5HW7A

Candida albicans fkbp12 apo protein in p21212 space group
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
122
structure length
122
Chain Sequence
EELPQIEIVQEGDNTTFAKPGDTVTIHYDGKLTNGKEFDSSRKRGKPFTCTVGVGQVIKGWDISLTNNYGKGGANLPKISKGTKAILTIPPNLAYGPRGIPPIIGPNETLVFEVELLGVNGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida albicans (strain sc5314 / atcc mya-2876)
molecule tags Isomerase
molecule keywords FK506-binding protein 1
total genus 28
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5hw7A00
2OFNA 3RGCA 3O5FA 3UQBA 4DRPA 2PPNA 4DRHA 1Q6IA 2M08A 4JFJA 4MGVA 2KI3A 4DRNA 5HW8A 3IKGA 4QT3A 2RUDA 1KT0A 1ROTA 2ZR4A 1FKHA 3H9RB 4W9QA 4DIPA 3TCZA 1D6OA 2MPHA 1NMWA 3JXVA 4C02B 1FD9A 3JYMA 2VN1A 4ODKA 2FKEA 4ODQA 5I98A 1R9HA 1J4HA 2DG9A 2MF9A 3LUOA 3PRDA 4GGQA 5BXJA 1J4RA 1QZ2A 1F40A 2PV2A 2Q5AA 3O5RA 2ZQSA 1ROUA 4ODOA 1FJDA 4DRIA 5HKGA 4ITZA 5HUAA 1FKGA 1L1PA 3O5KA 1A7XA 3O5MA 2MLXA 4BF8A 4DRKA 4ODMA 2PV3A 3CGMA 4W9PA 3UI5A 5HW7A 1T11A 2XP6A 2ZQUA 1ZCNA 2RUQA 3O5PA 4J4OA 4QT2A 5GPGA 2RURA 2RSEA 1U79A 3ODKA 3UF8A 2XP8A 5HTGA 1FKJA 1Q1CA 1N1AA 4JYSA 1P5QA 3PRBA 4W9OA 4DZ3A 1BKFA 5J6EA 4G2PA 2KR7A 3B7XA 4TW7A 4DT4A 1NMVA 3UI6A 1FKTA 3WH0A 1ZK6A 1FKBA 2PBCA 2LGOA 2Y78A 2F21A 3RFWA 2ZR5A 3UQAA 2PPOA 1J4IA 2XPBA 3NI6A 4JFKA 4JFMA 3O5EA 3O5IA 4U86A 1YATA 1JVWA 3KACA 2AWGA 2KFWA 2PPPA 3NTPA 1FKFA 2ITKA 2MLZA 2F2DA 1NSGA 3KAGA 3KZ7A 4FN2A 1BL4A 1D7HA 3I6CA 4LAWA 1D7IA 4ODRA 2MNTA 4DRQA 3VAWA 3OOBA 2DG4A 2FAPA 3KABA 5D75A 1JNTA 5DIVA 1HXVA 1FKRA 2ZR6A 3KAHA 2XP5A 4O2TA 2VCDA 4ODLA 3JYJA 3KADA 4U85A 2RUCA 5DITA 2MLYA 4IPXA 2UZ5A 4ODNA 4DZ2A 2N87A 1FAPA 5HWBA 4JFIA 1QPFA 4G50A 4FAPA 1PINA 5HW6A 5HWCA 2KO7A 1F8AB 1B6CA 2ZQTA 2M2AA 1Q6UA 2RQSA 3KAFA 2XPAA 2XP4A 1W26A 3KCEA 3O5DA 3PA7A 1KT1A 3UQIA 2KGJA 3CGNA 2LKNA 2K8IA 3IHZA 4NNRA 1M5YA 2LPVA 1Y0OA 4TX0A 1C9HA 2KE0A 3TDBA 4DH0A 3KAIA 1EQ3A 1EYMA 1QPLA 4TW6A 1FKLA 1FKDA 4DROA 1D7JA 4R0XA 3EY6A 2IF4A 4IQ2A 2PV1A 4N19A 5B8IC 2M1IA 3O5OA 1JNSA 1FKSA 4U84A 3GPKA 3NRKA 4J4NA 4TW8A 4LAYA 1J6YA 3O5LA 2L2SA 4DRJA 3IKDA 4QIBA 3O5QA 3FAPA 5DIUA 1FKIA 3IK8A 2JZVA 2F4EA 2D9FA 4GIVA 5HT1A 4ODPA 3O5GA 1PBKA 1FKKA 2LJ4A 4LAXA 2XP9A 2XP3A 4IQCA 2ZQVA 4TYOA 3UI4A 4JFLA 4MSPA 4LAVA 1Q6HA 3TC5A 2XP7A 1YW5A 1TCOC 3MDYB 4TNSA 2DG3A 3O5JA 4DRMA
chains in the Genus database with same CATH superfamily
1E6NA 2OLHA 4DRHA 3IKGA 4Z2IA 1ROTA 1H0IA 1HKJA 1FD9A 3JYMA 2VN1A 4ODKA 2FKEA 4NSBA 2DG9A 2P4VA 2ZQSA 4ODOA 4AY1A 3OA5A 1D2KA 5HKGA 5HUAA 1L1PA 4WKAA 4S3JA 2MLXA 4BF8A 4QT2A 4MNMA 2RURA 3UF8A 1Q1CA 1P5QA 3ARQA 4G2PA 4W5UA 3CHEA 3RMEA 1NMVA 1UR9A 3PR9A 1FKBA 2B31A 2Y78A 3AS0A 1E9LA 1JNDA 3O5IA 2AOSA 1HKIA 2AWGA 2PPPA 1FKFA 4FN2A 4ODRA 2MNTA 2WK2A 1E44A 3RM8A 2ZR6A 1HKKA 2A3CA 4ODLA 2PN0A 4ODNA 2PI6A 4DZ2A 1FAPA 1W9UA 5HWBA 4JFIA 3ALGA 4DWSB 1GPFA 3GU0A 1GOIA 1Q6UA 2XP4A 1TFVA 1M5YA 4DWSA 1Y0OA 4TX0A 1C9HA 3TDBA 1W1TA 4WK9A 4R0XA 1LJYA 1WAWA 4N19A 5B8IC 2F23A 4J4NA 1XRVA 1GUVA 3IKDA 2QF8A 1OGGA 1FFQA 1FKKA 1X6NA 3B8SA 3B9AA 4MSPA 1K9TA 2XP7A 3CZ8A 2DG3A 3O5JA 4DRMA 4DRKA 1LL4A 3G6MA 3UQBA 1LL6A 1JNEA 2PPNA 3G6LA 2KI3A 5HW8A 4QT3A 1E6ZA 1ZU8A 2RUDA 1FKHA 4Q7NA 4DIPA 3TCZA 1NMWA 4ODQA 1R9HA 2YBUA 1J4HA 3LUOA 3PRDA 4GGQA 1J4RA 3WD0A 2PV2A 1ROUA 2DT2A 1FKGA 1CTNA 3O5KA 4MNJA 5DF0A 1A7XA 3WD3A 2PV3A 4WKFA 4W9PA 3UI5A 1T11A 4J4OA 3RM4A 4TNSA 1N1AA 3PRBA 3QOKA 4W9OA 4TW7A 1W9PA 4LGXA 5JH8A 3WQWA 2PBCA 2PPOA 4JFMA 3WL0A 3W4RA 3KACA 2FDMA 3CHDA 4MPKA 2MLZA 1NSGA 3EIPA 1BL4A 5GQBA 4URIA 3VAWA 1NH6A 2DG4A 3KABA 1JCHB 1JNTA 3ARYA 1HXVA 3WKZA 5DITA 1VF8A 2N87A 2ESCA 1ITXA 4HARA 1QPFA 1HKMA 5HWCA 1ZBWA 1ZL1A 4IT6A 2DPEA 3KAFA 3O5DA 3PA7A 1EQ3A 1W26A 2DT3A 1KT1A 1XHGA 2DSWA 1W1YA 4L3NA 1QPLA 4L72B 2O92A 1FKLA 1D7JA 5GPRA 2G8ZA 2PV1A 2M1IA 4LAYA 4Q22A 1X6LA 3O5LA 4MTVA 2L2SA 4NZCA 4Z2GA 3O5QA 3WD1A 5DIUA 3BMBA 2B5UB 2JZVA 2F4EA 4Z2KA 2G41A 1W1VA 4MNLA 2LJ4A 2ZQVA 4IT4A 1SR0A 4P8UA 4P8VA 4LAVA 1NWSA 3CHCA 4DRPA 4JFJA 1EIBA 4MAVA 4MNKA 2ZR4A 1KT0A 3H9RB 4W9QA 3JXVA 4DWSD 3B9DA 4C02B 4ML4A 5I98A 3AS2A 2MF9A 3ARVA 5BXJA 1ZBVA 5DO2A 3O5RA 4P8WA 1ZB5A 1EDQA 1FJDA 3ARWA 4ITZA 3O5MA 4ODMA 5HW7A 2ZQUA 1ZCNA 2A3BA 2RSEA 1U79A 1FKJA 1BKFA 3B7XA 2YBTA 4HBEA 4DT4A 3FY1A 3UI6A 1FKTA 4Z2HA 1ZK6A 2LGOA 2F21A 2ZR5A 1J4IA 2XPBA 3ALFA 4JFKA 1SYTA 3O5EA 4U86A 1YATA 3WD4A 1FFRA 2KFWA 4NNRA 3NTPA 3KZ7A 2IUZA 4WJXA 2F2DA 3KAGA 1E6PA 2DSUA 2DSVA 1D7HA 1NWRA 5D75A 1H0GA 2XP5A 4O2TA 2VCDA 2RUCA 3AS1A 2MLYA 4HBOA 4IPXA 4FAPA 1PINA 5HW6A 2KO7A 2A3AA 3ARTA 1WNOA 1B6CA 2M2AA 2RQSA 4ZPVR 3IHZA 3WQVA 1HJWA 2KE0A 4DH0A 3KAIA 1EYMA 3RM9A 4DROA 1FKDA 3EY6A 2IF4A 1JNSA 4U84A 4ZPWR 3GPKA 2WLZA 4DRJA 2A3EA 4QIBA 1FKIA 4ODPA 3ARZA 1UR8A 1PBKA 1HJXA 2O9OA 2XP3A 4IQCA 1HJVA 1NWTA 3UI4A 4R5EA 3AQUA 3TC5A 1YW5A 1TCOC 1GRJA 3B9EA 1KFWA 2OFNA 3RGCA 3O5FA 4S3KA 3FXYA 1O6IA 1Q6IA 2M08A 4MGVA 2DSZA 3CHFA 4DRNA 3GTYX 1EHNA 1D6OA 2MPHA 4ZPTR 1ZBKA 3ARUA 1QZ2A 1F40A 2Q5AA 3ARSA 3ARPA 4P8XA 4DRIA 4Z2JA 4UDMA 3CGMA 4QZVB 2WM0A 2XP6A 3O5PA 2RUQA 5GPGA 3ODKA 2XP8A 5HTGA 4JYSA 4XAKA 5HBFA 1OGBA 1E15A 4DZ3A 4DWSC 3AROA 4KR0B 5J6EA 2KR7A 3ARXA 2EULA 4PTMA 3WH0A 2DT1A 3RFWA 3UQAA 3NI6A 2ETNA 4KQZA 4ZS6A 1JVWA 1W9VA 2ITKA 3I6CA 4LAWA 1D7IA 1LG1A 4DRQA 3OOBA 2FAPA 1LQ0A 1FKRA 3KAHA 5DIVA 4U85A 1LL7A 3JYJA 3KADA 2UZ5A 1ZBCA 2DT0A 3ARRA 4G50A 1F8AB 2ZQTA 3PRAA 3BXWA 3UQIA 2XPAA 3KCEA 2KGJA 1E6RA 3CGNA 2LKNA 2K8IA 3AS3A 2LPVA 3CH9A 3WD2A 4TW6A 1WB0A 1IX5A 2WLYA 3WL1A 4IQ2A 3O5OA 1FKSA 4Z2LA 3NRKA 4TW8A 1J6YA 3WIJA 5DEZA 3FAPA 3IK8A 1RD6A 2D9FA 4GIVA 5HT1A 4WKHA 3O5GA 4LAXA 2XP9A 1NWUA 4WIWA 4TYOA 4JFLA 1W1PA 1Q6HA 3MDYB 1LG2A 1OWQA
chains in the Genus database with same CATH topology
1E6NA 2OLHA 4DRHA 3IKGA 4Z2IA 1ROTA 1H0IA 1HKJA 1FD9A 3JYMA 2VN1A 4ODKA 2FKEA 4NSBA 2DG9A 2ZQSA 4ODOA 4AY1A 3OA5A 1D2KA 5HKGA 5HUAA 1L1PA 4WKAA 4S3JA 2MLXA 4BF8A 4QT2A 4MNMA 2RURA 3UF8A 1Q1CA 1P5QA 3ARQA 4G2PA 4W5UA 3CHEA 3RMEA 1NMVA 1UR9A 3PR9A 1FKBA 2B31A 2Y78A 3AS0A 1E9LA 1JNDA 3O5IA 2AOSA 1HKIA 2AWGA 2PPPA 1FKFA 4FN2A 4ODRA 2MNTA 2WK2A 3RM8A 2ZR6A 1HKKA 2A3CA 4ODLA 4ODNA 2PI6A 4DZ2A 1FAPA 1W9UA 5HWBA 4JFIA 3ALGA 4DWSB 1GPFA 1GOIA 1Q6UA 2XP4A 1TFVA 1M5YA 4DWSA 1Y0OA 4TX0A 1C9HA 3TDBA 1W1TA 4WK9A 4R0XA 1LJYA 1WAWA 4N19A 5B8IC 4J4NA 1XRVA 1GUVA 3IKDA 2QF8A 1OGGA 1FFQA 1FKKA 1X6NA 3B8SA 3B9AA 4MSPA 1K9TA 2XP7A 3CZ8A 2DG3A 3O5JA 4DRMA 4DRKA 1LL4A 3G6MA 3UQBA 1LL6A 1JNEA 2PPNA 3G6LA 2KI3A 5HW8A 4QT3A 1E6ZA 1ZU8A 2RUDA 1FKHA 4Q7NA 4DIPA 3TCZA 1NMWA 4ODQA 1R9HA 2YBUA 1J4HA 3LUOA 3PRDA 4GGQA 1J4RA 3WD0A 2PV2A 1ROUA 2DT2A 1FKGA 1CTNA 3O5KA 4MNJA 5DF0A 1A7XA 3WD3A 2PV3A 4WKFA 4W9PA 3UI5A 1T11A 4J4OA 3RM4A 4TNSA 1N1AA 3PRBA 3QOKA 4W9OA 4TW7A 1W9PA 4LGXA 5JH8A 3WQWA 2PBCA 2PPOA 4JFMA 3WL0A 3W4RA 3KACA 2FDMA 3CHDA 4MPKA 2MLZA 1NSGA 1BL4A 5GQBA 4URIA 3VAWA 1NH6A 2DG4A 3KABA 1JNTA 3ARYA 1HXVA 3WKZA 5DITA 1VF8A 2N87A 2ESCA 1ITXA 4HARA 1QPFA 1HKMA 5HWCA 1ZBWA 1ZL1A 4IT6A 2DPEA 3KAFA 3O5DA 3PA7A 1EQ3A 1W26A 2DT3A 1KT1A 1XHGA 2DSWA 1W1YA 4L3NA 1QPLA 4L72B 2O92A 1FKLA 1D7JA 5GPRA 2G8ZA 2PV1A 2M1IA 4LAYA 4Q22A 1X6LA 3O5LA 4MTVA 2L2SA 4NZCA 4Z2GA 3O5QA 3WD1A 5DIUA 2JZVA 2F4EA 4Z2KA 2G41A 1W1VA 4MNLA 2LJ4A 2ZQVA 4IT4A 1SR0A 4P8UA 4P8VA 4LAVA 1NWSA 3CHCA 4DRPA 4JFJA 1EIBA 4MAVA 4MNKA 2ZR4A 1KT0A 3H9RB 4W9QA 3JXVA 4DWSD 3B9DA 4C02B 4ML4A 5I98A 3AS2A 2MF9A 3ARVA 5BXJA 1ZBVA 5DO2A 3O5RA 4P8WA 1ZB5A 1EDQA 1FJDA 3ARWA 4ITZA 3O5MA 4ODMA 5HW7A 2ZQUA 1ZCNA 2A3BA 2RSEA 1U79A 1FKJA 1BKFA 3B7XA 2YBTA 4HBEA 4DT4A 3FY1A 3UI6A 1FKTA 4Z2HA 1ZK6A 2LGOA 2F21A 2ZR5A 1J4IA 2XPBA 3ALFA 4JFKA 1SYTA 3O5EA 4U86A 1YATA 3WD4A 1FFRA 2KFWA 4NNRA 3NTPA 3KZ7A 2IUZA 4WJXA 2F2DA 3KAGA 1E6PA 2DSUA 2DSVA 1D7HA 1NWRA 5D75A 1H0GA 2XP5A 4O2TA 2VCDA 2RUCA 3AS1A 2MLYA 4HBOA 4IPXA 4FAPA 1PINA 5HW6A 2KO7A 2A3AA 3ARTA 1WNOA 1B6CA 2M2AA 2RQSA 4ZPVR 3IHZA 3WQVA 1HJWA 2KE0A 4DH0A 3KAIA 1EYMA 3RM9A 4DROA 1FKDA 3EY6A 2IF4A 1JNSA 4U84A 4ZPWR 3GPKA 2WLZA 4DRJA 2A3EA 4QIBA 1FKIA 4ODPA 3ARZA 1UR8A 1PBKA 1HJXA 2O9OA 2XP3A 4IQCA 1HJVA 1NWTA 3UI4A 4R5EA 3AQUA 3TC5A 1YW5A 1TCOC 3B9EA 1KFWA 2OFNA 3RGCA 3O5FA 4S3KA 3FXYA 1O6IA 1Q6IA 2M08A 4MGVA 2DSZA 3CHFA 4DRNA 1EHNA 1D6OA 2MPHA 4ZPTR 1ZBKA 3ARUA 1QZ2A 1F40A 2Q5AA 3ARSA 3ARPA 4P8XA 4DRIA 4Z2JA 3CGMA 4QZVB 2WM0A 2XP6A 3O5PA 2RUQA 5GPGA 3ODKA 2XP8A 5HTGA 4JYSA 4XAKA 5HBFA 1OGBA 1E15A 4DZ3A 4DWSC 3AROA 4KR0B 5J6EA 2KR7A 3ARXA 4PTMA 3WH0A 2DT1A 3RFWA 3UQAA 3NI6A 4KQZA 4ZS6A 1JVWA 1W9VA 2ITKA 3I6CA 4LAWA 1D7IA 1LG1A 4DRQA 3OOBA 2FAPA 1LQ0A 1FKRA 3KAHA 5DIVA 4U85A 1LL7A 3JYJA 3KADA 2UZ5A 1ZBCA 2DT0A 3ARRA 4G50A 1F8AB 2ZQTA 3PRAA 3BXWA 3UQIA 2XPAA 3KCEA 2KGJA 1E6RA 3CGNA 2LKNA 2K8IA 3AS3A 2LPVA 3CH9A 3WD2A 4TW6A 1WB0A 1IX5A 2WLYA 3WL1A 4IQ2A 3O5OA 1FKSA 4Z2LA 3NRKA 4TW8A 1J6YA 3WIJA 5DEZA 3FAPA 3IK8A 1RD6A 2D9FA 4GIVA 5HT1A 4WKHA 3O5GA 4LAXA 2XP9A 1NWUA 4WIWA 4TYOA 4JFLA 1W1PA 1Q6HA 3MDYB 1LG2A 1OWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OFN A;  3RGC A;  3O5F A;  3UQB A;  4DRP A;  2PPN A;  4DRH A;  1Q6I A;  2M08 A;  4JFJ A;  4MGV A;  2KI3 A;  4DRN A;  5HW8 A;  3IKG A;  4QT3 A;  2RUD A;  1KT0 A;  1ROT A;  2ZR4 A;  1FKH A;  3H9R B;  4W9Q A;  4DIP A;  3TCZ A;  1D6O A;  2MPH A;  1NMW A;  3JXV A;  4C02 B;  1FD9 A;  3JYM A;  2VN1 A;  4ODK A;  2FKE A;  4ODQ A;  5I98 A;  1R9H A;  1J4H A;  2DG9 A;  2MF9 A;  3LUO A;  3PRD A;  4GGQ A;  5BXJ A;  1J4R A;  1QZ2 A;  1F40 A;  2PV2 A;  2Q5A A;  3O5R A;  2ZQS A;  1ROU A;  4ODO A;  1FJD A;  4DRI A;  5HKG A;  4ITZ A;  5HUA A;  1FKG A;  1L1P A;  3O5K A;  1A7X A;  3O5M A;  2MLX A;  4BF8 A;  4DRK A;  4ODM A;  2PV3 A;  3CGM A;  4W9P A;  3UI5 A;  5HW7 A;  1T11 A;  2XP6 A;  2ZQU A;  1ZCN A;  2RUQ A;  3O5P A;  4J4O A;  4QT2 A;  5GPG A;  2RUR A;  2RSE A;  1U79 A;  3ODK A;  3UF8 A;  2XP8 A;  5HTG A;  1FKJ A;  1Q1C A;  1N1A A;  4JYS A;  1P5Q A;  3PRB A;  4W9O A;  4DZ3 A;  1BKF A;  5J6E A;  4G2P A;  2KR7 A;  3B7X A;  4TW7 A;  4DT4 A;  1NMV A;  3UI6 A;  1FKT A;  3WH0 A;  1ZK6 A;  1FKB A;  2PBC A;  2LGO A;  2Y78 A;  2F21 A;  3RFW A;  2ZR5 A;  3UQA A;  2PPO A;  1J4I A;  2XPB A;  3NI6 A;  4JFK A;  4JFM A;  3O5E A;  3O5I A;  4U86 A;  1YAT A;  1JVW A;  3KAC A;  2AWG A;  2KFW A;  2PPP A;  3NTP A;  1FKF A;  2ITK A;  2MLZ A;  2F2D A;  1NSG A;  3KAG A;  3KZ7 A;  4FN2 A;  1BL4 A;  1D7H A;  3I6C A;  4LAW A;  1D7I A;  4ODR A;  2MNT A;  4DRQ A;  3VAW A;  3OOB A;  2DG4 A;  2FAP A;  3KAB A;  5D75 A;  1JNT A;  5DIV A;  1HXV A;  1FKR A;  2ZR6 A;  3KAH A;  2XP5 A;  4O2T A;  2VCD A;  4ODL A;  3JYJ A;  3KAD A;  4U85 A;  2RUC A;  5DIT A;  2MLY A;  4IPX A;  2UZ5 A;  4ODN A;  4DZ2 A;  2N87 A;  1FAP A;  5HWB A;  4JFI A;  1QPF A;  4G50 A;  4FAP A;  1PIN A;  5HW6 A;  5HWC A;  2KO7 A;  1F8A B;  1B6C A;  2ZQT A;  2M2A A;  1Q6U A;  2RQS A;  3KAF A;  2XPA A;  2XP4 A;  1W26 A;  3KCE A;  3O5D A;  3PA7 A;  1KT1 A;  3UQI A;  2KGJ A;  3CGN A;  2LKN A;  2K8I A;  3IHZ A;  4NNR A;  1M5Y A;  2LPV A;  1Y0O A;  4TX0 A;  1C9H A;  2KE0 A;  3TDB A;  4DH0 A;  3KAI A;  1EQ3 A;  1EYM A;  1QPL A;  4TW6 A;  1FKL A;  1FKD A;  4DRO A;  1D7J A;  4R0X A;  3EY6 A;  2IF4 A;  4IQ2 A;  2PV1 A;  4N19 A;  5B8I C;  2M1I A;  3O5O A;  1JNS A;  1FKS A;  4U84 A;  3GPK A;  3NRK A;  4J4N A;  4TW8 A;  4LAY A;  1J6Y A;  3O5L A;  2L2S A;  4DRJ A;  3IKD A;  4QIB A;  3O5Q A;  3FAP A;  5DIU A;  1FKI A;  3IK8 A;  2JZV A;  2F4E A;  2D9F A;  4GIV A;  5HT1 A;  4ODP A;  3O5G A;  1PBK A;  1FKK A;  2LJ4 A;  4LAX A;  2XP9 A;  2XP3 A;  4IQC A;  2ZQV A;  4TYO A;  3UI4 A;  4JFL A;  4MSP A;  4LAV A;  1Q6H A;  3TC5 A;  2XP7 A;  1YW5 A;  1TCO C;  3MDY B;  4TNS A;  2DG3 A;  3O5J A;  4DRM A; 
#chains in the Genus database with same CATH topology
 1E6N A;  2OLH A;  4DRH A;  3IKG A;  4Z2I A;  1ROT A;  1H0I A;  1HKJ A;  1FD9 A;  3JYM A;  2VN1 A;  4ODK A;  2FKE A;  4NSB A;  2DG9 A;  2P4V A;  2ZQS A;  4ODO A;  4AY1 A;  3OA5 A;  1D2K A;  5HKG A;  5HUA A;  1L1P A;  4WKA A;  4S3J A;  2MLX A;  4BF8 A;  4QT2 A;  4MNM A;  2RUR A;  3UF8 A;  1Q1C A;  1P5Q A;  3ARQ A;  4G2P A;  4W5U A;  3CHE A;  3RME A;  1NMV A;  1UR9 A;  3PR9 A;  1FKB A;  2B31 A;  2Y78 A;  3AS0 A;  1E9L A;  1JND A;  3O5I A;  2AOS A;  1HKI A;  2AWG A;  2PPP A;  1FKF A;  4FN2 A;  4ODR A;  2MNT A;  2WK2 A;  1E44 A;  3RM8 A;  2ZR6 A;  1HKK A;  2A3C A;  4ODL A;  2PN0 A;  4ODN A;  2PI6 A;  4DZ2 A;  1FAP A;  1W9U A;  5HWB A;  4JFI A;  3ALG A;  4DWS B;  1GPF A;  3GU0 A;  1GOI A;  1Q6U A;  2XP4 A;  1TFV A;  1M5Y A;  4DWS A;  1Y0O A;  4TX0 A;  1C9H A;  3TDB A;  1W1T A;  4WK9 A;  4R0X A;  1LJY A;  1WAW A;  4N19 A;  5B8I C;  2F23 A;  4J4N A;  1XRV A;  1GUV A;  3IKD A;  2QF8 A;  1OGG A;  1FFQ A;  1FKK A;  1X6N A;  3B8S A;  3B9A A;  4MSP A;  1K9T A;  2XP7 A;  3CZ8 A;  2DG3 A;  3O5J A;  4DRM A;  4DRK A;  1LL4 A;  3G6M A;  3UQB A;  1LL6 A;  1JNE A;  2PPN A;  3G6L A;  2KI3 A;  5HW8 A;  4QT3 A;  1E6Z A;  1ZU8 A;  2RUD A;  1FKH A;  4Q7N A;  4DIP A;  3TCZ A;  1NMW A;  4ODQ A;  1R9H A;  2YBU A;  1J4H A;  3LUO A;  3PRD A;  4GGQ A;  1J4R A;  3WD0 A;  2PV2 A;  1ROU A;  2DT2 A;  1FKG A;  1CTN A;  3O5K A;  4MNJ A;  5DF0 A;  1A7X A;  3WD3 A;  2PV3 A;  4WKF A;  4W9P A;  3UI5 A;  1T11 A;  4J4O A;  3RM4 A;  4TNS A;  1N1A A;  3PRB A;  3QOK A;  4W9O A;  4TW7 A;  1W9P A;  4LGX A;  5JH8 A;  3WQW A;  2PBC A;  2PPO A;  4JFM A;  3WL0 A;  3W4R A;  3KAC A;  2FDM A;  3CHD A;  4MPK A;  2MLZ A;  1NSG A;  3EIP A;  1BL4 A;  5GQB A;  4URI A;  3VAW A;  1NH6 A;  2DG4 A;  3KAB A;  1JCH B;  1JNT A;  3ARY A;  1HXV A;  3WKZ A;  5DIT A;  1VF8 A;  2N87 A;  2ESC A;  1ITX A;  4HAR A;  1QPF A;  1HKM A;  5HWC A;  1ZBW A;  1ZL1 A;  4IT6 A;  2DPE A;  3KAF A;  3O5D A;  3PA7 A;  1EQ3 A;  1W26 A;  2DT3 A;  1KT1 A;  1XHG A;  2DSW A;  1W1Y A;  4L3N A;  1QPL A;  4L72 B;  2O92 A;  1FKL A;  1D7J A;  5GPR A;  2G8Z A;  2PV1 A;  2M1I A;  4LAY A;  4Q22 A;  1X6L A;  3O5L A;  4MTV A;  2L2S A;  4NZC A;  4Z2G A;  3O5Q A;  3WD1 A;  5DIU A;  3BMB A;  2B5U B;  2JZV A;  2F4E A;  4Z2K A;  2G41 A;  1W1V A;  4MNL A;  2LJ4 A;  2ZQV A;  4IT4 A;  1SR0 A;  4P8U A;  4P8V A;  4LAV A;  1NWS A;  3CHC A;  4DRP A;  4JFJ A;  1EIB A;  4MAV A;  4MNK A;  2ZR4 A;  1KT0 A;  3H9R B;  4W9Q A;  3JXV A;  4DWS D;  3B9D A;  4C02 B;  4ML4 A;  5I98 A;  3AS2 A;  2MF9 A;  3ARV A;  5BXJ A;  1ZBV A;  5DO2 A;  3O5R A;  4P8W A;  1ZB5 A;  1EDQ A;  1FJD A;  3ARW A;  4ITZ A;  3O5M A;  4ODM A;  5HW7 A;  2ZQU A;  1ZCN A;  2A3B A;  2RSE A;  1U79 A;  1FKJ A;  1BKF A;  3B7X A;  2YBT A;  4HBE A;  4DT4 A;  3FY1 A;  3UI6 A;  1FKT A;  4Z2H A;  1ZK6 A;  2LGO A;  2F21 A;  2ZR5 A;  1J4I A;  2XPB A;  3ALF A;  4JFK A;  1SYT A;  3O5E A;  4U86 A;  1YAT A;  3WD4 A;  1FFR A;  2KFW A;  4NNR A;  3NTP A;  3KZ7 A;  2IUZ A;  4WJX A;  2F2D A;  3KAG A;  1E6P A;  2DSU A;  2DSV A;  1D7H A;  1NWR A;  5D75 A;  1H0G A;  2XP5 A;  4O2T A;  2VCD A;  2RUC A;  3AS1 A;  2MLY A;  4HBO A;  4IPX A;  4FAP A;  1PIN A;  5HW6 A;  2KO7 A;  2A3A A;  3ART A;  1WNO A;  1B6C A;  2M2A A;  2RQS A;  4ZPV R;  3IHZ A;  3WQV A;  1HJW A;  2KE0 A;  4DH0 A;  3KAI A;  1EYM A;  3RM9 A;  4DRO A;  1FKD A;  3EY6 A;  2IF4 A;  1JNS A;  4U84 A;  4ZPW R;  3GPK A;  2WLZ A;  4DRJ A;  2A3E A;  4QIB A;  1FKI A;  4ODP A;  3ARZ A;  1UR8 A;  1PBK A;  1HJX A;  2O9O A;  2XP3 A;  4IQC A;  1HJV A;  1NWT A;  3UI4 A;  4R5E A;  3AQU A;  3TC5 A;  1YW5 A;  1TCO C;  1GRJ A;  3B9E A;  1KFW A;  2OFN A;  3RGC A;  3O5F A;  4S3K A;  3FXY A;  1O6I A;  1Q6I A;  2M08 A;  4MGV A;  2DSZ A;  3CHF A;  4DRN A;  3GTY X;  1EHN A;  1D6O A;  2MPH A;  4ZPT R;  1ZBK A;  3ARU A;  1QZ2 A;  1F40 A;  2Q5A A;  3ARS A;  3ARP A;  4P8X A;  4DRI A;  4Z2J A;  4UDM A;  3CGM A;  4QZV B;  2WM0 A;  2XP6 A;  3O5P A;  2RUQ A;  5GPG A;  3ODK A;  2XP8 A;  5HTG A;  4JYS A;  4XAK A;  5HBF A;  1OGB A;  1E15 A;  4DZ3 A;  4DWS C;  3ARO A;  4KR0 B;  5J6E A;  2KR7 A;  3ARX A;  2EUL A;  4PTM A;  3WH0 A;  2DT1 A;  3RFW A;  3UQA A;  3NI6 A;  2ETN A;  4KQZ A;  4ZS6 A;  1JVW A;  1W9V A;  2ITK A;  3I6C A;  4LAW A;  1D7I A;  1LG1 A;  4DRQ A;  3OOB A;  2FAP A;  1LQ0 A;  1FKR A;  3KAH A;  5DIV A;  4U85 A;  1LL7 A;  3JYJ A;  3KAD A;  2UZ5 A;  1ZBC A;  2DT0 A;  3ARR A;  4G50 A;  1F8A B;  2ZQT A;  3PRA A;  3BXW A;  3UQI A;  2XPA A;  3KCE A;  2KGJ A;  1E6R A;  3CGN A;  2LKN A;  2K8I A;  3AS3 A;  2LPV A;  3CH9 A;  3WD2 A;  4TW6 A;  1WB0 A;  1IX5 A;  2WLY A;  3WL1 A;  4IQ2 A;  3O5O A;  1FKS A;  4Z2L A;  3NRK A;  4TW8 A;  1J6Y A;  3WIJ A;  5DEZ A;  3FAP A;  3IK8 A;  1RD6 A;  2D9F A;  4GIV A;  5HT1 A;  4WKH A;  3O5G A;  4LAX A;  2XP9 A;  1NWU A;  4WIW A;  4TYO A;  4JFL A;  1W1P A;  1Q6H A;  3MDY B;  1LG2 A;  1OWQ A; 
#chains in the Genus database with same CATH homology
 1E6N A;  2OLH A;  4DRH A;  3IKG A;  4Z2I A;  1ROT A;  1H0I A;  1HKJ A;  1FD9 A;  3JYM A;  2VN1 A;  4ODK A;  2FKE A;  4NSB A;  2DG9 A;  2ZQS A;  4ODO A;  4AY1 A;  3OA5 A;  1D2K A;  5HKG A;  5HUA A;  1L1P A;  4WKA A;  4S3J A;  2MLX A;  4BF8 A;  4QT2 A;  4MNM A;  2RUR A;  3UF8 A;  1Q1C A;  1P5Q A;  3ARQ A;  4G2P A;  4W5U A;  3CHE A;  3RME A;  1NMV A;  1UR9 A;  3PR9 A;  1FKB A;  2B31 A;  2Y78 A;  3AS0 A;  1E9L A;  1JND A;  3O5I A;  2AOS A;  1HKI A;  2AWG A;  2PPP A;  1FKF A;  4FN2 A;  4ODR A;  2MNT A;  2WK2 A;  3RM8 A;  2ZR6 A;  1HKK A;  2A3C A;  4ODL A;  4ODN A;  2PI6 A;  4DZ2 A;  1FAP A;  1W9U A;  5HWB A;  4JFI A;  3ALG A;  4DWS B;  1GPF A;  1GOI A;  1Q6U A;  2XP4 A;  1TFV A;  1M5Y A;  4DWS A;  1Y0O A;  4TX0 A;  1C9H A;  3TDB A;  1W1T A;  4WK9 A;  4R0X A;  1LJY A;  1WAW A;  4N19 A;  5B8I C;  4J4N A;  1XRV A;  1GUV A;  3IKD A;  2QF8 A;  1OGG A;  1FFQ A;  1FKK A;  1X6N A;  3B8S A;  3B9A A;  4MSP A;  1K9T A;  2XP7 A;  3CZ8 A;  2DG3 A;  3O5J A;  4DRM A;  4DRK A;  1LL4 A;  3G6M A;  3UQB A;  1LL6 A;  1JNE A;  2PPN A;  3G6L A;  2KI3 A;  5HW8 A;  4QT3 A;  1E6Z A;  1ZU8 A;  2RUD A;  1FKH A;  4Q7N A;  4DIP A;  3TCZ A;  1NMW A;  4ODQ A;  1R9H A;  2YBU A;  1J4H A;  3LUO A;  3PRD A;  4GGQ A;  1J4R A;  3WD0 A;  2PV2 A;  1ROU A;  2DT2 A;  1FKG A;  1CTN A;  3O5K A;  4MNJ A;  5DF0 A;  1A7X A;  3WD3 A;  2PV3 A;  4WKF A;  4W9P A;  3UI5 A;  1T11 A;  4J4O A;  3RM4 A;  4TNS A;  1N1A A;  3PRB A;  3QOK A;  4W9O A;  4TW7 A;  1W9P A;  4LGX A;  5JH8 A;  3WQW A;  2PBC A;  2PPO A;  4JFM A;  3WL0 A;  3W4R A;  3KAC A;  2FDM A;  3CHD A;  4MPK A;  2MLZ A;  1NSG A;  1BL4 A;  5GQB A;  4URI A;  3VAW A;  1NH6 A;  2DG4 A;  3KAB A;  1JNT A;  3ARY A;  1HXV A;  3WKZ A;  5DIT A;  1VF8 A;  2N87 A;  2ESC A;  1ITX A;  4HAR A;  1QPF A;  1HKM A;  5HWC A;  1ZBW A;  1ZL1 A;  4IT6 A;  2DPE A;  3KAF A;  3O5D A;  3PA7 A;  1EQ3 A;  1W26 A;  2DT3 A;  1KT1 A;  1XHG A;  2DSW A;  1W1Y A;  4L3N A;  1QPL A;  4L72 B;  2O92 A;  1FKL A;  1D7J A;  5GPR A;  2G8Z A;  2PV1 A;  2M1I A;  4LAY A;  4Q22 A;  1X6L A;  3O5L A;  4MTV A;  2L2S A;  4NZC A;  4Z2G A;  3O5Q A;  3WD1 A;  5DIU A;  2JZV A;  2F4E A;  4Z2K A;  2G41 A;  1W1V A;  4MNL A;  2LJ4 A;  2ZQV A;  4IT4 A;  1SR0 A;  4P8U A;  4P8V A;  4LAV A;  1NWS A;  3CHC A;  4DRP A;  4JFJ A;  1EIB A;  4MAV A;  4MNK A;  2ZR4 A;  1KT0 A;  3H9R B;  4W9Q A;  3JXV A;  4DWS D;  3B9D A;  4C02 B;  4ML4 A;  5I98 A;  3AS2 A;  2MF9 A;  3ARV A;  5BXJ A;  1ZBV A;  5DO2 A;  3O5R A;  4P8W A;  1ZB5 A;  1EDQ A;  1FJD A;  3ARW A;  4ITZ A;  3O5M A;  4ODM A;  5HW7 A;  2ZQU A;  1ZCN A;  2A3B A;  2RSE A;  1U79 A;  1FKJ A;  1BKF A;  3B7X A;  2YBT A;  4HBE A;  4DT4 A;  3FY1 A;  3UI6 A;  1FKT A;  4Z2H A;  1ZK6 A;  2LGO A;  2F21 A;  2ZR5 A;  1J4I A;  2XPB A;  3ALF A;  4JFK A;  1SYT A;  3O5E A;  4U86 A;  1YAT A;  3WD4 A;  1FFR A;  2KFW A;  4NNR A;  3NTP A;  3KZ7 A;  2IUZ A;  4WJX A;  2F2D A;  3KAG A;  1E6P A;  2DSU A;  2DSV A;  1D7H A;  1NWR A;  5D75 A;  1H0G A;  2XP5 A;  4O2T A;  2VCD A;  2RUC A;  3AS1 A;  2MLY A;  4HBO A;  4IPX A;  4FAP A;  1PIN A;  5HW6 A;  2KO7 A;  2A3A A;  3ART A;  1WNO A;  1B6C A;  2M2A A;  2RQS A;  4ZPV R;  3IHZ A;  3WQV A;  1HJW A;  2KE0 A;  4DH0 A;  3KAI A;  1EYM A;  3RM9 A;  4DRO A;  1FKD A;  3EY6 A;  2IF4 A;  1JNS A;  4U84 A;  4ZPW R;  3GPK A;  2WLZ A;  4DRJ A;  2A3E A;  4QIB A;  1FKI A;  4ODP A;  3ARZ A;  1UR8 A;  1PBK A;  1HJX A;  2O9O A;  2XP3 A;  4IQC A;  1HJV A;  1NWT A;  3UI4 A;  4R5E A;  3AQU A;  3TC5 A;  1YW5 A;  1TCO C;  3B9E A;  1KFW A;  2OFN A;  3RGC A;  3O5F A;  4S3K A;  3FXY A;  1O6I A;  1Q6I A;  2M08 A;  4MGV A;  2DSZ A;  3CHF A;  4DRN A;  1EHN A;  1D6O A;  2MPH A;  4ZPT R;  1ZBK A;  3ARU A;  1QZ2 A;  1F40 A;  2Q5A A;  3ARS A;  3ARP A;  4P8X A;  4DRI A;  4Z2J A;  3CGM A;  4QZV B;  2WM0 A;  2XP6 A;  3O5P A;  2RUQ A;  5GPG A;  3ODK A;  2XP8 A;  5HTG A;  4JYS A;  4XAK A;  5HBF A;  1OGB A;  1E15 A;  4DZ3 A;  4DWS C;  3ARO A;  4KR0 B;  5J6E A;  2KR7 A;  3ARX A;  4PTM A;  3WH0 A;  2DT1 A;  3RFW A;  3UQA A;  3NI6 A;  4KQZ A;  4ZS6 A;  1JVW A;  1W9V A;  2ITK A;  3I6C A;  4LAW A;  1D7I A;  1LG1 A;  4DRQ A;  3OOB A;  2FAP A;  1LQ0 A;  1FKR A;  3KAH A;  5DIV A;  4U85 A;  1LL7 A;  3JYJ A;  3KAD A;  2UZ5 A;  1ZBC A;  2DT0 A;  3ARR A;  4G50 A;  1F8A B;  2ZQT A;  3PRA A;  3BXW A;  3UQI A;  2XPA A;  3KCE A;  2KGJ A;  1E6R A;  3CGN A;  2LKN A;  2K8I A;  3AS3 A;  2LPV A;  3CH9 A;  3WD2 A;  4TW6 A;  1WB0 A;  1IX5 A;  2WLY A;  3WL1 A;  4IQ2 A;  3O5O A;  1FKS A;  4Z2L A;  3NRK A;  4TW8 A;  1J6Y A;  3WIJ A;  5DEZ A;  3FAP A;  3IK8 A;  1RD6 A;  2D9F A;  4GIV A;  5HT1 A;  4WKH A;  3O5G A;  4LAX A;  2XP9 A;  1NWU A;  4WIW A;  4TYO A;  4JFL A;  1W1P A;  1Q6H A;  3MDY B;  1LG2 A;  1OWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...