5GPGA

Co-crystal structure of the fk506 binding domain of human fkbp25, rapamycin and the frb domain of human mtor
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
110
Chain Sequence
SPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP3
publication title Proximity-Directed Labeling Reveals a New Rapamycin-Induced Heterodimer of FKBP25 and FRB in Live Cells
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/transferase
total genus 25
structure length 110
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5gpgA00
2K8IA 3IKGA 2M08A 4DIPA 2PPNA 2Y78A 1EYMA 4DROA 3O5IA 4O2TA 3WH0A 4ODRA 2XP9A 2LGOA 3KCEA 4ITZA 3O5DA 1KT1A 1JVWA 2KI3A 3RFWA 4FAPA 5B8IC 5HWCA 2ZQVA 4U84A 2XP7A 3NI6A 4MSPA 4ODMA 1FKHA 2MLXA 2RUDA 3UQIA 3NRKA 3O5FA 1C9HA 1BKFA 1HXVA 4IPXA 2ITKA 1J6YA 3JXVA 5I98A 2JZVA 1FKDA 1FKSA 2L2SA 2N87A 4JFJA 5HW8A 1QZ2A 3H9RB 2F21A 5HKGA 2MLZA 1Q6HA 2RQSA 3JYJA 4ODPA 2MNTA 3UI6A 1Y0OA 2AWGA 2UZ5A 2IF4A 3GPKA 4DRQA 1KT0A 4ODLA 2F2DA 2KGJA 4MGVA 2LPVA 2ZQSA 3B7XA 4G2PA 3IK8A 1YATA 3RGCA 4TW8A 4JFKA 1P5QA 2XPBA 1TCOC 3UF8A 4IQ2A 3KAFA 4C02B 1B6CA 2MLYA 3ODKA 3IHZA 2RSEA 1FKJA 4JFMA 4QT2A 5GPGA 1ZCNA 5J6EA 1NMVA 1NMWA 4JFIA 3JYMA 4R0XA 2M1IA 2VCDA 3TDBA 2PPPA 3OOBA 1PINA 1FKRA 1D7HA 2ZQTA 4DRJA 2XP5A 3CGNA 3O5LA 4J4OA 4DRMA 4JFLA 2MPHA 3FAPA 2DG3A 1ROUA 1N1AA 2PBCA 4ODNA 4QT3A 2LJ4A 4ODOA 3NTPA 3UI5A 4DZ3A 3O5JA 2MF9A 2PV2A 5HTGA 5HUAA 1ZK6A 4LAVA 2XP3A 3KAHA 4ODQA 2OFNA 4TW6A 4N19A 3IKDA 1PBKA 1EQ3A 4DH0A 2PPOA 4DRIA 1D7JA 1F8AB 2D9FA 5BXJA 4W9PA 1T11A 2FKEA 2XP6A 2DG9A 3O5GA 4U85A 4DT4A 2Q5AA 1R9HA 3TC5A 4DRHA 1FJDA 3KAIA 2DG4A 4IQCA 3MDYB 1Q6UA 3PA7A 3O5RA 2ZR4A 4LAWA 4DRPA 4TW7A 5HWBA 1F40A 4DRNA 1FKIA 4JYSA 1L1PA 4TYOA 2LKNA 2ZR6A 1YW5A 3KZ7A 3UI4A 2M2AA 2XP8A 1NSGA 1D7IA 3CGMA 3O5MA 4G50A 4J4NA 4ODKA 2KO7A 2KFWA 4TX0A 2PV3A 3PRDA 3O5OA 1FKTA 1ROTA 1FKGA 4BF8A 2RUQA 3O5PA 4LAYA 3I6CA 3PRBA 4TNSA 1FAPA 3EY6A 3O5QA 5D75A 4DZ2A 3UQAA 1J4RA 1Q1CA 5HT1A 4FN2A 3KABA 5DITA 4DRKA 1J4IA 4LAXA 1FKKA 3TCZA 2XPAA 1M5YA 2RUCA 1FKBA 2PV1A 5HW6A 2ZR5A 3VAWA 1Q6IA 5HW7A 1J4HA 4GIVA 5DIUA 4GGQA 1JNSA 2ZQUA 3KACA 2KR7A 4NNRA 4U86A 1A7XA 3KADA 5DIVA 1U79A 2RURA 1FD9A 1W26A 2KE0A 3LUOA 1QPFA 4W9OA 2F4EA 2FAPA 1BL4A 1QPLA 3O5KA 4QIBA 1JNTA 4W9QA 1FKFA 1FKLA 3UQBA 1D6OA 2XP4A 2VN1A 3O5EA 3KAGA
chains in the Genus database with same CATH superfamily
1E6PA 3ARVA 4PTMA 4L3NA 2XP9A 3ARQA 1E9LA 4ITZA 2O92A 1JVWA 2G8ZA 3RFWA 3WKZA 4U84A 2MLXA 4Z2HA 3NRKA 3O5FA 4P8XA 2ITKA 1WNOA 3JXVA 4DWSA 1W9VA 2N87A 1X6LA 1W1PA 2F21A 3ARXA 1ZBVA 1Y0OA 3EIPA 4DRQA 2IF4A 3ARZA 1KT0A 4NZCA 1W1TA 4URIA 3IK8A 3RGCA 4JFKA 1HJVA 4ZS6A 4IQ2A 3KAFA 5GPGA 1FKJA 3FXYA 4MNKA 1GUVA 4WKFA 2XP5A 4J4OA 2WLZA 3FAPA 4ODOA 3NTPA 2PV2A 5HTGA 3WD2A 1ZK6A 2OFNA 4DH0A 5BXJA 2D9FA 1T11A 3ARWA 3B9AA 3ARYA 3FY1A 1Q6UA 2IUZA 1F40A 4TW7A 2B5UB 4DWSB 1FKIA 4JYSA 1YW5A 1IX5A 3G6MA 1D7IA 4MPKA 2KFWA 4TX0A 3PRDA 1VF8A 4ZPWR 2A3AA 3AS0A 4NSBA 2RUQA 3O5QA 2B31A 4FN2A 5DITA 1E6NA 1J4IA 1FKKA 5DO2A 1M5YA 2RUCA 1FKBA 2PV1A 5HW6A 1Q6IA 4GIVA 1A7XA 3KADA 5DIVA 3WD1A 1RD6A 2YBTA 4UDMA 3LUOA 1BL4A 4QIBA 1JNTA 3ARTA 1FKFA 3UQBA 4J4NA 2FDMA 1ZBKA 3KAGA 1UR8A 2K8IA 2M08A 1EYMA 4DROA 4O2TA 3WQVA 3O5DA 3G6LA 2ZQVA 1E15A 1XRVA 4MSPA 2RUDA 3B9DA 1KFWA 1ZL1A 4Z2LA 2O9OA 4Q7NA 1J6YA 5I98A 1FKDA 1EIBA 1W1YA 1QZ2A 1W9PA 4L72B 3ARRA 5HKGA 3JYJA 2AWGA 4ODLA 1EDQA 2F2DA 3GU0A 3B7XA 4KQZA 4S3KA 1E44A 3RM9A 3B9EA 1TCOC 1H0GA 1B6CA 1NMWA 4R0XA 1UR9A 3ARSA 3CGNA 3O5LA 1TFVA 4P8WA 2MPHA 4ODNA 2DG3A 1ROUA 1N1AA 2WK2A 1E6ZA 4QT3A 2LJ4A 4HARA 3UI5A 4LAVA 4TW6A 4N19A 1EQ3A 3CHEA 3RM8A 3WD0A 3ARUA 2FKEA 1WAWA 2DG9A 3W4RA 3TC5A 5HWBA 1EHNA 4LAWA 3O5RA 3AROA 4DRNA 3AS3A 2LKNA 3KZ7A 3UI4A 2M2AA 1NSGA 3CGMA 4G50A 2A3BA 2PI6A 2KO7A 1LG1A 4QZVB 4WKAA 3QOKA 4BF8A 1LJYA 4LAYA 3O5PA 1FAPA 3WL0A 1Q1CA 5HT1A 1ZBCA 3KABA 3WD3A 2DT0A 3TCZA 3ALFA 4LGXA 4WKHA 3WIJA 2WM0A 2ZQUA 3KACA 2KR7A 1OGGA 1GOIA 1NWTA 1GRJA 2F23A 2RURA 2KE0A 1QPFA 4W9OA 1QPLA 1FKLA 2VN1A 3IKGA 2Y78A 1SR0A 3O5IA 2A3CA 3CHDA 4ODRA 2LGOA 2A3EA 3KCEA 4FAPA 5B8IC 4Z2KA 2XP7A 3UQIA 1BKFA 3CHFA 1NWUA 1O6IA 2YBUA 4JFJA 5HW8A 3H9RB 1JCHB 1FFRA 1Q6HA 2RQSA 2MNTA 3WD4A 2UZ5A 3GPKA 2DSUA 4IT4A 4MGVA 2LPVA 2ZQSA 3ALGA 1JNDA 4TW8A 4KR0B 1NH6A 4C02B 2MLYA 4AY1A 3IHZA 2RSEA 4QT2A 1WB0A 4R5EA 4WIWA 2M1IA 2VCDA 2PPPA 2ZQTA 4DRMA 4JFLA 1LL4A 1W1VA 1HKMA 2DT2A 3O5JA 5HUAA 2XP3A 3KAHA 4HBEA 4DRIA 1F8AB 4XAKA 2DT3A 5DF0A 1OWQA 2XP6A 3BMBA 4U85A 4DT4A 1NWSA 4DRHA 1FFQA 3KAIA 2DG4A 3B8SA 3PA7A 5GPRA 4DRPA 1L1PA 2XP8A 4ODKA 1LL6A 3AS2A 1ROTA 1ZB5A 3UQAA 3RM4A 3EY6A 1HKIA 3WQWA 1J4RA 5JH8A 4DRKA 4LAXA 1LL7A 2XPAA 3ARPA 3CZ8A 2AOSA 3VAWA 5GQBA 1JNSA 5HBFA 4MNLA 4U86A 1U79A 1FD9A 4S3JA 2F4EA 2FAPA 4ZPTR 1ZBWA 4W9QA 2XP4A 3O5EA 4DWSC 4Z2IA 4DIPA 1HJWA 3GTYX 2DT1A 2PPNA 4IT6A 1HJXA 3WH0A 1CTNA 1HKJA 2ESCA 4P8VA 4ML4A 1KT1A 2KI3A 5HWCA 3BXWA 3NI6A 4ODMA 1FKHA 4HBOA 4W5UA 1C9HA 1HXVA 4IPXA 2JZVA 1FKSA 2L2SA 2MLZA 2G41A 4ODPA 3UI6A 1LQ0A 2WLYA 4WJXA 2KGJA 4DWSD 4G2PA 1YATA 1GPFA 2ETNA 1P5QA 2XPBA 3CHCA 3UF8A 1JNEA 1ITXA 3WL1A 1ZU8A 2P4VA 3OA5A 3ODKA 4JFMA 1ZCNA 5J6EA 1NMVA 4P8UA 4JFIA 3JYMA 3TDBA 3OOBA 2EULA 1PINA 1FKRA 1D7HA 4DRJA 1K9TA 2PBCA 2OLHA 1NWRA 2PN0A 4DZ3A 2MF9A 4MAVA 2DPEA 1HKKA 4ODQA 2DSZA 3RMEA 3IKDA 1PBKA 2PPOA 1D7JA 4W9PA 3O5GA 2Q5AA 1R9HA 1FJDA 4IQCA 4MNMA 3MDYB 4MNJA 2ZR4A 3CH9A 3AS1A 2ZR6A 4TYOA 4Z2GA 2DSWA 3AQUA 3O5MA 4MTVA 4Z2JA 4ZPVR 1LG2A 2PV3A 3O5OA 1E6RA 1FKTA 2QF8A 1FKGA 4DZ2A 1SYTA 3I6CA 3PRBA 4TNSA 5D75A 4Q22A 1W9UA 2ZR5A 3PRAA 5HW7A 1J4HA 5DIUA 4GGQA 1X6NA 4NNRA 1D2KA 1XHGA 5DEZA 1H0IA 1W26A 3O5KA 1OGBA 4WK9A 2DSVA 1D6OA 3PR9A
chains in the Genus database with same CATH topology
1E6PA 3ARVA 4PTMA 4L3NA 2XP9A 3ARQA 1E9LA 4ITZA 2O92A 1JVWA 2G8ZA 3RFWA 3WKZA 4U84A 2MLXA 4Z2HA 3NRKA 3O5FA 4P8XA 2ITKA 1WNOA 3JXVA 4DWSA 1W9VA 2N87A 1X6LA 1W1PA 2F21A 3ARXA 1ZBVA 1Y0OA 4DRQA 2IF4A 3ARZA 1KT0A 4NZCA 1W1TA 4URIA 3IK8A 3RGCA 4JFKA 1HJVA 4ZS6A 4IQ2A 3KAFA 5GPGA 1FKJA 3FXYA 4MNKA 1GUVA 4WKFA 2XP5A 4J4OA 2WLZA 3FAPA 4ODOA 3NTPA 2PV2A 5HTGA 3WD2A 1ZK6A 2OFNA 4DH0A 5BXJA 2D9FA 1T11A 3ARWA 3B9AA 3ARYA 3FY1A 1Q6UA 2IUZA 1F40A 4TW7A 4DWSB 1FKIA 4JYSA 1YW5A 1IX5A 3G6MA 1D7IA 4MPKA 2KFWA 4TX0A 3PRDA 1VF8A 4ZPWR 2A3AA 3AS0A 4NSBA 2RUQA 3O5QA 2B31A 4FN2A 5DITA 1E6NA 1J4IA 1FKKA 5DO2A 1M5YA 2RUCA 1FKBA 2PV1A 5HW6A 1Q6IA 4GIVA 1A7XA 3KADA 5DIVA 3WD1A 1RD6A 2YBTA 3LUOA 1BL4A 4QIBA 1JNTA 3ARTA 1FKFA 3UQBA 4J4NA 2FDMA 1ZBKA 3KAGA 1UR8A 2K8IA 2M08A 1EYMA 4DROA 4O2TA 3WQVA 3O5DA 3G6LA 2ZQVA 1E15A 1XRVA 4MSPA 2RUDA 3B9DA 1KFWA 1ZL1A 4Z2LA 2O9OA 4Q7NA 1J6YA 5I98A 1FKDA 1EIBA 1W1YA 1QZ2A 1W9PA 4L72B 3ARRA 5HKGA 3JYJA 2AWGA 4ODLA 1EDQA 2F2DA 3B7XA 4KQZA 4S3KA 3RM9A 3B9EA 1TCOC 1H0GA 1B6CA 1NMWA 4R0XA 1UR9A 3ARSA 3CGNA 3O5LA 1TFVA 4P8WA 2MPHA 4ODNA 2DG3A 1ROUA 1N1AA 2WK2A 1E6ZA 4QT3A 2LJ4A 4HARA 3UI5A 4LAVA 4TW6A 4N19A 1EQ3A 3CHEA 3RM8A 3WD0A 3ARUA 2FKEA 1WAWA 2DG9A 3W4RA 3TC5A 5HWBA 1EHNA 4LAWA 3O5RA 3AROA 4DRNA 3AS3A 2LKNA 3KZ7A 3UI4A 2M2AA 1NSGA 3CGMA 4G50A 2A3BA 2PI6A 2KO7A 1LG1A 4QZVB 4WKAA 3QOKA 4BF8A 1LJYA 4LAYA 3O5PA 1FAPA 3WL0A 1Q1CA 5HT1A 1ZBCA 3KABA 3WD3A 2DT0A 3TCZA 3ALFA 4LGXA 4WKHA 3WIJA 2WM0A 2ZQUA 3KACA 2KR7A 1OGGA 1GOIA 1NWTA 2RURA 2KE0A 1QPFA 4W9OA 1QPLA 1FKLA 2VN1A 3IKGA 2Y78A 1SR0A 3O5IA 2A3CA 3CHDA 4ODRA 2LGOA 2A3EA 3KCEA 4FAPA 5B8IC 4Z2KA 2XP7A 3UQIA 1BKFA 3CHFA 1NWUA 1O6IA 2YBUA 4JFJA 5HW8A 3H9RB 1FFRA 1Q6HA 2RQSA 2MNTA 3WD4A 2UZ5A 3GPKA 2DSUA 4IT4A 4MGVA 2LPVA 2ZQSA 3ALGA 1JNDA 4TW8A 4KR0B 1NH6A 4C02B 2MLYA 4AY1A 3IHZA 2RSEA 4QT2A 1WB0A 4R5EA 4WIWA 2M1IA 2VCDA 2PPPA 2ZQTA 4DRMA 4JFLA 1LL4A 1W1VA 1HKMA 2DT2A 3O5JA 5HUAA 2XP3A 3KAHA 4HBEA 4DRIA 1F8AB 4XAKA 2DT3A 5DF0A 1OWQA 2XP6A 4DT4A 4U85A 1NWSA 4DRHA 1FFQA 3KAIA 2DG4A 3B8SA 3PA7A 5GPRA 4DRPA 1L1PA 2XP8A 4ODKA 1LL6A 3AS2A 1ROTA 1ZB5A 3UQAA 3RM4A 3EY6A 1HKIA 3WQWA 1J4RA 5JH8A 4DRKA 4LAXA 1LL7A 2XPAA 3ARPA 3CZ8A 2AOSA 3VAWA 5GQBA 1JNSA 5HBFA 4MNLA 4U86A 1U79A 1FD9A 4S3JA 2F4EA 2FAPA 4ZPTR 1ZBWA 4W9QA 2XP4A 3O5EA 4DWSC 4Z2IA 4DIPA 1HJWA 2DT1A 2PPNA 4IT6A 1HJXA 3WH0A 1CTNA 1HKJA 2ESCA 4P8VA 4ML4A 1KT1A 2KI3A 5HWCA 3BXWA 3NI6A 4ODMA 1FKHA 4HBOA 4W5UA 1C9HA 1HXVA 4IPXA 2JZVA 1FKSA 2L2SA 2MLZA 2G41A 4ODPA 3UI6A 1LQ0A 2WLYA 4WJXA 2KGJA 4DWSD 4G2PA 1YATA 1GPFA 1P5QA 2XPBA 3CHCA 3UF8A 1JNEA 1ITXA 3WL1A 1ZU8A 3OA5A 3ODKA 4JFMA 1ZCNA 5J6EA 1NMVA 4P8UA 4JFIA 3JYMA 3TDBA 3OOBA 1PINA 1FKRA 1D7HA 4DRJA 1K9TA 2PBCA 2OLHA 1NWRA 4DZ3A 2MF9A 4MAVA 2DPEA 1HKKA 4ODQA 2DSZA 3RMEA 3IKDA 1PBKA 2PPOA 1D7JA 4W9PA 3O5GA 2Q5AA 1R9HA 1FJDA 4IQCA 4MNMA 3MDYB 4MNJA 2ZR4A 3CH9A 3AS1A 2ZR6A 4TYOA 4Z2GA 2DSWA 3AQUA 3O5MA 4MTVA 4Z2JA 4ZPVR 1LG2A 2PV3A 3O5OA 1E6RA 1FKTA 2QF8A 1FKGA 4DZ2A 1SYTA 3I6CA 3PRBA 4TNSA 5D75A 4Q22A 1W9UA 2ZR5A 3PRAA 5HW7A 1J4HA 5DIUA 4GGQA 1X6NA 4NNRA 1D2KA 1XHGA 5DEZA 1H0IA 1W26A 3O5KA 1OGBA 4WK9A 2DSVA 1D6OA 3PR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K8I A;  3IKG A;  2M08 A;  4DIP A;  2PPN A;  2Y78 A;  1EYM A;  4DRO A;  3O5I A;  4O2T A;  3WH0 A;  4ODR A;  2XP9 A;  2LGO A;  3KCE A;  4ITZ A;  3O5D A;  1KT1 A;  1JVW A;  2KI3 A;  3RFW A;  4FAP A;  5B8I C;  5HWC A;  2ZQV A;  4U84 A;  2XP7 A;  3NI6 A;  4MSP A;  4ODM A;  1FKH A;  2MLX A;  2RUD A;  3UQI A;  3NRK A;  3O5F A;  1C9H A;  1BKF A;  1HXV A;  4IPX A;  2ITK A;  1J6Y A;  3JXV A;  5I98 A;  2JZV A;  1FKD A;  1FKS A;  2L2S A;  2N87 A;  4JFJ A;  5HW8 A;  1QZ2 A;  3H9R B;  2F21 A;  5HKG A;  2MLZ A;  1Q6H A;  2RQS A;  3JYJ A;  4ODP A;  2MNT A;  3UI6 A;  1Y0O A;  2AWG A;  2UZ5 A;  2IF4 A;  3GPK A;  4DRQ A;  1KT0 A;  4ODL A;  2F2D A;  2KGJ A;  4MGV A;  2LPV A;  2ZQS A;  3B7X A;  4G2P A;  3IK8 A;  1YAT A;  3RGC A;  4TW8 A;  4JFK A;  1P5Q A;  2XPB A;  1TCO C;  3UF8 A;  4IQ2 A;  3KAF A;  4C02 B;  1B6C A;  2MLY A;  3ODK A;  3IHZ A;  2RSE A;  1FKJ A;  4JFM A;  4QT2 A;  5GPG A;  1ZCN A;  5J6E A;  1NMV A;  1NMW A;  4JFI A;  3JYM A;  4R0X A;  2M1I A;  2VCD A;  3TDB A;  2PPP A;  3OOB A;  1PIN A;  1FKR A;  1D7H A;  2ZQT A;  4DRJ A;  2XP5 A;  3CGN A;  3O5L A;  4J4O A;  4DRM A;  4JFL A;  2MPH A;  3FAP A;  2DG3 A;  1ROU A;  1N1A A;  2PBC A;  4ODN A;  4QT3 A;  2LJ4 A;  4ODO A;  3NTP A;  3UI5 A;  4DZ3 A;  3O5J A;  2MF9 A;  2PV2 A;  5HTG A;  5HUA A;  1ZK6 A;  4LAV A;  2XP3 A;  3KAH A;  4ODQ A;  2OFN A;  4TW6 A;  4N19 A;  3IKD A;  1PBK A;  1EQ3 A;  4DH0 A;  2PPO A;  4DRI A;  1D7J A;  1F8A B;  2D9F A;  5BXJ A;  4W9P A;  1T11 A;  2FKE A;  2XP6 A;  2DG9 A;  3O5G A;  4U85 A;  4DT4 A;  2Q5A A;  1R9H A;  3TC5 A;  4DRH A;  1FJD A;  3KAI A;  2DG4 A;  4IQC A;  3MDY B;  1Q6U A;  3PA7 A;  3O5R A;  2ZR4 A;  4LAW A;  4DRP A;  4TW7 A;  5HWB A;  1F40 A;  4DRN A;  1FKI A;  4JYS A;  1L1P A;  4TYO A;  2LKN A;  2ZR6 A;  1YW5 A;  3KZ7 A;  3UI4 A;  2M2A A;  2XP8 A;  1NSG A;  1D7I A;  3CGM A;  3O5M A;  4G50 A;  4J4N A;  4ODK A;  2KO7 A;  2KFW A;  4TX0 A;  2PV3 A;  3PRD A;  3O5O A;  1FKT A;  1ROT A;  1FKG A;  4BF8 A;  2RUQ A;  3O5P A;  4LAY A;  3I6C A;  3PRB A;  4TNS A;  1FAP A;  3EY6 A;  3O5Q A;  5D75 A;  4DZ2 A;  3UQA A;  1J4R A;  1Q1C A;  5HT1 A;  4FN2 A;  3KAB A;  5DIT A;  4DRK A;  1J4I A;  4LAX A;  1FKK A;  3TCZ A;  2XPA A;  1M5Y A;  2RUC A;  1FKB A;  2PV1 A;  5HW6 A;  2ZR5 A;  3VAW A;  1Q6I A;  5HW7 A;  1J4H A;  4GIV A;  5DIU A;  4GGQ A;  1JNS A;  2ZQU A;  3KAC A;  2KR7 A;  4NNR A;  4U86 A;  1A7X A;  3KAD A;  5DIV A;  1U79 A;  2RUR A;  1FD9 A;  1W26 A;  2KE0 A;  3LUO A;  1QPF A;  4W9O A;  2F4E A;  2FAP A;  1BL4 A;  1QPL A;  3O5K A;  4QIB A;  1JNT A;  4W9Q A;  1FKF A;  1FKL A;  3UQB A;  1D6O A;  2XP4 A;  2VN1 A;  3O5E A;  3KAG A; 
#chains in the Genus database with same CATH topology
 1E6P A;  3ARV A;  4PTM A;  4L3N A;  2XP9 A;  3ARQ A;  1E9L A;  4ITZ A;  2O92 A;  1JVW A;  2G8Z A;  3RFW A;  3WKZ A;  4U84 A;  2MLX A;  4Z2H A;  3NRK A;  3O5F A;  4P8X A;  2ITK A;  1WNO A;  3JXV A;  4DWS A;  1W9V A;  2N87 A;  1X6L A;  1W1P A;  2F21 A;  3ARX A;  1ZBV A;  1Y0O A;  3EIP A;  4DRQ A;  2IF4 A;  3ARZ A;  1KT0 A;  4NZC A;  1W1T A;  4URI A;  3IK8 A;  3RGC A;  4JFK A;  1HJV A;  4ZS6 A;  4IQ2 A;  3KAF A;  5GPG A;  1FKJ A;  3FXY A;  4MNK A;  1GUV A;  4WKF A;  2XP5 A;  4J4O A;  2WLZ A;  3FAP A;  4ODO A;  3NTP A;  2PV2 A;  5HTG A;  3WD2 A;  1ZK6 A;  2OFN A;  4DH0 A;  5BXJ A;  2D9F A;  1T11 A;  3ARW A;  3B9A A;  3ARY A;  3FY1 A;  1Q6U A;  2IUZ A;  1F40 A;  4TW7 A;  2B5U B;  4DWS B;  1FKI A;  4JYS A;  1YW5 A;  1IX5 A;  3G6M A;  1D7I A;  4MPK A;  2KFW A;  4TX0 A;  3PRD A;  1VF8 A;  4ZPW R;  2A3A A;  3AS0 A;  4NSB A;  2RUQ A;  3O5Q A;  2B31 A;  4FN2 A;  5DIT A;  1E6N A;  1J4I A;  1FKK A;  5DO2 A;  1M5Y A;  2RUC A;  1FKB A;  2PV1 A;  5HW6 A;  1Q6I A;  4GIV A;  1A7X A;  3KAD A;  5DIV A;  3WD1 A;  1RD6 A;  2YBT A;  4UDM A;  3LUO A;  1BL4 A;  4QIB A;  1JNT A;  3ART A;  1FKF A;  3UQB A;  4J4N A;  2FDM A;  1ZBK A;  3KAG A;  1UR8 A;  2K8I A;  2M08 A;  1EYM A;  4DRO A;  4O2T A;  3WQV A;  3O5D A;  3G6L A;  2ZQV A;  1E15 A;  1XRV A;  4MSP A;  2RUD A;  3B9D A;  1KFW A;  1ZL1 A;  4Z2L A;  2O9O A;  4Q7N A;  1J6Y A;  5I98 A;  1FKD A;  1EIB A;  1W1Y A;  1QZ2 A;  1W9P A;  4L72 B;  3ARR A;  5HKG A;  3JYJ A;  2AWG A;  4ODL A;  1EDQ A;  2F2D A;  3GU0 A;  3B7X A;  4KQZ A;  4S3K A;  1E44 A;  3RM9 A;  3B9E A;  1TCO C;  1H0G A;  1B6C A;  1NMW A;  4R0X A;  1UR9 A;  3ARS A;  3CGN A;  3O5L A;  1TFV A;  4P8W A;  2MPH A;  4ODN A;  2DG3 A;  1ROU A;  1N1A A;  2WK2 A;  1E6Z A;  4QT3 A;  2LJ4 A;  4HAR A;  3UI5 A;  4LAV A;  4TW6 A;  4N19 A;  1EQ3 A;  3CHE A;  3RM8 A;  3WD0 A;  3ARU A;  2FKE A;  1WAW A;  2DG9 A;  3W4R A;  3TC5 A;  5HWB A;  1EHN A;  4LAW A;  3O5R A;  3ARO A;  4DRN A;  3AS3 A;  2LKN A;  3KZ7 A;  3UI4 A;  2M2A A;  1NSG A;  3CGM A;  4G50 A;  2A3B A;  2PI6 A;  2KO7 A;  1LG1 A;  4QZV B;  4WKA A;  3QOK A;  4BF8 A;  1LJY A;  4LAY A;  3O5P A;  1FAP A;  3WL0 A;  1Q1C A;  5HT1 A;  1ZBC A;  3KAB A;  3WD3 A;  2DT0 A;  3TCZ A;  3ALF A;  4LGX A;  4WKH A;  3WIJ A;  2WM0 A;  2ZQU A;  3KAC A;  2KR7 A;  1OGG A;  1GOI A;  1NWT A;  1GRJ A;  2F23 A;  2RUR A;  2KE0 A;  1QPF A;  4W9O A;  1QPL A;  1FKL A;  2VN1 A;  3IKG A;  2Y78 A;  1SR0 A;  3O5I A;  2A3C A;  3CHD A;  4ODR A;  2LGO A;  2A3E A;  3KCE A;  4FAP A;  5B8I C;  4Z2K A;  2XP7 A;  3UQI A;  1BKF A;  3CHF A;  1NWU A;  1O6I A;  2YBU A;  4JFJ A;  5HW8 A;  3H9R B;  1JCH B;  1FFR A;  1Q6H A;  2RQS A;  2MNT A;  3WD4 A;  2UZ5 A;  3GPK A;  2DSU A;  4IT4 A;  4MGV A;  2LPV A;  2ZQS A;  3ALG A;  1JND A;  4TW8 A;  4KR0 B;  1NH6 A;  4C02 B;  2MLY A;  4AY1 A;  3IHZ A;  2RSE A;  4QT2 A;  1WB0 A;  4R5E A;  4WIW A;  2M1I A;  2VCD A;  2PPP A;  2ZQT A;  4DRM A;  4JFL A;  1LL4 A;  1W1V A;  1HKM A;  2DT2 A;  3O5J A;  5HUA A;  2XP3 A;  3KAH A;  4HBE A;  4DRI A;  1F8A B;  4XAK A;  2DT3 A;  5DF0 A;  1OWQ A;  2XP6 A;  3BMB A;  4U85 A;  4DT4 A;  1NWS A;  4DRH A;  1FFQ A;  3KAI A;  2DG4 A;  3B8S A;  3PA7 A;  5GPR A;  4DRP A;  1L1P A;  2XP8 A;  4ODK A;  1LL6 A;  3AS2 A;  1ROT A;  1ZB5 A;  3UQA A;  3RM4 A;  3EY6 A;  1HKI A;  3WQW A;  1J4R A;  5JH8 A;  4DRK A;  4LAX A;  1LL7 A;  2XPA A;  3ARP A;  3CZ8 A;  2AOS A;  3VAW A;  5GQB A;  1JNS A;  5HBF A;  4MNL A;  4U86 A;  1U79 A;  1FD9 A;  4S3J A;  2F4E A;  2FAP A;  4ZPT R;  1ZBW A;  4W9Q A;  2XP4 A;  3O5E A;  4DWS C;  4Z2I A;  4DIP A;  1HJW A;  3GTY X;  2DT1 A;  2PPN A;  4IT6 A;  1HJX A;  3WH0 A;  1CTN A;  1HKJ A;  2ESC A;  4P8V A;  4ML4 A;  1KT1 A;  2KI3 A;  5HWC A;  3BXW A;  3NI6 A;  4ODM A;  1FKH A;  4HBO A;  4W5U A;  1C9H A;  1HXV A;  4IPX A;  2JZV A;  1FKS A;  2L2S A;  2MLZ A;  2G41 A;  4ODP A;  3UI6 A;  1LQ0 A;  2WLY A;  4WJX A;  2KGJ A;  4DWS D;  4G2P A;  1YAT A;  1GPF A;  2ETN A;  1P5Q A;  2XPB A;  3CHC A;  3UF8 A;  1JNE A;  1ITX A;  3WL1 A;  1ZU8 A;  2P4V A;  3OA5 A;  3ODK A;  4JFM A;  1ZCN A;  5J6E A;  1NMV A;  4P8U A;  4JFI A;  3JYM A;  3TDB A;  3OOB A;  2EUL A;  1PIN A;  1FKR A;  1D7H A;  4DRJ A;  1K9T A;  2PBC A;  2OLH A;  1NWR A;  2PN0 A;  4DZ3 A;  2MF9 A;  4MAV A;  2DPE A;  1HKK A;  4ODQ A;  2DSZ A;  3RME A;  3IKD A;  1PBK A;  2PPO A;  1D7J A;  4W9P A;  3O5G A;  2Q5A A;  1R9H A;  1FJD A;  4IQC A;  4MNM A;  3MDY B;  4MNJ A;  2ZR4 A;  3CH9 A;  3AS1 A;  2ZR6 A;  4TYO A;  4Z2G A;  2DSW A;  3AQU A;  3O5M A;  4MTV A;  4Z2J A;  4ZPV R;  1LG2 A;  2PV3 A;  3O5O A;  1E6R A;  1FKT A;  2QF8 A;  1FKG A;  4DZ2 A;  1SYT A;  3I6C A;  3PRB A;  4TNS A;  5D75 A;  4Q22 A;  1W9U A;  2ZR5 A;  3PRA A;  5HW7 A;  1J4H A;  5DIU A;  4GGQ A;  1X6N A;  4NNR A;  1D2K A;  1XHG A;  5DEZ A;  1H0I A;  1W26 A;  3O5K A;  1OGB A;  4WK9 A;  2DSV A;  1D6O A;  3PR9 A; 
#chains in the Genus database with same CATH homology
 1E6P A;  3ARV A;  4PTM A;  4L3N A;  2XP9 A;  3ARQ A;  1E9L A;  4ITZ A;  2O92 A;  1JVW A;  2G8Z A;  3RFW A;  3WKZ A;  4U84 A;  2MLX A;  4Z2H A;  3NRK A;  3O5F A;  4P8X A;  2ITK A;  1WNO A;  3JXV A;  4DWS A;  1W9V A;  2N87 A;  1X6L A;  1W1P A;  2F21 A;  3ARX A;  1ZBV A;  1Y0O A;  4DRQ A;  2IF4 A;  3ARZ A;  1KT0 A;  4NZC A;  1W1T A;  4URI A;  3IK8 A;  3RGC A;  4JFK A;  1HJV A;  4ZS6 A;  4IQ2 A;  3KAF A;  5GPG A;  1FKJ A;  3FXY A;  4MNK A;  1GUV A;  4WKF A;  2XP5 A;  4J4O A;  2WLZ A;  3FAP A;  4ODO A;  3NTP A;  2PV2 A;  5HTG A;  3WD2 A;  1ZK6 A;  2OFN A;  4DH0 A;  5BXJ A;  2D9F A;  1T11 A;  3ARW A;  3B9A A;  3ARY A;  3FY1 A;  1Q6U A;  2IUZ A;  1F40 A;  4TW7 A;  4DWS B;  1FKI A;  4JYS A;  1YW5 A;  1IX5 A;  3G6M A;  1D7I A;  4MPK A;  2KFW A;  4TX0 A;  3PRD A;  1VF8 A;  4ZPW R;  2A3A A;  3AS0 A;  4NSB A;  2RUQ A;  3O5Q A;  2B31 A;  4FN2 A;  5DIT A;  1E6N A;  1J4I A;  1FKK A;  5DO2 A;  1M5Y A;  2RUC A;  1FKB A;  2PV1 A;  5HW6 A;  1Q6I A;  4GIV A;  1A7X A;  3KAD A;  5DIV A;  3WD1 A;  1RD6 A;  2YBT A;  3LUO A;  1BL4 A;  4QIB A;  1JNT A;  3ART A;  1FKF A;  3UQB A;  4J4N A;  2FDM A;  1ZBK A;  3KAG A;  1UR8 A;  2K8I A;  2M08 A;  1EYM A;  4DRO A;  4O2T A;  3WQV A;  3O5D A;  3G6L A;  2ZQV A;  1E15 A;  1XRV A;  4MSP A;  2RUD A;  3B9D A;  1KFW A;  1ZL1 A;  4Z2L A;  2O9O A;  4Q7N A;  1J6Y A;  5I98 A;  1FKD A;  1EIB A;  1W1Y A;  1QZ2 A;  1W9P A;  4L72 B;  3ARR A;  5HKG A;  3JYJ A;  2AWG A;  4ODL A;  1EDQ A;  2F2D A;  3B7X A;  4KQZ A;  4S3K A;  3RM9 A;  3B9E A;  1TCO C;  1H0G A;  1B6C A;  1NMW A;  4R0X A;  1UR9 A;  3ARS A;  3CGN A;  3O5L A;  1TFV A;  4P8W A;  2MPH A;  4ODN A;  2DG3 A;  1ROU A;  1N1A A;  2WK2 A;  1E6Z A;  4QT3 A;  2LJ4 A;  4HAR A;  3UI5 A;  4LAV A;  4TW6 A;  4N19 A;  1EQ3 A;  3CHE A;  3RM8 A;  3WD0 A;  3ARU A;  2FKE A;  1WAW A;  2DG9 A;  3W4R A;  3TC5 A;  5HWB A;  1EHN A;  4LAW A;  3O5R A;  3ARO A;  4DRN A;  3AS3 A;  2LKN A;  3KZ7 A;  3UI4 A;  2M2A A;  1NSG A;  3CGM A;  4G50 A;  2A3B A;  2PI6 A;  2KO7 A;  1LG1 A;  4QZV B;  4WKA A;  3QOK A;  4BF8 A;  1LJY A;  4LAY A;  3O5P A;  1FAP A;  3WL0 A;  1Q1C A;  5HT1 A;  1ZBC A;  3KAB A;  3WD3 A;  2DT0 A;  3TCZ A;  3ALF A;  4LGX A;  4WKH A;  3WIJ A;  2WM0 A;  2ZQU A;  3KAC A;  2KR7 A;  1OGG A;  1GOI A;  1NWT A;  2RUR A;  2KE0 A;  1QPF A;  4W9O A;  1QPL A;  1FKL A;  2VN1 A;  3IKG A;  2Y78 A;  1SR0 A;  3O5I A;  2A3C A;  3CHD A;  4ODR A;  2LGO A;  2A3E A;  3KCE A;  4FAP A;  5B8I C;  4Z2K A;  2XP7 A;  3UQI A;  1BKF A;  3CHF A;  1NWU A;  1O6I A;  2YBU A;  4JFJ A;  5HW8 A;  3H9R B;  1FFR A;  1Q6H A;  2RQS A;  2MNT A;  3WD4 A;  2UZ5 A;  3GPK A;  2DSU A;  4IT4 A;  4MGV A;  2LPV A;  2ZQS A;  3ALG A;  1JND A;  4TW8 A;  4KR0 B;  1NH6 A;  4C02 B;  2MLY A;  4AY1 A;  3IHZ A;  2RSE A;  4QT2 A;  1WB0 A;  4R5E A;  4WIW A;  2M1I A;  2VCD A;  2PPP A;  2ZQT A;  4DRM A;  4JFL A;  1LL4 A;  1W1V A;  1HKM A;  2DT2 A;  3O5J A;  5HUA A;  2XP3 A;  3KAH A;  4HBE A;  4DRI A;  1F8A B;  4XAK A;  2DT3 A;  5DF0 A;  1OWQ A;  2XP6 A;  4DT4 A;  4U85 A;  1NWS A;  4DRH A;  1FFQ A;  3KAI A;  2DG4 A;  3B8S A;  3PA7 A;  5GPR A;  4DRP A;  1L1P A;  2XP8 A;  4ODK A;  1LL6 A;  3AS2 A;  1ROT A;  1ZB5 A;  3UQA A;  3RM4 A;  3EY6 A;  1HKI A;  3WQW A;  1J4R A;  5JH8 A;  4DRK A;  4LAX A;  1LL7 A;  2XPA A;  3ARP A;  3CZ8 A;  2AOS A;  3VAW A;  5GQB A;  1JNS A;  5HBF A;  4MNL A;  4U86 A;  1U79 A;  1FD9 A;  4S3J A;  2F4E A;  2FAP A;  4ZPT R;  1ZBW A;  4W9Q A;  2XP4 A;  3O5E A;  4DWS C;  4Z2I A;  4DIP A;  1HJW A;  2DT1 A;  2PPN A;  4IT6 A;  1HJX A;  3WH0 A;  1CTN A;  1HKJ A;  2ESC A;  4P8V A;  4ML4 A;  1KT1 A;  2KI3 A;  5HWC A;  3BXW A;  3NI6 A;  4ODM A;  1FKH A;  4HBO A;  4W5U A;  1C9H A;  1HXV A;  4IPX A;  2JZV A;  1FKS A;  2L2S A;  2MLZ A;  2G41 A;  4ODP A;  3UI6 A;  1LQ0 A;  2WLY A;  4WJX A;  2KGJ A;  4DWS D;  4G2P A;  1YAT A;  1GPF A;  1P5Q A;  2XPB A;  3CHC A;  3UF8 A;  1JNE A;  1ITX A;  3WL1 A;  1ZU8 A;  3OA5 A;  3ODK A;  4JFM A;  1ZCN A;  5J6E A;  1NMV A;  4P8U A;  4JFI A;  3JYM A;  3TDB A;  3OOB A;  1PIN A;  1FKR A;  1D7H A;  4DRJ A;  1K9T A;  2PBC A;  2OLH A;  1NWR A;  4DZ3 A;  2MF9 A;  4MAV A;  2DPE A;  1HKK A;  4ODQ A;  2DSZ A;  3RME A;  3IKD A;  1PBK A;  2PPO A;  1D7J A;  4W9P A;  3O5G A;  2Q5A A;  1R9H A;  1FJD A;  4IQC A;  4MNM A;  3MDY B;  4MNJ A;  2ZR4 A;  3CH9 A;  3AS1 A;  2ZR6 A;  4TYO A;  4Z2G A;  2DSW A;  3AQU A;  3O5M A;  4MTV A;  4Z2J A;  4ZPV R;  1LG2 A;  2PV3 A;  3O5O A;  1E6R A;  1FKT A;  2QF8 A;  1FKG A;  4DZ2 A;  1SYT A;  3I6C A;  3PRB A;  4TNS A;  5D75 A;  4Q22 A;  1W9U A;  2ZR5 A;  3PRA A;  5HW7 A;  1J4H A;  5DIU A;  4GGQ A;  1X6N A;  4NNR A;  1D2K A;  1XHG A;  5DEZ A;  1H0I A;  1W26 A;  3O5K A;  1OGB A;  4WK9 A;  2DSV A;  1D6O A;  3PR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...