4LAVA 1F8AB 3JYMA 4R0XA 1JNTA 5I98A 4ODQA 3TC5A 2ZQSA 4ODOA 4TW7A 2FAPA 4J4OA 4TW6A 1PINA 1YW5A 3B7XA 1JNSA 2IF4A 1FKTA 5HW7A 3UQAA 2XP4A 4C02B 4DT4A 2PPPA 4ODLA 4N19A 2DG9A 4DZ3A 2XP6A 2FKEA 3NRKA 5DITA 2LPVA 1U79A 2KO7A 3O5KA 1ZCNA 2D9FA 2MLYA 2LJ4A 3O5JA 1FD9A 1FKIA 2KI3A 4QT2A 1TCOC 1C9HA 4BF8A 2MLXA 1J4RA 2RSEA 2OFNA 3KCEA 3IK8A 4W9PA 4W9OA 1B6CA 3PA7A 1FKBA 4U86A 4TYOA 1FKHA 3KZ7A 3UQIA 1J6YA 1D6OA 5HKGA 2K8IA 4JFMA 1BKFA 3PRDA 2XP9A 1P5QA 2PPNA 2VCDA 4O2TA 1QPFA 4MSPA 2ITKA 4LAWA 3IKDA 4QIBA 5HWBA 4G2PA 3TCZA 3UI6A 2F4EA 5J6EA 4DRQA 3TDBA 4TW8A 2PPOA 2ZR6A 1FJDA 2ZQTA 2F21A 3O5LA 3CGNA 2DG4A 4DRIA 4LAYA 2Y78A 4DRHA 2LGOA 2XP8A 3JXVA 1FKRA 1QZ2A 2L2SA 3FAPA 3UI4A 1HXVA 1JVWA 3IKGA 1FKFA 2N87A 1Q6UA 4IPXA 3O5MA 3O5IA 4DRKA 4JFIA 1R9HA 2KR7A 2M08A 4ODPA 1FAPA 2ZR4A 5D75A 3KAFA 3WH0A 5GPGA 3RGCA 3O5EA 3UF8A 3O5GA 1T11A 4MGVA 1D7HA 1QPLA 2PBCA 2XPAA 3O5QA 4DRMA 1Q1CA 3EY6A
chains in the Genus database with same CATH superfamily
4QT3A 4ZS6A 4MTVA 5HWCA 1BL4A 4MPKA 2PV1A 4JFLA 2PN0A 1E6RA 1XHGA 2M2AA 1HJVA 3NI6A 4PTMA 4DH0A 2DT0A 3JYJA 4MNMA 4GGQA 2B31A 1Y0OA 3ALFA 3B9DA 2Q5AA 1E6PA 2MF9A 1ZBKA 2PV2A 1PBKA 4IQCA 3KAGA 1HKJA 1JCHB 1VF8A 4LAXA 3OA5A 1FKLA 3GPKA 5BXJA 2AWGA 4DZ2A 2DT1A 4MAVA 4DROA 1LQ0A 1HJXA 3RM9A 4DRJA 3O5FA 2MLZA 2RUDA 1ZK6A 4JFJA 4S3KA 1D7IA 3BMBA 1ROUA 3WQWA 4FAPA 2PV3A 2WLYA 2FDMA 3ARVA 5HT1A 2UZ5A 3KADA 5DEZA 1JNTA 4P8VA 1ZBCA 1PINA 2PI6A 4DZ3A 4N19A 2DG9A 2XP6A 5DITA 1U79A 2LJ4A 2KI3A 4IT4A 1TCOC 4BF8A 2OFNA 1HJWA 3IK8A 4TYOA 1FKHA 4Z2KA 5DO2A 1P5QA 2PPNA 4O2TA 1QPFA 5HWBA 4LAWA 4G2PA 3TCZA 3UI6A 3WD3A 2ZR6A 2F21A 3O5LA 3CGNA 1UR9A 2XP8A 3JXVA 1W1TA 2L2SA 3FAPA 1JVWA 1Q6UA 4IPXA 4JFIA 1UR8A 1OGGA 5HBFA 2AOSA 1NWSA 1GPFA 1CTNA 3WQVA 3AS2A 4WKHA 1T11A 3ARTA 2PBCA 3O5QA 2XPAA 4LAVA 5GPRA 3LUOA 3H9RB 2MNTA 2ETNA 2ZQVA 4GIVA 1SYTA 3I6CA 1EYMA 2WK2A 1W9UA 1E44A 4U85A 2KE0A 5B8IC 4WKAA 1EDQA 1NMWA 4P8WA 3VAWA 1E6NA 4AY1A 2DPEA 3RFWA 2MPHA 3QOKA 2RUCA 1KT1A 2DT3A 4DRNA 1N1AA 4JYSA 1W1YA 3NTPA 3OOBA 3CGMA 2XPBA 4NSBA 3PR9A 2QF8A 1H0IA 2M1IA 1W9PA 3WD1A 5DIVA 4ODRA 5GQBA 2KGJA 1YATA 1F8AB 3CH9A 3TC5A 4ODOA 4TW7A 2FAPA 2P4VA 1GOIA 4J4OA 3B7XA 2IF4A 2F23A 3GU0A 2A3CA 3UQAA 4C02B 4ODLA 3NRKA 2YBUA 2LPVA 2WM0A 2D9FA 3O5JA 1C9HA 2MLXA 4Q7NA 1B6CA 3PA7A 1FKBA 5JH8A 3CHFA 3ARRA 4ZPTR 2DSWA 2OLHA 2ITKA 2DT2A 1NWRA 2PPOA 4TW8A 3AS3A 4WIWA 2DG4A 4Q22A 1H0GA 2Y78A 4DRHA 1K9TA 2N87A 1R9HA 3RMEA 4ODPA 4WJXA 4DWSB 2O9OA 2ZR4A 5D75A 1E6ZA 5GPGA 3AS0A 2B5UB 3WIJA 1D7HA 1F40A 1FKJA 1LG2A 3ODKA 4TX0A 5HUAA 2XP3A 4QZVB 4DWSC 2DSUA 4P8XA 2A3BA 4DIPA 3CHEA 2F2DA 1Q6IA 3O5DA 3KAHA 1FKSA 1FKDA 4ODNA 3G6MA 2DG3A 4ODMA 2JZVA 1IX5A 1NMVA 3KACA 5HW6A 1WB0A 3ARPA 1ZBWA 2ZR5A 3ARZA 1D7JA 3B9AA 3MDYB 3WL0A 3WL1A 4NZCA 4HBEA 2ESCA 1HKMA 2RURA 2A3EA 1A7XA 4G50A 5HTGA 1L1PA 1W9VA 4ODKA 3KABA 1RD6A 3O5OA 5DIUA 3WKZA 4Z2LA 1J4IA 2YBTA 2VN1A 1O6IA 4R0XA 3AS1A 4ODQA 2ZQSA 1EIBA 3ARUA 1JNSA 1OWQA 1FKTA 4DT4A 2FKEA 2KO7A 2DSZA 2MLYA 1FD9A 1FKIA 2O92A 2RSEA 3KCEA 4W9PA 4U86A 3KZ7A 1OGBA 4WK9A 1W1VA 3GTYX 3WD4A 1BKFA 3PRDA 1E9LA 2XP9A 4ZPVR 1EHNA 3PRAA 2VCDA 4MSPA 3IKDA 3WD0A 5J6EA 3TDBA 1SR0A 2ZQTA 4LAYA 1E15A 1D2KA 1NWUA 1HXVA 3IKGA 1FKFA 3O5MA 3O5IA 4DRKA 1LJYA 1W1PA 2KR7A 2M08A 4R5EA 2G8ZA 3KAFA 3WH0A 3RGCA 3O5EA 1QPLA 4MNKA 1Q1CA 3EY6A 4FN2A 1NSGA 4S3JA 2A3AA 1X6NA 1FFQA 1LG1A 2DSVA 3G6LA 3B8SA 4IT6A 4MNLA 3CHCA 4L3NA 3O5PA 2LKNA 5DF0A 3KAIA 1EQ3A 4DWSA 3PRBA 3ARXA 3RM8A 4Z2JA 3UI5A 1M5YA 4P8UA 2KFWA 4URIA 3O5RA 4Z2IA 4JFKA 4ZPWR 3B9EA 1GUVA 4J4NA 2XP7A 2RQSA 2ZQUA 4IQ2A 1ROTA 3FY1A 1KT0A 3IHZA 1FKKA 3ARSA 4KR0B 3RM4A 2RUQA 1ZU8A 4TNSA 1JNEA 3AQUA 4U84A 1HKIA 1W26A 4W9QA 4NNRA 1GRJA 1KFWA 4ITZA 4HARA 2G41A 1FKGA 3UQBA 4DRPA 1J4HA 1ZL1A 5HW8A 2XP5A 1Q6HA 1NH6A 3JYMA 2IUZA 3ARWA 3EIPA 4W5UA 3W4RA 5I98A 3WD2A 3ARQA 4TW6A 1YW5A 1FFRA 1ITXA 5HW7A 1JNDA 2XP4A 1ZBVA 2PPPA 1TFVA 1WAWA 3O5KA 4Z2GA 1ZCNA 1LL6A 3CHDA 1ZB5A 4QT2A 1J4RA 4WKFA 4W9OA 1XRVA 3UQIA 1J6YA 1D6OA 3AROA 5HKGA 2K8IA 4JFMA 4XAKA 4QIBA 4ML4A 1NWTA 2WLZA 1LL4A 4MNJA 1X6LA 4DWSD 2F4EA 4DRQA 3ARYA 1FJDA 4DRIA 3ALGA 1LL7A 2LGOA 1FKRA 1QZ2A 1WNOA 3UI4A 3CZ8A 4KQZA 1HKKA 2EULA 4UDMA 4Z2HA 4L72B 1FAPA 3BXWA 4LGXA 3UF8A 3O5GA 4MGVA 4HBOA 3FXYA 4DRMA
chains in the Genus database with same CATH topology
4QT3A 4ZS6A 4MTVA 5HWCA 1BL4A 4MPKA 2PV1A 4JFLA 1E6RA 1XHGA 2M2AA 1HJVA 3NI6A 4PTMA 4DH0A 2DT0A 3JYJA 4MNMA 4GGQA 2B31A 1Y0OA 3ALFA 3B9DA 2Q5AA 1E6PA 2MF9A 1ZBKA 2PV2A 1PBKA 4IQCA 3KAGA 1HKJA 1VF8A 4LAXA 3OA5A 1FKLA 3GPKA 5BXJA 2AWGA 4DZ2A 2DT1A 4MAVA 4DROA 1LQ0A 1HJXA 3RM9A 4DRJA 3O5FA 2MLZA 2RUDA 1ZK6A 4JFJA 4S3KA 1D7IA 1ROUA 3WQWA 4FAPA 2PV3A 2WLYA 2FDMA 3ARVA 5HT1A 2UZ5A 3KADA 5DEZA 1JNTA 4P8VA 1ZBCA 1PINA 2PI6A 4DZ3A 4N19A 2DG9A 2XP6A 5DITA 1U79A 2LJ4A 2KI3A 4IT4A 1TCOC 4BF8A 2OFNA 1HJWA 3IK8A 4TYOA 1FKHA 4Z2KA 5DO2A 1P5QA 2PPNA 4O2TA 1QPFA 5HWBA 4LAWA 4G2PA 3TCZA 3UI6A 3WD3A 2ZR6A 2F21A 3O5LA 3CGNA 1UR9A 2XP8A 3JXVA 1W1TA 2L2SA 3FAPA 1JVWA 1Q6UA 4IPXA 4JFIA 1UR8A 1OGGA 5HBFA 2AOSA 1NWSA 1GPFA 1CTNA 3WQVA 3AS2A 4WKHA 1T11A 3ARTA 2PBCA 3O5QA 2XPAA 4LAVA 5GPRA 3LUOA 3H9RB 2MNTA 2ZQVA 4GIVA 1SYTA 3I6CA 1EYMA 2WK2A 1W9UA 4U85A 2KE0A 5B8IC 4WKAA 1EDQA 1NMWA 4P8WA 3VAWA 1E6NA 4AY1A 2DPEA 3RFWA 2MPHA 3QOKA 2RUCA 1KT1A 2DT3A 4DRNA 1N1AA 4JYSA 1W1YA 3NTPA 3OOBA 3CGMA 2XPBA 4NSBA 3PR9A 2QF8A 1H0IA 2M1IA 1W9PA 3WD1A 5DIVA 4ODRA 5GQBA 2KGJA 1YATA 1F8AB 3CH9A 3TC5A 4ODOA 4TW7A 2FAPA 1GOIA 4J4OA 3B7XA 2IF4A 2A3CA 3UQAA 4C02B 4ODLA 3NRKA 2YBUA 2LPVA 2WM0A 2D9FA 3O5JA 1C9HA 2MLXA 4Q7NA 1B6CA 3PA7A 1FKBA 5JH8A 3CHFA 3ARRA 4ZPTR 2DSWA 2OLHA 2ITKA 2DT2A 1NWRA 2PPOA 4TW8A 3AS3A 4WIWA 2DG4A 4Q22A 1H0GA 2Y78A 4DRHA 1K9TA 2N87A 1R9HA 3RMEA 4ODPA 4WJXA 4DWSB 2O9OA 2ZR4A 5D75A 1E6ZA 5GPGA 3AS0A 3WIJA 1D7HA 1F40A 1FKJA 1LG2A 3ODKA 4TX0A 5HUAA 2XP3A 4QZVB 4DWSC 2DSUA 4P8XA 2A3BA 4DIPA 3CHEA 2F2DA 1Q6IA 3O5DA 3KAHA 1FKSA 1FKDA 4ODNA 3G6MA 2DG3A 4ODMA 2JZVA 1IX5A 1NMVA 3KACA 5HW6A 1WB0A 3ARPA 1ZBWA 2ZR5A 3ARZA 1D7JA 3B9AA 3MDYB 3WL0A 3WL1A 4NZCA 4HBEA 2ESCA 1HKMA 2RURA 2A3EA 1A7XA 4G50A 5HTGA 1L1PA 1W9VA 4ODKA 3KABA 1RD6A 3O5OA 5DIUA 3WKZA 4Z2LA 1J4IA 2YBTA 2VN1A 1O6IA 4R0XA 3AS1A 4ODQA 2ZQSA 1EIBA 3ARUA 1JNSA 1OWQA 1FKTA 4DT4A 2FKEA 2KO7A 2DSZA 2MLYA 1FD9A 1FKIA 2O92A 2RSEA 3KCEA 4W9PA 4U86A 3KZ7A 1OGBA 4WK9A 1W1VA 3WD4A 1BKFA 3PRDA 1E9LA 2XP9A 4ZPVR 1EHNA 3PRAA 2VCDA 4MSPA 3IKDA 3WD0A 5J6EA 3TDBA 1SR0A 2ZQTA 4LAYA 1E15A 1D2KA 1NWUA 1HXVA 3IKGA 1FKFA 3O5MA 3O5IA 4DRKA 1LJYA 1W1PA 2KR7A 2M08A 4R5EA 2G8ZA 3KAFA 3WH0A 3RGCA 3O5EA 1QPLA 4MNKA 1Q1CA 3EY6A 4FN2A 1NSGA 4S3JA 2A3AA 1X6NA 1FFQA 1LG1A 2DSVA 3G6LA 3B8SA 4IT6A 4MNLA 3CHCA 4L3NA 3O5PA 2LKNA 5DF0A 3KAIA 1EQ3A 4DWSA 3PRBA 3ARXA 3RM8A 4Z2JA 3UI5A 1M5YA 4P8UA 2KFWA 4URIA 3O5RA 4Z2IA 4JFKA 4ZPWR 3B9EA 1GUVA 4J4NA 2XP7A 2RQSA 2ZQUA 4IQ2A 1ROTA 3FY1A 1KT0A 3IHZA 1FKKA 3ARSA 4KR0B 3RM4A 2RUQA 1ZU8A 4TNSA 1JNEA 3AQUA 4U84A 1HKIA 1W26A 4W9QA 4NNRA 1KFWA 4ITZA 4HARA 2G41A 1FKGA 3UQBA 4DRPA 1J4HA 1ZL1A 5HW8A 2XP5A 1Q6HA 1NH6A 3JYMA 2IUZA 3ARWA 4W5UA 5I98A 3W4RA 3WD2A 3ARQA 4TW6A 1YW5A 1FFRA 1ITXA 5HW7A 1JNDA 2XP4A 1ZBVA 2PPPA 1TFVA 1WAWA 3O5KA 4Z2GA 1ZCNA 1LL6A 3CHDA 1ZB5A 4QT2A 1J4RA 4WKFA 4W9OA 1XRVA 3UQIA 1J6YA 1D6OA 3AROA 5HKGA 2K8IA 4JFMA 4XAKA 4QIBA 4ML4A 1NWTA 2WLZA 1LL4A 4MNJA 1X6LA 4DWSD 2F4EA 4DRQA 3ARYA 1FJDA 4DRIA 3ALGA 1LL7A 2LGOA 1FKRA 1QZ2A 1WNOA 3UI4A 3CZ8A 4KQZA 1HKKA 4Z2HA 4L72B 1FAPA 3BXWA 4LGXA 3UF8A 3O5GA 4MGVA 4HBOA 3FXYA 4DRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKJ A;  3ODK A;  4FN2 A;  1NSG A;  4QT3 A;  3LUO A;  4TX0 A;  5HWC A;  2XP3 A;  1BL4 A;  2MNT A;  3H9R B;  5HUA A;  2ZQV A;  4DIP A;  4GIV A;  2F2D A;  2PV1 A;  4JFL A;  1Q6I A;  1EYM A;  3I6C A;  3O5D A;  3KAH A;  2M2A A;  4U85 A;  1FKS A;  3NI6 A;  3O5P A;  1FKD A;  2KE0 A;  4ODN A;  5B8I C;  4DH0 A;  1NMW A;  2LKN A;  3JYJ A;  4GGQ A;  3VAW A;  3KAI A;  2DG3 A;  1EQ3 A;  4ODM A;  3PRB A;  1F40 A;  1Y0O A;  2JZV A;  3UI5 A;  1M5Y A;  2KFW A;  3O5R A;  1NMV A;  2Q5A A;  2MF9 A;  4JFK A;  2PV2 A;  3RFW A;  3KAC A;  1PBK A;  4IQC A;  2MPH A;  5HW6 A;  3KAG A;  4J4N A;  2RUC A;  2XP7 A;  2ZR5 A;  1KT1 A;  2RQS A;  4LAX A;  2ZQU A;  1FKL A;  1D7J A;  1N1A A;  1ROT A;  3GPK A;  4IQ2 A;  4JYS A;  4DRN A;  5BXJ A;  3MDY B;  2AWG A;  1KT0 A;  3IHZ A;  1FKK A;  3NTP A;  3OOB A;  3CGM A;  4DZ2 A;  2XPB A;  2RUQ A;  4DRO A;  4TNS A;  2RUR A;  4U84 A;  4DRJ A;  1W26 A;  4W9Q A;  3O5F A;  2MLZ A;  2RUD A;  1A7X A;  1ZK6 A;  4JFJ A;  4NNR A;  2M1I A;  4G50 A;  1D7I A;  5HTG A;  1L1P A;  4ITZ A;  1ROU A;  4ODK A;  5DIV A;  4ODR A;  3KAB A;  5DIU A;  1FKG A;  2PV3 A;  3O5O A;  4FAP A;  2KGJ A;  1J4I A;  3UQB A;  4DRP A;  1J4H A;  5HT1 A;  2UZ5 A;  5HW8 A;  2XP5 A;  2VN1 A;  1YAT A;  1Q6H A;  3KAD A;  4LAV A;  1F8A B;  3JYM A;  4R0X A;  1JNT A;  5I98 A;  4ODQ A;  3TC5 A;  2ZQS A;  4ODO A;  4TW7 A;  2FAP A;  4J4O A;  4TW6 A;  1PIN A;  1YW5 A;  3B7X A;  1JNS A;  2IF4 A;  1FKT A;  5HW7 A;  3UQA A;  2XP4 A;  4C02 B;  4DT4 A;  2PPP A;  4ODL A;  4N19 A;  2DG9 A;  4DZ3 A;  2XP6 A;  2FKE A;  3NRK A;  5DIT A;  2LPV A;  1U79 A;  2KO7 A;  3O5K A;  1ZCN A;  2D9F A;  2MLY A;  2LJ4 A;  3O5J A;  1FD9 A;  1FKI A;  2KI3 A;  4QT2 A;  1TCO C;  1C9H A;  4BF8 A;  2MLX A;  1J4R A;  2RSE A;  2OFN A;  3KCE A;  3IK8 A;  4W9P A;  4W9O A;  1B6C A;  3PA7 A;  1FKB A;  4U86 A;  4TYO A;  1FKH A;  3KZ7 A;  3UQI A;  1J6Y A;  1D6O A;  5HKG A;  2K8I A;  4JFM A;  1BKF A;  3PRD A;  2XP9 A;  1P5Q A;  2PPN A;  2VCD A;  4O2T A;  1QPF A;  4MSP A;  2ITK A;  4LAW A;  3IKD A;  4QIB A;  5HWB A;  4G2P A;  3TCZ A;  3UI6 A;  2F4E A;  5J6E A;  4DRQ A;  3TDB A;  4TW8 A;  2PPO A;  2ZR6 A;  1FJD A;  2ZQT A;  2F21 A;  3O5L A;  3CGN A;  2DG4 A;  4DRI A;  4LAY A;  2Y78 A;  4DRH A;  2LGO A;  2XP8 A;  3JXV A;  1FKR A;  1QZ2 A;  2L2S A;  3FAP A;  3UI4 A;  1HXV A;  1JVW A;  3IKG A;  1FKF A;  2N87 A;  1Q6U A;  4IPX A;  3O5M A;  3O5I A;  4DRK A;  4JFI A;  1R9H A;  2KR7 A;  2M08 A;  4ODP A;  1FAP A;  2ZR4 A;  5D75 A;  3KAF A;  3WH0 A;  5GPG A;  3RGC A;  3O5E A;  3UF8 A;  3O5G A;  1T11 A;  4MGV A;  1D7H A;  1QPL A;  2PBC A;  2XPA A;  3O5Q A;  4DRM A;  1Q1C A;  3EY6 A; 
#chains in the Genus database with same CATH topology
 4QT3 A;  4ZS6 A;  4MTV A;  5HWC A;  1BL4 A;  4MPK A;  2PV1 A;  4JFL A;  2PN0 A;  1E6R A;  1XHG A;  2M2A A;  1HJV A;  3NI6 A;  4PTM A;  4DH0 A;  2DT0 A;  3JYJ A;  4MNM A;  4GGQ A;  2B31 A;  1Y0O A;  3ALF A;  3B9D A;  2Q5A A;  1E6P A;  2MF9 A;  1ZBK A;  2PV2 A;  1PBK A;  4IQC A;  3KAG A;  1HKJ A;  1JCH B;  1VF8 A;  4LAX A;  3OA5 A;  1FKL A;  3GPK A;  5BXJ A;  2AWG A;  4DZ2 A;  2DT1 A;  4MAV A;  4DRO A;  1LQ0 A;  1HJX A;  3RM9 A;  4DRJ A;  3O5F A;  2MLZ A;  2RUD A;  1ZK6 A;  4JFJ A;  4S3K A;  1D7I A;  3BMB A;  1ROU A;  3WQW A;  4FAP A;  2PV3 A;  2WLY A;  2FDM A;  3ARV A;  5HT1 A;  2UZ5 A;  3KAD A;  5DEZ A;  1JNT A;  4P8V A;  1ZBC A;  1PIN A;  2PI6 A;  4DZ3 A;  4N19 A;  2DG9 A;  2XP6 A;  5DIT A;  1U79 A;  2LJ4 A;  2KI3 A;  4IT4 A;  1TCO C;  4BF8 A;  2OFN A;  1HJW A;  3IK8 A;  4TYO A;  1FKH A;  4Z2K A;  5DO2 A;  1P5Q A;  2PPN A;  4O2T A;  1QPF A;  5HWB A;  4LAW A;  4G2P A;  3TCZ A;  3UI6 A;  3WD3 A;  2ZR6 A;  2F21 A;  3O5L A;  3CGN A;  1UR9 A;  2XP8 A;  3JXV A;  1W1T A;  2L2S A;  3FAP A;  1JVW A;  1Q6U A;  4IPX A;  4JFI A;  1UR8 A;  1OGG A;  5HBF A;  2AOS A;  1NWS A;  1GPF A;  1CTN A;  3WQV A;  3AS2 A;  4WKH A;  1T11 A;  3ART A;  2PBC A;  3O5Q A;  2XPA A;  4LAV A;  5GPR A;  3LUO A;  3H9R B;  2MNT A;  2ETN A;  2ZQV A;  4GIV A;  1SYT A;  3I6C A;  1EYM A;  2WK2 A;  1W9U A;  1E44 A;  4U85 A;  2KE0 A;  5B8I C;  4WKA A;  1EDQ A;  1NMW A;  4P8W A;  3VAW A;  1E6N A;  4AY1 A;  2DPE A;  3RFW A;  2MPH A;  3QOK A;  2RUC A;  1KT1 A;  2DT3 A;  4DRN A;  1N1A A;  4JYS A;  1W1Y A;  3NTP A;  3OOB A;  3CGM A;  2XPB A;  4NSB A;  3PR9 A;  2QF8 A;  1H0I A;  2M1I A;  1W9P A;  3WD1 A;  5DIV A;  4ODR A;  5GQB A;  2KGJ A;  1YAT A;  1F8A B;  3CH9 A;  3TC5 A;  4ODO A;  4TW7 A;  2FAP A;  2P4V A;  1GOI A;  4J4O A;  3B7X A;  2IF4 A;  2F23 A;  3GU0 A;  2A3C A;  3UQA A;  4C02 B;  4ODL A;  3NRK A;  2YBU A;  2LPV A;  2WM0 A;  2D9F A;  3O5J A;  1C9H A;  2MLX A;  4Q7N A;  1B6C A;  3PA7 A;  1FKB A;  5JH8 A;  3CHF A;  3ARR A;  4ZPT R;  2DSW A;  2OLH A;  2ITK A;  2DT2 A;  1NWR A;  2PPO A;  4TW8 A;  3AS3 A;  4WIW A;  2DG4 A;  4Q22 A;  1H0G A;  2Y78 A;  4DRH A;  1K9T A;  2N87 A;  1R9H A;  3RME A;  4ODP A;  4WJX A;  4DWS B;  2O9O A;  2ZR4 A;  5D75 A;  1E6Z A;  5GPG A;  3AS0 A;  2B5U B;  3WIJ A;  1D7H A;  1F40 A;  1FKJ A;  1LG2 A;  3ODK A;  4TX0 A;  5HUA A;  2XP3 A;  4QZV B;  4DWS C;  2DSU A;  4P8X A;  2A3B A;  4DIP A;  3CHE A;  2F2D A;  1Q6I A;  3O5D A;  3KAH A;  1FKS A;  1FKD A;  4ODN A;  3G6M A;  2DG3 A;  4ODM A;  2JZV A;  1IX5 A;  1NMV A;  3KAC A;  5HW6 A;  1WB0 A;  3ARP A;  1ZBW A;  2ZR5 A;  3ARZ A;  1D7J A;  3B9A A;  3MDY B;  3WL0 A;  3WL1 A;  4NZC A;  4HBE A;  2ESC A;  1HKM A;  2RUR A;  2A3E A;  1A7X A;  4G50 A;  5HTG A;  1L1P A;  1W9V A;  4ODK A;  3KAB A;  1RD6 A;  3O5O A;  5DIU A;  3WKZ A;  4Z2L A;  1J4I A;  2YBT A;  2VN1 A;  1O6I A;  4R0X A;  3AS1 A;  4ODQ A;  2ZQS A;  1EIB A;  3ARU A;  1JNS A;  1OWQ A;  1FKT A;  4DT4 A;  2FKE A;  2KO7 A;  2DSZ A;  2MLY A;  1FD9 A;  1FKI A;  2O92 A;  2RSE A;  3KCE A;  4W9P A;  4U86 A;  3KZ7 A;  1OGB A;  4WK9 A;  1W1V A;  3GTY X;  3WD4 A;  1BKF A;  3PRD A;  1E9L A;  2XP9 A;  4ZPV R;  1EHN A;  3PRA A;  2VCD A;  4MSP A;  3IKD A;  3WD0 A;  5J6E A;  3TDB A;  1SR0 A;  2ZQT A;  4LAY A;  1E15 A;  1D2K A;  1NWU A;  1HXV A;  3IKG A;  1FKF A;  3O5M A;  3O5I A;  4DRK A;  1LJY A;  1W1P A;  2KR7 A;  2M08 A;  4R5E A;  2G8Z A;  3KAF A;  3WH0 A;  3RGC A;  3O5E A;  1QPL A;  4MNK A;  1Q1C A;  3EY6 A;  4FN2 A;  1NSG A;  4S3J A;  2A3A A;  1X6N A;  1FFQ A;  1LG1 A;  2DSV A;  3G6L A;  3B8S A;  4IT6 A;  4MNL A;  3CHC A;  4L3N A;  3O5P A;  2LKN A;  5DF0 A;  3KAI A;  1EQ3 A;  4DWS A;  3PRB A;  3ARX A;  3RM8 A;  4Z2J A;  3UI5 A;  1M5Y A;  4P8U A;  2KFW A;  4URI A;  3O5R A;  4Z2I A;  4JFK A;  4ZPW R;  3B9E A;  1GUV A;  4J4N A;  2XP7 A;  2RQS A;  2ZQU A;  4IQ2 A;  1ROT A;  3FY1 A;  1KT0 A;  3IHZ A;  1FKK A;  3ARS A;  4KR0 B;  3RM4 A;  2RUQ A;  1ZU8 A;  4TNS A;  1JNE A;  3AQU A;  4U84 A;  1HKI A;  1W26 A;  4W9Q A;  4NNR A;  1GRJ A;  1KFW A;  4ITZ A;  4HAR A;  2G41 A;  1FKG A;  3UQB A;  4DRP A;  1J4H A;  1ZL1 A;  5HW8 A;  2XP5 A;  1Q6H A;  1NH6 A;  3JYM A;  2IUZ A;  3ARW A;  3EIP A;  4W5U A;  3W4R A;  5I98 A;  3WD2 A;  3ARQ A;  4TW6 A;  1YW5 A;  1FFR A;  1ITX A;  5HW7 A;  1JND A;  2XP4 A;  1ZBV A;  2PPP A;  1TFV A;  1WAW A;  3O5K A;  4Z2G A;  1ZCN A;  1LL6 A;  3CHD A;  1ZB5 A;  4QT2 A;  1J4R A;  4WKF A;  4W9O A;  1XRV A;  3UQI A;  1J6Y A;  1D6O A;  3ARO A;  5HKG A;  2K8I A;  4JFM A;  4XAK A;  4QIB A;  4ML4 A;  1NWT A;  2WLZ A;  1LL4 A;  4MNJ A;  1X6L A;  4DWS D;  2F4E A;  4DRQ A;  3ARY A;  1FJD A;  4DRI A;  3ALG A;  1LL7 A;  2LGO A;  1FKR A;  1QZ2 A;  1WNO A;  3UI4 A;  3CZ8 A;  4KQZ A;  1HKK A;  2EUL A;  4UDM A;  4Z2H A;  4L72 B;  1FAP A;  3BXW A;  4LGX A;  3UF8 A;  3O5G A;  4MGV A;  4HBO A;  3FXY A;  4DRM A; 
#chains in the Genus database with same CATH homology
 4QT3 A;  4ZS6 A;  4MTV A;  5HWC A;  1BL4 A;  4MPK A;  2PV1 A;  4JFL A;  1E6R A;  1XHG A;  2M2A A;  1HJV A;  3NI6 A;  4PTM A;  4DH0 A;  2DT0 A;  3JYJ A;  4MNM A;  4GGQ A;  2B31 A;  1Y0O A;  3ALF A;  3B9D A;  2Q5A A;  1E6P A;  2MF9 A;  1ZBK A;  2PV2 A;  1PBK A;  4IQC A;  3KAG A;  1HKJ A;  1VF8 A;  4LAX A;  3OA5 A;  1FKL A;  3GPK A;  5BXJ A;  2AWG A;  4DZ2 A;  2DT1 A;  4MAV A;  4DRO A;  1LQ0 A;  1HJX A;  3RM9 A;  4DRJ A;  3O5F A;  2MLZ A;  2RUD A;  1ZK6 A;  4JFJ A;  4S3K A;  1D7I A;  1ROU A;  3WQW A;  4FAP A;  2PV3 A;  2WLY A;  2FDM A;  3ARV A;  5HT1 A;  2UZ5 A;  3KAD A;  5DEZ A;  1JNT A;  4P8V A;  1ZBC A;  1PIN A;  2PI6 A;  4DZ3 A;  4N19 A;  2DG9 A;  2XP6 A;  5DIT A;  1U79 A;  2LJ4 A;  2KI3 A;  4IT4 A;  1TCO C;  4BF8 A;  2OFN A;  1HJW A;  3IK8 A;  4TYO A;  1FKH A;  4Z2K A;  5DO2 A;  1P5Q A;  2PPN A;  4O2T A;  1QPF A;  5HWB A;  4LAW A;  4G2P A;  3TCZ A;  3UI6 A;  3WD3 A;  2ZR6 A;  2F21 A;  3O5L A;  3CGN A;  1UR9 A;  2XP8 A;  3JXV A;  1W1T A;  2L2S A;  3FAP A;  1JVW A;  1Q6U A;  4IPX A;  4JFI A;  1UR8 A;  1OGG A;  5HBF A;  2AOS A;  1NWS A;  1GPF A;  1CTN A;  3WQV A;  3AS2 A;  4WKH A;  1T11 A;  3ART A;  2PBC A;  3O5Q A;  2XPA A;  4LAV A;  5GPR A;  3LUO A;  3H9R B;  2MNT A;  2ZQV A;  4GIV A;  1SYT A;  3I6C A;  1EYM A;  2WK2 A;  1W9U A;  4U85 A;  2KE0 A;  5B8I C;  4WKA A;  1EDQ A;  1NMW A;  4P8W A;  3VAW A;  1E6N A;  4AY1 A;  2DPE A;  3RFW A;  2MPH A;  3QOK A;  2RUC A;  1KT1 A;  2DT3 A;  4DRN A;  1N1A A;  4JYS A;  1W1Y A;  3NTP A;  3OOB A;  3CGM A;  2XPB A;  4NSB A;  3PR9 A;  2QF8 A;  1H0I A;  2M1I A;  1W9P A;  3WD1 A;  5DIV A;  4ODR A;  5GQB A;  2KGJ A;  1YAT A;  1F8A B;  3CH9 A;  3TC5 A;  4ODO A;  4TW7 A;  2FAP A;  1GOI A;  4J4O A;  3B7X A;  2IF4 A;  2A3C A;  3UQA A;  4C02 B;  4ODL A;  3NRK A;  2YBU A;  2LPV A;  2WM0 A;  2D9F A;  3O5J A;  1C9H A;  2MLX A;  4Q7N A;  1B6C A;  3PA7 A;  1FKB A;  5JH8 A;  3CHF A;  3ARR A;  4ZPT R;  2DSW A;  2OLH A;  2ITK A;  2DT2 A;  1NWR A;  2PPO A;  4TW8 A;  3AS3 A;  4WIW A;  2DG4 A;  4Q22 A;  1H0G A;  2Y78 A;  4DRH A;  1K9T A;  2N87 A;  1R9H A;  3RME A;  4ODP A;  4WJX A;  4DWS B;  2O9O A;  2ZR4 A;  5D75 A;  1E6Z A;  5GPG A;  3AS0 A;  3WIJ A;  1D7H A;  1F40 A;  1FKJ A;  1LG2 A;  3ODK A;  4TX0 A;  5HUA A;  2XP3 A;  4QZV B;  4DWS C;  2DSU A;  4P8X A;  2A3B A;  4DIP A;  3CHE A;  2F2D A;  1Q6I A;  3O5D A;  3KAH A;  1FKS A;  1FKD A;  4ODN A;  3G6M A;  2DG3 A;  4ODM A;  2JZV A;  1IX5 A;  1NMV A;  3KAC A;  5HW6 A;  1WB0 A;  3ARP A;  1ZBW A;  2ZR5 A;  3ARZ A;  1D7J A;  3B9A A;  3MDY B;  3WL0 A;  3WL1 A;  4NZC A;  4HBE A;  2ESC A;  1HKM A;  2RUR A;  2A3E A;  1A7X A;  4G50 A;  5HTG A;  1L1P A;  1W9V A;  4ODK A;  3KAB A;  1RD6 A;  3O5O A;  5DIU A;  3WKZ A;  4Z2L A;  1J4I A;  2YBT A;  2VN1 A;  1O6I A;  4R0X A;  3AS1 A;  4ODQ A;  2ZQS A;  1EIB A;  3ARU A;  1JNS A;  1OWQ A;  1FKT A;  4DT4 A;  2FKE A;  2KO7 A;  2DSZ A;  2MLY A;  1FD9 A;  1FKI A;  2O92 A;  2RSE A;  3KCE A;  4W9P A;  4U86 A;  3KZ7 A;  1OGB A;  4WK9 A;  1W1V A;  3WD4 A;  1BKF A;  3PRD A;  1E9L A;  2XP9 A;  4ZPV R;  1EHN A;  3PRA A;  2VCD A;  4MSP A;  3IKD A;  3WD0 A;  5J6E A;  3TDB A;  1SR0 A;  2ZQT A;  4LAY A;  1E15 A;  1D2K A;  1NWU A;  1HXV A;  3IKG A;  1FKF A;  3O5M A;  3O5I A;  4DRK A;  1LJY A;  1W1P A;  2KR7 A;  2M08 A;  4R5E A;  2G8Z A;  3KAF A;  3WH0 A;  3RGC A;  3O5E A;  1QPL A;  4MNK A;  1Q1C A;  3EY6 A;  4FN2 A;  1NSG A;  4S3J A;  2A3A A;  1X6N A;  1FFQ A;  1LG1 A;  2DSV A;  3G6L A;  3B8S A;  4IT6 A;  4MNL A;  3CHC A;  4L3N A;  3O5P A;  2LKN A;  5DF0 A;  3KAI A;  1EQ3 A;  4DWS A;  3PRB A;  3ARX A;  3RM8 A;  4Z2J A;  3UI5 A;  1M5Y A;  4P8U A;  2KFW A;  4URI A;  3O5R A;  4Z2I A;  4JFK A;  4ZPW R;  3B9E A;  1GUV A;  4J4N A;  2XP7 A;  2RQS A;  2ZQU A;  4IQ2 A;  1ROT A;  3FY1 A;  1KT0 A;  3IHZ A;  1FKK A;  3ARS A;  4KR0 B;  3RM4 A;  2RUQ A;  1ZU8 A;  4TNS A;  1JNE A;  3AQU A;  4U84 A;  1HKI A;  1W26 A;  4W9Q A;  4NNR A;  1KFW A;  4ITZ A;  4HAR A;  2G41 A;  1FKG A;  3UQB A;  4DRP A;  1J4H A;  1ZL1 A;  5HW8 A;  2XP5 A;  1Q6H A;  1NH6 A;  3JYM A;  2IUZ A;  3ARW A;  4W5U A;  5I98 A;  3W4R A;  3WD2 A;  3ARQ A;  4TW6 A;  1YW5 A;  1FFR A;  1ITX A;  5HW7 A;  1JND A;  2XP4 A;  1ZBV A;  2PPP A;  1TFV A;  1WAW A;  3O5K A;  4Z2G A;  1ZCN A;  1LL6 A;  3CHD A;  1ZB5 A;  4QT2 A;  1J4R A;  4WKF A;  4W9O A;  1XRV A;  3UQI A;  1J6Y A;  1D6O A;  3ARO A;  5HKG A;  2K8I A;  4JFM A;  4XAK A;  4QIB A;  4ML4 A;  1NWT A;  2WLZ A;  1LL4 A;  4MNJ A;  1X6L A;  4DWS D;  2F4E A;  4DRQ A;  3ARY A;  1FJD A;  4DRI A;  3ALG A;  1LL7 A;  2LGO A;  1FKR A;  1QZ2 A;  1WNO A;  3UI4 A;  3CZ8 A;  4KQZ A;  1HKK A;  4Z2H A;  4L72 B;  1FAP A;  3BXW A;  4LGX A;  3UF8 A;  3O5G A;  4MGV A;  4HBO A;  3FXY A;  4DRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...