5HW7A

Candida albicans fkbp12 apo protein in p21212 space group
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
122
structure length
122
Chain Sequence
EELPQIEIVQEGDNTTFAKPGDTVTIHYDGKLTNGKEFDSSRKRGKPFTCTVGVGQVIKGWDISLTNNYGKGGANLPKISKGTKAILTIPPNLAYGPRGIPPIIGPNETLVFEVELLGVNGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 1
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida albicans (strain sc5314 / atcc mya-2876)
molecule tags Isomerase
total genus 28
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5hw7A00
2FAPA 4DRMA 3KAFA 2KO7A 3UQAA 1FKHA 3KADA 3O5RA 3EY6A 4O2TA 2MLZA 4N19A 5GPGA 2RUQA 2KFWA 3NI6A 4J4NA 1A7XA 1JNSA 4U85A 1FKDA 2KR7A 4QIBA 4ODLA 4TYOA 5J6EA 4IPXA 4DH0A 4TW6A 5HTGA 3H9RB 2KE0A 2LGOA 3JXVA 3ODKA 4MGVA 4ODRA 4TNSA 1Y0OA 2DG4A 1PINA 2RSEA 3NTPA 2OFNA 3VAWA 4JFJA 4DRNA 2ZR6A 2PPPA 4DRIA 5HUAA 1EQ3A 2LPVA 1FKFA 2M08A 3JYMA 4U86A 5HWCA 2FKEA 4GIVA 1BL4A 1Q6IA 2L2SA 3O5KA 1FKJA 2JZVA 1C9HA 2MPHA 2RUCA 3MDYB 4DRKA 1YATA 3UQBA 1QPLA 3IKDA 3TDBA 2MF9A 3I6CA 5B8IC 4DIPA 1FKBA 3KAHA 4LAXA 1ROUA 2ZR4A 3O5GA 4W9OA 4JYSA 3O5QA 2PV1A 2VCDA 2ZR5A 1ZCNA 4U84A 1YW5A 4IQCA 1R9HA 4G2PA 2DG9A 4JFKA 3PRDA 4MSPA 4DT4A 4DZ3A 2D9FA 1D7IA 1NMVA 5DIUA 3WH0A 3LUOA 4DRPA 4FAPA 4TX0A 2N87A 1L1PA 3UF8A 3KZ7A 3CGNA 5I98A 2ZQSA 4R0XA 1QZ2A 2UZ5A 4DZ2A 1ZK6A 2XPAA 1D7JA 3FAPA 2XP7A 2IF4A 2XP4A 1FKGA 1FKIA 1PBKA 3O5OA 4BF8A 1T11A 1P5QA 1FKLA 4IQ2A 3CGMA 1FAPA 3O5IA 5HW7A 1FD9A 4JFIA 1HXVA 1ROTA 4JFLA 1FKRA 2F4EA 3OOBA 1TCOC 2M1IA 3O5MA 1D7HA 3O5DA 4TW7A 1BKFA 5HWBA 1F40A 4FN2A 2ZQTA 4G50A 2LKNA 2XP8A 3KABA 2RQSA 4JFMA 2XP9A 3PA7A 2Q5AA 4ODOA 3UQIA 5HW6A 1D6OA 4ODPA 3KAIA 3RGCA 1U79A 2MLYA 4ODKA 3O5PA 3KAGA 2PPNA 2XP3A 2KI3A 2PPOA 1FKKA 1J4HA 2VN1A 4QT3A 1JVWA 3UI6A 4TW8A 3UI5A 1J6YA 1KT1A 4GGQA 1FKSA 1JNTA 1Q6HA 3IK8A 5D75A 1EYMA 1M5YA 5DITA 1N1AA 2PV2A 1Q1CA 1B6CA 2ZQVA 3B7XA 3O5JA 3PRBA 4LAVA 3UI4A 4DRHA 3GPKA 2MNTA 2XP6A 5BXJA 2RUDA 4DROA 2MLXA 1FKTA 2ZQUA 5DIVA 3JYJA 4ODMA 5HKGA 2AWGA 3IHZA 5HT1A 4LAYA 3TC5A 1NSGA 2XPBA 1J4RA 4NNRA 1KT0A 2LJ4A 2RURA 1QPFA 3IKGA 3O5LA 4DRJA 4QT2A 3RFWA 2F2DA 1F8AB 4DRQA 4W9PA 2Y78A 1W26A 2KGJA 3O5EA 2DG3A 2M2AA 3TCZA 4C02B 2PV3A 3NRKA 1J4IA 1NMWA 4J4OA 4ITZA 1Q6UA 1FJDA 3KCEA 4W9QA 5HW8A 2ITKA 2F21A 2K8IA 4LAWA 3O5FA 3KACA 4ODNA 4ODQA 2PBCA 2XP5A
chains in the Genus database with same CATH superfamily
1K9TA 4DRMA 1E44A 2RUQA 3NI6A 2P4VA 4QZVB 1LL6A 1JNSA 4U85A 4TYOA 4HARA 5J6EA 4TW6A 3JXVA 2KE0A 2LGOA 3ODKA 4TW8A 4ZPVR 2DSWA 3ARRA 4MNJA 2OFNA 1E9LA 3JYMA 1FKFA 5GQBA 4U86A 1EQ3A 4GIVA 3PR9A 2JZVA 2RUCA 4Q22A 3IKDA 3I6CA 5B8IC 1E6ZA 1ROUA 2ZR4A 4W9OA 2VCDA 2ESCA 4ZS6A 4IQCA 4DT4A 3PRDA 4TX0A 3UF8A 3KZ7A 3BXWA 5I98A 4R0XA 1HKIA 2UZ5A 3B9EA 1EHNA 1HJXA 1HKJA 2IF4A 2XP4A 2PI6A 4XAKA 1FKLA 1E6RA 3CGMA 5HW7A 1FD9A 4MNLA 1FKRA 2DT3A 1XHGA 3ARPA 4FN2A 4NZCA 2LKNA 3RM9A 1FFQA 1E6PA 4PTMA 3PA7A 2O9OA 2Q5AA 1LL7A 3O5PA 3KAGA 2PPOA 4QT3A 4ZPTR 3UI6A 3UI5A 3CHEA 1FKSA 3IK8A 5DITA 1M5YA 3PRBA 4DRHA 2DSVA 4UDMA 2YBUA 2RUDA 3IHZA 5HT1A 1NSGA 4NNRA 4DRJA 3RFWA 2Y78A 4C02B 2PV3A 4J4OA 1J4IA 4Z2GA 4Z2JA 4W9QA 1CTNA 1OWQA 1D2KA 4DWSD 1NWSA 3CHDA 4ODNA 3UQAA 3KADA 1W9VA 2MLZA 4ZPWR 2KFWA 4J4NA 1E15A 4L3NA 3QOKA 3ALFA 4QIBA 4DH0A 3H9RB 4ODRA 4TNSA 1Y0OA 2DG4A 3GU0A 2ZR6A 2PPPA 4DRNA 4DWSB 1Q6IA 3O5KA 2B5UB 1C9HA 2MPHA 3AS3A 1YATA 1HJVA 3UQBA 1QPLA 4NSBA 2MF9A 4DWSC 4DIPA 1FKBA 1OGBA 4LAXA 1LG1A 3B8SA 4MSPA 1HKKA 1NMVA 5DIUA 1JNDA 3B9AA 4WKAA 3ARYA 1QZ2A 1ZK6A 2DPEA 2XP7A 4BF8A 4DWSA 1P5QA 4Q7NA 5JH8A 1OGGA 1ZU8A 4JFIA 3WKZA 4JFLA 2QF8A 1TCOC 1BKFA 2RQSA 2XP9A 3RM4A 3ARSA 4ODOA 1ITXA 4ODPA 3ARTA 3KAIA 3AS0A 3RGCA 1U79A 2MLYA 4ODKA 5DO2A 3W4RA 2XP3A 1FKKA 4P8UA 1EDQA 1EYMA 2PV2A 3B7XA 3UI4A 1SYTA 3ARZA 2DT0A 4HBEA 2F23A 2A3BA 1FKTA 1W9PA 2ETNA 4P8WA 2XPBA 1J4RA 3WD3A 3O5LA 2LJ4A 1QPFA 4WJXA 2WK2A 3BMBA 1H0IA 3AROA 4ITZA 1W9UA 1JCHB 1LG2A 5HW8A 4LGXA 2F21A 4S3JA 2XPAA 4Z2IA 2FAPA 3KAFA 2KO7A 3WL1A 1FKHA 1WAWA 3O5RA 3EY6A 4N19A 5GPGA 1W1YA 4L72B 1A7XA 3B9DA 1FKDA 2KR7A 3AQUA 4IPXA 1HJWA 5HTGA 3ARWA 5DEZA 3G6MA 3VAWA 4JFJA 1GRJA 2LPVA 4Z2KA 1BL4A 4DRKA 2EULA 4IT4A 4MNMA 4WKFA 3WD0A 3KAHA 2O92A 4URIA 4JYSA 4W5UA 2ZR5A 1ZCNA 1NWUA 3GTYX 4G2PA 2D9FA 3WH0A 4DRPA 3LUOA 4R5EA 4FAPA 2N87A 2B31A 1W1TA 3CGNA 4DZ2A 3O5OA 1FKGA 1IX5A 1SR0A 1GUVA 3WL0A 2G8ZA 1ZL1A 3OOBA 3O5MA 3O5DA 4TW7A 2ZQTA 3KABA 4JFMA 2AOSA 3UQIA 5HW6A 1GOIA 1D6OA 2A3EA 3WD1A 2PPNA 4WK9A 4IT6A 1J4HA 1WB0A 1LQ0A 2VN1A 5GPRA 1JVWA 1VF8A 3WD4A 4GGQA 5D75A 1JNTA 1Q1CA 1GPFA 3O5JA 4LAVA 4AY1A 1JNEA 2MLXA 4P8VA 2ZQUA 5DIVA 4ODMA 3WIJA 5HKGA 2AWGA 4LAYA 2YBTA 2DSZA 1KT0A 4ML4A 4Z2HA 3CHCA 1LL4A 1W1PA 1F8AB 1UR8A 4W9PA 4DRQA 4Z2LA 1W26A 2KGJA 3O5EA 2DG3A 2OLHA 2A3CA 3KCEA 4LAWA 3WQWA 3O5FA 1L1PA 2XP5A 3ARVA 3AS1A 2A3AA 2DT2A 4MNKA 1LJYA 4O2TA 4KQZA 2FDMA 3CHFA 4P8XA 1ZBKA 4ODLA 4MGVA 5HWCA 1NWRA 2RSEA 3NTPA 1PINA 3ALGA 4DRIA 5HUAA 2M08A 1ZB5A 2FKEA 1NH6A 2L2SA 1FKJA 3RMEA 3MDYB 3TDBA 5HBFA 1FFRA 3OA5A 3RM8A 3O5GA 3O5QA 2PV1A 4U84A 1YW5A 5DF0A 1R9HA 2DG9A 4JFKA 4DZ3A 1W1VA 1D7IA 2DT1A 2DSUA 4WIWA 2ZQSA 1D7JA 3FAPA 4MPKA 1H0GA 1FKIA 1PBKA 1T11A 3PRAA 4IQ2A 2IUZA 1ZBCA 1FAPA 3O5IA 1NWTA 1HXVA 3ARQA 1ROTA 3FY1A 3AS2A 2F4EA 2M1IA 1D7HA 5HWBA 1F40A 1WNOA 4S3KA 4G50A 2XP8A 1UR9A 3G6LA 4MAVA 2KI3A 3ARXA 4MTVA 1ZBWA 1J6YA 2WLZA 3FXYA 1KT1A 1KFWA 1HKMA 1ZBVA 3CZ8A 1Q6HA 1E6NA 1XRVA 1N1AA 4HBOA 2ZQVA 1B6CA 3CH9A 1X6NA 3GPKA 2MNTA 2XP6A 4KR0B 5BXJA 4WKHA 1EIBA 4DROA 1RD6A 3EIPA 1O6IA 2WLYA 3JYJA 2PN0A 3TC5A 3WQVA 2WM0A 2RURA 3IKGA 4QT2A 2F2DA 3TCZA 2M2AA 1TFVA 3NRKA 1NMWA 1X6LA 1Q6UA 1FJDA 2G41A 2ITKA 3ARUA 2K8IA 3KACA 4ODQA 2PBCA 3WD2A
chains in the Genus database with same CATH topology
1K9TA 4DRMA 2RUQA 3NI6A 4QZVB 1LL6A 1JNSA 4U85A 4TYOA 4HARA 5J6EA 4TW6A 3JXVA 2KE0A 2LGOA 3ODKA 4TW8A 4ZPVR 2DSWA 3ARRA 4MNJA 2OFNA 1E9LA 3JYMA 1FKFA 5GQBA 4U86A 1EQ3A 4GIVA 3PR9A 2JZVA 2RUCA 4Q22A 3IKDA 3I6CA 5B8IC 1E6ZA 1ROUA 2ZR4A 4W9OA 2VCDA 2ESCA 4ZS6A 4IQCA 4DT4A 3PRDA 4TX0A 3UF8A 3KZ7A 3BXWA 5I98A 4R0XA 1HKIA 2UZ5A 3B9EA 1EHNA 1HJXA 1HKJA 2IF4A 2XP4A 2PI6A 4XAKA 1FKLA 1E6RA 3CGMA 5HW7A 1FD9A 4MNLA 1FKRA 2DT3A 1XHGA 3ARPA 4FN2A 4NZCA 2LKNA 3RM9A 1FFQA 1E6PA 4PTMA 3PA7A 2O9OA 2Q5AA 1LL7A 3O5PA 3KAGA 2PPOA 4QT3A 4ZPTR 3UI6A 3UI5A 3CHEA 1FKSA 3IK8A 5DITA 1M5YA 3PRBA 4DRHA 2DSVA 2YBUA 2RUDA 3IHZA 5HT1A 1NSGA 4NNRA 4DRJA 3RFWA 2Y78A 4C02B 2PV3A 4J4OA 1J4IA 4Z2GA 4Z2JA 4W9QA 1CTNA 1OWQA 1D2KA 4DWSD 1NWSA 3CHDA 4ODNA 3UQAA 3KADA 1W9VA 2MLZA 4ZPWR 2KFWA 4J4NA 1E15A 4L3NA 3QOKA 3ALFA 4QIBA 4DH0A 3H9RB 4ODRA 4TNSA 1Y0OA 2DG4A 4DRNA 2ZR6A 2PPPA 4DWSB 1Q6IA 3O5KA 1C9HA 2MPHA 3AS3A 1YATA 1HJVA 3UQBA 1QPLA 4NSBA 2MF9A 4DWSC 4DIPA 1FKBA 1OGBA 4LAXA 1LG1A 3B8SA 4MSPA 1HKKA 1NMVA 5DIUA 1JNDA 3B9AA 4WKAA 3ARYA 1QZ2A 1ZK6A 2DPEA 2XP7A 4BF8A 4DWSA 1P5QA 4Q7NA 5JH8A 1OGGA 1ZU8A 4JFIA 3WKZA 4JFLA 2QF8A 1TCOC 1BKFA 2RQSA 2XP9A 3RM4A 3ARSA 4ODOA 1ITXA 4ODPA 3ARTA 3KAIA 3AS0A 3RGCA 1U79A 2MLYA 4ODKA 5DO2A 3W4RA 2XP3A 1FKKA 4P8UA 1EDQA 1EYMA 2PV2A 3B7XA 3UI4A 1SYTA 3ARZA 2DT0A 4HBEA 2A3BA 1FKTA 1W9PA 4P8WA 2XPBA 1J4RA 3WD3A 3O5LA 2LJ4A 1QPFA 4WJXA 2WK2A 1H0IA 3AROA 4ITZA 1W9UA 1LG2A 5HW8A 4LGXA 2F21A 4S3JA 2XPAA 4Z2IA 2FAPA 3KAFA 2KO7A 3WL1A 1FKHA 1WAWA 3O5RA 3EY6A 4N19A 5GPGA 1W1YA 4L72B 1A7XA 3B9DA 1FKDA 2KR7A 3AQUA 4IPXA 1HJWA 5HTGA 3ARWA 5DEZA 3G6MA 3VAWA 4JFJA 2LPVA 4Z2KA 1BL4A 4DRKA 4IT4A 4MNMA 4WKFA 3WD0A 3KAHA 2O92A 4URIA 4JYSA 4W5UA 2ZR5A 1ZCNA 1NWUA 4G2PA 2D9FA 3WH0A 4DRPA 3LUOA 4R5EA 4FAPA 2N87A 2B31A 1W1TA 3CGNA 4DZ2A 3O5OA 1FKGA 1IX5A 1SR0A 1GUVA 3WL0A 2G8ZA 1ZL1A 3OOBA 3O5MA 3O5DA 4TW7A 2ZQTA 3KABA 4JFMA 2AOSA 3UQIA 5HW6A 1GOIA 1D6OA 2A3EA 3WD1A 2PPNA 4WK9A 4IT6A 1J4HA 1WB0A 1LQ0A 2VN1A 5GPRA 1JVWA 1VF8A 3WD4A 4GGQA 5D75A 1JNTA 1Q1CA 1GPFA 3O5JA 4LAVA 4AY1A 1JNEA 2MLXA 4P8VA 2ZQUA 5DIVA 4ODMA 3WIJA 5HKGA 2AWGA 4LAYA 2YBTA 2DSZA 1KT0A 4ML4A 4Z2HA 3CHCA 1LL4A 1W1PA 1F8AB 1UR8A 4W9PA 4DRQA 4Z2LA 1W26A 2KGJA 3O5EA 2DG3A 2OLHA 2A3CA 3KCEA 4LAWA 3WQWA 3O5FA 1L1PA 2XP5A 3ARVA 3AS1A 2A3AA 2DT2A 4MNKA 1LJYA 4O2TA 4KQZA 2FDMA 3CHFA 4P8XA 1ZBKA 4ODLA 4MGVA 5HWCA 1NWRA 2RSEA 3NTPA 1PINA 3ALGA 4DRIA 5HUAA 2M08A 1ZB5A 2FKEA 1NH6A 2L2SA 1FKJA 3RMEA 3MDYB 3TDBA 5HBFA 1FFRA 3OA5A 3RM8A 3O5GA 3O5QA 2PV1A 4U84A 1YW5A 5DF0A 1R9HA 2DG9A 4JFKA 4DZ3A 1W1VA 1D7IA 2DT1A 2DSUA 4WIWA 2ZQSA 1D7JA 3FAPA 4MPKA 1H0GA 1FKIA 1PBKA 1T11A 3PRAA 4IQ2A 2IUZA 1ZBCA 1FAPA 3O5IA 1NWTA 1HXVA 3ARQA 1ROTA 3FY1A 3AS2A 2F4EA 2M1IA 1D7HA 5HWBA 1F40A 1WNOA 4S3KA 4G50A 2XP8A 1UR9A 3G6LA 4MAVA 2KI3A 3ARXA 4MTVA 1ZBWA 1J6YA 2WLZA 3FXYA 1KT1A 1KFWA 1HKMA 1ZBVA 3CZ8A 1Q6HA 1E6NA 1XRVA 1N1AA 4HBOA 2ZQVA 1B6CA 3CH9A 1X6NA 3GPKA 2MNTA 2XP6A 4KR0B 5BXJA 4WKHA 1EIBA 4DROA 1RD6A 1O6IA 2WLYA 3JYJA 3TC5A 3WQVA 2WM0A 2RURA 3IKGA 4QT2A 2F2DA 3TCZA 2M2AA 1TFVA 3NRKA 1NMWA 1X6LA 1Q6UA 1FJDA 2G41A 2ITKA 3ARUA 2K8IA 3KACA 4ODQA 2PBCA 3WD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FAP A;  4DRM A;  3KAF A;  2KO7 A;  3UQA A;  1FKH A;  3KAD A;  3O5R A;  3EY6 A;  4O2T A;  2MLZ A;  4N19 A;  5GPG A;  2RUQ A;  2KFW A;  3NI6 A;  4J4N A;  1A7X A;  1JNS A;  4U85 A;  1FKD A;  2KR7 A;  4QIB A;  4ODL A;  4TYO A;  5J6E A;  4IPX A;  4DH0 A;  4TW6 A;  5HTG A;  3H9R B;  2KE0 A;  2LGO A;  3JXV A;  3ODK A;  4MGV A;  4ODR A;  4TNS A;  1Y0O A;  2DG4 A;  1PIN A;  2RSE A;  3NTP A;  2OFN A;  3VAW A;  4JFJ A;  4DRN A;  2ZR6 A;  2PPP A;  4DRI A;  5HUA A;  1EQ3 A;  2LPV A;  1FKF A;  2M08 A;  3JYM A;  4U86 A;  5HWC A;  2FKE A;  4GIV A;  1BL4 A;  1Q6I A;  2L2S A;  3O5K A;  1FKJ A;  2JZV A;  1C9H A;  2MPH A;  2RUC A;  3MDY B;  4DRK A;  1YAT A;  3UQB A;  1QPL A;  3IKD A;  3TDB A;  2MF9 A;  3I6C A;  5B8I C;  4DIP A;  1FKB A;  3KAH A;  4LAX A;  1ROU A;  2ZR4 A;  3O5G A;  4W9O A;  4JYS A;  3O5Q A;  2PV1 A;  2VCD A;  2ZR5 A;  1ZCN A;  4U84 A;  1YW5 A;  4IQC A;  1R9H A;  4G2P A;  2DG9 A;  4JFK A;  3PRD A;  4MSP A;  4DT4 A;  4DZ3 A;  2D9F A;  1D7I A;  1NMV A;  5DIU A;  3WH0 A;  3LUO A;  4DRP A;  4FAP A;  4TX0 A;  2N87 A;  1L1P A;  3UF8 A;  3KZ7 A;  3CGN A;  5I98 A;  2ZQS A;  4R0X A;  1QZ2 A;  2UZ5 A;  4DZ2 A;  1ZK6 A;  2XPA A;  1D7J A;  3FAP A;  2XP7 A;  2IF4 A;  2XP4 A;  1FKG A;  1FKI A;  1PBK A;  3O5O A;  4BF8 A;  1T11 A;  1P5Q A;  1FKL A;  4IQ2 A;  3CGM A;  1FAP A;  3O5I A;  5HW7 A;  1FD9 A;  4JFI A;  1HXV A;  1ROT A;  4JFL A;  1FKR A;  2F4E A;  3OOB A;  1TCO C;  2M1I A;  3O5M A;  1D7H A;  3O5D A;  4TW7 A;  1BKF A;  5HWB A;  1F40 A;  4FN2 A;  2ZQT A;  4G50 A;  2LKN A;  2XP8 A;  3KAB A;  2RQS A;  4JFM A;  2XP9 A;  3PA7 A;  2Q5A A;  4ODO A;  3UQI A;  5HW6 A;  1D6O A;  4ODP A;  3KAI A;  3RGC A;  1U79 A;  2MLY A;  4ODK A;  3O5P A;  3KAG A;  2PPN A;  2XP3 A;  2KI3 A;  2PPO A;  1FKK A;  1J4H A;  2VN1 A;  4QT3 A;  1JVW A;  3UI6 A;  4TW8 A;  3UI5 A;  1J6Y A;  1KT1 A;  4GGQ A;  1FKS A;  1JNT A;  1Q6H A;  3IK8 A;  5D75 A;  1EYM A;  1M5Y A;  5DIT A;  1N1A A;  2PV2 A;  1Q1C A;  1B6C A;  2ZQV A;  3B7X A;  3O5J A;  3PRB A;  4LAV A;  3UI4 A;  4DRH A;  3GPK A;  2MNT A;  2XP6 A;  5BXJ A;  2RUD A;  4DRO A;  2MLX A;  1FKT A;  2ZQU A;  5DIV A;  3JYJ A;  4ODM A;  5HKG A;  2AWG A;  3IHZ A;  5HT1 A;  4LAY A;  3TC5 A;  1NSG A;  2XPB A;  1J4R A;  4NNR A;  1KT0 A;  2LJ4 A;  2RUR A;  1QPF A;  3IKG A;  3O5L A;  4DRJ A;  4QT2 A;  3RFW A;  2F2D A;  1F8A B;  4DRQ A;  4W9P A;  2Y78 A;  1W26 A;  2KGJ A;  3O5E A;  2DG3 A;  2M2A A;  3TCZ A;  4C02 B;  2PV3 A;  3NRK A;  1J4I A;  1NMW A;  4J4O A;  4ITZ A;  1Q6U A;  1FJD A;  3KCE A;  4W9Q A;  5HW8 A;  2ITK A;  2F21 A;  2K8I A;  4LAW A;  3O5F A;  3KAC A;  4ODN A;  4ODQ A;  2PBC A;  2XP5 A; 
#chains in the Genus database with same CATH topology
 1K9T A;  4DRM A;  1E44 A;  2RUQ A;  3NI6 A;  2P4V A;  4QZV B;  1LL6 A;  1JNS A;  4U85 A;  4TYO A;  4HAR A;  5J6E A;  4TW6 A;  3JXV A;  2KE0 A;  2LGO A;  3ODK A;  4TW8 A;  4ZPV R;  2DSW A;  3ARR A;  4MNJ A;  2OFN A;  1E9L A;  3JYM A;  1FKF A;  5GQB A;  4U86 A;  1EQ3 A;  4GIV A;  3PR9 A;  2JZV A;  2RUC A;  4Q22 A;  3IKD A;  3I6C A;  5B8I C;  1E6Z A;  1ROU A;  2ZR4 A;  4W9O A;  2VCD A;  2ESC A;  4ZS6 A;  4IQC A;  4DT4 A;  3PRD A;  4TX0 A;  3UF8 A;  3KZ7 A;  3BXW A;  5I98 A;  4R0X A;  1HKI A;  2UZ5 A;  3B9E A;  1EHN A;  1HJX A;  1HKJ A;  2IF4 A;  2XP4 A;  2PI6 A;  4XAK A;  1FKL A;  1E6R A;  3CGM A;  5HW7 A;  1FD9 A;  4MNL A;  1FKR A;  2DT3 A;  1XHG A;  3ARP A;  4FN2 A;  4NZC A;  2LKN A;  3RM9 A;  1FFQ A;  1E6P A;  4PTM A;  3PA7 A;  2O9O A;  2Q5A A;  1LL7 A;  3O5P A;  3KAG A;  2PPO A;  4QT3 A;  4ZPT R;  3UI6 A;  3UI5 A;  3CHE A;  1FKS A;  3IK8 A;  5DIT A;  1M5Y A;  3PRB A;  4DRH A;  2DSV A;  4UDM A;  2YBU A;  2RUD A;  3IHZ A;  5HT1 A;  1NSG A;  4NNR A;  4DRJ A;  3RFW A;  2Y78 A;  4C02 B;  2PV3 A;  4J4O A;  1J4I A;  4Z2G A;  4Z2J A;  4W9Q A;  1CTN A;  1OWQ A;  1D2K A;  4DWS D;  1NWS A;  3CHD A;  4ODN A;  3UQA A;  3KAD A;  1W9V A;  2MLZ A;  4ZPW R;  2KFW A;  4J4N A;  1E15 A;  4L3N A;  3QOK A;  3ALF A;  4QIB A;  4DH0 A;  3H9R B;  4ODR A;  4TNS A;  1Y0O A;  2DG4 A;  3GU0 A;  2ZR6 A;  2PPP A;  4DRN A;  4DWS B;  1Q6I A;  3O5K A;  2B5U B;  1C9H A;  2MPH A;  3AS3 A;  1YAT A;  1HJV A;  3UQB A;  1QPL A;  4NSB A;  2MF9 A;  4DWS C;  4DIP A;  1FKB A;  1OGB A;  4LAX A;  1LG1 A;  3B8S A;  4MSP A;  1HKK A;  1NMV A;  5DIU A;  1JND A;  3B9A A;  4WKA A;  3ARY A;  1QZ2 A;  1ZK6 A;  2DPE A;  2XP7 A;  4BF8 A;  4DWS A;  1P5Q A;  4Q7N A;  5JH8 A;  1OGG A;  1ZU8 A;  4JFI A;  3WKZ A;  4JFL A;  2QF8 A;  1TCO C;  1BKF A;  2RQS A;  2XP9 A;  3RM4 A;  3ARS A;  4ODO A;  1ITX A;  4ODP A;  3ART A;  3KAI A;  3AS0 A;  3RGC A;  1U79 A;  2MLY A;  4ODK A;  5DO2 A;  3W4R A;  2XP3 A;  1FKK A;  4P8U A;  1EDQ A;  1EYM A;  2PV2 A;  3B7X A;  3UI4 A;  1SYT A;  3ARZ A;  2DT0 A;  4HBE A;  2F23 A;  2A3B A;  1FKT A;  1W9P A;  2ETN A;  4P8W A;  2XPB A;  1J4R A;  3WD3 A;  3O5L A;  2LJ4 A;  1QPF A;  4WJX A;  2WK2 A;  3BMB A;  1H0I A;  3ARO A;  4ITZ A;  1W9U A;  1JCH B;  1LG2 A;  5HW8 A;  4LGX A;  2F21 A;  4S3J A;  2XPA A;  4Z2I A;  2FAP A;  3KAF A;  2KO7 A;  3WL1 A;  1FKH A;  1WAW A;  3O5R A;  3EY6 A;  4N19 A;  5GPG A;  1W1Y A;  4L72 B;  1A7X A;  3B9D A;  1FKD A;  2KR7 A;  3AQU A;  4IPX A;  1HJW A;  5HTG A;  3ARW A;  5DEZ A;  3G6M A;  3VAW A;  4JFJ A;  1GRJ A;  2LPV A;  4Z2K A;  1BL4 A;  4DRK A;  2EUL A;  4IT4 A;  4MNM A;  4WKF A;  3WD0 A;  3KAH A;  2O92 A;  4URI A;  4JYS A;  4W5U A;  2ZR5 A;  1ZCN A;  1NWU A;  3GTY X;  4G2P A;  2D9F A;  3WH0 A;  4DRP A;  3LUO A;  4R5E A;  4FAP A;  2N87 A;  2B31 A;  1W1T A;  3CGN A;  4DZ2 A;  3O5O A;  1FKG A;  1IX5 A;  1SR0 A;  1GUV A;  3WL0 A;  2G8Z A;  1ZL1 A;  3OOB A;  3O5M A;  3O5D A;  4TW7 A;  2ZQT A;  3KAB A;  4JFM A;  2AOS A;  3UQI A;  5HW6 A;  1GOI A;  1D6O A;  2A3E A;  3WD1 A;  2PPN A;  4WK9 A;  4IT6 A;  1J4H A;  1WB0 A;  1LQ0 A;  2VN1 A;  5GPR A;  1JVW A;  1VF8 A;  3WD4 A;  4GGQ A;  5D75 A;  1JNT A;  1Q1C A;  1GPF A;  3O5J A;  4LAV A;  4AY1 A;  1JNE A;  2MLX A;  4P8V A;  2ZQU A;  5DIV A;  4ODM A;  3WIJ A;  5HKG A;  2AWG A;  4LAY A;  2YBT A;  2DSZ A;  1KT0 A;  4ML4 A;  4Z2H A;  3CHC A;  1LL4 A;  1W1P A;  1F8A B;  1UR8 A;  4W9P A;  4DRQ A;  4Z2L A;  1W26 A;  2KGJ A;  3O5E A;  2DG3 A;  2OLH A;  2A3C A;  3KCE A;  4LAW A;  3WQW A;  3O5F A;  1L1P A;  2XP5 A;  3ARV A;  3AS1 A;  2A3A A;  2DT2 A;  4MNK A;  1LJY A;  4O2T A;  4KQZ A;  2FDM A;  3CHF A;  4P8X A;  1ZBK A;  4ODL A;  4MGV A;  5HWC A;  1NWR A;  2RSE A;  3NTP A;  1PIN A;  3ALG A;  4DRI A;  5HUA A;  2M08 A;  1ZB5 A;  2FKE A;  1NH6 A;  2L2S A;  1FKJ A;  3RME A;  3MDY B;  3TDB A;  5HBF A;  1FFR A;  3OA5 A;  3RM8 A;  3O5G A;  3O5Q A;  2PV1 A;  4U84 A;  1YW5 A;  5DF0 A;  1R9H A;  2DG9 A;  4JFK A;  4DZ3 A;  1W1V A;  1D7I A;  2DT1 A;  2DSU A;  4WIW A;  2ZQS A;  1D7J A;  3FAP A;  4MPK A;  1H0G A;  1FKI A;  1PBK A;  1T11 A;  3PRA A;  4IQ2 A;  2IUZ A;  1ZBC A;  1FAP A;  3O5I A;  1NWT A;  1HXV A;  3ARQ A;  1ROT A;  3FY1 A;  3AS2 A;  2F4E A;  2M1I A;  1D7H A;  5HWB A;  1F40 A;  1WNO A;  4S3K A;  4G50 A;  2XP8 A;  1UR9 A;  3G6L A;  4MAV A;  2KI3 A;  3ARX A;  4MTV A;  1ZBW A;  1J6Y A;  2WLZ A;  3FXY A;  1KT1 A;  1KFW A;  1HKM A;  1ZBV A;  3CZ8 A;  1Q6H A;  1E6N A;  1XRV A;  1N1A A;  4HBO A;  2ZQV A;  1B6C A;  3CH9 A;  1X6N A;  3GPK A;  2MNT A;  2XP6 A;  4KR0 B;  5BXJ A;  4WKH A;  1EIB A;  4DRO A;  1RD6 A;  3EIP A;  1O6I A;  2WLY A;  3JYJ A;  2PN0 A;  3TC5 A;  3WQV A;  2WM0 A;  2RUR A;  3IKG A;  4QT2 A;  2F2D A;  3TCZ A;  2M2A A;  1TFV A;  3NRK A;  1NMW A;  1X6L A;  1Q6U A;  1FJD A;  2G41 A;  2ITK A;  3ARU A;  2K8I A;  3KAC A;  4ODQ A;  2PBC A;  3WD2 A; 
#chains in the Genus database with same CATH homology
 1K9T A;  4DRM A;  2RUQ A;  3NI6 A;  4QZV B;  1LL6 A;  1JNS A;  4U85 A;  4TYO A;  4HAR A;  5J6E A;  4TW6 A;  3JXV A;  2KE0 A;  2LGO A;  3ODK A;  4TW8 A;  4ZPV R;  2DSW A;  3ARR A;  4MNJ A;  2OFN A;  1E9L A;  3JYM A;  1FKF A;  5GQB A;  4U86 A;  1EQ3 A;  4GIV A;  3PR9 A;  2JZV A;  2RUC A;  4Q22 A;  3IKD A;  3I6C A;  5B8I C;  1E6Z A;  1ROU A;  2ZR4 A;  4W9O A;  2VCD A;  2ESC A;  4ZS6 A;  4IQC A;  4DT4 A;  3PRD A;  4TX0 A;  3UF8 A;  3KZ7 A;  3BXW A;  5I98 A;  4R0X A;  1HKI A;  2UZ5 A;  3B9E A;  1EHN A;  1HJX A;  1HKJ A;  2IF4 A;  2XP4 A;  2PI6 A;  4XAK A;  1FKL A;  1E6R A;  3CGM A;  5HW7 A;  1FD9 A;  4MNL A;  1FKR A;  2DT3 A;  1XHG A;  3ARP A;  4FN2 A;  4NZC A;  2LKN A;  3RM9 A;  1FFQ A;  1E6P A;  4PTM A;  3PA7 A;  2O9O A;  2Q5A A;  1LL7 A;  3O5P A;  3KAG A;  2PPO A;  4QT3 A;  4ZPT R;  3UI6 A;  3UI5 A;  3CHE A;  1FKS A;  3IK8 A;  5DIT A;  1M5Y A;  3PRB A;  4DRH A;  2DSV A;  2YBU A;  2RUD A;  3IHZ A;  5HT1 A;  1NSG A;  4NNR A;  4DRJ A;  3RFW A;  2Y78 A;  4C02 B;  2PV3 A;  4J4O A;  1J4I A;  4Z2G A;  4Z2J A;  4W9Q A;  1CTN A;  1OWQ A;  1D2K A;  4DWS D;  1NWS A;  3CHD A;  4ODN A;  3UQA A;  3KAD A;  1W9V A;  2MLZ A;  4ZPW R;  2KFW A;  4J4N A;  1E15 A;  4L3N A;  3QOK A;  3ALF A;  4QIB A;  4DH0 A;  3H9R B;  4ODR A;  4TNS A;  1Y0O A;  2DG4 A;  4DRN A;  2ZR6 A;  2PPP A;  4DWS B;  1Q6I A;  3O5K A;  1C9H A;  2MPH A;  3AS3 A;  1YAT A;  1HJV A;  3UQB A;  1QPL A;  4NSB A;  2MF9 A;  4DWS C;  4DIP A;  1FKB A;  1OGB A;  4LAX A;  1LG1 A;  3B8S A;  4MSP A;  1HKK A;  1NMV A;  5DIU A;  1JND A;  3B9A A;  4WKA A;  3ARY A;  1QZ2 A;  1ZK6 A;  2DPE A;  2XP7 A;  4BF8 A;  4DWS A;  1P5Q A;  4Q7N A;  5JH8 A;  1OGG A;  1ZU8 A;  4JFI A;  3WKZ A;  4JFL A;  2QF8 A;  1TCO C;  1BKF A;  2RQS A;  2XP9 A;  3RM4 A;  3ARS A;  4ODO A;  1ITX A;  4ODP A;  3ART A;  3KAI A;  3AS0 A;  3RGC A;  1U79 A;  2MLY A;  4ODK A;  5DO2 A;  3W4R A;  2XP3 A;  1FKK A;  4P8U A;  1EDQ A;  1EYM A;  2PV2 A;  3B7X A;  3UI4 A;  1SYT A;  3ARZ A;  2DT0 A;  4HBE A;  2A3B A;  1FKT A;  1W9P A;  4P8W A;  2XPB A;  1J4R A;  3WD3 A;  3O5L A;  2LJ4 A;  1QPF A;  4WJX A;  2WK2 A;  1H0I A;  3ARO A;  4ITZ A;  1W9U A;  1LG2 A;  5HW8 A;  4LGX A;  2F21 A;  4S3J A;  2XPA A;  4Z2I A;  2FAP A;  3KAF A;  2KO7 A;  3WL1 A;  1FKH A;  1WAW A;  3O5R A;  3EY6 A;  4N19 A;  5GPG A;  1W1Y A;  4L72 B;  1A7X A;  3B9D A;  1FKD A;  2KR7 A;  3AQU A;  4IPX A;  1HJW A;  5HTG A;  3ARW A;  5DEZ A;  3G6M A;  3VAW A;  4JFJ A;  2LPV A;  4Z2K A;  1BL4 A;  4DRK A;  4IT4 A;  4MNM A;  4WKF A;  3WD0 A;  3KAH A;  2O92 A;  4URI A;  4JYS A;  4W5U A;  2ZR5 A;  1ZCN A;  1NWU A;  4G2P A;  2D9F A;  3WH0 A;  4DRP A;  3LUO A;  4R5E A;  4FAP A;  2N87 A;  2B31 A;  1W1T A;  3CGN A;  4DZ2 A;  3O5O A;  1FKG A;  1IX5 A;  1SR0 A;  1GUV A;  3WL0 A;  2G8Z A;  1ZL1 A;  3OOB A;  3O5M A;  3O5D A;  4TW7 A;  2ZQT A;  3KAB A;  4JFM A;  2AOS A;  3UQI A;  5HW6 A;  1GOI A;  1D6O A;  2A3E A;  3WD1 A;  2PPN A;  4WK9 A;  4IT6 A;  1J4H A;  1WB0 A;  1LQ0 A;  2VN1 A;  5GPR A;  1JVW A;  1VF8 A;  3WD4 A;  4GGQ A;  5D75 A;  1JNT A;  1Q1C A;  1GPF A;  3O5J A;  4LAV A;  4AY1 A;  1JNE A;  2MLX A;  4P8V A;  2ZQU A;  5DIV A;  4ODM A;  3WIJ A;  5HKG A;  2AWG A;  4LAY A;  2YBT A;  2DSZ A;  1KT0 A;  4ML4 A;  4Z2H A;  3CHC A;  1LL4 A;  1W1P A;  1F8A B;  1UR8 A;  4W9P A;  4DRQ A;  4Z2L A;  1W26 A;  2KGJ A;  3O5E A;  2DG3 A;  2OLH A;  2A3C A;  3KCE A;  4LAW A;  3WQW A;  3O5F A;  1L1P A;  2XP5 A;  3ARV A;  3AS1 A;  2A3A A;  2DT2 A;  4MNK A;  1LJY A;  4O2T A;  4KQZ A;  2FDM A;  3CHF A;  4P8X A;  1ZBK A;  4ODL A;  4MGV A;  5HWC A;  1NWR A;  2RSE A;  3NTP A;  1PIN A;  3ALG A;  4DRI A;  5HUA A;  2M08 A;  1ZB5 A;  2FKE A;  1NH6 A;  2L2S A;  1FKJ A;  3RME A;  3MDY B;  3TDB A;  5HBF A;  1FFR A;  3OA5 A;  3RM8 A;  3O5G A;  3O5Q A;  2PV1 A;  4U84 A;  1YW5 A;  5DF0 A;  1R9H A;  2DG9 A;  4JFK A;  4DZ3 A;  1W1V A;  1D7I A;  2DT1 A;  2DSU A;  4WIW A;  2ZQS A;  1D7J A;  3FAP A;  4MPK A;  1H0G A;  1FKI A;  1PBK A;  1T11 A;  3PRA A;  4IQ2 A;  2IUZ A;  1ZBC A;  1FAP A;  3O5I A;  1NWT A;  1HXV A;  3ARQ A;  1ROT A;  3FY1 A;  3AS2 A;  2F4E A;  2M1I A;  1D7H A;  5HWB A;  1F40 A;  1WNO A;  4S3K A;  4G50 A;  2XP8 A;  1UR9 A;  3G6L A;  4MAV A;  2KI3 A;  3ARX A;  4MTV A;  1ZBW A;  1J6Y A;  2WLZ A;  3FXY A;  1KT1 A;  1KFW A;  1HKM A;  1ZBV A;  3CZ8 A;  1Q6H A;  1E6N A;  1XRV A;  1N1A A;  4HBO A;  2ZQV A;  1B6C A;  3CH9 A;  1X6N A;  3GPK A;  2MNT A;  2XP6 A;  4KR0 B;  5BXJ A;  4WKH A;  1EIB A;  4DRO A;  1RD6 A;  1O6I A;  2WLY A;  3JYJ A;  3TC5 A;  3WQV A;  2WM0 A;  2RUR A;  3IKG A;  4QT2 A;  2F2D A;  3TCZ A;  2M2A A;  1TFV A;  3NRK A;  1NMW A;  1X6L A;  1Q6U A;  1FJD A;  2G41 A;  2ITK A;  3ARU A;  2K8I A;  3KAC A;  4ODQ A;  2PBC A;  3WD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...