5GPGA

Co-crystal structure of the fk506 binding domain of human fkbp25, rapamycin and the frb domain of human mtor
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
110
Chain Sequence
SPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Proximity-Directed Labeling Reveals a New Rapamycin-Induced Heterodimer of FKBP25 and FRB in Live Cells
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/transferase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP3
total genus 25
structure length 110
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5gpgA00
3JYJA 2DG3A 2UZ5A 1J6YA 1Q6HA 2RQSA 1FKFA 2Y78A 4ODMA 3RGCA 3O5FA 5HW7A 2M1IA 2RUCA 1PINA 3IK8A 4R0XA 1TCOC 1P5QA 2KI3A 3UF8A 3UI4A 2RUDA 2L2SA 4TNSA 1NSGA 2AWGA 2XP9A 4U86A 1ZCNA 4GIVA 2Q5AA 4J4NA 5DIUA 1Q6IA 2PBCA 3O5GA 2KE0A 4ODRA 1F8AB 4U85A 4W9OA 1D7JA 4DT4A 3TDBA 2PPOA 2KR7A 1YATA 1KT1A 3TC5A 1C9HA 1QZ2A 3IHZA 5HTGA 2DG4A 1FKJA 3JXVA 3GPKA 3PRDA 2FKEA 1EQ3A 1N1AA 4ODPA 3TCZA 2K8IA 4JYSA 1FKDA 4MGVA 3NRKA 2XP8A 3UI5A 2XPAA 4DROA 3KABA 2PPNA 5HT1A 3RFWA 1D6OA 5HKGA 5I98A 2ZQTA 4IQ2A 3O5MA 4FAPA 2PV1A 3KAFA 2ITKA 2KGJA 2MNTA 1J4HA 2RURA 5D75A 5B8IC 2MLXA 2N87A 4QT3A 2ZR6A 2ZR5A 4W9QA 2XP4A 2KO7A 1D7IA 5DITA 1ZK6A 4C02B 1FJDA 4JFLA 2LKNA 4DZ3A 3O5PA 4JFJA 1JNSA 3PA7A 1FKBA 3JYMA 3LUOA 4W9PA 1ROTA 4LAYA 4U84A 3WH0A 2DG9A 3FAPA 3O5JA 4DIPA 4DRPA 1Q6UA 2RUQA 2LJ4A 3MDYB 4DRNA 1L1PA 1ROUA 4TYOA 3O5QA 1JVWA 1Q1CA 1QPLA 4IPXA 3UQBA 4ODKA 1NMVA 3KCEA 2F2DA 2ZQUA 3VAWA 4DRKA 3H9RB 2MLYA 3KAGA 4G2PA 4G50A 4ITZA 2KFWA 3NTPA 2XP7A 3NI6A 4ODLA 2PV2A 1FKSA 3O5LA 3OOBA 4DRHA 2JZVA 3B7XA 1FKRA 2ZR4A 3O5OA 1FKIA 1Y0OA 3O5IA 4FN2A 5GPGA 2M2AA 3KACA 1FKLA 4LAWA 5HWBA 1EYMA 2LPVA 4DH0A 1B6CA 3IKGA 4DRJA 1QPFA 4GGQA 1KT0A 4DRIA 3UQAA 1FKTA 2MF9A 1W26A 2XP6A 4QT2A 4BF8A 3KZ7A 3EY6A 1F40A 2FAPA 2M08A 3CGNA 3CGMA 5HWCA 5BXJA 4NNRA 2PV3A 4JFKA 4ODQA 2XP5A 1JNTA 2ZQSA 5J6EA 1BKFA 3O5KA 2MLZA 4IQCA 4JFMA 4O2TA 4ODNA 2MPHA 2LGOA 4TX0A 3UQIA 4MSPA 2VN1A 2ZQVA 5HUAA 2D9FA 1BL4A 4DZ2A 2XPBA 5DIVA 5HW6A 3ODKA 4LAVA 2F21A 1U79A 3PRBA 1FKHA 2F4EA 1A7XA 1YW5A 3I6CA 3O5EA 3O5DA 4N19A 4DRMA 1FAPA 1NMWA 1J4IA 1FD9A 1FKGA 4TW7A 1M5YA 2VCDA 3IKDA 4DRQA 1T11A 2RSEA 4J4OA 4ODOA 4JFIA 1J4RA 2XP3A 3O5RA 3KAHA 2PPPA 1D7HA 2OFNA 4LAXA 5HW8A 3UI6A 3KADA 4QIBA 1FKKA 2IF4A 1HXVA 4TW8A 4TW6A 1PBKA 1R9HA 3KAIA
chains in the Genus database with same CATH superfamily
3JYJA 2UZ5A 3QOKA 3O5FA 3CHCA 4Z2HA 2M1IA 1ZBKA 1TCOC 1P5QA 4Z2JA 5DIUA 3CHEA 1Q6IA 2FDMA 2PBCA 4W9OA 3ARRA 1NWSA 1W1VA 3EIPA 2DT3A 2FKEA 1UR9A 2K8IA 3NRKA 4AY1A 4HARA 3KABA 1GOIA 3BXWA 5HBFA 2DT1A 4IQ2A 3O5MA 2AOSA 3KAFA 4ZPTR 4P8WA 3AS3A 2KGJA 2MNTA 3PRAA 4KQZA 5B8IC 2RURA 2MLXA 4QT3A 2ZR6A 1D7IA 4C02B 4DZ3A 3O5PA 4MNKA 3CHFA 4XAKA 1ZBWA 3WH0A 3FAPA 1W1TA 1HKKA 4IPXA 1HKIA 1NMVA 2F2DA 3AS2A 3H9RB 3KAGA 4G2PA 4ITZA 3ARZA 3OOBA 4W5UA 4DRHA 3B7XA 1FKIA 3PR9A 2DSUA 2M2AA 3KACA 5HWBA 2LPVA 1B6CA 1ZL1A 1QPFA 3WQWA 1LG2A 4DRIA 2XP6A 1VF8A 3EY6A 4MAVA 3B8SA 2XP5A 3G6LA 3O5KA 5BXJA 4TX0A 3WKZA 5HUAA 1ZBCA 2VN1A 4MSPA 4DZ2A 5DIVA 5HW6A 1A7XA 1NMWA 4MNLA 4WK9A 1FFRA 3AQUA 4TW7A 4IT4A 1T11A 4J4OA 3O5RA 2DSVA 3KAHA 2PPPA 2OFNA 4LAXA 3UI6A 1EDQA 2IF4A 4TW8A 3AS1A 3WD0A 2DG3A 1J6YA 2A3AA 1FKFA 2YBUA 3ARXA 4ODMA 2RUCA 2L2SA 4TNSA 4LGXA 5DO2A 4U86A 1GPFA 3WL0A 2ESCA 3ALFA 3ARWA 1D7JA 3TDBA 2KR7A 3TC5A 1QZ2A 5HTGA 3JXVA 1HKJA 1N1AA 4ODPA 4MGVA 3UI5A 1LQ0A 3WD2A 2PPNA 5HT1A 1W1YA 4QZVB 1NWTA 1J4HA 2N87A 4WIWA 3ARPA 4KR0B 3CZ8A 4JFLA 2DSZA 2B31A 3PA7A 3JYMA 1SYTA 1ROTA 4U84A 2DG9A 3O5JA 4MNMA 4DRNA 2P4VA 1JVWA 1Q1CA 1QPLA 1EHNA 1O6IA 4ZPWR 2MLYA 2KFWA 4P8VA 4ODLA 2PV2A 1FKSA 1WAWA 1FKRA 4FN2A 2ZR4A 3CH9A 1Y0OA 1KFWA 3IKGA 1UR8A 2B5UB 2MF9A 4QT2A 2O9OA 2PI6A 5DEZA 2WLZA 1NWRA 4ML4A 1LJYA 1JNTA 2DT2A 4HBEA 1XHGA 2WLYA 2MLZA 4IQCA 1W9PA 4DIPA 4L72B 2LGOA 1OWQA 1U79A 1NH6A 1E6PA 2F4EA 4P8UA 3O5DA 4DRMA 4N19A 3W4RA 1FKGA 1JNEA 2VCDA 2G41A 1E6NA 2XP3A 2O92A 1D7HA 4DWSA 3FY1A 1FKKA 4TW6A 1HJVA 1PBKA 1J4IA 1R9HA 3O5GA 1Q6HA 1ZB5A 5HW7A 4P8XA 3IK8A 4R0XA 4MNJA 2KI3A 3UI4A 2RUDA 1JNDA 3ARQA 4R5EA 1NSGA 2AWGA 3ARYA 1JCHB 2XP9A 1ZCNA 4GIVA 2F23A 4NZCA 1K9TA 4U85A 4ODRA 4DT4A 4Z2GA 4Z2IA 4L3NA 2PPOA 1YATA 1KT1A 4WKAA 1C9HA 3IHZA 2DG4A 3GTYX 3GPKA 3PRDA 3RM9A 3TCZA 4Q7NA 2XPAA 1XRVA 3RFWA 1D6OA 2ZQTA 4UDMA 5D75A 2IUZA 2ZR5A 1W9UA 2XP4A 4W9QA 2KO7A 2DSWA 1H0IA 3FXYA 5DITA 3G6MA 3WL1A 1ITXA 4JFJA 1JNSA 1FKBA 1E6RA 4S3KA 4W9PA 2A3BA 1W9VA 1WB0A 1E44A 1X6LA 4DRPA 1Q6UA 4ZPVR 3MDYB 4URIA 3B9EA 4ODKA 3VAWA 2ZQUA 3NTPA 2XP7A 3O5LA 2JZVA 2YBTA 1W1PA 5GPGA 1FKLA 4LAWA 4Z2KA 4DRJA 1KT0A 2QF8A 4DWSD 3UQAA 3KZ7A 1GRJA 1F40A 3CGNA 2DPEA 3CGMA 3ARUA 4NNRA 4ODQA 2OLHA 1CTNA 1HKMA 4JFMA 4O2TA 3UQIA 4ODNA 4BF8A 3RM8A 1TFVA 1BL4A 4LAVA 4IT6A 1YW5A 3I6CA 1FAPA 4WJXA 1FD9A 1M5YA 3IKDA 3ARTA 3BMBA 1D2KA 4ODOA 1J4RA 1E6ZA 3CHDA 5HW8A 3KADA 4QIBA 1HXVA 1E9LA 1HJWA 1LG1A 3B9AA 4DWSB 2RQSA 2Y78A 3RGCA 1ZBVA 1PINA 3UF8A 4NSBA 3RM4A 2A3EA 3ALGA 1WNOA 3WIJA 2ETNA 1LL4A 4MTVA 2Q5AA 4J4NA 2KE0A 1F8AB 1FKJA 4S3JA 4ZS6A 2EULA 5GQBA 3ARSA 4JYSA 1FKDA 2XP8A 4Z2LA 5JH8A 4DROA 3RMEA 5HKGA 5I98A 1LL6A 3AROA 4FAPA 2PV1A 4WKHA 1EIBA 2ITKA 4PTMA 3WD3A 2A3CA 1IX5A 1ZK6A 1FJDA 2LKNA 4DWSC 3AS0A 3WD1A 3LUOA 4LAYA 1ZU8A 2RUQA 3OA5A 2LJ4A 1L1PA 1ROUA 4TYOA 3O5QA 1H0GA 4HBOA 3UQBA 1OGGA 4DRKA 3KCEA 4G50A 3NI6A 1E15A 5GPRA 3O5OA 3O5IA 1EQ3A 1X6NA 1EYMA 4DH0A 4GGQA 4Q22A 1FKTA 1W26A 2WK2A 2DT0A 2FAPA 2M08A 1HJXA 5HWCA 1OGBA 1GUVA 2PV3A 4JFKA 5DF0A 5J6EA 2ZQSA 1BKFA 2MPHA 2ZQVA 2D9FA 3WQVA 2XPBA 3ODKA 2F21A 3PRBA 1FKHA 3O5EA 4MPKA 2PN0A 3B9DA 1LL7A 1RD6A 4DRQA 1NWUA 2RSEA 4JFIA 2WM0A 2G8ZA 3GU0A 1SR0A 1FFQA 3WD4A 3ARVA 3KAIA 4WKFA
chains in the Genus database with same CATH topology
3JYJA 2UZ5A 3QOKA 3O5FA 3CHCA 4Z2HA 2M1IA 1ZBKA 1TCOC 1P5QA 4Z2JA 5DIUA 3CHEA 1Q6IA 2FDMA 2PBCA 4W9OA 3ARRA 1NWSA 1W1VA 2DT3A 2FKEA 1UR9A 2K8IA 3NRKA 4AY1A 4HARA 3KABA 1GOIA 3BXWA 5HBFA 2DT1A 4IQ2A 3O5MA 2AOSA 3KAFA 4ZPTR 4P8WA 3AS3A 2KGJA 2MNTA 3PRAA 4KQZA 5B8IC 2RURA 2MLXA 4QT3A 2ZR6A 1D7IA 4C02B 4DZ3A 3O5PA 4MNKA 3CHFA 4XAKA 1ZBWA 3WH0A 3FAPA 1W1TA 1HKKA 4IPXA 1HKIA 1NMVA 2F2DA 3AS2A 3H9RB 3KAGA 4G2PA 4ITZA 3ARZA 3OOBA 4W5UA 4DRHA 3B7XA 1FKIA 3PR9A 2DSUA 2M2AA 3KACA 5HWBA 2LPVA 1B6CA 1ZL1A 1QPFA 3WQWA 1LG2A 4DRIA 2XP6A 1VF8A 3EY6A 4MAVA 3B8SA 2XP5A 3G6LA 3O5KA 5BXJA 4TX0A 3WKZA 5HUAA 1ZBCA 2VN1A 4MSPA 4DZ2A 5DIVA 5HW6A 1A7XA 1NMWA 4MNLA 4WK9A 1FFRA 3AQUA 4TW7A 4IT4A 1T11A 4J4OA 3O5RA 2DSVA 3KAHA 2PPPA 2OFNA 4LAXA 3UI6A 1EDQA 2IF4A 4TW8A 3AS1A 3WD0A 2DG3A 1J6YA 2A3AA 1FKFA 2YBUA 3ARXA 4ODMA 2RUCA 2L2SA 4TNSA 4LGXA 5DO2A 4U86A 1GPFA 3WL0A 2ESCA 3ALFA 3ARWA 1D7JA 3TDBA 2KR7A 3TC5A 1QZ2A 5HTGA 3JXVA 1HKJA 1N1AA 4ODPA 4MGVA 3UI5A 1LQ0A 3WD2A 2PPNA 5HT1A 1W1YA 4QZVB 1NWTA 1J4HA 2N87A 4WIWA 3ARPA 4KR0B 3CZ8A 4JFLA 2DSZA 2B31A 3PA7A 3JYMA 1SYTA 1ROTA 4U84A 2DG9A 3O5JA 4MNMA 4DRNA 1JVWA 1Q1CA 1QPLA 1EHNA 1O6IA 4ZPWR 2MLYA 2KFWA 4P8VA 4ODLA 2PV2A 1FKSA 1WAWA 1FKRA 4FN2A 2ZR4A 3CH9A 1Y0OA 1KFWA 3IKGA 1UR8A 2MF9A 4QT2A 2O9OA 2PI6A 5DEZA 2WLZA 1NWRA 4ML4A 1LJYA 1JNTA 2DT2A 4HBEA 1XHGA 2WLYA 2MLZA 4IQCA 1W9PA 4DIPA 4L72B 2LGOA 1OWQA 1U79A 1NH6A 1E6PA 2F4EA 4P8UA 3O5DA 4DRMA 4N19A 3W4RA 1FKGA 1JNEA 2VCDA 2G41A 1E6NA 2XP3A 2O92A 1D7HA 4DWSA 3FY1A 1FKKA 4TW6A 1HJVA 1PBKA 1J4IA 1R9HA 3O5GA 1Q6HA 1ZB5A 5HW7A 4P8XA 3IK8A 4R0XA 4MNJA 2KI3A 3UI4A 2RUDA 1JNDA 3ARQA 4R5EA 1NSGA 2AWGA 3ARYA 2XP9A 1ZCNA 4GIVA 4NZCA 1K9TA 4U85A 4ODRA 4DT4A 4Z2GA 4Z2IA 4L3NA 2PPOA 1YATA 1KT1A 4WKAA 1C9HA 3IHZA 2DG4A 3GPKA 3PRDA 3RM9A 3TCZA 4Q7NA 2XPAA 1XRVA 3RFWA 1D6OA 2ZQTA 5D75A 2IUZA 2ZR5A 1W9UA 2XP4A 4W9QA 2KO7A 2DSWA 1H0IA 3FXYA 5DITA 3G6MA 3WL1A 1ITXA 4JFJA 1JNSA 1FKBA 1E6RA 4S3KA 4W9PA 2A3BA 1W9VA 1WB0A 1X6LA 4DRPA 1Q6UA 4ZPVR 3MDYB 4URIA 3B9EA 4ODKA 3VAWA 2ZQUA 3NTPA 2XP7A 3O5LA 2JZVA 2YBTA 1W1PA 5GPGA 1FKLA 4LAWA 4Z2KA 4DRJA 1KT0A 2QF8A 4DWSD 3UQAA 3KZ7A 1F40A 3CGNA 2DPEA 3CGMA 3ARUA 4NNRA 4ODQA 2OLHA 1CTNA 4JFMA 1HKMA 4O2TA 3UQIA 4ODNA 4BF8A 3RM8A 1TFVA 1BL4A 4LAVA 4IT6A 1YW5A 3I6CA 1FAPA 4WJXA 1FD9A 1M5YA 3IKDA 3ARTA 1D2KA 4ODOA 1J4RA 1E6ZA 3CHDA 5HW8A 3KADA 4QIBA 1HXVA 1E9LA 1HJWA 1LG1A 3B9AA 4DWSB 2RQSA 2Y78A 3RGCA 1ZBVA 1PINA 3UF8A 4NSBA 3RM4A 2A3EA 3ALGA 1WNOA 3WIJA 1LL4A 4MTVA 2Q5AA 4J4NA 2KE0A 1F8AB 1FKJA 4S3JA 4ZS6A 5GQBA 3ARSA 4JYSA 1FKDA 2XP8A 4Z2LA 5JH8A 4DROA 3RMEA 5HKGA 5I98A 1LL6A 3AROA 4FAPA 2PV1A 4WKHA 1EIBA 2ITKA 4PTMA 3WD3A 2A3CA 1IX5A 1ZK6A 1FJDA 2LKNA 4DWSC 3AS0A 3WD1A 3LUOA 4LAYA 1ZU8A 2RUQA 3OA5A 2LJ4A 1L1PA 1ROUA 4TYOA 3O5QA 1H0GA 4HBOA 3UQBA 1OGGA 4DRKA 3KCEA 4G50A 3NI6A 1E15A 5GPRA 3O5OA 3O5IA 1EQ3A 1X6NA 1EYMA 4DH0A 4GGQA 4Q22A 1FKTA 1W26A 2WK2A 2DT0A 2FAPA 2M08A 1HJXA 5HWCA 1OGBA 1GUVA 2PV3A 4JFKA 5DF0A 5J6EA 2ZQSA 1BKFA 2MPHA 2ZQVA 2D9FA 3WQVA 2XPBA 3ODKA 2F21A 3PRBA 1FKHA 3O5EA 4MPKA 3B9DA 1LL7A 1RD6A 4DRQA 1NWUA 2RSEA 4JFIA 2WM0A 2G8ZA 1SR0A 1FFQA 3WD4A 3ARVA 3KAIA 4WKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JYJ A;  2DG3 A;  2UZ5 A;  1J6Y A;  1Q6H A;  2RQS A;  1FKF A;  2Y78 A;  4ODM A;  3RGC A;  3O5F A;  5HW7 A;  2M1I A;  2RUC A;  1PIN A;  3IK8 A;  4R0X A;  1TCO C;  1P5Q A;  2KI3 A;  3UF8 A;  3UI4 A;  2RUD A;  2L2S A;  4TNS A;  1NSG A;  2AWG A;  2XP9 A;  4U86 A;  1ZCN A;  4GIV A;  2Q5A A;  4J4N A;  5DIU A;  1Q6I A;  2PBC A;  3O5G A;  2KE0 A;  4ODR A;  1F8A B;  4U85 A;  4W9O A;  1D7J A;  4DT4 A;  3TDB A;  2PPO A;  2KR7 A;  1YAT A;  1KT1 A;  3TC5 A;  1C9H A;  1QZ2 A;  3IHZ A;  5HTG A;  2DG4 A;  1FKJ A;  3JXV A;  3GPK A;  3PRD A;  2FKE A;  1EQ3 A;  1N1A A;  4ODP A;  3TCZ A;  2K8I A;  4JYS A;  1FKD A;  4MGV A;  3NRK A;  2XP8 A;  3UI5 A;  2XPA A;  4DRO A;  3KAB A;  2PPN A;  5HT1 A;  3RFW A;  1D6O A;  5HKG A;  5I98 A;  2ZQT A;  4IQ2 A;  3O5M A;  4FAP A;  2PV1 A;  3KAF A;  2ITK A;  2KGJ A;  2MNT A;  1J4H A;  2RUR A;  5D75 A;  5B8I C;  2MLX A;  2N87 A;  4QT3 A;  2ZR6 A;  2ZR5 A;  4W9Q A;  2XP4 A;  2KO7 A;  1D7I A;  5DIT A;  1ZK6 A;  4C02 B;  1FJD A;  4JFL A;  2LKN A;  4DZ3 A;  3O5P A;  4JFJ A;  1JNS A;  3PA7 A;  1FKB A;  3JYM A;  3LUO A;  4W9P A;  1ROT A;  4LAY A;  4U84 A;  3WH0 A;  2DG9 A;  3FAP A;  3O5J A;  4DIP A;  4DRP A;  1Q6U A;  2RUQ A;  2LJ4 A;  3MDY B;  4DRN A;  1L1P A;  1ROU A;  4TYO A;  3O5Q A;  1JVW A;  1Q1C A;  1QPL A;  4IPX A;  3UQB A;  4ODK A;  1NMV A;  3KCE A;  2F2D A;  2ZQU A;  3VAW A;  4DRK A;  3H9R B;  2MLY A;  3KAG A;  4G2P A;  4G50 A;  4ITZ A;  2KFW A;  3NTP A;  2XP7 A;  3NI6 A;  4ODL A;  2PV2 A;  1FKS A;  3O5L A;  3OOB A;  4DRH A;  2JZV A;  3B7X A;  1FKR A;  2ZR4 A;  3O5O A;  1FKI A;  1Y0O A;  3O5I A;  4FN2 A;  5GPG A;  2M2A A;  3KAC A;  1FKL A;  4LAW A;  5HWB A;  1EYM A;  2LPV A;  4DH0 A;  1B6C A;  3IKG A;  4DRJ A;  1QPF A;  4GGQ A;  1KT0 A;  4DRI A;  3UQA A;  1FKT A;  2MF9 A;  1W26 A;  2XP6 A;  4QT2 A;  4BF8 A;  3KZ7 A;  3EY6 A;  1F40 A;  2FAP A;  2M08 A;  3CGN A;  3CGM A;  5HWC A;  5BXJ A;  4NNR A;  2PV3 A;  4JFK A;  4ODQ A;  2XP5 A;  1JNT A;  2ZQS A;  5J6E A;  1BKF A;  3O5K A;  2MLZ A;  4IQC A;  4JFM A;  4O2T A;  4ODN A;  2MPH A;  2LGO A;  4TX0 A;  3UQI A;  4MSP A;  2VN1 A;  2ZQV A;  5HUA A;  2D9F A;  1BL4 A;  4DZ2 A;  2XPB A;  5DIV A;  5HW6 A;  3ODK A;  4LAV A;  2F21 A;  1U79 A;  3PRB A;  1FKH A;  2F4E A;  1A7X A;  1YW5 A;  3I6C A;  3O5E A;  3O5D A;  4N19 A;  4DRM A;  1FAP A;  1NMW A;  1J4I A;  1FD9 A;  1FKG A;  4TW7 A;  1M5Y A;  2VCD A;  3IKD A;  4DRQ A;  1T11 A;  2RSE A;  4J4O A;  4ODO A;  4JFI A;  1J4R A;  2XP3 A;  3O5R A;  3KAH A;  2PPP A;  1D7H A;  2OFN A;  4LAX A;  5HW8 A;  3UI6 A;  3KAD A;  4QIB A;  1FKK A;  2IF4 A;  1HXV A;  4TW8 A;  4TW6 A;  1PBK A;  1R9H A;  3KAI A; 
#chains in the Genus database with same CATH topology
 3JYJ A;  2UZ5 A;  3QOK A;  3O5F A;  3CHC A;  4Z2H A;  2M1I A;  1ZBK A;  1TCO C;  1P5Q A;  4Z2J A;  5DIU A;  3CHE A;  1Q6I A;  2FDM A;  2PBC A;  4W9O A;  3ARR A;  1NWS A;  1W1V A;  3EIP A;  2DT3 A;  2FKE A;  1UR9 A;  2K8I A;  3NRK A;  4AY1 A;  4HAR A;  3KAB A;  1GOI A;  3BXW A;  5HBF A;  2DT1 A;  4IQ2 A;  3O5M A;  2AOS A;  3KAF A;  4ZPT R;  4P8W A;  3AS3 A;  2KGJ A;  2MNT A;  3PRA A;  4KQZ A;  5B8I C;  2RUR A;  2MLX A;  4QT3 A;  2ZR6 A;  1D7I A;  4C02 B;  4DZ3 A;  3O5P A;  4MNK A;  3CHF A;  4XAK A;  1ZBW A;  3WH0 A;  3FAP A;  1W1T A;  1HKK A;  4IPX A;  1HKI A;  1NMV A;  2F2D A;  3AS2 A;  3H9R B;  3KAG A;  4G2P A;  4ITZ A;  3ARZ A;  3OOB A;  4W5U A;  4DRH A;  3B7X A;  1FKI A;  3PR9 A;  2DSU A;  2M2A A;  3KAC A;  5HWB A;  2LPV A;  1B6C A;  1ZL1 A;  1QPF A;  3WQW A;  1LG2 A;  4DRI A;  2XP6 A;  1VF8 A;  3EY6 A;  4MAV A;  3B8S A;  2XP5 A;  3G6L A;  3O5K A;  5BXJ A;  4TX0 A;  3WKZ A;  5HUA A;  1ZBC A;  2VN1 A;  4MSP A;  4DZ2 A;  5DIV A;  5HW6 A;  1A7X A;  1NMW A;  4MNL A;  4WK9 A;  1FFR A;  3AQU A;  4TW7 A;  4IT4 A;  1T11 A;  4J4O A;  3O5R A;  2DSV A;  3KAH A;  2PPP A;  2OFN A;  4LAX A;  3UI6 A;  1EDQ A;  2IF4 A;  4TW8 A;  3AS1 A;  3WD0 A;  2DG3 A;  1J6Y A;  2A3A A;  1FKF A;  2YBU A;  3ARX A;  4ODM A;  2RUC A;  2L2S A;  4TNS A;  4LGX A;  5DO2 A;  4U86 A;  1GPF A;  3WL0 A;  2ESC A;  3ALF A;  3ARW A;  1D7J A;  3TDB A;  2KR7 A;  3TC5 A;  1QZ2 A;  5HTG A;  3JXV A;  1HKJ A;  1N1A A;  4ODP A;  4MGV A;  3UI5 A;  1LQ0 A;  3WD2 A;  2PPN A;  5HT1 A;  1W1Y A;  4QZV B;  1NWT A;  1J4H A;  2N87 A;  4WIW A;  3ARP A;  4KR0 B;  3CZ8 A;  4JFL A;  2DSZ A;  2B31 A;  3PA7 A;  3JYM A;  1SYT A;  1ROT A;  4U84 A;  2DG9 A;  3O5J A;  4MNM A;  4DRN A;  2P4V A;  1JVW A;  1Q1C A;  1QPL A;  1EHN A;  1O6I A;  4ZPW R;  2MLY A;  2KFW A;  4P8V A;  4ODL A;  2PV2 A;  1FKS A;  1WAW A;  1FKR A;  4FN2 A;  2ZR4 A;  3CH9 A;  1Y0O A;  1KFW A;  3IKG A;  1UR8 A;  2B5U B;  2MF9 A;  4QT2 A;  2O9O A;  2PI6 A;  5DEZ A;  2WLZ A;  1NWR A;  4ML4 A;  1LJY A;  1JNT A;  2DT2 A;  4HBE A;  1XHG A;  2WLY A;  2MLZ A;  4IQC A;  1W9P A;  4DIP A;  4L72 B;  2LGO A;  1OWQ A;  1U79 A;  1NH6 A;  1E6P A;  2F4E A;  4P8U A;  3O5D A;  4DRM A;  4N19 A;  3W4R A;  1FKG A;  1JNE A;  2VCD A;  2G41 A;  1E6N A;  2XP3 A;  2O92 A;  1D7H A;  4DWS A;  3FY1 A;  1FKK A;  4TW6 A;  1HJV A;  1PBK A;  1J4I A;  1R9H A;  3O5G A;  1Q6H A;  1ZB5 A;  5HW7 A;  4P8X A;  3IK8 A;  4R0X A;  4MNJ A;  2KI3 A;  3UI4 A;  2RUD A;  1JND A;  3ARQ A;  4R5E A;  1NSG A;  2AWG A;  3ARY A;  1JCH B;  2XP9 A;  1ZCN A;  4GIV A;  2F23 A;  4NZC A;  1K9T A;  4U85 A;  4ODR A;  4DT4 A;  4Z2G A;  4Z2I A;  4L3N A;  2PPO A;  1YAT A;  1KT1 A;  4WKA A;  1C9H A;  3IHZ A;  2DG4 A;  3GTY X;  3GPK A;  3PRD A;  3RM9 A;  3TCZ A;  4Q7N A;  2XPA A;  1XRV A;  3RFW A;  1D6O A;  2ZQT A;  4UDM A;  5D75 A;  2IUZ A;  2ZR5 A;  1W9U A;  2XP4 A;  4W9Q A;  2KO7 A;  2DSW A;  1H0I A;  3FXY A;  5DIT A;  3G6M A;  3WL1 A;  1ITX A;  4JFJ A;  1JNS A;  1FKB A;  1E6R A;  4S3K A;  4W9P A;  2A3B A;  1W9V A;  1WB0 A;  1E44 A;  1X6L A;  4DRP A;  1Q6U A;  4ZPV R;  3MDY B;  4URI A;  3B9E A;  4ODK A;  3VAW A;  2ZQU A;  3NTP A;  2XP7 A;  3O5L A;  2JZV A;  2YBT A;  1W1P A;  5GPG A;  1FKL A;  4LAW A;  4Z2K A;  4DRJ A;  1KT0 A;  2QF8 A;  4DWS D;  3UQA A;  3KZ7 A;  1GRJ A;  1F40 A;  3CGN A;  2DPE A;  3CGM A;  3ARU A;  4NNR A;  4ODQ A;  2OLH A;  1CTN A;  1HKM A;  4JFM A;  4O2T A;  3UQI A;  4ODN A;  4BF8 A;  3RM8 A;  1TFV A;  1BL4 A;  4LAV A;  4IT6 A;  1YW5 A;  3I6C A;  1FAP A;  4WJX A;  1FD9 A;  1M5Y A;  3IKD A;  3ART A;  3BMB A;  1D2K A;  4ODO A;  1J4R A;  1E6Z A;  3CHD A;  5HW8 A;  3KAD A;  4QIB A;  1HXV A;  1E9L A;  1HJW A;  1LG1 A;  3B9A A;  4DWS B;  2RQS A;  2Y78 A;  3RGC A;  1ZBV A;  1PIN A;  3UF8 A;  4NSB A;  3RM4 A;  2A3E A;  3ALG A;  1WNO A;  3WIJ A;  2ETN A;  1LL4 A;  4MTV A;  2Q5A A;  4J4N A;  2KE0 A;  1F8A B;  1FKJ A;  4S3J A;  4ZS6 A;  2EUL A;  5GQB A;  3ARS A;  4JYS A;  1FKD A;  2XP8 A;  4Z2L A;  5JH8 A;  4DRO A;  3RME A;  5HKG A;  5I98 A;  1LL6 A;  3ARO A;  4FAP A;  2PV1 A;  4WKH A;  1EIB A;  2ITK A;  4PTM A;  3WD3 A;  2A3C A;  1IX5 A;  1ZK6 A;  1FJD A;  2LKN A;  4DWS C;  3AS0 A;  3WD1 A;  3LUO A;  4LAY A;  1ZU8 A;  2RUQ A;  3OA5 A;  2LJ4 A;  1L1P A;  1ROU A;  4TYO A;  3O5Q A;  1H0G A;  4HBO A;  3UQB A;  1OGG A;  4DRK A;  3KCE A;  4G50 A;  3NI6 A;  1E15 A;  5GPR A;  3O5O A;  3O5I A;  1EQ3 A;  1X6N A;  1EYM A;  4DH0 A;  4GGQ A;  4Q22 A;  1FKT A;  1W26 A;  2WK2 A;  2DT0 A;  2FAP A;  2M08 A;  1HJX A;  5HWC A;  1OGB A;  1GUV A;  2PV3 A;  4JFK A;  5DF0 A;  5J6E A;  2ZQS A;  1BKF A;  2MPH A;  2ZQV A;  2D9F A;  3WQV A;  2XPB A;  3ODK A;  2F21 A;  3PRB A;  1FKH A;  3O5E A;  4MPK A;  2PN0 A;  3B9D A;  1LL7 A;  1RD6 A;  4DRQ A;  1NWU A;  2RSE A;  4JFI A;  2WM0 A;  2G8Z A;  3GU0 A;  1SR0 A;  1FFQ A;  3WD4 A;  3ARV A;  3KAI A;  4WKF A; 
#chains in the Genus database with same CATH homology
 3JYJ A;  2UZ5 A;  3QOK A;  3O5F A;  3CHC A;  4Z2H A;  2M1I A;  1ZBK A;  1TCO C;  1P5Q A;  4Z2J A;  5DIU A;  3CHE A;  1Q6I A;  2FDM A;  2PBC A;  4W9O A;  3ARR A;  1NWS A;  1W1V A;  2DT3 A;  2FKE A;  1UR9 A;  2K8I A;  3NRK A;  4AY1 A;  4HAR A;  3KAB A;  1GOI A;  3BXW A;  5HBF A;  2DT1 A;  4IQ2 A;  3O5M A;  2AOS A;  3KAF A;  4ZPT R;  4P8W A;  3AS3 A;  2KGJ A;  2MNT A;  3PRA A;  4KQZ A;  5B8I C;  2RUR A;  2MLX A;  4QT3 A;  2ZR6 A;  1D7I A;  4C02 B;  4DZ3 A;  3O5P A;  4MNK A;  3CHF A;  4XAK A;  1ZBW A;  3WH0 A;  3FAP A;  1W1T A;  1HKK A;  4IPX A;  1HKI A;  1NMV A;  2F2D A;  3AS2 A;  3H9R B;  3KAG A;  4G2P A;  4ITZ A;  3ARZ A;  3OOB A;  4W5U A;  4DRH A;  3B7X A;  1FKI A;  3PR9 A;  2DSU A;  2M2A A;  3KAC A;  5HWB A;  2LPV A;  1B6C A;  1ZL1 A;  1QPF A;  3WQW A;  1LG2 A;  4DRI A;  2XP6 A;  1VF8 A;  3EY6 A;  4MAV A;  3B8S A;  2XP5 A;  3G6L A;  3O5K A;  5BXJ A;  4TX0 A;  3WKZ A;  5HUA A;  1ZBC A;  2VN1 A;  4MSP A;  4DZ2 A;  5DIV A;  5HW6 A;  1A7X A;  1NMW A;  4MNL A;  4WK9 A;  1FFR A;  3AQU A;  4TW7 A;  4IT4 A;  1T11 A;  4J4O A;  3O5R A;  2DSV A;  3KAH A;  2PPP A;  2OFN A;  4LAX A;  3UI6 A;  1EDQ A;  2IF4 A;  4TW8 A;  3AS1 A;  3WD0 A;  2DG3 A;  1J6Y A;  2A3A A;  1FKF A;  2YBU A;  3ARX A;  4ODM A;  2RUC A;  2L2S A;  4TNS A;  4LGX A;  5DO2 A;  4U86 A;  1GPF A;  3WL0 A;  2ESC A;  3ALF A;  3ARW A;  1D7J A;  3TDB A;  2KR7 A;  3TC5 A;  1QZ2 A;  5HTG A;  3JXV A;  1HKJ A;  1N1A A;  4ODP A;  4MGV A;  3UI5 A;  1LQ0 A;  3WD2 A;  2PPN A;  5HT1 A;  1W1Y A;  4QZV B;  1NWT A;  1J4H A;  2N87 A;  4WIW A;  3ARP A;  4KR0 B;  3CZ8 A;  4JFL A;  2DSZ A;  2B31 A;  3PA7 A;  3JYM A;  1SYT A;  1ROT A;  4U84 A;  2DG9 A;  3O5J A;  4MNM A;  4DRN A;  1JVW A;  1Q1C A;  1QPL A;  1EHN A;  1O6I A;  4ZPW R;  2MLY A;  2KFW A;  4P8V A;  4ODL A;  2PV2 A;  1FKS A;  1WAW A;  1FKR A;  4FN2 A;  2ZR4 A;  3CH9 A;  1Y0O A;  1KFW A;  3IKG A;  1UR8 A;  2MF9 A;  4QT2 A;  2O9O A;  2PI6 A;  5DEZ A;  2WLZ A;  1NWR A;  4ML4 A;  1LJY A;  1JNT A;  2DT2 A;  4HBE A;  1XHG A;  2WLY A;  2MLZ A;  4IQC A;  1W9P A;  4DIP A;  4L72 B;  2LGO A;  1OWQ A;  1U79 A;  1NH6 A;  1E6P A;  2F4E A;  4P8U A;  3O5D A;  4DRM A;  4N19 A;  3W4R A;  1FKG A;  1JNE A;  2VCD A;  2G41 A;  1E6N A;  2XP3 A;  2O92 A;  1D7H A;  4DWS A;  3FY1 A;  1FKK A;  4TW6 A;  1HJV A;  1PBK A;  1J4I A;  1R9H A;  3O5G A;  1Q6H A;  1ZB5 A;  5HW7 A;  4P8X A;  3IK8 A;  4R0X A;  4MNJ A;  2KI3 A;  3UI4 A;  2RUD A;  1JND A;  3ARQ A;  4R5E A;  1NSG A;  2AWG A;  3ARY A;  2XP9 A;  1ZCN A;  4GIV A;  4NZC A;  1K9T A;  4U85 A;  4ODR A;  4DT4 A;  4Z2G A;  4Z2I A;  4L3N A;  2PPO A;  1YAT A;  1KT1 A;  4WKA A;  1C9H A;  3IHZ A;  2DG4 A;  3GPK A;  3PRD A;  3RM9 A;  3TCZ A;  4Q7N A;  2XPA A;  1XRV A;  3RFW A;  1D6O A;  2ZQT A;  5D75 A;  2IUZ A;  2ZR5 A;  1W9U A;  2XP4 A;  4W9Q A;  2KO7 A;  2DSW A;  1H0I A;  3FXY A;  5DIT A;  3G6M A;  3WL1 A;  1ITX A;  4JFJ A;  1JNS A;  1FKB A;  1E6R A;  4S3K A;  4W9P A;  2A3B A;  1W9V A;  1WB0 A;  1X6L A;  4DRP A;  1Q6U A;  4ZPV R;  3MDY B;  4URI A;  3B9E A;  4ODK A;  3VAW A;  2ZQU A;  3NTP A;  2XP7 A;  3O5L A;  2JZV A;  2YBT A;  1W1P A;  5GPG A;  1FKL A;  4LAW A;  4Z2K A;  4DRJ A;  1KT0 A;  2QF8 A;  4DWS D;  3UQA A;  3KZ7 A;  1F40 A;  3CGN A;  2DPE A;  3CGM A;  3ARU A;  4NNR A;  4ODQ A;  2OLH A;  1CTN A;  4JFM A;  1HKM A;  4O2T A;  3UQI A;  4ODN A;  4BF8 A;  3RM8 A;  1TFV A;  1BL4 A;  4LAV A;  4IT6 A;  1YW5 A;  3I6C A;  1FAP A;  4WJX A;  1FD9 A;  1M5Y A;  3IKD A;  3ART A;  1D2K A;  4ODO A;  1J4R A;  1E6Z A;  3CHD A;  5HW8 A;  3KAD A;  4QIB A;  1HXV A;  1E9L A;  1HJW A;  1LG1 A;  3B9A A;  4DWS B;  2RQS A;  2Y78 A;  3RGC A;  1ZBV A;  1PIN A;  3UF8 A;  4NSB A;  3RM4 A;  2A3E A;  3ALG A;  1WNO A;  3WIJ A;  1LL4 A;  4MTV A;  2Q5A A;  4J4N A;  2KE0 A;  1F8A B;  1FKJ A;  4S3J A;  4ZS6 A;  5GQB A;  3ARS A;  4JYS A;  1FKD A;  2XP8 A;  4Z2L A;  5JH8 A;  4DRO A;  3RME A;  5HKG A;  5I98 A;  1LL6 A;  3ARO A;  4FAP A;  2PV1 A;  4WKH A;  1EIB A;  2ITK A;  4PTM A;  3WD3 A;  2A3C A;  1IX5 A;  1ZK6 A;  1FJD A;  2LKN A;  4DWS C;  3AS0 A;  3WD1 A;  3LUO A;  4LAY A;  1ZU8 A;  2RUQ A;  3OA5 A;  2LJ4 A;  1L1P A;  1ROU A;  4TYO A;  3O5Q A;  1H0G A;  4HBO A;  3UQB A;  1OGG A;  4DRK A;  3KCE A;  4G50 A;  3NI6 A;  1E15 A;  5GPR A;  3O5O A;  3O5I A;  1EQ3 A;  1X6N A;  1EYM A;  4DH0 A;  4GGQ A;  4Q22 A;  1FKT A;  1W26 A;  2WK2 A;  2DT0 A;  2FAP A;  2M08 A;  1HJX A;  5HWC A;  1OGB A;  1GUV A;  2PV3 A;  4JFK A;  5DF0 A;  5J6E A;  2ZQS A;  1BKF A;  2MPH A;  2ZQV A;  2D9F A;  3WQV A;  2XPB A;  3ODK A;  2F21 A;  3PRB A;  1FKH A;  3O5E A;  4MPK A;  3B9D A;  1LL7 A;  1RD6 A;  4DRQ A;  1NWU A;  2RSE A;  4JFI A;  2WM0 A;  2G8Z A;  1SR0 A;  1FFQ A;  3WD4 A;  3ARV A;  3KAI A;  4WKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...