4DWSB

Crystal structure of a chitinase from the yersinia entomophaga toxin complex
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
540
structure length
527
Chain Sequence
KPTENIPSPILVEDKYTEETYSRPDVNFKEDGSQGNLSYTATRVCAPMYNHYVGDKTPKLSAYITDWCQYDARLDGGGSKEEERGRGFDLATLMQNPATYDRLIFSFLGICGDIGNSKKVQEVWDGWNAQAPSLGLPQIGGHIVPLDPYGDLGTARNVGLPPESADTSIESGTFLPYYQQNRAAGLLGGLRELQKKAHAMGHKLDLAFSIGGWSLSSYFSALAENPDERRVFVASVVDFFVRFPMFSCVDIDWEYPGGGGDEGNISSDDGENYVLLIELRSALDSRFGYSNREISIACSGVALKSNIDQLVANGLDNIYLMSYDFFGTIWADYIGHHTNLYSPKDPGEQELFDLSAEAAIDYLHNELGIPMEIHLGYANYGRSAVGGDLTTRQYTNGPALGTMENGAPEFFDIVKNYMDAEHSLSMGKNGFVLMTDTNADADFLFSEAKGHFISLDTPRTVKQKGEYAAKNKLGGVFSWSGDQDCGLLANAAREGLGYVADSETIDMGPLYNPGKEIYLKSISEIKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The BC component of ABC toxins is an RHS-repeat-containing protein encapsulation device.
pubmed doi rcsb
source organism Yersinia entomophaga
molecule tags Sugar binding protein
molecule keywords Chi2
total genus 190
structure length 527
sequence length 540
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dwsB01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4dwsB02
1ODUA 4HA1A 5GNZA 2J7CA 2GJXA 5CGMA 1FH9A 1QPKA 2W91A 3PZMA 1G5AA 2J7GA 1HP4A 1CGVA 1PX3A 4M1RA 4CU6A 4B3KA 2CEQA 3VO0A 1GORA 2XVLA 3GZAA 4PSPA 1SR0A 3VIHA 1NWUA 1HKMA 1GOWA 3WNNA 3VGFA 2WCSA 1VFOA 2DT0A 2ZE0A 1JZ4A 3N15A 3WN6A 1B3YA 1CXKA 1KXQA 2ZUNA 1G0CA 3O9NA 1AVAA 1FFRA 4JKKA 5D9NA 4UFJA 1GVIA 1C7SA 1VEOA 4WK9A 2YA1A 4UFHA 4PMUA 3SUUA 1UR4A 1KB3A 1WDSA 2JE8A 1BLIA 3BAJA 3ARSA 3F5KA 3WMCA 2VZOA 4J3XA 4PMYA 5M17A 3VIOA 4MNKA 2QF8A 2W66A 2G3IA 1E71M 3A4WA 3F5JA 3T2OA 1J01A 4M56A 4IUGA 4AZCB 5GNXA 1V08A 2QMJA 2C8NA 3CHFA 1BSIA 1UA3A 3T08A 3W38A 2GUYA 5DFAA 1UZ1A 1VF8A 2V3EA 1E0WA 3AS0A 5M3WA 3NIYA 2VR5A 1E56A 3WNLA 1JNDA 4AD5A 4AC1X 1QNSA 1EDQA 1RD6A 3D3AA 2WSPA 2WLYA 5LYRA 3A6OA 4CGTA 3WL0A 1FHDA 1J11A 5D8ZA 2WAGA 1LQ0A 5A1AA 1US2A 2NSXA 1SFSA 3WSUA 2B31A 3VNZA 1R7OA 4C7FA 5AC4A 2E9MA 1NWRA 3OLEA 4CD7A 4D6IA 2ESCA 1OINA 4J3UA 7TAAA 2CITA 3CMJA 1AMYA 4PN2A 4PCSA 1G1YA 3BAIA 1RPKA 1E0XA 1NOFA 2XYLA 1FFQA 4UQ9A 3W81A 5A6SA 1X6LA 4H8UA 3ZSTA 1JXKA 2J4GA 1EDGA 1B31A 3WQ6A 3TTOA 2WC3A 3WQWA 3I3EA 3IJ9A 1EQCA 3VD9A 3AHYA 4X0VA 3CZEA 4UQAA 3ZT6A 1OGGA 1WB0A 2IUZA 4NZCA 2Z1SA 1NOWA 2FHFA 3MSDA 4KRTA 4MJ4A 2PWFA 3MKKA 3TA9A 1VENA 1CGWA 4WLCA 4GXPA 2XFRA 2E4TA 2F61A 1CECA 5D9OA 2J77A 4W7VA 3WD1A 1BHGA 4QLLA 1E9LA 3AFBA 4JFVA 3CUFA 4DM2A 1OT1A 1QHZA 5D4YA 1W9XA 4GQRA 4OKDA 3VMOA 1JYVA 2FDMA 1C7TA 2GVYA 4GPNA 1QBAA 3ALGA 1E40A 3WFLA 4DWSB 1MQRA 5E6YA 1W9DM 3CHCA 2ZXQA 5D9MA 4ATDA 2BHUA 2VX7A 2BHYA 4FLOA 2FGZA 3SUWA 1MFVA 1UKTA 4FLQA 3CHEA 3HN3A 1VRXA 1ISYA 1R87A 4JAWA 1UOKA 3MUY1 1JNEA 5A94A 1UWSA 1FP9A 2VRKA 3W82A 3BMVA 1XV8A 3VMNA 3AZSA 4KMQA 4HMCA 3TP4A 1EOKA 1V0MA 3VIIA 3BXWA 2CKSA 3AS2A 1TZ7A 4K68A 1XD0A 1W3LA 4HPHA 4P8XA 4QFUA 4HZ6A 5BXPA 1E6PA 5EFFA 1L0PA 4U33A 3WUGA 2PWHA 4D6DA 4ZE4A 1CEOA 2ZX9A 3ZJ7A 5HNNA 3WDRA 2VVNA 3MANA 5I23A 1OBAA 4UZSA 1ZBVA 4GINA 2PI6A 5I2UA 1V6YA 4KH2A 3WQ4A 2BY1A 4B9YA 3QR3A 3GNOA 3HU7A 3RO8A 1PZ3A 3OLIA 3ARTA 1GZJA 4U2ZA 2XFFA 1XD1A 3GH5A 3SEPA 4WF7A 2V3DA 4MPKA 3L4YA 4UQCA 5GQBA 1PEZA 3QOMA 3WF1A 4UR9A 4JZ5A 1TVNA 5ABFB 3OA5A 2E40A 3AIUA 4W5ZA 1MQQA 4IPLA 5CJ5A 5I79A 5HPOA 1C90A 1QW9A 4ACYA 1JYXA 1FA2A 5A6BA 2C7FA 4MDOA 3ARRA 1ISXA 1FP8A 4UQDA 2ZXDA 4H2CA 1GQJA 4M82A 1M01A 4GZEA 4UCFA 4AZ6A 1HX0A 4LYRA 3VD7A 1J12A 4AZ7A 1E6SM 3TTYA 3N04A 3WNOA 4FK9A 3SURA 4JKLA 1H11A 2ZX8A 3OLGA 1E4NA 1EOMA 2Y5EA 5EMYA 5D8WA 4Z2IA 1QBBA 3W6LA 4WSJA 3CZKA 2XGBA 1B3XA 4D6FA 1KGXA 4PSRA 3QOKA 1ZL1A 2PB1A 1JAEA 2PBOA 4PCTA 1NWTA 1GCYA 4ACZA 1KR0A 2ZOXA 4AD2A 4HPGA 5JBFA 2WBGA 2WPGA 3W27A 4J3WA 3GNRA 1ODZA 4OOZA 4PTXA 5A6BD 3T2PA 1M7XA 5I3DA 5HBFA 4YPJA 4QCEA 1V3HA 2VURA 1J0ZA 1C8YA 1XH0A 1B9ZA 3GXFA 4LYPA 1XHGA 2V5CA 3CPUA 1GQIA 2HVMA 2OWCA 1JZ5A 1A47A 1GONA 3AHTA 4PMXA 5BXSA 2WHKA 3VM7A 1QNPA 1CENA 3AISA 1XH1A 1QNOA 2X0HA 5FD0A 1G9HA 2ZXAA 4WJXA 1GOKA 2W62A 3UEQA 3N12A 2Y8KA 2WLZA 2WHJA 1F4HA 4AZGA 2XIIA 2YBTA 1OIFA 4H7VA 1UWTA 2VT0A 4D6GA 5CGTA 3SCOA 1X1NA 1E6NA 2X09A 2DSKA 3UG4A 2JEQA 2UWFA 1TA3A 4GI8A 3CUJA 3SUTA 1W1TA 2X2YA 1JG9A 1HP5A 1UR9A 1CIUA 2XSBA 4M80A 4W8LA 1MFUA 3UESA 3WNPA 1OGSA 5A6LA 2ZWYA 1BGAA 1JYNA 1V3KA 2WCAA 4DWSD 4D1JA 2VTFA 4UOZA 3VIMA 5A8QA 3VD3A 5GPRA 2ZUMA 5ABFA 1UR0A 5LA1A 1UR8A 2UY3A 1GJUA 3IAQA 2EXOA 1UWQA 1BYCA 1DEDA 2G3NA 1B0IA 4GI6A 5DF0A 4JFUA 3OB8A 4U5IA 1UD4A 1V03A 2PF0A 5EFDA 3VGDA 1Q6EA 1GQKA 4BZYA 3AZTA 4GO9A 3WUFA 1GOIA 1CPUA 4CD4A 1HKJA 3AYRA 1CGYA 2JFEX 2E9BA 3AMDA 2VR4A 3WKZA 3LPGA 3WL1A 5I77A 5CSUA 4AY1A 4D6HA 2E8YA 2J75A 1E6RA 5A8MA 4D1IA 4P8UA 4PTMA 2JF7A 3B9AA 4AZIA 1XYFA 2G4FA 2XHYA 4PTWA 3VUPA 3WNKA 2Y2WA 1H4PA 3U57A 3WDPP 1XRVA 1E55A 1E15A 1Q6DA 3SCSA 2RGMA 3GBDA 2D0HA 3NCOA 4J7RA 2D0GA 2VX5A 5FCZA 2DSZA 5DT5A 5DEZA 3QHMA 1CNVA 5IFTA 5A6JA 3K46A 4GI9A 4YN5A 3GXDA 1KXTA 2WWDA 3WF3A 1V6VA 3WF0A 4D6CA 1UR2A 2VRQA 3ARWA 1CXHA 3UETA 3ARQA 4WKHA 5I6SA 1VBRA 1MXGA 1D3CA 4CU8A 3EMQA 3W4RA 3WQ5A 5EB8A 3BCFA 3W29A 4CD5A 1UKSA 5CSYA 2XIBA 3GH4A 1MW1A 2GSJA 1BVZA 2V3GA 4HA4A 4Z2HA 3AMLA 4D6JA 1J0KA 4W7UA 4S3JA 1VIWA 4P8VA 5CPSA 2VZSA 3IJ8A 1VEMA 2ZX5A 1LJYA 1Y7VA 4ZE5A 5E9AA 4KGJA 1H0GA 3T09A 3FY1A 2YLLA 2XFYA 3WEZA 2DSVA 1ZBKA 1J0JA 3AIQA 3DYOA 4HMEA 3B9EA 3L4VA 3GBEA 2DH2A 3II1A 3WMSA 4JCLA 4UQBA 5IHSA 1QVBA 5LA0A 4Z2JA 5A6KA 1UWIA 3GXIA 5HPCA 1GOMA 2ZUVA 5JBDA 1JZ7A 3MS8A 2DIEA 1ITXA 4TVDA 3O6AA 1H3GA 1YQ2A 1E5JA 1H2JA 5ABHA 3L4TA 1W3KA 1GOQA 1MQPA 3ZJKA 3WQVA 3IANA 2WANA 2J7DA 4F9JA 4OZOA 4P8WA 2NW0A 4JKMA 4MNJA 1UH4A 3N17A 3MMWA 5I5RA 1ESWA 1PX8A 5BXTA 2XUCA 2DH3A 3BSGA 1UZ4A 2WVVA 3K4AA 3ALFA 4W88A 3VD5A 1AQ0A 1W32A 1OB0A 4V27A 4AW7A 4LX4A 1E70M 4URIA 2FHBA 2W92A 2EPLX 1US3A 2QMKA 2WMIB 3GXMA 1CTNA 3UR7A 3SUVA 1LF1A 2JIWA 1TMQA 4QAWA 1ZBCA 3M7SA 3VDCA 3ZQ9A 4AZCA 2BY0A 2EQDA 3T0DA 1E5NA 3PBGA 2GJRA 4JFWA 4P7NA 2XVGA 4U2YA 5BROA 1CGTA 1JIBA 2X05A 1W9PA 4ZXOA 2J7BA 2JEPA 5A95A 2WSKA 4TXEA 4HU8A 2WMFA 2OWXA 1CLXA 3F4VA 2XPKA 1GJWA 3VU2A 4BQ3A 3FHQA 2VVSA 1NARA 1BG4A 1MWOA 4U5KA 5A3HA 4PMOA 3AICA 1L8NA 3ZT5A 1LWJA 1HNYA 1IT0A 1SMDA 1QI4A 1HIZA 3FAXA 2FH8A 3KZSA 5A8OA 3ECQA 3M07A 3MV01 1EHNA 4IPNB 3G6MA 4TVUA 1EHAA 3VDBA 1QNRA 2IXVA 3SCTA 1UUQA 1NM9A 4HMDA 1CZ1A 1JZ2A 2YA0A 1XCXA 2G8ZA 5JIWA 1UR1A 4TTGA 1JD7A 5KZ6A 3BSHA 2J7FA 1W9BM 3PTMA 2O9RA 1TE1A 4WKFA 3CUHA 4A3YA 4Z2KA 1BFNA 1WO2A 2BY2A 2WXDM 1E4IA 4V28A 5A2CA 3TTSA 4PBGA 3KEHA 1E43A 2YL9A 4AWEA 5FIPA 4BQ5A 3OZOA 2CKRA 3ZSSA 1JI2A 1V6UA 5BCAA 1BQCA 1OCQA 2ZUSA 1GPFA 1Q4NX 1QW8A 1OT2A 4DWSC 1BPLB 2D0FA 4U31A 3CGTA 4EAMA 1SYTA 2A3HA 2WC4A 1QHOA 3AYSA 4M29A 3OZPA 3VTRA 1I1XA 3SCWA 5FKYA 3RJXA 4AEEA 5CPQA 2O9OA 1JXJA 4TTUA 4UFMA 5HOSA 4QLKA 3CUGA 4AISA 3ZMRA 2WYSA 1E1EA 1JFXA 3SCQA 2VMFA 4B3LA 2PWDA 3K8MA 3KE0A 4XUYA 2BVDA 1M04A 2A3AA 2FHCA 2XSAA 3WFZA 2WW5A 3AJ7A 3ZR5A 3LPFA 1W2VA 5AYIA 3AIBA 1EXPA 3ARPA 3EMCA 3WY1A 5IXEA 3RM4A 4CKQA 2BHZA 2QPUA 3OIHA 4PMRA 2J25A 2WMIA 4JCMA 4XZBA 1VFMA 2XVPA 3RPMA 3RM8A 2DT1A 2E3ZA 4BF7A 3A47A 1E4MM 1JZ6A 3OG2A 4C7GA 2EO7A 3AXXA 3EMZA 2YDSA 4BCEA 4E2OA 1V6WA 1HJXA 1ZU8A 3BMWA 3L4XA 2MANA 3L4UA 1W1VA 3VINA 1WAWA 1B1YA 1RH9A 5JH8A 1MW3A 3WDHA 4WKAA 3IJ7A 1WE5A 4QCFA 5BRPA 1QI2A 1E6XM 1B3VA 3RCNA 1LL7A 5FL1A 3BLPX 2D23A 3M6DA 3N9KA 2CBVA 5A8PA 1CXIA 1PBGA 2CXGA 2GDVA 1N82A 3FAWA 5I0DA 1JZ8A 3WD2A 1BF2A 3WH9A 3W26A 1BTCA 1E4LA 2WZHA 5BRQA 4UZUA 4MNLA 1EDTA 3KWXA 4ML4A 2EJ1A 3WEMA 3PZUA 4E8DA 3DYPA 3ZJ8A 1UYQA 1B90A 3IK2A 3PZVA 3U5YA 3VPLA 4RL3A 1B3WA 1H49A 2IXUA 2G3MA 3PZOA 1HKIA 2BXYA 1NWSA 2J47A 3VDHA 5I24A 3WUBA 3LMYA 2CBUA 2VX6A 2V38A 1YHTA 2J74A 3N1AA 2YIHA 4HZ8A 4F8XA 1EH9A 3VILA 2YL5A 2YBUA 3CIVA 2XJ7A 1KGWA 1EGZA 4AIOA 2OWWA 5ABGA 1TUXA 1E73M 5IDIA 3TOPA 4N42A 1W1YA 2GK1B 2EEXA 3PZIA 3CTTA 5M5DA 1PZ2A 4NSBA 1EO7A 1NH6A 1OGBA 2ZICA 1CGUA 2Y24A 3UERA 2UY5A 2AAAA 1J0YA 2CNCA 1KXVA 1V3JA 3SCNA 2VZVA 1NP2A 3WD3A 2UY2A 3APGA 1HJVA 1MYRA 3CBWA 2BXZA 1J9YA 1V3LA 1TVPA 4WSKA 4V2XA 3MO4A 1HJUA 1UQZA 1C93A 1C8QA 7CGTA 5M03A 2VUYA 3K8KA 1HT6A 3AI0A 2WMJA 3PTKA 2XGIA 3BAXA 1FH8A 1HXJA 1C3FA 2OSYA 1V6XA 3DECA 1DWFM 1RP9A 1MW0A 4CCEA 2VQUA 5C71A 1HJSA 1K9DA 1NOUA 4N0RA 3CH9A 1C92A 3U7BA 2ZIDA 2VRJA 1HN1A 1UHVA 5AY7A 4Y7EA 3AXHA 5E70A 4RE4A 2WVVB 3GM8A 1ZBWA 4Q22A 4ATWA 3AIVA 3J7HA 1DWHM 4PMZA 1IZKA 5HDRA 4LGXA 1BYAA 1KQYA 1H09A 3EDFA 4TX6A 4XX6A 2VQTA 4IISA 1DTUA 3RILA 1ECEA 1R86A 3NDYA 3GYCA 2PC8A 1P6WA 1QOXA 1LWHA 2A3CA 1J10A 1PPIA 4IM4A 4PUDA 2YLAA 2XM1A 1WKYA 1UH2A 3MUIA 5A6MA 3T0BA 4M8UA 4EE9A 1VJSA 2EBNA 2XVKA 4BA0A 4HP5A 2QV4A 4AD4A 2YDRA 4JFTA 2ZUWA 2DGAA 1CYGA 4KRUA 5A6AA 4DM1A 4XZWA 1TCMA 2X1IA 2GK1A 3DYMA 3AMCA 2QLYA 3BLKA 3WF2A 4PMQA 2G3JA 3WDQA 1EQPA 4AD0A 2RGLA 1OIMA 2WHLA 2WMKA 3RJYA 6TAAA 3S6TA 2UY4A 2DDXA 1HKKA 3AQUA 3BAWA 1WCGA 1LL4A 4UFKA 3VM5A 3VGBA 2WZIA 3VD4A 5BWFA 2ZX7A 3CHDA 3QHOA 4R27A 1JI1A 1K9TA 4E8CA 1V0LA 3CLWA 3B9DA 8CGTA 1GUVA 1R85A 2EPKX 4MDPA 3W28A 1KWGA 2WBKA 4PYSA 2XM2A 3CO4A 3PZNA 4C7DA 1XCWA 1UD5A 4W5UA 3AMKA 1D7FA 3RMEA 1JFHA 3POHA 3OGRA 5AYBA 5GNYA 4R5EA 2BVTA 4OIFA 3NSXA 2E0PA 1W3HA 2VNCA 4UOQA 4H41A 4TVCA 2VCBA 2NT0A 3ZM8A 3IAPA 3EDEA 1PJ9A 2WM0A 1K9FA 2CIPA 4YHEA 3F5LA 1B3ZA 2ZUUA 4GKLA 4OBRA 2XWDA 4JIEA 3B8SA 1H41A 2CYGA 5TD4A 3K1DA 3BGAA 5FL0A 1H1NA 4MB5A 1W3JA 1LLOA 4RE3A 1UG6A 3QHNA 1B2YA 3AHZA 2J78A 2X0YA 3N18A 1BYDA 3N11A 2Z1KA 3VKKA 1J18A 4EKJA 3WBEA 1WZLA 4ZFMA 2OLHA 3BAYA 3WMBA 1DWAM 1JF5A 3ARXA 3UG5A 1FOBA 5IFPA 2AMGA 2E9LA 2J8GA 3I3BA 2VCCA 1V0NA 4AZHA 3A4XA 4J28A 1WDQA 1MW2A 4M24A 1ZJBA 2YA2A 2VOTA 2CPUA 2V5DA 4CN6A 4W93A 2D24A 5HXMA 4JL1A 4W89A 3WENA 4UFIA 2ZWZA 3FHAA 3SCUA 2WMGA 5E0FA 4JL2A 4QLJA 1W9VA 2W61A 2FH6A 1Q6CA 4CD8A 4MADA 5CPTA 4LYQA 4P7RA 5CG0A 3WDIA 4Z2LA 1E6QM 3WUEA 3AZRA 1U33A 1HVXA 2W5FA 4W87A 3THDA 4BQ4A 2WC7A 4E4PA 1QI3A 2DT2A 4OBSA 1K6AA 3FW6A 1HL9A 2CCRA 1HF6A 3MMUA 1HL8A 1QNQA 4W8BA 1GQLA 4MB4A 2OYKA 1JDAA 3W25A 2BS9A 4WIWA 2YOCA 3BC9A 5C8BB 5BXRA 4ZXLA 3FXYA 2G41A 1EO5A 1D2KA 4W7WA 3AIRA 1E1FA 2NT1A 4JFSA 4OOUA 2DPEA 1OSEA 2CHNA 4EK7A 3EDKA 4U3CA 1LL6A 1BGGA 1KGUA 4TUFA 3WQ8A 4CUCA 3A3HA 2BFGA 5DT7A 3VX1A 4FLRA 1JDDA 3NJ3A 1CLVA 7A3HA 4HOWA 2WVUA 4LPCA 1TR1A 3ZOAA 2DSWA 3K4DA 4HZ7A 2ZX6A 2Q8XA 1HVQA 3WH7A 5CQ1A 3K8LA 3VDAA 4B15A 3MSGA 1KR1A 2JIEA 4PUEA 2WVTA 1E3ZA 2YKKA 3GNPA 1UH3A 3ZIZA 4CN1A 2DEPA 1U30A 4L4OA 2WB5A 2FGLA 4RE2A 3JUGA 1JAKA 1W2PA 4PEEA 1GHRA 2C0HA 1AQHA 4MAZA 4J3SA 1XC6A 1VEPA 2W67A 4MB1A 4XV0A 3MUAA 1CXFA 4TOQA 1UKOA 5A2BA 1MXDA 1JD9A 3WF4A 1O6IA 1V02A 4W85A 4D71A 3TONA 1ISWA 2XTKA 3WDJA 4Q7NA 3WELA 3SCPA 4J3VA 1CXLA 4CD6A 4A3HA 3LPOA 4AIUA 4OUEA 4NRRA 3BAKA 2XVNA 2D1ZA 3T0AA 1C91A 2EPMX 2A3EA 1E72M 1JL8A 4TX8A 2W63A 2AOSA 1GOOA 2F2HA 1J0IA 4AZBA 4D6EA 4ZENA 2VL4A 2HISA 3L4WA 1JF6A 3AS3A 5CZKA 5E0CA 1QI5A 3AMGA 1TFVA 3A4AA 3ARZA 9CGTA 1DWIM 1VFUA 3O2LA 3NSMA 4AIEA 3U5UA 3DC0A 3SUSA 1EA9C 1HJQA 3WH5A 2QHAA 2YJQA 1PIGA 2D3NA 5ECUA 1JDCA 1VB9A 4M81A 4PTVA 3ARUA 5ABEA 1QHPA 2WHMA 3PZGA 3WNMA 3FNDA 3HJEA 1WP6A 4MAVA 1UWUA 2DT3A 3POCA 3KL5A 1FHLA 5E09A 1IZJA 2PBGA 1IV8A 1UD6A 4MB3A 3VIGA 4FF5A 1OD8A 2GDUA 3ARYA 1FH7A 3FN9A 3ZJ6A 4PMDA 4H04A 1WZMA 4D72A 2W4XA 2ZXBA 2JF6A 5FOOA 2J7EA 5F7UA 3EYPA 1KFWA 1OWQA 4UQEA 5DMYA 1UKPA 4S3KA 2CERA 4CU7A 2YL6A 2WK2A 2CESA 3D5HA 3DHUA 2Y4SA 1B30A 3PHAA 4X0NA 1KBBA 1WZKA 2VC9A 3L2MA 2F8QA 2D3LA 3WD0A 5A69A 3HMCA 3N13A 3UR8A 1XH2A 4AYSA 1E6ZA 1R7AA 2PWGA 3U7VA 3VNYA 2J8FA 3M46A 5D9PA 4PMNA 4LXFA 1DWGM 1NP0A 3GH7A 1Q6FA 3MU7A 5CLWA 2J62A 4F66A 1V3MA 3VX0A 4J3TA 5E6ZA 1JGIA 1J0HA 4GQQA 2O9PA 1K9EA 3KL0A 1UA7A 2WKLA 1C8XA 2CBJA 3CMGA 3L4ZA 4A4AA 4PRWA 1CDGA 3L2LA 1ZS2A 1OD0A 1JZ3A 2VZTA 2BV9A 1V3IA 1W9UA 4MTVA 2WWCA 3WBAA 1GNXA 1X6NA 3S2CA 3DHPA 1SMAA 3W53A 3ARVA 3AHXA 5BYWA 4MJ2A 3W0KA 3RM9A 2OYMA 4F9DA 3WEOA 1M03A 3AHVA 1KQZA 1UD3A 1H5VA 3AIEA 3CUIA 4FLSA 4OJYA 1UD8A 3MV11 3VIFA 3NSNA 4GZJA 4NI3A 3W37A 1XYZA 1G01A 3UCQA 3G6LA 2J7HA 1CWYA 2XWEA 1ISZA 3CZJA 4BQ2A 3THCA 1U2YA 3ZO9A 2E8ZA 1R8LA 4HA3A 5LA2A 3MUZ1 3VOCA 2VJXA 4UOJA 5EBAA 3W6MA 5A2AA 1TA3B 4ZEPA 3NUKA 5DO8A 2D2OA 2TAAA 3WIJA 2CETA 4QP0A 4U3AA 5JBEA 3BCDA 4NF7A 4GO8A 4CVUA 1KCLA 3AS1A 1A3HA 4CCDA 4KGLA 3PZ9A 3EBVA 3RDKA 2YDQA 2YL8A 2PWEA 4HTYA 3I3DA 4H8VA 3OBAA 2VZUA 4NRSA 5C70A 2WKGA 8A3HA 1XSKA 1BAGA 3WD4A 3PN8A 1GW1A 4DUWA 3CZGA 2CHOA 1DWJM 1V0KA 2A3BA 4HOZA 4AD3A 1PIFA 1PAMA 1GHSA 2D20A 3BH4A 1VBUA 2OSXA 2D22A 2DIJA 2Y8VA 1O7AA 4P7LA 3CZ8A 3EDDA 1CGXA 1RP8A 2GJXB 3AOFA 3AXIA 1V02E 4UFLA 4UNIA 2BVYA 2WZEA 1I75A 4P7QA 2XG9A 3PZTA 1DHKA 1VAHA 2VX4A 4DWSA 1BYBA 2JALA 2OYLA 3EDJA 2WVSA 1WPCA 2V3FA 4KWUA 4F79A 1ZB5A 1WZAA 2BY3A 5JUVA 1AQMA 4AEFA 1KXHA 1S46A 2O9TA 1XSJA 5A8NA 1PX4A 1W91A 4L4PA 3WH8A 4GIAA 1I1WA 4ATLA 4MNMA 1WDPA 1Z32X 1HJWA 2EPOA 1F4AA 1LG1A 4HOXA 2O92A 2OSWA 4JHOA 2J79A 3LPPA 1W1PA 3VGEA 3VIPA 1WNOA 2DSUA 3KL3A 5AC5A 3OLDA 1E0VA 4CN4A 1MVYA 1NQ6A 4B9ZA 3VIJA 4XB3A 4LQ1A 3VGHA 3CZLA 2GFTA 4FMVA 3NYDA 4CCCA 3VMPA 1JYWA 3OGVA 1M53A 4W8AA 4DUXA 1BVNP 2VCAA 4GZIA 3TTQA 2WNWA 1XSIA 1GVYA 3AROA 2WCGA 1TG7A 2QPSA 3SIMA 1ZJAA 1E3XA 1LG2A 1VFFA 5IHRA 4W86A 1KBKA 4UTFA 1UQYA 2DQXA 1DP0A 3W24A 3T2QA 3UG3A 3VGGA 4HU0A 4AMCA 3GTNA 1G94A 4W84A 1WDRA 1QI0A 2X8RA 1Q6GA 1ITCA 4Z2GA 4J27A 3E1F1 2BNJA 3PTQA 4AD1A 1BG9A 2VO5A 3RIKA 1CXEA 1H0IA 3ZR6A 3SCRA 2ZUTA 1KCKA 5JIPA 1UWRA 5CXPA 5KEZA 4AZ5A 1VJZA 3NDZA 2CBIA 1XGZA 3AIWA 4YHGA 1OM0A 4EANA 4CVWA 1EIBA 3WH6A 4X9YA 4P7OA 2VI0A 4BS0A 4B16A 4H8HA 4DUVA 6A3HA 3VVGA 2GJPA 1KWKA 5I78A 1CBGA 3OGSA 2EPNA 3GDBA 6CGTA 3VIKA 3ZT7A 4AXNA 3QGVA 3SCVA 3PZQA 1ISVA 1UD2A 4ACZB 1UKQA 4JHZA 5CLTA 4QDMA 2WMHA 4PMVA 3MMDA
chains in the Genus database with same CATH superfamily
5GNZA 2GJXA 1FH9A 2W91A 1JUBA 1W37A 3H55A 4QRNA 4AH7A 4F0LA 3S5NA 4CU6A 4B3KA 2BOEX 4DPPA 2CEQA 5EMKA 1GORA 4MKVA 1SJAA 5SWUA 3VIHA 1NWUA 1GOWA 2PDHA 4R7WA 1DL3A 2WCSA 3TN4A 3RLVA 5HMDA 3GTHA 2FKPA 3WN6A 3P67A 4KESA 4R7JA 1J5SA 1N8IA 3FEMA 3TYZA 1B3YA 1CXKA 1KXQA 2ZUNA 1DQWA 1AVAA 1FFRA 4W9PA 5DY3A 2GOKA 4YTTA 1YDYA 1ZAJA 2EG8A 3S6OA 3EKLA 3I6TA 4J3XA 1OC6A 4PMYA 1KTNA 3R6IA 4AEOA 1QZ2A 1J01A 4M56A 1TTPA 1V08A 2ITKA 2QMJA 2WPBA 1RVGA 2C8NA 1UA3A 3C3NA 5D2VA 1ADOA 3K4WA 3W7HA 4IP5A 1VF8A 3S5YA 1EKOA 4HSOA 5J5RA 3HIJA 1XYBA 1JCTA 3NIYA 3OJGA 4FAMA 1E56A 4AD5A 1LOQA 3BOXA 3D3AA 3M0MA 1J6YA 3VNMA 1SW3A 4PB3A 5D37A 2P50A 3T05A 5I07A 3CU2A 3UPMA 2NSXA 3QQ0A 2B31A 3A64A 3VNZA 5AC4A 4QZVB 4CD7A 3M4HA 2ESCA 1M41A 5DMLA 3ZFHA 1OINA 2OO0A 3WK1A 2ZQVA 3CMJA 4LVDA 1AMYA 4MHBA 5FF3A 4OGZA 1RPKA 3VAVA 4I3GA 4IT1A 2KAUC 1FFQA 3S9ZA 4GYFA 1K77A 1A5UA 1EUNA 2Z1BA 4TW6A 4HPJA 1B31A 2GJNA 1MEIA 2XP7A 3WQWA 2YGYA 3A13A 1CT5A 4WQ6A 1A5SA 3P60A 1QPLA 4UQAA 5FI8A 3RPDA 2B81A 2C3ZA 4L80A 2Y7EA 1NTHA 3MSDA 4LUTB 5BXJA 3L67A 3DN5A 2OELA 2ISFA 5T9CE 1I60A 5TAOA 4C6KA 4GNJA 5D9OA 1DPMA 3N6JA 3WD1A 3AALA 1IZCA 4JFVA 2AAMA 1G4PA 3CUFA 1OT1A 4MY9A 4GVFA 3EOEA 4X63A 3EWCA 3EX6A 3KAHA 3GXPA 3DFPA 3W7CA 1THFD 4GUJA 4GPNA 1QBAA 3ALGA 1KM5A 2DVXA 2Z6JA 2BHUA 2V2CA 2BHYA 3PG8A 1YRRA 4FLOA 2FGZA 2XH0A 1UKTA 3S1WA 2OVLA 1VRXA 4HYRA 1P6BA 3I6RA 2QW5A 1NFPA 4AQLA 3IK8A 3HQNA 3B0VC 3R1ZA 1DXFA 4TQTA 1PTAA 3U8GA 4GNVA 2A7PA 2I9EA 4HMCA 3UG8A 4DIAA 4UCGA 1IXNA 3A12A 2CKSA 2UBPC 3N19B 1TZ7A 2V5BA 3ZLFA 4QFUA 3SECA 1SFLA 3UU0A 5BXPA 4MFEA 5EFFA 4UMAA 1CEOA 1H7WA 4LC6A 5DMMA 1Q6IA 5HNNA 4ORMA 1GT8A 3GNNA 2VVNA 3DU0A 2ZR4A 5F1UA 5I23A 1GEQA 2PUZA 1OBAA 2HBXA 4YVPA 1DV7A 4QIUA 2VEKA 2VGBA 5I2UA 3KFTA 4YVXA 1BEUA 1EC7A 2NZLA 4HD5A 2FAPA 1TV4A 3QR3A 3A24A 2HK1A 3OLIA 1Z9AA 2JQXA 1F6PA 3TTEA 3OVRA 5IBXA 2Z28A 1TR9A 4P2VA 3KTXA 4HIBA 2QCFA 1AD4A 4C5YA 4JZ5A 1J6OA 1TWDA 3WQFA 2PA6A 3AIUA 4W5ZA 2K8IA 2I7GA 4IPLA 5H91A 1BF6A 1M9HA 3B0XA 3H8AA 1C90A 1LORA 1QW9A 3LXAA 4WRHA 4MDOA 5HR7A 2Y5SA 1ISXA 4UQDA 3W88A 3O06A 1SW0A 1GQJA 1ITQA 4MWAD 4LYRA 2SFPA 1RBLA 2YX0A 3CQIA 3TSBA 5HR6A 1M65A 3BZJA 3E2SA 4Z2IA 3PPGA 1RPXA 3S1GA 2Z1WA 1F6KA 2CLPA 3WLRA 1QU4A 3USBA 2XGBA 2JKPA 1B3XA 2PB1A 2PBOA 4AD2A 2ZOXA 1XBXA 5AVNA 2HROA 2WPGA 1A3WA 4RNHA 4LC8A 2RURA 4FA3A 5A6BD 3ZVHB 2ALRA 4DRNA 2FPVA 1YX1A 1EQ3A 2PODA 3LS9A 4F40A 5GJNA 1C8YA 2Y70A 4REQA 2V6AA 3AHTA 4K37A 1B57A 4PMXA 3A5VA 4QXIA 1QNPA 4QS6A 2ZXAA 4JY8A 1EUAA 1S2TA 1XFCA 1ALDA 1YW1A 2GZXA 3UEQA 3M1ZA 4G2DA 1UP2A 2YBTA 3UYCA 1UWTA 1D8CA 5CGTA 3TMQA 1DIEA 3DHDA 3UWWA 3KCOA 2JEQA 1TA3A 4GI8A 3VNIA 4LEQA 2QCLA 1UR9A 2XSBA 3EX3A 4C60A 3K13A 4LCRA 4R0XA 1GEHA 3L5LA 4B5VA 3V7PA 1SJDA 4BKNA 1V3KA 2X0SA 1W5QA 4FS9A 4UOZA 3MZ2A 4UTTA 1ZHAA 4RCXA 2PDXA 5I3FA 5LA1A 2RUSA 2X40A 4AB4A 4AWTA 1MDRA 3WBYA 1DEDA 2G3NA 2J9ZA 4GI6A 4H7CA 3IHZA 1V03A 2PF0A 5EFDA 3E3HA 3AZTA 4GO9A 3TC6A 1CPUA 1EJSC 3URQA 4G7FA 1VJIA 3AYRA 1OFQA 4Y96A 3AMDA 3BE7A 4IP4A 1SVDA 4IQJA 3KDNA 5I77A 5K9DA 1DTNA 3CPGA 2E8YA 4RDYA 2Q01A 2J8TA 5A8MA 1EWEA 2JF7A 1VCVA 3LHTA 1A0EA 4TNSA 1A5MC 1RV8A 1H4PA 1XRVA 4MJZA 1E55A 4JIRA 3NCOA 1KBIA 3SBFA 2NLYA 3PB2A 5FCZA 5H8UA 4I9MA 5DMNA 3QHMA 1VFSA 4GI9A 4YN5A 3GXDA 1KXTA 1WUEA 4B5WA 1TTQA 4JTEA 4IMCA 2OU4A 3WF0A 1XLHA 2PDGA 3RF9A 3MDWA 1SSGA 4ZS6A 3U2EA 3TDBA 1TV5A 1IXPA 3ZWTA 3QN3A 3W29A 3HM7A 1IT8A 1UKSA 2REQA 5CSYA 3NPXA 3NPUA 1F73A 3IGSA 4RDZA 2R91A 2TODA 4IQ2A 2KGJA 5I09A 1VEMA 2AL1A 4ZE5A 5E9AA 1V79A 1H0GA 2YBVA 3FY1A 2YLLA 1TREA 2XFYA 3QPEA 2DSVA 1J0JA 1Z7AA 3AIQA 1FKXA 3L4VA 3AXMA 1IQ8A 1P43A 3NQGA 2R14A 3II1A 4UIOA 4FOJA 3MPGA 1QVBA 5MKGA 1Q6OA 5A6KA 2NUXA 3WBWA 1VIZA 3GR7A 1JZ7A 3MS8A 2DIEA 4TVDA 3ANVA 4G2PA 3NGFA 4EXBA 5ABHA 3N6QA 3QTPA 4DEFA 4HHMA 1GOQA 4HCLA 1JPMA 3ZJKA 3WQVA 3NURA 4G9PA 4F9JA 5CPOA 3D47A 3N2CA 4JKMA 1UH4A 5I5RA 4FX8A 3ZS4A 1UZ4A 2YFNA 4IMAA 4C91A 3K4AA 4ASTA 4R7OA 3RMJA 3B03A 4Y2WA 5C0QA 4AW7A 4LX4A 1E70M 3M0IA 3G0XA 2FHBA 4R9XA 2EPLX 4QNWA 3WLKX 3SUVA 2G96A 2JIWA 5HNRA 1PKYA 3GVWA 2F2DA 2BY0A 5CKSA 1VCGA 5LXEA 2PPGA 3O5GA 3OODA 3PBGA 4NZ5A 4JFWA 2YCLA 4DVOA 2GVLA 1NFGA 3NI6A 5CSSA 4ERIA 1FDYA 2BXVA 4Q4KA 5CPMA 2X05A 3CQ0A 3JYMA 2JEPA 3BJSA 4LUSA 1TZZA 3SN0A 4LYKA 3B40A 4NZ4A 3OVPA 2C15A 4BQ3A 1XIMA 1H1YA 4S3EA 4U5KA 5A3HA 4PMOA 4ICMA 3KWSA 3AICA 1L8NA 3GTFA 2FTYA 3EWWA 1IT0A 4DB7A 3CJPA 2FH8A 4HHLA 3UF8A 1TMLA 1SZFA 1YBQB 1EHNA 1N8WA 3C4UA 4TVUA 3VDBA 4YYFA 1Q2SA 1UUQA 1NM9A 4DZ3A 4HMDA 2YA0A 3O5EA 2G8ZA 3ERPA 1UR1A 3MZNA 1VD6A 2DZXA 3PTMA 3BARA 4Q3MA 1TE1A 4GXWA 1WO2A 1I2QA 1PTDA 1R3SA 1RD5A 1NF7A 1AFSA 1FX6A 5T91A 1JI2A 3HTWA 1EWDA 5HAOA 1OCQA 2PDLA 5B7ZA 3GIQA 4US5A 3O5IA 3SJNA 3A9IA 3CGTA 5D75A 1SYTA 3AYSA 2ZZ1A 2WSQA 1P7TB 4QTGA 3BGGA 3UXLA 1FHUA 1IEIA 4UFMA 4TTUA 4YTQA 2Z1VA 2WYSA 1FAPA 2VMFA 1NFBA 4B3LA 3VAWA 3K8MA 1S39A 3KE0A 2BVDA 3HB9A 2XSAA 1VZWA 1KW1A 4ZO6A 1PCKA 1NSGA 5FF7A 1LWIA 4C5ZA 4F0SA 3WY1A 3QY7A 2QPUA 5AYYA 3NQVA 6XIMA 4GIEA 4YU1A 4E4FA 1KC7A 3RLHA 5CG7A 3BQ5A 2R1LA 4BF7A 5FAJA 3BMBA 1E4MM 4Q8UA 1FJDA 3WQCA 1D3GA 1P4CA 4BCEA 4J1OA 4H83A 1V6WA 2MPHA 2V0TA 1OCBA 4GFSA 1ONWA 2MANA 2NQHA 1WAWA 3QW4B 3KABA 3H26A 4WKAA 1WE5A 4QCFA 3G8RA 5BRPA 5DANA 3RX3A 1LL7A 3M41A 3JRKA 3N9KA 4AXKA 1A5BA 1PBGA 2GDVA 2R9RA 2OOFA 3WD2A 5BZAA 1NJJA 1IT7A 4UZUA 3W87A 4XZLX 5FF4A 1TVLA 1JPHA 3WEMA 3PZUA 4E8DA 4PODA 2BGNE 3VPLA 5D02A 1B3WA 2IXUA 3W1RA 4NIRA 1KV8A 3SQSA 1FWWA 5CBJA 1NWSA 2J47A 4M6UA 4W4QA 1AZ2A 2CFFA 4DF1A 3AO0A 4K36A 3LENA 2V38A 4GQGA 3NG3A 4HZ8A 1AJZA 3NQ6A 4DELA 4B4HA 2YBUA 1KGWA 3FDKA 4QE5A 2PGWA 2ACSA 1SGJA 3KAGA 1M5YA 1TUXA 1E73M 5IDIA 1REQA 3W6YA 1W1YA 2GK1B 4L61A 2ZCGA 3NL3A 4XZHA 3IIVA 1EO7A 1T8QA 1LRTA 4F48A 2QCDA 2Y24A 3UERA 5MKGB 3MI6A 2AAAA 1V3JA 2VZVA 3NTYA 1NP2A 3QKEA 1Z42A 1GYLA 1QRQA 1HJVA 1AD1A 2BXZA 4XD4A 2ZC1A 1J9YA 2FVMA 1V3LA 3H4WA 2GGHA 1C9DA 3S4TA 1HJUA 4LS2A 5F4SA 7CGTA 5M03A 4GC4A 3ABSA 3AI0A 5XIAA 4G1NA 2XGIA 3BAXA 3NVDA 3KRUA 4I7WA 4C1LA 1RUSA 3MSYA 1MW0A 1YTKA 3H2OA 5EGRA 1D8WA 1TB3A 1C92A 4I6KA 2E1WA 1TX2A 1U83A 1MUWA 2VRJA 3IKDA 4DI8A 5AY7A 4QIBA 4Y7EA 5E70A 1W8GA 3LHUA 1IWAA 2WVVB 1ZBWA 3PJTA 3TROA 4ATWA 5I3KA 3AIVA 3PS7A 2W0UA 4JHMA 3S8HA 1D9EA 4TX6A 4XX6A 4ADSA 5CC3A 4WXZA 4BEUA 1D3HA 4CEXC 2XPBA 1P6WA 3VZXA 2A3CA 1LDCA 2Z25A 2OR2A 5CJNA 4PUDA 3GU0A 3R4IA 3SRDA 3S5OA 3LQLA 1TPEA 1AL7A 5F2GA 3N6HA 4B5TA 4M8UA 2RFGA 3CAVA 5LIXX 2EBNA 3TWAA 2OEKA 5DQPA 4AD4A 1JCYA 4H9ZA 4JFTA 4N2YA 1Q4WA 2ZUWA 1YTEA 5CZTA 2DGAA 4KRUA 1KM4A 4I9AA 3FSUA 3NQ7A 4KEMA 1GK8A 4FF7A 1TPFA 3SJ3A 4EPDC 1DJYA 2ICSA 3AMCA 4DJED 1QNVA 3M0XA 1XCFA 3P0XA 1WV2A 2G3JA 5DXYA 1EQPA 1F8AB 3B7XA 1IIGA 1A80A 3RJYA 2DDXA 5F1VA 3G3MA 4Y8FA 3PBMA 4H9TA 5FJUA 2Q8ZA 1R30A 2BVWA 3VGBA 2WZIA 3M0KA 2HNHA 4M0XA 1FWBC 2QNEA 1IXOA 3QHOA 1XQKA 3CLWA 2INEA 1JCJA 2PDKA 2WBKA 1RY8A 3EOSA 3CV2A 1RHCA 4C7DA 1LRQA 1UD5A 5M1TA 3OGRA 2W79A 3N29A 3NSXA 4PBEA 3E0VA 1W3HA 1VS1A 2EPHA 3BLIA 5H6HA 3W1PA 2WM0A 1S1PA 1XF0A 3WQOA 3UQIA 1XPYA 3VKCA 1OFEA 3O6DA 3LOTA 1E0UA 2ZQTA 4H3DA 5FL0A 4DJFC 3A23A 4MB5A 1UG6A 1B2YA 3LLDA 5D04C 3PVFA 3N11A 4QBXA 3H54A 3LTSA 3W73A 2MNTA 4DRJA 4E2DA 3SN1A 3H7VA 3DG7A 1EJRC 3JYJA 5BRBA 2TYSA 3MVTA 4I7VA 2ZKMX 5G4HC 1JRCA 2OKOA 1FOBA 3UG5A 3EWDA 3DG6A 3OZYA 1S5MA 1OY0A 4O12A 2J8GA 5I00A 2VCCA 4JQ1A 4ML9A 4LNYA 1K3UA 2DUAA 3PJUA 1YPXA 3R94A 1WDQA 4OTKA 4RLIA 2VOTA 4HBEA 3IVSA 4DRSA 3VCRA 1U5JA 3FHAA 1W9VA 4Q7IA 2VD8A 2W61A 2FH6A 4QG6A 1A49A 4ALDA 3ES8A 3GSMA 4LYQA 1E6QM 2RDTA 3AC0A 3KBJA 4AFYA 1GW9A 2H3DA 1LQAA 2POZA 5HWBA 1U33A 2EJAA 4W87A 2WC7A 3B8UA 5IDZA 1K6AA 3HA1A 3MMUA 1QNQA 1UB3A 4MB4A 2BS9A 5M2FX 5BXRA 4W7WA 3B06A 3R11A 2MLYA 3MQTA 1HO4A 3WZ0E 4G7EB 5HMEA 4K2SA 2DPEA 1XYCA 2BODX 2REQB 1LLZA 5E9XA 4O50A 3IS4A 3NGJA 2BGQA 3I6CA 4FLRA 1JDDA 3M7WA 2E7FA 2WVUA 1TWZA 4YLWA 1O66A 4D9PA 3ZOAA 2DSWA 4UTUA 3TYCA 1T99A 1AJ2A 5DBUA 2Q8XA 3EKZA 3HGRA 3W7GA 4PBFA 3N2MA 1T40A 1VBGA 2AQWA 3K8LA 4B15A 1KR1A 2JIEA 4KFNA 3CM4A 1E3ZA 4L5ZA 2EHHA 4UC5A 2DEPA 4O57A 3UJRA 4RE2A 3GG7A 3V4BA 4DPQA 2PDIA 4ODOA 4J3SA 3DENA 2IPGA 3MUAA 1CXFA 5A2BA 1CX9A 4GKTA 1GTEA 3BK0A 3A3WA 4ICCX 3FVMA 4Q4RA 4H9MA 1WDDA 3DFSA 4Q7NA 4NAFA 4NNBA 5A5WA 4CNOA 1N8FA 4CD6A 4BEQA 2YZRA 4AIUA 4OUEA 1X1OA 3UZXA 3VXGA 4FNQA 4UTIA 2INZA 2XVNA 1C91A 4F0HA 2EPMX 3GHSA 2E6FA 3DKLA 2VP8A 1E72M 3G8EA 1GOOA 4GZ7A 3MSRA 3TC7A 2HISA 3L4WA 3AS3A 5CZKA 5E0CA 2O4QA 3ARZA 4DLFA 1DWIM 3RFWA 4QDWA 5KINA 4RNIA 3DC0A 2ZVRA 3MCMA 1TE6A 3O5OA 2OMAA 1UBSA 1K6WA 2WZTA 2BTMA 1F07A 2HS8A 3TE9A 1XLBA 4QGCA 3O16A 1JDCA 4MKSA 1VB9A 5HNUA 2QQ6A 2YXOA 1GJPA 1XRSA 3W9ZA 3CIXA 4JIQA 2WHMA 3GPKA 3FNDA 3AU6A 1UPMB 4NZ1A 4RK8A 5E09A 2BGSA 1X7FA 2PBGA 1IV8A 1OYCA 1YBQA 4R53A 4FF5A 4WEVX 1WZMA 2A7NA 4D72A 1S2CA 4JNMA 3R5EA 3M0ZA 3PSVA 1KFWA 1KFKA 1I8JA 2YL6A 4C6CA 2V63A 2WK2A 4ILSA 1GYMA 1KBBA 3VKAA 2RUQA 1TCOC 4HJWA 2F8QA 3TR2A 4LCQA 2EG6A 2D3LA 3HMCA 2F7FA 4FNUA 1XH2A 4LNCA 4AYSA 1F40A 2A7RA 2J8FA 5J5DA 4PMNA 1C9HA 1NP0A 3S2JA 3GH7A 4L7ZA 4AC7C 3UW6A 2DU2A 3IVUA 3XISA 1DYSA 4J3TA 3UCCA 2FIQA 3L12A 1J0HA 4EACA 3KL0A 3EXRA 4PRWA 1P1MA 1CDGA 3FEQA 1OD0A 3IACA 1FWEC 4S2BA 1Q7ZA 4MTVA 1AW1A 3W83A 3E6EA 2VWTA 1HUVA 3DHPA 4HYVA 4YCOA 1SMAA 4XUGA 3I4EA 4OHQA 1XIJA 1YXDA 4RNJA 3AHVA 3Q2DA 3UI6A 4V1XA 2NSOA 5HWMA 3CUIA 5LGZA 3ZYZA 1H5YA 1F3XA 3VIFA 1VP5A 4PRTA 3NSNA 4GOAA 4RW3A 1MUMA 4GZJA 4O14A 3GQYA 5KTLA 2E68A 4BQ2A 4O19A 3ZO9A 4AVFA 5FF0A 5LA2A 2R1MA 3MUZ1 1IR2A 2QJGA 2V67A 3DBNA 3C2VA 2VJXA 1JNSA 3GO2A 5A2AA 3TR9A 2XIOA 2W3ZA 3NUKA 5BU9A 4GGBA 5DO8A 1F3WA 4QP0A 1EC8A 8RUCA 3KCJA 1XLCA 4CVUA 1PHQA 1KCZA 5JMUA 1IX5A 4MKNA 1J93A 3QPZA 3LNMA 1IYXA 3EBVA 3RDKA 2YL8A 1YXCA 2IKGA 5BOOA 4I9JA 3WLMA 3I3DA 4G8TA 2VZUA 4QNEA 2QDHA 2JGQA 5C70A 2VEMA 4DNHA 4XSMA 4OUIA 1XSKA 2G3FA 2QUTA 4DUWA 1V0KA 3FYOA 4GBDA 4FXFA 2V81A 3MP5A 5C2GA 1O5RA 4CQBA 2DIJA 2HS6A 1O7AA 2NQLA 1REQB 1IR1A 4X2RA 2WJFA 4XWUA 1A4MA 3TSDA 2ATSA 2BVYA 1P48A 3LMZA 4JQ3A 1P0NA 3VUSA 3PZTA 3UCDA 1RCQA 4DWSA 1BYBA 4JYEA 3EDJA 5D03A 3UR2A 3WG6A 1ENUA 4Q6JA 3APYA 3R8RA 1WZAA 3UA4A 5JUVA 3CQKA 4AEFA 3U2CA 2PU0A 2LJ4A 1GWJA 5A8NA 2IW0A 2Z2UA 1W91A 4O53A 4L4PA 1TV8A 3KBVA 2ZR5A 1I1WA 4MNMA 3V0SA 3WLHA 4V1YA 1Z32X 4JTIA 1HJWA 3UZZA 4F2TA 1F4AA 4HOXA 4NAFB 3V3WA 3GRIA 2J79A 4DJFD 3VGEA 4YTUA 3OLDA 3JZUA 1IE7C 2WSYA 2PPNA 3RITA 3TUUA 4NZ3A 4LQ1A 3LB0A 3E49A 3TDFA 4JTTA 1JYWA 2QYGA 4HNCA 1KTBA 4M7TA 3FJLA 4W8AA 3THQA 4DUXA 2VCAA 3CUZA 4GZIA 1PINA 4CNNA 3TN6A 3AROA 5GJPA 3OG3A 4MUZA 4LAUA 4RV8A 1H7OA 1O12A 4Q8PA 3EX2A 4DWDA 4W86A 3URAA 1TWWA 2VC6A 2IQ0A 3NVTA 1OZQA 2C19A 5CC5A 1KRMA 3P5YA 4E3VA 2YW4A 1F05A 3QM3A 1WDRA 1QI0A 2L2SA 1PDZA 3CB8A 3IGXA 1ITCA 4J27A 2PDQA 1BL4A 2ABBA 1A0DA 3QFEA 1GVRA 3IRSA 1H51A 5CZ0A 2YPIA 3GC5A 5JIPA 3FV9A 3KVKA 3L9CA 5K9XA 1W26A 1VJZA 3VC6A 1DJHA 3L5AA 3AIWA 4YHGA 3KLKA 2QCGA 4UR8A 3SO7A 4DH0A 2ZRWA 4Q6XA 4P7OA 4B16A 4DUVA 1V7YA 3A21A 1W6TA 2HVOA 4DO7A 1OX6A 3LHYA 4K8GA 3VIKA 6CGTA 3QGVA 3NL6A 2DZAA 3HG3A 2DG3A 1PV8A 4QDMA 4O28A 2WMHA 3UGVA 3Q45A 2LKNA 2R1KA 2QKFA 1ONEA 2DZTA 1XGDA 4XO7A 4EVZA 4B2DA 1ZY9A 1MNZA 3VO0A 4LAVA 3EB2A 4C6JA 3QSTA 4LV9A 5CPLA 2XVLA 1ICPA 1SR0A 4MWAC 5FJRA 1EIXA 3I4KA 5G2WA 3VGFA 1WBHA 2DT0A 4LVFA 1YNPA 3KBMA 5LIKX 5LGXA 5LIUX 3N15A 4DBWA 1W5PA 5LSMA 3KCLA 3BO9A 3G0SA 4GCXA 3QTGA 3L23A 3O9NA 5D9NA 3QBUA 4UFJA 1C7SA 2YA1A 3BSMA 1KFLA 1XKYA 4KWOA 2PTYA 1KB3A 3U2OA 1WDSA 2JE8A 1BLIA 2OZTA 3BAJA 4GQ0A 1V77A 3F5KA 1HW6A 2VZOA 4PE8A 5M17A 4MNKA 1E71M 4Q8WA 3T2OA 4DRHA 3KOXA 3CHFA 4RPQA 3W38A 2GUYA 4MUPA 5DFAA 1UZ1A 2I5QA 4G5DA 3VNLA 4Q32A 1CW2A 2Q8LA 1E0WA 3AS0A 3WNLA 2OB3A 1JNDA 3S1VA 4DXVA 2RUDA 3A6OA 3S2LA 3WL0A 1KRCC 1FHDA 4MWAB 2QIWA 2F6UA 4I7UA 4TW7A 2X42A 4NJHA 4WJ8A 3RG6A 3PK7A 3C0JA 1SFSA 1RAKA 5BMWA 2E9MA 1NWRA 3H70A 2VD9A 3LLFA 3I7QA 2OEJA 1ONXA 4ADTA 3IVTA 3EWBX 1Q8AA 3W85A 3W7DA 3DFHA 1G4SA 4K8EA 2XYLA 1OQFA 5CH9A 5AYZA 4UQ9A 5A6SA 1X6LA 4H8UA 4C6QA 3XIMA 2Y78A 3TJLA 1FHVA 3ZSTA 2NQJA 5FF2A 1X97A 1WXJA 4DX3A 3I3EA 4IF2A 4NG3A 1I45A 2V68A 3VD9A 4X0VA 3CZEA 2OG9A 1EYWA 2VYOA 5KZMA 1WB0A 2IUZA 3SY5A 4W9TA 2Z1SA 3S9IA 3PG9A 3MJMA 2OLAA 1YDOA 3MKKA 2H6RA 2XFRA 2E4TA 3H7UA 1PYMA 2PCEA 1BHGA 2Y7FA 4ODLA 3N25A 1OFBA 4KKXA 4DM2A 1QHZA 3GC2A 2YXGA 4OKDA 1RQBA 7REQB 2FDMA 4DIPA 4M5PA 2GVYA 4Z1AA 1YIXA 5T26A 3C0QA 3MKVA 1E40A 3RHGA 3IV8A 2YYTA 3KS6A 3N4AA 1EP2A 2VX7A 3P0WA 3PC0A 4S3FA 4DQWA 5KETA 1AUSL 5FJJA 3SUWA 3ZWSA 4JEJA 1V7AA 1YLVA 4IFRA 4FLQA 3QMRA 4HN8A 3NQMA 1ISYA 2IQTA 4JAWA 4C6NA 1UOKA 1Q85A 5A94A 5HMFA 4GQBA 2B7OA 1XV8A 2QCEA 3KW3A 3VMNA 2JZVA 4KMQA 1WOAA 3K5XA 4E0CA 2D2HA 4RW5A 1V0MA 4IQEA 1AH3A 1XD0A 1O1ZA 2ZRYA 4P8XA 2PTWA 4HZ6A 4AUBA 2QJNA 4Q7BA 2ZQSA 4N6FA 1L0PA 4ZE4A 2ZX9A 2F21A 4NX5A 1IEQA 1Q7MA 3MANA 4A22A 1J96A 1QOPA 2Z6IA 3LY0A 1I4NA 3MB9A 3NOEA 2V9DA 4JYDA 3TFXA 3UBPC 4Y9OA 2PI6A 5C9WA 1V6YA 2XIJA 4RXGA 4EIVA 1PSCA 2ZZ4A 4J5NA 4Y9AA 3HU7A 1GVQA 1GZJA 4U2ZA 2KR7A 1WA3A 3B8IA 3UXAA 4WF7A 2ZZ6A 4GCAA 2V3DA 4GE8A 1P0KA 3FJNA 4UQCA 4GX8A 4O8AA 3WF1A 4UR9A 3WK3A 2I5GA 3S3GA 1MQQA 3SW6A 3NXLA 5HPOA 5AZ0A 3U4AA 2YZ5A 5GJMA 4TX0A 1E9YB 4QJ4B 2HSAA 2C7FA 4A29A 1FP8A 4H2CA 4M82A 4GZEA 4UCFA 4AZ6A 4LALA 1HX0A 3W2JA 3EOLA 3VD7A 3O6YX 1E6SM 3WNOA 2YCEA 1UWAA 2FMOA 3SURA 2PP3A 3OLGA 1E4NA 1EOMA 1VFTA 5D8WA 5CCZA 4WSJA 1IEXA 3NZPA 4IX0A 1CCWB 5LZLA 1KGXA 4PSRA 3QOKA 2Q02A 3B05A 1ZL1A 5IBXC 3GDMA 1G6CA 1KR0A 3EXSA 2HEJA 3TOYA 2MF9A 3VYLA 2Z0IA 3JZEA 3WK0A 1TWIA 2FQIA 4J3WA 3STPA 3GNRA 1ODZA 4OOZA 3HBLA 3PA7A 3ATZA 3REQA 3T2PA 5FEZA 1M7XA 4TX9A 1UZDA 5HBFA 5I3DA 2Q09A 2HPMA 1W1IE 5H2ZA 3VI2A 3R79A 3GXFA 3UWYA 2FYMA 3F4CA 1GQIA 1JZ5A 4LSBA 1A47A 3VM7A 1MZHA 3EX4A 1QNOA 2AQOA 4X61A 3SIZA 3V36A 4FPSA 3VOGA 3KRZA 5C9RA 1L6SA 4C65A 1FKIA 3N12A 4Z08A 2WLZA 2WHJA 1F4HA 1OIFA 4LOCA 1I2RA 3SCOA 1X1NA 1E6NA 4J35A 2J9XA 2V2DA 3VABA 1SO5A 3CUJA 3SUTA 2ATMA 1CIUA 1FTXA 1GTHA 2Z7GA 3E02A 4E2VA 2WZMA 1J2BA 1ME7A 3NM3A 4O4VA 4DZ2A 4O0QA 4DWSD 1Z3NA 2OQLA 2JKEA 2PFHA 2VTFA 4AWSA 3D6NA 4JX6A 2E5CA 4LY4A 2ZUMA 4A8IA 5ABFA 3IAQA 1QPQA 2EXOA 3SQLA 1ZZMA 1UWQA 1BYCA 2B7QA 3E5BA 5EMMA 4JFUA 3TWBA 4A6GA 3OB8A 1UD4A 3HQ1A 3W1NA 1GQKA 4PUUA 1GOIA 1WYIA 1HKJA 4XZNX 1SJCA 5FEWA 3STFA 2E5DA 4YWIA 3WL1A 5CSUA 2PDMA 2Q3OA 3WJSA 2XZ9A 4GUGA 1E6RA 5DITA 3IJ6A 2VELA 4D1IA 5MHBA 3EX1A 2XFWA 2Y2WA 3U57A 3CAQA 4PFMA 1Q6DA 1VH7A 3SCSA 2RGMA 3CGNA 1W1B1 4IXHA 4L9XA 4J7RA 3TIMA 2WJZA 1GYNA 2DSZA 5DEZA 1CNVA 2WJEA 4XIAA 4GIRA 4AY8A 3RFAA 2WWDA 1A7XA 4D6CA 1UR2A 3H4XA 3NZRA 1S2AA 2F4EA 3QZEA 5CPNA 1ZPTA 5I6SA 1F6YA 3NM1A 3EMQA 3FXGA 1XLAA 4DNMA 2P76A 2DZWA 2QGYA 2R82A 3T6CA 3FFSA 3ZLHA 4CEUC 1OABA 3PPFA 4NZJA 1MW1A 2DUXA 3HFTA 3IGUA 4QROA 3W7JA 4QEHA 2V3GA 4I9TA 3N14A 3VZZA 4KCUA 4F0MA 3GNDA 1XI3A 3N2BA 1FWFC 1VIWA 3L21A 1O4UA 5CPSA 4ICNA 2ZX5A 3P74A 5HW8A 3W22A 1XIBA 2NX3A 3WEZA 1ZBKA 3CC1A 3FGCA 3I68A 3B9EA 1C9WA 3GBEA 1W5OA 5AZ1A 3WMSA 3LBCA 4ZPTR 4JCLA 1NDVA 3L5MA 5IHSA 4ZR8A 3G1SA 3UZ5A 4IL2A 4NKCA 5HPCA 4Z1BA 3A3XA 2Y89A 2ZUVA 1RJQA 5JBDA 1ITXA 4LT9A 2PRMA 1LBFA 1BQGA 4XISA 3O5MA 1EEPA 4S3AA 5HWJA 1W3KA 2C16A 1MQPA 3C0SA 2WANA 4ZSTA 4OZOA 4JR5A 1GZ1A 4P8WA 2BZNA 4WOZA 3MMWA 3RR4A 1DE6A 4W88A 1Y65A 1PE1A 1AQ0A 1W32A 4GXMA 5JQ9A 2VFHA 4I90A 4URIA 4S1FA 2ZDSA 3RRXA 2QMKA 4S38A 4V33A 1WKDA 1E9IA 1LF1A 4AWUA 1B5TA 4QAWA 3M7SA 1ZCOA 1E5NA 2OX1A 2MNRA 1IXQA 3TC5A 2AKMA 4F4RA 2XVGA 5BROA 3UQNA 2Y63A 1W9PA 3TQKA 1J79A 2PC4A 2WSKA 1EJVC 2A0NA 4GYPC 3EWZA 2XPKA 1GJWA 3FHQA 2VVSA 1SFJA 3URBA 1MWOA 3FYPA 3C56A 4LANA 2PTXA 1SMDA 3B0PA 3DIPA 1POJA 5B8IC 1M6JA 3UNDA 3ECQA 4R88A 2KE0A 3MV01 4GUHA 3GZ3A 3WLSA 3ANUA 1LZOA 1GG1A 4US5D 2J24A 8XIAA 3SCTA 2Z4GA 2GUUA 3OQEA 3N3MA 2PN0A 4LVBA 3KTSA 3RLGA 3CQJA 2O9RA 4HNVA 1BKFA 4A05A 1BFNA 5F2IA 2MLZA 2POTA 5A2CA 1S2VA 1E43A 2C91A 3KEHA 5HWNA 4BQ5A 2VENA 3APTA 1GOXA 1V6UA 1VFLA 4O17A 3O63A 4JFMA 2ZUSA 1QW8A 3OO2A 4WDWA 4H8NA 3QZ6A 2A3HA 2GSEA 1LUCA 3BLDA 3RJXA 2O9OA 4GWEA 1E1EA 2RJHA 1JFXA 5B80A 3V1PA 2PWDA 4XUYA 1T8XA 3ENLA 1NSJA 1M04A 4PUWA 4FIRA 2A3AA 2FHCA 4WDXA 2PV2A 3LPFA 1Y5VA 5E0KA 2EKCA 4GA8A 3RAOA 3EMCA 5IXEA 4IX2A 5AECA 4PMRA 4LVGA 4O1BA 3CYJA 2WMIA 1Q6UA 4ZCWA 5H1WA 4GY7A 3RPMA 3RM8A 3KX6A 3RNDA 2DT1A 4IOTA 3FKKA 3OG2A 3G77A 5AYXA 3CIWA 1IGSA 4HQVA 2ZR6A 4WXYA 2VDHA 1TJPA 3NQCA 4NILA 3VINA 1E1CB 1B1YA 1RH9A 2D9FA 3GG8A 3RU8X 2P8CA 5IRPA 1F74A 1R3QA 3ITVA 1PIIA 1B3VA 3RCNA 4JTAA 2D23A 1EZWA 1QPRA 5K4XA 4O18A 2ZE3A 4PRRA 1F5ZA 1DJGA 5I0DA 1U1HA 4TMBA 2GPTA 4WGXA 1BF2A 3WH9A 2R1PA 3NZQA 3LD5A 3W26A 1E4LA 1ICQA 1FQ0A 4PCNA 5BRQA 3ATYA 1FKBA 3HFYA 3AAMA 1R38A 1B90A 3IK2A 3PZVA 3FAPA 3U5YA 1MNSA 4RZBA 3O15A 2G3MA 1LM1A 4XD5A 1FCBA 4UR7A 1KBLA 1HKIA 3H7RA 3TW9A 3TNBA 4BWLA 2YB4A 3VDHA 4ONVA 3WUBA 3LMYA 4B2DD 4FOUA 4X3ZA 1XRTA 2J74A 2HK0A 3KHDA 3CWHA 2O56A 7REQA 1XYLA 1UC5A 2OGYA 4TV6A 2YL5A 1FWDC 4FALA 4DBSA 3PUDA 2OWWA 1ADSA 2GUBA 5ABGA 1JR1A 3MA8A 3TOPA 4N42A 3ITXA 3CTLA 1YPIA 2H8XA 1FKWA 1PCWA 4KS0A 1JGMA 3F1QA 3GDRA 3NO5A 1XUZA 3QQ1A 3TYBA 3CTTA 4JX4A 3P80A 2ZICA 2FB3A 1A4LA 4I6VA 5JH2A 1NAL1 3B9OA 1QUMA 2UY2A 4L4MA 2QJIA 1GKQA 5XIMA 1TVPA 1TWSA 2OZ3A 4HSHA 5REQA 2RH9A 1ZK6A 4EXAA 3O5LA 2XIMA 3ITTA 1TJ2A 4JTCA 1RJPA 3HJZA 3VCNA 3PTKA 2HE8A 1FH8A 1C3FA 1V6XA 2X1TA 4PFHA 4HSNA 3MUXA 3QJAA 1EZ2A 1UASA 1YPFA 4HKPA 2VQUA 1NU5A 1A50A 3F2DA 1NOUA 2C1IA 3U7BA 3NFUA 3ITGA 1N1AA 1HN1A 4JTRA 2WNNA 5BMXA 2YDAA 1I2PA 2YXXA 3GXNA 4S3CA 2PE4A 4RE4A 3DGRA 3GM8A 2AL2B 3WLLA 1ZJIA 4IG2B 3J7HA 4MGGA 4FOKA 3GUGA 1YADA 1BYAA 4XIMA 1K4GA 2KO7A 1H09A 1KQYA 4O52A 3OHIA 5K9CA 2VQTA 5H8MA 5HKGA 1ECEA 4ZB2A 3GYCA 2NLIA 1GVOA 3U4FA 2C13A 4OBTA 1Y0OA 2FFCA 1ZRQA 1PPIA 2YLAA 1HO1A 2XM1A 4DN1A 3OTRA 1UH2A 2PD9A 4IJRA 2V5LA 2XVKA 1WUFA 4HP5A 3MDYB 1HL2A 1JVWA 1FWNA 1W8SA 4JN6A 4DM1A 2C6QA 2X1IA 3GTYX 4IH3A 1Z69A 5GPGA 1R0MA 4PMQA 1JQXA 4F2BA 2QDDA 2QGHA 4MY1A 4JTKA 2WHLA 2WMKA 3WMLA 4PEKA 5D2TA 1HKKA 1S3HA 4A8NA 1J8VA 1UPPA 4HPNA 1MZRA 4E5TA 1J4RA 1OF8A 3VD4A 5BWFA 2DZBA 9XIAA 1V0LA 3NO1A 5HUOA 8CGTA 3IJIA 3AXKA 1QPOA 5BWAA 3TJXA 2EPKX 2G37A 2XISA 4MDPA 3NQDA 2NWSA 4PYSA 2XM2A 3CO4A 7XIMA 3PZNA 3TEVA 1XCWA 3MI2A 3T55A 4YTSA 3RMEA 1ZUAX 3POHA 1IHIA 1Q45A 5GNYA 2BVTA 2E0PA 1W56A 2VNCA 5DCBA 3VFCA 1A3XA 1A53A 4IUOA 4F2UA 2PF8A 4M1BA 3IAPA 2Y0FA 4N4QA 2CIPA 3F5LA 2V8ZA 4PB4A 2ZUUA 3WJYA 3OHMB 4NQ1A 3NDOA 5HQLA 3K1DA 1TPDA 3CLMA 3EEZA 3C86A 1UZHA 1QASA 4YNGA 3TJIA 4RR4A 3A22A 4N7QA 4Y90A 1DBTA 1YE6A 1J18A 1DJWA 1ZLPA 4JS3A 3C2FA 3WBEA 3M64A 2YSWA 1WZLA 3EIPA 2HJPA 4ZFMA 4H00A 4O10A 3O07A 3PJWA 1NELA 4XKYA 3BAYA 1DWAM 3ARXA 3ICJA 1FDZA 2E9LA 4C6EA 5C6MA 3I3BA 4AZHA 1RZMA 4RZ5A 3MYOA 1R9ZA 4HVXA 4GI4A 1EJTC 1KM1A 5HATA 2KI3A 1UP0A 4JNYA 2INFA 2V5DA 2WNQA 1AMKA 4W89A 3WENA 4LAOA 3SCUA 4TMCA 5E0FA 2NQZA 4JFJA 4FZIA 3UF9A 5D05A 3DH7A 1R9YA 3VDGA 4C6DA 3RU6A 1B54A 4P7RA 5CG0A 3WDIA 3LERA 3ABOA 1LBLA 2DZUA 1R46A 4RZ6A 3HZ3A 4HARA 1H50A 2W5FA 4E4PA 2DT2A 4YL2A 1PZ0A 2HNEA 1UIOA 3V0TA 3CH0A 3KTCA 3SY8A 4S2CA 1RLDA 4UMCA 5KMYA 3LGEA 5HMSA 3S5SA 5C8BB 4ZQOA 3FXYA 1EO5A 3AIRA 1E1FA 2NT1A 4MPQA 2CLIA 5C2XA 2GQ3A 2V5KA 4XD6A 3EDKA 4U3CA 3NEHA 5JXQA 4TUFA 4HPXA 4KPLA 4CUCA 1OK4A 1Q63A 4WVXA 4GJIA 7A3HA 2Y7DA 1ZGDA 1RALA 2OO6A 4ENLA 5TNVA 5CQ1A 1A5KC 4IMGA 5K2ZA 3D46A 1I0DA 1GG0A 4PCFA 1WOBA 2YKKA 4LBUA 4KW2A 3ZIZA 1O95A 4CN1A 1U30A 4O1AA 4NP7A 3ELFA 1JAKA 1KM6A 4A8LA 2C0HA 4DJEC 1OJXA 3LCHA 1TMHA 4QE4A 1RJRA 2W67A 4D8LA 2DY3A 1SQ7A 1JD9A 1IGWA 1ZJHA 3LBOA 4W85A 3TONA 2FMNA 3VOHA 4LUYA 2Z1XA 1O5QA 3WELA 2UZ5A 1PHWA 2GSHA 2OZ0A 2QIIA 4NRRA 4LV4A 3GHUA 4DLMA 3VE9A 2ASHA 1TIWA 2JKAA 2A3EA 2HMCA 2VOMA 2W63A 4X9SA 5HJLA 5AFDA 1J0IA 4O0ZA 4ZENA 2VEGA 3CL8A 3E2RA 4JICA 1Z41A 1QI5A 3WBXA 3AMGA 4IXXA 2YB1A 2A5HA 3TYUA 9CGTA 2IF4A 3VKDA 4ZMGA 1EA9C 2AKZA 3TU9A 5D2YA 3O5QA 4LH8A 3H2FA 2Y5JA 2ZRZA 4PULA 4IFKA 4A21A 3VNJA 3ARUA 1QHPA 1U22A 3PZGA 3WNMA 2CLFA 1OADA 2PMQA 5K3VA 3HJEA 1BRLB 1WP6A 1VYSX 1AK5A 1OX5A 3THAA 3RYSA 2DT3A 3SAZA 3G1FA 1FHLA 4QM1A 3WYZA 4MB3A 3VIGA 3DFNA 2GDUA 3ARYA 1FH7A 1US0A 3FN9A 3TCSA 4DT4A 4H04A 5F4WA 3T44A 1Y5WA 5U7SA 1U5HA 3MBDA 4O1EA 2JF6A 2J7EA 2NXHA 5F7UA 3EYPA 4A2SA 4UQEA 4S3KA 2CERA 4WY0B 5HK4A 4CU7A 3PSWA 4F3HA 4Z17A 3P14A 1FWIC 2CESA 5EBUA 2Y4SA 3PBVA 2AGTA 4X0NA 2DZVA 2FVLA 3Q58A 4PZVA 1T41A 3W1LA 1EJXC 1TQJA 4KIEA 3WD0A 1JUEA 1QOQA 3N13A 3UR8A 2PAJA 2PWGA 4FNPA 1NDYA 5D9PA 3QMSA 4LXFA 1DWGM 3NPVA 1PWLA 1XIHA 1Z89A 2OJPA 3GUWA 4CQ8A 1KBJA 1V3MA 1IWPA 2DJLA 1LT8A 1H1ZA 2HE5A 1MDLA 1C8XA 3L4ZA 4A4AA 2QCCA 2F38A 2I9UA 3CO8A 3T40A 3QC3A 1F3EA 2VZTA 4JNZA 1LYXA 2XN2A 3MBFA 2BV9A 4EWJA 1W9UA 2WWCA 4EAYA 3KOFA 4CNUA 3E38A 3QKZA 4JYFA 3TX9A 2RDWA 2V69A 5BYWA 1JCNA 4MJ2A 3W0KA 4BI6A 4M19A 1YTDA 1M03A 2QS8A 1KQZA 4ZA0A 4FSAA 3FX4A 1UD3A 3ORWA 1ZCNA 2B5UB 2EAWA 4KEZA 2ZYFA 1PUDA 2X7WA 3EB4A 1J6PA 4JYSA 1UD8A 4QITA 4JFKA 1VPYA 4GABA 4Q8VA 1NDWA 3EXTA 3SRFA 3W37A 4S23A 1FDJA 3MJYA 1JPKA 1CWYA 3ZVIA 1ISZA 2Y85A 4JTUA 3CZJA 3GC4A 1QATA 2E8ZA 3W84A 1R8LA 3IJLA 4LBRA 2DJXA 1A5NC 1TA3B 3S2MA 1LCOA 2OZ8A 3F2BA 4J4NA 3WIJA 3W2UA 4U3AA 1P5QA 3AWOA 1ZSXA 3FYYA 1Z6KA 1W54A 3AUJA 4QSFA 2J6XA 3OYZA 4UTMA 3QV8A 1XXXA 4FR1A 3R25A 3PZ9A 1YDNA 4DF2A 4MGVA 2DIKA 2G95A 2YDQA 1TCDA 3BL3A 5AKQA 1SSDA 4HTYA 3ZXWA 3OBAA 2CLKA 4NAEB 1BRLA 1UJPA 3C52A 8A3HA 3WD4A 3PN8A 2CHOA 3LX9A 4JFLA 3R13A 3DZ1A 3B8TA 1LOLA 2A85A 3UPWA 2E1DA 4BF8A 1VCFA 1GHSA 5L9FA 3BZGA 2D22A 4P7LA 3CZ8A 3GE7A 5D30A 4PUJA 1CGXA 1RP8A 3AXIA 3W7IA 5ECVA 4H9YA 4UFLA 3CK5A 1J5TA 1TIMA 4GGQA 4ERGA 3P2VA 1VR6A 4PR4A 1DHKA 2JALA 3OA3A 2OYLA 3L0GA 3GYEA 2WVSA 4YVVA 2V3FA 5AHFA 4F79A 4UMBA 3E74A 3UWQA 3RN6A 3VE7A 4JTJA 9RUBA 2PPPA 2O9TA 2E6AA 1XSJA 3KZPA 4IIEA 1WBJA 4F0RA 2EF9A 3GIPA 1XP3A 1XYMA 3LYEA 4GIAA 1FVPA 1WDPA 1NF0A 3L68A 1TTIA 4RUBA 1Q3NA 2PDCA 4JHOA 3LPPA 4IICA 5XINA 2CC0A 4HA0A 4RKAA 1SZNA 5AC5A 1K03A 2ZA3A 3CEPA 4CN4A 4OWGA 4B9ZA 1VGAA 3W3OA 3BG3A 3VIJA 4YCPA 3PAOA 3VGHA 2ZZ5A 3BLLA 5ENLA 1LP6A 4DZ5A 4NHVA 1JDFA 4R3UA 1M53A 3NPWA 1BVNP 2F2KA 1WDWA 1CLKA 1XSIA 1CB7B 1GVYA 1XDLA 1GKRA 3S2NA 4LUIA 2QPSA 3HGSA 3LM7A 3OBKA 2XP4A 4UTFA 1KBKA 4C6BA 1UQYA 3QV9A 3T2QA 3V1HA 4HU0A 4AMCA 3GWQA 1QXLA 3B8WA 3GTNA 1U1UA 1W0MA 3IIZA 5EA9A 3I6EA 2X8RA 1OVDA 1Q6GA 4NXKA 3W1QA 4UB9A 2BNJA 1BG9A 2QUVA 1F9CA 2NV1A 1QO2A 1H0IA 3QYSA 4OV9A 3ZR6A 3SCRA 1KCKA 5DRCA 5CXPA 1V8EA 3HQOA 3MHFA 3HPFA 1R6WA 4ZGYA 4AZ5A 1B6CA 3LU2A 3DFYA 5KEZA 3NQEA 4IIDA 2CBIA 1OM0A 2HZGA 4EANA 4GVIA 5BW6A 1EIBA 3VVGA 2GJPA 2G50A 1XISA 3N4EA 3G1HA 2EPNA 3MVIA 3LHVA 3HG5A 3ZT7A 3UJEA 3P61A 3SCVA 6REQA 3M44A 2OFNA 3LNPA 3KP1A 1QPNA 1KRAC 1R9HA 1ISVA 1UD2A 3O5FA 1UKQA 1F3TA 4PMVA 1KT0A 2V5JA 5C9XA 4HA1A 6ALDA 1NY1A 4KFPA 2NX1A 1G5AA 1HP4A 1CGVA 1PX3A 4HB7A 2D2GA 4M1RA 4A2RA 4XD3A 4US6A 4JN8A 4XSLA 3CASA 2PPOA 1HKMA 1RK6A 3DX5A 3WNNA 3CV1A 3O5DA 1F8IA 2ZE0A 2QAFA 1JZ4A 1MEWA 2JGYA 3M5ZA 2NQ9A 3DFOA 1VHNA 1G0CA 3KVLA 2PD5A 4OQVA 5AHNA 1GVIA 4HK7A 3ABZA 1EL3A 2HXTA 3NQAA 4UFHA 4PMUA 4WSHA 1UR4A 3H4GA 3SB0A 5A6TC 3V5CA 2WQPA 5AVHA 4L9YA 5IOBA 2J66A 3K1GA 3WMCA 3VIOA 4Y9MA 2W66A 3A4WA 4IPPA 4M3PA 4IUGA 5GNXA 1FUYA 2X41A 3LCXA 2X30A 5I3HA 1T96A 3W70A 2V3EA 5I7GA 3W23A 3MMTA 5LXXA 3GHTA 1EJUC 5M3WA 2VR5A 2PTZA 3R10A 4AC1X 1Q13A 1EDQA 1RD6A 2WSPA 5LYRA 4GD0A 5D8ZA 4Q33A 1BWVA 4DAIA 3BG9A 1OEPA 2BOFX 3BW3A 1US2A 2ZQUA 3W7PA 2WOQA 3WSUA 1M7PA 4NAEA 4PCPA 3MDUA 1R7OA 4DJEA 4C7FA 2FJUB 1DQUA 4J3UA 7TAAA 2CITA 4RX0A 3GS6A 3A4JA 3KVMA 3LXCA 2ETNA 1E0XA 3SRHA 2C1HA 3W81A 1G7VA 3K30A 1RY0A 4JIPA 3TTOA 4LCSA 3PAJA 3NO3A 1R3TA 4H01A 3IJ9A 2EGZA 2KFWA 3AHYA 3BW2A 3E9AA 5CZSA 2C18A 2FHFA 4KRTA 3PBUA 4MJ4A 4V15A 2PWFA 4JY9A 1VENA 3TA9A 2HXUA 4WLCA 4GXPA 4H1ZA 3W74A 3GKFA 4AHPA 2QPXA 3AUOA 2J77A 2BSLA 4W7VA 1TPUA 4ZQMA 4K39A 1W31A 4QLLA 1E9LA 3AFBA 4IGNA 5DN1A 4QDPA 5D4YA 1W9XA 4GQRA 4JIIX 3VMOA 1JYVA 4J9JA 1C7TA 3B4UA 2QCNA 1XJBA 5EYWA 1FXQA 2FZNA 2X1SA 1LRNA 2CLHA 5I02A 1W9DM 2ZXQA 3MTWA 4ATDA 3UQBA 2WO5A 5C7HA 4KETA 5KITA 2ANUA 3HF3A 1Q6RA 2IS7A 1R87A 3P82A 1RBOB 3OQ8A 4XZ9A 4JBRA 3HOJA 1PZ1A 1UWSA 2TPSA 3FCPA 4N9CA 5LNUA 1JDEA 3DI0A 2GOUA 3BQ6A 4REQB 1EOKA 3VIIA 4LAKA 3L0KA 1XBYA 4K68A 1W3LA 1A0CA 2VFGA 2LLEA 2M2AA 4U33A 3WUGA 2CZ5A 2PWHA 4TO8A 4D6DA 4S3GA 4B5NA 3ZJ7A 1QFEA 3LHZA 3DEQA 3WDRA 1BXNA 1TPVA 3I65A 4JD4A 4AX7A 4UZSA 2QCMA 2OX4A 1ZBVA 2PLMA 2P88A 4IFOA 3WQ4A 2BY1A 5TF0A 4B9YA 3NQBA 1FKRA 3OOBA 3RO8A 3FLUA 3MI3A 5BOEA 2XFFA 4FXRA 1MI3A 3GH5A 4Q4QA 3SEPA 2RQSA 1DKWA 5DRIA 3L4YA 1PEZA 4MSPA 3QOMA 3U2ZA 2L5HA 2E40A 3WX7A 3TYDA 1AW2A 2A21A 5CJ5A 3N9RA 5I79A 3CAWA 1A5OC 2DORA 4ACYA 5A6BA 5FSDC 3NEVA 4FX6M 2E6YA 5LHEA 3Q94A 1HTIA 3P3BA 1J4IA 3PPCA 1BWKA 4WY0A 4AZ7A 1B4EA 4FK9A 2VDIA 2CLLA 3MHGA 4JKLA 2Y5EA 4ZO9A 4GYKA 1K8XA 1QBBA 1OYAA 5G5IA 4CNPA 4D6FA 4ZB0A 3H2CA 5HW6A 4GIVA 4PCTA 4ACZA 1GCYA 2A6LA 3PTDA 4CLMA 4HPGA 2WBGA 3VCCA 3W27A 2A3LA 5FESA 3UZYA 4PTXA 3LZ5A 4O2TA 3KCEA 3P81A 1FWCC 8XIMA 4EOUA 3NR0A 1XGEA 2PSNA 4H4IA 1B9ZA 4LYPA 2FLIA 5BXSA 3N9SA 2WHKA 1CENA 2ZDRA 2X0HA 3GFZA 2E6DA 1G9HA 1GOKA 4IGSA 2W62A 5AOUA 4DAFA 1FCUA 2F9RA 2ZADA 3WJZA 3S9YA 2XIIA 1UCWA 2VT0A 4D6GA 2DSKA 2ZFAA 4S3BA 3LCIA 4ODQA 3LGDA 1OCJA 4IG2A 1JG9A 4C6MA 3TH6A 1RQHA 1HP5A 3F7JA 5EKYA 1HQTA 2WNZA 1NIUA 4C90A 4M80A 3IKGA 3UESA 5EMUA 4L1WA 2ZWYA 1N7KA 2WCAA 4ZSUA 4D1JA 3BTNA 3VIMA 3EA2A 3VD3A 1UR0A 1UR8A 2UY3A 1Q6QA 1GJUA 3IK4A 3NOYA 3LCWA 2A6NA 1B0IA 4GYPA 5CJMA 4U5IA 2OXNA 1LQ2A 3JVAA 4ZTXA 3NQ8A 2N87A 4BZYA 3BG5A 1AQFA 1CGYA 3T1GA 2JFEX 3NAVA 4ZODA 1YDVA 3W1XA 2CWNA 5HTGA 4FHAA 5AB3A 4D6HA 1WKEA 2RHGA 1QTWA 4JIHA 1AA1B 3USZA 2GVGA 1H62A 4O1DA 4P8UA 2Z24A 1GRJA 2QAPA 3RGCA 1ECQA 3CAKA 3B9AA 3LG3A 4A3UA 1GPWA 2G4FA 2YCLB 3DDMA 2XHYA 3VUPA 3WNKA 3MCOA 1OC7A 3LGGA 3SDOA 1BWLA 3G0UA 3BLEA 2D0GA 4BF5A 2VX5A 4UTTC 3CXOA 1KM0A 5A6JA 1D7IA 3EAUA 4LB3A 3ZVHA 3WF3A 2GYIA 4FAPA 4ZFCA 1L6YA 4W9OA 3C3UA 1CXHA 4WKHA 1MXGA 4L56A 3EWYA 3W4RA 3BCFA 2QUNA 1EX5A 1OFPA 2XIBA 3V16A 1TJ1A 3DFQA 3GH4A 2I5IA 2GSJA 4ORIA 1R2SA 1R47A 1J0KA 1MEHA 4W7UA 3M0YA 3LRMA 3M16A 2TRSA 2RJGA 4HNOA 1H7PA 2GQAA 3FA4A 3HPZA 2NV2A 4P8VA 2VZSA 4L65A 3IJ8A 4CNTA 1LJYA 5C5YA 3M5VA 3WO8A 3T09A 3UWEA 3ONCA 3W01A 5DXXA 4MM1A 4HMEA 4C1NA 2M08A 2YCIX 2DH2A 1FKDA 4DJDC 2FB2A 3FJ6A 1XIIA 1GGOA 4UQBA 3P5ZA 4XAZA 4Z2JA 3KADA 3GXIA 2X7VA 2PV1A 5CC6A 2DZPA 5D2XA 3O6AA 1H3GA 4C02B 3BMXA 4GIYA 4DO5A 1H2JA 1XLJA 1P7TA 4GH3A 4AY7A 4CQAA 4ZO7A 1E51A 2J7DA 4M6VA 4RXFA 1O68A 2IKHA 2E25A 3N17A 1ZAHA 4XAYA 3EZ4A 3P8IA 4OT7A 2DH3A 3BSGA 3U3HA 3FIGA 1JJKA 2WVVA 2AGKA 3ALFA 1OG6A 1EPVA 3VD5A 3W07A 3G3DA 1OF6A 4ODKA 1LTDA 3BJTA 1CTNA 4IT6A 1S2UA 3W86A 3UR7A 1LBMA 5DO2A 1TMQA 4AZCA 3ZQ9A 3VDCA 2EQDA 3TV8A 2P5NA 4IL0A 3PY2A 2HBVA 2VGGA 1EGMA 1VPQA 3FVDA 4WD0A 4DBDA 3T7VA 4LAWA 1FD9A 1M3UA 1CGTA 4ZXOA 2PCQA 2J7BA 2OODA 3AYTA 4BWLC 4TXEA 2PTDA 1CLXA 2GLKA 3F4VA 4AX6A 1X1ZA 5A8GA 2X2GA 1UBPC 2DV0A 1HNYA 3B0UX 2FDSA 5E1QA 3UD6A 3KZSA 3C8FA 3UJ2A 3M07A 4IJBA 2BMBA 4IPNB 1EHAA 2IXVA 4WDUA 1CZ1A 1JZ2A 2GVJA 4ODNA 7ODCA 3KAIA 5JIWA 3W7KA 5JU6A 5KZ6A 3IJDA 2ZA2A 5CC7A 3BSHA 2J7FA 1W9BM 1CI1A 3LXBA 4WKFA 3SSZA 2XGZA 2ZZ3A 2WXDM 1SPQA 1YNYA 1XLEA 2YL9A 4S39A 4I5XA 3UGRA 5FIPA 2CZVA 4AVOA 2CKRA 4ZQPA 1UR3M 3ZSSA 3FA5A 2C0AA 4O13A 2Q71A 4GUIA 1Q4NX 3V5OA 1DJZA 1BPLB 2D0FA 4U31A 2B7PA 4EAMA 4MIMA 1I1XA 1QK2A 3CPRA 3SCWA 3INPA 1XLFA 4KQZA 4A35A 1JXJA 4P61A 4DXXA 3CT2A 5HOSA 4QLKA 4DRQA 3W1AA 3CUGA 4AISA 3ZMRA 1W17A 1P0BA 3SCQA 1DXIA 3DGBA 3BOFA 2VN1A 3WFAA 3HGOA 4BJHA 5FJTA 2OT0A 3CS2A 3ZR5A 1K1DA 3M9YA 5AYIA 3AIBA 3GHRA 1EXPA 2R8WA 4X2PA 2J27A 5HT1A 2BHZA 3OIHA 4DJDA 2B7NA 4I5RA 5LNSA 4AHQA 4B4FA 1FWSA 1Q6LA 1FBAA 4ODMA 3A47A 1XL9A 4C7GA 4U84<