5HW7A

Candida albicans fkbp12 apo protein in p21212 space group
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
122
structure length
122
Chain Sequence
EELPQIEIVQEGDNTTFAKPGDTVTIHYDGKLTNGKEFDSSRKRGKPFTCTVGVGQVIKGWDISLTNNYGKGGANLPKISKGTKAILTIPPNLAYGPRGIPPIIGPNETLVFEVELLGVNGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida albicans (strain sc5314 / atcc mya-2876)
molecule tags Isomerase
molecule keywords FK506-binding protein 1
total genus 28
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5hw7A00
3KZ7A 3IKDA 4ODKA 1Q6IA 1FD9A 3H9RB 1J4HA 1ROUA 2LGOA 4TW7A 4IPXA 2PPOA 4ODLA 2ZR6A 2F21A 2PPNA 3O5MA 2M2AA 1D7IA 3B7XA 3CGMA 2PBCA 4JFJA 4TW6A 3RFWA 2IF4A 4JFLA 3NI6A 3UQAA 4IQCA 1J4IA 1FKIA 1F8AB 1FKGA 2RSEA 1J6YA 2FAPA 2KR7A 3KADA 4DROA 2MLXA 1FKSA 4J4OA 3ODKA 4ODNA 1FAPA 2M08A 2KO7A 5HT1A 3O5PA 2ZQTA 4TW8A 1FKTA 1Y0OA 2XP5A 2AWGA 2Y78A 4G50A 2RUDA 4JFKA 4MGVA 2JZVA 4TNSA 3UI4A 4JYSA 5J6EA 1TCOC 2PPPA 2FKEA 1FKJA 1QPLA 5HW8A 4DH0A 4J4NA 2ITKA 2VCDA 4DIPA 1QZ2A 2L2SA 1P5QA 3KABA 2DG9A 3I6CA 2XP7A 4TX0A 3UF8A 4DRQA 4BF8A 4JFMA 4DRHA 1JNSA 4MSPA 2F2DA 2DG3A 1M5YA 4O2TA 1F40A 3TDBA 2PV3A 2UZ5A 1R9HA 1U79A 2MPHA 3NRKA 3O5LA 5BXJA 2D9FA 3UQBA 4N19A 2ZQUA 2N87A 3GPKA 4DT4A 1J4RA 2LPVA 4ITZA 2F4EA 5DITA 3IHZA 3TCZA 5D75A 3CGNA 3TC5A 3UI6A 1QPFA 3UI5A 1ZCNA 4JFIA 5B8IC 3O5GA 2MF9A 4DRIA 2XP6A 2KFWA 1D7HA 2PV2A 5HW7A 5HWCA 1KT0A 3VAWA 2MLZA 4IQ2A 2KI3A 2RUQA 5DIVA 1PINA 2PV1A 4DRNA 4ODRA 3JXVA 1BKFA 2OFNA 1N1AA 3PA7A 3KCEA 3O5JA 4ODPA 4TYOA 3O5QA 4U85A 3RGCA 3O5EA 1Q1CA 1FKFA 4DZ3A 4GIVA 3FAPA 3O5FA 5I98A 3O5OA 4DRJA 4QT2A 4C02B 2XP3A 4QIBA 3KAHA 2Q5AA 4LAXA 5DIUA 5GPGA 2KE0A 2ZQSA 5HKGA 3NTPA 1ZK6A 5HTGA 1FKRA 4DRPA 3KAGA 2DG4A 4ODQA 1T11A 2ZR4A 1D7JA 1EYMA 4FN2A 4LAWA 4ODMA 1JNTA 3JYJA 4DRKA 2KGJA 3KAIA 3LUOA 4ODOA 1FKDA 4W9OA 2M1IA 3MDYB 2XPAA 1NMVA 4DZ2A 4FAPA 4GGQA 2RUCA 1FJDA 1L1PA 5HWBA 1EQ3A 4R0XA 3IK8A 2XP9A 3O5DA 4NNRA 1FKHA 3O5RA 2LKNA 4G2PA 3PRDA 1FKLA 2XP4A 2ZQVA 1NMWA 2MLYA 4W9PA 4W9QA 3KAFA 1B6CA 1C9HA 1JVWA 3JYMA 1FKBA 4LAYA 4U86A 5HUAA 3KACA 1BL4A 2K8IA 1HXVA 3O5KA 1ROTA 2XPBA 1D6OA 1YATA 2LJ4A 1NSGA 4QT3A 3UQIA 3EY6A 1Q6UA 2RURA 1Q6HA 1W26A 3IKGA 3O5IA 2VN1A 1FKKA 4LAVA 4U84A 3OOBA 5HW6A 2MNTA 3PRBA 4DRMA 1PBKA 1A7XA 1KT1A 2RQSA 3WH0A 2XP8A 1YW5A 2ZR5A
chains in the Genus database with same CATH superfamily
4ODKA 1Q6IA 1IX5A 3BXWA 1J4HA 2LGOA 2PPOA 4P8UA 5DO2A 4NZCA 2PPNA 3AROA 3RFWA 2DSUA 4JFLA 3UQAA 4IQCA 4L3NA 1J4IA 1FKGA 2RSEA 3W4RA 2WM0A 3KADA 4DROA 2MLXA 4J4OA 4ODNA 1FAPA 2M08A 3O5PA 2ESCA 1FKTA 4JFKA 2Y78A 1HKKA 1E6PA 1ZBCA 2VCDA 1QZ2A 3ALGA 2L2SA 4WJXA 1NWRA 2DG9A 2PN0A 3I6CA 4TX0A 4DRQA 1M5YA 4S3JA 1R9HA 4KR0B 3CHEA 3O5LA 2ZQUA 1LL6A 4ITZA 3EIPA 2DPEA 1ZCNA 2XP6A 1D2KA 5HW7A 5DF0A 4MPKA 5DIVA 2G8ZA 1BKFA 1N1AA 3AS3A 3PA7A 3O5QA 3RGCA 1EIBA 3O5OA 4IT4A 5DIUA 3KAHA 2WK2A 2KE0A 2ZQSA 3BMBA 4FN2A 2ZR4A 3ARXA 4LAWA 3JYJA 2ETNA 4W9OA 3WH0A 2M1IA 2XPAA 1NMVA 4DZ2A 4GGQA 1E15A 3WD0A 1L1PA 1EQ3A 3IK8A 3O5DA 5GPRA 4G2PA 3PRDA 1ZBKA 1ZBVA 1ZL1A 1NMWA 2DT3A 3B9AA 1B6CA 3KAFA 3JYMA 4AY1A 1GPFA 5HUAA 3FY1A 1HXVA 4MTVA 1ROTA 2DT1A 2A3EA 1W26A 1XRVA 3WQWA 4U84A 1FKKA 2A3BA 5HW6A 4P8XA 1ZBWA 1E6RA 1HJXA 1YW5A 2ZR5A 1WAWA 3IKDA 4DWSA 1RD6A 1ROUA 1E44A 1GRJA 2F21A 2M2AA 1D7IA 3B7XA 2B5UB 2PBCA 3CGMA 4JFJA 3NI6A 4DWSC 4URIA 2FAPA 1NWTA 3CHFA 3ODKA 5HT1A 3WD3A 4DRPA 2AWGA 4Q22A 5J6EA 4JYSA 1TCOC 1KFWA 1FKJA 2FKEA 4NSBA 4DIPA 1ZB5A 1W1TA 1P5QA 4LGXA 2XP7A 3UF8A 4JFMA 1GUVA 4P8VA 1JNSA 2F2DA 1W1VA 2PV3A 1HKIA 1U79A 2MPHA 2QF8A 4ZPWR 3TCZA 2F4EA 4MNKA 5B8IC 1QPFA 3ARPA 3VAWA 2MLZA 4IQ2A 2KI3A 2RUQA 4DRNA 2PV1A 1XHGA 4ODRA 1WNOA 2OFNA 4R5EA 1H0IA 3KCEA 3ARQA 4HBEA 3CZ8A 4U85A 3O5EA 1UR9A 1NWSA 1Q1CA 1OGGA 5I98A 3ARTA 4DRJA 2XP3A 4QIBA 1HJVA 5HTGA 3NTPA 3ARUA 3KAGA 1TFVA 2DG4A 1D7JA 1E6NA 4UDMA 3PRAA 4DRKA 5GQBA 3UQBA 3KAIA 3LUOA 4ODOA 1FFRA 2RUCA 2G41A 4NNRA 3AS2A 3OA5A 1C9HA 2A3AA 3RM4A 4U86A 3KACA 4Z2IA 2A3CA 2XPBA 4QT3A 2LJ4A 3EY6A 1LQ0A 1LL4A 4WKFA 3WL1A 1Q6UA 2RURA 3RMEA 3RM8A 3IKGA 3O5IA 2VN1A 1X6NA 4HARA 3ARZA 1PBKA 1KT1A 4DRMA 2KGJA 3KZ7A 2DT2A 3GU0A 3H9RB 4MNMA 3G6MA 2O92A 4IPXA 4ODLA 2ZR6A 3RM9A 4XAKA 2DT0A 2IF4A 1W9UA 1F8AB 1J6YA 3PR9A 2KO7A 2ZQTA 1EDQA 2RUDA 2F23A 2JZVA 1QPLA 4J4NA 1OGBA 2P4VA 3B9EA 2DSWA 4Z2JA 4ML4A 4ZS6A 2DG3A 3AQUA 3TDBA 3QOKA 2O9OA 3NRKA 1W1YA 3ALFA 4N19A 2N87A 2IUZA 3GPKA 3WD2A 3TC5A 5D75A 3UI5A 4PTMA 2PV2A 1D7HA 4HBOA 1KT0A 3CH9A 1GOIA 4WKAA 1PINA 4ODPA 4WK9A 1FKFA 4GIVA 3WKZA 4L72B 5GPGA 5HKGA 4S3KA 1O6IA 1WB0A 3AS0A 1FKDA 3ARYA 3G6LA 3WIJA 1FJDA 5HWBA 2LKNA 1FKLA 2ZQVA 2MLYA 4W9PA 1HJWA 1JVWA 1CTNA 2K8IA 3O5KA 1SYTA 3CHCA 4ZPVR 1JCHB 2EULA 4LAVA 2PI6A 2MNTA 3FXYA 1A7XA 3ARSA 4TNSA 2AOSA 1FD9A 4DWSD 1K9TA 4TW7A 3ARWA 3O5MA 4TW6A 1NWUA 4Z2LA 4MAVA 1ITXA 1FKIA 4Z2HA 3ARVA 2KR7A 1FKSA 3WD1A 1H0GA 4TW8A 2XP5A 1Y0OA 4G50A 3UI4A 1JNEA 4MGVA 2B31A 4MNJA 2PPPA 5HW8A 4DH0A 2ITKA 1HKMA 4MNLA 3KABA 4DRHA 1E6ZA 1LG1A 4Z2GA 4BF8A 4MSPA 5JH8A 2WLZA 4QZVB 1F40A 4O2TA 2UZ5A 3AS1A 3B9DA 5BXJA 2D9FA 1LG2A 1VF8A 1JNDA 4P8WA 4DT4A 1J4RA 2LPVA 5DITA 1X6LA 3IHZA 3UI6A 3CGNA 4JFIA 3O5GA 2MF9A 1SR0A 4DRIA 5HBFA 5HWCA 2KFWA 2OLHA 2YBTA 3WL0A 4KQZA 3JXVA 2YBUA 1W9VA 3O5JA 4TYOA 1EHNA 3WD4A 3CHDA 4DZ3A 3FAPA 3O5FA 5DEZA 3WQVA 4QT2A 4C02B 2Q5AA 4LAXA 1FKRA 1ZK6A 4IT6A 4ODQA 4ODMA 2FDMA 1T11A 1LL7A 1EYMA 1W9PA 1JNTA 2DSVA 3ARRA 3MDYB 4FAPA 4WKHA 1NH6A 2DSZA 1W1PA 4R0XA 2XP9A 1FKHA 3O5RA 2WLYA 2XP4A 1E9LA 4W9QA 1OWQA 1FKBA 4W5UA 4LAYA 3GTYX 1UR8A 1BL4A 4DWSB 1HKJA 4Z2KA 1D6OA 1YATA 3UQIA 1NSGA 4ZPTR 1LJYA 1Q6HA 1ZU8A 4Q7NA 3OOBA 1FFQA 3PRBA 2RQSA 4WIWA 3B8SA 2XP8A
chains in the Genus database with same CATH topology
4ODKA 1Q6IA 1IX5A 3BXWA 1J4HA 2LGOA 2PPOA 4P8UA 5DO2A 4NZCA 2PPNA 3AROA 3RFWA 2DSUA 4JFLA 3UQAA 4IQCA 4L3NA 1J4IA 1FKGA 2RSEA 3W4RA 2WM0A 3KADA 4DROA 2MLXA 4J4OA 4ODNA 1FAPA 2M08A 3O5PA 2ESCA 1FKTA 4JFKA 2Y78A 1HKKA 1E6PA 1ZBCA 2VCDA 1QZ2A 3ALGA 2L2SA 4WJXA 1NWRA 2DG9A 3I6CA 4TX0A 4DRQA 1M5YA 4S3JA 1R9HA 4KR0B 3CHEA 3O5LA 2ZQUA 1LL6A 4ITZA 2DPEA 1ZCNA 2XP6A 1D2KA 5HW7A 5DF0A 4MPKA 5DIVA 2G8ZA 1BKFA 1N1AA 3AS3A 3PA7A 3O5QA 3RGCA 1EIBA 3O5OA 4IT4A 5DIUA 3KAHA 2WK2A 2KE0A 2ZQSA 4FN2A 2ZR4A 3ARXA 4LAWA 3JYJA 4W9OA 3WH0A 2M1IA 2XPAA 1NMVA 4DZ2A 4GGQA 1E15A 3WD0A 1L1PA 1EQ3A 3IK8A 3O5DA 5GPRA 4G2PA 3PRDA 1ZBKA 1ZBVA 1ZL1A 1NMWA 2DT3A 3B9AA 1B6CA 3KAFA 3JYMA 4AY1A 1GPFA 5HUAA 3FY1A 1HXVA 4MTVA 1ROTA 2DT1A 2A3EA 1W26A 1XRVA 3WQWA 4U84A 1FKKA 2A3BA 5HW6A 4P8XA 1ZBWA 1E6RA 1HJXA 1YW5A 2ZR5A 1WAWA 3IKDA 4DWSA 1RD6A 1ROUA 2F21A 2M2AA 1D7IA 3B7XA 3CGMA 2PBCA 4JFJA 3NI6A 4DWSC 4URIA 2FAPA 1NWTA 3CHFA 3ODKA 5HT1A 3WD3A 4DRPA 2AWGA 4Q22A 5J6EA 4JYSA 1TCOC 1KFWA 1FKJA 2FKEA 4NSBA 4DIPA 1ZB5A 1W1TA 1P5QA 4LGXA 2XP7A 3UF8A 4JFMA 1GUVA 4P8VA 1JNSA 2F2DA 1W1VA 2PV3A 1HKIA 1U79A 2MPHA 2QF8A 4ZPWR 3TCZA 2F4EA 4MNKA 5B8IC 1QPFA 3ARPA 3VAWA 2MLZA 4IQ2A 2KI3A 2RUQA 4DRNA 2PV1A 1XHGA 4ODRA 1WNOA 2OFNA 4R5EA 1H0IA 3KCEA 3ARQA 4HBEA 3CZ8A 4U85A 3O5EA 1UR9A 1NWSA 1Q1CA 1OGGA 5I98A 3ARTA 4DRJA 2XP3A 4QIBA 1HJVA 5HTGA 3NTPA 3ARUA 3KAGA 1TFVA 2DG4A 1D7JA 1E6NA 4DRKA 3PRAA 5GQBA 3UQBA 3KAIA 3LUOA 4ODOA 1FFRA 2RUCA 2G41A 4NNRA 3AS2A 3OA5A 1C9HA 2A3AA 3RM4A 4U86A 3KACA 4Z2IA 2A3CA 2XPBA 4QT3A 2LJ4A 3EY6A 1LQ0A 1LL4A 4WKFA 3WL1A 1Q6UA 2RURA 3RMEA 3RM8A 3IKGA 3O5IA 2VN1A 1X6NA 4HARA 3ARZA 1PBKA 1KT1A 4DRMA 2KGJA 3KZ7A 2DT2A 3H9RB 4MNMA 3G6MA 2O92A 4IPXA 4ODLA 2ZR6A 3RM9A 4XAKA 2DT0A 2IF4A 1W9UA 1F8AB 1J6YA 3PR9A 2KO7A 2ZQTA 1EDQA 2RUDA 2JZVA 1QPLA 4J4NA 1OGBA 3B9EA 2DSWA 4Z2JA 4ML4A 4ZS6A 2DG3A 3AQUA 3TDBA 3QOKA 2O9OA 3NRKA 1W1YA 3ALFA 4N19A 2N87A 2IUZA 3GPKA 3WD2A 3TC5A 5D75A 3UI5A 4PTMA 2PV2A 1D7HA 4HBOA 1KT0A 3CH9A 1GOIA 4WKAA 1PINA 4ODPA 4WK9A 1FKFA 4GIVA 3WKZA 4L72B 5GPGA 5HKGA 4S3KA 1O6IA 1WB0A 3AS0A 1FKDA 3ARYA 3G6LA 3WIJA 1FJDA 5HWBA 2LKNA 1FKLA 2ZQVA 2MLYA 4W9PA 1HJWA 1JVWA 1CTNA 2K8IA 3O5KA 1SYTA 3CHCA 4ZPVR 4LAVA 2PI6A 2MNTA 3FXYA 1A7XA 3ARSA 4TNSA 2AOSA 1FD9A 4DWSD 1K9TA 4TW7A 3ARWA 3O5MA 4TW6A 1NWUA 4Z2LA 4MAVA 1ITXA 1FKIA 4Z2HA 3ARVA 2KR7A 1FKSA 3WD1A 1H0GA 4TW8A 2XP5A 1Y0OA 4G50A 3UI4A 1JNEA 4MGVA 2B31A 4MNJA 2PPPA 5HW8A 4DH0A 2ITKA 1HKMA 4MNLA 3KABA 4DRHA 1E6ZA 1LG1A 4Z2GA 4BF8A 4MSPA 5JH8A 2WLZA 4QZVB 1F40A 4O2TA 2UZ5A 3AS1A 3B9DA 5BXJA 2D9FA 1LG2A 1VF8A 1JNDA 4P8WA 4DT4A 1J4RA 2LPVA 5DITA 1X6LA 3IHZA 3UI6A 3CGNA 4JFIA 3O5GA 2MF9A 1SR0A 4DRIA 5HBFA 5HWCA 2KFWA 2OLHA 2YBTA 3WL0A 4KQZA 3JXVA 2YBUA 1W9VA 3O5JA 4TYOA 1EHNA 3WD4A 3CHDA 4DZ3A 3FAPA 3O5FA 5DEZA 3WQVA 4QT2A 4C02B 2Q5AA 4LAXA 1FKRA 1ZK6A 4IT6A 4ODQA 4ODMA 2FDMA 1T11A 1LL7A 1EYMA 1W9PA 1JNTA 2DSVA 3ARRA 3MDYB 4FAPA 4WKHA 1NH6A 2DSZA 1W1PA 4R0XA 2XP9A 1FKHA 3O5RA 2WLYA 2XP4A 1E9LA 4W9QA 1OWQA 1FKBA 4W5UA 4LAYA 1UR8A 1BL4A 4DWSB 1HKJA 4Z2KA 1D6OA 1YATA 3UQIA 1NSGA 4ZPTR 1LJYA 1Q6HA 1ZU8A 4Q7NA 3OOBA 1FFQA 3PRBA 2RQSA 4WIWA 3B8SA 2XP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZ7 A;  3IKD A;  4ODK A;  1Q6I A;  1FD9 A;  3H9R B;  1J4H A;  1ROU A;  2LGO A;  4TW7 A;  4IPX A;  2PPO A;  4ODL A;  2ZR6 A;  2F21 A;  2PPN A;  3O5M A;  2M2A A;  1D7I A;  3B7X A;  3CGM A;  2PBC A;  4JFJ A;  4TW6 A;  3RFW A;  2IF4 A;  4JFL A;  3NI6 A;  3UQA A;  4IQC A;  1J4I A;  1FKI A;  1F8A B;  1FKG A;  2RSE A;  1J6Y A;  2FAP A;  2KR7 A;  3KAD A;  4DRO A;  2MLX A;  1FKS A;  4J4O A;  3ODK A;  4ODN A;  1FAP A;  2M08 A;  2KO7 A;  5HT1 A;  3O5P A;  2ZQT A;  4TW8 A;  1FKT A;  1Y0O A;  2XP5 A;  2AWG A;  2Y78 A;  4G50 A;  2RUD A;  4JFK A;  4MGV A;  2JZV A;  4TNS A;  3UI4 A;  4JYS A;  5J6E A;  1TCO C;  2PPP A;  2FKE A;  1FKJ A;  1QPL A;  5HW8 A;  4DH0 A;  4J4N A;  2ITK A;  2VCD A;  4DIP A;  1QZ2 A;  2L2S A;  1P5Q A;  3KAB A;  2DG9 A;  3I6C A;  2XP7 A;  4TX0 A;  3UF8 A;  4DRQ A;  4BF8 A;  4JFM A;  4DRH A;  1JNS A;  4MSP A;  2F2D A;  2DG3 A;  1M5Y A;  4O2T A;  1F40 A;  3TDB A;  2PV3 A;  2UZ5 A;  1R9H A;  1U79 A;  2MPH A;  3NRK A;  3O5L A;  5BXJ A;  2D9F A;  3UQB A;  4N19 A;  2ZQU A;  2N87 A;  3GPK A;  4DT4 A;  1J4R A;  2LPV A;  4ITZ A;  2F4E A;  5DIT A;  3IHZ A;  3TCZ A;  5D75 A;  3CGN A;  3TC5 A;  3UI6 A;  1QPF A;  3UI5 A;  1ZCN A;  4JFI A;  5B8I C;  3O5G A;  2MF9 A;  4DRI A;  2XP6 A;  2KFW A;  1D7H A;  2PV2 A;  5HW7 A;  5HWC A;  1KT0 A;  3VAW A;  2MLZ A;  4IQ2 A;  2KI3 A;  2RUQ A;  5DIV A;  1PIN A;  2PV1 A;  4DRN A;  4ODR A;  3JXV A;  1BKF A;  2OFN A;  1N1A A;  3PA7 A;  3KCE A;  3O5J A;  4ODP A;  4TYO A;  3O5Q A;  4U85 A;  3RGC A;  3O5E A;  1Q1C A;  1FKF A;  4DZ3 A;  4GIV A;  3FAP A;  3O5F A;  5I98 A;  3O5O A;  4DRJ A;  4QT2 A;  4C02 B;  2XP3 A;  4QIB A;  3KAH A;  2Q5A A;  4LAX A;  5DIU A;  5GPG A;  2KE0 A;  2ZQS A;  5HKG A;  3NTP A;  1ZK6 A;  5HTG A;  1FKR A;  4DRP A;  3KAG A;  2DG4 A;  4ODQ A;  1T11 A;  2ZR4 A;  1D7J A;  1EYM A;  4FN2 A;  4LAW A;  4ODM A;  1JNT A;  3JYJ A;  4DRK A;  2KGJ A;  3KAI A;  3LUO A;  4ODO A;  1FKD A;  4W9O A;  2M1I A;  3MDY B;  2XPA A;  1NMV A;  4DZ2 A;  4FAP A;  4GGQ A;  2RUC A;  1FJD A;  1L1P A;  5HWB A;  1EQ3 A;  4R0X A;  3IK8 A;  2XP9 A;  3O5D A;  4NNR A;  1FKH A;  3O5R A;  2LKN A;  4G2P A;  3PRD A;  1FKL A;  2XP4 A;  2ZQV A;  1NMW A;  2MLY A;  4W9P A;  4W9Q A;  3KAF A;  1B6C A;  1C9H A;  1JVW A;  3JYM A;  1FKB A;  4LAY A;  4U86 A;  5HUA A;  3KAC A;  1BL4 A;  2K8I A;  1HXV A;  3O5K A;  1ROT A;  2XPB A;  1D6O A;  1YAT A;  2LJ4 A;  1NSG A;  4QT3 A;  3UQI A;  3EY6 A;  1Q6U A;  2RUR A;  1Q6H A;  1W26 A;  3IKG A;  3O5I A;  2VN1 A;  1FKK A;  4LAV A;  4U84 A;  3OOB A;  5HW6 A;  2MNT A;  3PRB A;  4DRM A;  1PBK A;  1A7X A;  1KT1 A;  2RQS A;  3WH0 A;  2XP8 A;  1YW5 A;  2ZR5 A; 
#chains in the Genus database with same CATH topology
 4ODK A;  1Q6I A;  1IX5 A;  3BXW A;  1J4H A;  2LGO A;  2PPO A;  4P8U A;  5DO2 A;  4NZC A;  2PPN A;  3ARO A;  3RFW A;  2DSU A;  4JFL A;  3UQA A;  4IQC A;  4L3N A;  1J4I A;  1FKG A;  2RSE A;  3W4R A;  2WM0 A;  3KAD A;  4DRO A;  2MLX A;  4J4O A;  4ODN A;  1FAP A;  2M08 A;  3O5P A;  2ESC A;  1FKT A;  4JFK A;  2Y78 A;  1HKK A;  1E6P A;  1ZBC A;  2VCD A;  1QZ2 A;  3ALG A;  2L2S A;  4WJX A;  1NWR A;  2DG9 A;  2PN0 A;  3I6C A;  4TX0 A;  4DRQ A;  1M5Y A;  4S3J A;  1R9H A;  4KR0 B;  3CHE A;  3O5L A;  2ZQU A;  1LL6 A;  4ITZ A;  3EIP A;  2DPE A;  1ZCN A;  2XP6 A;  1D2K A;  5HW7 A;  5DF0 A;  4MPK A;  5DIV A;  2G8Z A;  1BKF A;  1N1A A;  3AS3 A;  3PA7 A;  3O5Q A;  3RGC A;  1EIB A;  3O5O A;  4IT4 A;  5DIU A;  3KAH A;  2WK2 A;  2KE0 A;  2ZQS A;  3BMB A;  4FN2 A;  2ZR4 A;  3ARX A;  4LAW A;  3JYJ A;  2ETN A;  4W9O A;  3WH0 A;  2M1I A;  2XPA A;  1NMV A;  4DZ2 A;  4GGQ A;  1E15 A;  3WD0 A;  1L1P A;  1EQ3 A;  3IK8 A;  3O5D A;  5GPR A;  4G2P A;  3PRD A;  1ZBK A;  1ZBV A;  1ZL1 A;  1NMW A;  2DT3 A;  3B9A A;  1B6C A;  3KAF A;  3JYM A;  4AY1 A;  1GPF A;  5HUA A;  3FY1 A;  1HXV A;  4MTV A;  1ROT A;  2DT1 A;  2A3E A;  1W26 A;  1XRV A;  3WQW A;  4U84 A;  1FKK A;  2A3B A;  5HW6 A;  4P8X A;  1ZBW A;  1E6R A;  1HJX A;  1YW5 A;  2ZR5 A;  1WAW A;  3IKD A;  4DWS A;  1RD6 A;  1ROU A;  1E44 A;  1GRJ A;  2F21 A;  2M2A A;  1D7I A;  3B7X A;  2B5U B;  2PBC A;  3CGM A;  4JFJ A;  3NI6 A;  4DWS C;  4URI A;  2FAP A;  1NWT A;  3CHF A;  3ODK A;  5HT1 A;  3WD3 A;  4DRP A;  2AWG A;  4Q22 A;  5J6E A;  4JYS A;  1TCO C;  1KFW A;  1FKJ A;  2FKE A;  4NSB A;  4DIP A;  1ZB5 A;  1W1T A;  1P5Q A;  4LGX A;  2XP7 A;  3UF8 A;  4JFM A;  1GUV A;  4P8V A;  1JNS A;  2F2D A;  1W1V A;  2PV3 A;  1HKI A;  1U79 A;  2MPH A;  2QF8 A;  4ZPW R;  3TCZ A;  2F4E A;  4MNK A;  5B8I C;  1QPF A;  3ARP A;  3VAW A;  2MLZ A;  4IQ2 A;  2KI3 A;  2RUQ A;  4DRN A;  2PV1 A;  1XHG A;  4ODR A;  1WNO A;  2OFN A;  4R5E A;  1H0I A;  3KCE A;  3ARQ A;  4HBE A;  3CZ8 A;  4U85 A;  3O5E A;  1UR9 A;  1NWS A;  1Q1C A;  1OGG A;  5I98 A;  3ART A;  4DRJ A;  2XP3 A;  4QIB A;  1HJV A;  5HTG A;  3NTP A;  3ARU A;  3KAG A;  1TFV A;  2DG4 A;  1D7J A;  1E6N A;  4UDM A;  3PRA A;  4DRK A;  5GQB A;  3UQB A;  3KAI A;  3LUO A;  4ODO A;  1FFR A;  2RUC A;  2G41 A;  4NNR A;  3AS2 A;  3OA5 A;  1C9H A;  2A3A A;  3RM4 A;  4U86 A;  3KAC A;  4Z2I A;  2A3C A;  2XPB A;  4QT3 A;  2LJ4 A;  3EY6 A;  1LQ0 A;  1LL4 A;  4WKF A;  3WL1 A;  1Q6U A;  2RUR A;  3RME A;  3RM8 A;  3IKG A;  3O5I A;  2VN1 A;  1X6N A;  4HAR A;  3ARZ A;  1PBK A;  1KT1 A;  4DRM A;  2KGJ A;  3KZ7 A;  2DT2 A;  3GU0 A;  3H9R B;  4MNM A;  3G6M A;  2O92 A;  4IPX A;  4ODL A;  2ZR6 A;  3RM9 A;  4XAK A;  2DT0 A;  2IF4 A;  1W9U A;  1F8A B;  1J6Y A;  3PR9 A;  2KO7 A;  2ZQT A;  1EDQ A;  2RUD A;  2F23 A;  2JZV A;  1QPL A;  4J4N A;  1OGB A;  2P4V A;  3B9E A;  2DSW A;  4Z2J A;  4ML4 A;  4ZS6 A;  2DG3 A;  3AQU A;  3TDB A;  3QOK A;  2O9O A;  3NRK A;  1W1Y A;  3ALF A;  4N19 A;  2N87 A;  2IUZ A;  3GPK A;  3WD2 A;  3TC5 A;  5D75 A;  3UI5 A;  4PTM A;  2PV2 A;  1D7H A;  4HBO A;  1KT0 A;  3CH9 A;  1GOI A;  4WKA A;  1PIN A;  4ODP A;  4WK9 A;  1FKF A;  4GIV A;  3WKZ A;  4L72 B;  5GPG A;  5HKG A;  4S3K A;  1O6I A;  1WB0 A;  3AS0 A;  1FKD A;  3ARY A;  3G6L A;  3WIJ A;  1FJD A;  5HWB A;  2LKN A;  1FKL A;  2ZQV A;  2MLY A;  4W9P A;  1HJW A;  1JVW A;  1CTN A;  2K8I A;  3O5K A;  1SYT A;  3CHC A;  4ZPV R;  1JCH B;  2EUL A;  4LAV A;  2PI6 A;  2MNT A;  3FXY A;  1A7X A;  3ARS A;  4TNS A;  2AOS A;  1FD9 A;  4DWS D;  1K9T A;  4TW7 A;  3ARW A;  3O5M A;  4TW6 A;  1NWU A;  4Z2L A;  4MAV A;  1ITX A;  1FKI A;  4Z2H A;  3ARV A;  2KR7 A;  1FKS A;  3WD1 A;  1H0G A;  4TW8 A;  2XP5 A;  1Y0O A;  4G50 A;  3UI4 A;  1JNE A;  4MGV A;  2B31 A;  4MNJ A;  2PPP A;  5HW8 A;  4DH0 A;  2ITK A;  1HKM A;  4MNL A;  3KAB A;  4DRH A;  1E6Z A;  1LG1 A;  4Z2G A;  4BF8 A;  4MSP A;  5JH8 A;  2WLZ A;  4QZV B;  1F40 A;  4O2T A;  2UZ5 A;  3AS1 A;  3B9D A;  5BXJ A;  2D9F A;  1LG2 A;  1VF8 A;  1JND A;  4P8W A;  4DT4 A;  1J4R A;  2LPV A;  5DIT A;  1X6L A;  3IHZ A;  3UI6 A;  3CGN A;  4JFI A;  3O5G A;  2MF9 A;  1SR0 A;  4DRI A;  5HBF A;  5HWC A;  2KFW A;  2OLH A;  2YBT A;  3WL0 A;  4KQZ A;  3JXV A;  2YBU A;  1W9V A;  3O5J A;  4TYO A;  1EHN A;  3WD4 A;  3CHD A;  4DZ3 A;  3FAP A;  3O5F A;  5DEZ A;  3WQV A;  4QT2 A;  4C02 B;  2Q5A A;  4LAX A;  1FKR A;  1ZK6 A;  4IT6 A;  4ODQ A;  4ODM A;  2FDM A;  1T11 A;  1LL7 A;  1EYM A;  1W9P A;  1JNT A;  2DSV A;  3ARR A;  3MDY B;  4FAP A;  4WKH A;  1NH6 A;  2DSZ A;  1W1P A;  4R0X A;  2XP9 A;  1FKH A;  3O5R A;  2WLY A;  2XP4 A;  1E9L A;  4W9Q A;  1OWQ A;  1FKB A;  4W5U A;  4LAY A;  3GTY X;  1UR8 A;  1BL4 A;  4DWS B;  1HKJ A;  4Z2K A;  1D6O A;  1YAT A;  3UQI A;  1NSG A;  4ZPT R;  1LJY A;  1Q6H A;  1ZU8 A;  4Q7N A;  3OOB A;  1FFQ A;  3PRB A;  2RQS A;  4WIW A;  3B8S A;  2XP8 A; 
#chains in the Genus database with same CATH homology
 4ODK A;  1Q6I A;  1IX5 A;  3BXW A;  1J4H A;  2LGO A;  2PPO A;  4P8U A;  5DO2 A;  4NZC A;  2PPN A;  3ARO A;  3RFW A;  2DSU A;  4JFL A;  3UQA A;  4IQC A;  4L3N A;  1J4I A;  1FKG A;  2RSE A;  3W4R A;  2WM0 A;  3KAD A;  4DRO A;  2MLX A;  4J4O A;  4ODN A;  1FAP A;  2M08 A;  3O5P A;  2ESC A;  1FKT A;  4JFK A;  2Y78 A;  1HKK A;  1E6P A;  1ZBC A;  2VCD A;  1QZ2 A;  3ALG A;  2L2S A;  4WJX A;  1NWR A;  2DG9 A;  3I6C A;  4TX0 A;  4DRQ A;  1M5Y A;  4S3J A;  1R9H A;  4KR0 B;  3CHE A;  3O5L A;  2ZQU A;  1LL6 A;  4ITZ A;  2DPE A;  1ZCN A;  2XP6 A;  1D2K A;  5HW7 A;  5DF0 A;  4MPK A;  5DIV A;  2G8Z A;  1BKF A;  1N1A A;  3AS3 A;  3PA7 A;  3O5Q A;  3RGC A;  1EIB A;  3O5O A;  4IT4 A;  5DIU A;  3KAH A;  2WK2 A;  2KE0 A;  2ZQS A;  4FN2 A;  2ZR4 A;  3ARX A;  4LAW A;  3JYJ A;  4W9O A;  3WH0 A;  2M1I A;  2XPA A;  1NMV A;  4DZ2 A;  4GGQ A;  1E15 A;  3WD0 A;  1L1P A;  1EQ3 A;  3IK8 A;  3O5D A;  5GPR A;  4G2P A;  3PRD A;  1ZBK A;  1ZBV A;  1ZL1 A;  1NMW A;  2DT3 A;  3B9A A;  1B6C A;  3KAF A;  3JYM A;  4AY1 A;  1GPF A;  5HUA A;  3FY1 A;  1HXV A;  4MTV A;  1ROT A;  2DT1 A;  2A3E A;  1W26 A;  1XRV A;  3WQW A;  4U84 A;  1FKK A;  2A3B A;  5HW6 A;  4P8X A;  1ZBW A;  1E6R A;  1HJX A;  1YW5 A;  2ZR5 A;  1WAW A;  3IKD A;  4DWS A;  1RD6 A;  1ROU A;  2F21 A;  2M2A A;  1D7I A;  3B7X A;  3CGM A;  2PBC A;  4JFJ A;  3NI6 A;  4DWS C;  4URI A;  2FAP A;  1NWT A;  3CHF A;  3ODK A;  5HT1 A;  3WD3 A;  4DRP A;  2AWG A;  4Q22 A;  5J6E A;  4JYS A;  1TCO C;  1KFW A;  1FKJ A;  2FKE A;  4NSB A;  4DIP A;  1ZB5 A;  1W1T A;  1P5Q A;  4LGX A;  2XP7 A;  3UF8 A;  4JFM A;  1GUV A;  4P8V A;  1JNS A;  2F2D A;  1W1V A;  2PV3 A;  1HKI A;  1U79 A;  2MPH A;  2QF8 A;  4ZPW R;  3TCZ A;  2F4E A;  4MNK A;  5B8I C;  1QPF A;  3ARP A;  3VAW A;  2MLZ A;  4IQ2 A;  2KI3 A;  2RUQ A;  4DRN A;  2PV1 A;  1XHG A;  4ODR A;  1WNO A;  2OFN A;  4R5E A;  1H0I A;  3KCE A;  3ARQ A;  4HBE A;  3CZ8 A;  4U85 A;  3O5E A;  1UR9 A;  1NWS A;  1Q1C A;  1OGG A;  5I98 A;  3ART A;  4DRJ A;  2XP3 A;  4QIB A;  1HJV A;  5HTG A;  3NTP A;  3ARU A;  3KAG A;  1TFV A;  2DG4 A;  1D7J A;  1E6N A;  4DRK A;  3PRA A;  5GQB A;  3UQB A;  3KAI A;  3LUO A;  4ODO A;  1FFR A;  2RUC A;  2G41 A;  4NNR A;  3AS2 A;  3OA5 A;  1C9H A;  2A3A A;  3RM4 A;  4U86 A;  3KAC A;  4Z2I A;  2A3C A;  2XPB A;  4QT3 A;  2LJ4 A;  3EY6 A;  1LQ0 A;  1LL4 A;  4WKF A;  3WL1 A;  1Q6U A;  2RUR A;  3RME A;  3RM8 A;  3IKG A;  3O5I A;  2VN1 A;  1X6N A;  4HAR A;  3ARZ A;  1PBK A;  1KT1 A;  4DRM A;  2KGJ A;  3KZ7 A;  2DT2 A;  3H9R B;  4MNM A;  3G6M A;  2O92 A;  4IPX A;  4ODL A;  2ZR6 A;  3RM9 A;  4XAK A;  2DT0 A;  2IF4 A;  1W9U A;  1F8A B;  1J6Y A;  3PR9 A;  2KO7 A;  2ZQT A;  1EDQ A;  2RUD A;  2JZV A;  1QPL A;  4J4N A;  1OGB A;  3B9E A;  2DSW A;  4Z2J A;  4ML4 A;  4ZS6 A;  2DG3 A;  3AQU A;  3TDB A;  3QOK A;  2O9O A;  3NRK A;  1W1Y A;  3ALF A;  4N19 A;  2N87 A;  2IUZ A;  3GPK A;  3WD2 A;  3TC5 A;  5D75 A;  3UI5 A;  4PTM A;  2PV2 A;  1D7H A;  4HBO A;  1KT0 A;  3CH9 A;  1GOI A;  4WKA A;  1PIN A;  4ODP A;  4WK9 A;  1FKF A;  4GIV A;  3WKZ A;  4L72 B;  5GPG A;  5HKG A;  4S3K A;  1O6I A;  1WB0 A;  3AS0 A;  1FKD A;  3ARY A;  3G6L A;  3WIJ A;  1FJD A;  5HWB A;  2LKN A;  1FKL A;  2ZQV A;  2MLY A;  4W9P A;  1HJW A;  1JVW A;  1CTN A;  2K8I A;  3O5K A;  1SYT A;  3CHC A;  4ZPV R;  4LAV A;  2PI6 A;  2MNT A;  3FXY A;  1A7X A;  3ARS A;  4TNS A;  2AOS A;  1FD9 A;  4DWS D;  1K9T A;  4TW7 A;  3ARW A;  3O5M A;  4TW6 A;  1NWU A;  4Z2L A;  4MAV A;  1ITX A;  1FKI A;  4Z2H A;  3ARV A;  2KR7 A;  1FKS A;  3WD1 A;  1H0G A;  4TW8 A;  2XP5 A;  1Y0O A;  4G50 A;  3UI4 A;  1JNE A;  4MGV A;  2B31 A;  4MNJ A;  2PPP A;  5HW8 A;  4DH0 A;  2ITK A;  1HKM A;  4MNL A;  3KAB A;  4DRH A;  1E6Z A;  1LG1 A;  4Z2G A;  4BF8 A;  4MSP A;  5JH8 A;  2WLZ A;  4QZV B;  1F40 A;  4O2T A;  2UZ5 A;  3AS1 A;  3B9D A;  5BXJ A;  2D9F A;  1LG2 A;  1VF8 A;  1JND A;  4P8W A;  4DT4 A;  1J4R A;  2LPV A;  5DIT A;  1X6L A;  3IHZ A;  3UI6 A;  3CGN A;  4JFI A;  3O5G A;  2MF9 A;  1SR0 A;  4DRI A;  5HBF A;  5HWC A;  2KFW A;  2OLH A;  2YBT A;  3WL0 A;  4KQZ A;  3JXV A;  2YBU A;  1W9V A;  3O5J A;  4TYO A;  1EHN A;  3WD4 A;  3CHD A;  4DZ3 A;  3FAP A;  3O5F A;  5DEZ A;  3WQV A;  4QT2 A;  4C02 B;  2Q5A A;  4LAX A;  1FKR A;  1ZK6 A;  4IT6 A;  4ODQ A;  4ODM A;  2FDM A;  1T11 A;  1LL7 A;  1EYM A;  1W9P A;  1JNT A;  2DSV A;  3ARR A;  3MDY B;  4FAP A;  4WKH A;  1NH6 A;  2DSZ A;  1W1P A;  4R0X A;  2XP9 A;  1FKH A;  3O5R A;  2WLY A;  2XP4 A;  1E9L A;  4W9Q A;  1OWQ A;  1FKB A;  4W5U A;  4LAY A;  1UR8 A;  1BL4 A;  4DWS B;  1HKJ A;  4Z2K A;  1D6O A;  1YAT A;  3UQI A;  1NSG A;  4ZPT R;  1LJY A;  1Q6H A;  1ZU8 A;  4Q7N A;  3OOB A;  1FFQ A;  3PRB A;  2RQS A;  4WIW A;  3B8S A;  2XP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...