5GPGA

Co-crystal structure of the fk506 binding domain of human fkbp25, rapamycin and the frb domain of human mtor
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
110
Chain Sequence
SPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Proximity-Directed Labeling Reveals a New Rapamycin-Induced Heterodimer of FKBP25 and FRB in Live Cells
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/transferase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP3
total genus 25
structure length 110
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5gpgA00
4DRHA 3TCZA 3IKDA 1Q6UA 1YATA 3KAHA 3RGCA 3O5PA 1Q6HA 1KT0A 2M2AA 2RURA 4ODKA 5HW7A 4ODMA 1NMVA 3FAPA 2XP7A 4TW8A 4DZ3A 3OOBA 1FKJA 2ZQTA 1JNSA 3KZ7A 4LAWA 4TW7A 5HKGA 2D9FA 2UZ5A 3KAGA 4QT2A 1ROTA 3RFWA 3O5KA 4ODNA 4QT3A 1FKTA 3O5GA 4DT4A 2RUQA 2F4EA 3JYJA 2RUDA 2FAPA 2XP5A 1J6YA 2PPPA 4ODQA 1FKIA 1D6OA 3UQIA 5J6EA 4DRQA 1FKGA 1FKKA 2PPOA 1FKBA 2MLZA 3NI6A 3O5IA 2ZR6A 2LKNA 4J4OA 2ZR4A 3O5FA 1FAPA 2IF4A 4JYSA 3UI6A 4GGQA 1BL4A 2DG3A 1QPLA 3UI4A 4JFLA 2M1IA 5DIVA 4C02B 4DRMA 1Q1CA 3I6CA 4W9PA 2RQSA 4IPXA 2KI3A 2OFNA 2PV3A 3KAFA 3O5DA 4JFIA 4JFMA 1FD9A 1F8AB 1D7HA 2N87A 3NTPA 4LAVA 1Y0OA 4DRJA 2XP6A 3CGNA 1NMWA 2XPAA 4G50A 1YW5A 2ITKA 3H9RB 2XPBA 4N19A 1D7JA 2F2DA 3PRBA 4QIBA 3VAWA 4BF8A 4FAPA 5HWCA 5HUAA 4TNSA 3TC5A 3WH0A 4DROA 2Q5AA 4ITZA 4MSPA 2K8IA 3O5LA 4JFJA 2PV1A 3KCEA 4TW6A 1PINA 2MNTA 4ODRA 5HW8A 1N1AA 3O5EA 5HT1A 2XP4A 2KGJA 2VCDA 3PRDA 4GIVA 3UF8A 3UI5A 1P5QA 1FKRA 1U79A 1FKFA 1D7IA 2L2SA 4FN2A 2MLXA 3IHZA 4MGVA 2MPHA 1R9HA 3EY6A 1A7XA 4W9QA 2KR7A 1C9HA 4O2TA 3IK8A 3GPKA 3KACA 5HWBA 4TX0A 2PBCA 1EYMA 2RSEA 3O5OA 2ZQUA 2AWGA 3IKGA 1Q6IA 4LAXA 4ODOA 1W26A 2DG9A 4U85A 3MDYB 4NNRA 3O5QA 4W9OA 5GPGA 3B7XA 4J4NA 4LAYA 3JYMA 4IQCA 3KABA 1TCOC 2XP3A 2LGOA 1ZCNA 1ROUA 2VN1A 2ZQSA 5DIUA 5D75A 1FJDA 3TDBA 1EQ3A 2KFWA 4DH0A 4DRIA 1J4IA 2PV2A 2XP8A 5DITA 1QPFA 1ZK6A 1J4HA 1JVWA 3O5MA 4R0XA 2Y78A 3UQBA 4ODPA 1PBKA 2MLYA 4TYOA 4DRKA 2PPNA 5HTGA 1FKSA 1KT1A 1JNTA 1L1PA 5BXJA 1HXVA 4G2PA 2ZR5A 4DZ2A 2RUCA 4DRNA 4ODLA 1FKLA 3JXVA 1J4RA 3KADA 3LUOA 1F40A 4JFKA 2KO7A 3O5RA 4IQ2A 1FKHA 4DIPA 1M5YA 3ODKA 5I98A 3UQAA 2LPVA 2ZQVA 3KAIA 2FKEA 3NRKA 3PA7A 5HW6A 5B8IC 1FKDA 2M08A 2F21A 4DRPA 1B6CA 1BKFA 4U84A 2XP9A 3O5JA 2JZVA 1QZ2A 1T11A 1NSGA 4U86A 2KE0A 2MF9A 3CGMA 2DG4A 2LJ4A
chains in the Genus database with same CATH superfamily
1IX5A 3IKDA 1Q6UA 3O5PA 1Q6HA 4ZPWR 2F23A 2ZQTA 4TW7A 1ZB5A 3RFWA 3O5GA 4DT4A 1JNEA 2FAPA 4ODQA 1D6OA 1SR0A 2PPOA 1FKBA 2MLZA 3O5FA 1FAPA 2IF4A 1LL6A 1NH6A 2DG3A 1W1PA 2WK2A 1X6NA 4JFLA 2M1IA 5GPRA 2O92A 4Z2GA 2KI3A 2OFNA 2PV3A 4L3NA 1XHGA 1F8AB 1D7HA 2A3CA 3ARYA 4HARA 2XPAA 2ITKA 1JNSA 2F2DA 3VAWA 2K8IA 3WD0A 2PV1A 2XP4A 2VCDA 3PRDA 4GIVA 4MNLA 2YBUA 1FKFA 1CTNA 1W9VA 1HJXA 1E15A 2AOSA 3W4RA 1C9HA 4P8VA 3KACA 4IT6A 1H0GA 2ZQUA 1FFQA 4U85A 2DG9A 4W5UA 3B7XA 4LAYA 3JYMA 3ARVA 1K9TA 2XP3A 1EDQA 1ROUA 1RD6A 1ZU8A 5D75A 1LJYA 4Z2KA 1LG1A 4DWSD 3WD3A 4MNKA 4ZS6A 3AS3A 1E9LA 2YBTA 5HTGA 1FFRA 1L1PA 1W9PA 1LQ0A 3CH9A 3ARTA 1FKHA 5I98A 1LL4A 1GUVA 2LPVA 2DSZA 4XAKA 2JZVA 3B9EA 1QZ2A 3CZ8A 4U86A 2MF9A 1X6LA 2DSUA 1YATA 2DSVA 1KT0A 1UR8A 4DWSA 4WK9A 3FXYA 1UR9A 2B31A 4LAWA 5HKGA 3KAGA 4QT2A 1ZBKA 3O5KA 4ODNA 4MPKA 4Z2JA 2F4EA 2PN0A 3WQWA 1FKIA 3UQIA 1FKGA 1FKKA 4JYSA 4DH0A 2LKNA 2ZR4A 3ARUA 3ALFA 4PTMA 3CHDA 4LGXA 1Q1CA 4W9PA 2RQSA 1ZBWA 2N87A 4QZVB 1Y0OA 3WKZA 3AROA 1NMWA 4N19A 2XPBA 4QIBA 3ARZA 5HUAA 4TNSA 4MSPA 4ITZA 4DWSB 3WD1A 3O5LA 4TW6A 3ARWA 1PINA 2DT0A 4ODRA 1N1AA 1GRJA 4Z2IA 2DSWA 4R5EA 4WIWA 2MLXA 3IHZA 1R9HA 3IK8A 4TX0A 5GQBA 1EYMA 2RSEA 1EHNA 2AWGA 3IKGA 1Q6IA 4ODOA 1GOIA 4NNRA 3O5QA 1WNOA 4W9OA 4S3JA 4J4NA 4ML4A 1W9UA 2ZQSA 1EIBA 1HKIA 3TDBA 1EQ3A 5DEZA 3WL1A 3G6MA 4P8XA 4HBOA 3O5MA 5JH8A 4KR0B 4MAVA 3UQBA 1PBKA 3ARQA 4DRKA 3AS0A 2FDMA 1JNTA 5DO2A 1HXVA 4G2PA 4KQZA 1SYTA 1J4RA 4JFKA 3ARXA 2KO7A 3CHCA 4IQ2A 1M5YA 3ODKA 2ZQVA 3PA7A 4DRPA 1NWTA 3ARPA 3O5JA 3AS2A 2DG4A 1NMVA 4DRHA 3TCZA 4WJXA 3RGCA 1OGGA 2RURA 4ODKA 3FAPA 2XP7A 4TW8A 1XRVA 2WLYA 2DT1A 2D9FA 2UZ5A 3FY1A 4NSBA 4QT3A 1FKTA 2RUQA 3JYJA 1NWUA 2RUDA 3WD2A 3QOKA 1J6YA 5HBFA 2DPEA 3NI6A 3UF8A 3UI6A 3CHEA 4GGQA 1BL4A 1HKMA 3UI4A 5DIVA 4C02B 4IPXA 3O5DA 2O9OA 4JFMA 1FD9A 4LAVA 1W1VA 1ITXA 4G50A 1YW5A 3G6LA 3H9RB 4BF8A 1D7JA 1E6RA 3PRBA 3WH0A 4DROA 2Q5AA 1TFVA 2P4VA 2G41A 4L72B 2KGJA 3UI5A 4IT4A 2L2SA 4FN2A 4MGVA 3EY6A 4O2TA 1E6PA 4WKFA 1HKKA 3RMEA 2PBCA 1W26A 2OLHA 1LG2A 3EIPA 1ZBVA 2IUZA 2B5UB 3MDYB 1NWSA 3ARRA 3PR9A 5GPGA 2A3AA 2DT3A 1E6NA 4IQCA 3GU0A 1TCOC 2VN1A 3WQVA 3GTYX 5DIUA 1NWRA 3RM8A 2KFWA 4DRIA 1J4IA 2PV2A 4ZPVR 5DITA 1J4HA 1JVWA 2Y78A 4AY1A 2MLYA 3WL0A 5BXJA 2ZR5A 4S3KA 4ODLA 1FKLA 3LUOA 3UQAA 3B9AA 3KAIA 3NRKA 2FKEA 4URIA 2M08A 4MNJA 2XP9A 4MTVA 4MNMA 4HBEA 1JCHB 4NZCA 3KAHA 1E6ZA 2M2AA 5HW7A 4ODMA 4DZ3A 3OOBA 3WIJA 3PRAA 1FKJA 2QF8A 3KZ7A 1HJWA 3ARSA 1WB0A 1ROTA 3RM9A 2PI6A 2ETNA 2ESCA 4P8WA 2XP5A 2PPPA 2G8ZA 4DRQA 5J6EA 3O5IA 4J4OA 3B8SA 2ZR6A 1ZBCA 1QPLA 4DRMA 3BXWA 3RM4A 3I6CA 1LL7A 1H0IA 3KAFA 4JFIA 3NTPA 4DRJA 3BMBA 2XP6A 5DF0A 3CGNA 1D2KA 5HWCA 3ALGA 4FAPA 4Q7NA 3TC5A 4WKHA 2A3EA 3KCEA 4JFJA 2MNTA 4Q22A 1WAWA 5HW8A 3O5EA 4DWSC 5HT1A 1FKRA 1P5QA 3OA5A 1U79A 1D7IA 2EULA 1W1TA 1OGBA 2MPHA 3AS1A 1A7XA 4W9QA 2KR7A 2DT2A 2A3BA 3GPKA 5HWBA 4UDMA 2WLZA 1GPFA 3O5OA 1HKJA 4LAXA 4WKAA 3KABA 2LGOA 1ZCNA 3CHFA 1HJVA 3AQUA 1FJDA 3WD4A 4P8UA 2WM0A 2XP8A 1QPFA 1ZK6A 1ZL1A 1OWQA 4R0XA 4Z2LA 1JNDA 4ODPA 4TYOA 1W1YA 1E44A 2PPNA 1FKSA 1KT1A 1VF8A 4DZ2A 2RUCA 4DRNA 3JXVA 3KADA 1F40A 3O5RA 4DIPA 1O6IA 5HW6A 4ZPTR 4Z2HA 5B8IC 1FKDA 2F21A 1B6CA 1BKFA 1KFWA 4U84A 1T11A 1NSGA 3B9DA 2KE0A 3CGMA 2LJ4A
chains in the Genus database with same CATH topology
1IX5A 3IKDA 1Q6UA 3O5PA 1Q6HA 4ZPWR 2ZQTA 4TW7A 1ZB5A 3RFWA 3O5GA 4DT4A 1JNEA 2FAPA 4ODQA 1D6OA 1SR0A 2PPOA 1FKBA 2MLZA 3O5FA 1FAPA 2IF4A 1LL6A 1NH6A 2DG3A 1W1PA 2WK2A 1X6NA 4JFLA 2M1IA 5GPRA 2O92A 4Z2GA 2KI3A 2OFNA 2PV3A 4L3NA 1XHGA 1F8AB 1D7HA 2A3CA 3ARYA 4HARA 2XPAA 2ITKA 1JNSA 2F2DA 3VAWA 2K8IA 3WD0A 2PV1A 2XP4A 2VCDA 3PRDA 4GIVA 4MNLA 2YBUA 1FKFA 1CTNA 1W9VA 1HJXA 1E15A 2AOSA 3W4RA 1C9HA 4P8VA 3KACA 4IT6A 1H0GA 2ZQUA 1FFQA 4U85A 2DG9A 4W5UA 3B7XA 4LAYA 3JYMA 3ARVA 1K9TA 2XP3A 1EDQA 1ROUA 1RD6A 1ZU8A 5D75A 1LJYA 4Z2KA 1LG1A 4DWSD 3WD3A 4MNKA 4ZS6A 3AS3A 1E9LA 2YBTA 5HTGA 1FFRA 1L1PA 1W9PA 1LQ0A 3CH9A 3ARTA 1FKHA 5I98A 1LL4A 1GUVA 2LPVA 2DSZA 4XAKA 2JZVA 3B9EA 1QZ2A 3CZ8A 4U86A 2MF9A 1X6LA 2DSUA 1YATA 2DSVA 1KT0A 1UR8A 4DWSA 4WK9A 3FXYA 1UR9A 2B31A 4LAWA 5HKGA 3KAGA 4QT2A 1ZBKA 3O5KA 4ODNA 4MPKA 4Z2JA 2F4EA 3WQWA 1FKIA 3UQIA 1FKGA 1FKKA 4JYSA 4DH0A 2LKNA 2ZR4A 3ARUA 3ALFA 4PTMA 3CHDA 4LGXA 1Q1CA 4W9PA 2RQSA 1ZBWA 2N87A 4QZVB 1Y0OA 3WKZA 3AROA 1NMWA 4N19A 2XPBA 4QIBA 3ARZA 5HUAA 4TNSA 4MSPA 4ITZA 4DWSB 3WD1A 3O5LA 4TW6A 3ARWA 1PINA 2DT0A 4ODRA 1N1AA 4Z2IA 2DSWA 4R5EA 4WIWA 2MLXA 3IHZA 1R9HA 3IK8A 4TX0A 5GQBA 1EYMA 2RSEA 1EHNA 2AWGA 3IKGA 1Q6IA 4ODOA 1GOIA 4NNRA 3O5QA 1WNOA 4W9OA 4S3JA 4J4NA 4ML4A 1W9UA 2ZQSA 1EIBA 1HKIA 3TDBA 1EQ3A 5DEZA 3WL1A 3G6MA 4P8XA 4HBOA 3O5MA 5JH8A 4KR0B 4MAVA 3UQBA 1PBKA 3ARQA 4DRKA 3AS0A 2FDMA 1JNTA 5DO2A 1HXVA 4G2PA 4KQZA 1SYTA 1J4RA 4JFKA 3ARXA 2KO7A 3CHCA 4IQ2A 1M5YA 3ODKA 2ZQVA 3PA7A 4DRPA 1NWTA 3ARPA 3O5JA 3AS2A 2DG4A 1NMVA 4DRHA 3TCZA 4WJXA 3RGCA 1OGGA 2RURA 4ODKA 3FAPA 2XP7A 4TW8A 1XRVA 2WLYA 2DT1A 2D9FA 2UZ5A 3FY1A 4NSBA 4QT3A 1FKTA 2RUQA 3JYJA 1NWUA 2RUDA 3WD2A 3QOKA 1J6YA 5HBFA 2DPEA 3NI6A 3UF8A 3UI6A 3CHEA 4GGQA 1BL4A 1HKMA 3UI4A 5DIVA 4C02B 4IPXA 3O5DA 2O9OA 4JFMA 1FD9A 4LAVA 1W1VA 1ITXA 4G50A 1YW5A 3G6LA 3H9RB 4BF8A 1D7JA 1E6RA 3PRBA 3WH0A 4DROA 2Q5AA 1TFVA 2G41A 4L72B 2KGJA 3UI5A 4IT4A 2L2SA 4FN2A 4MGVA 3EY6A 4O2TA 1E6PA 4WKFA 1HKKA 3RMEA 2PBCA 1W26A 2OLHA 1LG2A 1ZBVA 2IUZA 3MDYB 1NWSA 3ARRA 3PR9A 5GPGA 2A3AA 2DT3A 1E6NA 4IQCA 1TCOC 2VN1A 3WQVA 5DIUA 1NWRA 3RM8A 2KFWA 4DRIA 1J4IA 2PV2A 4ZPVR 5DITA 1J4HA 1JVWA 2Y78A 4AY1A 2MLYA 3WL0A 5BXJA 2ZR5A 4S3KA 4ODLA 1FKLA 3LUOA 3UQAA 3B9AA 3KAIA 3NRKA 2FKEA 4URIA 2M08A 4MNJA 2XP9A 4MTVA 4MNMA 4HBEA 4NZCA 3KAHA 1E6ZA 2M2AA 5HW7A 4ODMA 4DZ3A 3OOBA 3WIJA 3PRAA 1FKJA 2QF8A 3KZ7A 1HJWA 3ARSA 1WB0A 1ROTA 3RM9A 2PI6A 2ESCA 4P8WA 2XP5A 2PPPA 2G8ZA 4DRQA 5J6EA 4J4OA 3O5IA 3B8SA 2ZR6A 1ZBCA 1QPLA 4DRMA 3BXWA 3RM4A 3I6CA 1LL7A 1H0IA 3KAFA 4JFIA 3NTPA 4DRJA 2XP6A 5DF0A 3CGNA 1D2KA 5HWCA 3ALGA 4FAPA 4Q7NA 3TC5A 4WKHA 4JFJA 2A3EA 3KCEA 2MNTA 4Q22A 1WAWA 5HW8A 3O5EA 4DWSC 5HT1A 1FKRA 1P5QA 3OA5A 1U79A 1D7IA 1W1TA 1OGBA 2MPHA 3AS1A 1A7XA 4W9QA 2KR7A 2DT2A 2A3BA 3GPKA 5HWBA 2WLZA 1GPFA 3O5OA 1HKJA 4LAXA 4WKAA 3KABA 2LGOA 1ZCNA 3CHFA 1HJVA 3AQUA 1FJDA 3WD4A 4P8UA 2WM0A 2XP8A 1QPFA 1ZK6A 1ZL1A 1OWQA 4R0XA 4Z2LA 1JNDA 4ODPA 4TYOA 1W1YA 2PPNA 1FKSA 1KT1A 1VF8A 4DZ2A 2RUCA 4DRNA 3JXVA 3KADA 1F40A 3O5RA 4DIPA 1O6IA 5HW6A 4ZPTR 4Z2HA 5B8IC 1FKDA 2F21A 1B6CA 1BKFA 1KFWA 4U84A 1T11A 1NSGA 3B9DA 2KE0A 3CGMA 2LJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRH A;  3TCZ A;  3IKD A;  1Q6U A;  1YAT A;  3KAH A;  3RGC A;  3O5P A;  1Q6H A;  1KT0 A;  2M2A A;  2RUR A;  4ODK A;  5HW7 A;  4ODM A;  1NMV A;  3FAP A;  2XP7 A;  4TW8 A;  4DZ3 A;  3OOB A;  1FKJ A;  2ZQT A;  1JNS A;  3KZ7 A;  4LAW A;  4TW7 A;  5HKG A;  2D9F A;  2UZ5 A;  3KAG A;  4QT2 A;  1ROT A;  3RFW A;  3O5K A;  4ODN A;  4QT3 A;  1FKT A;  3O5G A;  4DT4 A;  2RUQ A;  2F4E A;  3JYJ A;  2RUD A;  2FAP A;  2XP5 A;  1J6Y A;  2PPP A;  4ODQ A;  1FKI A;  1D6O A;  3UQI A;  5J6E A;  4DRQ A;  1FKG A;  1FKK A;  2PPO A;  1FKB A;  2MLZ A;  3NI6 A;  3O5I A;  2ZR6 A;  2LKN A;  4J4O A;  2ZR4 A;  3O5F A;  1FAP A;  2IF4 A;  4JYS A;  3UI6 A;  4GGQ A;  1BL4 A;  2DG3 A;  1QPL A;  3UI4 A;  4JFL A;  2M1I A;  5DIV A;  4C02 B;  4DRM A;  1Q1C A;  3I6C A;  4W9P A;  2RQS A;  4IPX A;  2KI3 A;  2OFN A;  2PV3 A;  3KAF A;  3O5D A;  4JFI A;  4JFM A;  1FD9 A;  1F8A B;  1D7H A;  2N87 A;  3NTP A;  4LAV A;  1Y0O A;  4DRJ A;  2XP6 A;  3CGN A;  1NMW A;  2XPA A;  4G50 A;  1YW5 A;  2ITK A;  3H9R B;  2XPB A;  4N19 A;  1D7J A;  2F2D A;  3PRB A;  4QIB A;  3VAW A;  4BF8 A;  4FAP A;  5HWC A;  5HUA A;  4TNS A;  3TC5 A;  3WH0 A;  4DRO A;  2Q5A A;  4ITZ A;  4MSP A;  2K8I A;  3O5L A;  4JFJ A;  2PV1 A;  3KCE A;  4TW6 A;  1PIN A;  2MNT A;  4ODR A;  5HW8 A;  1N1A A;  3O5E A;  5HT1 A;  2XP4 A;  2KGJ A;  2VCD A;  3PRD A;  4GIV A;  3UF8 A;  3UI5 A;  1P5Q A;  1FKR A;  1U79 A;  1FKF A;  1D7I A;  2L2S A;  4FN2 A;  2MLX A;  3IHZ A;  4MGV A;  2MPH A;  1R9H A;  3EY6 A;  1A7X A;  4W9Q A;  2KR7 A;  1C9H A;  4O2T A;  3IK8 A;  3GPK A;  3KAC A;  5HWB A;  4TX0 A;  2PBC A;  1EYM A;  2RSE A;  3O5O A;  2ZQU A;  2AWG A;  3IKG A;  1Q6I A;  4LAX A;  4ODO A;  1W26 A;  2DG9 A;  4U85 A;  3MDY B;  4NNR A;  3O5Q A;  4W9O A;  5GPG A;  3B7X A;  4J4N A;  4LAY A;  3JYM A;  4IQC A;  3KAB A;  1TCO C;  2XP3 A;  2LGO A;  1ZCN A;  1ROU A;  2VN1 A;  2ZQS A;  5DIU A;  5D75 A;  1FJD A;  3TDB A;  1EQ3 A;  2KFW A;  4DH0 A;  4DRI A;  1J4I A;  2PV2 A;  2XP8 A;  5DIT A;  1QPF A;  1ZK6 A;  1J4H A;  1JVW A;  3O5M A;  4R0X A;  2Y78 A;  3UQB A;  4ODP A;  1PBK A;  2MLY A;  4TYO A;  4DRK A;  2PPN A;  5HTG A;  1FKS A;  1KT1 A;  1JNT A;  1L1P A;  5BXJ A;  1HXV A;  4G2P A;  2ZR5 A;  4DZ2 A;  2RUC A;  4DRN A;  4ODL A;  1FKL A;  3JXV A;  1J4R A;  3KAD A;  3LUO A;  1F40 A;  4JFK A;  2KO7 A;  3O5R A;  4IQ2 A;  1FKH A;  4DIP A;  1M5Y A;  3ODK A;  5I98 A;  3UQA A;  2LPV A;  2ZQV A;  3KAI A;  2FKE A;  3NRK A;  3PA7 A;  5HW6 A;  5B8I C;  1FKD A;  2M08 A;  2F21 A;  4DRP A;  1B6C A;  1BKF A;  4U84 A;  2XP9 A;  3O5J A;  2JZV A;  1QZ2 A;  1T11 A;  1NSG A;  4U86 A;  2KE0 A;  2MF9 A;  3CGM A;  2DG4 A;  2LJ4 A; 
#chains in the Genus database with same CATH topology
 1IX5 A;  3IKD A;  1Q6U A;  3O5P A;  1Q6H A;  4ZPW R;  2F23 A;  2ZQT A;  4TW7 A;  1ZB5 A;  3RFW A;  3O5G A;  4DT4 A;  1JNE A;  2FAP A;  4ODQ A;  1D6O A;  1SR0 A;  2PPO A;  1FKB A;  2MLZ A;  3O5F A;  1FAP A;  2IF4 A;  1LL6 A;  1NH6 A;  2DG3 A;  1W1P A;  2WK2 A;  1X6N A;  4JFL A;  2M1I A;  5GPR A;  2O92 A;  4Z2G A;  2KI3 A;  2OFN A;  2PV3 A;  4L3N A;  1XHG A;  1F8A B;  1D7H A;  2A3C A;  3ARY A;  4HAR A;  2XPA A;  2ITK A;  1JNS A;  2F2D A;  3VAW A;  2K8I A;  3WD0 A;  2PV1 A;  2XP4 A;  2VCD A;  3PRD A;  4GIV A;  4MNL A;  2YBU A;  1FKF A;  1CTN A;  1W9V A;  1HJX A;  1E15 A;  2AOS A;  3W4R A;  1C9H A;  4P8V A;  3KAC A;  4IT6 A;  1H0G A;  2ZQU A;  1FFQ A;  4U85 A;  2DG9 A;  4W5U A;  3B7X A;  4LAY A;  3JYM A;  3ARV A;  1K9T A;  2XP3 A;  1EDQ A;  1ROU A;  1RD6 A;  1ZU8 A;  5D75 A;  1LJY A;  4Z2K A;  1LG1 A;  4DWS D;  3WD3 A;  4MNK A;  4ZS6 A;  3AS3 A;  1E9L A;  2YBT A;  5HTG A;  1FFR A;  1L1P A;  1W9P A;  1LQ0 A;  3CH9 A;  3ART A;  1FKH A;  5I98 A;  1LL4 A;  1GUV A;  2LPV A;  2DSZ A;  4XAK A;  2JZV A;  3B9E A;  1QZ2 A;  3CZ8 A;  4U86 A;  2MF9 A;  1X6L A;  2DSU A;  1YAT A;  2DSV A;  1KT0 A;  1UR8 A;  4DWS A;  4WK9 A;  3FXY A;  1UR9 A;  2B31 A;  4LAW A;  5HKG A;  3KAG A;  4QT2 A;  1ZBK A;  3O5K A;  4ODN A;  4MPK A;  4Z2J A;  2F4E A;  2PN0 A;  3WQW A;  1FKI A;  3UQI A;  1FKG A;  1FKK A;  4JYS A;  4DH0 A;  2LKN A;  2ZR4 A;  3ARU A;  3ALF A;  4PTM A;  3CHD A;  4LGX A;  1Q1C A;  4W9P A;  2RQS A;  1ZBW A;  2N87 A;  4QZV B;  1Y0O A;  3WKZ A;  3ARO A;  1NMW A;  4N19 A;  2XPB A;  4QIB A;  3ARZ A;  5HUA A;  4TNS A;  4MSP A;  4ITZ A;  4DWS B;  3WD1 A;  3O5L A;  4TW6 A;  3ARW A;  1PIN A;  2DT0 A;  4ODR A;  1N1A A;  1GRJ A;  4Z2I A;  2DSW A;  4R5E A;  4WIW A;  2MLX A;  3IHZ A;  1R9H A;  3IK8 A;  4TX0 A;  5GQB A;  1EYM A;  2RSE A;  1EHN A;  2AWG A;  3IKG A;  1Q6I A;  4ODO A;  1GOI A;  4NNR A;  3O5Q A;  1WNO A;  4W9O A;  4S3J A;  4J4N A;  4ML4 A;  1W9U A;  2ZQS A;  1EIB A;  1HKI A;  3TDB A;  1EQ3 A;  5DEZ A;  3WL1 A;  3G6M A;  4P8X A;  4HBO A;  3O5M A;  5JH8 A;  4KR0 B;  4MAV A;  3UQB A;  1PBK A;  3ARQ A;  4DRK A;  3AS0 A;  2FDM A;  1JNT A;  5DO2 A;  1HXV A;  4G2P A;  4KQZ A;  1SYT A;  1J4R A;  4JFK A;  3ARX A;  2KO7 A;  3CHC A;  4IQ2 A;  1M5Y A;  3ODK A;  2ZQV A;  3PA7 A;  4DRP A;  1NWT A;  3ARP A;  3O5J A;  3AS2 A;  2DG4 A;  1NMV A;  4DRH A;  3TCZ A;  4WJX A;  3RGC A;  1OGG A;  2RUR A;  4ODK A;  3FAP A;  2XP7 A;  4TW8 A;  1XRV A;  2WLY A;  2DT1 A;  2D9F A;  2UZ5 A;  3FY1 A;  4NSB A;  4QT3 A;  1FKT A;  2RUQ A;  3JYJ A;  1NWU A;  2RUD A;  3WD2 A;  3QOK A;  1J6Y A;  5HBF A;  2DPE A;  3NI6 A;  3UF8 A;  3UI6 A;  3CHE A;  4GGQ A;  1BL4 A;  1HKM A;  3UI4 A;  5DIV A;  4C02 B;  4IPX A;  3O5D A;  2O9O A;  4JFM A;  1FD9 A;  4LAV A;  1W1V A;  1ITX A;  4G50 A;  1YW5 A;  3G6L A;  3H9R B;  4BF8 A;  1D7J A;  1E6R A;  3PRB A;  3WH0 A;  4DRO A;  2Q5A A;  1TFV A;  2P4V A;  2G41 A;  4L72 B;  2KGJ A;  3UI5 A;  4IT4 A;  2L2S A;  4FN2 A;  4MGV A;  3EY6 A;  4O2T A;  1E6P A;  4WKF A;  1HKK A;  3RME A;  2PBC A;  1W26 A;  2OLH A;  1LG2 A;  3EIP A;  1ZBV A;  2IUZ A;  2B5U B;  3MDY B;  1NWS A;  3ARR A;  3PR9 A;  5GPG A;  2A3A A;  2DT3 A;  1E6N A;  4IQC A;  3GU0 A;  1TCO C;  2VN1 A;  3WQV A;  3GTY X;  5DIU A;  1NWR A;  3RM8 A;  2KFW A;  4DRI A;  1J4I A;  2PV2 A;  4ZPV R;  5DIT A;  1J4H A;  1JVW A;  2Y78 A;  4AY1 A;  2MLY A;  3WL0 A;  5BXJ A;  2ZR5 A;  4S3K A;  4ODL A;  1FKL A;  3LUO A;  3UQA A;  3B9A A;  3KAI A;  3NRK A;  2FKE A;  4URI A;  2M08 A;  4MNJ A;  2XP9 A;  4MTV A;  4MNM A;  4HBE A;  1JCH B;  4NZC A;  3KAH A;  1E6Z A;  2M2A A;  5HW7 A;  4ODM A;  4DZ3 A;  3OOB A;  3WIJ A;  3PRA A;  1FKJ A;  2QF8 A;  3KZ7 A;  1HJW A;  3ARS A;  1WB0 A;  1ROT A;  3RM9 A;  2PI6 A;  2ETN A;  2ESC A;  4P8W A;  2XP5 A;  2PPP A;  2G8Z A;  4DRQ A;  5J6E A;  3O5I A;  4J4O A;  3B8S A;  2ZR6 A;  1ZBC A;  1QPL A;  4DRM A;  3BXW A;  3RM4 A;  3I6C A;  1LL7 A;  1H0I A;  3KAF A;  4JFI A;  3NTP A;  4DRJ A;  3BMB A;  2XP6 A;  5DF0 A;  3CGN A;  1D2K A;  5HWC A;  3ALG A;  4FAP A;  4Q7N A;  3TC5 A;  4WKH A;  2A3E A;  3KCE A;  4JFJ A;  2MNT A;  4Q22 A;  1WAW A;  5HW8 A;  3O5E A;  4DWS C;  5HT1 A;  1FKR A;  1P5Q A;  3OA5 A;  1U79 A;  1D7I A;  2EUL A;  1W1T A;  1OGB A;  2MPH A;  3AS1 A;  1A7X A;  4W9Q A;  2KR7 A;  2DT2 A;  2A3B A;  3GPK A;  5HWB A;  4UDM A;  2WLZ A;  1GPF A;  3O5O A;  1HKJ A;  4LAX A;  4WKA A;  3KAB A;  2LGO A;  1ZCN A;  3CHF A;  1HJV A;  3AQU A;  1FJD A;  3WD4 A;  4P8U A;  2WM0 A;  2XP8 A;  1QPF A;  1ZK6 A;  1ZL1 A;  1OWQ A;  4R0X A;  4Z2L A;  1JND A;  4ODP A;  4TYO A;  1W1Y A;  1E44 A;  2PPN A;  1FKS A;  1KT1 A;  1VF8 A;  4DZ2 A;  2RUC A;  4DRN A;  3JXV A;  3KAD A;  1F40 A;  3O5R A;  4DIP A;  1O6I A;  5HW6 A;  4ZPT R;  4Z2H A;  5B8I C;  1FKD A;  2F21 A;  1B6C A;  1BKF A;  1KFW A;  4U84 A;  1T11 A;  1NSG A;  3B9D A;  2KE0 A;  3CGM A;  2LJ4 A; 
#chains in the Genus database with same CATH homology
 1IX5 A;  3IKD A;  1Q6U A;  3O5P A;  1Q6H A;  4ZPW R;  2ZQT A;  4TW7 A;  1ZB5 A;  3RFW A;  3O5G A;  4DT4 A;  1JNE A;  2FAP A;  4ODQ A;  1D6O A;  1SR0 A;  2PPO A;  1FKB A;  2MLZ A;  3O5F A;  1FAP A;  2IF4 A;  1LL6 A;  1NH6 A;  2DG3 A;  1W1P A;  2WK2 A;  1X6N A;  4JFL A;  2M1I A;  5GPR A;  2O92 A;  4Z2G A;  2KI3 A;  2OFN A;  2PV3 A;  4L3N A;  1XHG A;  1F8A B;  1D7H A;  2A3C A;  3ARY A;  4HAR A;  2XPA A;  2ITK A;  1JNS A;  2F2D A;  3VAW A;  2K8I A;  3WD0 A;  2PV1 A;  2XP4 A;  2VCD A;  3PRD A;  4GIV A;  4MNL A;  2YBU A;  1FKF A;  1CTN A;  1W9V A;  1HJX A;  1E15 A;  2AOS A;  3W4R A;  1C9H A;  4P8V A;  3KAC A;  4IT6 A;  1H0G A;  2ZQU A;  1FFQ A;  4U85 A;  2DG9 A;  4W5U A;  3B7X A;  4LAY A;  3JYM A;  3ARV A;  1K9T A;  2XP3 A;  1EDQ A;  1ROU A;  1RD6 A;  1ZU8 A;  5D75 A;  1LJY A;  4Z2K A;  1LG1 A;  4DWS D;  3WD3 A;  4MNK A;  4ZS6 A;  3AS3 A;  1E9L A;  2YBT A;  5HTG A;  1FFR A;  1L1P A;  1W9P A;  1LQ0 A;  3CH9 A;  3ART A;  1FKH A;  5I98 A;  1LL4 A;  1GUV A;  2LPV A;  2DSZ A;  4XAK A;  2JZV A;  3B9E A;  1QZ2 A;  3CZ8 A;  4U86 A;  2MF9 A;  1X6L A;  2DSU A;  1YAT A;  2DSV A;  1KT0 A;  1UR8 A;  4DWS A;  4WK9 A;  3FXY A;  1UR9 A;  2B31 A;  4LAW A;  5HKG A;  3KAG A;  4QT2 A;  1ZBK A;  3O5K A;  4ODN A;  4MPK A;  4Z2J A;  2F4E A;  3WQW A;  1FKI A;  3UQI A;  1FKG A;  1FKK A;  4JYS A;  4DH0 A;  2LKN A;  2ZR4 A;  3ARU A;  3ALF A;  4PTM A;  3CHD A;  4LGX A;  1Q1C A;  4W9P A;  2RQS A;  1ZBW A;  2N87 A;  4QZV B;  1Y0O A;  3WKZ A;  3ARO A;  1NMW A;  4N19 A;  2XPB A;  4QIB A;  3ARZ A;  5HUA A;  4TNS A;  4MSP A;  4ITZ A;  4DWS B;  3WD1 A;  3O5L A;  4TW6 A;  3ARW A;  1PIN A;  2DT0 A;  4ODR A;  1N1A A;  4Z2I A;  2DSW A;  4R5E A;  4WIW A;  2MLX A;  3IHZ A;  1R9H A;  3IK8 A;  4TX0 A;  5GQB A;  1EYM A;  2RSE A;  1EHN A;  2AWG A;  3IKG A;  1Q6I A;  4ODO A;  1GOI A;  4NNR A;  3O5Q A;  1WNO A;  4W9O A;  4S3J A;  4J4N A;  4ML4 A;  1W9U A;  2ZQS A;  1EIB A;  1HKI A;  3TDB A;  1EQ3 A;  5DEZ A;  3WL1 A;  3G6M A;  4P8X A;  4HBO A;  3O5M A;  5JH8 A;  4KR0 B;  4MAV A;  3UQB A;  1PBK A;  3ARQ A;  4DRK A;  3AS0 A;  2FDM A;  1JNT A;  5DO2 A;  1HXV A;  4G2P A;  4KQZ A;  1SYT A;  1J4R A;  4JFK A;  3ARX A;  2KO7 A;  3CHC A;  4IQ2 A;  1M5Y A;  3ODK A;  2ZQV A;  3PA7 A;  4DRP A;  1NWT A;  3ARP A;  3O5J A;  3AS2 A;  2DG4 A;  1NMV A;  4DRH A;  3TCZ A;  4WJX A;  3RGC A;  1OGG A;  2RUR A;  4ODK A;  3FAP A;  2XP7 A;  4TW8 A;  1XRV A;  2WLY A;  2DT1 A;  2D9F A;  2UZ5 A;  3FY1 A;  4NSB A;  4QT3 A;  1FKT A;  2RUQ A;  3JYJ A;  1NWU A;  2RUD A;  3WD2 A;  3QOK A;  1J6Y A;  5HBF A;  2DPE A;  3NI6 A;  3UF8 A;  3UI6 A;  3CHE A;  4GGQ A;  1BL4 A;  1HKM A;  3UI4 A;  5DIV A;  4C02 B;  4IPX A;  3O5D A;  2O9O A;  4JFM A;  1FD9 A;  4LAV A;  1W1V A;  1ITX A;  4G50 A;  1YW5 A;  3G6L A;  3H9R B;  4BF8 A;  1D7J A;  1E6R A;  3PRB A;  3WH0 A;  4DRO A;  2Q5A A;  1TFV A;  2G41 A;  4L72 B;  2KGJ A;  3UI5 A;  4IT4 A;  2L2S A;  4FN2 A;  4MGV A;  3EY6 A;  4O2T A;  1E6P A;  4WKF A;  1HKK A;  3RME A;  2PBC A;  1W26 A;  2OLH A;  1LG2 A;  1ZBV A;  2IUZ A;  3MDY B;  1NWS A;  3ARR A;  3PR9 A;  5GPG A;  2A3A A;  2DT3 A;  1E6N A;  4IQC A;  1TCO C;  2VN1 A;  3WQV A;  5DIU A;  1NWR A;  3RM8 A;  2KFW A;  4DRI A;  1J4I A;  2PV2 A;  4ZPV R;  5DIT A;  1J4H A;  1JVW A;  2Y78 A;  4AY1 A;  2MLY A;  3WL0 A;  5BXJ A;  2ZR5 A;  4S3K A;  4ODL A;  1FKL A;  3LUO A;  3UQA A;  3B9A A;  3KAI A;  3NRK A;  2FKE A;  4URI A;  2M08 A;  4MNJ A;  2XP9 A;  4MTV A;  4MNM A;  4HBE A;  4NZC A;  3KAH A;  1E6Z A;  2M2A A;  5HW7 A;  4ODM A;  4DZ3 A;  3OOB A;  3WIJ A;  3PRA A;  1FKJ A;  2QF8 A;  3KZ7 A;  1HJW A;  3ARS A;  1WB0 A;  1ROT A;  3RM9 A;  2PI6 A;  2ESC A;  4P8W A;  2XP5 A;  2PPP A;  2G8Z A;  4DRQ A;  5J6E A;  4J4O A;  3O5I A;  3B8S A;  2ZR6 A;  1ZBC A;  1QPL A;  4DRM A;  3BXW A;  3RM4 A;  3I6C A;  1LL7 A;  1H0I A;  3KAF A;  4JFI A;  3NTP A;  4DRJ A;  2XP6 A;  5DF0 A;  3CGN A;  1D2K A;  5HWC A;  3ALG A;  4FAP A;  4Q7N A;  3TC5 A;  4WKH A;  4JFJ A;  2A3E A;  3KCE A;  2MNT A;  4Q22 A;  1WAW A;  5HW8 A;  3O5E A;  4DWS C;  5HT1 A;  1FKR A;  1P5Q A;  3OA5 A;  1U79 A;  1D7I A;  1W1T A;  1OGB A;  2MPH A;  3AS1 A;  1A7X A;  4W9Q A;  2KR7 A;  2DT2 A;  2A3B A;  3GPK A;  5HWB A;  2WLZ A;  1GPF A;  3O5O A;  1HKJ A;  4LAX A;  4WKA A;  3KAB A;  2LGO A;  1ZCN A;  3CHF A;  1HJV A;  3AQU A;  1FJD A;  3WD4 A;  4P8U A;  2WM0 A;  2XP8 A;  1QPF A;  1ZK6 A;  1ZL1 A;  1OWQ A;  4R0X A;  4Z2L A;  1JND A;  4ODP A;  4TYO A;  1W1Y A;  2PPN A;  1FKS A;  1KT1 A;  1VF8 A;  4DZ2 A;  2RUC A;  4DRN A;  3JXV A;  3KAD A;  1F40 A;  3O5R A;  4DIP A;  1O6I A;  5HW6 A;  4ZPT R;  4Z2H A;  5B8I C;  1FKD A;  2F21 A;  1B6C A;  1BKF A;  1KFW A;  4U84 A;  1T11 A;  1NSG A;  3B9D A;  2KE0 A;  3CGM A;  2LJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...