1EQ3A

Nmr structure of human parvulin hpar14
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
96
structure length
96
Chain Sequence
NAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-PROLYL CIS/TRANS ISOMERASE (PPIASE)
publication title NMR solution structure of hPar14 reveals similarity to the peptidyl prolyl cis/trans isomerase domain of the mitotic regulator hPin1 but indicates a different functionality of the protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 14
structure length 96
sequence length 96
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2000-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1eq3A00
3KACA 5DIUA 4TNSA 4DROA 4ODMA 3MDYB 2MPHA 2VN1A 4QT2A 1J6YA 2KGJA 2ZQVA 2ZQTA 3NTPA 2D9FA 2OFNA 1PINA 2KFWA 4W9OA 2KO7A 1TCOC 1F40A 2F2DA 2ZR5A 2RQSA 4ITZA 4BF8A 3O5JA 1FKSA 2AWGA 2ITKA 4IPXA 1JNSA 3I6CA 1FKKA 2PPNA 3UI6A 2PV1A 2RUDA 1P5QA 3EY6A 3IHZA 5D75A 1Y0OA 3KAIA 4TW6A 1W26A 3RGCA 1FKJA 5J6EA 3PRBA 4TYOA 1YW5A 2ZQUA 2PV2A 3KZ7A 4JFJA 4ODKA 2XP9A 4DRJA 3O5LA 1FJDA 5GPGA 2K8IA 1N1AA 3UQIA 1JNTA 4ODPA 1J4RA 4U85A 2MLZA 4ODRA 2FKEA 1FKIA 3WH0A 3KAFA 1R9HA 3GPKA 3O5MA 2MNTA 2KR7A 1BL4A 1D7JA 2DG9A 3JXVA 3PA7A 2PBCA 2JZVA 5B8IC 1Q6HA 2XP7A 2M2AA 2PPPA 2RSEA 4JFIA 3LUOA 1PBKA 3KAGA 4LAYA 4ODQA 3TC5A 1F8AB 3ODKA 3UI4A 1ROUA 1ZK6A 2LJ4A 1ROTA 2N87A 2KE0A 3FAPA 2DG4A 3KAHA 4JYSA 3JYMA 4DZ2A 5HTGA 1EQ3A 1EYMA 1FKLA 1BKFA 2RURA 1QPLA 4NNRA 5HWBA 2F21A 4QT3A 3UF8A 3OOBA 2M08A 4C02B 5HUAA 3O5PA 1FKGA 3KADA 4ODNA 5HW6A 2M1IA 3CGNA 3UQAA 1YATA 4DIPA 4LAWA 1ZCNA 1KT1A 2XP3A 1D6OA 4IQCA 1NMVA 2LPVA 3O5IA 5HWCA 1L1PA 3PRDA 4DH0A 2Y78A 3JYJA 3O5RA 3O5QA 4FAPA 1Q6UA 2ZR6A 1QZ2A 4LAVA 1KT0A 1HXVA 4TX0A 3IKDA 2IF4A 4J4OA 4DRMA 4DRHA 1Q6IA 4G50A 3O5EA 4GIVA 1D7IA 3IK8A 5DITA 5HW7A 1FKHA 2ZR4A 3VAWA 2XP8A 3KABA 2XP4A 1FAPA 1T11A 4J4NA 4DZ3A 2XPBA 1A7XA 2F4EA 2FAPA 2DG3A 5BXJA 2RUCA 3B7XA 1U79A 1FD9A 1C9HA 4ODLA 1M5YA 4QIBA 5HW8A 3O5GA 2L2SA 4G2PA 4R0XA 4LAXA 1FKBA 4FN2A 4JFKA 5I98A 1J4HA 2RUQA 4GGQA 2Q5AA 4DRNA 1J4IA 2XP5A 3UI5A 3CGMA 4O2TA 5HKGA 1NSGA 2MLYA 2PV3A 2XPAA 3NRKA 3IKGA 1QPFA 2LKNA 2MF9A 3KCEA 3O5OA 3O5KA 5HT1A 4U84A 1FKRA 1B6CA 2PPOA 3H9RB 1JVWA 3O5DA 2VCDA 2ZQSA 4JFLA 4W9QA 3O5FA 4DRQA 4DRPA 4MSPA 4TW7A 3RFWA 2LGOA 1Q1CA 2XP6A 1FKTA 3NI6A 4W9PA 4DRIA 4ODOA 3UQBA 4MGVA 4IQ2A 4JFMA 4U86A 1D7HA 2MLXA 3TDBA 1NMWA 2KI3A 4DRKA 1FKDA 1FKFA 4TW8A 3TCZA 2UZ5A 5DIVA 4DT4A 4N19A
chains in the Genus database with same CATH superfamily
5GPRA 4TNSA 4QT2A 2VN1A 1J6YA 4HBOA 2OFNA 1PINA 4MNLA 2DSZA 1E44A 2KFWA 4ITZA 2AWGA 4IPXA 3I6CA 2DT1A 4WJXA 1H0GA 1OGBA 3CH9A 2PV1A 2OLHA 3KAIA 1W26A 1FKJA 3PR9A 4MAVA 4MPKA 2XP9A 1N1AA 4MTVA 1O6IA 4ODPA 1J4RA 1HJXA 4ODRA 4U85A 2FKEA 1HJWA 4PTMA 3W4RA 5JH8A 3O5MA 1WB0A 1BL4A 1D7JA 3CZ8A 2PBCA 2JZVA 1NWRA 2M2AA 2RSEA 3TC5A 1F8AB 1D2KA 3FAPA 5GQBA 3AS1A 4P8VA 2YBUA 4Z2HA 2DT0A 1FKGA 3CGNA 3RM9A 3ARVA 1ZCNA 1KT1A 3RM8A 1UR8A 1K9TA 3FXYA 1NMVA 1L1PA 3BMBA 2P4VA 4DWSC 1Q6UA 2ZR6A 4XAKA 1LL6A 3IKDA 2IF4A 3WL0A 3O5EA 4GIVA 5DITA 5HW7A 3VAWA 1E6PA 3ARYA 2F4EA 2DG3A 3WD1A 1GPFA 3B7XA 1U79A 1C9HA 3AS3A 2O92A 4UDMA 4Z2LA 1XHGA 5HW8A 3O5GA 2A3BA 4R0XA 1FKBA 4FN2A 4URIA 4Z2IA 4WKHA 2XP5A 3ARTA 1NSGA 1WAWA 3GTYX 2LKNA 3O5OA 5HT1A 3H9RB 1HKJA 3PRAA 1UR9A 2VCDA 4DRQA 4DRPA 3RFWA 4W9PA 2XP6A 1FKTA 4MGVA 1D7HA 1ZB5A 1ZU8A 1ZL1A 1FKDA 1FKFA 3TCZA 3WD0A 2EULA 2D9FA 2DT2A 1LG1A 1LQ0A 4P8XA 1OGGA 1F40A 1W9VA 2RQSA 3O5JA 2ITKA 4P8WA 1JNSA 3RM4A 5J6EA 2B31A 2B5UB 4ZS6A 3PRBA 1KFWA 4TYOA 3WD4A 2ZQUA 4JFJA 2G8ZA 1FJDA 3B8SA 2K8IA 4WKFA 3ARSA 2MLZA 3ARWA 3KAFA 1GUVA 1R9HA 3GPKA 3JXVA 2KR7A 1HKMA 1SYTA 3PA7A 2A3AA 3RMEA 3AROA 5B8IC 1Q6HA 2PPPA 3GU0A 3ALGA 3KAGA 4LAYA 4L3NA 4ODQA 1ZBKA 1JNEA 2DSVA 2KE0A 1LJYA 2DG4A 4DZ2A 4S3KA 1FKLA 1GRJA 1QPLA 4NNRA 2M08A 1X6NA 1W1YA 2M1IA 1NH6A 3CHCA 1YATA 3ARPA 3ARQA 4LAWA 4DIPA 2XP3A 4WK9A 3CHFA 2LPVA 1W9PA 3PRDA 4ZPVR 3O5QA 4HARA 4FAPA 3WL1A 3FY1A 3WQVA 1D7IA 4MNKA 1LL4A 1LG2A 3AS0A 1W9UA 1FAPA 1T11A 2FAPA 1FD9A 1NWSA 4ODLA 4QIBA 2L2SA 2ESCA 3WIJA 3WKZA 4P8UA 2IUZA 4R5EA 2PV3A 2XPAA 4ZPWR 2A3EA 4DWSD 3O5KA 4U84A 1B6CA 3AQUA 3CHDA 2WM0A 1W1TA 4ML4A 2LGOA 1Q1CA 4Z2JA 4MNJA 3WD2A 2YBTA 4ODOA 3TDBA 1CTNA 4Z2KA 2KI3A 3ARRA 2UZ5A 5DIVA 1E6RA 1EDQA 5DIUA 1IX5A 2MPHA 4MNMA 3NTPA 4W9OA 2F2DA 2ZR5A 1FKSA 1X6LA 2RUDA 3IHZA 4DWSA 1Y0OA 5DF0A 1E6ZA 3B9EA 4AY1A 3ARZA 1YW5A 2A3CA 3KZ7A 4ODKA 3EIPA 3UQIA 3WH0A 1GOIA 2MNTA 4NSBA 2DG9A 2WLYA 2AOSA 4JFIA 1EHNA 1ROUA 1ZK6A 2N87A 3KAHA 4JYSA 1E9LA 1HKKA 5HWBA 2F21A 4KR0B 3OOBA 1JNDA 5DO2A 5HUAA 3O5PA 3UQAA 3KADA 1W1PA 4ODNA 1JCHB 2G41A 3WQWA 4L72B 1D6OA 1LL7A 5HWCA 4DH0A 2Y78A 3B9AA 3O5RA 1HXVA 4LAVA 1QZ2A 4TX0A 4ZPTR 2WK2A 2DSWA 4G50A 1FKHA 2ZR4A 3KABA 2XP8A 4DZ3A 3ARXA 1HJVA 1M5YA 4IT6A 1EIBA 1VF8A 1NWUA 4G2PA 4KQZA 4LAXA 4HBEA 4JFKA 4Q22A 5I98A 1J4HA 4GGQA 1J4IA 3UI5A 3CGMA 5HKGA 1WNOA 2PI6A 1FKRA 1QPFA 3KCEA 1TFVA 1RD6A 2PPOA 3O5DA 4JFLA 4W9QA 3O5FA 1ZBVA 3NI6A 4WKAA 4DRIA 4DWSB 3UQBA 1SR0A 1E15A 4U86A 2MLXA 2O9OA 2QF8A 4DRKA 1W1VA 4S3JA 4DT4A 4N19A 3KACA 4DROA 4ODMA 3MDYB 2KGJA 2ZQVA 2ZQTA 2F23A 2WLZA 2KO7A 1TCOC 4BF8A 4W5UA 1FKKA 2PPNA 3UI6A 1P5QA 2FDMA 3EY6A 5D75A 4TW6A 3RGCA 1ITXA 2PV2A 1XRVA 4DRJA 3O5LA 5GPGA 1JNTA 1FKIA 2DSUA 3G6LA 4Q7NA 2XP7A 1FFQA 3LUOA 1PBKA 3ODKA 3UI4A 2LJ4A 1ROTA 3ALFA 3JYMA 1EQ3A 1EYMA 1BKFA 2RURA 1OWQA 4QT3A 4Z2GA 3UF8A 4C02B 3BXWA 5HW6A 2DPEA 4LGXA 4IQCA 3O5IA 3AS2A 3JYJA 3QOKA 5DEZA 1KT0A 4NZCA 4J4OA 4DRMA 4DRHA 1E6NA 1Q6IA 3ARUA 3IK8A 2XP4A 4J4NA 2ETNA 1H0IA 2XPBA 1A7XA 5BXJA 2RUCA 2PN0A 4IT4A 2RUQA 4WIWA 2Q5AA 4DRNA 3OA5A 4O2TA 1ZBWA 2MLYA 3NRKA 5HTGA 3IKGA 2MF9A 1JVWA 1NWTA 2ZQSA 1ZBCA 3WD3A 4MSPA 3G6MA 4TW7A 4QZVB 1HKIA 3CHEA 5HBFA 4IQ2A 4JFMA 1FFRA 1NMWA 4TW8A 2DT3A 3B9DA
chains in the Genus database with same CATH topology
5GPRA 4TNSA 4QT2A 2VN1A 1J6YA 4HBOA 2OFNA 1PINA 4MNLA 2DSZA 2KFWA 4ITZA 2AWGA 4IPXA 3I6CA 2DT1A 4WJXA 1H0GA 1OGBA 3CH9A 2PV1A 2OLHA 3KAIA 1W26A 1FKJA 3PR9A 4MAVA 4MPKA 2XP9A 1N1AA 4MTVA 1O6IA 4ODPA 1J4RA 1HJXA 4ODRA 4U85A 2FKEA 1HJWA 4PTMA 3W4RA 5JH8A 3O5MA 1WB0A 1BL4A 1D7JA 3CZ8A 2PBCA 2JZVA 1NWRA 2M2AA 2RSEA 3TC5A 1F8AB 1D2KA 3FAPA 5GQBA 3AS1A 4P8VA 2YBUA 4Z2HA 2DT0A 1FKGA 3CGNA 3RM9A 3ARVA 1ZCNA 1KT1A 3RM8A 1UR8A 1K9TA 3FXYA 1NMVA 1L1PA 4DWSC 1Q6UA 2ZR6A 4XAKA 1LL6A 3IKDA 2IF4A 3WL0A 3O5EA 4GIVA 5DITA 5HW7A 3VAWA 1E6PA 3ARYA 2F4EA 2DG3A 3WD1A 1GPFA 3B7XA 1U79A 1C9HA 3AS3A 2O92A 4Z2LA 1XHGA 5HW8A 3O5GA 2A3BA 4R0XA 1FKBA 4FN2A 4URIA 4Z2IA 4WKHA 2XP5A 3ARTA 1NSGA 1WAWA 5HT1A 2LKNA 3O5OA 3H9RB 1HKJA 3PRAA 1UR9A 2VCDA 4DRQA 4DRPA 3RFWA 4W9PA 2XP6A 1FKTA 4MGVA 1D7HA 1ZB5A 1ZU8A 1ZL1A 1FKDA 1FKFA 3TCZA 3WD0A 2D9FA 2DT2A 1LG1A 1LQ0A 4P8XA 1OGGA 1F40A 1W9VA 2RQSA 3O5JA 2ITKA 4P8WA 1JNSA 3RM4A 5J6EA 2B31A 4ZS6A 3PRBA 1KFWA 4TYOA 3WD4A 2ZQUA 4JFJA 2G8ZA 1FJDA 3B8SA 2K8IA 4WKFA 3ARSA 2MLZA 3ARWA 3KAFA 1GUVA 1R9HA 3GPKA 3JXVA 2KR7A 1HKMA 1SYTA 3PA7A 2A3AA 3RMEA 3AROA 5B8IC 1Q6HA 2PPPA 3ALGA 3KAGA 4LAYA 4L3NA 4ODQA 1ZBKA 1JNEA 2DSVA 2KE0A 1LJYA 2DG4A 4DZ2A 4S3KA 1FKLA 1QPLA 4NNRA 2M08A 1X6NA 1W1YA 2M1IA 1NH6A 3CHCA 1YATA 3ARPA 3ARQA 4LAWA 4DIPA 2XP3A 4WK9A 3CHFA 2LPVA 1W9PA 3PRDA 4ZPVR 3O5QA 4HARA 4FAPA 3WL1A 3FY1A 3WQVA 1D7IA 4MNKA 1LL4A 1LG2A 3AS0A 1W9UA 1FAPA 1T11A 2FAPA 1FD9A 1NWSA 4ODLA 4QIBA 2L2SA 2ESCA 3WIJA 3WKZA 4P8UA 2IUZA 4R5EA 2PV3A 2XPAA 4ZPWR 2A3EA 4DWSD 3O5KA 4U84A 1B6CA 3AQUA 3CHDA 2WM0A 1W1TA 4ML4A 2LGOA 1Q1CA 4Z2JA 4MNJA 3WD2A 2YBTA 4ODOA 3TDBA 1CTNA 4Z2KA 2KI3A 3ARRA 2UZ5A 5DIVA 1E6RA 1EDQA 5DIUA 1IX5A 2MPHA 4MNMA 3NTPA 4W9OA 2F2DA 2ZR5A 1FKSA 1X6LA 2RUDA 3IHZA 4DWSA 1Y0OA 5DF0A 1E6ZA 3B9EA 4AY1A 3ARZA 1YW5A 2A3CA 3KZ7A 4ODKA 3UQIA 3WH0A 1GOIA 2MNTA 4NSBA 2DG9A 2WLYA 2AOSA 4JFIA 1EHNA 1ROUA 1ZK6A 2N87A 3KAHA 4JYSA 1E9LA 1HKKA 5HWBA 2F21A 4KR0B 3OOBA 1JNDA 5DO2A 5HUAA 3O5PA 3UQAA 3KADA 1W1PA 4ODNA 2G41A 3WQWA 4L72B 1D6OA 1LL7A 5HWCA 4DH0A 2Y78A 3B9AA 3O5RA 1HXVA 4LAVA 1QZ2A 4TX0A 4ZPTR 2WK2A 2DSWA 4G50A 1FKHA 2ZR4A 2XP8A 3KABA 4DZ3A 3ARXA 1HJVA 1M5YA 4IT6A 1EIBA 1VF8A 1NWUA 4G2PA 4KQZA 4LAXA 4HBEA 4JFKA 4Q22A 5I98A 1J4HA 4GGQA 1J4IA 3UI5A 3CGMA 5HKGA 1WNOA 2PI6A 1FKRA 1QPFA 3KCEA 1TFVA 1RD6A 2PPOA 3O5DA 4JFLA 4W9QA 3O5FA 1ZBVA 3NI6A 4WKAA 4DRIA 4DWSB 3UQBA 1SR0A 1E15A 4U86A 2MLXA 2O9OA 2QF8A 4DRKA 1W1VA 4S3JA 4DT4A 4N19A 3KACA 4DROA 4ODMA 3MDYB 2KGJA 2ZQVA 2ZQTA 2WLZA 2KO7A 1TCOC 4BF8A 4W5UA 1FKKA 2PPNA 3UI6A 1P5QA 2FDMA 3EY6A 5D75A 4TW6A 3RGCA 1ITXA 2PV2A 1XRVA 4DRJA 3O5LA 5GPGA 1JNTA 1FKIA 2DSUA 3G6LA 4Q7NA 2XP7A 1FFQA 3LUOA 1PBKA 3ODKA 3UI4A 2LJ4A 1ROTA 3ALFA 3JYMA 1EQ3A 1EYMA 1BKFA 2RURA 1OWQA 4QT3A 4Z2GA 3UF8A 4C02B 3BXWA 5HW6A 2DPEA 4LGXA 4IQCA 3O5IA 3AS2A 3JYJA 3QOKA 5DEZA 1KT0A 4NZCA 4J4OA 4DRMA 4DRHA 1E6NA 1Q6IA 3ARUA 3IK8A 2XP4A 4J4NA 1H0IA 2XPBA 1A7XA 5BXJA 2RUCA 4IT4A 2RUQA 4WIWA 2Q5AA 4DRNA 3OA5A 4O2TA 1ZBWA 2MLYA 3NRKA 5HTGA 3IKGA 2MF9A 1JVWA 1NWTA 2ZQSA 1ZBCA 3WD3A 4MSPA 3G6MA 4TW7A 4QZVB 1HKIA 3CHEA 5HBFA 4IQ2A 4JFMA 1FFRA 1NMWA 4TW8A 2DT3A 3B9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KAC A;  5DIU A;  4TNS A;  4DRO A;  4ODM A;  3MDY B;  2MPH A;  2VN1 A;  4QT2 A;  1J6Y A;  2KGJ A;  2ZQV A;  2ZQT A;  3NTP A;  2D9F A;  2OFN A;  1PIN A;  2KFW A;  4W9O A;  2KO7 A;  1TCO C;  1F40 A;  2F2D A;  2ZR5 A;  2RQS A;  4ITZ A;  4BF8 A;  3O5J A;  1FKS A;  2AWG A;  2ITK A;  4IPX A;  1JNS A;  3I6C A;  1FKK A;  2PPN A;  3UI6 A;  2PV1 A;  2RUD A;  1P5Q A;  3EY6 A;  3IHZ A;  5D75 A;  1Y0O A;  3KAI A;  4TW6 A;  1W26 A;  3RGC A;  1FKJ A;  5J6E A;  3PRB A;  4TYO A;  1YW5 A;  2ZQU A;  2PV2 A;  3KZ7 A;  4JFJ A;  4ODK A;  2XP9 A;  4DRJ A;  3O5L A;  1FJD A;  5GPG A;  2K8I A;  1N1A A;  3UQI A;  1JNT A;  4ODP A;  1J4R A;  4U85 A;  2MLZ A;  4ODR A;  2FKE A;  1FKI A;  3WH0 A;  3KAF A;  1R9H A;  3GPK A;  3O5M A;  2MNT A;  2KR7 A;  1BL4 A;  1D7J A;  2DG9 A;  3JXV A;  3PA7 A;  2PBC A;  2JZV A;  5B8I C;  1Q6H A;  2XP7 A;  2M2A A;  2PPP A;  2RSE A;  4JFI A;  3LUO A;  1PBK A;  3KAG A;  4LAY A;  4ODQ A;  3TC5 A;  1F8A B;  3ODK A;  3UI4 A;  1ROU A;  1ZK6 A;  2LJ4 A;  1ROT A;  2N87 A;  2KE0 A;  3FAP A;  2DG4 A;  3KAH A;  4JYS A;  3JYM A;  4DZ2 A;  5HTG A;  1EQ3 A;  1EYM A;  1FKL A;  1BKF A;  2RUR A;  1QPL A;  4NNR A;  5HWB A;  2F21 A;  4QT3 A;  3UF8 A;  3OOB A;  2M08 A;  4C02 B;  5HUA A;  3O5P A;  1FKG A;  3KAD A;  4ODN A;  5HW6 A;  2M1I A;  3CGN A;  3UQA A;  1YAT A;  4DIP A;  4LAW A;  1ZCN A;  1KT1 A;  2XP3 A;  1D6O A;  4IQC A;  1NMV A;  2LPV A;  3O5I A;  5HWC A;  1L1P A;  3PRD A;  4DH0 A;  2Y78 A;  3JYJ A;  3O5R A;  3O5Q A;  4FAP A;  1Q6U A;  2ZR6 A;  1QZ2 A;  4LAV A;  1KT0 A;  1HXV A;  4TX0 A;  3IKD A;  2IF4 A;  4J4O A;  4DRM A;  4DRH A;  1Q6I A;  4G50 A;  3O5E A;  4GIV A;  1D7I A;  3IK8 A;  5DIT A;  5HW7 A;  1FKH A;  2ZR4 A;  3VAW A;  2XP8 A;  3KAB A;  2XP4 A;  1FAP A;  1T11 A;  4J4N A;  4DZ3 A;  2XPB A;  1A7X A;  2F4E A;  2FAP A;  2DG3 A;  5BXJ A;  2RUC A;  3B7X A;  1U79 A;  1FD9 A;  1C9H A;  4ODL A;  1M5Y A;  4QIB A;  5HW8 A;  3O5G A;  2L2S A;  4G2P A;  4R0X A;  4LAX A;  1FKB A;  4FN2 A;  4JFK A;  5I98 A;  1J4H A;  2RUQ A;  4GGQ A;  2Q5A A;  4DRN A;  1J4I A;  2XP5 A;  3UI5 A;  3CGM A;  4O2T A;  5HKG A;  1NSG A;  2MLY A;  2PV3 A;  2XPA A;  3NRK A;  3IKG A;  1QPF A;  2LKN A;  2MF9 A;  3KCE A;  3O5O A;  3O5K A;  5HT1 A;  4U84 A;  1FKR A;  1B6C A;  2PPO A;  3H9R B;  1JVW A;  3O5D A;  2VCD A;  2ZQS A;  4JFL A;  4W9Q A;  3O5F A;  4DRQ A;  4DRP A;  4MSP A;  4TW7 A;  3RFW A;  2LGO A;  1Q1C A;  2XP6 A;  1FKT A;  3NI6 A;  4W9P A;  4DRI A;  4ODO A;  3UQB A;  4MGV A;  4IQ2 A;  4JFM A;  4U86 A;  1D7H A;  2MLX A;  3TDB A;  1NMW A;  2KI3 A;  4DRK A;  1FKD A;  1FKF A;  4TW8 A;  3TCZ A;  2UZ5 A;  5DIV A;  4DT4 A;  4N19 A; 
#chains in the Genus database with same CATH topology
 5GPR A;  4TNS A;  4QT2 A;  2VN1 A;  1J6Y A;  4HBO A;  2OFN A;  1PIN A;  4MNL A;  2DSZ A;  1E44 A;  2KFW A;  4ITZ A;  2AWG A;  4IPX A;  3I6C A;  2DT1 A;  4WJX A;  1H0G A;  1OGB A;  3CH9 A;  2PV1 A;  2OLH A;  3KAI A;  1W26 A;  1FKJ A;  3PR9 A;  4MAV A;  4MPK A;  2XP9 A;  1N1A A;  4MTV A;  1O6I A;  4ODP A;  1J4R A;  1HJX A;  4ODR A;  4U85 A;  2FKE A;  1HJW A;  4PTM A;  3W4R A;  5JH8 A;  3O5M A;  1WB0 A;  1BL4 A;  1D7J A;  3CZ8 A;  2PBC A;  2JZV A;  1NWR A;  2M2A A;  2RSE A;  3TC5 A;  1F8A B;  1D2K A;  3FAP A;  5GQB A;  3AS1 A;  4P8V A;  2YBU A;  4Z2H A;  2DT0 A;  1FKG A;  3CGN A;  3RM9 A;  3ARV A;  1ZCN A;  1KT1 A;  3RM8 A;  1UR8 A;  1K9T A;  3FXY A;  1NMV A;  1L1P A;  3BMB A;  2P4V A;  4DWS C;  1Q6U A;  2ZR6 A;  4XAK A;  1LL6 A;  3IKD A;  2IF4 A;  3WL0 A;  3O5E A;  4GIV A;  5DIT A;  5HW7 A;  3VAW A;  1E6P A;  3ARY A;  2F4E A;  2DG3 A;  3WD1 A;  1GPF A;  3B7X A;  1U79 A;  1C9H A;  3AS3 A;  2O92 A;  4UDM A;  4Z2L A;  1XHG A;  5HW8 A;  3O5G A;  2A3B A;  4R0X A;  1FKB A;  4FN2 A;  4URI A;  4Z2I A;  4WKH A;  2XP5 A;  3ART A;  1NSG A;  1WAW A;  3GTY X;  2LKN A;  3O5O A;  5HT1 A;  3H9R B;  1HKJ A;  3PRA A;  1UR9 A;  2VCD A;  4DRQ A;  4DRP A;  3RFW A;  4W9P A;  2XP6 A;  1FKT A;  4MGV A;  1D7H A;  1ZB5 A;  1ZU8 A;  1ZL1 A;  1FKD A;  1FKF A;  3TCZ A;  3WD0 A;  2EUL A;  2D9F A;  2DT2 A;  1LG1 A;  1LQ0 A;  4P8X A;  1OGG A;  1F40 A;  1W9V A;  2RQS A;  3O5J A;  2ITK A;  4P8W A;  1JNS A;  3RM4 A;  5J6E A;  2B31 A;  2B5U B;  4ZS6 A;  3PRB A;  1KFW A;  4TYO A;  3WD4 A;  2ZQU A;  4JFJ A;  2G8Z A;  1FJD A;  3B8S A;  2K8I A;  4WKF A;  3ARS A;  2MLZ A;  3ARW A;  3KAF A;  1GUV A;  1R9H A;  3GPK A;  3JXV A;  2KR7 A;  1HKM A;  1SYT A;  3PA7 A;  2A3A A;  3RME A;  3ARO A;  5B8I C;  1Q6H A;  2PPP A;  3GU0 A;  3ALG A;  3KAG A;  4LAY A;  4L3N A;  4ODQ A;  1ZBK A;  1JNE A;  2DSV A;  2KE0 A;  1LJY A;  2DG4 A;  4DZ2 A;  4S3K A;  1FKL A;  1GRJ A;  1QPL A;  4NNR A;  2M08 A;  1X6N A;  1W1Y A;  2M1I A;  1NH6 A;  3CHC A;  1YAT A;  3ARP A;  3ARQ A;  4LAW A;  4DIP A;  2XP3 A;  4WK9 A;  3CHF A;  2LPV A;  1W9P A;  3PRD A;  4ZPV R;  3O5Q A;  4HAR A;  4FAP A;  3WL1 A;  3FY1 A;  3WQV A;  1D7I A;  4MNK A;  1LL4 A;  1LG2 A;  3AS0 A;  1W9U A;  1FAP A;  1T11 A;  2FAP A;  1FD9 A;  1NWS A;  4ODL A;  4QIB A;  2L2S A;  2ESC A;  3WIJ A;  3WKZ A;  4P8U A;  2IUZ A;  4R5E A;  2PV3 A;  2XPA A;  4ZPW R;  2A3E A;  4DWS D;  3O5K A;  4U84 A;  1B6C A;  3AQU A;  3CHD A;  2WM0 A;  1W1T A;  4ML4 A;  2LGO A;  1Q1C A;  4Z2J A;  4MNJ A;  3WD2 A;  2YBT A;  4ODO A;  3TDB A;  1CTN A;  4Z2K A;  2KI3 A;  3ARR A;  2UZ5 A;  5DIV A;  1E6R A;  1EDQ A;  5DIU A;  1IX5 A;  2MPH A;  4MNM A;  3NTP A;  4W9O A;  2F2D A;  2ZR5 A;  1FKS A;  1X6L A;  2RUD A;  3IHZ A;  4DWS A;  1Y0O A;  5DF0 A;  1E6Z A;  3B9E A;  4AY1 A;  3ARZ A;  1YW5 A;  2A3C A;  3KZ7 A;  4ODK A;  3EIP A;  3UQI A;  3WH0 A;  1GOI A;  2MNT A;  4NSB A;  2DG9 A;  2WLY A;  2AOS A;  4JFI A;  1EHN A;  1ROU A;  1ZK6 A;  2N87 A;  3KAH A;  4JYS A;  1E9L A;  1HKK A;  5HWB A;  2F21 A;  4KR0 B;  3OOB A;  1JND A;  5DO2 A;  5HUA A;  3O5P A;  3UQA A;  3KAD A;  1W1P A;  4ODN A;  1JCH B;  2G41 A;  3WQW A;  4L72 B;  1D6O A;  1LL7 A;  5HWC A;  4DH0 A;  2Y78 A;  3B9A A;  3O5R A;  1HXV A;  4LAV A;  1QZ2 A;  4TX0 A;  4ZPT R;  2WK2 A;  2DSW A;  4G50 A;  1FKH A;  2ZR4 A;  3KAB A;  2XP8 A;  4DZ3 A;  3ARX A;  1HJV A;  1M5Y A;  4IT6 A;  1EIB A;  1VF8 A;  1NWU A;  4G2P A;  4KQZ A;  4LAX A;  4HBE A;  4JFK A;  4Q22 A;  5I98 A;  1J4H A;  4GGQ A;  1J4I A;  3UI5 A;  3CGM A;  5HKG A;  1WNO A;  2PI6 A;  1FKR A;  1QPF A;  3KCE A;  1TFV A;  1RD6 A;  2PPO A;  3O5D A;  4JFL A;  4W9Q A;  3O5F A;  1ZBV A;  3NI6 A;  4WKA A;  4DRI A;  4DWS B;  3UQB A;  1SR0 A;  1E15 A;  4U86 A;  2MLX A;  2O9O A;  2QF8 A;  4DRK A;  1W1V A;  4S3J A;  4DT4 A;  4N19 A;  3KAC A;  4DRO A;  4ODM A;  3MDY B;  2KGJ A;  2ZQV A;  2ZQT A;  2F23 A;  2WLZ A;  2KO7 A;  1TCO C;  4BF8 A;  4W5U A;  1FKK A;  2PPN A;  3UI6 A;  1P5Q A;  2FDM A;  3EY6 A;  5D75 A;  4TW6 A;  3RGC A;  1ITX A;  2PV2 A;  1XRV A;  4DRJ A;  3O5L A;  5GPG A;  1JNT A;  1FKI A;  2DSU A;  3G6L A;  4Q7N A;  2XP7 A;  1FFQ A;  3LUO A;  1PBK A;  3ODK A;  3UI4 A;  2LJ4 A;  1ROT A;  3ALF A;  3JYM A;  1EQ3 A;  1EYM A;  1BKF A;  2RUR A;  1OWQ A;  4QT3 A;  4Z2G A;  3UF8 A;  4C02 B;  3BXW A;  5HW6 A;  2DPE A;  4LGX A;  4IQC A;  3O5I A;  3AS2 A;  3JYJ A;  3QOK A;  5DEZ A;  1KT0 A;  4NZC A;  4J4O A;  4DRM A;  4DRH A;  1E6N A;  1Q6I A;  3ARU A;  3IK8 A;  2XP4 A;  4J4N A;  2ETN A;  1H0I A;  2XPB A;  1A7X A;  5BXJ A;  2RUC A;  2PN0 A;  4IT4 A;  2RUQ A;  4WIW A;  2Q5A A;  4DRN A;  3OA5 A;  4O2T A;  1ZBW A;  2MLY A;  3NRK A;  5HTG A;  3IKG A;  2MF9 A;  1JVW A;  1NWT A;  2ZQS A;  1ZBC A;  3WD3 A;  4MSP A;  3G6M A;  4TW7 A;  4QZV B;  1HKI A;  3CHE A;  5HBF A;  4IQ2 A;  4JFM A;  1FFR A;  1NMW A;  4TW8 A;  2DT3 A;  3B9D A; 
#chains in the Genus database with same CATH homology
 5GPR A;  4TNS A;  4QT2 A;  2VN1 A;  1J6Y A;  4HBO A;  2OFN A;  1PIN A;  4MNL A;  2DSZ A;  2KFW A;  4ITZ A;  2AWG A;  4IPX A;  3I6C A;  2DT1 A;  4WJX A;  1H0G A;  1OGB A;  3CH9 A;  2PV1 A;  2OLH A;  3KAI A;  1W26 A;  1FKJ A;  3PR9 A;  4MAV A;  4MPK A;  2XP9 A;  1N1A A;  4MTV A;  1O6I A;  4ODP A;  1J4R A;  1HJX A;  4ODR A;  4U85 A;  2FKE A;  1HJW A;  4PTM A;  3W4R A;  5JH8 A;  3O5M A;  1WB0 A;  1BL4 A;  1D7J A;  3CZ8 A;  2PBC A;  2JZV A;  1NWR A;  2M2A A;  2RSE A;  3TC5 A;  1F8A B;  1D2K A;  3FAP A;  5GQB A;  3AS1 A;  4P8V A;  2YBU A;  4Z2H A;  2DT0 A;  1FKG A;  3CGN A;  3RM9 A;  3ARV A;  1ZCN A;  1KT1 A;  3RM8 A;  1UR8 A;  1K9T A;  3FXY A;  1NMV A;  1L1P A;  4DWS C;  1Q6U A;  2ZR6 A;  4XAK A;  1LL6 A;  3IKD A;  2IF4 A;  3WL0 A;  3O5E A;  4GIV A;  5DIT A;  5HW7 A;  3VAW A;  1E6P A;  3ARY A;  2F4E A;  2DG3 A;  3WD1 A;  1GPF A;  3B7X A;  1U79 A;  1C9H A;  3AS3 A;  2O92 A;  4Z2L A;  1XHG A;  5HW8 A;  3O5G A;  2A3B A;  4R0X A;  1FKB A;  4FN2 A;  4URI A;  4Z2I A;  4WKH A;  2XP5 A;  3ART A;  1NSG A;  1WAW A;  5HT1 A;  2LKN A;  3O5O A;  3H9R B;  1HKJ A;  3PRA A;  1UR9 A;  2VCD A;  4DRQ A;  4DRP A;  3RFW A;  4W9P A;  2XP6 A;  1FKT A;  4MGV A;  1D7H A;  1ZB5 A;  1ZU8 A;  1ZL1 A;  1FKD A;  1FKF A;  3TCZ A;  3WD0 A;  2D9F A;  2DT2 A;  1LG1 A;  1LQ0 A;  4P8X A;  1OGG A;  1F40 A;  1W9V A;  2RQS A;  3O5J A;  2ITK A;  4P8W A;  1JNS A;  3RM4 A;  5J6E A;  2B31 A;  4ZS6 A;  3PRB A;  1KFW A;  4TYO A;  3WD4 A;  2ZQU A;  4JFJ A;  2G8Z A;  1FJD A;  3B8S A;  2K8I A;  4WKF A;  3ARS A;  2MLZ A;  3ARW A;  3KAF A;  1GUV A;  1R9H A;  3GPK A;  3JXV A;  2KR7 A;  1HKM A;  1SYT A;  3PA7 A;  2A3A A;  3RME A;  3ARO A;  5B8I C;  1Q6H A;  2PPP A;  3ALG A;  3KAG A;  4LAY A;  4L3N A;  4ODQ A;  1ZBK A;  1JNE A;  2DSV A;  2KE0 A;  1LJY A;  2DG4 A;  4DZ2 A;  4S3K A;  1FKL A;  1QPL A;  4NNR A;  2M08 A;  1X6N A;  1W1Y A;  2M1I A;  1NH6 A;  3CHC A;  1YAT A;  3ARP A;  3ARQ A;  4LAW A;  4DIP A;  2XP3 A;  4WK9 A;  3CHF A;  2LPV A;  1W9P A;  3PRD A;  4ZPV R;  3O5Q A;  4HAR A;  4FAP A;  3WL1 A;  3FY1 A;  3WQV A;  1D7I A;  4MNK A;  1LL4 A;  1LG2 A;  3AS0 A;  1W9U A;  1FAP A;  1T11 A;  2FAP A;  1FD9 A;  1NWS A;  4ODL A;  4QIB A;  2L2S A;  2ESC A;  3WIJ A;  3WKZ A;  4P8U A;  2IUZ A;  4R5E A;  2PV3 A;  2XPA A;  4ZPW R;  2A3E A;  4DWS D;  3O5K A;  4U84 A;  1B6C A;  3AQU A;  3CHD A;  2WM0 A;  1W1T A;  4ML4 A;  2LGO A;  1Q1C A;  4Z2J A;  4MNJ A;  3WD2 A;  2YBT A;  4ODO A;  3TDB A;  1CTN A;  4Z2K A;  2KI3 A;  3ARR A;  2UZ5 A;  5DIV A;  1E6R A;  1EDQ A;  5DIU A;  1IX5 A;  2MPH A;  4MNM A;  3NTP A;  4W9O A;  2F2D A;  2ZR5 A;  1FKS A;  1X6L A;  2RUD A;  3IHZ A;  4DWS A;  1Y0O A;  5DF0 A;  1E6Z A;  3B9E A;  4AY1 A;  3ARZ A;  1YW5 A;  2A3C A;  3KZ7 A;  4ODK A;  3UQI A;  3WH0 A;  1GOI A;  2MNT A;  4NSB A;  2DG9 A;  2WLY A;  2AOS A;  4JFI A;  1EHN A;  1ROU A;  1ZK6 A;  2N87 A;  3KAH A;  4JYS A;  1E9L A;  1HKK A;  5HWB A;  2F21 A;  4KR0 B;  3OOB A;  1JND A;  5DO2 A;  5HUA A;  3O5P A;  3UQA A;  3KAD A;  1W1P A;  4ODN A;  2G41 A;  3WQW A;  4L72 B;  1D6O A;  1LL7 A;  5HWC A;  4DH0 A;  2Y78 A;  3B9A A;  3O5R A;  1HXV A;  4LAV A;  1QZ2 A;  4TX0 A;  4ZPT R;  2WK2 A;  2DSW A;  4G50 A;  1FKH A;  2ZR4 A;  2XP8 A;  3KAB A;  4DZ3 A;  3ARX A;  1HJV A;  1M5Y A;  4IT6 A;  1EIB A;  1VF8 A;  1NWU A;  4G2P A;  4KQZ A;  4LAX A;  4HBE A;  4JFK A;  4Q22 A;  5I98 A;  1J4H A;  4GGQ A;  1J4I A;  3UI5 A;  3CGM A;  5HKG A;  1WNO A;  2PI6 A;  1FKR A;  1QPF A;  3KCE A;  1TFV A;  1RD6 A;  2PPO A;  3O5D A;  4JFL A;  4W9Q A;  3O5F A;  1ZBV A;  3NI6 A;  4WKA A;  4DRI A;  4DWS B;  3UQB A;  1SR0 A;  1E15 A;  4U86 A;  2MLX A;  2O9O A;  2QF8 A;  4DRK A;  1W1V A;  4S3J A;  4DT4 A;  4N19 A;  3KAC A;  4DRO A;  4ODM A;  3MDY B;  2KGJ A;  2ZQV A;  2ZQT A;  2WLZ A;  2KO7 A;  1TCO C;  4BF8 A;  4W5U A;  1FKK A;  2PPN A;  3UI6 A;  1P5Q A;  2FDM A;  3EY6 A;  5D75 A;  4TW6 A;  3RGC A;  1ITX A;  2PV2 A;  1XRV A;  4DRJ A;  3O5L A;  5GPG A;  1JNT A;  1FKI A;  2DSU A;  3G6L A;  4Q7N A;  2XP7 A;  1FFQ A;  3LUO A;  1PBK A;  3ODK A;  3UI4 A;  2LJ4 A;  1ROT A;  3ALF A;  3JYM A;  1EQ3 A;  1EYM A;  1BKF A;  2RUR A;  1OWQ A;  4QT3 A;  4Z2G A;  3UF8 A;  4C02 B;  3BXW A;  5HW6 A;  2DPE A;  4LGX A;  4IQC A;  3O5I A;  3AS2 A;  3JYJ A;  3QOK A;  5DEZ A;  1KT0 A;  4NZC A;  4J4O A;  4DRM A;  4DRH A;  1E6N A;  1Q6I A;  3ARU A;  3IK8 A;  2XP4 A;  4J4N A;  1H0I A;  2XPB A;  1A7X A;  5BXJ A;  2RUC A;  4IT4 A;  2RUQ A;  4WIW A;  2Q5A A;  4DRN A;  3OA5 A;  4O2T A;  1ZBW A;  2MLY A;  3NRK A;  5HTG A;  3IKG A;  2MF9 A;  1JVW A;  1NWT A;  2ZQS A;  1ZBC A;  3WD3 A;  4MSP A;  3G6M A;  4TW7 A;  4QZV B;  1HKI A;  3CHE A;  5HBF A;  4IQ2 A;  4JFM A;  1FFR A;  1NMW A;  4TW8 A;  2DT3 A;  3B9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...