5HW7A

Candida albicans fkbp12 apo protein in p21212 space group
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
122
structure length
122
Chain Sequence
b'EELPQIEIVQEGDNTTFAKPGDTVTIHYDGKLTNGKEFDSSRKRGKPFTCTVGVGQVIKGWDISLTNNYGKGGANLPKISKGTKAILTIPPNLAYGPRGIPPIIGPNETLVFEVELLGVNGQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 1
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida albicans (strain sc5314 / atcc mya-2876)
molecule tags Isomerase
total genus 28
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5hw7A00
3KACA 4DROA 1Y0OA 1EYMA 2LKNA 1FKSA 3O5PA 2ZR5A 4C02B 3KAIA 2XP8A 4JFKA 2F21A 5I98A 2ZR6A 2XPAA 4TYOA 1JNTA 4QIBA 1FKBA 5HW8A 3UQBA 2M2AA 2FKEA 4FN2A 2AWGA 3O5MA 5DIVA 3KAHA 3UI6A 4JFLA 4W9PA 2ZR4A 2FAPA 4DRJA 3LUOA 1FKHA 1FKLA 1QZ2A 3B7XA 2LJ4A 3KADA 2RURA 1EQ3A 1JVWA 2PV3A 2MNTA 2IF4A 2MLXA 4U84A 4IPXA 4J4OA 5HT1A 4ODQA 3TC5A 2N87A 2PV1A 4DRPA 3CGNA 4JFIA 2XP7A 2VN1A 1FKFA 2F2DA 3FAPA 5HW7A 2MLZA 3VAWA 3IKDA 1W26A 3O5GA 1JNSA 4DRMA 1J6YA 2D9FA 3NI6A 1FKGA 1M5YA 1U79A 1D7JA 1ROUA 1ZK6A 2M08A 2RQSA 2JZVA 2XP3A 3PRDA 4G2PA 4QT3A 2L2SA 1Q6UA 2PBCA 4QT2A 4TNSA 4DIPA 5HTGA 2DG3A 4TW6A 3PRBA 5DIUA 4IQ2A 2F4EA 4W9QA 4DRNA 3EY6A 4GIVA 4N19A 4JFMA 4MGVA 1FKTA 1PINA 2M1IA 3O5KA 3JYMA 2ZQTA 4IQCA 4J4NA 1C9HA 2OFNA 4FAPA 2RUCA 3I6CA 3ODKA 2KO7A 1FKKA 1YATA 1D7HA 1QPFA 1PBKA 2RUQA 4ODMA 5DITA 1P5QA 2Q5AA 5GPGA 2VCDA 1A7XA 4JFJA 4LAVA 5D75A 4DZ2A 1TCOC 4TX0A 3IHZA 4BF8A 4DRKA 1FKJA 2KFWA 1NMVA 4DRQA 2K8IA 4ODKA 4O2TA 4JYSA 2XP6A 4U86A 4ODRA 1YW5A 2XP5A 3KAFA 4U85A 2PPNA 3UF8A 4DRIA 3KCEA 1F8AB 5HUAA 1L1PA 1Q6IA 1BL4A 4NNRA 3RFWA 1ROTA 3TCZA 5HWBA 3WH0A 1J4RA 4DZ3A 2RSEA 3KABA 1N1AA 3O5QA 2ZQUA 5HKGA 2XP4A 3OOBA 2XPBA 3CGMA 5HW6A 4R0XA 2RUDA 1NMWA 3TDBA 1FKDA 3PA7A 3GPKA 3IKGA 4TW8A 1FJDA 1KT0A 1Q1CA 4ODLA 4G50A 1FKIA 1BKFA 4LAYA 4W9OA 1B6CA 3UQAA 2ZQVA 4MSPA 3O5FA 2KE0A 3O5OA 2PPPA 3O5JA 5HWCA 4GGQA 4DT4A 5J6EA 2MLYA 4LAXA 4TW7A 3O5LA 1FD9A 2ITKA 4DRHA 3UI5A 1R9HA 2ZQSA 2LPVA 3KZ7A 4ITZA 3MDYB 2MF9A 1ZCNA 3JXVA 3O5RA 4LAWA 1D6OA 4ODPA 1T11A 1F40A 1FKRA 2KR7A 3IK8A 1Q6HA 1KT1A 2KI3A 1J4IA 3UQIA 1NSGA 1FAPA 2Y78A 3NRKA 1QPLA 1J4HA 2PV2A 3KAGA 2DG9A 3NTPA 3UI4A 2LGOA 2DG4A 2PPOA 4ODOA 3JYJA 3H9RB 2MPHA 1D7IA 3O5EA 3O5DA 4ODNA 4DH0A 2UZ5A 3O5IA 2XP9A 5B8IC 1HXVA 2KGJA 5BXJA 3RGCA
chains in the Genus database with same CATH superfamily
1Y0OA 1LQ0A 1VF8A 2DT2A 4TYOA 1JNTA 5HW8A 1E9LA 1W9PA 4NZCA 3WD3A 4W5UA 3KADA 3AS2A 2PV3A 4URIA 2MLXA 4U84A 1GRJA 2ETNA 4P8VA 4Z2IA 1LG1A 2XP7A 3FY1A 1JNSA 4ML4A 1J6YA 1M5YA 1D7JA 2AOSA 1ZK6A 4DIPA 3B9AA 1Q6UA 5HTGA 1E6RA 4TW6A 4N19A 4MGVA 1HKKA 4KQZA 4J4NA 2OFNA 1FKKA 1D7HA 1W9VA 5DITA 1PBKA 2RUQA 4ODMA 3PRAA 5GPGA 4LAVA 1A7XA 1O6IA 2K8IA 4O2TA 4AY1A 4U85A 3KAFA 1F8AB 3G6MA 1ZB5A 4WKHA 3WD1A 5HWBA 2A3AA 5JH8A 1NWSA 2XP4A 2XPBA 3ARTA 3CGMA 3CHCA 4Z2LA 2WLYA 1FKDA 5GQBA 1SYTA 3UQAA 4LAYA 1E6PA 2KE0A 4Z2KA 2PPPA 4ZPTR 5HWCA 4GGQA 5J6EA 4Z2JA 4IT6A 3WKZA 4IT4A 1WB0A 4MNJA 2YBUA 2ZQSA 4MPKA 3JXVA 4WJXA 1T11A 1FKRA 3W4RA 1KT1A 2KI3A 3ALFA 2FDMA 1E6ZA 3GU0A 1NSGA 1FAPA 1HKJA 1QPLA 1J4HA 1ZU8A 2DG9A 3UI4A 3AS1A 4ODOA 3O5EA 4ODNA 1H0IA 2A3BA 3KACA 4DROA 3O5PA 2ZR5A 4JFKA 2A3CA 2YBTA 2ESCA 1LL6A 2O92A 1FKBA 3WL0A 3UQBA 2FKEA 2AWGA 3O5MA 2PN0A 3EIPA 4R5EA 1FKLA 1QZ2A 3B7XA 4HARA 5DEZA 4IPXA 5HT1A 4L72B 4ODQA 4PTMA 1HJXA 4DRPA 3CH9A 1HJWA 1FKFA 2F2DA 3ARZA 5HW7A 2MLZA 3VAWA 2WK2A 3O5GA 4P8XA 1EIBA 5DF0A 3PRDA 1U79A 1ROUA 2RQSA 4MAVA 2JZVA 4QT3A 2PBCA 4DWSC 2DSUA 2F4EA 3AS0A 1W9UA 5GPRA 4JFMA 4MTVA 2M1IA 2PI6A 3ALGA 4WK9A 2B5UB 3O5KA 4Q22A 3JYMA 2IUZA 1C9HA 1FFQA 1W1VA 3ODKA 5HBFA 2DT3A 1TCOC 1W1TA 3IHZA 1SR0A 2DT1A 4DRKA 1NMVA 4JYSA 2XP6A 3KCEA 1Q6IA 4NNRA 1ZL1A 1LL4A 3KABA 1RD6A 1N1AA 2ZQUA 4ZPWR 4L3NA 5HW6A 1XRVA 3GTYX 3G6LA 1Q1CA 4ODLA 4G50A 4S3KA 1IX5A 3O5OA 5DO2A 1GUVA 4DT4A 4LAXA 4TW7A 3O5LA 2O9OA 2LPVA 2MF9A 3O5RA 1D6OA 3IK8A 4WIWA 1ZBKA 1JNDA 2DT0A 1J4IA 1HKMA 1NWRA 3NTPA 2DG4A 3JYJA 2MPHA 1D7IA 3O5DA 3WQWA 4DH0A 2XP9A 1HXVA 2KGJA 2P4VA 2LKNA 3KAIA 2XP8A 5I98A 1UR8A 2F21A 3WQVA 1ITXA 2XPAA 1OWQA 3ARUA 1ZBVA 2FAPA 1FKHA 2LJ4A 1EQ3A 2RURA 1JVWA 3WD0A 3RM9A 1CTNA 4J4OA 2N87A 2WM0A 3CGNA 1W1YA 3RM4A 1XHGA 1H0GA 2VN1A 3FAPA 4ZS6A 3B9EA 3CHFA 3IKDA 1W26A 3WL1A 2D9FA 3NI6A 1FKGA 3WD4A 2M08A 4DRMA 2G8ZA 4G2PA 4QT2A 2L2SA 2DG3A 5DIUA 4DRNA 3FXYA 4DWSA 2ZQTA 4Q7NA 1FFRA 2B31A 2QF8A 1E15A 1QPFA 2VCDA 4JFJA 4DZ2A 1W1PA 4HBOA 4WKAA 1FKJA 1HJVA 2KFWA 1WAWA 4ZPVR 4U86A 2XP5A 3UF8A 2PPNA 3CHDA 4DRIA 4P8UA 5HUAA 1L1PA 3BMBA 1X6NA 4Z2GA 3ARWA 1BL4A 3CZ8A 1ROTA 3TCZA 1J4RA 1KFWA 1X6LA 1E44A 3O5QA 5HKGA 1NWUA 4R0XA 2RUDA 3PA7A 3GPKA 4MNLA 3IKGA 4TW8A 1FJDA 1BKFA 4W9OA 2ZQVA 4DWSD 3O5FA 1UR9A 3AQUA 3O5JA 3ARYA 3BXWA 1ZBCA 1FD9A 1R9HA 1E6NA 3KZ7A 1ZCNA 1F40A 1LJYA 1WNOA 1Q6HA 3PR9A 3UQIA 3ARQA 3ARSA 2Y78A 3NRKA 2PV2A 2OLHA 3RMEA 2DSVA 2LGOA 3B8SA 3O5IA 5B8IC 5BXJA 1EYMA 1FKSA 4UDMA 4C02B 4KR0B 4MNMA 2ZR6A 3RM8A 4QIBA 2M2AA 4FN2A 5DIVA 3KAHA 3UI6A 4JFLA 4W9PA 2ZR4A 4DRJA 2DPEA 2F23A 3LUOA 3OA5A 2MNTA 2IF4A 3WIJA 3TC5A 2PV1A 4NSBA 4JFIA 4P8WA 2DSZA 1JNEA 3ARXA 3CHEA 2DSWA 3B9DA 2XP3A 1NWTA 4TNSA 3AS3A 1GPFA 3PRBA 4IQ2A 1HKIA 4W9QA 3EY6A 4GIVA 1FKTA 1PINA 3ARVA 4IQCA 1JCHB 4FAPA 2RUCA 4LGXA 3WD2A 3I6CA 2KO7A 1K9TA 1YATA 1P5QA 2Q5AA 5D75A 4XAKA 4TX0A 4BF8A 4HBEA 4DRQA 4ODKA 4ODRA 1YW5A 1NH6A 2A3EA 2EULA 1GOIA 4QZVB 3RFWA 4WKFA 3WH0A 4DZ3A 2RSEA 3OOBA 1D2KA 1OGGA 1NMWA 3TDBA 1KT0A 3ARPA 1LL7A 1FKIA 1B6CA 4MSPA 2WLZA 4DWSB 2MLYA 3QOKA 4Z2HA 2ITKA 4DRHA 3UI5A 4ITZA 3MDYB 1ZBWA 4LAWA 4ODPA 4MNKA 2KR7A 1OGBA 2G41A 4S3JA 1EDQA 3KAGA 2PPOA 3AROA 1EHNA 1LG2A 3H9RB 1TFVA 2UZ5A 3ARRA 3RGCA
chains in the Genus database with same CATH topology
1Y0OA 1LQ0A 1VF8A 2DT2A 4TYOA 1JNTA 5HW8A 1E9LA 1W9PA 4NZCA 3WD3A 4W5UA 3KADA 3AS2A 2PV3A 4URIA 2MLXA 4U84A 4P8VA 4Z2IA 1LG1A 2XP7A 3FY1A 1JNSA 4ML4A 1J6YA 1M5YA 1D7JA 2AOSA 1ZK6A 4DIPA 3B9AA 1Q6UA 5HTGA 1E6RA 4TW6A 4N19A 4MGVA 1HKKA 4KQZA 4J4NA 2OFNA 1FKKA 1D7HA 1W9VA 5DITA 1PBKA 2RUQA 4ODMA 3PRAA 5GPGA 4LAVA 1A7XA 1O6IA 2K8IA 4O2TA 4AY1A 4U85A 3KAFA 1F8AB 3G6MA 1ZB5A 4WKHA 3WD1A 5HWBA 2A3AA 5JH8A 1NWSA 2XP4A 2XPBA 3ARTA 3CGMA 3CHCA 4Z2LA 2WLYA 1FKDA 5GQBA 1SYTA 3UQAA 4LAYA 1E6PA 2KE0A 4Z2KA 2PPPA 4ZPTR 5HWCA 4GGQA 5J6EA 4Z2JA 4IT6A 3WKZA 4IT4A 1WB0A 4MNJA 2YBUA 2ZQSA 4MPKA 3JXVA 4WJXA 1T11A 1FKRA 3W4RA 1KT1A 2KI3A 3ALFA 2FDMA 1E6ZA 1NSGA 1FAPA 1HKJA 1QPLA 1J4HA 1ZU8A 2DG9A 3UI4A 3AS1A 4ODOA 3O5EA 4ODNA 1H0IA 2A3BA 3KACA 4DROA 3O5PA 2ZR5A 4JFKA 2A3CA 2YBTA 2ESCA 1LL6A 2O92A 1FKBA 3WL0A 3UQBA 2FKEA 2AWGA 3O5MA 4R5EA 1FKLA 1QZ2A 3B7XA 4HARA 5DEZA 4IPXA 5HT1A 4L72B 4ODQA 4PTMA 1HJXA 4DRPA 3CH9A 1HJWA 1FKFA 2F2DA 3ARZA 5HW7A 2MLZA 3VAWA 2WK2A 3O5GA 4P8XA 1EIBA 5DF0A 3PRDA 1U79A 1ROUA 2RQSA 4MAVA 2JZVA 4QT3A 2PBCA 4DWSC 2DSUA 2F4EA 3AS0A 1W9UA 5GPRA 4JFMA 4MTVA 2M1IA 2PI6A 3ALGA 4WK9A 3O5KA 4Q22A 3JYMA 2IUZA 1C9HA 1FFQA 1W1VA 3ODKA 5HBFA 2DT3A 1TCOC 1W1TA 3IHZA 1SR0A 2DT1A 4DRKA 1NMVA 4JYSA 2XP6A 3KCEA 1Q6IA 4NNRA 1ZL1A 1LL4A 3KABA 1RD6A 1N1AA 2ZQUA 4ZPWR 4L3NA 5HW6A 1XRVA 3G6LA 1Q1CA 4ODLA 4G50A 4S3KA 1IX5A 3O5OA 5DO2A 1GUVA 4DT4A 4LAXA 4TW7A 3O5LA 2O9OA 2LPVA 2MF9A 3O5RA 1D6OA 3IK8A 4WIWA 1ZBKA 1JNDA 2DT0A 1J4IA 1HKMA 1NWRA 3NTPA 2DG4A 3JYJA 2MPHA 1D7IA 3O5DA 3WQWA 4DH0A 2XP9A 1HXVA 2KGJA 2LKNA 3KAIA 2XP8A 5I98A 1UR8A 2F21A 3WQVA 1ITXA 2XPAA 1OWQA 3ARUA 1ZBVA 2FAPA 1FKHA 2LJ4A 1EQ3A 2RURA 1JVWA 3WD0A 3RM9A 1CTNA 4J4OA 2N87A 2WM0A 3CGNA 1W1YA 3RM4A 1XHGA 1H0GA 2VN1A 3FAPA 4ZS6A 3B9EA 3CHFA 3IKDA 1W26A 3WL1A 2D9FA 3NI6A 1FKGA 3WD4A 2M08A 4DRMA 2G8ZA 4G2PA 4QT2A 2L2SA 2DG3A 5DIUA 4DRNA 3FXYA 4DWSA 2ZQTA 4Q7NA 1FFRA 2B31A 2QF8A 1E15A 1QPFA 2VCDA 4JFJA 4DZ2A 1W1PA 4HBOA 4WKAA 1FKJA 1HJVA 2KFWA 1WAWA 4ZPVR 4U86A 2XP5A 3UF8A 2PPNA 3CHDA 4DRIA 4P8UA 5HUAA 1L1PA 1X6NA 4Z2GA 3ARWA 1BL4A 3CZ8A 1ROTA 3TCZA 1J4RA 1KFWA 1X6LA 3O5QA 5HKGA 1NWUA 4R0XA 2RUDA 3PA7A 3GPKA 4MNLA 3IKGA 4TW8A 1FJDA 1BKFA 4W9OA 2ZQVA 4DWSD 3O5FA 1UR9A 3AQUA 3O5JA 3ARYA 3BXWA 1ZBCA 1FD9A 1R9HA 1E6NA 3KZ7A 1ZCNA 1F40A 1LJYA 1WNOA 1Q6HA 3PR9A 3UQIA 3ARQA 3ARSA 2Y78A 3NRKA 2PV2A 2OLHA 3RMEA 2DSVA 2LGOA 3B8SA 3O5IA 5B8IC 5BXJA 1EYMA 1FKSA 4C02B 4KR0B 4MNMA 2ZR6A 3RM8A 4QIBA 2M2AA 4FN2A 5DIVA 3KAHA 3UI6A 4JFLA 4W9PA 2ZR4A 4DRJA 2DPEA 3LUOA 3OA5A 2MNTA 2IF4A 3WIJA 3TC5A 2PV1A 4NSBA 4JFIA 4P8WA 2DSZA 1JNEA 3ARXA 3CHEA 2DSWA 3B9DA 2XP3A 1NWTA 4TNSA 3AS3A 1GPFA 3PRBA 4IQ2A 1HKIA 4W9QA 3EY6A 4GIVA 1FKTA 1PINA 3ARVA 4IQCA 4FAPA 2RUCA 4LGXA 3WD2A 3I6CA 2KO7A 1K9TA 1YATA 1P5QA 2Q5AA 5D75A 4XAKA 4TX0A 4BF8A 4HBEA 4DRQA 4ODKA 4ODRA 1YW5A 1NH6A 2A3EA 1GOIA 4QZVB 3RFWA 4WKFA 3WH0A 4DZ3A 2RSEA 3OOBA 1D2KA 1OGGA 1NMWA 3TDBA 1KT0A 3ARPA 1LL7A 1FKIA 1B6CA 4MSPA 2WLZA 4DWSB 2MLYA 3QOKA 4Z2HA 2ITKA 4DRHA 3UI5A 4ITZA 3MDYB 1ZBWA 4LAWA 4ODPA 4MNKA 2KR7A 1OGBA 2G41A 4S3JA 1EDQA 3KAGA 2PPOA 3AROA 1EHNA 1LG2A 3H9RB 1TFVA 2UZ5A 3ARRA 3RGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KAC A;  4DRO A;  1Y0O A;  1EYM A;  2LKN A;  1FKS A;  3O5P A;  2ZR5 A;  4C02 B;  3KAI A;  2XP8 A;  4JFK A;  2F21 A;  5I98 A;  2ZR6 A;  2XPA A;  4TYO A;  1JNT A;  4QIB A;  1FKB A;  5HW8 A;  3UQB A;  2M2A A;  2FKE A;  4FN2 A;  2AWG A;  3O5M A;  5DIV A;  3KAH A;  3UI6 A;  4JFL A;  4W9P A;  2ZR4 A;  2FAP A;  4DRJ A;  3LUO A;  1FKH A;  1FKL A;  1QZ2 A;  3B7X A;  2LJ4 A;  3KAD A;  2RUR A;  1EQ3 A;  1JVW A;  2PV3 A;  2MNT A;  2IF4 A;  2MLX A;  4U84 A;  4IPX A;  4J4O A;  5HT1 A;  4ODQ A;  3TC5 A;  2N87 A;  2PV1 A;  4DRP A;  3CGN A;  4JFI A;  2XP7 A;  2VN1 A;  1FKF A;  2F2D A;  3FAP A;  5HW7 A;  2MLZ A;  3VAW A;  3IKD A;  1W26 A;  3O5G A;  1JNS A;  4DRM A;  1J6Y A;  2D9F A;  3NI6 A;  1FKG A;  1M5Y A;  1U79 A;  1D7J A;  1ROU A;  1ZK6 A;  2M08 A;  2RQS A;  2JZV A;  2XP3 A;  3PRD A;  4G2P A;  4QT3 A;  2L2S A;  1Q6U A;  2PBC A;  4QT2 A;  4TNS A;  4DIP A;  5HTG A;  2DG3 A;  4TW6 A;  3PRB A;  5DIU A;  4IQ2 A;  2F4E A;  4W9Q A;  4DRN A;  3EY6 A;  4GIV A;  4N19 A;  4JFM A;  4MGV A;  1FKT A;  1PIN A;  2M1I A;  3O5K A;  3JYM A;  2ZQT A;  4IQC A;  4J4N A;  1C9H A;  2OFN A;  4FAP A;  2RUC A;  3I6C A;  3ODK A;  2KO7 A;  1FKK A;  1YAT A;  1D7H A;  1QPF A;  1PBK A;  2RUQ A;  4ODM A;  5DIT A;  1P5Q A;  2Q5A A;  5GPG A;  2VCD A;  1A7X A;  4JFJ A;  4LAV A;  5D75 A;  4DZ2 A;  1TCO C;  4TX0 A;  3IHZ A;  4BF8 A;  4DRK A;  1FKJ A;  2KFW A;  1NMV A;  4DRQ A;  2K8I A;  4ODK A;  4O2T A;  4JYS A;  2XP6 A;  4U86 A;  4ODR A;  1YW5 A;  2XP5 A;  3KAF A;  4U85 A;  2PPN A;  3UF8 A;  4DRI A;  3KCE A;  1F8A B;  5HUA A;  1L1P A;  1Q6I A;  1BL4 A;  4NNR A;  3RFW A;  1ROT A;  3TCZ A;  5HWB A;  3WH0 A;  1J4R A;  4DZ3 A;  2RSE A;  3KAB A;  1N1A A;  3O5Q A;  2ZQU A;  5HKG A;  2XP4 A;  3OOB A;  2XPB A;  3CGM A;  5HW6 A;  4R0X A;  2RUD A;  1NMW A;  3TDB A;  1FKD A;  3PA7 A;  3GPK A;  3IKG A;  4TW8 A;  1FJD A;  1KT0 A;  1Q1C A;  4ODL A;  4G50 A;  1FKI A;  1BKF A;  4LAY A;  4W9O A;  1B6C A;  3UQA A;  2ZQV A;  4MSP A;  3O5F A;  2KE0 A;  3O5O A;  2PPP A;  3O5J A;  5HWC A;  4GGQ A;  4DT4 A;  5J6E A;  2MLY A;  4LAX A;  4TW7 A;  3O5L A;  1FD9 A;  2ITK A;  4DRH A;  3UI5 A;  1R9H A;  2ZQS A;  2LPV A;  3KZ7 A;  4ITZ A;  3MDY B;  2MF9 A;  1ZCN A;  3JXV A;  3O5R A;  4LAW A;  1D6O A;  4ODP A;  1T11 A;  1F40 A;  1FKR A;  2KR7 A;  3IK8 A;  1Q6H A;  1KT1 A;  2KI3 A;  1J4I A;  3UQI A;  1NSG A;  1FAP A;  2Y78 A;  3NRK A;  1QPL A;  1J4H A;  2PV2 A;  3KAG A;  2DG9 A;  3NTP A;  3UI4 A;  2LGO A;  2DG4 A;  2PPO A;  4ODO A;  3JYJ A;  3H9R B;  2MPH A;  1D7I A;  3O5E A;  3O5D A;  4ODN A;  4DH0 A;  2UZ5 A;  3O5I A;  2XP9 A;  5B8I C;  1HXV A;  2KGJ A;  5BXJ A;  3RGC A; 
#chains in the Genus database with same CATH topology
 1Y0O A;  1LQ0 A;  1VF8 A;  2DT2 A;  4TYO A;  1JNT A;  5HW8 A;  1E9L A;  1W9P A;  4NZC A;  3WD3 A;  4W5U A;  3KAD A;  3AS2 A;  2PV3 A;  4URI A;  2MLX A;  4U84 A;  1GRJ A;  2ETN A;  4P8V A;  4Z2I A;  1LG1 A;  2XP7 A;  3FY1 A;  1JNS A;  4ML4 A;  1J6Y A;  1M5Y A;  1D7J A;  2AOS A;  1ZK6 A;  4DIP A;  3B9A A;  1Q6U A;  5HTG A;  1E6R A;  4TW6 A;  4N19 A;  4MGV A;  1HKK A;  4KQZ A;  4J4N A;  2OFN A;  1FKK A;  1D7H A;  1W9V A;  5DIT A;  1PBK A;  2RUQ A;  4ODM A;  3PRA A;  5GPG A;  4LAV A;  1A7X A;  1O6I A;  2K8I A;  4O2T A;  4AY1 A;  4U85 A;  3KAF A;  1F8A B;  3G6M A;  1ZB5 A;  4WKH A;  3WD1 A;  5HWB A;  2A3A A;  5JH8 A;  1NWS A;  2XP4 A;  2XPB A;  3ART A;  3CGM A;  3CHC A;  4Z2L A;  2WLY A;  1FKD A;  5GQB A;  1SYT A;  3UQA A;  4LAY A;  1E6P A;  2KE0 A;  4Z2K A;  2PPP A;  4ZPT R;  5HWC A;  4GGQ A;  5J6E A;  4Z2J A;  4IT6 A;  3WKZ A;  4IT4 A;  1WB0 A;  4MNJ A;  2YBU A;  2ZQS A;  4MPK A;  3JXV A;  4WJX A;  1T11 A;  1FKR A;  3W4R A;  1KT1 A;  2KI3 A;  3ALF A;  2FDM A;  1E6Z A;  3GU0 A;  1NSG A;  1FAP A;  1HKJ A;  1QPL A;  1J4H A;  1ZU8 A;  2DG9 A;  3UI4 A;  3AS1 A;  4ODO A;  3O5E A;  4ODN A;  1H0I A;  2A3B A;  3KAC A;  4DRO A;  3O5P A;  2ZR5 A;  4JFK A;  2A3C A;  2YBT A;  2ESC A;  1LL6 A;  2O92 A;  1FKB A;  3WL0 A;  3UQB A;  2FKE A;  2AWG A;  3O5M A;  2PN0 A;  3EIP A;  4R5E A;  1FKL A;  1QZ2 A;  3B7X A;  4HAR A;  5DEZ A;  4IPX A;  5HT1 A;  4L72 B;  4ODQ A;  4PTM A;  1HJX A;  4DRP A;  3CH9 A;  1HJW A;  1FKF A;  2F2D A;  3ARZ A;  5HW7 A;  2MLZ A;  3VAW A;  2WK2 A;  3O5G A;  4P8X A;  1EIB A;  5DF0 A;  3PRD A;  1U79 A;  1ROU A;  2RQS A;  4MAV A;  2JZV A;  4QT3 A;  2PBC A;  4DWS C;  2DSU A;  2F4E A;  3AS0 A;  1W9U A;  5GPR A;  4JFM A;  4MTV A;  2M1I A;  2PI6 A;  3ALG A;  4WK9 A;  2B5U B;  3O5K A;  4Q22 A;  3JYM A;  2IUZ A;  1C9H A;  1FFQ A;  1W1V A;  3ODK A;  5HBF A;  2DT3 A;  1TCO C;  1W1T A;  3IHZ A;  1SR0 A;  2DT1 A;  4DRK A;  1NMV A;  4JYS A;  2XP6 A;  3KCE A;  1Q6I A;  4NNR A;  1ZL1 A;  1LL4 A;  3KAB A;  1RD6 A;  1N1A A;  2ZQU A;  4ZPW R;  4L3N A;  5HW6 A;  1XRV A;  3GTY X;  3G6L A;  1Q1C A;  4ODL A;  4G50 A;  4S3K A;  1IX5 A;  3O5O A;  5DO2 A;  1GUV A;  4DT4 A;  4LAX A;  4TW7 A;  3O5L A;  2O9O A;  2LPV A;  2MF9 A;  3O5R A;  1D6O A;  3IK8 A;  4WIW A;  1ZBK A;  1JND A;  2DT0 A;  1J4I A;  1HKM A;  1NWR A;  3NTP A;  2DG4 A;  3JYJ A;  2MPH A;  1D7I A;  3O5D A;  3WQW A;  4DH0 A;  2XP9 A;  1HXV A;  2KGJ A;  2P4V A;  2LKN A;  3KAI A;  2XP8 A;  5I98 A;  1UR8 A;  2F21 A;  3WQV A;  1ITX A;  2XPA A;  1OWQ A;  3ARU A;  1ZBV A;  2FAP A;  1FKH A;  2LJ4 A;  1EQ3 A;  2RUR A;  1JVW A;  3WD0 A;  3RM9 A;  1CTN A;  4J4O A;  2N87 A;  2WM0 A;  3CGN A;  1W1Y A;  3RM4 A;  1XHG A;  1H0G A;  2VN1 A;  3FAP A;  4ZS6 A;  3B9E A;  3CHF A;  3IKD A;  1W26 A;  3WL1 A;  2D9F A;  3NI6 A;  1FKG A;  3WD4 A;  2M08 A;  4DRM A;  2G8Z A;  4G2P A;  4QT2 A;  2L2S A;  2DG3 A;  5DIU A;  4DRN A;  3FXY A;  4DWS A;  2ZQT A;  4Q7N A;  1FFR A;  2B31 A;  2QF8 A;  1E15 A;  1QPF A;  2VCD A;  4JFJ A;  4DZ2 A;  1W1P A;  4HBO A;  4WKA A;  1FKJ A;  1HJV A;  2KFW A;  1WAW A;  4ZPV R;  4U86 A;  2XP5 A;  3UF8 A;  2PPN A;  3CHD A;  4DRI A;  4P8U A;  5HUA A;  1L1P A;  3BMB A;  1X6N A;  4Z2G A;  3ARW A;  1BL4 A;  3CZ8 A;  1ROT A;  3TCZ A;  1J4R A;  1KFW A;  1X6L A;  1E44 A;  3O5Q A;  5HKG A;  1NWU A;  4R0X A;  2RUD A;  3PA7 A;  3GPK A;  4MNL A;  3IKG A;  4TW8 A;  1FJD A;  1BKF A;  4W9O A;  2ZQV A;  4DWS D;  3O5F A;  1UR9 A;  3AQU A;  3O5J A;  3ARY A;  3BXW A;  1ZBC A;  1FD9 A;  1R9H A;  1E6N A;  3KZ7 A;  1ZCN A;  1F40 A;  1LJY A;  1WNO A;  1Q6H A;  3PR9 A;  3UQI A;  3ARQ A;  3ARS A;  2Y78 A;  3NRK A;  2PV2 A;  2OLH A;  3RME A;  2DSV A;  2LGO A;  3B8S A;  3O5I A;  5B8I C;  5BXJ A;  1EYM A;  1FKS A;  4UDM A;  4C02 B;  4KR0 B;  4MNM A;  2ZR6 A;  3RM8 A;  4QIB A;  2M2A A;  4FN2 A;  5DIV A;  3KAH A;  3UI6 A;  4JFL A;  4W9P A;  2ZR4 A;  4DRJ A;  2DPE A;  2F23 A;  3LUO A;  3OA5 A;  2MNT A;  2IF4 A;  3WIJ A;  3TC5 A;  2PV1 A;  4NSB A;  4JFI A;  4P8W A;  2DSZ A;  1JNE A;  3ARX A;  3CHE A;  2DSW A;  3B9D A;  2XP3 A;  1NWT A;  4TNS A;  3AS3 A;  1GPF A;  3PRB A;  4IQ2 A;  1HKI A;  4W9Q A;  3EY6 A;  4GIV A;  1FKT A;  1PIN A;  3ARV A;  4IQC A;  1JCH B;  4FAP A;  2RUC A;  4LGX A;  3WD2 A;  3I6C A;  2KO7 A;  1K9T A;  1YAT A;  1P5Q A;  2Q5A A;  5D75 A;  4XAK A;  4TX0 A;  4BF8 A;  4HBE A;  4DRQ A;  4ODK A;  4ODR A;  1YW5 A;  1NH6 A;  2A3E A;  2EUL A;  1GOI A;  4QZV B;  3RFW A;  4WKF A;  3WH0 A;  4DZ3 A;  2RSE A;  3OOB A;  1D2K A;  1OGG A;  1NMW A;  3TDB A;  1KT0 A;  3ARP A;  1LL7 A;  1FKI A;  1B6C A;  4MSP A;  2WLZ A;  4DWS B;  2MLY A;  3QOK A;  4Z2H A;  2ITK A;  4DRH A;  3UI5 A;  4ITZ A;  3MDY B;  1ZBW A;  4LAW A;  4ODP A;  4MNK A;  2KR7 A;  1OGB A;  2G41 A;  4S3J A;  1EDQ A;  3KAG A;  2PPO A;  3ARO A;  1EHN A;  1LG2 A;  3H9R B;  1TFV A;  2UZ5 A;  3ARR A;  3RGC A; 
#chains in the Genus database with same CATH homology
 1Y0O A;  1LQ0 A;  1VF8 A;  2DT2 A;  4TYO A;  1JNT A;  5HW8 A;  1E9L A;  1W9P A;  4NZC A;  3WD3 A;  4W5U A;  3KAD A;  3AS2 A;  2PV3 A;  4URI A;  2MLX A;  4U84 A;  4P8V A;  4Z2I A;  1LG1 A;  2XP7 A;  3FY1 A;  1JNS A;  4ML4 A;  1J6Y A;  1M5Y A;  1D7J A;  2AOS A;  1ZK6 A;  4DIP A;  3B9A A;  1Q6U A;  5HTG A;  1E6R A;  4TW6 A;  4N19 A;  4MGV A;  1HKK A;  4KQZ A;  4J4N A;  2OFN A;  1FKK A;  1D7H A;  1W9V A;  5DIT A;  1PBK A;  2RUQ A;  4ODM A;  3PRA A;  5GPG A;  4LAV A;  1A7X A;  1O6I A;  2K8I A;  4O2T A;  4AY1 A;  4U85 A;  3KAF A;  1F8A B;  3G6M A;  1ZB5 A;  4WKH A;  3WD1 A;  5HWB A;  2A3A A;  5JH8 A;  1NWS A;  2XP4 A;  2XPB A;  3ART A;  3CGM A;  3CHC A;  4Z2L A;  2WLY A;  1FKD A;  5GQB A;  1SYT A;  3UQA A;  4LAY A;  1E6P A;  2KE0 A;  4Z2K A;  2PPP A;  4ZPT R;  5HWC A;  4GGQ A;  5J6E A;  4Z2J A;  4IT6 A;  3WKZ A;  4IT4 A;  1WB0 A;  4MNJ A;  2YBU A;  2ZQS A;  4MPK A;  3JXV A;  4WJX A;  1T11 A;  1FKR A;  3W4R A;  1KT1 A;  2KI3 A;  3ALF A;  2FDM A;  1E6Z A;  1NSG A;  1FAP A;  1HKJ A;  1QPL A;  1J4H A;  1ZU8 A;  2DG9 A;  3UI4 A;  3AS1 A;  4ODO A;  3O5E A;  4ODN A;  1H0I A;  2A3B A;  3KAC A;  4DRO A;  3O5P A;  2ZR5 A;  4JFK A;  2A3C A;  2YBT A;  2ESC A;  1LL6 A;  2O92 A;  1FKB A;  3WL0 A;  3UQB A;  2FKE A;  2AWG A;  3O5M A;  4R5E A;  1FKL A;  1QZ2 A;  3B7X A;  4HAR A;  5DEZ A;  4IPX A;  5HT1 A;  4L72 B;  4ODQ A;  4PTM A;  1HJX A;  4DRP A;  3CH9 A;  1HJW A;  1FKF A;  2F2D A;  3ARZ A;  5HW7 A;  2MLZ A;  3VAW A;  2WK2 A;  3O5G A;  4P8X A;  1EIB A;  5DF0 A;  3PRD A;  1U79 A;  1ROU A;  2RQS A;  4MAV A;  2JZV A;  4QT3 A;  2PBC A;  4DWS C;  2DSU A;  2F4E A;  3AS0 A;  1W9U A;  5GPR A;  4JFM A;  4MTV A;  2M1I A;  2PI6 A;  3ALG A;  4WK9 A;  3O5K A;  4Q22 A;  3JYM A;  2IUZ A;  1C9H A;  1FFQ A;  1W1V A;  3ODK A;  5HBF A;  2DT3 A;  1TCO C;  1W1T A;  3IHZ A;  1SR0 A;  2DT1 A;  4DRK A;  1NMV A;  4JYS A;  2XP6 A;  3KCE A;  1Q6I A;  4NNR A;  1ZL1 A;  1LL4 A;  3KAB A;  1RD6 A;  1N1A A;  2ZQU A;  4ZPW R;  4L3N A;  5HW6 A;  1XRV A;  3G6L A;  1Q1C A;  4ODL A;  4G50 A;  4S3K A;  1IX5 A;  3O5O A;  5DO2 A;  1GUV A;  4DT4 A;  4LAX A;  4TW7 A;  3O5L A;  2O9O A;  2LPV A;  2MF9 A;  3O5R A;  1D6O A;  3IK8 A;  4WIW A;  1ZBK A;  1JND A;  2DT0 A;  1J4I A;  1HKM A;  1NWR A;  3NTP A;  2DG4 A;  3JYJ A;  2MPH A;  1D7I A;  3O5D A;  3WQW A;  4DH0 A;  2XP9 A;  1HXV A;  2KGJ A;  2LKN A;  3KAI A;  2XP8 A;  5I98 A;  1UR8 A;  2F21 A;  3WQV A;  1ITX A;  2XPA A;  1OWQ A;  3ARU A;  1ZBV A;  2FAP A;  1FKH A;  2LJ4 A;  1EQ3 A;  2RUR A;  1JVW A;  3WD0 A;  3RM9 A;  1CTN A;  4J4O A;  2N87 A;  2WM0 A;  3CGN A;  1W1Y A;  3RM4 A;  1XHG A;  1H0G A;  2VN1 A;  3FAP A;  4ZS6 A;  3B9E A;  3CHF A;  3IKD A;  1W26 A;  3WL1 A;  2D9F A;  3NI6 A;  1FKG A;  3WD4 A;  2M08 A;  4DRM A;  2G8Z A;  4G2P A;  4QT2 A;  2L2S A;  2DG3 A;  5DIU A;  4DRN A;  3FXY A;  4DWS A;  2ZQT A;  4Q7N A;  1FFR A;  2B31 A;  2QF8 A;  1E15 A;  1QPF A;  2VCD A;  4JFJ A;  4DZ2 A;  1W1P A;  4HBO A;  4WKA A;  1FKJ A;  1HJV A;  2KFW A;  1WAW A;  4ZPV R;  4U86 A;  2XP5 A;  3UF8 A;  2PPN A;  3CHD A;  4DRI A;  4P8U A;  5HUA A;  1L1P A;  1X6N A;  4Z2G A;  3ARW A;  1BL4 A;  3CZ8 A;  1ROT A;  3TCZ A;  1J4R A;  1KFW A;  1X6L A;  3O5Q A;  5HKG A;  1NWU A;  4R0X A;  2RUD A;  3PA7 A;  3GPK A;  4MNL A;  3IKG A;  4TW8 A;  1FJD A;  1BKF A;  4W9O A;  2ZQV A;  4DWS D;  3O5F A;  1UR9 A;  3AQU A;  3O5J A;  3ARY A;  3BXW A;  1ZBC A;  1FD9 A;  1R9H A;  1E6N A;  3KZ7 A;  1ZCN A;  1F40 A;  1LJY A;  1WNO A;  1Q6H A;  3PR9 A;  3UQI A;  3ARQ A;  3ARS A;  2Y78 A;  3NRK A;  2PV2 A;  2OLH A;  3RME A;  2DSV A;  2LGO A;  3B8S A;  3O5I A;  5B8I C;  5BXJ A;  1EYM A;  1FKS A;  4C02 B;  4KR0 B;  4MNM A;  2ZR6 A;  3RM8 A;  4QIB A;  2M2A A;  4FN2 A;  5DIV A;  3KAH A;  3UI6 A;  4JFL A;  4W9P A;  2ZR4 A;  4DRJ A;  2DPE A;  3LUO A;  3OA5 A;  2MNT A;  2IF4 A;  3WIJ A;  3TC5 A;  2PV1 A;  4NSB A;  4JFI A;  4P8W A;  2DSZ A;  1JNE A;  3ARX A;  3CHE A;  2DSW A;  3B9D A;  2XP3 A;  1NWT A;  4TNS A;  3AS3 A;  1GPF A;  3PRB A;  4IQ2 A;  1HKI A;  4W9Q A;  3EY6 A;  4GIV A;  1FKT A;  1PIN A;  3ARV A;  4IQC A;  4FAP A;  2RUC A;  4LGX A;  3WD2 A;  3I6C A;  2KO7 A;  1K9T A;  1YAT A;  1P5Q A;  2Q5A A;  5D75 A;  4XAK A;  4TX0 A;  4BF8 A;  4HBE A;  4DRQ A;  4ODK A;  4ODR A;  1YW5 A;  1NH6 A;  2A3E A;  1GOI A;  4QZV B;  3RFW A;  4WKF A;  3WH0 A;  4DZ3 A;  2RSE A;  3OOB A;  1D2K A;  1OGG A;  1NMW A;  3TDB A;  1KT0 A;  3ARP A;  1LL7 A;  1FKI A;  1B6C A;  4MSP A;  2WLZ A;  4DWS B;  2MLY A;  3QOK A;  4Z2H A;  2ITK A;  4DRH A;  3UI5 A;  4ITZ A;  3MDY B;  1ZBW A;  4LAW A;  4ODP A;  4MNK A;  2KR7 A;  1OGB A;  2G41 A;  4S3J A;  1EDQ A;  3KAG A;  2PPO A;  3ARO A;  1EHN A;  1LG2 A;  3H9R B;  1TFV A;  2UZ5 A;  3ARR A;  3RGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...