1EQ3A

Nmr structure of human parvulin hpar14
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
96
structure length
96
Chain Sequence
b'NAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-PROLYL CIS/TRANS ISOMERASE (PPIASE)
publication title NMR solution structure of hPar14 reveals similarity to the peptidyl prolyl cis/trans isomerase domain of the mitotic regulator hPin1 but indicates a different functionality of the protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 14
structure length 96
sequence length 96
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2000-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1eq3A00
2XP6A 2PPPA 2L2SA 1FJDA 4DROA 5DITA 4DZ3A 3UQBA 1FKGA 4IQCA 4DRPA 2ITKA 3O5KA 4JFMA 2PV1A 2JZVA 2UZ5A 1M5YA 3OOBA 4G50A 2DG4A 4LAYA 4DRJA 3NI6A 2KE0A 1KT0A 4ODRA 4TW7A 1J6YA 2XP7A 3UI4A 4ODQA 2F21A 1A7XA 2PPNA 3TDBA 2KFWA 3KACA 4JFJA 3O5LA 4DT4A 4DH0A 5HUAA 2RSEA 2D9FA 4BF8A 4ODOA 2MPHA 1F40A 4G2PA 1J4IA 1P5QA 1F8AB 3JYMA 5DIUA 2XP5A 4QT2A 4ODLA 5I98A 2LJ4A 2PV3A 2ZQTA 1FKBA 1QZ2A 4TW6A 3IHZA 3O5IA 2M1IA 3KAHA 4R0XA 4DIPA 2MLXA 2Q5AA 4QIBA 3KAGA 2XP9A 4QT3A 4W9QA 3VAWA 3CGNA 1D7IA 2KR7A 2OFNA 2VCDA 3O5JA 4LAVA 1TCOC 5B8IC 2XP3A 3EY6A 2ZQSA 4GIVA 4GGQA 5HTGA 2FAPA 1PINA 4TX0A 2MF9A 3UI6A 5BXJA 1ZCNA 4NNRA 4FAPA 4JFKA 3TC5A 1T11A 3CGMA 4LAXA 3WH0A 4DRKA 2XPAA 2N87A 4TW8A 3O5GA 5J6EA 3O5DA 4TNSA 1FKJA 2RUDA 4N19A 1D7HA 3FAPA 4C02B 2DG9A 1R9HA 4U86A 5HWBA 3PRDA 3O5PA 2PPOA 2KGJA 3H9RB 4TYOA 5HT1A 2RUCA 4DRMA 2ZR4A 1Y0OA 3LUOA 4J4NA 4U85A 2XP8A 3O5EA 4DRNA 1Q6UA 4IPXA 1BL4A 1D7JA 3KAFA 3UF8A 4JYSA 2M08A 2RURA 5HW6A 5HW8A 3KABA 1L1PA 3UI5A 2RUQA 2MLZA 4ITZA 2F2DA 2M2AA 2RQSA 1Q6IA 2DG3A 4ODMA 1FKIA 5HKGA 1FKHA 1FKRA 1NMVA 5DIVA 1QPFA 5HW7A 4J4OA 2VN1A 2ZR6A 3I6CA 3KAIA 4U84A 3O5RA 3RFWA 3O5OA 3MDYB 1U79A 2LPVA 4ODPA 4JFIA 2ZQVA 1PBKA 3NTPA 3O5QA 2KO7A 4JFLA 3IK8A 1C9HA 1FKDA 2MLYA 1EQ3A 1ROUA 3TCZA 1FKKA 3RGCA 1KT1A 2XPBA 4MSPA 4ODKA 5GPGA 3UQIA 3GPKA 3KZ7A 2IF4A 3O5MA 3NRKA 3KCEA 3JXVA 1Q6HA 4IQ2A 4O2TA 4W9PA 2K8IA 1FD9A 4ODNA 1QPLA 4DRIA 2LKNA 1JNSA 3UQAA 1BKFA 1HXVA 2XP4A 2F4EA 3JYJA 3ODKA 2ZQUA 5D75A 2PBCA 1W26A 2Y78A 3B7XA 3O5FA 1YW5A 5HWCA 1Q1CA 2ZR5A 1J4HA 1EYMA 1JVWA 1ROTA 1B6CA 1N1AA 3IKDA 1JNTA 4DRHA 3KADA 1YATA 1NSGA 3IKGA 3PA7A 1FAPA 4W9OA 2FKEA 4LAWA 2LGOA 4MGVA 4DZ2A 1FKTA 4FN2A 1FKLA 2KI3A 2PV2A 1FKFA 1ZK6A 2AWGA 1NMWA 3PRBA 1FKSA 4DRQA 1D6OA 1J4RA 2MNTA
chains in the Genus database with same CATH superfamily
1GPFA 3ARTA 4DWSA 4IQCA 4IT6A 1OGBA 3O5KA 4JFMA 4LAYA 4Z2LA 3WD3A 4ODQA 1A7XA 2DPEA 5HUAA 1HJVA 4QT2A 2LJ4A 3WL1A 2ZQTA 4TW6A 1HKMA 3IHZA 3O5IA 3B9DA 2Q5AA 1LJYA 4W9QA 2WM0A 5DEZA 2WLZA 3ALFA 2XP3A 1CTNA 4GGQA 1JCHB 4TX0A 2MF9A 4NNRA 3AS0A 4FAPA 4QZVB 1T11A 1GUVA 4ML4A 4DRKA 2XPAA 1X6NA 2N87A 3O5GA 2P4VA 4TNSA 2RUDA 3CHDA 1D7HA 3WD0A 1NWSA 3PRDA 4URIA 4DRMA 3ALGA 3LUOA 4J4NA 4MPKA 1OGGA 4DRNA 4IPXA 3KAFA 5HW6A 2RUQA 4L3NA 3WIJA 3ARZA 4DWSB 1LG2A 1ZBWA 3WD4A 2ZR6A 3I6CA 4U84A 3KAIA 4S3JA 3O5RA 3RFWA 3AS2A 3NTPA 1PBKA 1FFQA 1C9HA 3KZ7A 3OA5A 4LGXA 3JXVA 1Q6HA 4W9PA 2K8IA 1O6IA 3ARYA 3G6MA 1W9VA 3CHFA 1LL6A 3ARWA 2F4EA 1ZL1A 2ZQUA 4Q22A 2IUZA 1YW5A 4NZCA 2ZR5A 3AROA 1J4HA 1ROTA 1ZB5A 1N1AA 1NH6A 3PA7A 2FKEA 1RD6A 2LGOA 3GU0A 1FFRA 2ESCA 1FKTA 2PV2A 1FKFA 1HJWA 2AWGA 4DRQA 1FKBA 4R5EA 3BMBA 2PPPA 4DROA 5DITA 1FKGA 4DRPA 2ITKA 2JZVA 3OOBA 4G50A 3AS3A 2XP7A 2F21A 2PPNA 3TDBA 1EIBA 2KFWA 3O5LA 1UR9A 3AS1A 1ITXA 2PI6A 3BXWA 4DH0A 1ZBCA 2D9FA 4HBEA 4P8WA 4IT4A 2MPHA 1J4IA 5GPRA 2XP5A 5DO2A 4P8VA 1JNEA 5I98A 1LG1A 2DSZA 2M1IA 4MNJA 1W1TA 4PTMA 4QIBA 3KAGA 4QT3A 3O5JA 1NWUA 3EY6A 4GIVA 5HTGA 3ARVA 3FXYA 1PINA 1WB0A 1JNDA 1SR0A 3CH9A 4JFKA 3CGMA 3WH0A 1W1YA 5J6EA 3O5DA 1R9HA 2PPOA 3H9RB 5HT1A 1Y0OA 2DT0A 2XP8A 3O5EA 2A3BA 1BL4A 3KABA 2MLZA 3WKZA 2DG3A 1FKIA 5HKGA 3RM4A 1FKRA 5DIVA 1QPFA 2VN1A 2B31A 2LPVA 2QF8A 2WLYA 3O5QA 1VF8A 1WAWA 1FKDA 3IK8A 4AY1A 2MLYA 4HBOA 3RGCA 1KT1A 4MSPA 3ARUA 4HARA 3KCEA 1TFVA 4Z2JA 1NWTA 2LKNA 2XP4A 3JYJA 5D75A 3B7XA 3O5FA 5HWCA 1K9TA 2OLHA 1Q1CA 4UDMA 1NWRA 1EYMA 1JVWA 1EDQA 4KQZA 1HKJA 2YBTA 4DZ2A 1FKLA 1ZU8A 1ZK6A 3PRBA 2ETNA 2MLXA 1FKSA 1D6OA 4JYSA 1ZBKA 1FJDA 1W1VA 4DWSC 4DZ3A 4P8UA 2B5UB 3CHEA 2PV1A 4W5UA 1WNOA 2DG4A 4DRJA 3NI6A 2KE0A 1KT0A 3PR9A 4TW7A 1E44A 2A3EA 3UI4A 4DT4A 2RSEA 2DSWA 4BF8A 4Z2IA 1F40A 1KFWA 4G2PA 5DIUA 3JYMA 4MNLA 1LQ0A 3G6LA 4ODLA 2A3AA 2PV3A 1QZ2A 3KAHA 4DIPA 2XP9A 3CGNA 1XHGA 1D7IA 2KR7A 2OFNA 4LAVA 1TCOC 5B8IC 2ZQSA 2FAPA 2WK2A 1W9PA 3UI6A 3B8SA 5BXJA 3ARQA 3TC5A 4LAXA 3WL0A 1GRJA 4TW8A 3FAPA 4C02B 2DG9A 4KR0B 2DSUA 2KGJA 3QOKA 1X6LA 1LL4A 3UF8A 5HW8A 2M08A 2RURA 3UI5A 2AOSA 1H0IA 3B9EA 1Q6IA 4ODMA 1IX5A 4WK9A 1FKHA 4P8XA 5HW7A 1W1PA 3O5OA 3AQUA 3MDYB 1U79A 4JFIA 2ZQVA 4Z2KA 2KO7A 4JFLA 1OWQA 4WKHA 1LL7A 3TCZA 2XPBA 2EULA 3ARPA 3O5MA 4IQ2A 4ODNA 1QPLA 1SYTA 4ZPTR 4DRIA 1JNSA 4ZPWR 1BKFA 3UQAA 1HXVA 3ODKA 5DF0A 4L72B 1W26A 4ZS6A 4MNMA 3W4RA 1B6CA 4Q7NA 3KADA 1YATA 3IKGA 3WQVA 1E6PA 1FAPA 4NSBA 1XRVA 2G8ZA 1D2KA 2KI3A 1J4RA 2MNTA 2XP6A 2L2SA 5HBFA 3UQBA 2DT2A 2UZ5A 1M5YA 4WKFA 4MAVA 3CZ8A 4ODRA 1J6YA 3KACA 4JFJA 1HKIA 1HJXA 4ODOA 3WD1A 1P5QA 1F8AB 3ARSA 4R0XA 1E6NA 3VAWA 2VCDA 3RM8A 2A3CA 3CHCA 4MNKA 4WIWA 3B9AA 1ZCNA 1E15A 3FY1A 2DSVA 3ARXA 1E6RA 1FKJA 4N19A 2O9OA 5HWBA 4ZPVR 4U86A 1E6ZA 2DT1A 3O5PA 4TYOA 2RUCA 2ZR4A 4U85A 1Q6UA 3RM9A 1GOIA 1D7JA 3WD2A 1L1PA 4ITZA 5GQBA 2F2DA 2M2AA 2RQSA 2F23A 3WQWA 1UR8A 2G41A 2YBUA 3EIPA 1NMVA 4J4OA 4WKAA 3ARRA 4WJXA 1W9UA 2DT3A 4ODPA 1E9LA 3GTYX 4S3KA 1EQ3A 2PN0A 1ROUA 1H0GA 1FKKA 1EHNA 4ODKA 5GPGA 1ZBVA 2FDMA 3GPKA 3UQIA 2IF4A 3NRKA 4O2TA 1FD9A 3RMEA 1HKKA 2PBCA 2Y78A 3IKDA 1JNTA 4DRHA 4MTVA 1NSGA 4W9OA 4LAWA 4XAKA 4DWSD 5JH8A 4Z2HA 4MGVA 3PRAA 2O92A 4Z2GA 4FN2A 1NMWA
chains in the Genus database with same CATH topology
1GPFA 3ARTA 4DWSA 4IQCA 4IT6A 1OGBA 3O5KA 4JFMA 4LAYA 4Z2LA 3WD3A 4ODQA 1A7XA 2DPEA 5HUAA 1HJVA 4QT2A 2LJ4A 3WL1A 2ZQTA 4TW6A 1HKMA 3IHZA 3O5IA 3B9DA 2Q5AA 1LJYA 4W9QA 2WM0A 5DEZA 2WLZA 3ALFA 2XP3A 1CTNA 4GGQA 4TX0A 2MF9A 4NNRA 3AS0A 4FAPA 4QZVB 1T11A 1GUVA 4ML4A 4DRKA 2XPAA 1X6NA 2N87A 3O5GA 4TNSA 2RUDA 3CHDA 1D7HA 3WD0A 1NWSA 3PRDA 4URIA 4DRMA 3ALGA 3LUOA 4J4NA 4MPKA 1OGGA 4DRNA 4IPXA 3KAFA 5HW6A 2RUQA 4L3NA 3WIJA 3ARZA 4DWSB 1LG2A 1ZBWA 3WD4A 2ZR6A 3I6CA 4U84A 3KAIA 4S3JA 3O5RA 3RFWA 3AS2A 3NTPA 1PBKA 1FFQA 1C9HA 3KZ7A 3OA5A 4LGXA 3JXVA 1Q6HA 4W9PA 2K8IA 1O6IA 3ARYA 3G6MA 1W9VA 3CHFA 1LL6A 3ARWA 2F4EA 1ZL1A 2ZQUA 4Q22A 2IUZA 1YW5A 4NZCA 2ZR5A 3AROA 1J4HA 1ROTA 1ZB5A 1N1AA 1NH6A 3PA7A 2FKEA 1RD6A 2LGOA 1FFRA 2ESCA 1FKTA 2PV2A 1FKFA 1HJWA 2AWGA 4DRQA 1FKBA 4R5EA 2PPPA 4DROA 5DITA 1FKGA 4DRPA 2ITKA 2JZVA 3OOBA 4G50A 3AS3A 2XP7A 2F21A 2PPNA 3TDBA 1EIBA 2KFWA 3O5LA 1UR9A 3AS1A 1ITXA 2PI6A 3BXWA 4DH0A 1ZBCA 2D9FA 4HBEA 4P8WA 4IT4A 2MPHA 1J4IA 5GPRA 2XP5A 5DO2A 4P8VA 1JNEA 5I98A 1LG1A 2DSZA 2M1IA 4MNJA 1W1TA 4PTMA 4QIBA 3KAGA 4QT3A 3O5JA 1NWUA 3EY6A 4GIVA 5HTGA 3ARVA 3FXYA 1PINA 1WB0A 1JNDA 1SR0A 3CH9A 4JFKA 3CGMA 3WH0A 1W1YA 5J6EA 3O5DA 1R9HA 2PPOA 3H9RB 5HT1A 1Y0OA 2DT0A 2XP8A 3O5EA 2A3BA 1BL4A 3KABA 2MLZA 3WKZA 2DG3A 1FKIA 5HKGA 3RM4A 1FKRA 5DIVA 1QPFA 2VN1A 2B31A 2LPVA 2QF8A 2WLYA 3O5QA 1VF8A 1WAWA 1FKDA 3IK8A 4AY1A 2MLYA 4HBOA 3RGCA 1KT1A 4MSPA 3ARUA 4HARA 3KCEA 1TFVA 4Z2JA 1NWTA 2LKNA 2XP4A 3JYJA 5D75A 3B7XA 3O5FA 5HWCA 1K9TA 2OLHA 1Q1CA 1NWRA 1EYMA 1JVWA 1EDQA 4KQZA 1HKJA 2YBTA 4DZ2A 1FKLA 1ZU8A 1ZK6A 3PRBA 2MLXA 1FKSA 1D6OA 4JYSA 1ZBKA 1FJDA 1W1VA 4DWSC 4DZ3A 4P8UA 3CHEA 2PV1A 4W5UA 1WNOA 2DG4A 4DRJA 3NI6A 2KE0A 1KT0A 3PR9A 4TW7A 2A3EA 3UI4A 4DT4A 2RSEA 2DSWA 4BF8A 4Z2IA 1F40A 1KFWA 4G2PA 5DIUA 3JYMA 4MNLA 1LQ0A 3G6LA 4ODLA 2A3AA 2PV3A 1QZ2A 3KAHA 4DIPA 2XP9A 3CGNA 1XHGA 1D7IA 2KR7A 2OFNA 4LAVA 1TCOC 5B8IC 2ZQSA 2FAPA 2WK2A 1W9PA 3UI6A 3B8SA 5BXJA 3ARQA 3TC5A 4LAXA 3WL0A 4TW8A 3FAPA 4C02B 2DG9A 4KR0B 2DSUA 2KGJA 3QOKA 1X6LA 1LL4A 3UF8A 5HW8A 2M08A 2RURA 3UI5A 2AOSA 1H0IA 3B9EA 1Q6IA 4ODMA 1IX5A 4WK9A 1FKHA 4P8XA 5HW7A 1W1PA 3O5OA 3AQUA 3MDYB 1U79A 4JFIA 2ZQVA 4Z2KA 2KO7A 4JFLA 1OWQA 4WKHA 1LL7A 3TCZA 2XPBA 3ARPA 3O5MA 4IQ2A 4ODNA 1QPLA 1SYTA 4ZPTR 4DRIA 1JNSA 4ZPWR 1BKFA 3UQAA 1HXVA 3ODKA 5DF0A 4L72B 1W26A 4ZS6A 4MNMA 3W4RA 1B6CA 4Q7NA 3KADA 1YATA 3IKGA 3WQVA 1E6PA 1FAPA 4NSBA 1XRVA 2G8ZA 1D2KA 2KI3A 1J4RA 2MNTA 2XP6A 2L2SA 5HBFA 3UQBA 2DT2A 2UZ5A 1M5YA 4WKFA 4MAVA 3CZ8A 4ODRA 1J6YA 3KACA 4JFJA 1HKIA 1HJXA 4ODOA 3WD1A 1P5QA 1F8AB 3ARSA 4R0XA 1E6NA 3VAWA 2VCDA 3RM8A 2A3CA 3CHCA 4MNKA 4WIWA 3B9AA 1ZCNA 1E15A 3FY1A 2DSVA 3ARXA 1E6RA 1FKJA 4N19A 2O9OA 5HWBA 4ZPVR 4U86A 1E6ZA 2DT1A 3O5PA 4TYOA 2RUCA 2ZR4A 4U85A 1Q6UA 3RM9A 1GOIA 1D7JA 3WD2A 1L1PA 4ITZA 5GQBA 2F2DA 2M2AA 2RQSA 3WQWA 1UR8A 2G41A 2YBUA 1NMVA 4J4OA 4WKAA 3ARRA 4WJXA 1W9UA 2DT3A 4ODPA 1E9LA 4S3KA 1EQ3A 1ROUA 1H0GA 1FKKA 1EHNA 4ODKA 5GPGA 1ZBVA 2FDMA 3GPKA 3UQIA 2IF4A 3NRKA 4O2TA 1FD9A 3RMEA 1HKKA 2PBCA 2Y78A 3IKDA 1JNTA 4DRHA 4MTVA 1NSGA 4W9OA 4LAWA 4XAKA 4DWSD 5JH8A 4Z2HA 4MGVA 3PRAA 2O92A 4Z2GA 4FN2A 1NMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XP6 A;  2PPP A;  2L2S A;  1FJD A;  4DRO A;  5DIT A;  4DZ3 A;  3UQB A;  1FKG A;  4IQC A;  4DRP A;  2ITK A;  3O5K A;  4JFM A;  2PV1 A;  2JZV A;  2UZ5 A;  1M5Y A;  3OOB A;  4G50 A;  2DG4 A;  4LAY A;  4DRJ A;  3NI6 A;  2KE0 A;  1KT0 A;  4ODR A;  4TW7 A;  1J6Y A;  2XP7 A;  3UI4 A;  4ODQ A;  2F21 A;  1A7X A;  2PPN A;  3TDB A;  2KFW A;  3KAC A;  4JFJ A;  3O5L A;  4DT4 A;  4DH0 A;  5HUA A;  2RSE A;  2D9F A;  4BF8 A;  4ODO A;  2MPH A;  1F40 A;  4G2P A;  1J4I A;  1P5Q A;  1F8A B;  3JYM A;  5DIU A;  2XP5 A;  4QT2 A;  4ODL A;  5I98 A;  2LJ4 A;  2PV3 A;  2ZQT A;  1FKB A;  1QZ2 A;  4TW6 A;  3IHZ A;  3O5I A;  2M1I A;  3KAH A;  4R0X A;  4DIP A;  2MLX A;  2Q5A A;  4QIB A;  3KAG A;  2XP9 A;  4QT3 A;  4W9Q A;  3VAW A;  3CGN A;  1D7I A;  2KR7 A;  2OFN A;  2VCD A;  3O5J A;  4LAV A;  1TCO C;  5B8I C;  2XP3 A;  3EY6 A;  2ZQS A;  4GIV A;  4GGQ A;  5HTG A;  2FAP A;  1PIN A;  4TX0 A;  2MF9 A;  3UI6 A;  5BXJ A;  1ZCN A;  4NNR A;  4FAP A;  4JFK A;  3TC5 A;  1T11 A;  3CGM A;  4LAX A;  3WH0 A;  4DRK A;  2XPA A;  2N87 A;  4TW8 A;  3O5G A;  5J6E A;  3O5D A;  4TNS A;  1FKJ A;  2RUD A;  4N19 A;  1D7H A;  3FAP A;  4C02 B;  2DG9 A;  1R9H A;  4U86 A;  5HWB A;  3PRD A;  3O5P A;  2PPO A;  2KGJ A;  3H9R B;  4TYO A;  5HT1 A;  2RUC A;  4DRM A;  2ZR4 A;  1Y0O A;  3LUO A;  4J4N A;  4U85 A;  2XP8 A;  3O5E A;  4DRN A;  1Q6U A;  4IPX A;  1BL4 A;  1D7J A;  3KAF A;  3UF8 A;  4JYS A;  2M08 A;  2RUR A;  5HW6 A;  5HW8 A;  3KAB A;  1L1P A;  3UI5 A;  2RUQ A;  2MLZ A;  4ITZ A;  2F2D A;  2M2A A;  2RQS A;  1Q6I A;  2DG3 A;  4ODM A;  1FKI A;  5HKG A;  1FKH A;  1FKR A;  1NMV A;  5DIV A;  1QPF A;  5HW7 A;  4J4O A;  2VN1 A;  2ZR6 A;  3I6C A;  3KAI A;  4U84 A;  3O5R A;  3RFW A;  3O5O A;  3MDY B;  1U79 A;  2LPV A;  4ODP A;  4JFI A;  2ZQV A;  1PBK A;  3NTP A;  3O5Q A;  2KO7 A;  4JFL A;  3IK8 A;  1C9H A;  1FKD A;  2MLY A;  1EQ3 A;  1ROU A;  3TCZ A;  1FKK A;  3RGC A;  1KT1 A;  2XPB A;  4MSP A;  4ODK A;  5GPG A;  3UQI A;  3GPK A;  3KZ7 A;  2IF4 A;  3O5M A;  3NRK A;  3KCE A;  3JXV A;  1Q6H A;  4IQ2 A;  4O2T A;  4W9P A;  2K8I A;  1FD9 A;  4ODN A;  1QPL A;  4DRI A;  2LKN A;  1JNS A;  3UQA A;  1BKF A;  1HXV A;  2XP4 A;  2F4E A;  3JYJ A;  3ODK A;  2ZQU A;  5D75 A;  2PBC A;  1W26 A;  2Y78 A;  3B7X A;  3O5F A;  1YW5 A;  5HWC A;  1Q1C A;  2ZR5 A;  1J4H A;  1EYM A;  1JVW A;  1ROT A;  1B6C A;  1N1A A;  3IKD A;  1JNT A;  4DRH A;  3KAD A;  1YAT A;  1NSG A;  3IKG A;  3PA7 A;  1FAP A;  4W9O A;  2FKE A;  4LAW A;  2LGO A;  4MGV A;  4DZ2 A;  1FKT A;  4FN2 A;  1FKL A;  2KI3 A;  2PV2 A;  1FKF A;  1ZK6 A;  2AWG A;  1NMW A;  3PRB A;  1FKS A;  4DRQ A;  1D6O A;  1J4R A;  2MNT A; 
#chains in the Genus database with same CATH topology
 1GPF A;  3ART A;  4DWS A;  4IQC A;  4IT6 A;  1OGB A;  3O5K A;  4JFM A;  4LAY A;  4Z2L A;  3WD3 A;  4ODQ A;  1A7X A;  2DPE A;  5HUA A;  1HJV A;  4QT2 A;  2LJ4 A;  3WL1 A;  2ZQT A;  4TW6 A;  1HKM A;  3IHZ A;  3O5I A;  3B9D A;  2Q5A A;  1LJY A;  4W9Q A;  2WM0 A;  5DEZ A;  2WLZ A;  3ALF A;  2XP3 A;  1CTN A;  4GGQ A;  1JCH B;  4TX0 A;  2MF9 A;  4NNR A;  3AS0 A;  4FAP A;  4QZV B;  1T11 A;  1GUV A;  4ML4 A;  4DRK A;  2XPA A;  1X6N A;  2N87 A;  3O5G A;  2P4V A;  4TNS A;  2RUD A;  3CHD A;  1D7H A;  3WD0 A;  1NWS A;  3PRD A;  4URI A;  4DRM A;  3ALG A;  3LUO A;  4J4N A;  4MPK A;  1OGG A;  4DRN A;  4IPX A;  3KAF A;  5HW6 A;  2RUQ A;  4L3N A;  3WIJ A;  3ARZ A;  4DWS B;  1LG2 A;  1ZBW A;  3WD4 A;  2ZR6 A;  3I6C A;  4U84 A;  3KAI A;  4S3J A;  3O5R A;  3RFW A;  3AS2 A;  3NTP A;  1PBK A;  1FFQ A;  1C9H A;  3KZ7 A;  3OA5 A;  4LGX A;  3JXV A;  1Q6H A;  4W9P A;  2K8I A;  1O6I A;  3ARY A;  3G6M A;  1W9V A;  3CHF A;  1LL6 A;  3ARW A;  2F4E A;  1ZL1 A;  2ZQU A;  4Q22 A;  2IUZ A;  1YW5 A;  4NZC A;  2ZR5 A;  3ARO A;  1J4H A;  1ROT A;  1ZB5 A;  1N1A A;  1NH6 A;  3PA7 A;  2FKE A;  1RD6 A;  2LGO A;  3GU0 A;  1FFR A;  2ESC A;  1FKT A;  2PV2 A;  1FKF A;  1HJW A;  2AWG A;  4DRQ A;  1FKB A;  4R5E A;  3BMB A;  2PPP A;  4DRO A;  5DIT A;  1FKG A;  4DRP A;  2ITK A;  2JZV A;  3OOB A;  4G50 A;  3AS3 A;  2XP7 A;  2F21 A;  2PPN A;  3TDB A;  1EIB A;  2KFW A;  3O5L A;  1UR9 A;  3AS1 A;  1ITX A;  2PI6 A;  3BXW A;  4DH0 A;  1ZBC A;  2D9F A;  4HBE A;  4P8W A;  4IT4 A;  2MPH A;  1J4I A;  5GPR A;  2XP5 A;  5DO2 A;  4P8V A;  1JNE A;  5I98 A;  1LG1 A;  2DSZ A;  2M1I A;  4MNJ A;  1W1T A;  4PTM A;  4QIB A;  3KAG A;  4QT3 A;  3O5J A;  1NWU A;  3EY6 A;  4GIV A;  5HTG A;  3ARV A;  3FXY A;  1PIN A;  1WB0 A;  1JND A;  1SR0 A;  3CH9 A;  4JFK A;  3CGM A;  3WH0 A;  1W1Y A;  5J6E A;  3O5D A;  1R9H A;  2PPO A;  3H9R B;  5HT1 A;  1Y0O A;  2DT0 A;  2XP8 A;  3O5E A;  2A3B A;  1BL4 A;  3KAB A;  2MLZ A;  3WKZ A;  2DG3 A;  1FKI A;  5HKG A;  3RM4 A;  1FKR A;  5DIV A;  1QPF A;  2VN1 A;  2B31 A;  2LPV A;  2QF8 A;  2WLY A;  3O5Q A;  1VF8 A;  1WAW A;  1FKD A;  3IK8 A;  4AY1 A;  2MLY A;  4HBO A;  3RGC A;  1KT1 A;  4MSP A;  3ARU A;  4HAR A;  3KCE A;  1TFV A;  4Z2J A;  1NWT A;  2LKN A;  2XP4 A;  3JYJ A;  5D75 A;  3B7X A;  3O5F A;  5HWC A;  1K9T A;  2OLH A;  1Q1C A;  4UDM A;  1NWR A;  1EYM A;  1JVW A;  1EDQ A;  4KQZ A;  1HKJ A;  2YBT A;  4DZ2 A;  1FKL A;  1ZU8 A;  1ZK6 A;  3PRB A;  2ETN A;  2MLX A;  1FKS A;  1D6O A;  4JYS A;  1ZBK A;  1FJD A;  1W1V A;  4DWS C;  4DZ3 A;  4P8U A;  2B5U B;  3CHE A;  2PV1 A;  4W5U A;  1WNO A;  2DG4 A;  4DRJ A;  3NI6 A;  2KE0 A;  1KT0 A;  3PR9 A;  4TW7 A;  1E44 A;  2A3E A;  3UI4 A;  4DT4 A;  2RSE A;  2DSW A;  4BF8 A;  4Z2I A;  1F40 A;  1KFW A;  4G2P A;  5DIU A;  3JYM A;  4MNL A;  1LQ0 A;  3G6L A;  4ODL A;  2A3A A;  2PV3 A;  1QZ2 A;  3KAH A;  4DIP A;  2XP9 A;  3CGN A;  1XHG A;  1D7I A;  2KR7 A;  2OFN A;  4LAV A;  1TCO C;  5B8I C;  2ZQS A;  2FAP A;  2WK2 A;  1W9P A;  3UI6 A;  3B8S A;  5BXJ A;  3ARQ A;  3TC5 A;  4LAX A;  3WL0 A;  1GRJ A;  4TW8 A;  3FAP A;  4C02 B;  2DG9 A;  4KR0 B;  2DSU A;  2KGJ A;  3QOK A;  1X6L A;  1LL4 A;  3UF8 A;  5HW8 A;  2M08 A;  2RUR A;  3UI5 A;  2AOS A;  1H0I A;  3B9E A;  1Q6I A;  4ODM A;  1IX5 A;  4WK9 A;  1FKH A;  4P8X A;  5HW7 A;  1W1P A;  3O5O A;  3AQU A;  3MDY B;  1U79 A;  4JFI A;  2ZQV A;  4Z2K A;  2KO7 A;  4JFL A;  1OWQ A;  4WKH A;  1LL7 A;  3TCZ A;  2XPB A;  2EUL A;  3ARP A;  3O5M A;  4IQ2 A;  4ODN A;  1QPL A;  1SYT A;  4ZPT R;  4DRI A;  1JNS A;  4ZPW R;  1BKF A;  3UQA A;  1HXV A;  3ODK A;  5DF0 A;  4L72 B;  1W26 A;  4ZS6 A;  4MNM A;  3W4R A;  1B6C A;  4Q7N A;  3KAD A;  1YAT A;  3IKG A;  3WQV A;  1E6P A;  1FAP A;  4NSB A;  1XRV A;  2G8Z A;  1D2K A;  2KI3 A;  1J4R A;  2MNT A;  2XP6 A;  2L2S A;  5HBF A;  3UQB A;  2DT2 A;  2UZ5 A;  1M5Y A;  4WKF A;  4MAV A;  3CZ8 A;  4ODR A;  1J6Y A;  3KAC A;  4JFJ A;  1HKI A;  1HJX A;  4ODO A;  3WD1 A;  1P5Q A;  1F8A B;  3ARS A;  4R0X A;  1E6N A;  3VAW A;  2VCD A;  3RM8 A;  2A3C A;  3CHC A;  4MNK A;  4WIW A;  3B9A A;  1ZCN A;  1E15 A;  3FY1 A;  2DSV A;  3ARX A;  1E6R A;  1FKJ A;  4N19 A;  2O9O A;  5HWB A;  4ZPV R;  4U86 A;  1E6Z A;  2DT1 A;  3O5P A;  4TYO A;  2RUC A;  2ZR4 A;  4U85 A;  1Q6U A;  3RM9 A;  1GOI A;  1D7J A;  3WD2 A;  1L1P A;  4ITZ A;  5GQB A;  2F2D A;  2M2A A;  2RQS A;  2F23 A;  3WQW A;  1UR8 A;  2G41 A;  2YBU A;  3EIP A;  1NMV A;  4J4O A;  4WKA A;  3ARR A;  4WJX A;  1W9U A;  2DT3 A;  4ODP A;  1E9L A;  3GTY X;  4S3K A;  1EQ3 A;  2PN0 A;  1ROU A;  1H0G A;  1FKK A;  1EHN A;  4ODK A;  5GPG A;  1ZBV A;  2FDM A;  3GPK A;  3UQI A;  2IF4 A;  3NRK A;  4O2T A;  1FD9 A;  3RME A;  1HKK A;  2PBC A;  2Y78 A;  3IKD A;  1JNT A;  4DRH A;  4MTV A;  1NSG A;  4W9O A;  4LAW A;  4XAK A;  4DWS D;  5JH8 A;  4Z2H A;  4MGV A;  3PRA A;  2O92 A;  4Z2G A;  4FN2 A;  1NMW A; 
#chains in the Genus database with same CATH homology
 1GPF A;  3ART A;  4DWS A;  4IQC A;  4IT6 A;  1OGB A;  3O5K A;  4JFM A;  4LAY A;  4Z2L A;  3WD3 A;  4ODQ A;  1A7X A;  2DPE A;  5HUA A;  1HJV A;  4QT2 A;  2LJ4 A;  3WL1 A;  2ZQT A;  4TW6 A;  1HKM A;  3IHZ A;  3O5I A;  3B9D A;  2Q5A A;  1LJY A;  4W9Q A;  2WM0 A;  5DEZ A;  2WLZ A;  3ALF A;  2XP3 A;  1CTN A;  4GGQ A;  4TX0 A;  2MF9 A;  4NNR A;  3AS0 A;  4FAP A;  4QZV B;  1T11 A;  1GUV A;  4ML4 A;  4DRK A;  2XPA A;  1X6N A;  2N87 A;  3O5G A;  4TNS A;  2RUD A;  3CHD A;  1D7H A;  3WD0 A;  1NWS A;  3PRD A;  4URI A;  4DRM A;  3ALG A;  3LUO A;  4J4N A;  4MPK A;  1OGG A;  4DRN A;  4IPX A;  3KAF A;  5HW6 A;  2RUQ A;  4L3N A;  3WIJ A;  3ARZ A;  4DWS B;  1LG2 A;  1ZBW A;  3WD4 A;  2ZR6 A;  3I6C A;  4U84 A;  3KAI A;  4S3J A;  3O5R A;  3RFW A;  3AS2 A;  3NTP A;  1PBK A;  1FFQ A;  1C9H A;  3KZ7 A;  3OA5 A;  4LGX A;  3JXV A;  1Q6H A;  4W9P A;  2K8I A;  1O6I A;  3ARY A;  3G6M A;  1W9V A;  3CHF A;  1LL6 A;  3ARW A;  2F4E A;  1ZL1 A;  2ZQU A;  4Q22 A;  2IUZ A;  1YW5 A;  4NZC A;  2ZR5 A;  3ARO A;  1J4H A;  1ROT A;  1ZB5 A;  1N1A A;  1NH6 A;  3PA7 A;  2FKE A;  1RD6 A;  2LGO A;  1FFR A;  2ESC A;  1FKT A;  2PV2 A;  1FKF A;  1HJW A;  2AWG A;  4DRQ A;  1FKB A;  4R5E A;  2PPP A;  4DRO A;  5DIT A;  1FKG A;  4DRP A;  2ITK A;  2JZV A;  3OOB A;  4G50 A;  3AS3 A;  2XP7 A;  2F21 A;  2PPN A;  3TDB A;  1EIB A;  2KFW A;  3O5L A;  1UR9 A;  3AS1 A;  1ITX A;  2PI6 A;  3BXW A;  4DH0 A;  1ZBC A;  2D9F A;  4HBE A;  4P8W A;  4IT4 A;  2MPH A;  1J4I A;  5GPR A;  2XP5 A;  5DO2 A;  4P8V A;  1JNE A;  5I98 A;  1LG1 A;  2DSZ A;  2M1I A;  4MNJ A;  1W1T A;  4PTM A;  4QIB A;  3KAG A;  4QT3 A;  3O5J A;  1NWU A;  3EY6 A;  4GIV A;  5HTG A;  3ARV A;  3FXY A;  1PIN A;  1WB0 A;  1JND A;  1SR0 A;  3CH9 A;  4JFK A;  3CGM A;  3WH0 A;  1W1Y A;  5J6E A;  3O5D A;  1R9H A;  2PPO A;  3H9R B;  5HT1 A;  1Y0O A;  2DT0 A;  2XP8 A;  3O5E A;  2A3B A;  1BL4 A;  3KAB A;  2MLZ A;  3WKZ A;  2DG3 A;  1FKI A;  5HKG A;  3RM4 A;  1FKR A;  5DIV A;  1QPF A;  2VN1 A;  2B31 A;  2LPV A;  2QF8 A;  2WLY A;  3O5Q A;  1VF8 A;  1WAW A;  1FKD A;  3IK8 A;  4AY1 A;  2MLY A;  4HBO A;  3RGC A;  1KT1 A;  4MSP A;  3ARU A;  4HAR A;  3KCE A;  1TFV A;  4Z2J A;  1NWT A;  2LKN A;  2XP4 A;  3JYJ A;  5D75 A;  3B7X A;  3O5F A;  5HWC A;  1K9T A;  2OLH A;  1Q1C A;  1NWR A;  1EYM A;  1JVW A;  1EDQ A;  4KQZ A;  1HKJ A;  2YBT A;  4DZ2 A;  1FKL A;  1ZU8 A;  1ZK6 A;  3PRB A;  2MLX A;  1FKS A;  1D6O A;  4JYS A;  1ZBK A;  1FJD A;  1W1V A;  4DWS C;  4DZ3 A;  4P8U A;  3CHE A;  2PV1 A;  4W5U A;  1WNO A;  2DG4 A;  4DRJ A;  3NI6 A;  2KE0 A;  1KT0 A;  3PR9 A;  4TW7 A;  2A3E A;  3UI4 A;  4DT4 A;  2RSE A;  2DSW A;  4BF8 A;  4Z2I A;  1F40 A;  1KFW A;  4G2P A;  5DIU A;  3JYM A;  4MNL A;  1LQ0 A;  3G6L A;  4ODL A;  2A3A A;  2PV3 A;  1QZ2 A;  3KAH A;  4DIP A;  2XP9 A;  3CGN A;  1XHG A;  1D7I A;  2KR7 A;  2OFN A;  4LAV A;  1TCO C;  5B8I C;  2ZQS A;  2FAP A;  2WK2 A;  1W9P A;  3UI6 A;  3B8S A;  5BXJ A;  3ARQ A;  3TC5 A;  4LAX A;  3WL0 A;  4TW8 A;  3FAP A;  4C02 B;  2DG9 A;  4KR0 B;  2DSU A;  2KGJ A;  3QOK A;  1X6L A;  1LL4 A;  3UF8 A;  5HW8 A;  2M08 A;  2RUR A;  3UI5 A;  2AOS A;  1H0I A;  3B9E A;  1Q6I A;  4ODM A;  1IX5 A;  4WK9 A;  1FKH A;  4P8X A;  5HW7 A;  1W1P A;  3O5O A;  3AQU A;  3MDY B;  1U79 A;  4JFI A;  2ZQV A;  4Z2K A;  2KO7 A;  4JFL A;  1OWQ A;  4WKH A;  1LL7 A;  3TCZ A;  2XPB A;  3ARP A;  3O5M A;  4IQ2 A;  4ODN A;  1QPL A;  1SYT A;  4ZPT R;  4DRI A;  1JNS A;  4ZPW R;  1BKF A;  3UQA A;  1HXV A;  3ODK A;  5DF0 A;  4L72 B;  1W26 A;  4ZS6 A;  4MNM A;  3W4R A;  1B6C A;  4Q7N A;  3KAD A;  1YAT A;  3IKG A;  3WQV A;  1E6P A;  1FAP A;  4NSB A;  1XRV A;  2G8Z A;  1D2K A;  2KI3 A;  1J4R A;  2MNT A;  2XP6 A;  2L2S A;  5HBF A;  3UQB A;  2DT2 A;  2UZ5 A;  1M5Y A;  4WKF A;  4MAV A;  3CZ8 A;  4ODR A;  1J6Y A;  3KAC A;  4JFJ A;  1HKI A;  1HJX A;  4ODO A;  3WD1 A;  1P5Q A;  1F8A B;  3ARS A;  4R0X A;  1E6N A;  3VAW A;  2VCD A;  3RM8 A;  2A3C A;  3CHC A;  4MNK A;  4WIW A;  3B9A A;  1ZCN A;  1E15 A;  3FY1 A;  2DSV A;  3ARX A;  1E6R A;  1FKJ A;  4N19 A;  2O9O A;  5HWB A;  4ZPV R;  4U86 A;  1E6Z A;  2DT1 A;  3O5P A;  4TYO A;  2RUC A;  2ZR4 A;  4U85 A;  1Q6U A;  3RM9 A;  1GOI A;  1D7J A;  3WD2 A;  1L1P A;  4ITZ A;  5GQB A;  2F2D A;  2M2A A;  2RQS A;  3WQW A;  1UR8 A;  2G41 A;  2YBU A;  1NMV A;  4J4O A;  4WKA A;  3ARR A;  4WJX A;  1W9U A;  2DT3 A;  4ODP A;  1E9L A;  4S3K A;  1EQ3 A;  1ROU A;  1H0G A;  1FKK A;  1EHN A;  4ODK A;  5GPG A;  1ZBV A;  2FDM A;  3GPK A;  3UQI A;  2IF4 A;  3NRK A;  4O2T A;  1FD9 A;  3RME A;  1HKK A;  2PBC A;  2Y78 A;  3IKD A;  1JNT A;  4DRH A;  4MTV A;  1NSG A;  4W9O A;  4LAW A;  4XAK A;  4DWS D;  5JH8 A;  4Z2H A;  4MGV A;  3PRA A;  2O92 A;  4Z2G A;  4FN2 A;  1NMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...