1EQ3A

Nmr structure of human parvulin hpar14
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
96
structure length
96
Chain Sequence
NAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure of hPar14 reveals similarity to the peptidyl prolyl cis/trans isomerase domain of the mitotic regulator hPin1 but indicates a different functionality of the protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PEPTIDYL-PROLYL CIS/TRANS ISOMERASE (PPIASE)
total genus 14
structure length 96
sequence length 96
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2000-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1eq3A00
2ZR4A 4G2PA 5HUAA 1KT0A 1FKDA 4IQ2A 1M5YA 1D7JA 3UI6A 4LAYA 3CGNA 4DT4A 5HWCA 3H9RB 1FKLA 2ZQVA 2UZ5A 1P5QA 2KFWA 2XP6A 4TX0A 2D9FA 3O5OA 4J4OA 2VN1A 4U86A 4G50A 3MDYB 4ITZA 5HTGA 2XPBA 5DIVA 2KR7A 2F21A 3O5LA 3JXVA 3IK8A 2M08A 1J4RA 4MSPA 3UQAA 4TNSA 1HXVA 2DG3A 4ODNA 1BL4A 1EYMA 4IPXA 2XP8A 1NSGA 4DH0A 3PRBA 2MF9A 2PV3A 5HWBA 1FJDA 1B6CA 3LUOA 2MLXA 2ZQUA 2ZQSA 4JYSA 2FAPA 5HKGA 1F40A 4N19A 1QPLA 1YATA 3UI4A 1FKFA 1FAPA 3UQBA 1JNSA 1Q6UA 2MLZA 4LAWA 4DRHA 3TC5A 4MGVA 3O5GA 2RUDA 1BKFA 3GPKA 2Q5AA 4BF8A 1J4HA 1D7HA 1Q1CA 1R9HA 2RSEA 3KABA 3KCEA 3ODKA 4ODRA 1C9HA 2OFNA 4DROA 1ZK6A 3NRKA 4JFLA 5BXJA 2FKEA 3KZ7A 3PRDA 4DRQA 5GPGA 1JNTA 3O5DA 2M2AA 3NI6A 3O5JA 3O5IA 2LPVA 2PBCA 4GGQA 4QT2A 2LGOA 4ODKA 3O5FA 4U85A 4QT3A 2XP3A 4ODMA 4TW6A 4JFIA 1FKGA 4FN2A 2XP4A 1PBKA 1ZCNA 3O5MA 1F8AB 4DRMA 5HW6A 4LAVA 3KAIA 4JFKA 1NMVA 2MNTA 2XP7A 3B7XA 1D6OA 1FKIA 2KE0A 4JFMA 4C02B 5B8IC 4W9QA 3O5EA 1J4IA 1FKRA 3UQIA 1D7IA 3UF8A 4W9OA 2VCDA 3IKGA 1ROUA 3O5KA 5DITA 4DRIA 1NMWA 1PINA 2RUQA 1N1AA 4NNRA 1Y0OA 3TDBA 2PPOA 1FKSA 2PPNA 1FKJA 2RQSA 3KAFA 2AWGA 4JFJA 2PV1A 4TW8A 5HT1A 5D75A 3IKDA 4TYOA 4DIPA 2L2SA 2MPHA 2K8IA 3KACA 1J6YA 1FKTA 4ODOA 3CGMA 4DRKA 5J6EA 4TW7A 4ODPA 1KT1A 4W9PA 3O5RA 3JYJA 4DZ3A 2MLYA 3NTPA 4ODLA 4DRNA 2DG9A 2RUCA 1TCOC 5I98A 2F4EA 3O5PA 4DRJA 3UI5A 2KGJA 2KO7A 4J4NA 1Q6IA 3KAHA 4ODQA 2PV2A 4O2TA 1FD9A 2IF4A 3TCZA 3PA7A 4LAXA 3IHZA 2XP9A 4DZ2A 2ZQTA 4GIVA 4DRPA 1YW5A 1T11A 1FKBA 3EY6A 1QPFA 4U84A 1L1PA 2RURA 1Q6HA 1JVWA 3I6CA 5HW7A 2ITKA 1FKHA 1QZ2A 3OOBA 3VAWA 1A7XA 1ROTA 2Y78A 3KADA 1U79A 3WH0A 1W26A 3FAPA 4R0XA 2KI3A 2LKNA 4IQCA 1EQ3A 2ZR5A 2ZR6A 3RGCA 2DG4A 2PPPA 2N87A 3RFWA 2XPAA 1FKKA 2F2DA 2XP5A 3JYMA 3O5QA 2JZVA 2M1IA 3KAGA 2LJ4A 5DIUA 4FAPA 5HW8A 4QIBA
chains in the Genus database with same CATH superfamily
4G2PA 3AS3A 5GQBA 1ZBVA 4IQ2A 5DEZA 3UI6A 2P4VA 4LAYA 3CGNA 4WJXA 1FKLA 2UZ5A 2XP6A 2D9FA 4G50A 2KR7A 3AS0A 2F21A 4MSPA 3JXVA 3IK8A 2PI6A 1HXVA 1K9TA 1BL4A 4MNKA 2A3EA 1B6CA 1FFRA 1ZBWA 5HKGA 1FAPA 3UQBA 1Q6UA 2MLZA 4WKFA 4WKHA 1HJXA 2B31A 2ESCA 4BF8A 1UR9A 3KABA 3KCEA 2O9OA 4IT4A 3NRKA 3ARXA 5GPGA 3O5JA 3O5IA 2WK2A 4GGQA 2LGOA 4ODKA 4U85A 2XP3A 4ODMA 1LJYA 4R5EA 4LAVA 1NMVA 2MNTA 2XP7A 3B7XA 3B9EA 4JFMA 4DWSA 4W9QA 2VCDA 1D2KA 4S3JA 1ROUA 3G6LA 1LL7A 3O5KA 4DRIA 1HJWA 2A3CA 3TDBA 2PPOA 2PPNA 3B9DA 4JFJA 3KAFA 4NZCA 5HT1A 3B9AA 3WD3A 1ZB5A 4TYOA 2L2SA 3KACA 2K8IA 2QF8A 1FKTA 2DT0A 4TW7A 1W9UA 4S3KA 2MLYA 4ODLA 4DRNA 1NWTA 1JNDA 1WB0A 4J4NA 3CHCA 4KQZA 3TCZA 1WNOA 3IHZA 4DZ2A 2ZQTA 4GIVA 4P8VA 4MNJA 1T11A 4U84A 1LL6A 5DF0A 3VAWA 3WD4A 1ROTA 3FAPA 2KI3A 4IQCA 2DT2A 1FFQA 2ZR5A 2ZR6A 2DG4A 1OGGA 1ZU8A 1FKKA 1HKKA 2M1IA 3KAGA 4MTVA 3ARZA 1KFWA 2ZR4A 1FKDA 1D7JA 1UR8A 4J4OA 1E6NA 1NWUA 3MDYB 2DSZA 2XPBA 2YBTA 3O5LA 2M08A 3ARRA 3WD0A 4ODNA 4W5UA 1HKIA 1NSGA 3WQVA 1RD6A 3AROA 2A3AA 3PRBA 3FXYA 2ZQSA 4JYSA 1XRVA 4N19A 4KR0B 3WQWA 4LAWA 4MGVA 1GOIA 1Q1CA 1R9HA 1FJDA 1ZK6A 1XHGA 4DRQA 3FY1A 1TFVA 4QT2A 3O5FA 4QT3A 4Q22A 4JFIA 1FKGA 1WAWA 1ZCNA 1EIBA 3CZ8A 4DWSC 1F8AB 4DRMA 5HW6A 2PN0A 3KAIA 4JFKA 4WKAA 2FDMA 2G8ZA 2DPEA 1J4IA 1D7IA 4W9OA 4DWSD 1PINA 4MPKA 2RUQA 4NNRA 4Z2GA 4TW8A 5D75A 3IKDA 1E6ZA 4MNMA 1J6YA 3CGMA 3GTYX 4DRKA 1SR0A 4Z2LA 4W9PA 1KT1A 3O5RA 3JYJA 4P8XA 4DZ3A 1E15A 2DG9A 1TCOC 2KGJA 1JCHB 1Q6IA 3KAHA 2PV2A 4O2TA 1FD9A 4DRPA 4ZPTR 1E6RA 3I6CA 5HW7A 2ITKA 1FKHA 2ETNA 1U79A 4HBOA 4R0XA 1EQ3A 3ARUA 2EULA 3BXWA 4P8WA 3WIJA 3O5QA 2DSVA 1ZBCA 3WKZA 4PTMA 1M5YA 1GUVA 1NWRA 4DT4A 3H9RB 2WM0A 1H0IA 3EIPA 4TX0A 4U86A 4MAVA 4ITZA 4DWSB 4L3NA 1ZL1A 1J4RA 3AS1A 4TNSA 1W9PA 1EYMA 4IPXA 4QZVB 2MF9A 2PV3A 2O92A 1ZBKA 2MLXA 1ITXA 2ZQUA 1F40A 1YATA 1CTNA 3O5GA 2RUDA 2WLYA 1BKFA 3GPKA 4HBEA 3W4RA 1D7HA 4ODRA 4DROA 5BXJA 3B8SA 2OFNA 4ZPVR 4JFLA 4ZS6A 3GU0A 3KZ7A 1NH6A 2M2AA 2PBCA 1EDQA 2DT3A 2YBUA 4FN2A 3ARTA 3WL0A 4P8UA 1W1YA 3PRAA 1FKIA 2KE0A 3G6MA 4C02B 3ARPA 2F23A 1VF8A 3UQIA 1W9VA 3BMBA 4Z2JA 3IKGA 3OA5A 1N1AA 4NSBA 1Y0OA 1X6NA 1FKJA 1H0GA 2PV1A 1LL4A 4DIPA 2A3BA 4ODOA 3ALFA 4ODPA 3NTPA 1NWSA 2RUCA 5I98A 2F4EA 3O5PA 3RM4A 1SYTA 4DRJA 5GPRA 4ODQA 2B5UB 1LQ0A 2IF4A 3CHDA 3CH9A 3PA7A 4LAXA 2XP9A 1E44A 1YW5A 4HARA 1FKBA 2RURA 1E6PA 1W1PA 1LG2A 2DSUA 1W1VA 2Y78A 5HBFA 3KADA 4Z2KA 1W26A 3RGCA 2PPPA 2N87A 2XPAA 2F2DA 3ARQA 2XP5A 1HKJA 4FAPA 5JH8A 5HW8A 1W1TA 4WIWA 5HUAA 1KT0A 4URIA 1OWQA 5HWCA 2ZQVA 1P5QA 2KFWA 4Z2IA 1JNEA 3O5OA 1E9LA 2VN1A 3ALGA 1HKMA 5HTGA 5DIVA 3UQAA 3ARWA 2WLZA 2DG3A 4WK9A 3AS2A 2XP8A 4DH0A 3ARVA 3CHFA 5HWBA 4L72B 3LUOA 2FAPA 1QPLA 3UI4A 1FKFA 3RM8A 3ARYA 1EHNA 4ZPWR 1JNSA 4DRHA 3TC5A 3WD1A 2G41A 2DT1A 4MNLA 3WL1A 2Q5AA 4UDMA 1J4HA 4AY1A 3ODKA 2RSEA 1C9HA 4Z2HA 3WD2A 2FKEA 3PRDA 4XAKA 1JNTA 3O5DA 3NI6A 2LPVA 1HJVA 4TW6A 1GRJA 2XP4A 1PBKA 2DSWA 3O5MA 3AQUA 1LG1A 1D6OA 3RMEA 5B8IC 2OLHA 3O5EA 1FKRA 3ARSA 3UF8A 2IUZA 5DITA 1O6IA 1NMWA 3QOKA 3PR9A 3CHEA 4IT6A 1FKSA 2RQSA 2AOSA 4ML4A 2AWGA 2MPHA 5J6EA 5DO2A 1IX5A 1X6LA 4Q7NA 3UI5A 2KO7A 1OGBA 3RM9A 3EY6A 1L1PA 1QPFA 1Q6HA 1JVWA 1GPFA 1QZ2A 3OOBA 1A7XA 3WH0A 2LKNA 3RFWA 3JYMA 2JZVA 4LGXA 2LJ4A 5DIUA 4QIBA
chains in the Genus database with same CATH topology
4G2PA 3AS3A 5GQBA 1ZBVA 4IQ2A 5DEZA 3UI6A 4LAYA 3CGNA 4WJXA 1FKLA 2UZ5A 2XP6A 2D9FA 4G50A 2KR7A 3AS0A 2F21A 4MSPA 3JXVA 3IK8A 2PI6A 1HXVA 1K9TA 1BL4A 4MNKA 2A3EA 1B6CA 1FFRA 1ZBWA 5HKGA 1FAPA 3UQBA 1Q6UA 2MLZA 4WKFA 4WKHA 1HJXA 2B31A 2ESCA 4BF8A 1UR9A 3KABA 3KCEA 2O9OA 4IT4A 3NRKA 3ARXA 5GPGA 3O5JA 3O5IA 2WK2A 4GGQA 2LGOA 4ODKA 4U85A 2XP3A 4ODMA 1LJYA 4R5EA 4LAVA 1NMVA 2MNTA 2XP7A 3B7XA 3B9EA 4JFMA 4DWSA 4W9QA 2VCDA 1D2KA 4S3JA 1ROUA 3G6LA 1LL7A 3O5KA 4DRIA 1HJWA 2A3CA 3TDBA 2PPOA 2PPNA 3B9DA 4JFJA 3KAFA 4NZCA 5HT1A 3B9AA 3WD3A 1ZB5A 4TYOA 2L2SA 3KACA 2K8IA 2QF8A 1FKTA 2DT0A 4TW7A 1W9UA 4S3KA 2MLYA 4ODLA 4DRNA 1NWTA 1JNDA 1WB0A 4J4NA 3CHCA 4KQZA 3TCZA 1WNOA 3IHZA 4DZ2A 2ZQTA 4GIVA 4P8VA 4MNJA 1T11A 4U84A 1LL6A 5DF0A 3VAWA 3WD4A 1ROTA 3FAPA 2KI3A 4IQCA 2DT2A 1FFQA 2ZR5A 2ZR6A 2DG4A 1OGGA 1ZU8A 1FKKA 1HKKA 2M1IA 3KAGA 4MTVA 3ARZA 1KFWA 2ZR4A 1FKDA 1D7JA 1UR8A 4J4OA 1E6NA 1NWUA 3MDYB 2DSZA 2XPBA 2YBTA 3O5LA 2M08A 3ARRA 3WD0A 4ODNA 4W5UA 1HKIA 1NSGA 3WQVA 1RD6A 3AROA 2A3AA 3PRBA 3FXYA 2ZQSA 4JYSA 1XRVA 4N19A 4KR0B 3WQWA 4LAWA 4MGVA 1GOIA 1Q1CA 1R9HA 1FJDA 1ZK6A 1XHGA 4DRQA 3FY1A 1TFVA 4QT2A 3O5FA 4QT3A 4Q22A 4JFIA 1FKGA 1WAWA 1ZCNA 1EIBA 3CZ8A 4DWSC 1F8AB 4DRMA 5HW6A 3KAIA 4JFKA 4WKAA 2FDMA 2G8ZA 2DPEA 1J4IA 1D7IA 4W9OA 4DWSD 1PINA 4MPKA 2RUQA 4NNRA 4Z2GA 4TW8A 5D75A 3IKDA 1E6ZA 4MNMA 1J6YA 3CGMA 4DRKA 1SR0A 4Z2LA 4W9PA 1KT1A 3O5RA 3JYJA 4P8XA 4DZ3A 1E15A 2DG9A 1TCOC 2KGJA 1Q6IA 3KAHA 2PV2A 4O2TA 1FD9A 4DRPA 4ZPTR 1E6RA 3I6CA 5HW7A 2ITKA 1FKHA 1U79A 4HBOA 4R0XA 1EQ3A 3ARUA 3BXWA 4P8WA 3WIJA 3O5QA 2DSVA 1ZBCA 3WKZA 4PTMA 1M5YA 1GUVA 1NWRA 4DT4A 3H9RB 2WM0A 1H0IA 4TX0A 4U86A 4MAVA 4ITZA 4DWSB 4L3NA 1ZL1A 1J4RA 3AS1A 4TNSA 1W9PA 1EYMA 4IPXA 4QZVB 2MF9A 2PV3A 2O92A 1ZBKA 2MLXA 1ITXA 2ZQUA 1F40A 1YATA 1CTNA 3O5GA 2RUDA 2WLYA 1BKFA 3GPKA 4HBEA 3W4RA 1D7HA 4ODRA 4DROA 5BXJA 3B8SA 2OFNA 4ZPVR 4JFLA 4ZS6A 3KZ7A 1NH6A 2M2AA 2PBCA 1EDQA 2DT3A 2YBUA 4FN2A 3ARTA 3WL0A 4P8UA 1W1YA 3PRAA 1FKIA 2KE0A 3G6MA 4C02B 3ARPA 1VF8A 3UQIA 1W9VA 4Z2JA 3IKGA 3OA5A 1N1AA 4NSBA 1Y0OA 1X6NA 1FKJA 1H0GA 2PV1A 1LL4A 4DIPA 2A3BA 4ODOA 3ALFA 4ODPA 3NTPA 1NWSA 2RUCA 5I98A 2F4EA 3O5PA 3RM4A 1SYTA 4DRJA 5GPRA 4ODQA 1LQ0A 2IF4A 3CHDA 3CH9A 3PA7A 4LAXA 2XP9A 1YW5A 4HARA 1FKBA 2RURA 1E6PA 1W1PA 1LG2A 2DSUA 1W1VA 2Y78A 5HBFA 3KADA 4Z2KA 1W26A 3RGCA 2PPPA 2N87A 2XPAA 2F2DA 3ARQA 2XP5A 1HKJA 4FAPA 5JH8A 5HW8A 1W1TA 4WIWA 5HUAA 1KT0A 4URIA 1OWQA 5HWCA 2ZQVA 1P5QA 2KFWA 4Z2IA 1JNEA 3O5OA 1E9LA 2VN1A 3ALGA 1HKMA 5HTGA 5DIVA 3UQAA 3ARWA 2WLZA 2DG3A 4WK9A 3AS2A 2XP8A 4DH0A 3ARVA 3CHFA 5HWBA 4L72B 3LUOA 2FAPA 1QPLA 3UI4A 1FKFA 3RM8A 3ARYA 1EHNA 4ZPWR 1JNSA 4DRHA 3TC5A 3WD1A 2G41A 2DT1A 4MNLA 3WL1A 2Q5AA 1J4HA 4AY1A 3ODKA 2RSEA 1C9HA 4Z2HA 3WD2A 2FKEA 3PRDA 4XAKA 1JNTA 3O5DA 3NI6A 2LPVA 1HJVA 4TW6A 2XP4A 1PBKA 2DSWA 3O5MA 3AQUA 1LG1A 1D6OA 3RMEA 5B8IC 2OLHA 3O5EA 1FKRA 3ARSA 3UF8A 2IUZA 5DITA 1O6IA 1NMWA 3QOKA 3PR9A 3CHEA 4IT6A 1FKSA 2RQSA 2AOSA 4ML4A 2AWGA 2MPHA 5J6EA 5DO2A 1IX5A 1X6LA 4Q7NA 3UI5A 2KO7A 1OGBA 3RM9A 3EY6A 1L1PA 1QPFA 1Q6HA 1JVWA 1GPFA 1QZ2A 3OOBA 1A7XA 3WH0A 2LKNA 3RFWA 3JYMA 2JZVA 4LGXA 2LJ4A 5DIUA 4QIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZR4 A;  4G2P A;  5HUA A;  1KT0 A;  1FKD A;  4IQ2 A;  1M5Y A;  1D7J A;  3UI6 A;  4LAY A;  3CGN A;  4DT4 A;  5HWC A;  3H9R B;  1FKL A;  2ZQV A;  2UZ5 A;  1P5Q A;  2KFW A;  2XP6 A;  4TX0 A;  2D9F A;  3O5O A;  4J4O A;  2VN1 A;  4U86 A;  4G50 A;  3MDY B;  4ITZ A;  5HTG A;  2XPB A;  5DIV A;  2KR7 A;  2F21 A;  3O5L A;  3JXV A;  3IK8 A;  2M08 A;  1J4R A;  4MSP A;  3UQA A;  4TNS A;  1HXV A;  2DG3 A;  4ODN A;  1BL4 A;  1EYM A;  4IPX A;  2XP8 A;  1NSG A;  4DH0 A;  3PRB A;  2MF9 A;  2PV3 A;  5HWB A;  1FJD A;  1B6C A;  3LUO A;  2MLX A;  2ZQU A;  2ZQS A;  4JYS A;  2FAP A;  5HKG A;  1F40 A;  4N19 A;  1QPL A;  1YAT A;  3UI4 A;  1FKF A;  1FAP A;  3UQB A;  1JNS A;  1Q6U A;  2MLZ A;  4LAW A;  4DRH A;  3TC5 A;  4MGV A;  3O5G A;  2RUD A;  1BKF A;  3GPK A;  2Q5A A;  4BF8 A;  1J4H A;  1D7H A;  1Q1C A;  1R9H A;  2RSE A;  3KAB A;  3KCE A;  3ODK A;  4ODR A;  1C9H A;  2OFN A;  4DRO A;  1ZK6 A;  3NRK A;  4JFL A;  5BXJ A;  2FKE A;  3KZ7 A;  3PRD A;  4DRQ A;  5GPG A;  1JNT A;  3O5D A;  2M2A A;  3NI6 A;  3O5J A;  3O5I A;  2LPV A;  2PBC A;  4GGQ A;  4QT2 A;  2LGO A;  4ODK A;  3O5F A;  4U85 A;  4QT3 A;  2XP3 A;  4ODM A;  4TW6 A;  4JFI A;  1FKG A;  4FN2 A;  2XP4 A;  1PBK A;  1ZCN A;  3O5M A;  1F8A B;  4DRM A;  5HW6 A;  4LAV A;  3KAI A;  4JFK A;  1NMV A;  2MNT A;  2XP7 A;  3B7X A;  1D6O A;  1FKI A;  2KE0 A;  4JFM A;  4C02 B;  5B8I C;  4W9Q A;  3O5E A;  1J4I A;  1FKR A;  3UQI A;  1D7I A;  3UF8 A;  4W9O A;  2VCD A;  3IKG A;  1ROU A;  3O5K A;  5DIT A;  4DRI A;  1NMW A;  1PIN A;  2RUQ A;  1N1A A;  4NNR A;  1Y0O A;  3TDB A;  2PPO A;  1FKS A;  2PPN A;  1FKJ A;  2RQS A;  3KAF A;  2AWG A;  4JFJ A;  2PV1 A;  4TW8 A;  5HT1 A;  5D75 A;  3IKD A;  4TYO A;  4DIP A;  2L2S A;  2MPH A;  2K8I A;  3KAC A;  1J6Y A;  1FKT A;  4ODO A;  3CGM A;  4DRK A;  5J6E A;  4TW7 A;  4ODP A;  1KT1 A;  4W9P A;  3O5R A;  3JYJ A;  4DZ3 A;  2MLY A;  3NTP A;  4ODL A;  4DRN A;  2DG9 A;  2RUC A;  1TCO C;  5I98 A;  2F4E A;  3O5P A;  4DRJ A;  3UI5 A;  2KGJ A;  2KO7 A;  4J4N A;  1Q6I A;  3KAH A;  4ODQ A;  2PV2 A;  4O2T A;  1FD9 A;  2IF4 A;  3TCZ A;  3PA7 A;  4LAX A;  3IHZ A;  2XP9 A;  4DZ2 A;  2ZQT A;  4GIV A;  4DRP A;  1YW5 A;  1T11 A;  1FKB A;  3EY6 A;  1QPF A;  4U84 A;  1L1P A;  2RUR A;  1Q6H A;  1JVW A;  3I6C A;  5HW7 A;  2ITK A;  1FKH A;  1QZ2 A;  3OOB A;  3VAW A;  1A7X A;  1ROT A;  2Y78 A;  3KAD A;  1U79 A;  3WH0 A;  1W26 A;  3FAP A;  4R0X A;  2KI3 A;  2LKN A;  4IQC A;  1EQ3 A;  2ZR5 A;  2ZR6 A;  3RGC A;  2DG4 A;  2PPP A;  2N87 A;  3RFW A;  2XPA A;  1FKK A;  2F2D A;  2XP5 A;  3JYM A;  3O5Q A;  2JZV A;  2M1I A;  3KAG A;  2LJ4 A;  5DIU A;  4FAP A;  5HW8 A;  4QIB A; 
#chains in the Genus database with same CATH topology
 4G2P A;  3AS3 A;  5GQB A;  1ZBV A;  4IQ2 A;  5DEZ A;  3UI6 A;  2P4V A;  4LAY A;  3CGN A;  4WJX A;  1FKL A;  2UZ5 A;  2XP6 A;  2D9F A;  4G50 A;  2KR7 A;  3AS0 A;  2F21 A;  4MSP A;  3JXV A;  3IK8 A;  2PI6 A;  1HXV A;  1K9T A;  1BL4 A;  4MNK A;  2A3E A;  1B6C A;  1FFR A;  1ZBW A;  5HKG A;  1FAP A;  3UQB A;  1Q6U A;  2MLZ A;  4WKF A;  4WKH A;  1HJX A;  2B31 A;  2ESC A;  4BF8 A;  1UR9 A;  3KAB A;  3KCE A;  2O9O A;  4IT4 A;  3NRK A;  3ARX A;  5GPG A;  3O5J A;  3O5I A;  2WK2 A;  4GGQ A;  2LGO A;  4ODK A;  4U85 A;  2XP3 A;  4ODM A;  1LJY A;  4R5E A;  4LAV A;  1NMV A;  2MNT A;  2XP7 A;  3B7X A;  3B9E A;  4JFM A;  4DWS A;  4W9Q A;  2VCD A;  1D2K A;  4S3J A;  1ROU A;  3G6L A;  1LL7 A;  3O5K A;  4DRI A;  1HJW A;  2A3C A;  3TDB A;  2PPO A;  2PPN A;  3B9D A;  4JFJ A;  3KAF A;  4NZC A;  5HT1 A;  3B9A A;  3WD3 A;  1ZB5 A;  4TYO A;  2L2S A;  3KAC A;  2K8I A;  2QF8 A;  1FKT A;  2DT0 A;  4TW7 A;  1W9U A;  4S3K A;  2MLY A;  4ODL A;  4DRN A;  1NWT A;  1JND A;  1WB0 A;  4J4N A;  3CHC A;  4KQZ A;  3TCZ A;  1WNO A;  3IHZ A;  4DZ2 A;  2ZQT A;  4GIV A;  4P8V A;  4MNJ A;  1T11 A;  4U84 A;  1LL6 A;  5DF0 A;  3VAW A;  3WD4 A;  1ROT A;  3FAP A;  2KI3 A;  4IQC A;  2DT2 A;  1FFQ A;  2ZR5 A;  2ZR6 A;  2DG4 A;  1OGG A;  1ZU8 A;  1FKK A;  1HKK A;  2M1I A;  3KAG A;  4MTV A;  3ARZ A;  1KFW A;  2ZR4 A;  1FKD A;  1D7J A;  1UR8 A;  4J4O A;  1E6N A;  1NWU A;  3MDY B;  2DSZ A;  2XPB A;  2YBT A;  3O5L A;  2M08 A;  3ARR A;  3WD0 A;  4ODN A;  4W5U A;  1HKI A;  1NSG A;  3WQV A;  1RD6 A;  3ARO A;  2A3A A;  3PRB A;  3FXY A;  2ZQS A;  4JYS A;  1XRV A;  4N19 A;  4KR0 B;  3WQW A;  4LAW A;  4MGV A;  1GOI A;  1Q1C A;  1R9H A;  1FJD A;  1ZK6 A;  1XHG A;  4DRQ A;  3FY1 A;  1TFV A;  4QT2 A;  3O5F A;  4QT3 A;  4Q22 A;  4JFI A;  1FKG A;  1WAW A;  1ZCN A;  1EIB A;  3CZ8 A;  4DWS C;  1F8A B;  4DRM A;  5HW6 A;  2PN0 A;  3KAI A;  4JFK A;  4WKA A;  2FDM A;  2G8Z A;  2DPE A;  1J4I A;  1D7I A;  4W9O A;  4DWS D;  1PIN A;  4MPK A;  2RUQ A;  4NNR A;  4Z2G A;  4TW8 A;  5D75 A;  3IKD A;  1E6Z A;  4MNM A;  1J6Y A;  3CGM A;  3GTY X;  4DRK A;  1SR0 A;  4Z2L A;  4W9P A;  1KT1 A;  3O5R A;  3JYJ A;  4P8X A;  4DZ3 A;  1E15 A;  2DG9 A;  1TCO C;  2KGJ A;  1JCH B;  1Q6I A;  3KAH A;  2PV2 A;  4O2T A;  1FD9 A;  4DRP A;  4ZPT R;  1E6R A;  3I6C A;  5HW7 A;  2ITK A;  1FKH A;  2ETN A;  1U79 A;  4HBO A;  4R0X A;  1EQ3 A;  3ARU A;  2EUL A;  3BXW A;  4P8W A;  3WIJ A;  3O5Q A;  2DSV A;  1ZBC A;  3WKZ A;  4PTM A;  1M5Y A;  1GUV A;  1NWR A;  4DT4 A;  3H9R B;  2WM0 A;  1H0I A;  3EIP A;  4TX0 A;  4U86 A;  4MAV A;  4ITZ A;  4DWS B;  4L3N A;  1ZL1 A;  1J4R A;  3AS1 A;  4TNS A;  1W9P A;  1EYM A;  4IPX A;  4QZV B;  2MF9 A;  2PV3 A;  2O92 A;  1ZBK A;  2MLX A;  1ITX A;  2ZQU A;  1F40 A;  1YAT A;  1CTN A;  3O5G A;  2RUD A;  2WLY A;  1BKF A;  3GPK A;  4HBE A;  3W4R A;  1D7H A;  4ODR A;  4DRO A;  5BXJ A;  3B8S A;  2OFN A;  4ZPV R;  4JFL A;  4ZS6 A;  3GU0 A;  3KZ7 A;  1NH6 A;  2M2A A;  2PBC A;  1EDQ A;  2DT3 A;  2YBU A;  4FN2 A;  3ART A;  3WL0 A;  4P8U A;  1W1Y A;  3PRA A;  1FKI A;  2KE0 A;  3G6M A;  4C02 B;  3ARP A;  2F23 A;  1VF8 A;  3UQI A;  1W9V A;  3BMB A;  4Z2J A;  3IKG A;  3OA5 A;  1N1A A;  4NSB A;  1Y0O A;  1X6N A;  1FKJ A;  1H0G A;  2PV1 A;  1LL4 A;  4DIP A;  2A3B A;  4ODO A;  3ALF A;  4ODP A;  3NTP A;  1NWS A;  2RUC A;  5I98 A;  2F4E A;  3O5P A;  3RM4 A;  1SYT A;  4DRJ A;  5GPR A;  4ODQ A;  2B5U B;  1LQ0 A;  2IF4 A;  3CHD A;  3CH9 A;  3PA7 A;  4LAX A;  2XP9 A;  1E44 A;  1YW5 A;  4HAR A;  1FKB A;  2RUR A;  1E6P A;  1W1P A;  1LG2 A;  2DSU A;  1W1V A;  2Y78 A;  5HBF A;  3KAD A;  4Z2K A;  1W26 A;  3RGC A;  2PPP A;  2N87 A;  2XPA A;  2F2D A;  3ARQ A;  2XP5 A;  1HKJ A;  4FAP A;  5JH8 A;  5HW8 A;  1W1T A;  4WIW A;  5HUA A;  1KT0 A;  4URI A;  1OWQ A;  5HWC A;  2ZQV A;  1P5Q A;  2KFW A;  4Z2I A;  1JNE A;  3O5O A;  1E9L A;  2VN1 A;  3ALG A;  1HKM A;  5HTG A;  5DIV A;  3UQA A;  3ARW A;  2WLZ A;  2DG3 A;  4WK9 A;  3AS2 A;  2XP8 A;  4DH0 A;  3ARV A;  3CHF A;  5HWB A;  4L72 B;  3LUO A;  2FAP A;  1QPL A;  3UI4 A;  1FKF A;  3RM8 A;  3ARY A;  1EHN A;  4ZPW R;  1JNS A;  4DRH A;  3TC5 A;  3WD1 A;  2G41 A;  2DT1 A;  4MNL A;  3WL1 A;  2Q5A A;  4UDM A;  1J4H A;  4AY1 A;  3ODK A;  2RSE A;  1C9H A;  4Z2H A;  3WD2 A;  2FKE A;  3PRD A;  4XAK A;  1JNT A;  3O5D A;  3NI6 A;  2LPV A;  1HJV A;  4TW6 A;  1GRJ A;  2XP4 A;  1PBK A;  2DSW A;  3O5M A;  3AQU A;  1LG1 A;  1D6O A;  3RME A;  5B8I C;  2OLH A;  3O5E A;  1FKR A;  3ARS A;  3UF8 A;  2IUZ A;  5DIT A;  1O6I A;  1NMW A;  3QOK A;  3PR9 A;  3CHE A;  4IT6 A;  1FKS A;  2RQS A;  2AOS A;  4ML4 A;  2AWG A;  2MPH A;  5J6E A;  5DO2 A;  1IX5 A;  1X6L A;  4Q7N A;  3UI5 A;  2KO7 A;  1OGB A;  3RM9 A;  3EY6 A;  1L1P A;  1QPF A;  1Q6H A;  1JVW A;  1GPF A;  1QZ2 A;  3OOB A;  1A7X A;  3WH0 A;  2LKN A;  3RFW A;  3JYM A;  2JZV A;  4LGX A;  2LJ4 A;  5DIU A;  4QIB A; 
#chains in the Genus database with same CATH homology
 4G2P A;  3AS3 A;  5GQB A;  1ZBV A;  4IQ2 A;  5DEZ A;  3UI6 A;  4LAY A;  3CGN A;  4WJX A;  1FKL A;  2UZ5 A;  2XP6 A;  2D9F A;  4G50 A;  2KR7 A;  3AS0 A;  2F21 A;  4MSP A;  3JXV A;  3IK8 A;  2PI6 A;  1HXV A;  1K9T A;  1BL4 A;  4MNK A;  2A3E A;  1B6C A;  1FFR A;  1ZBW A;  5HKG A;  1FAP A;  3UQB A;  1Q6U A;  2MLZ A;  4WKF A;  4WKH A;  1HJX A;  2B31 A;  2ESC A;  4BF8 A;  1UR9 A;  3KAB A;  3KCE A;  2O9O A;  4IT4 A;  3NRK A;  3ARX A;  5GPG A;  3O5J A;  3O5I A;  2WK2 A;  4GGQ A;  2LGO A;  4ODK A;  4U85 A;  2XP3 A;  4ODM A;  1LJY A;  4R5E A;  4LAV A;  1NMV A;  2MNT A;  2XP7 A;  3B7X A;  3B9E A;  4JFM A;  4DWS A;  4W9Q A;  2VCD A;  1D2K A;  4S3J A;  1ROU A;  3G6L A;  1LL7 A;  3O5K A;  4DRI A;  1HJW A;  2A3C A;  3TDB A;  2PPO A;  2PPN A;  3B9D A;  4JFJ A;  3KAF A;  4NZC A;  5HT1 A;  3B9A A;  3WD3 A;  1ZB5 A;  4TYO A;  2L2S A;  3KAC A;  2K8I A;  2QF8 A;  1FKT A;  2DT0 A;  4TW7 A;  1W9U A;  4S3K A;  2MLY A;  4ODL A;  4DRN A;  1NWT A;  1JND A;  1WB0 A;  4J4N A;  3CHC A;  4KQZ A;  3TCZ A;  1WNO A;  3IHZ A;  4DZ2 A;  2ZQT A;  4GIV A;  4P8V A;  4MNJ A;  1T11 A;  4U84 A;  1LL6 A;  5DF0 A;  3VAW A;  3WD4 A;  1ROT A;  3FAP A;  2KI3 A;  4IQC A;  2DT2 A;  1FFQ A;  2ZR5 A;  2ZR6 A;  2DG4 A;  1OGG A;  1ZU8 A;  1FKK A;  1HKK A;  2M1I A;  3KAG A;  4MTV A;  3ARZ A;  1KFW A;  2ZR4 A;  1FKD A;  1D7J A;  1UR8 A;  4J4O A;  1E6N A;  1NWU A;  3MDY B;  2DSZ A;  2XPB A;  2YBT A;  3O5L A;  2M08 A;  3ARR A;  3WD0 A;  4ODN A;  4W5U A;  1HKI A;  1NSG A;  3WQV A;  1RD6 A;  3ARO A;  2A3A A;  3PRB A;  3FXY A;  2ZQS A;  4JYS A;  1XRV A;  4N19 A;  4KR0 B;  3WQW A;  4LAW A;  4MGV A;  1GOI A;  1Q1C A;  1R9H A;  1FJD A;  1ZK6 A;  1XHG A;  4DRQ A;  3FY1 A;  1TFV A;  4QT2 A;  3O5F A;  4QT3 A;  4Q22 A;  4JFI A;  1FKG A;  1WAW A;  1ZCN A;  1EIB A;  3CZ8 A;  4DWS C;  1F8A B;  4DRM A;  5HW6 A;  3KAI A;  4JFK A;  4WKA A;  2FDM A;  2G8Z A;  2DPE A;  1J4I A;  1D7I A;  4W9O A;  4DWS D;  1PIN A;  4MPK A;  2RUQ A;  4NNR A;  4Z2G A;  4TW8 A;  5D75 A;  3IKD A;  1E6Z A;  4MNM A;  1J6Y A;  3CGM A;  4DRK A;  1SR0 A;  4Z2L A;  4W9P A;  1KT1 A;  3O5R A;  3JYJ A;  4P8X A;  4DZ3 A;  1E15 A;  2DG9 A;  1TCO C;  2KGJ A;  1Q6I A;  3KAH A;  2PV2 A;  4O2T A;  1FD9 A;  4DRP A;  4ZPT R;  1E6R A;  3I6C A;  5HW7 A;  2ITK A;  1FKH A;  1U79 A;  4HBO A;  4R0X A;  1EQ3 A;  3ARU A;  3BXW A;  4P8W A;  3WIJ A;  3O5Q A;  2DSV A;  1ZBC A;  3WKZ A;  4PTM A;  1M5Y A;  1GUV A;  1NWR A;  4DT4 A;  3H9R B;  2WM0 A;  1H0I A;  4TX0 A;  4U86 A;  4MAV A;  4ITZ A;  4DWS B;  4L3N A;  1ZL1 A;  1J4R A;  3AS1 A;  4TNS A;  1W9P A;  1EYM A;  4IPX A;  4QZV B;  2MF9 A;  2PV3 A;  2O92 A;  1ZBK A;  2MLX A;  1ITX A;  2ZQU A;  1F40 A;  1YAT A;  1CTN A;  3O5G A;  2RUD A;  2WLY A;  1BKF A;  3GPK A;  4HBE A;  3W4R A;  1D7H A;  4ODR A;  4DRO A;  5BXJ A;  3B8S A;  2OFN A;  4ZPV R;  4JFL A;  4ZS6 A;  3KZ7 A;  1NH6 A;  2M2A A;  2PBC A;  1EDQ A;  2DT3 A;  2YBU A;  4FN2 A;  3ART A;  3WL0 A;  4P8U A;  1W1Y A;  3PRA A;  1FKI A;  2KE0 A;  3G6M A;  4C02 B;  3ARP A;  1VF8 A;  3UQI A;  1W9V A;  4Z2J A;  3IKG A;  3OA5 A;  1N1A A;  4NSB A;  1Y0O A;  1X6N A;  1FKJ A;  1H0G A;  2PV1 A;  1LL4 A;  4DIP A;  2A3B A;  4ODO A;  3ALF A;  4ODP A;  3NTP A;  1NWS A;  2RUC A;  5I98 A;  2F4E A;  3O5P A;  3RM4 A;  1SYT A;  4DRJ A;  5GPR A;  4ODQ A;  1LQ0 A;  2IF4 A;  3CHD A;  3CH9 A;  3PA7 A;  4LAX A;  2XP9 A;  1YW5 A;  4HAR A;  1FKB A;  2RUR A;  1E6P A;  1W1P A;  1LG2 A;  2DSU A;  1W1V A;  2Y78 A;  5HBF A;  3KAD A;  4Z2K A;  1W26 A;  3RGC A;  2PPP A;  2N87 A;  2XPA A;  2F2D A;  3ARQ A;  2XP5 A;  1HKJ A;  4FAP A;  5JH8 A;  5HW8 A;  1W1T A;  4WIW A;  5HUA A;  1KT0 A;  4URI A;  1OWQ A;  5HWC A;  2ZQV A;  1P5Q A;  2KFW A;  4Z2I A;  1JNE A;  3O5O A;  1E9L A;  2VN1 A;  3ALG A;  1HKM A;  5HTG A;  5DIV A;  3UQA A;  3ARW A;  2WLZ A;  2DG3 A;  4WK9 A;  3AS2 A;  2XP8 A;  4DH0 A;  3ARV A;  3CHF A;  5HWB A;  4L72 B;  3LUO A;  2FAP A;  1QPL A;  3UI4 A;  1FKF A;  3RM8 A;  3ARY A;  1EHN A;  4ZPW R;  1JNS A;  4DRH A;  3TC5 A;  3WD1 A;  2G41 A;  2DT1 A;  4MNL A;  3WL1 A;  2Q5A A;  1J4H A;  4AY1 A;  3ODK A;  2RSE A;  1C9H A;  4Z2H A;  3WD2 A;  2FKE A;  3PRD A;  4XAK A;  1JNT A;  3O5D A;  3NI6 A;  2LPV A;  1HJV A;  4TW6 A;  2XP4 A;  1PBK A;  2DSW A;  3O5M A;  3AQU A;  1LG1 A;  1D6O A;  3RME A;  5B8I C;  2OLH A;  3O5E A;  1FKR A;  3ARS A;  3UF8 A;  2IUZ A;  5DIT A;  1O6I A;  1NMW A;  3QOK A;  3PR9 A;  3CHE A;  4IT6 A;  1FKS A;  2RQS A;  2AOS A;  4ML4 A;  2AWG A;  2MPH A;  5J6E A;  5DO2 A;  1IX5 A;  1X6L A;  4Q7N A;  3UI5 A;  2KO7 A;  1OGB A;  3RM9 A;  3EY6 A;  1L1P A;  1QPF A;  1Q6H A;  1JVW A;  1GPF A;  1QZ2 A;  3OOB A;  1A7X A;  3WH0 A;  2LKN A;  3RFW A;  3JYM A;  2JZV A;  4LGX A;  2LJ4 A;  5DIU A;  4QIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...