5HW7A

Candida albicans fkbp12 apo protein in p21212 space group
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
122
structure length
122
Chain Sequence
EELPQIEIVQEGDNTTFAKPGDTVTIHYDGKLTNGKEFDSSRKRGKPFTCTVGVGQVIKGWDISLTNNYGKGGANLPKISKGTKAILTIPPNLAYGPRGIPPIIGPNETLVFEVELLGVNGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FK506-binding protein 1
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida albicans (strain sc5314 / atcc mya-2876)
total genus 28
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5hw7A00
2XP5A 2K8IA 2XP4A 3JYJA 3KCEA 5HW6A 5HWCA 1FAPA 5HUAA 2PBCA 2RUDA 4JFLA 4LAWA 4DT4A 1FJDA 2ZQVA 1ZCNA 1ROUA 3IHZA 2XP9A 3EY6A 1D7JA 4QT3A 3KACA 4DRKA 4FAPA 2XP6A 1FKKA 2M2AA 3O5QA 1ZK6A 3UQIA 2PV1A 2D9FA 3TCZA 3KAGA 4ITZA 2FKEA 2PPOA 4TYOA 3B7XA 5I98A 2VN1A 4W9PA 2Q5AA 1FKSA 2PPPA 2DG9A 3CGNA 1P5QA 3NI6A 4JFIA 4U86A 1HXVA 3RFWA 3KAIA 2VCDA 1A7XA 4TNSA 3JYMA 3KADA 3PRBA 3MDYB 4MGVA 1Q6IA 3PA7A 4J4OA 4DROA 4TW7A 4ODLA 4GGQA 2MNTA 4ODQA 3LUOA 2IF4A 1J4RA 2RUCA 4IPXA 3O5EA 3KZ7A 1FKTA 1C9HA 4LAVA 2KO7A 1D6OA 2MPHA 2DG3A 2ZQUA 4JFMA 1F40A 4QT2A 1JNSA 2XPAA 4FN2A 3O5MA 2RQSA 4DZ3A 5HTGA 4ODRA 4G50A 5HW7A 2LGOA 1NMVA 4DRNA 5GPGA 4DZ2A 1FKJA 4ODMA 1W26A 4IQCA 1FKDA 2XP3A 3FAPA 1FKGA 4JFJA 2LJ4A 4JYSA 5DIVA 4BF8A 3VAWA 2N87A 2JZVA 3IK8A 2PV2A 3PRDA 1PBKA 3TC5A 1J4IA 2ZR6A 4TW8A 3NRKA 3UQBA 2RSEA 5HKGA 2FAPA 3O5OA 3IKGA 4ODPA 2XP8A 2ZR5A 1J6YA 2KE0A 2M08A 2Y78A 1EQ3A 4DRMA 3TDBA 3O5KA 3GPKA 3CGMA 2PV3A 2ZQTA 4N19A 2MLYA 3UF8A 2M1IA 1Q1CA 1KT0A 1R9HA 1QPLA 4LAYA 4DRQA 1FKLA 3O5LA 1KT1A 2LPVA 1QZ2A 4DRJA 3O5FA 4O2TA 4U85A 5J6EA 1FKBA 3I6CA 2RURA 2F21A 4DRPA 4GIVA 3UI5A 2LKNA 5BXJA 5HW8A 2UZ5A 1FKRA 4R0XA 1T11A 2KR7A 1FD9A 2L2SA 5B8IC 2KGJA 5HT1A 1Q6HA 3WH0A 1L1PA 1TCOC 1D7HA 2MLXA 3KABA 1N1AA 3UI4A 3O5JA 1PINA 1M5YA 3O5GA 4G2PA 4ODKA 4QIBA 4W9OA 1D7IA 1NSGA 2F2DA 2ZQSA 4W9QA 3H9RB 2RUQA 1JVWA 3JXVA 4IQ2A 3KAFA 3O5RA 5HWBA 3UQAA 1QPFA 2OFNA 4U84A 4DRIA 1FKIA 4NNRA 2PPNA 4ODOA 1U79A 4ODNA 1EYMA 1Y0OA 5D75A 4DH0A 1Q6UA 1FKFA 1JNTA 1YATA 4MSPA 4TX0A 2AWGA 5DITA 1J4HA 2KI3A 4JFKA 2F4EA 2DG4A 4J4NA 4LAXA 3O5IA 1B6CA 2ZR4A 2MF9A 2ITKA 2XPBA 3O5PA 4C02B 1ROTA 3KAHA 2KFWA 1FKHA 1F8AB 4TW6A 1BKFA 2XP7A 2MLZA 3O5DA 3NTPA 1NMWA 4DRHA 3ODKA 3IKDA 3RGCA 1BL4A 4DIPA 3OOBA 1YW5A 3UI6A 5DIUA
chains in the Genus database with same CATH superfamily
2XP4A 1H0GA 4XAKA 2PBCA 4LAWA 3ALGA 1ROUA 3KACA 3WD0A 1FKKA 1WAWA 2DT0A 1SYTA 3AS3A 4Z2LA 3TCZA 4ITZA 1OGGA 4R5EA 1EDQA 4JFIA 1FKSA 4U86A 1P5QA 2VCDA 1ZBWA 3KADA 3MDYB 4MGVA 3RMEA 3PA7A 4TW7A 1TFVA 2IF4A 1ZBVA 2DG3A 3PRAA 4ZPWR 3ARVA 4URIA 2O92A 4DZ2A 1W26A 4IQCA 3FAPA 1FKGA 2WLZA 3B9EA 3WD2A 3PRDA 3NRKA 2FAPA 3B8SA 2DT3A 1EHNA 1W9VA 3CHCA 2P4VA 4IT4A 4AY1A 4Z2KA 4PTMA 3O5LA 3ARUA 1QZ2A 1FKBA 3I6CA 2RURA 3UI5A 5BXJA 5HW8A 1FD9A 2L2SA 2KGJA 1Q6HA 1TCOC 2MLXA 3KABA 4G2PA 3O5GA 4QIBA 2F2DA 1NSGA 5HUAA 4KQZA 4L3NA 4KR0B 1W9PA 3KAFA 1K9TA 4U84A 2PPNA 4ML4A 1EYMA 4QZVB 4TX0A 1HKMA 2KI3A 1OWQA 4ZPTR 4LAXA 3CZ8A 4WKFA 4MAVA 1FJDA 4TW6A 3NTPA 4UDMA 5DEZA 1BL4A 4DIPA 5DF0A 1JNTA 4Q22A 3G6LA 1E15A 4DT4A 4WJXA 1H0IA 2A3EA 2A3CA 1D7JA 3EY6A 4QT3A 4FAPA 3O5QA 1LQ0A 1NWTA 3OA5A 1FFRA 3ARYA 3ARZA 2FKEA 5I98A 1JNEA 2PN0A 1NWSA 3NI6A 2DG9A 3ARPA 3FY1A 4DWSC 5GPRA 4TNSA 4DWSA 3JYMA 3PRBA 3ARXA 1Q6IA 4ODLA 4GGQA 3RM8A 2DSZA 1J4RA 2DT2A 4LAVA 3O5EA 4U85A 1C9HA 2ZQUA 1GPFA 1F40A 2G41A 2XPAA 3O5MA 4DZ3A 4ODRA 4DRNA 4DWSD 1HKIA 4JYSA 4BF8A 2LJ4A 3VAWA 2JZVA 3IK8A 3WL1A 1J4IA 4TW8A 1HKJA 2RSEA 1D2KA 4Z2HA 3G6MA 3O5OA 2IUZA 2ZR5A 2KE0A 1ZBCA 4DRMA 4Z2JA 3TDBA 3GPKA 2PV3A 1JCHB 1GOIA 1KT0A 1R9HA 4DRQA 1FKLA 1ZU8A 1W1PA 5J6EA 1E6ZA 2WK2A 5DO2A 2LKNA 4NZCA 1WB0A 1FKRA 3WD3A 2KR7A 3WH0A 1L1PA 1D7HA 1N1AA 1W1VA 3O5JA 1PINA 4ODKA 1WNOA 3H9RB 1LL7A 4IQ2A 1E6PA 2A3BA 3UQAA 1O6IA 2DSWA 4ODOA 4ODNA 1Y0OA 3WD1A 4DH0A 3CHFA 1GRJA 4MSPA 1XHGA 2OLHA 2F4EA 3ALFA 4HARA 3O5IA 1B6CA 4C02B 1ROTA 3WL0A 2XP7A 4P8WA 1X6LA 2MLZA 1CTNA 1UR9A 4DRHA 4L72B 3B9AA 1E6NA 3RM4A 5HBFA 1KFWA 5HW6A 3JYJA 5HWCA 4MNJA 3WQWA 3PR9A 4ZPVR 1FAPA 2RUDA 3AS1A 4JFLA 3AROA 2ZQVA 4MTVA 4P8VA 4DRKA 2XP6A 2M2AA 1EIBA 1ZK6A 3UQIA 3KAGA 1ZL1A 4TYOA 2VN1A 4W9PA 2WLYA 2Q5AA 1VF8A 3CGNA 4W5UA 3RFWA 3WQVA 3FXYA 4DROA 4P8XA 3KZ7A 4HBOA 3CHEA 5HT1A 2KO7A 1D6OA 3WD4A 4JFMA 1RD6A 1JNSA 3WKZA 1LJYA 1LG2A 4G50A 2O9OA 2LGOA 1NMVA 5JH8A 3AS2A 1FKJA 4WKHA 1FKDA 2FDMA 1HKKA 1NWUA 2N87A 3TC5A 1PBKA 3UQBA 1HJXA 3AS0A 3GTYX 3IKGA 4ODPA 2XP8A 1FFQA 1EQ3A 1HJVA 3CH9A 3O5KA 4N19A 4NSBA 2M1IA 1QPLA 2A3AA 2YBUA 1HJWA 1KT1A 4DRJA 4O2TA 1GUVA 2F21A 4MPKA 4DRPA 4MNLA 3W4RA 4WIWA 4HBEA 1NWRA 2EULA 3EIPA 1IX5A 3UI4A 1M5YA 1D7IA 2ZQSA 4W9QA 5HWBA 2RUQA 1JVWA 4DWSB 1QPFA 2OFNA 1FKIA 1SR0A 4NNRA 4WK9A 1U79A 5D75A 1FKFA 2AWGA 5DITA 1J4HA 4J4NA 4Q7NA 2ZR4A 2ITKA 2XPBA 3O5PA 3QOKA 1F8AB 1NH6A 1BKFA 3B9DA 4WKAA 2ETNA 1NMWA 4S3KA 5DIUA 2XP5A 2K8IA 3KCEA 4LGXA 1W9UA 1E44A 1ITXA 2PI6A 1ZCNA 3BMBA 3IHZA 2XP9A 2DT1A 4S3JA 1OGBA 4Z2IA 1XRVA 1W1YA 1X6NA 5GQBA 1LL4A 3CHDA 2PV1A 2D9FA 2PPOA 3B7XA 2PPPA 3RM9A 4ZS6A 3WIJA 1HXVA 1E6RA 3KAIA 1A7XA 1ZB5A 4J4OA 2MNTA 2B31A 2ESCA 4ODQA 3LUOA 2AOSA 1LL6A 2YBTA 2RUCA 4IPXA 5B8IC 1FKTA 2MPHA 4QT2A 4FN2A 2RQSA 5HTGA 5HW7A 5GPGA 2QF8A 2WM0A 4ODMA 4MNKA 5DIVA 2XP3A 4JFJA 1ZBKA 2DPEA 2PV2A 2DSVA 2ZR6A 5HKGA 3ARWA 1J6YA 2Y78A 2M08A 2G8ZA 3BXWA 3CGMA 2ZQTA 2MLYA 3UF8A 1Q1CA 4LAYA 2LPVA 3ARTA 3ARRA 4P8UA 3O5FA 3AQUA 4GIVA 2UZ5A 4R0XA 1T11A 2B5UB 4W9OA 3GU0A 3JXVA 3O5RA 1W1TA 4DRIA 1E9LA 1LG1A 1Q6UA 1YATA 3ARSA 4JFKA 2F23A 2DG4A 1UR8A 4IT6A 2MF9A 3KAHA 2KFWA 1FKHA 4Z2GA 4MNMA 3O5DA 2DSUA 3ODKA 1JNDA 3IKDA 3RGCA 3ARQA 3OOBA 1YW5A 3UI6A
chains in the Genus database with same CATH topology
2XP4A 1H0GA 4XAKA 2PBCA 4LAWA 3ALGA 1ROUA 3KACA 3WD0A 1FKKA 1WAWA 2DT0A 1SYTA 3AS3A 4Z2LA 3TCZA 4ITZA 1OGGA 4R5EA 1EDQA 4JFIA 1FKSA 4U86A 1P5QA 2VCDA 1ZBWA 3KADA 3MDYB 4MGVA 3RMEA 3PA7A 4TW7A 1TFVA 2IF4A 1ZBVA 2DG3A 3PRAA 4ZPWR 3ARVA 4URIA 2O92A 4DZ2A 1W26A 4IQCA 3FAPA 1FKGA 2WLZA 3B9EA 3WD2A 3PRDA 3NRKA 2FAPA 3B8SA 2DT3A 1EHNA 1W9VA 3CHCA 4IT4A 4AY1A 4Z2KA 4PTMA 3O5LA 3ARUA 1QZ2A 1FKBA 3I6CA 2RURA 3UI5A 5BXJA 5HW8A 1FD9A 2L2SA 2KGJA 1Q6HA 1TCOC 2MLXA 3KABA 4G2PA 3O5GA 4QIBA 2F2DA 1NSGA 5HUAA 4KQZA 4L3NA 4KR0B 1W9PA 3KAFA 1K9TA 4U84A 2PPNA 4ML4A 1EYMA 4QZVB 4TX0A 1HKMA 2KI3A 1OWQA 4ZPTR 4LAXA 3CZ8A 4WKFA 4MAVA 1FJDA 4TW6A 3NTPA 5DEZA 1BL4A 4DIPA 5DF0A 1JNTA 4Q22A 3G6LA 1E15A 4DT4A 4WJXA 1H0IA 2A3EA 2A3CA 1D7JA 3EY6A 4QT3A 4FAPA 3O5QA 1LQ0A 1NWTA 3OA5A 1FFRA 3ARYA 3ARZA 2FKEA 5I98A 1JNEA 1NWSA 3NI6A 2DG9A 3ARPA 3FY1A 4DWSC 5GPRA 4TNSA 4DWSA 3JYMA 3PRBA 3ARXA 1Q6IA 4ODLA 4GGQA 3RM8A 2DSZA 1J4RA 2DT2A 4LAVA 3O5EA 4U85A 1C9HA 2ZQUA 1GPFA 1F40A 2G41A 2XPAA 3O5MA 4DZ3A 4ODRA 4DRNA 4DWSD 1HKIA 4JYSA 4BF8A 2LJ4A 3VAWA 2JZVA 3IK8A 3WL1A 1J4IA 4TW8A 1HKJA 2RSEA 1D2KA 4Z2HA 3G6MA 3O5OA 2IUZA 2ZR5A 2KE0A 1ZBCA 4DRMA 4Z2JA 3TDBA 3GPKA 2PV3A 1GOIA 1KT0A 1R9HA 4DRQA 1FKLA 1ZU8A 1W1PA 5J6EA 1E6ZA 2WK2A 5DO2A 2LKNA 4NZCA 1WB0A 1FKRA 3WD3A 2KR7A 3WH0A 1L1PA 1D7HA 1N1AA 1W1VA 3O5JA 1PINA 4ODKA 1WNOA 3H9RB 1LL7A 4IQ2A 1E6PA 2A3BA 3UQAA 1O6IA 2DSWA 4ODOA 4ODNA 1Y0OA 3WD1A 4DH0A 3CHFA 4MSPA 1XHGA 2OLHA 2F4EA 3ALFA 4HARA 3O5IA 1B6CA 4C02B 1ROTA 3WL0A 2XP7A 4P8WA 1X6LA 2MLZA 1CTNA 1UR9A 4DRHA 4L72B 3B9AA 1E6NA 3RM4A 5HBFA 1KFWA 5HW6A 3JYJA 5HWCA 4MNJA 3WQWA 3PR9A 4ZPVR 1FAPA 2RUDA 3AS1A 4JFLA 3AROA 2ZQVA 4MTVA 4P8VA 4DRKA 2XP6A 2M2AA 1EIBA 1ZK6A 3UQIA 3KAGA 1ZL1A 4TYOA 2VN1A 4W9PA 2WLYA 2Q5AA 1VF8A 3CGNA 4W5UA 3RFWA 3WQVA 3FXYA 4DROA 4P8XA 3KZ7A 4HBOA 3CHEA 5HT1A 2KO7A 1D6OA 3WD4A 4JFMA 1RD6A 1JNSA 3WKZA 1LJYA 1LG2A 4G50A 2O9OA 2LGOA 1NMVA 5JH8A 3AS2A 1FKJA 4WKHA 1FKDA 2FDMA 1HKKA 1NWUA 2N87A 3TC5A 1PBKA 3UQBA 1HJXA 3AS0A 3IKGA 4ODPA 2XP8A 1FFQA 1EQ3A 1HJVA 3CH9A 3O5KA 4N19A 4NSBA 2M1IA 1QPLA 2A3AA 2YBUA 1HJWA 1KT1A 4DRJA 4O2TA 1GUVA 2F21A 4MPKA 4DRPA 4MNLA 3W4RA 4WIWA 4HBEA 1NWRA 1IX5A 3UI4A 1M5YA 1D7IA 2ZQSA 4W9QA 5HWBA 2RUQA 1JVWA 4DWSB 1QPFA 2OFNA 1FKIA 1SR0A 4NNRA 4WK9A 1U79A 5D75A 1FKFA 2AWGA 5DITA 1J4HA 4J4NA 4Q7NA 2ZR4A 2ITKA 2XPBA 3O5PA 3QOKA 1F8AB 1NH6A 1BKFA 3B9DA 4WKAA 1NMWA 4S3KA 5DIUA 2XP5A 2K8IA 3KCEA 4LGXA 1W9UA 1ITXA 2PI6A 1ZCNA 3IHZA 2XP9A 2DT1A 4S3JA 1OGBA 4Z2IA 1XRVA 1W1YA 1X6NA 5GQBA 1LL4A 3CHDA 2PV1A 2D9FA 2PPOA 3B7XA 2PPPA 3RM9A 4ZS6A 3WIJA 1HXVA 1E6RA 3KAIA 1A7XA 1ZB5A 4J4OA 2MNTA 2B31A 2ESCA 4ODQA 3LUOA 2AOSA 1LL6A 2YBTA 2RUCA 4IPXA 5B8IC 1FKTA 2MPHA 4QT2A 4FN2A 2RQSA 5HTGA 5HW7A 5GPGA 2QF8A 2WM0A 4ODMA 4MNKA 5DIVA 2XP3A 4JFJA 1ZBKA 2DPEA 2PV2A 2DSVA 2ZR6A 5HKGA 3ARWA 1J6YA 2Y78A 2M08A 2G8ZA 3BXWA 3CGMA 2ZQTA 2MLYA 3UF8A 1Q1CA 4LAYA 2LPVA 3ARTA 3ARRA 4P8UA 3O5FA 3AQUA 4GIVA 2UZ5A 4R0XA 1T11A 4W9OA 3JXVA 3O5RA 1W1TA 4DRIA 1E9LA 1LG1A 1Q6UA 1YATA 3ARSA 4JFKA 2DG4A 1UR8A 4IT6A 2MF9A 3KAHA 2KFWA 1FKHA 4Z2GA 4MNMA 3O5DA 2DSUA 3ODKA 1JNDA 3IKDA 3RGCA 3ARQA 3OOBA 1YW5A 3UI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XP5 A;  2K8I A;  2XP4 A;  3JYJ A;  3KCE A;  5HW6 A;  5HWC A;  1FAP A;  5HUA A;  2PBC A;  2RUD A;  4JFL A;  4LAW A;  4DT4 A;  1FJD A;  2ZQV A;  1ZCN A;  1ROU A;  3IHZ A;  2XP9 A;  3EY6 A;  1D7J A;  4QT3 A;  3KAC A;  4DRK A;  4FAP A;  2XP6 A;  1FKK A;  2M2A A;  3O5Q A;  1ZK6 A;  3UQI A;  2PV1 A;  2D9F A;  3TCZ A;  3KAG A;  4ITZ A;  2FKE A;  2PPO A;  4TYO A;  3B7X A;  5I98 A;  2VN1 A;  4W9P A;  2Q5A A;  1FKS A;  2PPP A;  2DG9 A;  3CGN A;  1P5Q A;  3NI6 A;  4JFI A;  4U86 A;  1HXV A;  3RFW A;  3KAI A;  2VCD A;  1A7X A;  4TNS A;  3JYM A;  3KAD A;  3PRB A;  3MDY B;  4MGV A;  1Q6I A;  3PA7 A;  4J4O A;  4DRO A;  4TW7 A;  4ODL A;  4GGQ A;  2MNT A;  4ODQ A;  3LUO A;  2IF4 A;  1J4R A;  2RUC A;  4IPX A;  3O5E A;  3KZ7 A;  1FKT A;  1C9H A;  4LAV A;  2KO7 A;  1D6O A;  2MPH A;  2DG3 A;  2ZQU A;  4JFM A;  1F40 A;  4QT2 A;  1JNS A;  2XPA A;  4FN2 A;  3O5M A;  2RQS A;  4DZ3 A;  5HTG A;  4ODR A;  4G50 A;  5HW7 A;  2LGO A;  1NMV A;  4DRN A;  5GPG A;  4DZ2 A;  1FKJ A;  4ODM A;  1W26 A;  4IQC A;  1FKD A;  2XP3 A;  3FAP A;  1FKG A;  4JFJ A;  2LJ4 A;  4JYS A;  5DIV A;  4BF8 A;  3VAW A;  2N87 A;  2JZV A;  3IK8 A;  2PV2 A;  3PRD A;  1PBK A;  3TC5 A;  1J4I A;  2ZR6 A;  4TW8 A;  3NRK A;  3UQB A;  2RSE A;  5HKG A;  2FAP A;  3O5O A;  3IKG A;  4ODP A;  2XP8 A;  2ZR5 A;  1J6Y A;  2KE0 A;  2M08 A;  2Y78 A;  1EQ3 A;  4DRM A;  3TDB A;  3O5K A;  3GPK A;  3CGM A;  2PV3 A;  2ZQT A;  4N19 A;  2MLY A;  3UF8 A;  2M1I A;  1Q1C A;  1KT0 A;  1R9H A;  1QPL A;  4LAY A;  4DRQ A;  1FKL A;  3O5L A;  1KT1 A;  2LPV A;  1QZ2 A;  4DRJ A;  3O5F A;  4O2T A;  4U85 A;  5J6E A;  1FKB A;  3I6C A;  2RUR A;  2F21 A;  4DRP A;  4GIV A;  3UI5 A;  2LKN A;  5BXJ A;  5HW8 A;  2UZ5 A;  1FKR A;  4R0X A;  1T11 A;  2KR7 A;  1FD9 A;  2L2S A;  5B8I C;  2KGJ A;  5HT1 A;  1Q6H A;  3WH0 A;  1L1P A;  1TCO C;  1D7H A;  2MLX A;  3KAB A;  1N1A A;  3UI4 A;  3O5J A;  1PIN A;  1M5Y A;  3O5G A;  4G2P A;  4ODK A;  4QIB A;  4W9O A;  1D7I A;  1NSG A;  2F2D A;  2ZQS A;  4W9Q A;  3H9R B;  2RUQ A;  1JVW A;  3JXV A;  4IQ2 A;  3KAF A;  3O5R A;  5HWB A;  3UQA A;  1QPF A;  2OFN A;  4U84 A;  4DRI A;  1FKI A;  4NNR A;  2PPN A;  4ODO A;  1U79 A;  4ODN A;  1EYM A;  1Y0O A;  5D75 A;  4DH0 A;  1Q6U A;  1FKF A;  1JNT A;  1YAT A;  4MSP A;  4TX0 A;  2AWG A;  5DIT A;  1J4H A;  2KI3 A;  4JFK A;  2F4E A;  2DG4 A;  4J4N A;  4LAX A;  3O5I A;  1B6C A;  2ZR4 A;  2MF9 A;  2ITK A;  2XPB A;  3O5P A;  4C02 B;  1ROT A;  3KAH A;  2KFW A;  1FKH A;  1F8A B;  4TW6 A;  1BKF A;  2XP7 A;  2MLZ A;  3O5D A;  3NTP A;  1NMW A;  4DRH A;  3ODK A;  3IKD A;  3RGC A;  1BL4 A;  4DIP A;  3OOB A;  1YW5 A;  3UI6 A;  5DIU A; 
#chains in the Genus database with same CATH topology
 2XP4 A;  1H0G A;  4XAK A;  2PBC A;  4LAW A;  3ALG A;  1ROU A;  3KAC A;  3WD0 A;  1FKK A;  1WAW A;  2DT0 A;  1SYT A;  3AS3 A;  4Z2L A;  3TCZ A;  4ITZ A;  1OGG A;  4R5E A;  1EDQ A;  4JFI A;  1FKS A;  4U86 A;  1P5Q A;  2VCD A;  1ZBW A;  3KAD A;  3MDY B;  4MGV A;  3RME A;  3PA7 A;  4TW7 A;  1TFV A;  2IF4 A;  1ZBV A;  2DG3 A;  3PRA A;  4ZPW R;  3ARV A;  4URI A;  2O92 A;  4DZ2 A;  1W26 A;  4IQC A;  3FAP A;  1FKG A;  2WLZ A;  3B9E A;  3WD2 A;  3PRD A;  3NRK A;  2FAP A;  3B8S A;  2DT3 A;  1EHN A;  1W9V A;  3CHC A;  2P4V A;  4IT4 A;  4AY1 A;  4Z2K A;  4PTM A;  3O5L A;  3ARU A;  1QZ2 A;  1FKB A;  3I6C A;  2RUR A;  3UI5 A;  5BXJ A;  5HW8 A;  1FD9 A;  2L2S A;  2KGJ A;  1Q6H A;  1TCO C;  2MLX A;  3KAB A;  4G2P A;  3O5G A;  4QIB A;  2F2D A;  1NSG A;  5HUA A;  4KQZ A;  4L3N A;  4KR0 B;  1W9P A;  3KAF A;  1K9T A;  4U84 A;  2PPN A;  4ML4 A;  1EYM A;  4QZV B;  4TX0 A;  1HKM A;  2KI3 A;  1OWQ A;  4ZPT R;  4LAX A;  3CZ8 A;  4WKF A;  4MAV A;  1FJD A;  4TW6 A;  3NTP A;  4UDM A;  5DEZ A;  1BL4 A;  4DIP A;  5DF0 A;  1JNT A;  4Q22 A;  3G6L A;  1E15 A;  4DT4 A;  4WJX A;  1H0I A;  2A3E A;  2A3C A;  1D7J A;  3EY6 A;  4QT3 A;  4FAP A;  3O5Q A;  1LQ0 A;  1NWT A;  3OA5 A;  1FFR A;  3ARY A;  3ARZ A;  2FKE A;  5I98 A;  1JNE A;  2PN0 A;  1NWS A;  3NI6 A;  2DG9 A;  3ARP A;  3FY1 A;  4DWS C;  5GPR A;  4TNS A;  4DWS A;  3JYM A;  3PRB A;  3ARX A;  1Q6I A;  4ODL A;  4GGQ A;  3RM8 A;  2DSZ A;  1J4R A;  2DT2 A;  4LAV A;  3O5E A;  4U85 A;  1C9H A;  2ZQU A;  1GPF A;  1F40 A;  2G41 A;  2XPA A;  3O5M A;  4DZ3 A;  4ODR A;  4DRN A;  4DWS D;  1HKI A;  4JYS A;  4BF8 A;  2LJ4 A;  3VAW A;  2JZV A;  3IK8 A;  3WL1 A;  1J4I A;  4TW8 A;  1HKJ A;  2RSE A;  1D2K A;  4Z2H A;  3G6M A;  3O5O A;  2IUZ A;  2ZR5 A;  2KE0 A;  1ZBC A;  4DRM A;  4Z2J A;  3TDB A;  3GPK A;  2PV3 A;  1JCH B;  1GOI A;  1KT0 A;  1R9H A;  4DRQ A;  1FKL A;  1ZU8 A;  1W1P A;  5J6E A;  1E6Z A;  2WK2 A;  5DO2 A;  2LKN A;  4NZC A;  1WB0 A;  1FKR A;  3WD3 A;  2KR7 A;  3WH0 A;  1L1P A;  1D7H A;  1N1A A;  1W1V A;  3O5J A;  1PIN A;  4ODK A;  1WNO A;  3H9R B;  1LL7 A;  4IQ2 A;  1E6P A;  2A3B A;  3UQA A;  1O6I A;  2DSW A;  4ODO A;  4ODN A;  1Y0O A;  3WD1 A;  4DH0 A;  3CHF A;  1GRJ A;  4MSP A;  1XHG A;  2OLH A;  2F4E A;  3ALF A;  4HAR A;  3O5I A;  1B6C A;  4C02 B;  1ROT A;  3WL0 A;  2XP7 A;  4P8W A;  1X6L A;  2MLZ A;  1CTN A;  1UR9 A;  4DRH A;  4L72 B;  3B9A A;  1E6N A;  3RM4 A;  5HBF A;  1KFW A;  5HW6 A;  3JYJ A;  5HWC A;  4MNJ A;  3WQW A;  3PR9 A;  4ZPV R;  1FAP A;  2RUD A;  3AS1 A;  4JFL A;  3ARO A;  2ZQV A;  4MTV A;  4P8V A;  4DRK A;  2XP6 A;  2M2A A;  1EIB A;  1ZK6 A;  3UQI A;  3KAG A;  1ZL1 A;  4TYO A;  2VN1 A;  4W9P A;  2WLY A;  2Q5A A;  1VF8 A;  3CGN A;  4W5U A;  3RFW A;  3WQV A;  3FXY A;  4DRO A;  4P8X A;  3KZ7 A;  4HBO A;  3CHE A;  5HT1 A;  2KO7 A;  1D6O A;  3WD4 A;  4JFM A;  1RD6 A;  1JNS A;  3WKZ A;  1LJY A;  1LG2 A;  4G50 A;  2O9O A;  2LGO A;  1NMV A;  5JH8 A;  3AS2 A;  1FKJ A;  4WKH A;  1FKD A;  2FDM A;  1HKK A;  1NWU A;  2N87 A;  3TC5 A;  1PBK A;  3UQB A;  1HJX A;  3AS0 A;  3GTY X;  3IKG A;  4ODP A;  2XP8 A;  1FFQ A;  1EQ3 A;  1HJV A;  3CH9 A;  3O5K A;  4N19 A;  4NSB A;  2M1I A;  1QPL A;  2A3A A;  2YBU A;  1HJW A;  1KT1 A;  4DRJ A;  4O2T A;  1GUV A;  2F21 A;  4MPK A;  4DRP A;  4MNL A;  3W4R A;  4WIW A;  4HBE A;  1NWR A;  2EUL A;  3EIP A;  1IX5 A;  3UI4 A;  1M5Y A;  1D7I A;  2ZQS A;  4W9Q A;  5HWB A;  2RUQ A;  1JVW A;  4DWS B;  1QPF A;  2OFN A;  1FKI A;  1SR0 A;  4NNR A;  4WK9 A;  1U79 A;  5D75 A;  1FKF A;  2AWG A;  5DIT A;  1J4H A;  4J4N A;  4Q7N A;  2ZR4 A;  2ITK A;  2XPB A;  3O5P A;  3QOK A;  1F8A B;  1NH6 A;  1BKF A;  3B9D A;  4WKA A;  2ETN A;  1NMW A;  4S3K A;  5DIU A;  2XP5 A;  2K8I A;  3KCE A;  4LGX A;  1W9U A;  1E44 A;  1ITX A;  2PI6 A;  1ZCN A;  3BMB A;  3IHZ A;  2XP9 A;  2DT1 A;  4S3J A;  1OGB A;  4Z2I A;  1XRV A;  1W1Y A;  1X6N A;  5GQB A;  1LL4 A;  3CHD A;  2PV1 A;  2D9F A;  2PPO A;  3B7X A;  2PPP A;  3RM9 A;  4ZS6 A;  3WIJ A;  1HXV A;  1E6R A;  3KAI A;  1A7X A;  1ZB5 A;  4J4O A;  2MNT A;  2B31 A;  2ESC A;  4ODQ A;  3LUO A;  2AOS A;  1LL6 A;  2YBT A;  2RUC A;  4IPX A;  5B8I C;  1FKT A;  2MPH A;  4QT2 A;  4FN2 A;  2RQS A;  5HTG A;  5HW7 A;  5GPG A;  2QF8 A;  2WM0 A;  4ODM A;  4MNK A;  5DIV A;  2XP3 A;  4JFJ A;  1ZBK A;  2DPE A;  2PV2 A;  2DSV A;  2ZR6 A;  5HKG A;  3ARW A;  1J6Y A;  2Y78 A;  2M08 A;  2G8Z A;  3BXW A;  3CGM A;  2ZQT A;  2MLY A;  3UF8 A;  1Q1C A;  4LAY A;  2LPV A;  3ART A;  3ARR A;  4P8U A;  3O5F A;  3AQU A;  4GIV A;  2UZ5 A;  4R0X A;  1T11 A;  2B5U B;  4W9O A;  3GU0 A;  3JXV A;  3O5R A;  1W1T A;  4DRI A;  1E9L A;  1LG1 A;  1Q6U A;  1YAT A;  3ARS A;  4JFK A;  2F23 A;  2DG4 A;  1UR8 A;  4IT6 A;  2MF9 A;  3KAH A;  2KFW A;  1FKH A;  4Z2G A;  4MNM A;  3O5D A;  2DSU A;  3ODK A;  1JND A;  3IKD A;  3RGC A;  3ARQ A;  3OOB A;  1YW5 A;  3UI6 A; 
#chains in the Genus database with same CATH homology
 2XP4 A;  1H0G A;  4XAK A;  2PBC A;  4LAW A;  3ALG A;  1ROU A;  3KAC A;  3WD0 A;  1FKK A;  1WAW A;  2DT0 A;  1SYT A;  3AS3 A;  4Z2L A;  3TCZ A;  4ITZ A;  1OGG A;  4R5E A;  1EDQ A;  4JFI A;  1FKS A;  4U86 A;  1P5Q A;  2VCD A;  1ZBW A;  3KAD A;  3MDY B;  4MGV A;  3RME A;  3PA7 A;  4TW7 A;  1TFV A;  2IF4 A;  1ZBV A;  2DG3 A;  3PRA A;  4ZPW R;  3ARV A;  4URI A;  2O92 A;  4DZ2 A;  1W26 A;  4IQC A;  3FAP A;  1FKG A;  2WLZ A;  3B9E A;  3WD2 A;  3PRD A;  3NRK A;  2FAP A;  3B8S A;  2DT3 A;  1EHN A;  1W9V A;  3CHC A;  4IT4 A;  4AY1 A;  4Z2K A;  4PTM A;  3O5L A;  3ARU A;  1QZ2 A;  1FKB A;  3I6C A;  2RUR A;  3UI5 A;  5BXJ A;  5HW8 A;  1FD9 A;  2L2S A;  2KGJ A;  1Q6H A;  1TCO C;  2MLX A;  3KAB A;  4G2P A;  3O5G A;  4QIB A;  2F2D A;  1NSG A;  5HUA A;  4KQZ A;  4L3N A;  4KR0 B;  1W9P A;  3KAF A;  1K9T A;  4U84 A;  2PPN A;  4ML4 A;  1EYM A;  4QZV B;  4TX0 A;  1HKM A;  2KI3 A;  1OWQ A;  4ZPT R;  4LAX A;  3CZ8 A;  4WKF A;  4MAV A;  1FJD A;  4TW6 A;  3NTP A;  5DEZ A;  1BL4 A;  4DIP A;  5DF0 A;  1JNT A;  4Q22 A;  3G6L A;  1E15 A;  4DT4 A;  4WJX A;  1H0I A;  2A3E A;  2A3C A;  1D7J A;  3EY6 A;  4QT3 A;  4FAP A;  3O5Q A;  1LQ0 A;  1NWT A;  3OA5 A;  1FFR A;  3ARY A;  3ARZ A;  2FKE A;  5I98 A;  1JNE A;  1NWS A;  3NI6 A;  2DG9 A;  3ARP A;  3FY1 A;  4DWS C;  5GPR A;  4TNS A;  4DWS A;  3JYM A;  3PRB A;  3ARX A;  1Q6I A;  4ODL A;  4GGQ A;  3RM8 A;  2DSZ A;  1J4R A;  2DT2 A;  4LAV A;  3O5E A;  4U85 A;  1C9H A;  2ZQU A;  1GPF A;  1F40 A;  2G41 A;  2XPA A;  3O5M A;  4DZ3 A;  4ODR A;  4DRN A;  4DWS D;  1HKI A;  4JYS A;  4BF8 A;  2LJ4 A;  3VAW A;  2JZV A;  3IK8 A;  3WL1 A;  1J4I A;  4TW8 A;  1HKJ A;  2RSE A;  1D2K A;  4Z2H A;  3G6M A;  3O5O A;  2IUZ A;  2ZR5 A;  2KE0 A;  1ZBC A;  4DRM A;  4Z2J A;  3TDB A;  3GPK A;  2PV3 A;  1GOI A;  1KT0 A;  1R9H A;  4DRQ A;  1FKL A;  1ZU8 A;  1W1P A;  5J6E A;  1E6Z A;  2WK2 A;  5DO2 A;  2LKN A;  4NZC A;  1WB0 A;  1FKR A;  3WD3 A;  2KR7 A;  3WH0 A;  1L1P A;  1D7H A;  1N1A A;  1W1V A;  3O5J A;  1PIN A;  4ODK A;  1WNO A;  3H9R B;  1LL7 A;  4IQ2 A;  1E6P A;  2A3B A;  3UQA A;  1O6I A;  2DSW A;  4ODO A;  4ODN A;  1Y0O A;  3WD1 A;  4DH0 A;  3CHF A;  4MSP A;  1XHG A;  2OLH A;  2F4E A;  3ALF A;  4HAR A;  3O5I A;  1B6C A;  4C02 B;  1ROT A;  3WL0 A;  2XP7 A;  4P8W A;  1X6L A;  2MLZ A;  1CTN A;  1UR9 A;  4DRH A;  4L72 B;  3B9A A;  1E6N A;  3RM4 A;  5HBF A;  1KFW A;  5HW6 A;  3JYJ A;  5HWC A;  4MNJ A;  3WQW A;  3PR9 A;  4ZPV R;  1FAP A;  2RUD A;  3AS1 A;  4JFL A;  3ARO A;  2ZQV A;  4MTV A;  4P8V A;  4DRK A;  2XP6 A;  2M2A A;  1EIB A;  1ZK6 A;  3UQI A;  3KAG A;  1ZL1 A;  4TYO A;  2VN1 A;  4W9P A;  2WLY A;  2Q5A A;  1VF8 A;  3CGN A;  4W5U A;  3RFW A;  3WQV A;  3FXY A;  4DRO A;  4P8X A;  3KZ7 A;  4HBO A;  3CHE A;  5HT1 A;  2KO7 A;  1D6O A;  3WD4 A;  4JFM A;  1RD6 A;  1JNS A;  3WKZ A;  1LJY A;  1LG2 A;  4G50 A;  2O9O A;  2LGO A;  1NMV A;  5JH8 A;  3AS2 A;  1FKJ A;  4WKH A;  1FKD A;  2FDM A;  1HKK A;  1NWU A;  2N87 A;  3TC5 A;  1PBK A;  3UQB A;  1HJX A;  3AS0 A;  3IKG A;  4ODP A;  2XP8 A;  1FFQ A;  1EQ3 A;  1HJV A;  3CH9 A;  3O5K A;  4N19 A;  4NSB A;  2M1I A;  1QPL A;  2A3A A;  2YBU A;  1HJW A;  1KT1 A;  4DRJ A;  4O2T A;  1GUV A;  2F21 A;  4MPK A;  4DRP A;  4MNL A;  3W4R A;  4WIW A;  4HBE A;  1NWR A;  1IX5 A;  3UI4 A;  1M5Y A;  1D7I A;  2ZQS A;  4W9Q A;  5HWB A;  2RUQ A;  1JVW A;  4DWS B;  1QPF A;  2OFN A;  1FKI A;  1SR0 A;  4NNR A;  4WK9 A;  1U79 A;  5D75 A;  1FKF A;  2AWG A;  5DIT A;  1J4H A;  4J4N A;  4Q7N A;  2ZR4 A;  2ITK A;  2XPB A;  3O5P A;  3QOK A;  1F8A B;  1NH6 A;  1BKF A;  3B9D A;  4WKA A;  1NMW A;  4S3K A;  5DIU A;  2XP5 A;  2K8I A;  3KCE A;  4LGX A;  1W9U A;  1ITX A;  2PI6 A;  1ZCN A;  3IHZ A;  2XP9 A;  2DT1 A;  4S3J A;  1OGB A;  4Z2I A;  1XRV A;  1W1Y A;  1X6N A;  5GQB A;  1LL4 A;  3CHD A;  2PV1 A;  2D9F A;  2PPO A;  3B7X A;  2PPP A;  3RM9 A;  4ZS6 A;  3WIJ A;  1HXV A;  1E6R A;  3KAI A;  1A7X A;  1ZB5 A;  4J4O A;  2MNT A;  2B31 A;  2ESC A;  4ODQ A;  3LUO A;  2AOS A;  1LL6 A;  2YBT A;  2RUC A;  4IPX A;  5B8I C;  1FKT A;  2MPH A;  4QT2 A;  4FN2 A;  2RQS A;  5HTG A;  5HW7 A;  5GPG A;  2QF8 A;  2WM0 A;  4ODM A;  4MNK A;  5DIV A;  2XP3 A;  4JFJ A;  1ZBK A;  2DPE A;  2PV2 A;  2DSV A;  2ZR6 A;  5HKG A;  3ARW A;  1J6Y A;  2Y78 A;  2M08 A;  2G8Z A;  3BXW A;  3CGM A;  2ZQT A;  2MLY A;  3UF8 A;  1Q1C A;  4LAY A;  2LPV A;  3ART A;  3ARR A;  4P8U A;  3O5F A;  3AQU A;  4GIV A;  2UZ5 A;  4R0X A;  1T11 A;  4W9O A;  3JXV A;  3O5R A;  1W1T A;  4DRI A;  1E9L A;  1LG1 A;  1Q6U A;  1YAT A;  3ARS A;  4JFK A;  2DG4 A;  1UR8 A;  4IT6 A;  2MF9 A;  3KAH A;  2KFW A;  1FKH A;  4Z2G A;  4MNM A;  3O5D A;  2DSU A;  3ODK A;  1JND A;  3IKD A;  3RGC A;  3ARQ A;  3OOB A;  1YW5 A;  3UI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...