1EQ3A

Nmr structure of human parvulin hpar14
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
96
structure length
96
Chain Sequence
NAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure of hPar14 reveals similarity to the peptidyl prolyl cis/trans isomerase domain of the mitotic regulator hPin1 but indicates a different functionality of the protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PEPTIDYL-PROLYL CIS/TRANS ISOMERASE (PPIASE)
total genus 14
structure length 96
sequence length 96
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2000-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1eq3A00
3KCEA 4J4NA 4LAVA 1Q6IA 2LKNA 2XPAA 3O5DA 2XP5A 3O5RA 4DRNA 2XP8A 5HUAA 3KACA 1QPFA 2PPOA 1R9HA 4U86A 5HTGA 3PRBA 4QT2A 3LUOA 2KR7A 3O5KA 2LPVA 1ZCNA 3O5EA 3TDBA 2PBCA 1U79A 1Q6UA 2FKEA 4DRPA 2Q5AA 2XP4A 4QT3A 5GPGA 1L1PA 4ODMA 2M08A 2ZQUA 1JNSA 3WH0A 3UI6A 3UQIA 1FKGA 2VCDA 4DZ2A 2PPNA 4FN2A 3IKGA 3UQAA 2ZR6A 3KADA 2UZ5A 1YATA 2ZR4A 1PBKA 2XP3A 3O5GA 2ZQVA 3O5FA 5HW7A 1KT0A 3PA7A 4W9OA 1EQ3A 1FKIA 2D9FA 3GPKA 4TX0A 3TCZA 1P5QA 1J4RA 4GIVA 2PPPA 4FAPA 1B6CA 1JNTA 4J4OA 1NMWA 1D7IA 3O5LA 2DG9A 1D6OA 2MPHA 3JYJA 2IF4A 2ITKA 1N1AA 2MF9A 4ODPA 2XP6A 4NNRA 4LAYA 1KT1A 1TCOC 1ROTA 2KGJA 1FKLA 3CGMA 1Q1CA 3UF8A 2F2DA 4JFIA 1FKSA 4ODKA 3NI6A 2RUCA 1FKFA 2KI3A 4QIBA 4IQ2A 5I98A 3JYMA 5HW8A 3O5QA 5J6EA 2JZVA 3IHZA 3PRDA 3KZ7A 4G2PA 3KAGA 4U85A 3KABA 2K8IA 2DG4A 3RFWA 4TW7A 2XP7A 3ODKA 4ODRA 2DG3A 3TC5A 1J4IA 3O5PA 4DROA 2RUQA 4JFMA 1C9HA 2RURA 2LGOA 4JYSA 2MLYA 4LAXA 4DRMA 2XPBA 2M1IA 3KAHA 4ITZA 3IKDA 1T11A 1D7HA 2KE0A 4LAWA 4N19A 1Y0OA 3UI5A 1F8AB 1FKDA 3OOBA 4TNSA 4DZ3A 1J6YA 4DRJA 3MDYB 4DT4A 5BXJA 3KAFA 3O5OA 4TYOA 4U84A 4ODOA 1FKHA 3UQBA 2PV1A 1BL4A 4DRHA 2VN1A 5DIUA 1FKRA 1FJDA 5HWBA 4W9PA 1YW5A 1FD9A 2F4EA 2PV3A 1D7JA 1NSGA 2XP9A 2Y78A 4O2TA 1ROUA 2ZQTA 5D75A 5B8IC 3EY6A 2KO7A 1FAPA 2FAPA 2RUDA 1FKKA 4C02B 4W9QA 4GGQA 4IQCA 1EYMA 1ZK6A 4DRKA 5HW6A 2F21A 2AWGA 4BF8A 4MSPA 1FKTA 2MLXA 4ODNA 1NMVA 3CGNA 4JFLA 1JVWA 2MNTA 2PV2A 4TW6A 4DH0A 5HKGA 3FAPA 3KAIA 1BKFA 3O5MA 3VAWA 4JFKA 5HWCA 2N87A 1W26A 4JFJA 5DIVA 1F40A 3JXVA 3NRKA 3UI4A 1QZ2A 2L2SA 2LJ4A 2OFNA 2ZR5A 3RGCA 2MLZA 5DITA 3NTPA 4DRQA 3IK8A 1PINA 2KFWA 4MGVA 1HXVA 2RQSA 3O5JA 4DIPA 3I6CA 1J4HA 1FKJA 5HT1A 4G50A 1Q6HA 2RSEA 4TW8A 3H9RB 2ZQSA 2M2AA 4R0XA 4DRIA 3B7XA 1A7XA 4IPXA 4ODLA 1M5YA 3O5IA 4ODQA 1QPLA 1FKBA
chains in the Genus database with same CATH superfamily
1EHNA 3KCEA 2LKNA 2WLZA 2XP8A 2PPOA 1R9HA 4U86A 3O5KA 1EIBA 4HARA 3ALFA 1OWQA 1ZCNA 3OA5A 4Z2IA 2PBCA 2Q5AA 2OLHA 4Z2LA 1FKGA 4P8UA 3IKGA 5HW7A 1FKIA 4MNMA 3GPKA 3G6MA 4TX0A 4QZVB 1P5QA 1B6CA 1JNTA 3GTYX 3WD4A 3CHCA 2DG9A 2MPHA 4IT4A 3WD3A 2MF9A 1IX5A 4WKHA 4P8XA 1ROTA 3NI6A 4AY1A 5HW8A 4DWSC 2B5UB 3O5QA 2DSWA 1NH6A 4G2PA 2DG4A 3RFWA 2DG3A 5JH8A 3O5PA 1C9HA 2DSZA 2MLYA 2AOSA 2M1IA 4ML4A 4LAWA 4N19A 3UI5A 4TYOA 4U84A 1FKHA 1BL4A 2VN1A 2F4EA 2FDMA 4HBEA 2KO7A 4MAVA 3CHFA 4W9QA 2B31A 4IQCA 2MLXA 1NMVA 4JFLA 4DWSB 2ESCA 4MNJA 1NWUA 4XAKA 1F40A 3NRKA 3ARUA 2L2SA 2MLZA 5DITA 4Z2GA 1ZU8A 3ARRA 3NTPA 4MGVA 2DT0A 2P4VA 5HT1A 1Q6HA 4DRIA 4MTVA 3B7XA 1W1VA 1M5YA 1FKBA 1GUVA 4LAVA 5HBFA 1Q6IA 4URIA 1D2KA 3O5RA 3W4RA 4QT2A 2LPVA 1VF8A 4MNLA 1HKMA 1GOIA 4ODMA 2M08A 2ZQUA 1JNSA 3WH0A 3UI6A 2PPNA 4FN2A 1SYTA 3UQAA 2ZR6A 2UZ5A 1YATA 2ZR4A 2XP3A 3O5GA 3FXYA 4W9OA 3AQUA 2D9FA 3TCZA 1HJVA 2DT2A 2G8ZA 4FAPA 1D7IA 2IF4A 1TCOC 4L72B 1EDQA 3CH9A 3UF8A 4WK9A 4R5EA 3CHEA 1FKFA 1X6LA 2KI3A 4IQ2A 5I98A 5J6EA 2JZVA 3KAGA 3KABA 5DF0A 3ARWA 4P8VA 4TW7A 3WD0A 1J4IA 2LGOA 4LAXA 1LL7A 1FFRA 2XPBA 3KAHA 1D7HA 1TFVA 1J6YA 4NZCA 4DRJA 3MDYB 3O5OA 1NWTA 2WLYA 4DRHA 2O9OA 1O6IA 4W9PA 1YW5A 3WL0A 2Y78A 1HKJA 3WL1A 1ROUA 2ZQTA 5B8IC 4L3NA 4Q22A 3CZ8A 1HKIA 1H0IA 2EULA 4MPKA 1ZK6A 3B8SA 5HW6A 2F21A 4MSPA 1OGGA 1W9PA 2PV2A 3KAIA 3O5MA 2DPEA 2N87A 2O92A 5DO2A 3JXVA 3PR9A 2OFNA 4ZPTR 3G6LA 1PINA 1HXVA 2RQSA 1J4HA 2A3BA 1FKJA 2RSEA 1ZBWA 4ZPWR 3H9RB 4KQZA 4IPXA 1A7XA 4ODLA 1ZBKA 3AS2A 4ODQA 1QPLA 4J4NA 2XPAA 1XHGA 5HUAA 4LGXA 5HTGA 3LUOA 1LL4A 1RD6A 2A3CA 2FKEA 3WD1A 2XP4A 5GPGA 1WNOA 2VCDA 4DZ2A 1JNDA 3AS3A 3PRAA 3O5FA 1UR9A 2DSUA 2ETNA 1ZB5A 1W1TA 1J4RA 4GIVA 1SR0A 4WIWA 4J4OA 5GPRA 1OGBA 1D6OA 3BMBA 4ODPA 2ITKA 2XP6A 4IT6A 3QOKA 1Q1CA 1WB0A 1H0GA 2A3AA 3IHZA 3PRDA 3KZ7A 2K8IA 1LQ0A 3ODKA 1CTNA 4DROA 2RUQA 3ALGA 4DRMA 1HKKA 2IUZA 2KE0A 1Y0OA 4DZ3A 4TNSA 1E6ZA 2WK2A 5BXJA 3RMEA 3WKZA 4DT4A 1JCHB 1NWRA 1X6NA 3WQVA 4ODOA 4HBOA 1FFQA 3UQBA 1FKRA 5DIUA 2XP9A 4O2TA 1D7JA 3ARZA 1K9TA 1JNEA 1LJYA 5D75A 2PI6A 3EY6A 1LG2A 1W9VA 3WQWA 1E6RA 1FAPA 2FAPA 2RUDA 4GGQA 4UDMA 3BXWA 4DRKA 3CGNA 4TW6A 1JVWA 3FAPA 3WIJA 4S3JA 4JFKA 3AS0A 1W26A 2LJ4A 4ZS6A 2ZR5A 1NWSA 1HJXA 4WKAA 3RGCA 4DRQA 2F23A 3RM9A 4DIPA 3I6CA 1ZBVA 1LG1A 2G41A 4R0XA 2M2AA 2PN0A 3O5IA 4G50A 4ZPVR 4MNKA 1GRJA 3O5DA 2XP5A 4DRNA 4DWSA 3KACA 1QPFA 3PRBA 2KR7A 3O5EA 3TDBA 3GU0A 1U79A 1Q6UA 1E44A 3AROA 4DRPA 3RM8A 4QT3A 1L1PA 3ARPA 3AS1A 1E9LA 3UQIA 4KR0B 3KADA 4P8WA 1PBKA 4WJXA 3ARSA 2ZQVA 1KT0A 3PA7A 1EQ3A 1E15A 1HJWA 2PPPA 2QF8A 2YBTA 1NMWA 3O5LA 3JYJA 1N1AA 3ARXA 4NNRA 4LAYA 1KT1A 2A3EA 2KGJA 1FKLA 3CGMA 2F2DA 4JFIA 1ITXA 1FKSA 4ODKA 2RUCA 4QIBA 3FY1A 3JYMA 1W1YA 4U85A 3ARYA 1XRVA 2WM0A 2XP7A 5DEZA 3B9AA 1W9UA 4ODRA 3ARQA 3ARTA 2DSVA 3TC5A 4Z2JA 3CHDA 4JFMA 2RURA 4PTMA 4JYSA 3RM4A 4ITZA 3IKDA 1T11A 1F8AB 1FKDA 3OOBA 1E6PA 3KAFA 4Q7NA 2PV1A 3B9DA 3EIPA 1FJDA 5HWBA 2PV3A 1FD9A 1NSGA 2DT3A 1FKKA 4WKFA 1EYMA 2AWGA 4BF8A 1FKTA 4ODNA 1GPFA 4DH0A 2YBUA 2MNTA 1W1PA 5HKGA 4Z2KA 5GQBA 1BKFA 5HWCA 3VAWA 4JFJA 5DIVA 1WAWA 1ZL1A 3UI4A 1QZ2A 2DT1A 4W5UA 3IK8A 4DWSD 2KFWA 3O5JA 1UR8A 1LL6A 4Z2HA 1E6NA 1KFWA 3ARVA 4TW8A 2ZQSA 4S3KA 3WD2A 1ZBCA 4NSBA 4C02B 3B9EA
chains in the Genus database with same CATH topology
1EHNA 3KCEA 2LKNA 2WLZA 2XP8A 2PPOA 1R9HA 4U86A 3O5KA 1EIBA 4HARA 3ALFA 1OWQA 1ZCNA 3OA5A 4Z2IA 2PBCA 2Q5AA 2OLHA 4Z2LA 1FKGA 4P8UA 3IKGA 5HW7A 1FKIA 4MNMA 3GPKA 3G6MA 4TX0A 4QZVB 1P5QA 1B6CA 1JNTA 3WD4A 3CHCA 2DG9A 2MPHA 4IT4A 3WD3A 2MF9A 1IX5A 4WKHA 4P8XA 1ROTA 3NI6A 4AY1A 5HW8A 4DWSC 3O5QA 2DSWA 1NH6A 4G2PA 2DG4A 3RFWA 2DG3A 5JH8A 3O5PA 1C9HA 2DSZA 2MLYA 2AOSA 2M1IA 4ML4A 4LAWA 4N19A 3UI5A 4TYOA 4U84A 1FKHA 1BL4A 2VN1A 2F4EA 2FDMA 4HBEA 2KO7A 4MAVA 3CHFA 4W9QA 2B31A 4IQCA 2MLXA 1NMVA 4JFLA 4DWSB 2ESCA 4MNJA 1NWUA 4XAKA 1F40A 3NRKA 3ARUA 2L2SA 2MLZA 5DITA 4Z2GA 1ZU8A 3ARRA 3NTPA 4MGVA 2DT0A 5HT1A 1Q6HA 4DRIA 4MTVA 3B7XA 1W1VA 1M5YA 1FKBA 1GUVA 4LAVA 5HBFA 1Q6IA 4URIA 1D2KA 3O5RA 3W4RA 4QT2A 2LPVA 1VF8A 4MNLA 1HKMA 1GOIA 4ODMA 2M08A 2ZQUA 1JNSA 3WH0A 3UI6A 2PPNA 4FN2A 1SYTA 3UQAA 2ZR6A 2UZ5A 1YATA 2ZR4A 2XP3A 3O5GA 3FXYA 4W9OA 3AQUA 2D9FA 3TCZA 1HJVA 2DT2A 2G8ZA 4FAPA 1D7IA 2IF4A 1TCOC 4L72B 1EDQA 3CH9A 3UF8A 4WK9A 4R5EA 3CHEA 1FKFA 1X6LA 2KI3A 4IQ2A 5I98A 5J6EA 2JZVA 3KAGA 3KABA 5DF0A 3ARWA 4P8VA 4TW7A 3WD0A 1J4IA 2LGOA 4LAXA 1LL7A 1FFRA 2XPBA 3KAHA 1D7HA 1TFVA 1J6YA 4NZCA 4DRJA 3MDYB 3O5OA 1NWTA 2WLYA 4DRHA 2O9OA 1O6IA 4W9PA 1YW5A 3WL0A 2Y78A 1HKJA 3WL1A 1ROUA 2ZQTA 5B8IC 4L3NA 4Q22A 3CZ8A 1HKIA 1H0IA 4MPKA 1ZK6A 3B8SA 5HW6A 2F21A 4MSPA 1OGGA 1W9PA 2PV2A 3KAIA 3O5MA 2DPEA 2N87A 2O92A 5DO2A 3JXVA 3PR9A 2OFNA 4ZPTR 3G6LA 1PINA 1HXVA 2RQSA 1J4HA 2A3BA 1FKJA 2RSEA 1ZBWA 4ZPWR 3H9RB 4KQZA 4IPXA 1A7XA 4ODLA 1ZBKA 3AS2A 4ODQA 1QPLA 4J4NA 2XPAA 1XHGA 5HUAA 4LGXA 5HTGA 3LUOA 1LL4A 1RD6A 2A3CA 2FKEA 3WD1A 2XP4A 5GPGA 1WNOA 2VCDA 4DZ2A 1JNDA 3AS3A 3PRAA 3O5FA 1UR9A 2DSUA 1ZB5A 1W1TA 1J4RA 4GIVA 1SR0A 4WIWA 4J4OA 5GPRA 1OGBA 1D6OA 4ODPA 2ITKA 2XP6A 4IT6A 3QOKA 1Q1CA 1WB0A 1H0GA 2A3AA 3IHZA 3PRDA 3KZ7A 2K8IA 1LQ0A 3ODKA 1CTNA 4DROA 2RUQA 3ALGA 4DRMA 1HKKA 2IUZA 2KE0A 1Y0OA 4DZ3A 4TNSA 1E6ZA 2WK2A 5BXJA 3RMEA 3WKZA 4DT4A 1NWRA 3WQVA 1X6NA 4ODOA 1FFQA 4HBOA 3UQBA 1FKRA 5DIUA 2XP9A 4O2TA 1D7JA 3ARZA 1K9TA 1JNEA 1LJYA 5D75A 2PI6A 3EY6A 1LG2A 1W9VA 3WQWA 1E6RA 1FAPA 2FAPA 2RUDA 4GGQA 3BXWA 4DRKA 3CGNA 4TW6A 1JVWA 3FAPA 3WIJA 4S3JA 4JFKA 3AS0A 1W26A 2LJ4A 4ZS6A 2ZR5A 1NWSA 1HJXA 4WKAA 3RGCA 4DRQA 3RM9A 4DIPA 3I6CA 1ZBVA 1LG1A 2G41A 4R0XA 2M2AA 3O5IA 4G50A 4ZPVR 4MNKA 3O5DA 2XP5A 4DRNA 4DWSA 3KACA 1QPFA 3PRBA 2KR7A 3O5EA 3TDBA 1U79A 1Q6UA 3AROA 4DRPA 3RM8A 4QT3A 1L1PA 3ARPA 3AS1A 1E9LA 3UQIA 4KR0B 3KADA 4P8WA 1PBKA 4WJXA 3ARSA 2ZQVA 1KT0A 3PA7A 1EQ3A 1E15A 1HJWA 2PPPA 2QF8A 2YBTA 1NMWA 3O5LA 3JYJA 1N1AA 3ARXA 4NNRA 4LAYA 1KT1A 2A3EA 2KGJA 1FKLA 3CGMA 2F2DA 4JFIA 1ITXA 1FKSA 4ODKA 2RUCA 4QIBA 3FY1A 3JYMA 1W1YA 4U85A 3ARYA 1XRVA 2WM0A 2XP7A 5DEZA 3B9AA 1W9UA 4ODRA 3ARQA 3ARTA 2DSVA 3TC5A 4Z2JA 3CHDA 4JFMA 2RURA 4PTMA 4JYSA 3RM4A 4ITZA 3IKDA 1T11A 1F8AB 1FKDA 3OOBA 1E6PA 3KAFA 4Q7NA 2PV1A 3B9DA 1FJDA 5HWBA 2PV3A 1FD9A 1NSGA 2DT3A 1FKKA 4WKFA 1EYMA 2AWGA 4BF8A 1FKTA 4ODNA 1GPFA 4DH0A 2YBUA 2MNTA 1W1PA 5HKGA 4Z2KA 5GQBA 1BKFA 5HWCA 3VAWA 4JFJA 5DIVA 1WAWA 1ZL1A 3UI4A 1QZ2A 2DT1A 4W5UA 3IK8A 4DWSD 2KFWA 3O5JA 1UR8A 1LL6A 4Z2HA 1E6NA 1KFWA 3ARVA 4TW8A 2ZQSA 4S3KA 3WD2A 1ZBCA 4NSBA 4C02B 3B9EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KCE A;  4J4N A;  4LAV A;  1Q6I A;  2LKN A;  2XPA A;  3O5D A;  2XP5 A;  3O5R A;  4DRN A;  2XP8 A;  5HUA A;  3KAC A;  1QPF A;  2PPO A;  1R9H A;  4U86 A;  5HTG A;  3PRB A;  4QT2 A;  3LUO A;  2KR7 A;  3O5K A;  2LPV A;  1ZCN A;  3O5E A;  3TDB A;  2PBC A;  1U79 A;  1Q6U A;  2FKE A;  4DRP A;  2Q5A A;  2XP4 A;  4QT3 A;  5GPG A;  1L1P A;  4ODM A;  2M08 A;  2ZQU A;  1JNS A;  3WH0 A;  3UI6 A;  3UQI A;  1FKG A;  2VCD A;  4DZ2 A;  2PPN A;  4FN2 A;  3IKG A;  3UQA A;  2ZR6 A;  3KAD A;  2UZ5 A;  1YAT A;  2ZR4 A;  1PBK A;  2XP3 A;  3O5G A;  2ZQV A;  3O5F A;  5HW7 A;  1KT0 A;  3PA7 A;  4W9O A;  1EQ3 A;  1FKI A;  2D9F A;  3GPK A;  4TX0 A;  3TCZ A;  1P5Q A;  1J4R A;  4GIV A;  2PPP A;  4FAP A;  1B6C A;  1JNT A;  4J4O A;  1NMW A;  1D7I A;  3O5L A;  2DG9 A;  1D6O A;  2MPH A;  3JYJ A;  2IF4 A;  2ITK A;  1N1A A;  2MF9 A;  4ODP A;  2XP6 A;  4NNR A;  4LAY A;  1KT1 A;  1TCO C;  1ROT A;  2KGJ A;  1FKL A;  3CGM A;  1Q1C A;  3UF8 A;  2F2D A;  4JFI A;  1FKS A;  4ODK A;  3NI6 A;  2RUC A;  1FKF A;  2KI3 A;  4QIB A;  4IQ2 A;  5I98 A;  3JYM A;  5HW8 A;  3O5Q A;  5J6E A;  2JZV A;  3IHZ A;  3PRD A;  3KZ7 A;  4G2P A;  3KAG A;  4U85 A;  3KAB A;  2K8I A;  2DG4 A;  3RFW A;  4TW7 A;  2XP7 A;  3ODK A;  4ODR A;  2DG3 A;  3TC5 A;  1J4I A;  3O5P A;  4DRO A;  2RUQ A;  4JFM A;  1C9H A;  2RUR A;  2LGO A;  4JYS A;  2MLY A;  4LAX A;  4DRM A;  2XPB A;  2M1I A;  3KAH A;  4ITZ A;  3IKD A;  1T11 A;  1D7H A;  2KE0 A;  4LAW A;  4N19 A;  1Y0O A;  3UI5 A;  1F8A B;  1FKD A;  3OOB A;  4TNS A;  4DZ3 A;  1J6Y A;  4DRJ A;  3MDY B;  4DT4 A;  5BXJ A;  3KAF A;  3O5O A;  4TYO A;  4U84 A;  4ODO A;  1FKH A;  3UQB A;  2PV1 A;  1BL4 A;  4DRH A;  2VN1 A;  5DIU A;  1FKR A;  1FJD A;  5HWB A;  4W9P A;  1YW5 A;  1FD9 A;  2F4E A;  2PV3 A;  1D7J A;  1NSG A;  2XP9 A;  2Y78 A;  4O2T A;  1ROU A;  2ZQT A;  5D75 A;  5B8I C;  3EY6 A;  2KO7 A;  1FAP A;  2FAP A;  2RUD A;  1FKK A;  4C02 B;  4W9Q A;  4GGQ A;  4IQC A;  1EYM A;  1ZK6 A;  4DRK A;  5HW6 A;  2F21 A;  2AWG A;  4BF8 A;  4MSP A;  1FKT A;  2MLX A;  4ODN A;  1NMV A;  3CGN A;  4JFL A;  1JVW A;  2MNT A;  2PV2 A;  4TW6 A;  4DH0 A;  5HKG A;  3FAP A;  3KAI A;  1BKF A;  3O5M A;  3VAW A;  4JFK A;  5HWC A;  2N87 A;  1W26 A;  4JFJ A;  5DIV A;  1F40 A;  3JXV A;  3NRK A;  3UI4 A;  1QZ2 A;  2L2S A;  2LJ4 A;  2OFN A;  2ZR5 A;  3RGC A;  2MLZ A;  5DIT A;  3NTP A;  4DRQ A;  3IK8 A;  1PIN A;  2KFW A;  4MGV A;  1HXV A;  2RQS A;  3O5J A;  4DIP A;  3I6C A;  1J4H A;  1FKJ A;  5HT1 A;  4G50 A;  1Q6H A;  2RSE A;  4TW8 A;  3H9R B;  2ZQS A;  2M2A A;  4R0X A;  4DRI A;  3B7X A;  1A7X A;  4IPX A;  4ODL A;  1M5Y A;  3O5I A;  4ODQ A;  1QPL A;  1FKB A; 
#chains in the Genus database with same CATH topology
 1EHN A;  3KCE A;  2LKN A;  2WLZ A;  2XP8 A;  2PPO A;  1R9H A;  4U86 A;  3O5K A;  1EIB A;  4HAR A;  3ALF A;  1OWQ A;  1ZCN A;  3OA5 A;  4Z2I A;  2PBC A;  2Q5A A;  2OLH A;  4Z2L A;  1FKG A;  4P8U A;  3IKG A;  5HW7 A;  1FKI A;  4MNM A;  3GPK A;  3G6M A;  4TX0 A;  4QZV B;  1P5Q A;  1B6C A;  1JNT A;  3GTY X;  3WD4 A;  3CHC A;  2DG9 A;  2MPH A;  4IT4 A;  3WD3 A;  2MF9 A;  1IX5 A;  4WKH A;  4P8X A;  1ROT A;  3NI6 A;  4AY1 A;  5HW8 A;  4DWS C;  2B5U B;  3O5Q A;  2DSW A;  1NH6 A;  4G2P A;  2DG4 A;  3RFW A;  2DG3 A;  5JH8 A;  3O5P A;  1C9H A;  2DSZ A;  2MLY A;  2AOS A;  2M1I A;  4ML4 A;  4LAW A;  4N19 A;  3UI5 A;  4TYO A;  4U84 A;  1FKH A;  1BL4 A;  2VN1 A;  2F4E A;  2FDM A;  4HBE A;  2KO7 A;  4MAV A;  3CHF A;  4W9Q A;  2B31 A;  4IQC A;  2MLX A;  1NMV A;  4JFL A;  4DWS B;  2ESC A;  4MNJ A;  1NWU A;  4XAK A;  1F40 A;  3NRK A;  3ARU A;  2L2S A;  2MLZ A;  5DIT A;  4Z2G A;  1ZU8 A;  3ARR A;  3NTP A;  4MGV A;  2DT0 A;  2P4V A;  5HT1 A;  1Q6H A;  4DRI A;  4MTV A;  3B7X A;  1W1V A;  1M5Y A;  1FKB A;  1GUV A;  4LAV A;  5HBF A;  1Q6I A;  4URI A;  1D2K A;  3O5R A;  3W4R A;  4QT2 A;  2LPV A;  1VF8 A;  4MNL A;  1HKM A;  1GOI A;  4ODM A;  2M08 A;  2ZQU A;  1JNS A;  3WH0 A;  3UI6 A;  2PPN A;  4FN2 A;  1SYT A;  3UQA A;  2ZR6 A;  2UZ5 A;  1YAT A;  2ZR4 A;  2XP3 A;  3O5G A;  3FXY A;  4W9O A;  3AQU A;  2D9F A;  3TCZ A;  1HJV A;  2DT2 A;  2G8Z A;  4FAP A;  1D7I A;  2IF4 A;  1TCO C;  4L72 B;  1EDQ A;  3CH9 A;  3UF8 A;  4WK9 A;  4R5E A;  3CHE A;  1FKF A;  1X6L A;  2KI3 A;  4IQ2 A;  5I98 A;  5J6E A;  2JZV A;  3KAG A;  3KAB A;  5DF0 A;  3ARW A;  4P8V A;  4TW7 A;  3WD0 A;  1J4I A;  2LGO A;  4LAX A;  1LL7 A;  1FFR A;  2XPB A;  3KAH A;  1D7H A;  1TFV A;  1J6Y A;  4NZC A;  4DRJ A;  3MDY B;  3O5O A;  1NWT A;  2WLY A;  4DRH A;  2O9O A;  1O6I A;  4W9P A;  1YW5 A;  3WL0 A;  2Y78 A;  1HKJ A;  3WL1 A;  1ROU A;  2ZQT A;  5B8I C;  4L3N A;  4Q22 A;  3CZ8 A;  1HKI A;  1H0I A;  2EUL A;  4MPK A;  1ZK6 A;  3B8S A;  5HW6 A;  2F21 A;  4MSP A;  1OGG A;  1W9P A;  2PV2 A;  3KAI A;  3O5M A;  2DPE A;  2N87 A;  2O92 A;  5DO2 A;  3JXV A;  3PR9 A;  2OFN A;  4ZPT R;  3G6L A;  1PIN A;  1HXV A;  2RQS A;  1J4H A;  2A3B A;  1FKJ A;  2RSE A;  1ZBW A;  4ZPW R;  3H9R B;  4KQZ A;  4IPX A;  1A7X A;  4ODL A;  1ZBK A;  3AS2 A;  4ODQ A;  1QPL A;  4J4N A;  2XPA A;  1XHG A;  5HUA A;  4LGX A;  5HTG A;  3LUO A;  1LL4 A;  1RD6 A;  2A3C A;  2FKE A;  3WD1 A;  2XP4 A;  5GPG A;  1WNO A;  2VCD A;  4DZ2 A;  1JND A;  3AS3 A;  3PRA A;  3O5F A;  1UR9 A;  2DSU A;  2ETN A;  1ZB5 A;  1W1T A;  1J4R A;  4GIV A;  1SR0 A;  4WIW A;  4J4O A;  5GPR A;  1OGB A;  1D6O A;  3BMB A;  4ODP A;  2ITK A;  2XP6 A;  4IT6 A;  3QOK A;  1Q1C A;  1WB0 A;  1H0G A;  2A3A A;  3IHZ A;  3PRD A;  3KZ7 A;  2K8I A;  1LQ0 A;  3ODK A;  1CTN A;  4DRO A;  2RUQ A;  3ALG A;  4DRM A;  1HKK A;  2IUZ A;  2KE0 A;  1Y0O A;  4DZ3 A;  4TNS A;  1E6Z A;  2WK2 A;  5BXJ A;  3RME A;  3WKZ A;  4DT4 A;  1JCH B;  1NWR A;  1X6N A;  3WQV A;  4ODO A;  4HBO A;  1FFQ A;  3UQB A;  1FKR A;  5DIU A;  2XP9 A;  4O2T A;  1D7J A;  3ARZ A;  1K9T A;  1JNE A;  1LJY A;  5D75 A;  2PI6 A;  3EY6 A;  1LG2 A;  1W9V A;  3WQW A;  1E6R A;  1FAP A;  2FAP A;  2RUD A;  4GGQ A;  4UDM A;  3BXW A;  4DRK A;  3CGN A;  4TW6 A;  1JVW A;  3FAP A;  3WIJ A;  4S3J A;  4JFK A;  3AS0 A;  1W26 A;  2LJ4 A;  4ZS6 A;  2ZR5 A;  1NWS A;  1HJX A;  4WKA A;  3RGC A;  4DRQ A;  2F23 A;  3RM9 A;  4DIP A;  3I6C A;  1ZBV A;  1LG1 A;  2G41 A;  4R0X A;  2M2A A;  2PN0 A;  3O5I A;  4G50 A;  4ZPV R;  4MNK A;  1GRJ A;  3O5D A;  2XP5 A;  4DRN A;  4DWS A;  3KAC A;  1QPF A;  3PRB A;  2KR7 A;  3O5E A;  3TDB A;  3GU0 A;  1U79 A;  1Q6U A;  1E44 A;  3ARO A;  4DRP A;  3RM8 A;  4QT3 A;  1L1P A;  3ARP A;  3AS1 A;  1E9L A;  3UQI A;  4KR0 B;  3KAD A;  4P8W A;  1PBK A;  4WJX A;  3ARS A;  2ZQV A;  1KT0 A;  3PA7 A;  1EQ3 A;  1E15 A;  1HJW A;  2PPP A;  2QF8 A;  2YBT A;  1NMW A;  3O5L A;  3JYJ A;  1N1A A;  3ARX A;  4NNR A;  4LAY A;  1KT1 A;  2A3E A;  2KGJ A;  1FKL A;  3CGM A;  2F2D A;  4JFI A;  1ITX A;  1FKS A;  4ODK A;  2RUC A;  4QIB A;  3FY1 A;  3JYM A;  1W1Y A;  4U85 A;  3ARY A;  1XRV A;  2WM0 A;  2XP7 A;  5DEZ A;  3B9A A;  1W9U A;  4ODR A;  3ARQ A;  3ART A;  2DSV A;  3TC5 A;  4Z2J A;  3CHD A;  4JFM A;  2RUR A;  4PTM A;  4JYS A;  3RM4 A;  4ITZ A;  3IKD A;  1T11 A;  1F8A B;  1FKD A;  3OOB A;  1E6P A;  3KAF A;  4Q7N A;  2PV1 A;  3B9D A;  3EIP A;  1FJD A;  5HWB A;  2PV3 A;  1FD9 A;  1NSG A;  2DT3 A;  1FKK A;  4WKF A;  1EYM A;  2AWG A;  4BF8 A;  1FKT A;  4ODN A;  1GPF A;  4DH0 A;  2YBU A;  2MNT A;  1W1P A;  5HKG A;  4Z2K A;  5GQB A;  1BKF A;  5HWC A;  3VAW A;  4JFJ A;  5DIV A;  1WAW A;  1ZL1 A;  3UI4 A;  1QZ2 A;  2DT1 A;  4W5U A;  3IK8 A;  4DWS D;  2KFW A;  3O5J A;  1UR8 A;  1LL6 A;  4Z2H A;  1E6N A;  1KFW A;  3ARV A;  4TW8 A;  2ZQS A;  4S3K A;  3WD2 A;  1ZBC A;  4NSB A;  4C02 B;  3B9E A; 
#chains in the Genus database with same CATH homology
 1EHN A;  3KCE A;  2LKN A;  2WLZ A;  2XP8 A;  2PPO A;  1R9H A;  4U86 A;  3O5K A;  1EIB A;  4HAR A;  3ALF A;  1OWQ A;  1ZCN A;  3OA5 A;  4Z2I A;  2PBC A;  2Q5A A;  2OLH A;  4Z2L A;  1FKG A;  4P8U A;  3IKG A;  5HW7 A;  1FKI A;  4MNM A;  3GPK A;  3G6M A;  4TX0 A;  4QZV B;  1P5Q A;  1B6C A;  1JNT A;  3WD4 A;  3CHC A;  2DG9 A;  2MPH A;  4IT4 A;  3WD3 A;  2MF9 A;  1IX5 A;  4WKH A;  4P8X A;  1ROT A;  3NI6 A;  4AY1 A;  5HW8 A;  4DWS C;  3O5Q A;  2DSW A;  1NH6 A;  4G2P A;  2DG4 A;  3RFW A;  2DG3 A;  5JH8 A;  3O5P A;  1C9H A;  2DSZ A;  2MLY A;  2AOS A;  2M1I A;  4ML4 A;  4LAW A;  4N19 A;  3UI5 A;  4TYO A;  4U84 A;  1FKH A;  1BL4 A;  2VN1 A;  2F4E A;  2FDM A;  4HBE A;  2KO7 A;  4MAV A;  3CHF A;  4W9Q A;  2B31 A;  4IQC A;  2MLX A;  1NMV A;  4JFL A;  4DWS B;  2ESC A;  4MNJ A;  1NWU A;  4XAK A;  1F40 A;  3NRK A;  3ARU A;  2L2S A;  2MLZ A;  5DIT A;  4Z2G A;  1ZU8 A;  3ARR A;  3NTP A;  4MGV A;  2DT0 A;  5HT1 A;  1Q6H A;  4DRI A;  4MTV A;  3B7X A;  1W1V A;  1M5Y A;  1FKB A;  1GUV A;  4LAV A;  5HBF A;  1Q6I A;  4URI A;  1D2K A;  3O5R A;  3W4R A;  4QT2 A;  2LPV A;  1VF8 A;  4MNL A;  1HKM A;  1GOI A;  4ODM A;  2M08 A;  2ZQU A;  1JNS A;  3WH0 A;  3UI6 A;  2PPN A;  4FN2 A;  1SYT A;  3UQA A;  2ZR6 A;  2UZ5 A;  1YAT A;  2ZR4 A;  2XP3 A;  3O5G A;  3FXY A;  4W9O A;  3AQU A;  2D9F A;  3TCZ A;  1HJV A;  2DT2 A;  2G8Z A;  4FAP A;  1D7I A;  2IF4 A;  1TCO C;  4L72 B;  1EDQ A;  3CH9 A;  3UF8 A;  4WK9 A;  4R5E A;  3CHE A;  1FKF A;  1X6L A;  2KI3 A;  4IQ2 A;  5I98 A;  5J6E A;  2JZV A;  3KAG A;  3KAB A;  5DF0 A;  3ARW A;  4P8V A;  4TW7 A;  3WD0 A;  1J4I A;  2LGO A;  4LAX A;  1LL7 A;  1FFR A;  2XPB A;  3KAH A;  1D7H A;  1TFV A;  1J6Y A;  4NZC A;  4DRJ A;  3MDY B;  3O5O A;  1NWT A;  2WLY A;  4DRH A;  2O9O A;  1O6I A;  4W9P A;  1YW5 A;  3WL0 A;  2Y78 A;  1HKJ A;  3WL1 A;  1ROU A;  2ZQT A;  5B8I C;  4L3N A;  4Q22 A;  3CZ8 A;  1HKI A;  1H0I A;  4MPK A;  1ZK6 A;  3B8S A;  5HW6 A;  2F21 A;  4MSP A;  1OGG A;  1W9P A;  2PV2 A;  3KAI A;  3O5M A;  2DPE A;  2N87 A;  2O92 A;  5DO2 A;  3JXV A;  3PR9 A;  2OFN A;  4ZPT R;  3G6L A;  1PIN A;  1HXV A;  2RQS A;  1J4H A;  2A3B A;  1FKJ A;  2RSE A;  1ZBW A;  4ZPW R;  3H9R B;  4KQZ A;  4IPX A;  1A7X A;  4ODL A;  1ZBK A;  3AS2 A;  4ODQ A;  1QPL A;  4J4N A;  2XPA A;  1XHG A;  5HUA A;  4LGX A;  5HTG A;  3LUO A;  1LL4 A;  1RD6 A;  2A3C A;  2FKE A;  3WD1 A;  2XP4 A;  5GPG A;  1WNO A;  2VCD A;  4DZ2 A;  1JND A;  3AS3 A;  3PRA A;  3O5F A;  1UR9 A;  2DSU A;  1ZB5 A;  1W1T A;  1J4R A;  4GIV A;  1SR0 A;  4WIW A;  4J4O A;  5GPR A;  1OGB A;  1D6O A;  4ODP A;  2ITK A;  2XP6 A;  4IT6 A;  3QOK A;  1Q1C A;  1WB0 A;  1H0G A;  2A3A A;  3IHZ A;  3PRD A;  3KZ7 A;  2K8I A;  1LQ0 A;  3ODK A;  1CTN A;  4DRO A;  2RUQ A;  3ALG A;  4DRM A;  1HKK A;  2IUZ A;  2KE0 A;  1Y0O A;  4DZ3 A;  4TNS A;  1E6Z A;  2WK2 A;  5BXJ A;  3RME A;  3WKZ A;  4DT4 A;  1NWR A;  3WQV A;  1X6N A;  4ODO A;  1FFQ A;  4HBO A;  3UQB A;  1FKR A;  5DIU A;  2XP9 A;  4O2T A;  1D7J A;  3ARZ A;  1K9T A;  1JNE A;  1LJY A;  5D75 A;  2PI6 A;  3EY6 A;  1LG2 A;  1W9V A;  3WQW A;  1E6R A;  1FAP A;  2FAP A;  2RUD A;  4GGQ A;  3BXW A;  4DRK A;  3CGN A;  4TW6 A;  1JVW A;  3FAP A;  3WIJ A;  4S3J A;  4JFK A;  3AS0 A;  1W26 A;  2LJ4 A;  4ZS6 A;  2ZR5 A;  1NWS A;  1HJX A;  4WKA A;  3RGC A;  4DRQ A;  3RM9 A;  4DIP A;  3I6C A;  1ZBV A;  1LG1 A;  2G41 A;  4R0X A;  2M2A A;  3O5I A;  4G50 A;  4ZPV R;  4MNK A;  3O5D A;  2XP5 A;  4DRN A;  4DWS A;  3KAC A;  1QPF A;  3PRB A;  2KR7 A;  3O5E A;  3TDB A;  1U79 A;  1Q6U A;  3ARO A;  4DRP A;  3RM8 A;  4QT3 A;  1L1P A;  3ARP A;  3AS1 A;  1E9L A;  3UQI A;  4KR0 B;  3KAD A;  4P8W A;  1PBK A;  4WJX A;  3ARS A;  2ZQV A;  1KT0 A;  3PA7 A;  1EQ3 A;  1E15 A;  1HJW A;  2PPP A;  2QF8 A;  2YBT A;  1NMW A;  3O5L A;  3JYJ A;  1N1A A;  3ARX A;  4NNR A;  4LAY A;  1KT1 A;  2A3E A;  2KGJ A;  1FKL A;  3CGM A;  2F2D A;  4JFI A;  1ITX A;  1FKS A;  4ODK A;  2RUC A;  4QIB A;  3FY1 A;  3JYM A;  1W1Y A;  4U85 A;  3ARY A;  1XRV A;  2WM0 A;  2XP7 A;  5DEZ A;  3B9A A;  1W9U A;  4ODR A;  3ARQ A;  3ART A;  2DSV A;  3TC5 A;  4Z2J A;  3CHD A;  4JFM A;  2RUR A;  4PTM A;  4JYS A;  3RM4 A;  4ITZ A;  3IKD A;  1T11 A;  1F8A B;  1FKD A;  3OOB A;  1E6P A;  3KAF A;  4Q7N A;  2PV1 A;  3B9D A;  1FJD A;  5HWB A;  2PV3 A;  1FD9 A;  1NSG A;  2DT3 A;  1FKK A;  4WKF A;  1EYM A;  2AWG A;  4BF8 A;  1FKT A;  4ODN A;  1GPF A;  4DH0 A;  2YBU A;  2MNT A;  1W1P A;  5HKG A;  4Z2K A;  5GQB A;  1BKF A;  5HWC A;  3VAW A;  4JFJ A;  5DIV A;  1WAW A;  1ZL1 A;  3UI4 A;  1QZ2 A;  2DT1 A;  4W5U A;  3IK8 A;  4DWS D;  2KFW A;  3O5J A;  1UR8 A;  1LL6 A;  4Z2H A;  1E6N A;  1KFW A;  3ARV A;  4TW8 A;  2ZQS A;  4S3K A;  3WD2 A;  1ZBC A;  4NSB A;  4C02 B;  3B9E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...