5GPGA

Co-crystal structure of the fk506 binding domain of human fkbp25, rapamycin and the frb domain of human mtor
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
110
Chain Sequence
b'SPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP3
molecule tags Isomerase/transferase
source organism Homo sapiens
publication title Proximity-Directed Labeling Reveals a New Rapamycin-Induced Heterodimer of FKBP25 and FRB in Live Cells
pubmed doi rcsb
total genus 25
structure length 110
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5gpgA00
2IF4A 4DIPA 2JZVA 4O2TA 1F40A 4W9PA 2MNTA 2ZR5A 4QT2A 5HUAA 1QPFA 4ITZA 5HW6A 3GPKA 5HWCA 1JNSA 2VN1A 5I98A 5DITA 3KAHA 1TCOC 2MPHA 3PRBA 1FKHA 1PINA 2DG9A 2FKEA 1Q6UA 2D9FA 4J4OA 4JYSA 4ODNA 2PBCA 4TW7A 3UI4A 2PV3A 2KR7A 1FAPA 1FKSA 5B8IC 2ZQTA 2RUCA 1M5YA 2RUQA 2F2DA 2XP9A 1Q6HA 2LKNA 1ZK6A 2FAPA 4FAPA 4TNSA 4DRJA 1F8AB 2KE0A 4IQCA 1KT1A 4DT4A 3O5FA 5DIVA 2DG4A 4ODMA 1HXVA 4MSPA 2KFWA 3VAWA 3UQIA 2ZQSA 3TC5A 1NMWA 1B6CA 3OOBA 2PPNA 2Y78A 3KAIA 3KCEA 2ZR6A 3KZ7A 3IKGA 4IQ2A 4ODQA 3O5EA 5D75A 4DZ3A 3KADA 1FKTA 4BF8A 1ROTA 1PBKA 2M1IA 1P5QA 3O5MA 3UQAA 3NRKA 2LJ4A 4NNRA 3LUOA 5HW8A 3UQBA 1BKFA 1FKFA 3O5JA 4N19A 4W9OA 4DRKA 4DRPA 1NMVA 2XP3A 1ROUA 2KGJA 3PA7A 3B7XA 2N87A 3JYJA 4J4NA 4ODLA 3I6CA 2KO7A 3RGCA 5BXJA 1JVWA 4LAVA 2ZR4A 4QIBA 4ODKA 5HW7A 3MDYB 5HKGA 3CGMA 2RQSA 4DRHA 2PV2A 2XP6A 4G2PA 2ZQUA 3O5LA 1EQ3A 1C9HA 1FKGA 1KT0A 2RUDA 2MF9A 4W9QA 1FKBA 4LAXA 4C02B 2XP5A 3IK8A 2K8IA 2XP8A 3IHZA 2Q5AA 2M2AA 3NTPA 4G50A 3O5PA 2VCDA 1FKKA 2ZQVA 1J4IA 3JXVA 3O5IA 5HTGA 4U84A 3KABA 3O5OA 5HT1A 1J4RA 4DRNA 2XP7A 3EY6A 2XPAA 1QZ2A 1Q1CA 3O5GA 1J4HA 4JFLA 4GIVA 4ODOA 1EYMA 1Y0OA 2LGOA 3WH0A 2MLYA 3CGNA 1NSGA 2F4EA 3RFWA 1D6OA 3ODKA 3PRDA 2PV1A 1FKJA 4TW6A 4JFMA 5GPGA 3KAGA 2PPOA 2XP4A 3TDBA 1N1AA 4GGQA 4TW8A 1YATA 1A7XA 2LPVA 2UZ5A 3UF8A 2PPPA 4LAYA 1T11A 3JYMA 1FKIA 2OFNA 1FJDA 2XPBA 4R0XA 1D7JA 4DROA 5J6EA 4DRIA 1U79A 3O5RA 3FAPA 5HWBA 5DIUA 4U86A 1J6YA 4LAWA 4U85A 1FKRA 2AWGA 4MGVA 4QT3A 4ODPA 4DH0A 1YW5A 1FKLA 1QPLA 2ITKA 3IKDA 4ODRA 2MLXA 1D7IA 3NI6A 3O5KA 2DG3A 3O5QA 3UI6A 4TX0A 4DRMA 3KAFA 4JFJA 4DRQA 3O5DA 1FD9A 3KACA 1R9HA 2MLZA 1FKDA 2RURA 3UI5A 1BL4A 1W26A 4TYOA 3TCZA 1L1PA 2F21A 2KI3A 2L2SA 3H9RB 2M08A 1ZCNA 4JFIA 1Q6IA 4DZ2A 1D7HA 2RSEA 4FN2A 4JFKA 1JNTA 4IPXA
chains in the Genus database with same CATH superfamily
1TFVA 3RMEA 1GOIA 1HJXA 5HW6A 5DITA 2PI6A 1FKHA 1PINA 2DG9A 4J4OA 4IT4A 4ODNA 4WIWA 3G6MA 1VF8A 1IX5A 1ITXA 1EDQA 1Q6HA 4L3NA 1H0IA 4ZPWR 4FAPA 1F8AB 4IQCA 1E9LA 1E15A 4PTMA 3ALGA 1HJVA 1KFWA 3G6LA 3CHDA 4HBEA 2Y78A 1HJWA 4IQ2A 4P8WA 1FKTA 4BF8A 1ROTA 3UQAA 1P5QA 4NNRA 1EIBA 3AS0A 4WJXA 2XP3A 2N87A 2KO7A 5BXJA 2EULA 3RM9A 4LAVA 4QIBA 3WD4A 2RQSA 1W9VA 3B9DA 5DF0A 1C9HA 1FKGA 1E44A 2RUDA 1W1PA 4MNLA 4Z2IA 4LAXA 3IK8A 3IHZA 3NTPA 2M2AA 3JXVA 3O5IA 1J4IA 3KABA 4WKHA 1E6PA 1OGBA 3EY6A 4P8XA 2XPAA 1Q1CA 4ODOA 1EYMA 1WB0A 2QF8A 1NSGA 1SR0A 1FKJA 4JFMA 2B31A 2LPVA 1ZB5A 2XPBA 2YBTA 4DROA 1K9TA 5J6EA 3CHEA 1FFRA 1W9UA 3ARTA 4U86A 1LJYA 4LAWA 4QT3A 4WKAA 3WD3A 3WD1A 4ODRA 1D7IA 3O5QA 3UI6A 2A3CA 4DRMA 3KAFA 3AQUA 4JFJA 4DRQA 1FFQA 1FD9A 2RURA 3UI5A 4TYOA 3H9RB 1ZBCA 3FY1A 1ZCNA 2G41A 3ARRA 2JZVA 4O2TA 1WNOA 2DSWA 2YBUA 5HUAA 3GPKA 3ARZA 2P4VA 1OWQA 2D9FA 4TW7A 2PBCA 3UI4A 1FKSA 3WD0A 2DSUA 4DRJA 2KE0A 4DT4A 2DSZA 3O5FA 2DPEA 4ODMA 3ARXA 2KFWA 3UQIA 2ZQSA 1NMWA 1B6CA 4DWSA 3KAIA 4WK9A 4DZ3A 1F40A 2LJ4A 4KR0B 3WL1A 1OGGA 4S3KA 4W5UA 4L72B 4DRPA 1NMVA 2WK2A 1ROUA 2KGJA 3W4RA 4MNJA 4J4NA 4ODLA 1EHNA 2ZR4A 4ODKA 5HW7A 3MDYB 3PR9A 1HKMA 3CGMA 2PV2A 2XP6A 2ZQUA 3O5LA 2A3BA 1EQ3A 1KT0A 5JH8A 1FKBA 4C02B 3WQVA 3ARPA 4G50A 4U84A 1XRVA 3FXYA 1J4RA 2XP7A 1J4HA 4JFLA 3WH0A 3WKZA 1D6OA 3PRDA 1E6RA 4TW6A 1JCHB 1LL4A 3ARWA 3KAGA 4GGQA 1YATA 1GRJA 1GUVA 2ESCA 4NSBA 2FDMA 1D7JA 1W9PA 5DIUA 1J6YA 1NWRA 2AWGA 4MGVA 4ODPA 4QZVB 4Z2HA 4R5EA 4DWSD 3O5DA 5GPRA 1LG1A 1BL4A 2OLHA 3EIPA 2M08A 1Q6IA 4FN2A 1LL7A 4IPXA 2IF4A 4WKFA 1HKIA 1E6NA 4W9PA 2MNTA 1WAWA 2O92A 1QPFA 4ITZA 1JNSA 2VN1A 4ZS6A 2DT0A 2ETNA 4DWSB 4JYSA 2PV3A 2KR7A 5B8IC 1UR8A 2ZQTA 5HBFA 2RUCA 1M5YA 2RUQA 4ML4A 3WQWA 2F2DA 2LKNA 1ZK6A 1UR9A 1RD6A 2PN0A 1KT1A 5DIVA 2DG4A 2WLYA 1HXVA 3RM4A 4AY1A 3TC5A 2G8ZA 3WL0A 3GTYX 2PPNA 2ZR6A 2WM0A 3KZ7A 5DEZA 5D75A 4ODQA 3KADA 1D2KA 1E6ZA 2M1IA 4LGXA 2A3EA 5HW8A 1FKFA 4DRKA 1ZBVA 3B7XA 3I6CA 3PRAA 2B5UB 1JVWA 1LL6A 1H0GA 3ARVA 5HKGA 1W1YA 1X6LA 4DRHA 2MF9A 4W9QA 3ARYA 4Q7NA 2K8IA 2XP8A 4Z2JA 1JNEA 4Z2GA 5HTGA 3AS1A 3UQBA 1QZ2A 1NWSA 4IT6A 3CGNA 2F4EA 4P8VA 3ODKA 2PV1A 3B9EA 5GPGA 2PPOA 1N1AA 4MNMA 4TW8A 1A7XA 4LAYA 2F23A 3QOKA 3WD2A 1ZL1A 1FKRA 4URIA 1YW5A 1QPLA 2ITKA 2DT2A 2MLXA 3O5KA 2DG3A 4TX0A 4MTVA 1NH6A 3KACA 4S3JA 2MLZA 1FKDA 2DT3A 4Z2LA 1L1PA 1W26A 1XHGA 2F21A 4JFIA 2RSEA 4JFKA 1JNTA 4DIPA 4Q22A 2DSVA 2ZR5A 4QT2A 1GPFA 5HWCA 1LG2A 3KAHA 1TCOC 4P8UA 2MPHA 3PRBA 4HARA 5GQBA 3CZ8A 1JNDA 1NWUA 2A3AA 2FKEA 1Q6UA 1FAPA 4KQZA 1LQ0A 2DT1A 3AS2A 4HBOA 4Z2KA 2XP9A 1X6NA 4MNKA 1W1TA 2FAPA 4TNSA 5DO2A 2WLZA 4MAVA 4MSPA 1O6IA 3VAWA 3OOBA 3KCEA 3IKGA 3O5EA 5HWBA 1PBKA 3O5MA 4ZPVR 1CTNA 3NRKA 3LUOA 1BKFA 3O5JA 4N19A 4W9OA 4NZCA 3PA7A 3AROA 3JYJA 3RGCA 4MPKA 3CH9A 3BXWA 1ZBKA 4G2PA 1ZBWA 2XP5A 2Q5AA 3O5PA 2VCDA 1FKKA 2ZQVA 3AS3A 3ARQA 3O5OA 5HT1A 1HKKA 4DRNA 3O5GA 4GIVA 1Y0OA 2LGOA 4XAKA 2MLYA 3CHFA 3RFWA 1SYTA 2XP4A 3TDBA 2UZ5A 3UF8A 2PPPA 1T11A 3GU0A 3JYMA 1FKIA 2OFNA 1FJDA 4R0XA 4DRIA 1U79A 3O5RA 4DWSC 3FAPA 1ZU8A 3OA5A 4U85A 4ZPTR 4DH0A 1FKLA 3ARSA 4UDMA 3IKDA 3NI6A 2AOSA 2IUZA 1R9HA 3B8SA 3BMBA 3CHCA 3TCZA 2O9OA 3RM8A 1NWTA 2KI3A 2L2SA 3WIJA 1W1VA 3ALFA 4DZ2A 1D7HA 3B9AA 3ARUA 1HKJA 5I98A
chains in the Genus database with same CATH topology
1TFVA 3RMEA 1GOIA 1HJXA 5HW6A 5DITA 2PI6A 1FKHA 1PINA 2DG9A 4J4OA 4IT4A 4ODNA 4WIWA 3G6MA 1VF8A 1IX5A 1ITXA 1EDQA 1Q6HA 4L3NA 1H0IA 4ZPWR 4FAPA 1F8AB 4IQCA 1E9LA 1E15A 4PTMA 3ALGA 1HJVA 1KFWA 3G6LA 3CHDA 4HBEA 2Y78A 1HJWA 4IQ2A 4P8WA 1FKTA 4BF8A 1ROTA 3UQAA 1P5QA 4NNRA 1EIBA 3AS0A 4WJXA 2XP3A 2N87A 2KO7A 5BXJA 3RM9A 4LAVA 4QIBA 3WD4A 2RQSA 1W9VA 3B9DA 5DF0A 1C9HA 1FKGA 2RUDA 1W1PA 4MNLA 4Z2IA 4LAXA 3IK8A 3IHZA 3NTPA 2M2AA 3JXVA 3O5IA 1J4IA 3KABA 4WKHA 1E6PA 1OGBA 3EY6A 4P8XA 2XPAA 1Q1CA 4ODOA 1EYMA 1WB0A 2QF8A 1NSGA 1SR0A 1FKJA 4JFMA 2B31A 2LPVA 1ZB5A 2XPBA 2YBTA 4DROA 1K9TA 5J6EA 3CHEA 1FFRA 1W9UA 3ARTA 4U86A 1LJYA 4LAWA 4QT3A 4WKAA 3WD3A 3WD1A 4ODRA 1D7IA 3O5QA 3UI6A 2A3CA 4DRMA 3KAFA 3AQUA 4JFJA 4DRQA 1FFQA 1FD9A 2RURA 3UI5A 4TYOA 1ZBCA 3FY1A 3H9RB 1ZCNA 2G41A 3ARRA 2JZVA 4O2TA 1WNOA 2DSWA 2YBUA 5HUAA 3GPKA 3ARZA 1OWQA 2D9FA 4TW7A 2PBCA 3UI4A 1FKSA 3WD0A 2DSUA 4DRJA 2KE0A 4DT4A 2DSZA 3O5FA 2DPEA 4ODMA 3ARXA 2KFWA 3UQIA 2ZQSA 1NMWA 1B6CA 4DWSA 3KAIA 4WK9A 4DZ3A 1F40A 2LJ4A 4KR0B 3WL1A 1OGGA 4S3KA 4W5UA 4L72B 4DRPA 1NMVA 2WK2A 1ROUA 2KGJA 3W4RA 4MNJA 4J4NA 4ODLA 1EHNA 2ZR4A 4ODKA 5HW7A 3MDYB 3PR9A 1HKMA 3CGMA 2PV2A 2XP6A 2ZQUA 3O5LA 2A3BA 1EQ3A 1KT0A 5JH8A 1FKBA 4C02B 3WQVA 3ARPA 4G50A 4U84A 1XRVA 3FXYA 1J4RA 2XP7A 1J4HA 4JFLA 3WH0A 3WKZA 1D6OA 3PRDA 1E6RA 4TW6A 3ARWA 1LL4A 3KAGA 4GGQA 1YATA 1GUVA 2ESCA 4NSBA 2FDMA 1D7JA 1W9PA 5DIUA 1J6YA 1NWRA 2AWGA 4MGVA 4ODPA 4QZVB 4Z2HA 4R5EA 4DWSD 3O5DA 5GPRA 1LG1A 1BL4A 2OLHA 2M08A 1Q6IA 4FN2A 1LL7A 4IPXA 2IF4A 4WKFA 1HKIA 1E6NA 4W9PA 2MNTA 1WAWA 2O92A 1QPFA 4ITZA 1JNSA 2VN1A 4ZS6A 2DT0A 4DWSB 4JYSA 2PV3A 2KR7A 5B8IC 1UR8A 2ZQTA 5HBFA 2RUCA 1M5YA 2RUQA 4ML4A 3WQWA 2F2DA 2LKNA 1ZK6A 1UR9A 1RD6A 1KT1A 5DIVA 2DG4A 2WLYA 1HXVA 3RM4A 4AY1A 3TC5A 2G8ZA 3WL0A 2PPNA 2ZR6A 2WM0A 3KZ7A 5DEZA 5D75A 4ODQA 3KADA 1D2KA 1E6ZA 2M1IA 4LGXA 2A3EA 5HW8A 1FKFA 4DRKA 1ZBVA 3B7XA 3I6CA 3PRAA 1JVWA 1LL6A 1H0GA 3ARVA 5HKGA 1W1YA 1X6LA 4DRHA 2MF9A 4W9QA 3ARYA 4Q7NA 2K8IA 2XP8A 4Z2JA 1JNEA 4Z2GA 5HTGA 3AS1A 3UQBA 1QZ2A 1NWSA 4IT6A 3CGNA 2F4EA 4P8VA 3ODKA 2PV1A 3B9EA 5GPGA 2PPOA 1N1AA 4MNMA 4TW8A 1A7XA 4LAYA 3QOKA 3WD2A 1ZL1A 1FKRA 4URIA 1YW5A 1QPLA 2ITKA 2DT2A 2MLXA 3O5KA 2DG3A 4TX0A 4MTVA 1NH6A 3KACA 4S3JA 2MLZA 1FKDA 2DT3A 4Z2LA 1L1PA 1W26A 1XHGA 2F21A 4JFIA 2RSEA 4JFKA 1JNTA 4DIPA 4Q22A 2DSVA 2ZR5A 4QT2A 1GPFA 5HWCA 1LG2A 3KAHA 1TCOC 4P8UA 2MPHA 3PRBA 4HARA 5GQBA 3CZ8A 1JNDA 1NWUA 2A3AA 2FKEA 1Q6UA 1FAPA 4KQZA 1LQ0A 2DT1A 3AS2A 4HBOA 4Z2KA 2XP9A 1X6NA 4MNKA 1W1TA 2FAPA 4TNSA 5DO2A 2WLZA 4MAVA 4MSPA 1O6IA 3VAWA 3OOBA 3KCEA 3IKGA 3O5EA 5HWBA 1PBKA 3O5MA 4ZPVR 1CTNA 3NRKA 3LUOA 1BKFA 3O5JA 4N19A 4W9OA 4NZCA 3PA7A 3AROA 3JYJA 3RGCA 4MPKA 3CH9A 3BXWA 1ZBKA 4G2PA 1ZBWA 2XP5A 2Q5AA 3O5PA 2VCDA 1FKKA 2ZQVA 3AS3A 3ARQA 3O5OA 5HT1A 1HKKA 4DRNA 3O5GA 4GIVA 1Y0OA 2LGOA 4XAKA 2MLYA 3CHFA 3RFWA 1SYTA 2XP4A 3TDBA 2UZ5A 3UF8A 2PPPA 1T11A 3JYMA 1FKIA 2OFNA 1FJDA 4R0XA 4DRIA 1U79A 3O5RA 4DWSC 3FAPA 1ZU8A 3OA5A 4U85A 4ZPTR 4DH0A 1FKLA 3ARSA 3IKDA 3NI6A 2AOSA 2IUZA 1R9HA 3B8SA 3CHCA 3TCZA 2O9OA 3RM8A 1NWTA 2KI3A 2L2SA 3WIJA 1W1VA 3ALFA 4DZ2A 1D7HA 3B9AA 3ARUA 1HKJA 5I98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IF4 A;  4DIP A;  2JZV A;  4O2T A;  1F40 A;  4W9P A;  2MNT A;  2ZR5 A;  4QT2 A;  5HUA A;  1QPF A;  4ITZ A;  5HW6 A;  3GPK A;  5HWC A;  1JNS A;  2VN1 A;  5I98 A;  5DIT A;  3KAH A;  1TCO C;  2MPH A;  3PRB A;  1FKH A;  1PIN A;  2DG9 A;  2FKE A;  1Q6U A;  2D9F A;  4J4O A;  4JYS A;  4ODN A;  2PBC A;  4TW7 A;  3UI4 A;  2PV3 A;  2KR7 A;  1FAP A;  1FKS A;  5B8I C;  2ZQT A;  2RUC A;  1M5Y A;  2RUQ A;  2F2D A;  2XP9 A;  1Q6H A;  2LKN A;  1ZK6 A;  2FAP A;  4FAP A;  4TNS A;  4DRJ A;  1F8A B;  2KE0 A;  4IQC A;  1KT1 A;  4DT4 A;  3O5F A;  5DIV A;  2DG4 A;  4ODM A;  1HXV A;  4MSP A;  2KFW A;  3VAW A;  3UQI A;  2ZQS A;  3TC5 A;  1NMW A;  1B6C A;  3OOB A;  2PPN A;  2Y78 A;  3KAI A;  3KCE A;  2ZR6 A;  3KZ7 A;  3IKG A;  4IQ2 A;  4ODQ A;  3O5E A;  5D75 A;  4DZ3 A;  3KAD A;  1FKT A;  4BF8 A;  1ROT A;  1PBK A;  2M1I A;  1P5Q A;  3O5M A;  3UQA A;  3NRK A;  2LJ4 A;  4NNR A;  3LUO A;  5HW8 A;  3UQB A;  1BKF A;  1FKF A;  3O5J A;  4N19 A;  4W9O A;  4DRK A;  4DRP A;  1NMV A;  2XP3 A;  1ROU A;  2KGJ A;  3PA7 A;  3B7X A;  2N87 A;  3JYJ A;  4J4N A;  4ODL A;  3I6C A;  2KO7 A;  3RGC A;  5BXJ A;  1JVW A;  4LAV A;  2ZR4 A;  4QIB A;  4ODK A;  5HW7 A;  3MDY B;  5HKG A;  3CGM A;  2RQS A;  4DRH A;  2PV2 A;  2XP6 A;  4G2P A;  2ZQU A;  3O5L A;  1EQ3 A;  1C9H A;  1FKG A;  1KT0 A;  2RUD A;  2MF9 A;  4W9Q A;  1FKB A;  4LAX A;  4C02 B;  2XP5 A;  3IK8 A;  2K8I A;  2XP8 A;  3IHZ A;  2Q5A A;  2M2A A;  3NTP A;  4G50 A;  3O5P A;  2VCD A;  1FKK A;  2ZQV A;  1J4I A;  3JXV A;  3O5I A;  5HTG A;  4U84 A;  3KAB A;  3O5O A;  5HT1 A;  1J4R A;  4DRN A;  2XP7 A;  3EY6 A;  2XPA A;  1QZ2 A;  1Q1C A;  3O5G A;  1J4H A;  4JFL A;  4GIV A;  4ODO A;  1EYM A;  1Y0O A;  2LGO A;  3WH0 A;  2MLY A;  3CGN A;  1NSG A;  2F4E A;  3RFW A;  1D6O A;  3ODK A;  3PRD A;  2PV1 A;  1FKJ A;  4TW6 A;  4JFM A;  5GPG A;  3KAG A;  2PPO A;  2XP4 A;  3TDB A;  1N1A A;  4GGQ A;  4TW8 A;  1YAT A;  1A7X A;  2LPV A;  2UZ5 A;  3UF8 A;  2PPP A;  4LAY A;  1T11 A;  3JYM A;  1FKI A;  2OFN A;  1FJD A;  2XPB A;  4R0X A;  1D7J A;  4DRO A;  5J6E A;  4DRI A;  1U79 A;  3O5R A;  3FAP A;  5HWB A;  5DIU A;  4U86 A;  1J6Y A;  4LAW A;  4U85 A;  1FKR A;  2AWG A;  4MGV A;  4QT3 A;  4ODP A;  4DH0 A;  1YW5 A;  1FKL A;  1QPL A;  2ITK A;  3IKD A;  4ODR A;  2MLX A;  1D7I A;  3NI6 A;  3O5K A;  2DG3 A;  3O5Q A;  3UI6 A;  4TX0 A;  4DRM A;  3KAF A;  4JFJ A;  4DRQ A;  3O5D A;  1FD9 A;  3KAC A;  1R9H A;  2MLZ A;  1FKD A;  2RUR A;  3UI5 A;  1BL4 A;  1W26 A;  4TYO A;  3TCZ A;  1L1P A;  2F21 A;  2KI3 A;  2L2S A;  3H9R B;  2M08 A;  1ZCN A;  4JFI A;  1Q6I A;  4DZ2 A;  1D7H A;  2RSE A;  4FN2 A;  4JFK A;  1JNT A;  4IPX A; 
#chains in the Genus database with same CATH topology
 1TFV A;  3RME A;  1GOI A;  1HJX A;  5HW6 A;  5DIT A;  2PI6 A;  1FKH A;  1PIN A;  2DG9 A;  4J4O A;  4IT4 A;  4ODN A;  4WIW A;  3G6M A;  1VF8 A;  1IX5 A;  1ITX A;  1EDQ A;  1Q6H A;  4L3N A;  1H0I A;  4ZPW R;  4FAP A;  1F8A B;  4IQC A;  1E9L A;  1E15 A;  4PTM A;  3ALG A;  1HJV A;  1KFW A;  3G6L A;  3CHD A;  4HBE A;  2Y78 A;  1HJW A;  4IQ2 A;  4P8W A;  1FKT A;  4BF8 A;  1ROT A;  3UQA A;  1P5Q A;  4NNR A;  1EIB A;  3AS0 A;  4WJX A;  2XP3 A;  2N87 A;  2KO7 A;  5BXJ A;  2EUL A;  3RM9 A;  4LAV A;  4QIB A;  3WD4 A;  2RQS A;  1W9V A;  3B9D A;  5DF0 A;  1C9H A;  1FKG A;  1E44 A;  2RUD A;  1W1P A;  4MNL A;  4Z2I A;  4LAX A;  3IK8 A;  3IHZ A;  3NTP A;  2M2A A;  3JXV A;  3O5I A;  1J4I A;  3KAB A;  4WKH A;  1E6P A;  1OGB A;  3EY6 A;  4P8X A;  2XPA A;  1Q1C A;  4ODO A;  1EYM A;  1WB0 A;  2QF8 A;  1NSG A;  1SR0 A;  1FKJ A;  4JFM A;  2B31 A;  2LPV A;  1ZB5 A;  2XPB A;  2YBT A;  4DRO A;  1K9T A;  5J6E A;  3CHE A;  1FFR A;  1W9U A;  3ART A;  4U86 A;  1LJY A;  4LAW A;  4QT3 A;  4WKA A;  3WD3 A;  3WD1 A;  4ODR A;  1D7I A;  3O5Q A;  3UI6 A;  2A3C A;  4DRM A;  3KAF A;  3AQU A;  4JFJ A;  4DRQ A;  1FFQ A;  1FD9 A;  2RUR A;  3UI5 A;  4TYO A;  3H9R B;  1ZBC A;  3FY1 A;  1ZCN A;  2G41 A;  3ARR A;  2JZV A;  4O2T A;  1WNO A;  2DSW A;  2YBU A;  5HUA A;  3GPK A;  3ARZ A;  2P4V A;  1OWQ A;  2D9F A;  4TW7 A;  2PBC A;  3UI4 A;  1FKS A;  3WD0 A;  2DSU A;  4DRJ A;  2KE0 A;  4DT4 A;  2DSZ A;  3O5F A;  2DPE A;  4ODM A;  3ARX A;  2KFW A;  3UQI A;  2ZQS A;  1NMW A;  1B6C A;  4DWS A;  3KAI A;  4WK9 A;  4DZ3 A;  1F40 A;  2LJ4 A;  4KR0 B;  3WL1 A;  1OGG A;  4S3K A;  4W5U A;  4L72 B;  4DRP A;  1NMV A;  2WK2 A;  1ROU A;  2KGJ A;  3W4R A;  4MNJ A;  4J4N A;  4ODL A;  1EHN A;  2ZR4 A;  4ODK A;  5HW7 A;  3MDY B;  3PR9 A;  1HKM A;  3CGM A;  2PV2 A;  2XP6 A;  2ZQU A;  3O5L A;  2A3B A;  1EQ3 A;  1KT0 A;  5JH8 A;  1FKB A;  4C02 B;  3WQV A;  3ARP A;  4G50 A;  4U84 A;  1XRV A;  3FXY A;  1J4R A;  2XP7 A;  1J4H A;  4JFL A;  3WH0 A;  3WKZ A;  1D6O A;  3PRD A;  1E6R A;  4TW6 A;  1JCH B;  1LL4 A;  3ARW A;  3KAG A;  4GGQ A;  1YAT A;  1GRJ A;  1GUV A;  2ESC A;  4NSB A;  2FDM A;  1D7J A;  1W9P A;  5DIU A;  1J6Y A;  1NWR A;  2AWG A;  4MGV A;  4ODP A;  4QZV B;  4Z2H A;  4R5E A;  4DWS D;  3O5D A;  5GPR A;  1LG1 A;  1BL4 A;  2OLH A;  3EIP A;  2M08 A;  1Q6I A;  4FN2 A;  1LL7 A;  4IPX A;  2IF4 A;  4WKF A;  1HKI A;  1E6N A;  4W9P A;  2MNT A;  1WAW A;  2O92 A;  1QPF A;  4ITZ A;  1JNS A;  2VN1 A;  4ZS6 A;  2DT0 A;  2ETN A;  4DWS B;  4JYS A;  2PV3 A;  2KR7 A;  5B8I C;  1UR8 A;  2ZQT A;  5HBF A;  2RUC A;  1M5Y A;  2RUQ A;  4ML4 A;  3WQW A;  2F2D A;  2LKN A;  1ZK6 A;  1UR9 A;  1RD6 A;  2PN0 A;  1KT1 A;  5DIV A;  2DG4 A;  2WLY A;  1HXV A;  3RM4 A;  4AY1 A;  3TC5 A;  2G8Z A;  3WL0 A;  3GTY X;  2PPN A;  2ZR6 A;  2WM0 A;  3KZ7 A;  5DEZ A;  5D75 A;  4ODQ A;  3KAD A;  1D2K A;  1E6Z A;  2M1I A;  4LGX A;  2A3E A;  5HW8 A;  1FKF A;  4DRK A;  1ZBV A;  3B7X A;  3I6C A;  3PRA A;  2B5U B;  1JVW A;  1LL6 A;  1H0G A;  3ARV A;  5HKG A;  1W1Y A;  1X6L A;  4DRH A;  2MF9 A;  4W9Q A;  3ARY A;  4Q7N A;  2K8I A;  2XP8 A;  4Z2J A;  1JNE A;  4Z2G A;  5HTG A;  3AS1 A;  3UQB A;  1QZ2 A;  1NWS A;  4IT6 A;  3CGN A;  2F4E A;  4P8V A;  3ODK A;  2PV1 A;  3B9E A;  5GPG A;  2PPO A;  1N1A A;  4MNM A;  4TW8 A;  1A7X A;  4LAY A;  2F23 A;  3QOK A;  3WD2 A;  1ZL1 A;  1FKR A;  4URI A;  1YW5 A;  1QPL A;  2ITK A;  2DT2 A;  2MLX A;  3O5K A;  2DG3 A;  4TX0 A;  4MTV A;  1NH6 A;  3KAC A;  4S3J A;  2MLZ A;  1FKD A;  2DT3 A;  4Z2L A;  1L1P A;  1W26 A;  1XHG A;  2F21 A;  4JFI A;  2RSE A;  4JFK A;  1JNT A;  4DIP A;  4Q22 A;  2DSV A;  2ZR5 A;  4QT2 A;  1GPF A;  5HWC A;  1LG2 A;  3KAH A;  1TCO C;  4P8U A;  2MPH A;  3PRB A;  4HAR A;  5GQB A;  3CZ8 A;  1JND A;  1NWU A;  2A3A A;  2FKE A;  1Q6U A;  1FAP A;  4KQZ A;  1LQ0 A;  2DT1 A;  3AS2 A;  4HBO A;  4Z2K A;  2XP9 A;  1X6N A;  4MNK A;  1W1T A;  2FAP A;  4TNS A;  5DO2 A;  2WLZ A;  4MAV A;  4MSP A;  1O6I A;  3VAW A;  3OOB A;  3KCE A;  3IKG A;  3O5E A;  5HWB A;  1PBK A;  3O5M A;  4ZPV R;  1CTN A;  3NRK A;  3LUO A;  1BKF A;  3O5J A;  4N19 A;  4W9O A;  4NZC A;  3PA7 A;  3ARO A;  3JYJ A;  3RGC A;  4MPK A;  3CH9 A;  3BXW A;  1ZBK A;  4G2P A;  1ZBW A;  2XP5 A;  2Q5A A;  3O5P A;  2VCD A;  1FKK A;  2ZQV A;  3AS3 A;  3ARQ A;  3O5O A;  5HT1 A;  1HKK A;  4DRN A;  3O5G A;  4GIV A;  1Y0O A;  2LGO A;  4XAK A;  2MLY A;  3CHF A;  3RFW A;  1SYT A;  2XP4 A;  3TDB A;  2UZ5 A;  3UF8 A;  2PPP A;  1T11 A;  3GU0 A;  3JYM A;  1FKI A;  2OFN A;  1FJD A;  4R0X A;  4DRI A;  1U79 A;  3O5R A;  4DWS C;  3FAP A;  1ZU8 A;  3OA5 A;  4U85 A;  4ZPT R;  4DH0 A;  1FKL A;  3ARS A;  4UDM A;  3IKD A;  3NI6 A;  2AOS A;  2IUZ A;  1R9H A;  3B8S A;  3BMB A;  3CHC A;  3TCZ A;  2O9O A;  3RM8 A;  1NWT A;  2KI3 A;  2L2S A;  3WIJ A;  1W1V A;  3ALF A;  4DZ2 A;  1D7H A;  3B9A A;  3ARU A;  1HKJ A;  5I98 A; 
#chains in the Genus database with same CATH homology
 1TFV A;  3RME A;  1GOI A;  1HJX A;  5HW6 A;  5DIT A;  2PI6 A;  1FKH A;  1PIN A;  2DG9 A;  4J4O A;  4IT4 A;  4ODN A;  4WIW A;  3G6M A;  1VF8 A;  1IX5 A;  1ITX A;  1EDQ A;  1Q6H A;  4L3N A;  1H0I A;  4ZPW R;  4FAP A;  1F8A B;  4IQC A;  1E9L A;  1E15 A;  4PTM A;  3ALG A;  1HJV A;  1KFW A;  3G6L A;  3CHD A;  4HBE A;  2Y78 A;  1HJW A;  4IQ2 A;  4P8W A;  1FKT A;  4BF8 A;  1ROT A;  3UQA A;  1P5Q A;  4NNR A;  1EIB A;  3AS0 A;  4WJX A;  2XP3 A;  2N87 A;  2KO7 A;  5BXJ A;  3RM9 A;  4LAV A;  4QIB A;  3WD4 A;  2RQS A;  1W9V A;  3B9D A;  5DF0 A;  1C9H A;  1FKG A;  2RUD A;  1W1P A;  4MNL A;  4Z2I A;  4LAX A;  3IK8 A;  3IHZ A;  3NTP A;  2M2A A;  3JXV A;  3O5I A;  1J4I A;  3KAB A;  4WKH A;  1E6P A;  1OGB A;  3EY6 A;  4P8X A;  2XPA A;  1Q1C A;  4ODO A;  1EYM A;  1WB0 A;  2QF8 A;  1NSG A;  1SR0 A;  1FKJ A;  4JFM A;  2B31 A;  2LPV A;  1ZB5 A;  2XPB A;  2YBT A;  4DRO A;  1K9T A;  5J6E A;  3CHE A;  1FFR A;  1W9U A;  3ART A;  4U86 A;  1LJY A;  4LAW A;  4QT3 A;  4WKA A;  3WD3 A;  3WD1 A;  4ODR A;  1D7I A;  3O5Q A;  3UI6 A;  2A3C A;  4DRM A;  3KAF A;  3AQU A;  4JFJ A;  4DRQ A;  1FFQ A;  1FD9 A;  2RUR A;  3UI5 A;  4TYO A;  1ZBC A;  3FY1 A;  3H9R B;  1ZCN A;  2G41 A;  3ARR A;  2JZV A;  4O2T A;  1WNO A;  2DSW A;  2YBU A;  5HUA A;  3GPK A;  3ARZ A;  1OWQ A;  2D9F A;  4TW7 A;  2PBC A;  3UI4 A;  1FKS A;  3WD0 A;  2DSU A;  4DRJ A;  2KE0 A;  4DT4 A;  2DSZ A;  3O5F A;  2DPE A;  4ODM A;  3ARX A;  2KFW A;  3UQI A;  2ZQS A;  1NMW A;  1B6C A;  4DWS A;  3KAI A;  4WK9 A;  4DZ3 A;  1F40 A;  2LJ4 A;  4KR0 B;  3WL1 A;  1OGG A;  4S3K A;  4W5U A;  4L72 B;  4DRP A;  1NMV A;  2WK2 A;  1ROU A;  2KGJ A;  3W4R A;  4MNJ A;  4J4N A;  4ODL A;  1EHN A;  2ZR4 A;  4ODK A;  5HW7 A;  3MDY B;  3PR9 A;  1HKM A;  3CGM A;  2PV2 A;  2XP6 A;  2ZQU A;  3O5L A;  2A3B A;  1EQ3 A;  1KT0 A;  5JH8 A;  1FKB A;  4C02 B;  3WQV A;  3ARP A;  4G50 A;  4U84 A;  1XRV A;  3FXY A;  1J4R A;  2XP7 A;  1J4H A;  4JFL A;  3WH0 A;  3WKZ A;  1D6O A;  3PRD A;  1E6R A;  4TW6 A;  3ARW A;  1LL4 A;  3KAG A;  4GGQ A;  1YAT A;  1GUV A;  2ESC A;  4NSB A;  2FDM A;  1D7J A;  1W9P A;  5DIU A;  1J6Y A;  1NWR A;  2AWG A;  4MGV A;  4ODP A;  4QZV B;  4Z2H A;  4R5E A;  4DWS D;  3O5D A;  5GPR A;  1LG1 A;  1BL4 A;  2OLH A;  2M08 A;  1Q6I A;  4FN2 A;  1LL7 A;  4IPX A;  2IF4 A;  4WKF A;  1HKI A;  1E6N A;  4W9P A;  2MNT A;  1WAW A;  2O92 A;  1QPF A;  4ITZ A;  1JNS A;  2VN1 A;  4ZS6 A;  2DT0 A;  4DWS B;  4JYS A;  2PV3 A;  2KR7 A;  5B8I C;  1UR8 A;  2ZQT A;  5HBF A;  2RUC A;  1M5Y A;  2RUQ A;  4ML4 A;  3WQW A;  2F2D A;  2LKN A;  1ZK6 A;  1UR9 A;  1RD6 A;  1KT1 A;  5DIV A;  2DG4 A;  2WLY A;  1HXV A;  3RM4 A;  4AY1 A;  3TC5 A;  2G8Z A;  3WL0 A;  2PPN A;  2ZR6 A;  2WM0 A;  3KZ7 A;  5DEZ A;  5D75 A;  4ODQ A;  3KAD A;  1D2K A;  1E6Z A;  2M1I A;  4LGX A;  2A3E A;  5HW8 A;  1FKF A;  4DRK A;  1ZBV A;  3B7X A;  3I6C A;  3PRA A;  1JVW A;  1LL6 A;  1H0G A;  3ARV A;  5HKG A;  1W1Y A;  1X6L A;  4DRH A;  2MF9 A;  4W9Q A;  3ARY A;  4Q7N A;  2K8I A;  2XP8 A;  4Z2J A;  1JNE A;  4Z2G A;  5HTG A;  3AS1 A;  3UQB A;  1QZ2 A;  1NWS A;  4IT6 A;  3CGN A;  2F4E A;  4P8V A;  3ODK A;  2PV1 A;  3B9E A;  5GPG A;  2PPO A;  1N1A A;  4MNM A;  4TW8 A;  1A7X A;  4LAY A;  3QOK A;  3WD2 A;  1ZL1 A;  1FKR A;  4URI A;  1YW5 A;  1QPL A;  2ITK A;  2DT2 A;  2MLX A;  3O5K A;  2DG3 A;  4TX0 A;  4MTV A;  1NH6 A;  3KAC A;  4S3J A;  2MLZ A;  1FKD A;  2DT3 A;  4Z2L A;  1L1P A;  1W26 A;  1XHG A;  2F21 A;  4JFI A;  2RSE A;  4JFK A;  1JNT A;  4DIP A;  4Q22 A;  2DSV A;  2ZR5 A;  4QT2 A;  1GPF A;  5HWC A;  1LG2 A;  3KAH A;  1TCO C;  4P8U A;  2MPH A;  3PRB A;  4HAR A;  5GQB A;  3CZ8 A;  1JND A;  1NWU A;  2A3A A;  2FKE A;  1Q6U A;  1FAP A;  4KQZ A;  1LQ0 A;  2DT1 A;  3AS2 A;  4HBO A;  4Z2K A;  2XP9 A;  1X6N A;  4MNK A;  1W1T A;  2FAP A;  4TNS A;  5DO2 A;  2WLZ A;  4MAV A;  4MSP A;  1O6I A;  3VAW A;  3OOB A;  3KCE A;  3IKG A;  3O5E A;  5HWB A;  1PBK A;  3O5M A;  4ZPV R;  1CTN A;  3NRK A;  3LUO A;  1BKF A;  3O5J A;  4N19 A;  4W9O A;  4NZC A;  3PA7 A;  3ARO A;  3JYJ A;  3RGC A;  4MPK A;  3CH9 A;  3BXW A;  1ZBK A;  4G2P A;  1ZBW A;  2XP5 A;  2Q5A A;  3O5P A;  2VCD A;  1FKK A;  2ZQV A;  3AS3 A;  3ARQ A;  3O5O A;  5HT1 A;  1HKK A;  4DRN A;  3O5G A;  4GIV A;  1Y0O A;  2LGO A;  4XAK A;  2MLY A;  3CHF A;  3RFW A;  1SYT A;  2XP4 A;  3TDB A;  2UZ5 A;  3UF8 A;  2PPP A;  1T11 A;  3JYM A;  1FKI A;  2OFN A;  1FJD A;  4R0X A;  4DRI A;  1U79 A;  3O5R A;  4DWS C;  3FAP A;  1ZU8 A;  3OA5 A;  4U85 A;  4ZPT R;  4DH0 A;  1FKL A;  3ARS A;  3IKD A;  3NI6 A;  2AOS A;  2IUZ A;  1R9H A;  3B8S A;  3CHC A;  3TCZ A;  2O9O A;  3RM8 A;  1NWT A;  2KI3 A;  2L2S A;  3WIJ A;  1W1V A;  3ALF A;  4DZ2 A;  1D7H A;  3B9A A;  3ARU A;  1HKJ A;  5I98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...