4DWSB

Crystal structure of a chitinase from the yersinia entomophaga toxin complex
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
540
structure length
527
Chain Sequence
KPTENIPSPILVEDKYTEETYSRPDVNFKEDGSQGNLSYTATRVCAPMYNHYVGDKTPKLSAYITDWCQYDARLDGGGSKEEERGRGFDLATLMQNPATYDRLIFSFLGICGDIGNSKKVQEVWDGWNAQAPSLGLPQIGGHIVPLDPYGDLGTARNVGLPPESADTSIESGTFLPYYQQNRAAGLLGGLRELQKKAHAMGHKLDLAFSIGGWSLSSYFSALAENPDERRVFVASVVDFFVRFPMFSCVDIDWEYPGGGGDEGNISSDDGENYVLLIELRSALDSRFGYSNREISIACSGVALKSNIDQLVANGLDNIYLMSYDFFGTIWADYIGHHTNLYSPKDPGEQELFDLSAEAAIDYLHNELGIPMEIHLGYANYGRSAVGGDLTTRQYTNGPALGTMENGAPEFFDIVKNYMDAEHSLSMGKNGFVLMTDTNADADFLFSEAKGHFISLDTPRTVKQKGEYAAKNKLGGVFSWSGDQDCGLLANAAREGLGYVADSETIDMGPLYNPGKEIYLKSISEIKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sugar binding protein
molecule keywords Chi2
publication title The BC component of ABC toxins is an RHS-repeat-containing protein encapsulation device.
pubmed doi rcsb
source organism Yersinia entomophaga
total genus 190
structure length 527
sequence length 540
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dwsB01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4dwsB02
4M80A 2AAAA 4GXPA 3AXHA 4U3AA 1OD0A 1ODUA 5BRPA 4AD3A 4D6DA 4OOUA 5EMYA 1E6QM 3AICA 4B16A 1PBGA 3VOCA 2XVPA 3OB8A 2PBGA 2WYSA 4H8VA 1ZB5A 2VJXA 2XG9A 3PTQA 3N15A 3GM8A 1CDGA 3K1DA 1C91A 1C90A 1WDSA 3PTMA 4MNKA 2UY3A 1R7AA 2QMKA 2EPNA 1QNPA 1SFSA 1UWQA 2BY3A 2YL8A 1KGXA 3QHMA 1GW1A 2WZIA 2DGAA 2J25A 1IV8A 1RP8A 1EQPA 3WFLA 3MANA 1GUVA 3L4WA 1VRXA 4W8AA 3TONA 1ECEA 1ZJAA 3W81A 3DYOA 2OWWA 3CH9A 4J3XA 1UR0A 4JCMA 3OZOA 3K46A 4GZIA 1PX3A 4QLJA 4NI3A 4J3WA 2DH2A 3GNRA 1OB0A 1IT0A 1UR8A 1V3KA 3ARWA 3CZJA 4X9YA 2V3DA 3VDBA 2J7CA 3A6OA 3OLGA 4ZXLA 3T09A 1GVYA 1SMAA 4E8DA 3N13A 4F9JA 2VZOA 3CLWA 4C7GA 3O9NA 3ARVA 2NT0A 4PN2A 1DEDA 3DYPA 1WDRA 1WCGA 4UFLA 3SCWA 1LWHA 4CD6A 3AYRA 4PMVA 4NRSA 2VCAA 1EDTA 1EHAA 5LYRA 1DWJM 4OOZA 2WMIA 3BLPX 1OINA 2ZUTA 3NSMA 1G94A 3FNDA 3L2LA 2FDMA 4GZJA 2DT1A 2VZVA 2O9OA 3ZSSA 1F4AA 1E6SM 3SUWA 5D9NA 1DWGM 1HP5A 2XWDA 4ZEPA 2GVYA 3WNNA 2JEPA 4PMZA 4B9ZA 3AOFA 5BCAA 3MMDA 1NWSA 3CUFA 1JGIA 4DM1A 5I3DA 1JI1A 3WF0A 5DEZA 2J4GA 3T08A 1V6VA 5DMYA 5IHSA 1ISXA 2WLYA 1ISWA 2J62A 1WPCA 1VIWA 2VO5A 3IJ9A 2WVSA 4KRTA 1BYCA 2XFRA 4NRRA 2GK1B 1FH9A 1HF6A 4EE9A 3NUKA 3T2QA 2VRJA 3MV01 3WF2A 2CEQA 1Q6DA 2IXVA 1UOKA 5IFTA 3VIGA 2PB1A 1B3VA 1C8QA 3VMPA 1N82A 4XZWA 3ARYA 3CZEA 3VNZA 3B9DA 5D8ZA 1CXEA 5BXRA 2WC4A 4F8XA 1MW1A 4AD5A 2ZWYA 1UQYA 4CCDA 1TG7A 1TZ7A 4KGLA 1FP9A 1H09A 1W3JA 1UWIA 4BQ4A 1NP0A 1AQMA 2WMJA 4AXNA 2O9PA 1XSJA 3UG4A 4AEFA 2ZUUA 2W4XA 3TA9A 4M81A 1J0HA 2DEPA 2YLLA 4V27A 5D9MA 3VIJA 4D6EA 2ZXBA 5IHRA 4M1RA 1RPKA 3W29A 5HBFA 4B3LA 3W6LA 1JYWA 1OCQA 4D6CA 3CZ8A 2JE8A 5LA0A 1V0MA 5JH8A 1GOKA 1C92A 3NSNA 3RJYA 4TOQA 2G8ZA 1HKIA 1XD1A 1JF6A 3VVGA 3RJXA 4KRUA 1E4MM 4D71A 1EO7A 1E4LA 1HJSA 2D2OA 8CGTA 3AYSA 3QOKA 1FOBA 1G5AA 1I1XA 2YA1A 3CUHA 4BQ2A 3WQVA 2Z1SA 3WUBA 4MDOA 1X6NA 2Z1KA 1C3FA 3AMKA 2FGLA 1NOUA 3WEMA 4TXEA 4AD4A 2E8YA 5A95A 3RILA 3II1A 5E09A 2WW5A 4WLCA 2D23A 5GQBA 1TA3B 4J28A 5HPCA 1BVNP 1XH1A 4P7OA 4WJXA 1V3IA 3F5KA 3AXXA 1NQ6A 2CESA 3L4YA 4TTGA 1E43A 1MWOA 2UY2A 3ECQA 1NP2A 3VIOA 1TE1A 2GJXB 1NWUA 1UR9A 3AROA 4E4PA 3SCRA 1XCWA 4PSRA 4TUFA 1VF8A 5BXPA 3POCA 5FKYA 3VIKA 3N04A 2YA2A 1MW3A 4GIAA 1A3HA 4M24A 3VIMA 3VKKA 4UFMA 4UFHA 5ABHA 3U57A 3TP4A 2VX5A 1I75A 4B15A 5A2AA 4MJ2A 3THCA 1MVYA 3PBGA 4FLRA 1HJUA 2VC9A 5CSUA 2W66A 2O92A 2J7EA 3AHYA 1OGSA 3VILA 4P8XA 1VJZA 1BLIA 3OGRA 2Y24A 4OZOA 1GONA 3ZM8A 2XGIA 3WNMA 1OD8A 1X6LA 4MAVA 4MB3A 3WSUA 4JKLA 4YHEA 3O2LA 1KR1A 1B3WA 2X05A 3UESA 3W6MA 1AMYA 1JNEA 5A6SA 3SCUA 3EMCA 4U3CA 2JIEA 3WDHA 2ZXDA 1HN1A 2VR5A 1US2A 3MSGA 2YKKA 2WBKA 4PUDA 1UYQA 4ZE4A 1ESWA 4W88A 4J27A 3T0AA 3MU7A 2WHLA 1UWTA 1CTNA 1WZKA 3MUAA 2VZSA 1HJVA 3CHDA 1WO2A 1EDQA 2C7FA 3WMSA 2RGMA 3OIHA 1RD6A 1UR1A 2XIIA 1MW2A 1XV8A 3VM5A 5A94A 3AZSA 1MFVA 3A47A 1W1TA 2YL5A 1MW0A 4HOXA 2D0FA 1OSEA 3AMGA 3PHAA 2J74A 2J8FA 1NH6A 1VEOA 2AOSA 1ZBWA 3N17A 3FY1A 5IXEA 3CO4A 4W85A 5M5DA 4PMYA 1CGTA 3WH8A 2G3MA 4KH2A 4WK9A 1J0YA 3BXWA 1AVAA 3IK2A 3GXFA 1J10A 1Q6FA 1V02A 3CPUA 1QW9A 1M04A 2E9LA 4Q22A 3W82A 4B9YA 1KGWA 3WIJA 3EDEA 2YBUA 3WH7A 4QLKA 4QAWA 2XIBA 2O9RA 5CGMA 5BRQA 2X1IA 1E6RA 5LA2A 5GNYA 1O6IA 1QNSA 3AIQA 4UNIA 4XZBA 3EYPA 5C70A 5DFAA 4AEEA 1EOMA 4DWSA 3N18A 4JL1A 2WMIB 3T2PA 3B9AA 1H41A 2WMFA 4BZYA 1E56A 1SYTA 3WD2A 3THDA 3ARTA 1YQ2A 1KCKA 1WZAA 2CPUA 4CD8A 3VGGA 5A3HA 3WDPP 3UCQA 2CBIA 3OGVA 3U7VA 3PZVA 3GH7A 2WANA 1E4NA 1HVXA 2XYLA 4W87A 2CKSA 1V08A 4LX4A 1DWAM 1QHOA 4CGTA 2VRKA 1V0NA 4EAMA 5A8MA 3WH9A 4PMXA 1E1FA 4LGXA 2DSUA 1FHDA 3NDZA 2WVVA 1FA2A 4Z2KA 3N1AA 4IM4A 3ALGA 1LG2A 4PMDA 2CIPA 4UCFA 1E6PA 4Q7NA 4ZE5A 4QCFA 3IJ8A 5GNXA 3MUZ1 2ESCA 3ZJ7A 1UZ1A 2FHFA 4W93A 1UA7A 2BV9A 5CPTA 4PMOA 1IZJA 1EO5A 2XVLA 3RIKA 4OUEA 4HZ8A 3OG2A 3BCDA 1UKSA 1GORA 5A69A 1VFMA 9CGTA 3FHQA 2D0GA 1KB3A 1CGXA 2W5FA 5CLWA 3SUSA 4F79A 1UH4A 4OJYA 2BY0A 4QP0A 3PZTA 2QLYA 1R87A 1KXVA 3CHFA 3WKZA 2BVDA 2MANA 2W92A 1DP0A 1G9HA 5CSYA 2DSKA 2CNCA 2WBGA 1OBAA 4GI9A 4ATDA 1MQRA 1UWSA 4BQ3A 1OIMA 2X2YA 5HDRA 5E0FA 3A3HA 3UR8A 3ZQ9A 5FOOA 5BWFA 4AY1A 3W24A 2VOTA 3L4TA 3KEHA 4QDMA 3BAKA 3WDIA 1UKQA 4HU8A 4D6FA 4JFWA 1GQIA 2D3LA 2V3EA 4QLLA 5FL1A 5BXSA 2WHMA 3M07A 3T0DA 4NF7A 1C7SA 1W1YA 4DWSC 3EMZA 1NWTA 2OSYA 4WKAA 4D72A 3SCSA 1J12A 3DECA 4H41A 3WELA 5KZ6A 4LXFA 4KGJA 2EBNA 3GYCA 4UQ9A 4P8VA 2D22A 1WDPA 1KGUA 5CG0A 3WQ8A 3L4XA 4M29A 3AJ7A 3EMQA 1H49A 4HPHA 1JD7A 1PAMA 1JAKA 2DSWA 4FMVA 1J0JA 2EPMX 3A4WA 2VVSA 4P8WA 2CBUA 5EBAA 2DIEA 4YPJA 3WBEA 1PEZA 1BYAA 2D24A 4UQAA 4X0NA 2CCRA 3VM7A 3EDKA 4PCTA 5ABFA 1E70M 4MB1A 4MB4A 5AC5A 3OLEA 1QW8A 5DT5A 3AHXA 1ZL1A 1BYDA 3MUY1 5EFDA 3CTTA 5FD0A 3WF1A 3IJ7A 3EDFA 5DF0A 2ZOXA 3SUTA 1P6WA 1SR0A 1VBUA 1J0KA 2WZEA 3KL0A 3TTQA 5A8OA 5I78A 2BXZA 2ZUNA 3PZ9A 4LYQA 3WMBA 5FCZA 2YL9A 3VGBA 2J7FA 2GJRA 4AZ5A 1OM0A 2BHUA 4UQBA 1J0IA 3AXIA 5I5RA 3PZIA 4F66A 3TOPA 4HZ6A 3GH5A 2DSZA 1JYXA 3IAPA 4WF7A 2WK2A 1G1YA 1W9PA 4C7FA 3AS2A 2PWGA 4WKFA 3E1F1 2YLAA 2D3NA 5EFFA 5D9PA 3PZOA 3RM8A 3CZGA 2NT1A 1WNOA 3UETA 1UD6A 4BA0A 3S2CA 1UWRA 3DHUA 4JFUA 2C0HA 3KZSA 3IANA 1B30A 1BVZA 4AIUA 6A3HA 1E3XA 2JIWA 4JHOA 1CXFA 2BHZA 4CCEA 5AY7A 3MMUA 1W2PA 2J7GA 1HNYA 2F61A 4AWEA 1BG9A 2X8RA 2CBVA 2Y4SA 5KEZA 3AQUA 1LG1A 1UZ4A 2OYMA 3AISA 4HMEA 1E40A 3LPFA 2WKGA 2BY1A 4PTVA 5D8WA 4QCEA 2YIHA 3I3EA 3BC9A 2XTKA 1XHGA 4UR9A 3VD3A 4TVCA 1EDGA 3WQWA 3VMNA 4ML4A 2WCGA 1B0IA 1W9BM 1HKMA 4HOWA 4PMRA 1XC6A 5CGTA 4IUGA 3W53A 4P7NA 4ACZA 1LL7A 4Z2JA 1V3LA 1JF5A 1ZJBA 3MS8A 1ZBCA 1S46A 3WH5A 1W9UA 4YN5A 1UWUA 1UKOA 4ZXOA 1US3A 4S3JA 1C8YA 2F2HA 5HXMA 2D0HA 1LF1A 3CHEA 4DUXA 1W32A 1W91A 2PF0A 3BMWA 1QNQA 3D3AA 1UD8A 5CQ1A 3G6MA 3I3BA 1CGWA 1JXKA 2X0YA 3AI0A 1G01A 4MB5A 3J7HA 4P7QA 3M46A 5CXPA 2XM1A 3WL0A 2BVTA 3SEPA 3PN8A 3UR7A 5EB8A 2YBTA 1BTCA 1E5JA 1VFOA 3VMOA 2XGBA 3HU7A 1VFUA 2Y8KA 1C93A 2ZICA 5F7UA 2XJ7A 4AZGA 4R5EA 1CLXA 1L0PA 2ZUMA 4P7LA 4D6GA 1HJWA 1E1EA 4ATWA 4JL2A 2J47A 2WVVB 2G3JA 3HN3A 1ZBVA 3HMCA 4CU7A 5D9OA 3FXYA 1PIFA 4J3TA 1GOMA 4PCSA 4WSKA 1HKJA 3SCNA 2DT3A 3ZT7A 3FAWA 4TVDA 2ZE0A 1E15A 4PTWA 2PWFA 1D7FA 2DSVA 3WH6A 2HVMA 2BNJA 1UKPA 4IPLA 1UD4A 2XM2A 5M3WA 2ZUSA 2VRQA 3WUFA 3B8SA 3WNKA 2YDQA 1CXIA 1QI0A 2DDXA 2J77A 3RMEA 3W27A 2CHOA 2WVUA 3AIUA 4GPNA 3VIHA 4AIEA 5BROA 3JUGA 2J79A 3WQ4A 2JFEX 1W1VA 3TTOA 4CKQA 4TX6A 1BF2A 3BLKA 3BSHA 4CCCA 4MTVA 1LLOA 4WKHA 1IZKA 4OBSA 4BS0A 1BSIA 1Q4NX 3FHAA 4M56A 1H0IA 2WMGA 4MAZA 1QI4A 2VCBA 2IUZA 3L4UA 4QFUA 1B1YA 1R86A 5I23A 5A6BD 2QF8A 1B9ZA 1QI3A 3WN6A 1GJWA 1MQPA 1H2JA 1XH0A 3WEOA 1O7AA 2W91A 7TAAA 1YHTA 4W7UA 2ZX5A 1ITXA 3QOMA 4W5UA 3NDYA 1LL4A 1TUXA 4GKLA 3WQ5A 1B2YA 1XRVA 2W61A 6CGTA 4JZ5A 4Z2HA 1Q6GA 1V0LA 1HKKA 4C7DA 4JAWA 1BHGA 4RL3A 1E73M 3VD9A 2WMHA 1CEOA 3VD7A 1EA9C 5AYBA 4KWUA 4W5ZA 2FH8A 1DWFM 4IPNB 5E70A 3NJ3A 4U5KA 3L2MA 3PZGA 1G0CA 4D1JA 1JZ3A 3W38A 3TTSA 1OGBA 2QPSA 2UWFA 2V3GA 1HP4A 3LPPA 3AMDA 4RE4A 1KWKA 2VMFA 4MDPA 1OT1A 1RP9A 1W2VA 1EQCA 4V28A 3BCFA 2GJPA 3VIPA 1UD3A 2WVTA 2GK1A 1UD2A 4HZ7A 3VGHA 4E2OA 1L8NA 3K4DA 1FP8A 4HA4A 3WF3A 2ZX9A 3AIEA 1H3GA 1WAWA 1JZ6A 3BGAA 1ISZA 4PUEA 1V3HA 4KMQA 2RGLA 1H4PA 2CERA 4EANA 4XV0A 1GQJA 2WLZA 4DUWA 3ZJ6A 4BCEA 2GDVA 7CGTA 7A3HA 2VQUA 1BG4A 2YJQA 3MMWA 1E71M 4S3KA 2ZX8A 3AMLA 1CGUA 1KCLA 1WDQA 1TVNA 3ZO9A 4B3KA 2BS9A 4DM2A 3BAWA 4JKKA 2VX4A 4AISA 1GOWA 2VZTA 4AZIA 3RPMA 3VX0A 4JKMA 3BMVA 1NM9A 2J75A 1V6WA 4D6HA 4JHZA 2UY4A 4UFIA 3POHA 1WKYA 4CU6A 2DPEA 1QHPA 5CZKA 1JFHA 5E6YA 2J7HA 3UERA 2Y2WA 3FAXA 3ZT5A 1RH9A 2XSAA 1UQZA 3WENA 1CNVA 2UY5A 2A3AA 2FGZA 3U5UA 5I77A 1AQHA 2WWDA 2Y5EA 1H0GA 3M6DA 4Z2LA 2XFFA 1SMDA 2E4TA 3A4XA 1KR0A 2CITA 4PSPA 4UOZA 3ZSTA 1EIBA 2DQXA 2EPLX 3ZR6A 2OYKA 1CXLA 3MO4A 5ABGA 3WNPA 1K9DA 4PEEA 1AQ0A 4GO8A 1J0ZA 1E5NA 2D20A 3LPGA 1BQCA 1JDCA 2VR4A 4HMDA 4D6JA 2WHJA 1TA3A 3TTYA 1U2YA 1KWGA 4PMNA 4CU8A 5HOSA 5BYWA 4U5IA 2A3CA 4CVUA 3WD3A 3VUPA 4CD4A 3VD4A 1GOIA 2ZWZA 4P7RA 3SUVA 3VU2A 3M7SA 3CZKA 2VVNA 1JNDA 5A2BA 1UR2A 2YDSA 2G41A 4JFTA 3CZLA 3G6LA 4FF5A 4A4AA 2XUCA 3FN9A 1MYRA 4U31A 1W1PA 4GINA 2ZXAA 1FH7A 4NSBA 3VIIA 1JI2A 3GNPA 1H1NA 1CECA 3WNLA 1XYFA 2E0PA 2QHAA 2X09A 3ARZA 3AZRA 4AMCA 2G3IA 4URIA 5A6MA 1BYBA 4CN6A 2BY2A 2OYLA 4H7VA 1J18A 1KXTA 3SUUA 4HMCA 2YA0A 1GNXA 1V0KA 1ZS2A 2GUYA 2OWXA 4JFSA 3OBAA 1MXDA 2FHBA 1K9EA 1XSIA 2BFGA 2ZX7A 4JFVA 1GOOA 3AHZA 3WUGA 4JCLA 5CLTA 3L4ZA 3WY1A 3OLDA 2WPGA 5LA1A 3UEQA 3WF4A 3AHVA 1GHRA 2CHNA 4EK7A 3B9EA 1E3ZA 1MFUA 4H8HA 2QPUA 2CETA 4AD2A 3GDBA 3VGEA 4UQEA 3W28A 1QI2A 2V5DA 2EXOA 4GI6A 3DHPA 5M03A 4LQ1A 1LL6A 3AS3A 2XHYA 4H8UA 4HOZA 2CYGA 5BXTA 3ZT6A 1XH2A 2XSBA 2F8QA 1X1NA 3F5LA 1NOWA 5A6JA 1JZ8A 1FH8A 1V3JA 5A1AA 3S6TA 2J78A 2XVKA 2DH3A 3NSXA 1KFWA 5GPRA 5JUVA 2A3EA 2ZIDA 5FL0A 1JFXA 1QBBA 1ZU8A 1HX0A 3BSGA 1CGVA 5DT7A 4XB3A 4AIOA 1OWQA 3QR3A 4CN1A 2B31A 3PZQA 2VCCA 1V03A 1XD0A 2QV4A 1V3MA 1W3LA 2YL6A 4W84A 1JDAA 2O9TA 3UG5A 3GTNA 1E6XM 4FLQA 1K9TA 5FIPA 2D1ZA 1NOFA 3LPOA 3N11A 4UFKA 1GQLA 1V6UA 4UQCA 4EKJA 3CIVA 4OBRA 3WMCA 1NARA 1V6YA 5A8NA 1TCMA 3DC0A 1LJYA 1DWHM 3ARXA 4F9DA 4PYSA 1CIUA 1E0WA 1QBAA 5I2UA 2WCAA 3RCNA 5HPOA 1JZ2A 1EOKA 2C8NA 2WNWA 1VEMA 3K8MA 1QHZA 3KL3A 5C8BB 1CBGA 4X0VA 2WHKA 4AZCA 3UG3A 4DUVA 4TTUA 1PJ9A 1EHNA 2WKLA 3PTKA 3T0BA 1HVQA 2PC8A 1ISYA 1V02E 2Y8VA 3WDRA 1E4IA 2WCSA 1XSKA 3VNYA 3SCTA 4GI8A 3W4RA 4W7WA 1ITCA 3U7BA 2AMGA 3ZMRA 1MQQA 1PX8A 1HJQA 3SCQA 1WE5A 4CVWA 4AZ7A 4AD0A 5C71A 1ISVA 3CUGA 1Y7VA 3VX1A 1I1WA 4MJ4A 4J3SA 4MPKA 3AS1A 3OGSA 3VPLA 2EO7A 1TFVA 3K8KA 1B3XA 4CD7A 2HISA 1TVPA 1EH9A 1Z32X 4IISA 3VINA 4HA1A 1GQKA 1MXGA 1HT6A 1QNOA 1PZ2A 1DWIM 3ARSA 4JIEA 1KBKA 3BH4A 4HU0A 4V2XA 4NZCA 4AZHA 1CXKA 3GBDA 2PWHA 2WXDM 1OGGA 3EDDA 1PZ3A 1KQYA 3AS0A 3QGVA 4GQQA 5IFPA 3AHTA 2OLHA 4UOQA 6TAAA 3EDJA 4AZBA 1UR4A 3D5HA 2BHYA 4HTYA 2XVGA 3KWXA 1CZ1A 3CHCA 4PBGA 1R7OA 4GQRA 4CN4A 1XCXA 2PWDA 1FFQA 2CKRA 4A3HA 2EQDA 5IDIA 3RDKA 4U2ZA 1W3KA 1F4HA 5ABEA 4DWSB 1E0VA 4UTFA 2WMKA 2QMJA 1V6XA 4GO9A 3LMYA 4N42A 4TVUA 2WC7A 3I3DA 2WB5A 1FFRA 2Q8XA 4PTMA 5AC4A 3RO8A 5CPSA 2J8GA 2BXYA 4PTXA 2WM0A 5A6KA 1PX4A 1PIGA 4XUYA 5E9AA 4WIWA 3PZNA 2WSKA 3EBVA 3A4AA 4LPCA 4AZ6A 1EGZA 1NWRA 1B31A 2WZHA 3IAQA 1FHLA 3ARQA 2OSXA 2EJ1A 3WDQA 1C8XA 4N0RA 1CLVA 1VENA 2CXGA 4UZSA 4PMQA 1E6ZA 1PPIA 3ARPA 3SIMA 3BAIA 2G4FA 4FLOA 4PMUA 5A6AA 3O6AA 4L4OA 2PBOA 3PZUA 1ZBKA 1DHKA 2WSPA 4J3UA 4R27A 3WEZA 3NCOA 4UQDA 3WQ6A 1JG9A 2W62A 3WUEA 4D6IA 3W37A 3N9KA 2GFTA 3NIYA 4ZFMA 4W8LA 1U30A 4XX6A 1E9LA 2A3HA 1CWYA 4HPGA 2G3NA 1GJUA 5A8QA 5I79A 5E0CA 1JDDA 1HXJA 3ARRA 3MUIA 2E40A 1GCYA 2IXUA 4H04A 1EXPA 2XVNA 1W9XA 3U5YA 2J7BA 1OT2A 1GHSA 3AZTA 5JBDA 4AYSA 3AIWA 3ZIZA 4LYPA 4J7RA 2JEQA 3PZMA 2OSWA 3VDCA 1UG6A 5ECUA 1HIZA 1UH3A 5TD4A 3ZOAA 3T2OA 1HL8A 4MNLA 1TMQA 5I6SA 1HJXA 3WDJA 1JZ7A 2ZUVA 1BGGA 2DT2A 2VX7A 3BAYA 4BQ5A 2DT0A 2WAGA 2YDRA 1D2KA 3WBAA 2FH6A 2GSJA 5M17A 3K8LA 2W67A 3CUIA 4W7VA 2V5CA 4U2YA 4YHGA 2E9BA 1CGYA 1JXJA 3GXMA 4GZEA 1XGZA 3ALFA 4OKDA 1E55A 2VI0A 1JAEA 3NYDA 1QVBA 3OZPA 4MNJA 1J01A 1UUQA 1VAHA 4OIFA 3F4VA 4D1IA 1UD5A 3RM4A 3MKKA 1CPUA 2J7DA 2XFYA 5A6BA 1E0XA 4P8UA 4UFJA 2WWCA 1QPKA 3SURA 1GVIA 2BVYA 3VIFA 3CMGA 1GOQA 1UHVA 1K9FA 3GNOA 1W3HA 5A6LA 2VX6A 1QI5A 4J3VA 1HL9A 4DWSD 1UH2A 3QHOA 3N12A 1UA3A 5JBEA 1KXQA 1VBRA 2JF7A 3AIRA 5I0DA 1KBBA 3APGA 1W9VA 2NW0A 1Q6EA 1BGAA 2OWCA 3ARUA 3AFBA 3QHNA 4WSJA 4AC1X 5ABFB 5DO8A 3WNOA 3FW6A 4A3YA 1M53A 1R8LA 2JF6A 4LYRA 3KL5A 5I24A 1CYGA 3CUJA 2V38A 1QNRA 4H2CA 1B90A 4W86A 1C7TA 1JD9A 3RM9A 3GXIA 1QOXA 5JBFA 1JL8A 3SCOA 8A3HA 3OA5A 2EPOA 2XPKA 2DIJA 4MNMA 4AW7A 1JYNA 2JALA 4HA3A 3BAJA 5D4YA 1Q6CA 4Z2GA 1A47A 1LWJA 3BAXA 1H11A 3VGDA 4RE2A 1VB9A 3WFZA 3VDHA 1K6AA 4L4PA 4FLSA 4FK9A 4AZCB 3W26A 2VNCA 1M03A 2E3ZA 4AD1A 5JIPA 1BFNA 1XYZA 1JZ5A 4CUCA 3MSDA 1CXHA 4BF7A 1M7XA 1VEPA 4M82A 1BAGA 1J9YA 3AIVA 3ZR5A 1J11A 3AMCA 2VZUA 2CBJA 2VUYA 3MV11 1TR1A 4ZENA 4RE3A 2VTFA 3VTRA 1U33A 1BPLB 2PWEA 1VFFA 3VD5A 5E6ZA 2VT0A 1JYVA 4PRWA 4CD5A 5GNZA 1DTUA 3GH4A 4MADA 1OIFA 1WB0A 2FHCA 3WL1A 3CMJA 2VQTA 3VGFA 3ZJKA 1JIBA 1KXHA 4ACYA 1VJSA 4W8BA 4M8UA 5HNNA 2E8ZA 4Y7EA 3ZJ8A 1M01A 1B3ZA 4ATLA 4K68A 3CBWA 2VURA 1B3YA 1LQ0A 3SCPA 4Z2IA 4E8CA 2ZUWA 1CENA 4TX8A 2NSXA 4HP5A 1GPFA 2E9MA 3GXDA 4W89A 2VL4A 3L4VA 3WD1A 2EPKX 3DYMA 2ZX6A 2GDUA 4ACZB 2GJXA 3HJEA 3GZAA 1E72M 3F5JA 2XWEA 2ZXQA 2EEXA 2YOCA 1R85A 1WZMA 3K4AA 3W25A 5CJ5A 1WP6A 5AYIA 5JIWA 1E6NA 5A8PA 3KE0A 3W0KA 1GZJA 3WD0A 3AIBA 3WD4A 1UKTA 1W9DM 2WC3A 1D3CA 1WZLA 5CPQA 1JZ4A 3VDAA 2PI6A 3GBEA 4UZUA 1KQZA 4UOJA 5A2CA 1H5VA 1ODZA 4U33A 2W63A 3SCVA 2V3FA 3OLIA 2TAAA 2X0HA 3CGTA 3VO0A 2A3BA
chains in the Genus database with same CATH superfamily
2FB3A 2AAAA 5LNWA 2YCEA 4U3AA 4ROPA 4AD3A 4OOUA 4B16A 3VOCA 3OB8A 2O7SA 3GM8A 2EHHA 3UWQA 1O68A 5MKGB 5D30A 4IT6A 4MNKA 2UY3A 4HNLA 4KT2A 3VZXA 1R7AA 2QMKA 4G2PA 1Z89A 4XAGA 3UWEA 9XIMA 1UWQA 3XISA 2BY3A 2YL8A 1KGXA 4IGSA 4NYYA 3JZEA 3QHMA 1GW1A 1Q2SA 2WZIA 1QO2A 2C1IA 3DKJA 2J25A 3OVQA 4RJEA 3SO7A 1FWHC 5KZMA 1EJVC 3MANA 2ZZ5A 1VRXA 4W8AA 3UYIA 3I7RA 3IGHX 4YTUA 5JMUA 1NFBA 1O5QA 4UNKA 2FQIA 5BOFA 3CH0A 4ERAA 2A5HA 4DUOA 5C7HA 3GNRA 1UR8A 2VR2A 4EOUA 1YTEA 3T9PA 4E5TA 3VDBA 1EEXA 2J7CA 4DBEA 1Q7ZA 2NWSA 1ONEA 4MGGA 1GVYA 2X7VA 4E8DA 1O1HA 4F9JA 1OFEA 2PPNA 3CIWA 2ZR5A 3WJZA 2Y70A 3O9NA 2NT0A 4R53A 1BXCA 4M3PA 1WDRA 1GVFA 1GOXA 3MW7A 3GNDA 5AHEA 5D2WA 3OVRA 3L9CA 4QSFA 4LUIA 4MMWA 4OOZA 2EF9A 4H9TA 3GYEA 1G94A 1VZWA 3W1NA 2FVMA 2HE8A 4KIRA 2GOUA 4N6FA 4Q6JA 1HP5A 4C6MA 2PGWA 2Y61A 2I9UA 3GFYA 2PBCA 1AZ2A 3WNNA 3VZZA 4XSLA 3MC5A 4RNHA 2E1DA 1JGIA 1H63A 4QDWA 2VYOA 3RCMA 4HGXA 1V6VA 3TR2A 1UBPC 2WJDA 2X1UA 3BG5A 1A50A 3LGGA 2GK1B 1FH9A 1CB2A 3NUKA 2I9EA 3RLGA 1ADOA 1EGVA 2IXVA 2PB1A 3EWYA 1M1BA 1I45A 2X16A 7ODCA 3ARYA 3VNZA 2QR6A 3OOBA 5DBTA 1PXGA 4A6GA 2PDQA 3DENA 4HPNA 4O1DA 3MCNA 5CBBA 1UQYA 4GNKB 4CCDA 4ZOAA 1SZNA 4G7EA 1L9WA 1W3JA 4V15A 4BQ4A 4Q8WA 1NP0A 1D9EA 5BNKA 4XAZA 2J27A 2A6LA 1N8FA 2ZUUA 3QSRA 2W4XA 4LALA 3HQ1A 6PTDA 4ZB5A 3TA9A 5HINA 2BGQA 1UCWA 2WSRA 1RVKA 3EPOA 4D6EA 3ZLFA 2DFAA 1NSGA 1HKWA 1TREA 3EX6A 2BLEA 3SRKA 4GY0A 4WOZA 4B3LA 1DJNA 3G8EA 3B9OA 4DI8A 4GD0A 1QXLA 2JE8A 3R8GA 2HBXA 3W1AA 3GS6A 1KW1A 3BLDA 3O5GA 3R12A 3PSVA 2DZAA 4TOQA 2G8ZA 1XD1A 4IP5A 1OADA 1E4LA 3M5VA 2OB3A 2GVEA 1RA0A 3B9NA 1FOBA 1VCFA 2YA1A 3CUHA 1BXNA 1I0DA 4MDOA 1X6NA 2WV8A 3DZ1A 3AMKA 2QGHA 3DN5A 3BANA 3CQIA 4EF8A 4Q8MA 2C19A 5A95A 3M7WA 3V36A 3TLQA 1OC6A 1TA3B 4J28A 4Y8EA 1XH1A 1EJSC 1V3IA 1P1XA 2NXHA 3A5VA 3AXXA 4C1LA 1NQ6A 5C2GA 4TTGA 2UY2A 2QAFA 4XVDA 3WJWA 3VIOA 5DCDA 3TN3A 4AWUA 5C7VA 3N29A 1TE1A 2G5WA 1WDWA 4CQBA 5T9CE 3B8WA 1V7AA 4E4PA 3G0XA 3SCRA 2Q3OA 3POCA 2YA2A 1MW3A 3BJSA 1BKHA 1EF3A 3MHGA 4EAYA 3VIMA 4K1WA 3CV6A 3GU1A 1XYAA 3U57A 3IJ6A 5K7JA 1ZP3A 1ROUA 5A2AA 3TDFA 2RUQA 4O2TA 4L61A 5E93A 5CSUA 3MI6A 1HGYA 4XISA 3AHYA 4P8XA 4BR1A 3P74A 1BLIA 3EEZA 4F0HA 3OGRA 2Y24A 3GFXA 1SJDA 4GNVA 3ZM8A 3E12A 5CZJA 2F84A 4IGMA 4IFOA 1VPXA 4N6EA 1OD8A 3R8RA 1X6LA 3TN6A 3WSUA 5AB3A 4FF7A 1WKEA 4YVXA 3NXFA 4YHEA 1ZENA 3U2ZA 5AHIA 3CV7A 3ITTA 4Q7IA 1BRLB 3W6MA 1AMYA 1JNEA 5A6SA 6XIAA 3TROA 3SCUA 4U3CA 2GQ3A 2OGJA 3NTYA 3SJ3A 2VR5A 2YKKA 4Y8FA 4C5ZA 1SVDA 4PUDA 2YDAA 4ZE4A 1Y5WA 1NTHA 2XN1A 4J27A 1W6TA 4H6RA 4HT3A 1WZKA 3QBUA 4Q4QA 4ODOA 4PBFA 1WO2A 1GGOA 3O6CA 2C7FA 3WMSA 2RGMA 3GTIA 3SY1A 1RD6A 1MW2A 3IRSA 1H51A 3VM5A 1MFVA 3A47A 2CLKA 2YL5A 4NYUA 5IM51 3W7OA 2J74A 1FCBA 3RR4A 3B8VA 1NFGA 1T8QA 3CU2A 4I5RA 3PJUA 3HJZA 2A7NA 4N02A 1YNQA 3LHZA 3FY1A 2VXNA 3BGJA 3WJSA 1J0YA 4TNSA 3E6EA 4KW2A 1AVAA 3GXFA 1J10A 1V02A 4RPPA 2EGZA 1QW9A 2NVDA 1QK0A 2JK2A 3FV9A 2R82A 2YBUA 3HGJA 1F3WA 1MMFA 5J5DA 3T8LA 3S47A 2O9RA 3TH6A 1G67A 3K13A 5BRQA 2HE5A 1XYCA 3S3GA 2NVCA 4AEEA 4DJFA 3EOUA 2WMIB 2V0TA 3CUXA 3W00A 4E2VA 3TNBA 2HNHA 3THDA 3ARTA 3UZJA 3KBVA 4CNOA 3F4WA 3BOXA 4N4PA 3WDPP 3EY6A 4Z17A 4DT4A 3W1LA 4QIBA 2LGOA 3FKKA 4XVEA 2ZTKA 2PDIA 4DI9A 2VFDA 4NJHA 4DJDC 3QPEA 1QU4A 1A0DA 1QATA 3A12A 4AVNA 3KOWA 4CGTA 4EXAA 1EYMA 2VRKA 4G56A 4PMXA 3QSTA 3ZZ1A 2ZE3A 3DG3A 3NI6A 3N1AA 4S3DA 4E0CA 3GE7A 3GFZA 5HJLA 5G5IA 4DN1A 2DZWA 3UW6A 2XP5A 5FEWA 4JBRA 3MUZ1 2ESCA 3ZJ7A 4IP7A 3SRFA 3CEPA 1U5JA 1REQB 5CPTA 3NQ8A 4H8NA 1EO5A 3TKFA 3N14A 3O7UA 5LHFA 5BOOA 3OG2A 1DJZA 3RLHA 4FOUA 4RLIA 2PCQA 1GORA 2XU2A 3GHSA 5CZ0A 5A69A 4MGVA 3QKZA 2AQOA 2PGEA 3FHQA 1FKFA 1PHQA 4EP8C 2G97A 3BG3A 2XP3A 3TMLA 4PTNA 1GRJA 3UA4A 1RVGA 4P5UA 3WH0A 1UH4A 4OJYA 2BY0A 3PZTA 4LBUA 3SI9A 3FYYA 3RNDA 1KXVA 3CHFA 3VC6A 1LZOA 2BVDA 4JX5A 4XD6A 4G5DA 4DY1A 1AD4A 1DJGA 2A21A 4HU4A 1OBAA 4GZ7A 4C6DA 2ZQVA 3LD5A 3NNTA 4J2MA 2BDQA 5HDRA 2E6FA 3DEQA 1A3XA 1POKA 3UR8A 5FOOA 5BWFA 1Q6UA 3W24A 2ZR4A 3USBA 3TYZA 1DXEA 3CJPA 2YXGA 1X96A 5FEZA 3KEHA 4QDMA 2EG6A 3LBCA 3WDIA 2V8ZA 1OX4A 1UKQA 4D6FA 4JTGA 1F3XA 2V3EA 3NAVA 1M5YA 2VEKA 4G2DA 5TBOA 3T0DA 4NNRA 1C7SA 3EMZA 1NWTA 3CAWA 3OW1A 4D72A 4F2UA 1LOLA 3GD6A 2POZA 2GGHA 3BV7A 2KGJA 3P0XA 4DJEA 2JKEA 4WXYA 4LUSB 4U10A 1Y5VA 3WQ8A 5E1QA 1KCXA 3GU9A 1PAMA 3L67A 3S8HA 3QMTA 2OJPA 2EPMX 4NKCA 2YPIA 4OTKA 4MKNA 4P8WA 4DO4A 2OVLA 2AL1A 2INZA 5EBAA 4AX6A 1A3WA 1FTXA 3VUSA 3THUA 4UQAA 2O4MA 3VM7A 2GWGA 1TPH1 1XL9A 2CZFA 5ABFA 1E70M 2KE0A 1LLWA 3OLEA 4XO6A 4RXGA 3I68A 3U2CA 4ERIA 3MUY1 5EFDA 4QEHA 1VC4A 3SGZA 1TWZA 1TMLA 4HD5A 4UMAA 3KL0A 4IF2A 1IR1A 3NO5A 1JCLA 4LYQA 2FKEA 1GYMA 3VGBA 3F4NA 3G1RA 1YNYA 2GJRA 5EL1A 2GVLA 2NUXA 2VCDA 2Z29A 3AWNA 2WJZA 4D8AA 1EC9A 3NQEA 4WF7A 2I5QA 1W9PA 1TMHA 5L9FA 1P0DA 2PWGA 1WUEA 2YLAA 1GK8A 5EFFA 3FVDA 1XW8A 2GGIA 4GISA 3T42A 3R58A 5D9PA 3W83A 2NT1A 4BA0A 1UWRA 4O11A 2XZ9A 4EIVA 3TYEA 2PDKA 1B30A 4DYEA 2ONEA 6A3HA 2JIWA 4YTTA 2BHZA 5AY7A 4S2BA 5BU9A 1SW7A 3QN3A 4K38A 3NG3A 1LG1A 3VNMA 2OYMA 1MZRA 1MZHA 5DBUA 3LPFA 3OEXA 4PTVA 1D6OA 4UR9A 3EA2A 5HQLA 4TVCA 3G1SA 2H3DA 1F8IA 3NRKA 4ODKA 3OYZA 5DCBA 1RUSA 3BG9A 5CGTA 1AH0A 4P7NA 4ACZA 3S1XA 5EU9A 4Z2JA 3W84A 1V3LA 6TIMA 3MS8A 3WH5A 1W9UA 5DXYA 1US3A 2D0HA 3CHEA 2HRWA 1OC5A 1KRMA 5LHEA 1MRAA 3PY2A 4Q3MA 2G4JA 1UD8A 5CQ1A 1P43A 2X41A 2FAPA 4FNUA 2GQAA 3ZLHA 1QAPA 2ZRUA 2ZYFA 4PUWA 5MF5A 2HNEA 3IUIA 4OV4A 3KWSA 3UR7A 2YBTA 3GAKA 2XGBA 1W31A 2QUNA 2Y8KA 3C5QA 4YTRA 2CLIA 2ZICA 1UR3M 3P62A 3V18A 2KR7A 2V81A 4R5EA 5F1VA 1TO3A 2ZUMA 1S38A 4BI6A 2AAMA 4RV3A 4PULA 4ATWA 2ZC8A 5FJRA 3QMSA 4RXFA 2WVVB 4W9QA 4GGQA 3ORWA 1IEXA 4J3TA 2HBVA 1GOMA 1IQ8A 4MOZA 4WSKA 4MKSA 3VFLA 3SCNA 4JTUA 2AQVA 4C6EA 3UXKA 4C1KA 2BNJA 2PRMA 4IPLA 1G4TA 4IIBA 3WNKA 2DIKA 3KAOA 5J04A 1NDZA 3P14A 4XAYA 3CT2A 2DDXA 1P6BA 2WVUA 4RCXA 4JX4A 4X22A 1LBLA 1OZQA 2P1FA 3JUGA 5BROA 1T7LA 1XIFA 4TX6A 3BOLA 4CCCA 1M65A 4WKHA 4BS0A 1BSIA 2YFOA 1H0IA 2WMGA 4GFIA 4X63A 1QI4A 2IUZA 1YLVA 1JCMP 4XQ6A 5I23A 3Q4DA 1H2JA 2Q5AA 5D05A 1F61A 1ITXA 3QZAA 5HA7A 3QOMA 4W5UA 3TMQA 5KINA 1SO3A 1AH4A 4DPQA 4LAMA 2QCLA 2W61A 5HMEA 1IGSA 1IEQA 4G7FA 1V0LA 4WGHA 4A2SA 1MUMA 1I2PA 2PV2A 5C9WA 1CEOA 1VFLA 2REQB 3S1VA 3I6CA 4GI4A 1JCHB 4UR7A 3M0VA 5H8PA 1XLMA 4F4RA 2YCJA 3EWZA 3MKVA 3S83A 3C3NA 3PZGA 3TTSA 2DG9A 3P2VA 3WLIA 2Y63A 4C90A 4GMEA 1SSDA 4Q4SA 4GWEA 3LPPA 3AMDA 1IZCA 1ZUAX 1NDVA 4DRHA 1EQCA 4V28A 1M7JA 3OBEA 1ZHAA 1P6CA 3VIPA 4HBKA 4HZ7A 3JYJA 3GDLA 3PBVA 1KT0A 3E5BA 3K4DA 3WF3A 1FHVA 5HUAA 5JXQA 1H3GA 3IVSA 1ISZA 3ZWSA 2BG5A 4PUEA 2F6UA 3R0DA 3WK2A 4MWAA 2CERA 1GG1A 3NA8A 3UPBA 4C6LA 3CPRA 4A29A 7CGTA 4QJ3B 3M5ZA 4IQLA 2WNNA 1CGUA 4NL1A 2VKZG 2Z1WA 3EWUA 4INFA 2OMAA 2UZ9A 2CLPA 2C3ZA 4AZIA 4DZAA 3BQ5A 2ZQTA 3VX0A 4G8TA 3IVUA 5CCZA 3LCLA 4LUTB 4DRNA 1EYWA 4JHZA 4UFIA 3PC0A 4UTMA 3FAXA 1RH9A 3VA8A 1UQZA 3WENA 1KBLA 1CNVA 4C6KA 2MF9A 4AHPA 1OFBA 1B57A 4L6HA 3HV9A 5I77A 3SRHA 1FKSA 1S2WA 2FZ8A 3UJEA 4B5SA 4Z2LA 2XFFA 1BXBA 3KZPA 3LBMA 2CITA 4PSPA 3FDKA 1F8MA 2EPLX 1XLAA 3MO4A 4DRKA 5HMDA 1AQ0A 3ME3A 3R8HA 4GO8A 2ANUA 4YVVA 3UXIA 3KX6A 1DQUA 3BGGA 1JDCA 3P8JA 3ZFHA 4DZ5A 4IIHA 3TTYA 2QDDA 3T4WA 2B4GA 2A3CA 3DUGA 3VD4A 4CD4A 4XWUA 3KBSA 4P7RA 3SUVA 2VVNA 2TYSA 1JNDA 1PTAA 4S3BA 5A2BA 1ZK6A 2WM1A 2YDSA 4JFTA 4PZVA 4FF5A 5HJYA 4GIRA 1W1PA 4AWTA 1WYIA 5F4XA 4Q4OA 1O5RA 5FESA 2ZXAA 4LUYA 1JI2A 4KESA 3KBNA 3WNLA 2E0PA 3AZRA 2PU1A 1LBFA 4AMCA 5A6MA 4O1AA 4CN6A 1MRQA 3W7JA 4H7VA 4GJJA 3QZEA 3VNKA 1RXOB 3WLSA 3CM4A 1P5BA 3SUUA 1F6PA 1XC4A 4HMCA 1GNXA 2OWXA 4JFSA 2FHBA 1XSIA 2BFGA 2ZX7A 4ORIA 1EF2A 3C4UA 3WUGA 5CLTA 3L4ZA 2WPGA 3BZJA 3UEQA 3AHVA 1GHRA 1X38A 3B9EA 4WDXA 3T0TA 1EP1A 4PR4A 1MFUA 2NX1A 4H8HA 1TRDA 4AD2A 1QMLA 3DI0A 4IPIA 4GXWA 1VKFA 4UNLA 1KLZA 2QCNA 4HJFA 2FZ9A 2OOGA 4NY2A 5M03A 2ISFA 3KACA 3ERPA 2ZRYA 4ZQPA 4N19A 4BJHA 3CQHA 2J9YA 2XHYA 3LX9A 3R4IA 3DU0A 1Q4WA 4WY0F 3HBLA 4IIDA 4XO7A 2XSBA 3IKDA 2WZTA 3S6TA 8XIAA 2DH3A 3NSXA 1GEQA 3IS4A 2A3EA 2ZIDA 1JFXA 2RUDA 2RSEA 3BSGA 1CGVA 4AIOA 5LKYA 4V33A 3SGUA 2G95A 3E0VA 5DITA 1H62A 4L7ZA 3O5MA 3M43A 2YL6A 1KFBA 3GR4A 5FIPA 4TIMA 1NOFA 3VCCA 1GQLA 4UQCA 3WMCA 2N87A 1TCMA 3IUHA 4LWWA 5DCEA 4XZNX 3RCNA 5HPOA 1F40A 1EOKA 2C8NA 2SFPA 3GNNA 3KL3A 2I57A 4X0VA 1FKDA 4ZO6A 3UG3A 1KFLA 1GPWA 3PTKA 4HN4A 1ISYA 5CC3A 1XSKA 2DUZA 4A8LA 4FPSA 3EWWA 7XIMA 3O07A 1ISVA 3VX1A 2QJNA 2WJEA 3O5QA 5B7ZA 4KWSA 4V1XA 2Y6ZA 3AS1A 3OGSA 5FF7A 1B3XA 2XP9A 1A5SA 3FEMA 5ENLA 4HA1A 3A13A 5C5YA 3CTLA 4JIEA 1VPQA 1K7FA 1SFJA 4AZHA 1RAKA 2PWHA 3RRAA 1ZALA 3R13A 3PF3A 4J4OA 4YIWA 4TW8A 1RR2A 3QGVA 3AHTA 4KWWA 4LEQA 2EJAA 3I4KA 1PZ1A 2XVGA 1E9IA 3CHCA 2YXOA 2VWSA 3NPUA 1FFQA 1L6GA 3V1PA 3RDKA 1F4HA 1D7KA 2WMKA 1V6XA 1DV7A 3LMYA 4ZQCA 3M4HA 3I3DA 4MG4A 1S5MA 1FFRA 5HANA 1KKRA 4PTMA 2J8GA 1N8IA 4OE7A 1PIGA 2VEFA 3GKAA 4XUYA 2WSKA 1FY6A 4AIBA 1TRIA 2Z0IA 2WZHA 2Y0FA 3W2JA 5DMMA 2OSXA 4GC4A 3WDQA 2PP1A 5GJPA 2CXGA 2PDHA 3HFTA 1V79A 4PMUA 5A6AA 2IS7A 3W1MA 1IXOA 1UB3A 3W7NA 3PZUA 1QJWA 4GYJA 1DHKA 4J3UA 4PGLA 3BK0A 4BWLC 4KF1A 4UQDA 1GG0A 4RW3A 2GLKA 3N9KA 2GFTA 3RFWA 2NQJA 1Q8JA 2ATSA 4ZFMA 4QAIA 1U30A 5M2FX 5HKGA 2A3HA 2Z1XA 3STCA 1JUKA 4HPGA 3RX2A 2NV9A 4U84A 1XLHA 5CGQA 5A8QA 3CMFA 3C2YA 4XZLX 3BQ6A 3ARRA 2E40A 3NURA 1EXPA 3W02A 5G2IA 2XVNA 5D2VA 2W79A 3UF9A 2J7BA 3BJTA 3C2FA 1L6WA 5JBDA 4F3HA 3W76A 3ZIZA 4QHRA 2PDUA 5HWNA 4LYPA 3OZYA 3JZUA 1PCWA 3H7RA 1A0EA 5ECUA 1HL8A 4MNLA 2L2SA 5ECVA 1TMQA 4D2JA 4GGBA 3ZWTA 2ZUVA 5D33A 1LOQA 2VX7A 1KRCC 2JGQA 2YDRA 3HG5A 4HU3A 1S3TC 2EULA 4CNSA 2HEJA 3K8LA 4YWSA 4KCTA 5HNUA 2W67A 2WQPA 3SRDA 4W7VA 4U2YA 4YHGA 4O15A 1QOPA 5EGRA 1F07A 2G50A 4GZEA 3GPKA 1Z6KA 3IGSA 3TW7A 2VI0A 2ZA2A 5C0QA 1A5BA 3OZPA 4MNJA 1UUQA 3F4VA 1GT8A 3SY5A 4F0MA 1ICPA 1LUCB 2GWNA 4D1IA 1SZRA 5A6BA 1H1ZA 3TN5A 4NZFA 4UFJA 2WWCA 1LORA 1TTIA 2QJMA 3LK6A 1GVIA 3VIFA 3VNIA 3MWCA 3GNOA 1W3HA 2O0TA 4IZGA 4LBRA 2VX6A 2CFFA 4DZ2A 4J3VA 4O53A 5TNVA 4DJFD 3DAQA 2LJ4A 2FZDA 2VHLA 1TV2A 2JF7A 3CL8A 1MO0A 2PCEA 6ALDA 2I56A 1E9YB 1H50A 2OWCA 2Z7GA 4Y9NA 2ETNA 3VNJA 4JOMA 3TW6A 4UTWC 3Q2DA 5DO8A 3SSZA 4YLWA 4TV5A 3KDOA 2CW6A 2JF6A 5K9DA 3CUZA 4NILA 4H2CA 1UP2A 1O60A 1QNRA 3CUJA 1R6WA 5CAKA 3RM9A 3A3WA 1WKDA 3P67A 5JBFA 3UPMA 3F1QA 3OA5A 3LBOA 3O5LA 2E6AA 4JTQA 2OEJA 3LV6A 3W7HA 4MNMA 1JYNA 4OECA 3PG8A 4EF9A 3K30A 2A1YA 1Q6CA 3A9BA 1WXYA 1US0A 1LT8A 1K6AA 4L4PA 2Z1VA 4AZCB 3W26A 2VNCA 4WY0B 4U85A 1BFNA 1XYZA 1JZ5A 1FWCC 3DFTA 1CXHA 2Y1HA 4BF7A 1IHIA 4M82A 1XIJA 1BAGA 1J9YA 3AIVA 3GZ3A 2MPHA 4N2YA 1KV8A 2VZUA 2PP0A 3MV11 1TR1A 1XIMA 3I6RA 2E28A 1U33A 1Q6RA 2J6XA 1TSIA 1ICQA 1W5OA 2VT0A 3ITCA 3N2CA 4JTCA 1JYVA 3ABZA 5GNZA 4GABA 4C6IA 3V3WA 1V7YA 2R1NA 1OIFA 5G2WA 4H4IA 3VGFA 3DG7A 3IEBA 3CNYA 4K8EA 1OFQA 3GTYX 1W5MA 2E8ZA 1B3ZA 3RR1A 4K68A 4ATLA 4GJ1A 1B3YA 4M6PA 3M1ZA 4E8CA 1Q7QA 3P6LA 4U4MA 4JICA 3TWBA 2E9MA 1BEUA 3N34A 4CQDA 2VL4A 4EXBA 3GTXA 2OQYA 5D02A 2ZX6A 1XKJA 2DP3A 4A35A 3G5EA 4DROA 3WLTA 2AKMA 1W37A 3HJEA 1E72M 1HUVA 2D9FA 1T11A 1RY0A 3QQ1A 1R85A 3EXRA 3GUGA 3DKLA 4PCNA 1FWEC 5AYIA 3H21A 3SGGA 5CJ5A 5G1TA 2BP1A 1R9HA 1GYLA 2GL5A 3ATZA 3VCNA 3AIBA 3WK0A 3NQDA 5CPQA 4FI4A 3GBEA 4UZUA 1KQZA 1UW9A 4UOJA 4ZQMA 1KFJA 3D46A 3RO6A 1A5NC 5F2GA 4U33A 1DHPA 3HURA 4ZMGA 1LRTA 3NL6A 1B4EA 2CHRA 1XUUA 1I2RA 1XYLA 4OWGA 5LIYX 3HQOA 2A3BA 4DJED 4GXPA 3IV3A 3G1AA 3WO8A 3URQA 4MF4A 5EMYA 3AICA 3FYOA 4O12A 2FB2A 5D09A 3WK3A 3DH7A 4RDZA 2VJXA 3PTQA 4RZBA 1CDGA 1C91A 1A49A 1B9BA 1WAUA 4JIQA 3KS5A 4NUWA 3UI5A 1QNPA 4AHOA 5BMWA 1W8SA 3G1DA 2GGJA 4IFKB 2FGBA 2PUZA 2DGAA 3TX9A 1TX2A 2YCLB 1IV8A 5HMFA 1AW1A 4JN8A 1RK6A 3WFLA 4W9TA 3L4WA 2BOGX 4LT9A 1O5XA 1JDFA 1ITUA 1EJRC 1OYAA 2ON3A 4N7QA 3IIOA 3CV1A 2YR1A 2P4VA 3DYOA 3PWAA 3VNLA 1L2QA 2F38A 2OWWA 3CH9A 1YPXA 3A9IA 4WUIA 1UR0A 3OZOA 4TW6A 3K46A 1PX3A 1TV4A 4QLJA 3NFUA 4IHCA 4NI3A 4GYPC 3PPGA 3TCSA 1OB0A 3LDVA 3CC1A 2IQDA 1V3KA 3CAVA 3VOHA 4AAJA 1BF6A 4X9YA 4TU1A 1Z7AA 3FS2A 1FUYA 3TOYA 5EMMA 3MSRA 4HCLA 1PE1A 1PWMA 2PFHA 4UTKA 3DBNA 4PN2A 3PVFA 2CLLA 4WCJA 2QW5A 1WCGA 4UFLA 1IXPA 3SCWA 4CD6A 2DZTA 1GZGA 2VCAA 3HPAA 3HGSA 3WLKX 3KRSA 1DWJM 3SBFA 4R7OA 2WMIA 1JJKA 2ZRWA 1FKRA 4RDWA 2FDMA 2DT1A 2YZ5A 3GX9A 3ZSSA 1F4AA 2P5NA 3SUWA 3TFXA 3WYZA 3NQ6A 4HQVA 1T8XA 3NQCA 2CZEA 3LLDA 4R7JA 1NEYA 2XWDA 1RBAA 2GVYA 2PWUA 1L8PA 1XRSA 4GVGA 2DUAA 2CLHA 3CUFA 2OX1A 3G1FA 4J9JA 4DM1A 4DRSA 2W3ZA 2ADAA 5DEZA 5DMYA 5IHSA 1ISXA 4WZHA 3E0WA 1W54A 3GXNA 2WVSA 4QG9A 4GHRA 4LS1A 3JRKA 4KRTA 2XFRA 1MXSA 1PUDA 3W23A 3O5FA 3BE7A 2HROA 3DESA 2TMDA 2VRJA 3NGJA 2CEQA 3I10A 1UOKA 5IFTA 3IGUA 1B3VA 2QUTA 4C6OA 1C8QA 3M0JA 4XZWA 3IIVA 3CT7A 3M44A 3Q65A 4HJWA 4DYKA 3P81A 3M0XA 1F5ZA 5H1WA 1AZ1A 3T78A 1NU5A 3UNDA 5C54A 1TZ7A 4NT0A 1S5TA 4GQGA 2MLXA 4KGLA 1H09A 3W7MA 3SECA 4GY1A 5TAOA 1KM3A 3LCHA 3KCJA 4TR9A 3UG4A 4XBSA 4MZ1A 5BOEA 1EXBA 2HVOA 2CLMA 2ZRVA 5D9MA 4C6QA 4V27A 5AHFA 3C2RA 5CPMA 3SIZA 1VFTA 3W6LA 4D6CA 3CZ8A 1UP0A 4LJ3A 5LA0A 3T1GA 6XIMA 1YPIA 3MP5A 2NX3A 1BKSA 2IMRA 1W1IE 4BEQA 3RJYA 3CASA 4JTSA 1E4MM 4D71A 4MFDA 1HJSA 2D2OA 3IK8A 4Z1YA 3AYSA 2INEA 4LBSA 5FJJA 4IT1A 4Y9PA 2XDFA 1OF6A 1C3FA 2FGLA 2P8CA 4PTDA 3C56A 3PB2A 3UQBA 2ZQ0A 3GNXA 4DBWA 2E8YA 3L65A 3RILA 4O4WA 5E5CA 5E09A 2WW5A 3KXQA 1X6UA 3KS6A 5GQBA 2E6DA 5HPCA 1BVNP 4DBDA 4P7OA 3ANUA 3PA7A 5DY2A 1S3HA 3WLPA 2CESA 3N9SA 1VIZA 4LUSA 3ECQA 3V5OA 3S5YA 4KWVA 3TE9A 1UR9A 3AROA 5KMYA 3TAOA 1XCWA 4TUFA 1VF8A 5I3KA 3VIKA 4GIAA 4IMCA 3BJFA 1LRNA 2UBPC 3VKKA 3PSWA 2R94A 2P76A 2RKXA 2QPXA 1I75A 1FWSA 2PDLA 1WOAA 5IRPA 2ZC1A 1I60A 4FLRA 2VC9A 3KOXA 5I3GA 4HHMA 3PB0A 2W66A 3ELFA 2O92A 2ATMA 1IF2A 1OGSA 3VILA 2X7WA 3KLLA 3MP3A 2ODOA 2DORA 7PTDA 1GONA 1E44A 3NL3A 3O1NA 1KM0A 4R88A 4LY4A 5K4ZA 4LNYA 4LB4A 4MB3A 5XIAA 2GZXA 1XKYA 5CPNA 1FWAC 3CB3A 4H3DA 3HG4A 1ZAIA 4H2HA 4LAXA 1RBOB 3UWZA 1NMWA 1TJ2A 2ZBTA 4LB3A 1FWIC 1PKMA 1T41A 1US2A 2X0SA 3LQLA 3WBXA 4QEEA 5E9XA 1VR6A 4GOAA 5AHMA 4LFYA 1XDLA 3OIHA 1AODA 4L1XA 3AZSA 4R0XA 4G1NA 3B97A 1MW0A 1Q85A 2HDJA 4Q8NA 3AMGA 3PHAA 3S46A 3C0JA 3AALA 1RLDA 1NH6A 2AOSA 4I7WA 1ZBWA 5G1YA 3N17A 3QQ0A 3CQKA 1ZTVA 2VEPA 2VEGA 1ZCNA 5MHBA 1WQ5A 4B3ZA 3A21A 3SM0A 4XD3A 3W1TA 2AL2B 1Q6FA 4RW5A 1Z8AA 3H2NA 3CPUA 2VGIA 3QVQA 4DXXA 1M04A 1Z41A 4P61A 4Q22A 3W82A 4XAFA 4B9YA 1V93A 4V1YA 3WIJA 3EDEA 5C55A 2R1KA 4BI7A 3WG6A 2XIBA 1XLCA 4Z1CA 5CGMA 1JRBA 1E6RA 2NVAA 2GSEA 5G4HC 5C2CA 3N18A 4JL1A 3T2PA 3B9AA 1H41A 1EIXA 1VRDA 1E56A 4I7UA 4PMJA 3PFRA 1YTDA 3S9YA 1YQ2A 1KCKA 1RK5A 1WZAA 2CPUA 3AXKA 3VGGA 5A3HA 4IWWA 3UCQA 2CBIA 1UZDA 1CW2A 1XYMA 4KFNA 2YCKX 4S23A 4K7YA 4M0XA 1X98A 4GUJA 4J35A 4OT7A 1GYNA 4S3CA 3PZVA 3GH7A 2CLEA 4TMCA 1TQXA 4LV9A 2M08A 1E4NA 5SWUA 1TIMA 1AFSA 1FKWA 4LX4A 1QHOA 3E0IA 2OFNA 1V0NA 3QXBA 3FLUA 1FHDA 1B6CA 1B5TA 1ME8A 2WVVA 3ITOA 5CKSA 1OG0A 1A0CA 3ALGA 3LZ5A 4EACA 4UCFA 1E6PA 4H19A 4ZE5A 3IJ8A 3B8IA 1IZJA 4IG2A 4OUEA 2KFWA 1AJ2A 1TJ0A 3QLLA 3KM8A 1WXJA 5DELA 3HO8A 3G3MA 3LHWA 3H70A 3R94A 5AHLA 3AU2A 3EWCA 3FK4A 3QV6A 4DIAA 3PBMA 3KCLA 5I3IA 1AL8A 2CWNA 1ONWA 4IMFA 3EX4A 5CLWA 2I16A 3WFAA 4JIPA 4JTHA 4K8GA 2BGNE 5DO2A 4M6VA 1VPYA 1R87A 2MANA 1UBSA 3WKZA 1ZAJA 1DP0A 3CHVA 1G9HA 1GTEA 2DSKA 1QDSA 1VLWA 3M6YA 5J8LA 5DIVA 3NZQA 4ATDA 2YX0A 3KP1A 4AG0A 4J3ZA 1OIMA 3SR7A 3JXVA 3LGDA 5E0FA 3A3HA 3PANA 1GVSA 3RMJA 2Z6IA 1L6FA 2VOTA 1ZGDA 1AW5A 1OFAA 5CEWA 3L0NA 4K2SA 3UXLA 2REQA 4JR5A 3Q94A 1GQIA 4REQB 5HULA 3KBWA 3DFQA 5FL1A 3EA3A 4QDPA 4R85A 1LT7A 4HMNA 1EWDA 3QC0A 1ZZMA 4DJFC 4WKAA 2BSLA 3B0XA 3SDOA 3SN4A 3WELA 5LGXA 3NQMA 1SO5A 3E2RA 3GYCA 4P8VA 3VOGA 3NWRA 1KGUA 3HPZA 4QRNA 4QSHA 1EP3A 3CYVA 3L4XA 3AJ7A 4PUMA 1JD7A 1JAKA 2DSWA 3QF0A 3UR2A 1ADDA 2CBUA 5BZAA 3E3HA 2KX9A 3OVPA 1L1PA 4DLMA 1BYAA 3F2DA 4X0NA 1PVNA 3TJLA 2Q8ZA 4NJJA 3TSMA 3CGMA 3AHXA 3VKCA 1ZL1A 4D8ZA 1Q1CA 5FD0A 3UI6A 4HHPA 5DF0A 4ZO7A 1P0EA 1FWGC 1ZCCA 1SR0A 1LTDA 1J0KA 1VBUA 3NEHA 1KTCA 1JCNA 3QZ6A 3BW4A 3WMBA 3H4WA 3KW3A 2ZZ2A 5B7YA 4AZ5A 2KO7A 3MO7A 1UASA 3NZGA 2R1PA 4F66A 3AUJA 3GH5A 3CPGA 1TPEA 3LENA 2WK2A 1G1YA 1KFEA 3F03K 3BOFA 1F6YA 2R91A 3IPWA 3UZ5A 3E1F1 3GG0A 3WLMA 2D3NA 4JNMA 1YADA 3PZOA 5LNUA 3RM8A 4Y96A 4DNMA 3CZGA 3UETA 4QS6A 3V35A 3S2CA 3DHUA 2C0HA 4FOKA 4K7VA 1BVZA 4AIUA 1E3XA 2A3LA 1CXFA 4AWEA 3CEUA 2VGBA 2X8RA 2Y4SA 5KEZA 2I14A 4HMEA 1E40A 3PTDA 3G1VA 1UP3A 2BY1A 5D8WA 4QCEA 2YIHA 3AC0A 3VFCA 4L9ZA 3VD3A 3G1XA 4ML4A 2WCGA 4UTLA 1B0IA 3WLOA 4HOWA 3C8NA 1F9CA 4AXKA 1XC6A 1TTJA 3KABA 3GG8A 4HSHA 3SQSA 4GUFA 4CEXC 1SW0A 1DQXA 1S5VA 3SZ8A 1RHCA 1V4YA 4IQJA 4GQ0A 1C8YA 1TPWA 3DFPA 1A5KC 2Q01A 3ONBA 4O50A 3BDKA 1XDJA 4TQTA 1PBKA 3BLIA 1XX1A 3T05A 5RUBA 3ZVHB 4Q8VA 1A5MC 3I3BA 1CGWA 4AEOA 3AI0A 1I4NA 6REQA 3J7HA 3QW3A 4AF0A 2DZXA 4NZ3A 4IMEA 3PN8A 3BV4A 5EB8A 1VFOA 5CBIA 3HU7A 4JTIA 3O0KA 1DL3A 1VFHA 4UTIA 2XJ7A 3URBA 4AZGA 3W7QA 2C1HA 4P7LA 4S1FA 1KBIA 1E1EA 3OYXA 2PTZA 3STPA 5I09A 4XKYB 5EYWA 3BCJA 3PUOA 3LY0A 2FFIA 4CU7A 2RDUA 4LS0A 3S5SA 4LVGA 2VEIA 1ELSA 1XG3A 1HKJA 4Z1DA 1IWPA 2DT3A 4JFLA 3W1RA 4R9XA 3BUVA 1VP5A 4PTWA 2HVMA 1UKPA 2XM2A 5M3WA 2Z6JA 3B8SA 4IPXA 2YDQA 1TE6A 1XLBA 3FXGA 1XGDA 2BOFX 3NZRA 2A7PA 1GKPA 3RYSA 3VIHA 1YEYA 2OPJA 3WQ4A 1SZGA 5FF2A 1W1VA 4CKQA 1G6CA 3BLKA 3BSHA 1IGWA 1OG6A 5DLCA 2ZDSA 3URAA 3TDBA 3QW4B 3H2FA 3NQAA 2P8BA 3MUXA 3S1UA 1R5YA 1NF0A 2E6YA 4L4MA 3PPFA 1B1YA 1R86A 3FGCB 4ZL1A 3HMJG 1OF8A 5A6BD 1B9ZA 1MQPA 1YNPA 3WEOA 1O7AA 2W91A 4MIMA 2F23A 2NQ9A 1YHTA 2XP6A 5HW6A 3IWPA 2C0AA 3NDYA 1LL4A 3WQ5A 1B2YA 4Z2HA 1YXDA 1Q6GA 4JAWA 2DUXA 1MSSA 1BHGA 3W7RA 1E73M 3VD9A 1O12A 2WMHA 1YDOA 3IJIA 1O66A 1RCXB 1LRQA 2FH8A 5E70A 3NJ3A 2YXXA 5JH2A 1Q66A 4J5NA 1NIUA 4D1JA 3TK7A 1FQ0A 2V3GA 1S5WA 1HP4A 3O05A 4PUJA 1DJXA 4FEZA 1QPLA 1GWJA 3LTPA 1DJWA 3W01A 1UD3A 2WVTA 2PGRA 3TQ0A 4ZODA 1UD2A 2ZCGA 3STEA 4E2OA 3SN0A 1WAWA 1JZ6A 1BWKA 5C9XA 1TZZA 2AGKA 3O8AA 4GK8A 3TYCA 3O5IA 2D2GA 4EANA 3H54A 3LHTA 1BD0A 3ZJ6A 2VQUA 1Q6LA 5AVNA 2G0WA 4E2DA 2PDWA 4JQ3A 3MMWA 1H60A 2ACRA 4L6OA 1E71M 4LCRA 4NASA 2XPBA 4R34A 4S3KA 4IIFA 4L6DA 1E1CA 4EX4A 5DQPA 4KIEA 4JKKA 3BMVA 2J75A 1V6WA 3POHA 3C2VA 4CU6A 1QHPA 3GW0A 4DNHA 4NXSA 4IMGA 4Y9AA 3FSTA 2QJIA 2D73A 4Y2WA 2UY5A 2OO6A 4MLJA 3HOJA 2WWDA 4YCPA 1EB3A 1SMDA 3BMXA 4LUJA 4GY7A 1J96A 1VGAA 2FTPA 2OYKA 2PD5A 1K9DA 3W7LA 1S2UA 4IIEA 4FNQA 4KS0A 3DCPA 1J0ZA 1E5NA 2V30A 1W1A1 3SB0A 3BARA 3PG9A 3B3DA 3G0SA 2YBVA 5U4NA 2WHJA 4AH7A 1KWGA 5HOSA 1GQNA 4H6QA 4ZZ9A 2XFWA 1ML1A 3WQCA 3FX4A 3E38A 3U9IA 3VU2A 3M7SA 4FNRA 5DY3A 4QISA 3R11A 3FVMA 3TYBA 5HATA 1X1ZA 3G6LA 4QITA 1Y0EA 4A4AA 3FN9A 2HMCA 4MZ8A 4GINA 4QIUA 4XBJA 4NSBA 2OO0A 1TWIA 3QYSA 2YZRA 4HVXA 3D3FA 1H1NA 4A8NA 3TYUA 4JD4A 4DO5A 4K1GA 1Q13A 1BYBA 5LXEA 2BY2A 2OYLA 1C9HA 4L64A 5DIUA 4LH8A 2DG3A 1LBMA 1OX6A 1KXTA 4PB3A 3SFWA 2ISWA 2QV5A 3TJXA 3HGOA 3QH2A 1Q63A 1V0KA 2DZUA 2QCGA 2C6QA 5CAHA 2F7FA 2GUYA 4O28A 3OBAA 3S5OA 3H6OA 2I5IA 2XH4A 1NDYA 1TPUA 1PINA 3AHZA 4MWAC 1KM2A 4JCLA 3QY8A 4LU0A 5LA1A 1H61A 4GKTA 2Z26A 2GVJA 2CHNA 4LC8A 3S5ZA 3NZPA 4FNTA 4DF1A 2QPUA 3EWXA 2DZPA 1XRFA 2OZ3A 3UP8A 3GDBA 1L2UA 2NUWA 4UQEA 4X3ZA 3E74A 1FWNA 4GGHA 2GPTA 2PLJA 1ZPTA 2EXOA 4GI6A 1P1MA 2HS6A 3AS3A 4QT3A 1RJRA 2B7QA 4HOZA 3LRKA 3EX1A 2XP4A 2A7RA 2YYTA 4GCXA 3F5LA 1JZ8A 3REQB 1XLJA 3N2TA 3KZ7A 4IOTA 3W2UA 3VCRA 2XVKA 1TWWA 2PLMA 3CV2A 1QBBA 1ZU8A 2GUBA 3LEPA 1ZCOA 3ZVIA 3LN3A 5REQB 4XB3A 3QR3A 5H6HA 1S2VA 1XD0A 2CC0A 3B8UA 1L6YA 1DIEA 1W3LA 1JUEA 3LGEA 1E6XM 4FLQA 5I3JA 4YCOA 2R8WA 3H55A 4TYOA 3N11A 2XN2A 2FZMA 4UFKA 4EKJA 2YB4A 1NARA 1V6YA 1YXYA 3DC0A 1QBAA 5I2UA 2C14A 2WNWA 3GDRA 4NAEA 3UJRA 2WHKA 4AZCA 1MUCA 3PS7A 2CWXA 4QG6A 3G24A 3T0BA 2I5GA 4DBSA 3WDRA 3FA3A 2BMBA 4JYSA 3PR9A 1QTWA 3W4RA 1W3NA 3U7BA 1V5XA 1PX8A 5EPDA 1WE5A 2H8XA 4CVWA 4AZ7A 3BO9A 3MHFA 8RUCA 1Y7VA 1I1WA 4JS3A 4J3SA 1VYRA 2ISVA 5AC8A 1R3WA 3NQBA 1TFVA 4HNUA 2HISA 3BMBA 5I98A 4GNJA 1GQKA 3B06A 2HS8A 3R43A 1MXGA 3A5FA 1TTQA 1HT6A 5FSEC 1ENUA 4JGDA 1PZ2A 2OLSA 3ARSA 1KBKA 3W7KA 3Q45A 2PD9A 3QTGA 1CXKA 3GBDA 2EPHA 1OGGA 1RJPA 3B0YA 3BWWA 4IICA 4MSPA 1KQYA 4GQQA 1LROA 3TSDA 4UOQA 2OLHA 6TAAA 1UR4A 3V0TA 3D5HA 3RF9A 1W8GA 2BHYA 3KWXA 3TJ4A 1CZ1A 2DW7A 3HG2A 3OPSA 4JTEA 2VD9A 1XCXA 5FJPA 1VJIA 3G8RA 1KTBA 4A3HA 2EQDA 4KQNA 5IDIA 4FR6A 4WDTA 4U2ZA 1W3KA 2NLIA 4UTFA 4E2BA 3WQDA 4UIOA 2QMJA 3LG3A 1FVPA 4TVUA 3UWYA 1Y8BA 4JIIX 4AMAA 3QR0A 2WM0A 1I0BA 4ODQA 4WIWA 3EBVA 3TAKA 4LPCA 5I07A 3OU8A 4DHGA 3GAYA 1W1B1 1B31A 1FWDC 5XINA 3A22A 4RPQA 2XPAA 3ARQA 2EJ1A 1C8XA 3FJ6A 4N0RA 4O0QA 4PMQA 4GYFA 3Q37A 1PPIA 4G50A 2G4FA 5CC5A 3A3XA 3GHRA 4ALDA 1HKVA 1TUFA 1TTPA 1XBZA 2YCLA 1ZBKA 2WSPA 4OUIA 3NCOA 4AHQA 4GYKA 3WQ6A 3WUEA 3MPGA 3VC5A 1EP2A 4AX7A 3NIYA 3K1GA 2DVXA 4B90A 4XX6A 3U48A 2OOFA 2ZADA 4LAUA 3C0QA 3QPYA 2ZA1A 3G77A 1KM4A 2A79A 3N9RA 4YWIA 3RLVA 3MUIA 1GCYA 3S42A 1VLIA 3MZ2A 3TWAA 3U5YA 5F4SA 1X1OA 1S5NA 3U3HA 1Y65A 4AYSA 3AIWA 3UZXA 3AO0A 3CGNA 1HL2A 3FJ4A 1OVDA 3GC5A 3UCCA 3RGCA 5I6SA 3ABQA 2Y7EA 1JZ7A 3P8IA 2ZFAA 1BGGA 2DT2A 1DXFA 2DT0A 3WBAA 3M5YA 4GUIA 4S2CA 1RALA 3TSBA 4ZQNA 3VDGA 2GSJA 5FJTA 3ANYA 3MP4A 3ABSA 3AYTA 3FOKA 3W70A 4KEUA 2E9BA 1JXJA 3DFHA 1U79A 2JBMA 1XGZA 1E55A 1SR9A 1JAEA 4GUHA 4JTLA 3D47A 4IJRA 2GJNA 5JU6A 1U1HA 1XXXA 1J01A 1VAHA 2RURA 3O5OA 3ES7A 1UD5A 1CPUA 2XFYA 2BOEX 2V67A 2PA6A 1JQVA 2BVYA 3BLOA 3CMGA 1GOQA 1K9FA 4C60A 1V51A 2EKCA 5HNRA 2DG4A 1IT8A 4FHAA 1QI5A 1XRTA 4I6KA 1TB3A 3BLEA 4JFMA 3N12A 1I2OA 1KXQA 1VBRA 5I0DA 1AA1B 5DRCA 2Y7FA 1KBBA 3W7EA 1EA0A 4HZMA 5XIMA 4ZOEA 4LAYA 1BGAA 3ARUA 2TRSA 3AFBA 3QHNA 4AC1X 1FKKA 3V1HA 5ABFB 3IARA 1TPFA 4H9VA 4A3YA 1KNWA 2Z2AA 1UWAA 2V38A 4O13A 4XAPA 1XBYA 3UF8A 2O4QA 1QOXA 4MY8A 1JL8A 3M0HA 4Q4RA 2XPKA 5BRBA 4FR1A 4IL0A 4F2TA 1VH7A 3W2MA 1HO4A 1LWJA 1T0OA 3GB6A 3T0CA 4RE2A 1VB9A 3WFZA 4FLSA 3OO2A 3RK8A 2E3ZA 5TF0A 1J6YA 3MSDA 4ODMA 1TZ9A 2J9ZA 4F0LA 5HNTA 4NX0A 1A4LA 4MY9A 3QC3A 2CBJA 1WUFA 1KT1A 1FRBA 1N8WA 1KFCA 3VTRA 1U22A 2PF8A 4JEJA 3O5EA 4E4UA 3MQTA 1TJPA 1FWFC 3VD5A 3ZYZA 1FHUA 3A24A 1KM1A 1RLCL 5F2IA 5G4EA 2PGFA 2VQTA 1JIBA 1VJSA 2V5LA 4RK8A 3ZJ8A 4CNNA 2VURA 1CB7B 1SJAA 3QV7A 1LQ0A 1P0KA 4Z2IA 3IKGA 3ABOA 3MCMA 4HP5A 1GPFA 4W89A 3L4VA 1NY1A 4LAVA 2DZVA 2EPKX 2GDUA 4ACZB 4ASTA 1N7KA 3M16A 4DIPA 4UMBA 3FIGA 1OCNA 1WZMA 1MDLA 3K4AA 1XLIA 3W7CA 1WDDA 4B5XA 4GBUA 2X30A 3KE0A 1FKTA 2XZ7A 3TR9A 1OFOA 1XISA 3UGVA 4FB7A 2VDIA 2ABAA 1D3CA 1WZLA 2TSYA 3VDAA 2GSHA 3QYQA 4MSSA 3OLIA 1XICA 3SW6A 1IXQA 1QPQA 3CGTA 1KKOA 2VFIA 4M80A 5T91A 3MBDA 1AG1O 3AXHA 1TQJA 1W56A 1OD0A 1ODUA 4D6DA 3COTA 5LGZA 3IK4A 2PDXA 2PBGA 1JGMA 2PTDA 3GVVA 2PDBA 3ISIX 3PULA 1P0BA 1WDSA 3PTMA 3STGA 5BU6A 2F21A 1SFSA 3I6EA 4KCVA 2GVGA 4DZIA 3GY1A 4L4LA 2ITKA 4FXRA 1RP8A 1RQBA 1EQPA 1GUVA 3TONA 1TELA 5M1TA 1TIWA 1ZJAA 4LV4A 2VN1A 3IJLA 4LVAA 2W6RA 1F2JA 1K3UA 2ALRA 2KI3A 1AMKA 2I1OA 4JTFA 2OODA 4XZIA 3RAOA 3W7PA 1JCYA 1W0MA 3W07A 3ARWA 5FAGA 4MHBA 3CZJA 1WXZA 4X2RA 2AL2A 3OLGA 4ZXLA 4Z0JA 4A21A 3FCPA 3CLWA 3G1YA 4PB5A 4Q6XA 4X61A 4IQ2A 1RCQA 2BZNA 3PUDA 3HIJA 3AYRA 4PMVA 1EDTA 2TPSA 4FS9A 1EHAA 4BWLA 3KBMA 1EC8A 3MJMA 4A3RA 4ZBCA 4GZJA 4FAPA 4O1CA 3GVWA 1E6SM 3UJSA 1DWGM 8XIMA 2HZGA 3UI4A 5FF0A 4PMZA 3MMDA 1P4CA 1NWSA 1SJBA 2FIQA 5I3DA 7ENLA 3E2SA 3V7PA 2CLOA 2J4GA 1FWJC 2VO5A 2V2HA 4LVFA 4IQEA 4IMDA 1BYCA 1OABA 2FVLA 4NRRA 3TQKA 3MV01 1Q6DA 3G3DA 1M41A 3EOOA 4C5YA 2HPMA 3VMPA 3CZEA 3THQA 3W1PA 4I5UA 3MA8A 4QNEA 3B9DA 2JKAA 5D8ZA 4MWAB 3KADA 1N1AA 2J6VA 2OXNA 5BXRA 3OJGA 1W5PA 4LTSA 4F8XA 4BF8A 3KFTA 1YRRA 3N6QA 2ZWYA 4G1KA 3ZXWA 3CXOA 4D8LA 1EC7A 1FP9A 1PIIA 3NOEA 4BEUA 3M0IA 3WJYA 3BW2A 2ZRXA 5I7GA 3MDUA 3YPIA 4L1WA 3S0CA 2A6NA 4MVAA 4PA8A 1EUNA 4M81A 2YLLA 3THAA 3VIJA 5IHRA 5C6MA 1VCGA 5HBFA 1OCQA 4OFCA 1LP6A 4Q8OA 2F9RA 1BWVA 4HPXA 1V0MA 3N2MA 3DIPA 3OP2A 5F2MA 3PFMA 3MDWA 5CH9A 1YDYA 7TIMA 3VVGA 3RJXA 3LCGA 3TW9A 1EO7A 4O17A 5C9UA 1R9ZA 2PLKA 4FOJA 3QOKA 1QCWA 2GQ8A 5CG7A 2NV1A 3MTWA 2Z1SA 3WUBA 5JVLA 3KDNA 2Z1KA 4REQA 2QCDB 3ITYA 5PTDA 1NOUA 2FVKA 4H9ZA 4TXEA 4AD4A 2M1IA 1R0MA 3NYZA 3N2BA 4WLCA 3LUTA 2D23A 3EB3A 3VKAA 2AQWA 4F48A 4Z1AA 3O5RA 3WQOA 3B7XA 1KC7A 4UTTC 1YXCA 2RDXA 3L4YA 1MWOA 4CCZA 1NP2A 1GKQA 1Q6HA 1YX1A 2GJXB 3VAVA 4Y6GA 2QYGA 5HWCA 2PPPA 3WLJA 1K1DA 5EA9A 4IX0A 5FKYA 3N04A 1JPKA 3ABRA 4IP4A 4WVXA 3KRZA 4M24A 3F4CA 3EB2A 4W9PA 1P48A 2VENA 4UFMA 3W7DA 4UFHA 4Q33A 5ABHA 3EPMA 1D3GA 3TP4A 2DZSA 3NL2A 1IE7C 5FAJA 3E96A 2FJKA 4B15A 5AVHA 3PBGA 3RN6A 3ATYA 3QGAC 2OZ0A 3GVRA 1GTHA 2C15A 4PRTA 1UZHA 2R9RA 4OZOA 4H7CA 2XGIA 4BFAA 3C8FA 3E02A 4H01A 2JZVA 2ZVRA 3BPWA 2FFCA 3CL7A 1BKFA 4JKLA 1YDVA 4LEFA 1KR1A 1B3WA 2X05A 1FKBA 3B03A 2L5HA 5HUOA 3UESA 3T40A 3L66A 4Q8QA 2CZDA 2B7OA 3C52A 3EMCA 4NNBA 1ZQ5A 2JIEA 3RCYA 1BVWA 1ONRA 3WDHA 2ZXDA 3T81A 4QXIA 3O63A 1ONXA 1O95A 1RZMA 1UYQA 3T07A 2MNTA 4W88A 4GUGA 2VP8A 2XP7A 3S1WA 1YBQA 3T0AA 3LRLA 3H26A 3EEGA 1IR2A 4WOQA 2NQ5A 1CTNA 4K39A 1NF7A 1HJVA 1EWEA 3CHDA 5KITA 1UR1A 3SFKA 4NIRA 3O0FA 2D0FA 4I7VA 1NSJA 2J8FA 4I90A 4FSAA 5I06A 1VEOA 4ZVJA 3HFYA 4ZQRA 5AYZA 3H2EA 3DHDA 4LF2A 3CO4A 3CYJA 5M5DA 4PMYA 3OQEA 1ZRQA 4A22A 1CGTA 3C0LA 1FAPA 3C3UA 1D8WA 2G3MA 2F2DA 5AECA 3G0UA 2QJJA 1ME9A 2JQXA 3BXWA 5HQMA 2PEVA 4MKVA 4POCA 3UWWA 4QBXA 2Q71A 3SQLA 2E9LA 3LSCA 1KGWA 1XLDA 4B2DA 4H83A 1ALDA 4HNOA 3UXAA 3WH7A 4QLKA 4QAWA 3GSMA 2QJGA 1M7PA 4NG3A 1SFLA 2X1IA 2QKFA 4UNIA 4XZBA 3GHTA 1X7FA 4DWSA 4Q4KA 2YSWA 3UZWA 4LW7A 1ICSA 4EPBC 2PP3A 3EIPA 1CI1A 1I2QA 4CD8A 3S6DA 1PYFA 1XIBA 3LQGA 2C91A 1Q8AA 5AN7A 3N19B 3OGVA 1F76A 4GYPA 2GGGA 4Z42C 3H24A 3KRUA 5AOUA 4C6PA 3KVJA 3O5KA 5HWBA 3D0CA 2QZRA 1V08A 1DWAM 4ZA0A 2PU0A 5A8MA 4LGXA 1U1UA 3NDZA 4W9OA 1VYPX 4XKYA 1FA2A 4DVOA 5C9ZA 4PFMA 4CEUC 2CIPA 2ACQA 2LLEA 4Q7NA 5D38A 3WLNA 3KBJA 2BGSA 4H9UA 2QDEA 1TR9A 5GNXA 5FI8A 4QS5A 3RITA 1TKKA 1UZ1A 3NQVA 2FHFA 1SJCA 4RZ6A 1G4EA 1UA7A 2V5BA 4E4FA 2BV9A 1XS2A 4PMOA 4H9YA 4WGXA 3O6YX 2XVLA 3EX2A 4FNSA 1O1ZA 2PC4A 7REQA 4IX2A 5GJMA 4GVHA 4TX0A 1UKSA 4E38A 1ZP4A 3MDYB 2VFFA 3CWHA 3W71A 1VHNA 4C91A 3HM7A 1R9YA 5CJMA 1IYXA 4JHMA 1KB3A 1TCDA 2DJXA 4NAFA 4A8IA 1IIGA 2WZMA 3SUSA 5LNRA 3FSUA 4F79A 3MHUA 2DU2A 4QP0A 1JEZA 3FGCA 5DN1A 3AUOA 1OZMA 5CSYA 4DAIA 2WBGA 3WLRA 3VYLA 4I9TA 2PS2A 2V2DA 3MBFA 4GI9A 2DV0A 2XH0A 1UWSA 1UUMA 3DX5A 4NHVA 2Q6ZA 3ZQ9A 4IGHA 3VKDA 4QJ5B 1DOSA 4JFIA 4MUPA 2NQLA 4HU8A 4OQVA 3LHUA 3EX3A 2D3LA 1Z44A 4LY8A 4O14A 4QLLA 2ZA3A 1K7EA 1K7XA 1UUOA 1A80A 3GLCA 1FWRA 2WHMA 3M07A 1VFSA 4H6EA 4M7SA 4XD5A 2OSYA 1PTGA 4ZSUA 2F6XA 1J12A 3KAHA 2W0UA 4LXFA 4KGJA 4QE4A 4ONVA 4UQ9A 3UY8A 2D22A 1VCVA 4O4VA 5CG0A 1UROA 3EMQA 1H49A 1X8FA 4FMVA 1J0JA 1A5OC 1IEWA 1G7UA 2P0IA 3A4WA 2VVSA 2H8ZA 2BODX 3V5FA 2FPVA 4HCDA 3QY6A 4YPJA 4JN6A 4WR3A 3NVDA 3WBEA 1PEZA 1BWLA 2CCRA 3NEVA 2X1TA 4F0RA 1H7PA 5AC5A 5DT5A 1IEIA 2E09A 3CTTA 2BX7A 3EDFA 2ZOXA 1JULA 3SUTA 2E5DA 4WRHA 4B5WA 1P6WA 2PTXA 2Z27A 2EG7A 4HCHA 3GG1A 2VFHA 3QQWA 3TTQA 3E5PA 3GTFA 4HNNA 5I78A 3PZ9A 5FCZA 3B0PA 3H7UA 1GW9A 2BHUA 5LNSA 1J0IA 3AXIA 3PZIA 3TOPA 1JYXA 4UTHA 1EJTC 4C7FA 5HWMA 1XR2A 2AWGA 2FTYA 4FZIA 3L0KA 5F1UA 4XIMA 3V5CA 4K6AA 5F2LA 4LYKA 3EXTA 4G6CA 4IIGA 5AHNA 1UD6A 2C16A 4JFUA 3KZSA 3Q58A 2PDNA 3IANA 4RR4A 1JPIA 3GIQA 3S2LA 4JHOA 3MMUA 1W2PA 1HNYA 2F61A 5AYYA 1BG9A 2CBVA 3AQUA 1ECQA 3VK5A 3H2CA 2ABBA 1XHGA 2XISA 4Q8TA 3S9IA 1XFBA 1RSCA 4DAFA 3SSJA 2YGYA 1HKMA 4CQCA 1H7OA 1YTKA 3P93A 3NPVA 1O5KA 1S46A 2RFGA 3PJXA 4BF5A 3WMLA 3O15A 4YN5A 1Z69A 1J8VA 3M5XA 3QTPA 3DXIA 2PTWA 4ZXOA 5KZEA 2F2HA 1FKXA 1P0NA 5HXMA 4DBUA 3H23A 1EUAA 1O4UA 1AUSL 2PF0A 5KZDA 4RNJA 2QVNA 4YMZA 3NOYA 2NUYA 3QFWA 3PJTA 1AH3A 1FWTA 4EPDC 3G6MA 3SAZA 3RX4A 1R30A 2ISSA 1YPFA 3LM7A 4S3FA 1DTNA 3LU2A 4P7QA 3M46A 3PK7A 3KTCA 1RV8A 5AZ0A