5GPGA

Co-crystal structure of the fk506 binding domain of human fkbp25, rapamycin and the frb domain of human mtor
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
110
Chain Sequence
SPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Isomerase/transferase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP3
publication title Proximity-Directed Labeling Reveals a New Rapamycin-Induced Heterodimer of FKBP25 and FRB in Live Cells
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 110
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5gpgA00
2JZVA 3NTPA 2VCDA 1HXVA 1FKFA 3O5JA 5B8IC 5HUAA 1QPFA 2RQSA 5D75A 2IF4A 2Y78A 1Q6HA 2RURA 1NMWA 2F4EA 5HW7A 4ODLA 1ROUA 4G2PA 1D7HA 4DRNA 2XP5A 1N1AA 3UQIA 5DIUA 2PPOA 4C02B 1KT1A 2KO7A 1B6CA 5BXJA 1FKDA 1D7IA 1W26A 3I6CA 4TW8A 3UI4A 4IPXA 4LAXA 3TCZA 1D7JA 2MLZA 4U86A 2ZR4A 2XP4A 2ZR6A 2Q5AA 4NNRA 3KAHA 4DROA 3ODKA 4ODPA 4DIPA 1Y0OA 2ZQVA 2DG9A 2D9FA 2PPPA 3IK8A 1TCOC 4U85A 4FN2A 1PINA 3IHZA 3KADA 3LUOA 3FAPA 4JFKA 3MDYB 3RFWA 1P5QA 2OFNA 3NI6A 3UI6A 3O5DA 4DZ3A 4QIBA 2KR7A 2K8IA 2RUDA 2XP7A 4GGQA 1D6OA 2ITKA 3CGNA 2LKNA 2PV1A 5HTGA 1F8AB 1FKSA 4JFLA 1FKTA 2XPAA 5DITA 3JXVA 3KABA 3KAFA 1Q6IA 1YATA 1FD9A 2RSEA 3KACA 3KCEA 2N87A 4ODQA 5DIVA 3IKGA 3KAGA 3KZ7A 1J6YA 4LAVA 1JVWA 1U79A 2MNTA 2KE0A 2MLYA 2ZQSA 3CGMA 4JFJA 3VAWA 5J6EA 2M08A 1JNTA 2ZQUA 3O5IA 4DRHA 1FKGA 1QPLA 3JYJA 2LGOA 3NRKA 4TNSA 3H9RB 1Q1CA 4LAYA 5HT1A 4LAWA 3O5GA 2PPNA 4MGVA 4DRKA 1J4RA 4W9PA 3OOBA 1PBKA 3PA7A 2XPBA 5HW6A 3UQAA 1JNSA 3GPKA 2L2SA 4QT3A 2FAPA 3O5PA 4J4OA 2DG4A 1C9HA 1FKKA 4TW6A 3KAIA 1ZK6A 2VN1A 4DRQA 1FAPA 1FKBA 1KT0A 3PRDA 4JYSA 2XP6A 4ODNA 2LJ4A 1NMVA 4IQ2A 2KGJA 5I98A 2XP8A 4DRPA 3TC5A 4DRJA 4DRMA 1T11A 1J4IA 4ODRA 4DH0A 3RGCA 3O5OA 4DRIA 1EQ3A 2ZR5A 3O5MA 4GIVA 2PV3A 2RUCA 2ZQTA 4ODMA 4ODOA 3O5EA 4IQCA 3WH0A 4JFMA 1ROTA 2DG3A 3TDBA 4J4NA 4ODKA 1A7XA 2MPHA 4W9QA 3UQBA 4MSPA 4JFIA 3O5FA 4TW7A 1QZ2A 3JYMA 3O5RA 1FKJA 2F21A 2M1IA 3UI5A 4DT4A 4FAPA 4W9OA 1FJDA 1YW5A 2PV2A 2MLXA 1F40A 3EY6A 1BKFA 2KFWA 1EYMA 2FKEA 2UZ5A 4R0XA 5HKGA 1FKLA 1NSGA 1FKIA 4ITZA 2XP9A 4U84A 1ZCNA 3B7XA 2PBCA 3O5QA 1M5YA 2F2DA 4QT2A 4DZ2A 5HW8A 1R9HA 1L1PA 1FKHA 4TX0A 2XP3A 3UF8A 4TYOA 5GPGA 1BL4A 5HWBA 1J4HA 2M2AA 1Q6UA 4N19A 2KI3A 2LPVA 2AWGA 3O5LA 4BF8A 5HWCA 3PRBA 4O2TA 4G50A 3O5KA 1FKRA 2MF9A 2RUQA 3IKDA
chains in the Genus database with same CATH superfamily
3ARZA 1FKFA 1O6IA 2OLHA 1JNEA 4P8UA 1GUVA 4P8VA 1NMWA 5HW7A 4DRNA 1W1PA 1KT1A 4P8XA 1B6CA 3WD3A 1HKMA 1D7JA 4U86A 4DIPA 1TCOC 4U85A 4FN2A 1ZL1A 3KADA 4JFKA 4DZ3A 2XP7A 1E6PA 4GGQA 1D6OA 3GU0A 2LKNA 3CHCA 4JFLA 4Z2LA 5DITA 1FKTA 2XPAA 2DT0A 1OGGA 3KCEA 1FD9A 3ARWA 1UR9A 3AS2A 3KZ7A 2MLYA 4JFJA 5J6EA 4DRHA 3AS0A 3NRKA 4Z2KA 3WD2A 3H9RB 3PR9A 4MNLA 4Z2HA 3OOBA 1E6ZA 3UQAA 5GQBA 3GPKA 5GPRA 5DEZA 1CTNA 4ODNA 1KT0A 2XP6A 4Q22A 2LJ4A 4IQ2A 1LG1A 2EULA 4MNKA 4DRJA 4DRMA 1T11A 4ODRA 3ARTA 3OA5A 4DRIA 3O5MA 1E44A 2RUCA 3FY1A 4ODMA 3O5EA 3WIJA 3TDBA 3O5FA 4WK9A 1QZ2A 3UI5A 4DT4A 1FKJA 4FAPA 1FJDA 1BKFA 2DSWA 4R0XA 1FKIA 4ITZA 4DWSA 4MTVA 4U84A 1W9UA 5HW8A 4AY1A 3G6MA 2WM0A 1W1YA 3BMBA 2KI3A 3PRBA 4G50A 1E6NA 2MF9A 4Z2GA 2RUQA 3IKDA 2JZVA 3NTPA 2WLYA 5B8IC 1QPFA 2RQSA 3CHDA 2IF4A 2Y78A 2F4EA 1ROUA 4G2PA 1D7HA 1GOIA 2XP5A 5HBFA 5DIUA 2DT2A 1W26A 1D7IA 4L3NA 3I6CA 3UI4A 4QZVB 4IPXA 2F23A 3TCZA 4NNRA 3KAHA 1OGBA 2ZQVA 2D9FA 3IK8A 4DWSB 4WKHA 3LUOA 3FAPA 4UDMA 1P5QA 2DPEA 2RUDA 3B8SA 2ITKA 2O9OA 1F8AB 3KABA 3ARXA 3CZ8A 3KAFA 1Q6IA 1NWTA 1LL4A 2DSUA 4ODQA 1W9PA 4KR0B 2MNTA 1JNTA 2ZQUA 1W9VA 1JCHB 3JYJA 3RM4A 3PRAA 5DF0A 4MGVA 4W9PA 4ZPTR 2L2SA 2P4VA 1C9HA 1ZK6A 2VN1A 1FAPA 1SYTA 1FKBA 2B31A 2WK2A 2WLZA 1LQ0A 4DH0A 3CHEA 2ZQTA 2A3EA 3WH0A 4JFMA 4DWSC 1ITXA 2DG3A 4J4NA 1E6RA 3W4RA 1EDQA 4W9QA 4WJXA 3WL1A 3EIPA 3UQBA 1SR0A 1W1VA 2A3AA 3RMEA 1F40A 2KFWA 1KFWA 1EYMA 2UZ5A 1ZCNA 3B7XA 3O5QA 1NWSA 4MNMA 4DZ2A 1R9HA 1L1PA 3GTYX 2XP3A 3UF8A 1HKIA 5GPGA 3ARVA 3CHFA 1HJXA 2M2AA 1Q6UA 2LPVA 2AWGA 3WL0A 2G41A 3O5KA 1FKRA 4NSBA 2VCDA 2A3BA 1ZU8A 5HUAA 5D75A 4ZS6A 1Q6HA 2RURA 4ODLA 3ALGA 3AS1A 1N1AA 2PPOA 4C02B 2KO7A 1FKDA 4HBEA 1HKJA 1VF8A 4TW8A 4LAXA 4MAVA 2MLZA 2XP4A 2ZR6A 2A3CA 4DROA 3ODKA 1Y0OA 4P8WA 4IT6A 4HARA 2DT3A 3MDYB 3UI6A 3NI6A 1ZBVA 3O5DA 4MNJA 2KR7A 2K8IA 3ARQA 2PV1A 5HTGA 1WB0A 3AQUA 3JXVA 1YATA 5DIVA 2IUZA 3IKGA 1J6YA 4S3JA 4LAVA 4Z2IA 1ZBWA 1JVWA 1U79A 4PTMA 1HJVA 1NWUA 2LGOA 4TNSA 1Q1CA 4LAWA 4DRKA 2PPNA 1J4RA 1PBKA 5HW6A 2YBUA 4QT3A 3B9DA 3O5PA 4KQZA 2DG4A 1HJWA 3PRDA 4JYSA 4W5UA 3WD1A 5DO2A 4ZPVR 1NMVA 1J4IA 1FFRA 3RGCA 2PI6A 1EQ3A 4GIVA 4ZPWR 1LG2A 2FDMA 3ARPA 4IQCA 1ROTA 4IT4A 2QF8A 1WNOA 1WAWA 4ODKA 2MPHA 3ARYA 1W1TA 4NZCA 2ETNA 3JYMA 2F21A 2M1IA 1IX5A 4W9OA 2MLXA 3AROA 3EY6A 3WQWA 2G8ZA 1FKLA 1NSGA 3FXYA 1E9LA 4R5EA 2PBCA 2F2DA 4QT2A 1GPFA 1FKHA 4TYOA 3WD4A 1H0GA 1RD6A 4N19A 4DWSD 4WKFA 1JNDA 5HWCA 4BF8A 2O92A 4O2TA 3BXWA 4S3KA 3WQVA 1UR8A 4WKAA 1HXVA 3O5JA 3RM8A 3RM9A 4Q7NA 3UQIA 2DSVA 1TFVA 5BXJA 3CH9A 3ARRA 2ZR4A 3ARUA 2Q5AA 4ODPA 4MPKA 2DG9A 2PPPA 1X6LA 1PINA 3IHZA 3ARSA 3B9EA 3RFWA 2OFNA 1E15A 4LGXA 4QIBA 1NH6A 4ML4A 1ZBCA 1ZBKA 1XHGA 2DT1A 3CGNA 3B9AA 3WKZA 1FKSA 1D2KA 3KACA 2RSEA 3G6LA 1LL6A 2N87A 5JH8A 3KAGA 2KE0A 4L72B 2ZQSA 3CGMA 3VAWA 2M08A 3O5IA 1FKGA 1QPLA 2YBTA 4HBOA 4Z2JA 4LAYA 2PN0A 1GRJA 5HT1A 3O5GA 3PA7A 2XPBA 2DSZA 1JNSA 2FAPA 2AOSA 4J4OA 1LJYA 1EHNA 1FKKA 4TW6A 3KAIA 4DRQA 3ALFA 1NWRA 2KGJA 5I98A 2XP8A 4DRPA 3TC5A 1H0IA 1OWQA 1XRVA 3O5OA 2ZR5A 2PV3A 4ODOA 1A7XA 3QOKA 2ESCA 4MSPA 4JFIA 4TW7A 3O5RA 1HKKA 1YW5A 2PV2A 2FKEA 1K9TA 5HKGA 1ZB5A 1EIBA 1X6NA 3WD0A 2XP9A 2B5UB 1FFQA 1M5YA 4XAKA 4TX0A 1LL7A 3AS3A 1BL4A 5HWBA 1J4HA 4WIWA 4URIA 3O5LA
chains in the Genus database with same CATH topology
3ARZA 1FKFA 1O6IA 2OLHA 1JNEA 4P8UA 1GUVA 4P8VA 1NMWA 5HW7A 4DRNA 1W1PA 1KT1A 4P8XA 1B6CA 3WD3A 1HKMA 1D7JA 4U86A 4DIPA 1TCOC 4U85A 4FN2A 1ZL1A 3KADA 4JFKA 4DZ3A 2XP7A 1E6PA 4GGQA 1D6OA 2LKNA 3CHCA 4JFLA 4Z2LA 5DITA 1FKTA 2XPAA 2DT0A 1OGGA 3KCEA 1FD9A 3ARWA 1UR9A 3AS2A 3KZ7A 2MLYA 4JFJA 5J6EA 4DRHA 3AS0A 3NRKA 4Z2KA 3WD2A 3H9RB 3PR9A 4MNLA 4Z2HA 3OOBA 1E6ZA 3UQAA 5GQBA 3GPKA 5GPRA 5DEZA 1CTNA 4ODNA 1KT0A 2XP6A 4Q22A 2LJ4A 4IQ2A 1LG1A 4MNKA 4DRJA 4DRMA 1T11A 4ODRA 3ARTA 3OA5A 4DRIA 3O5MA 2RUCA 3FY1A 4ODMA 3O5EA 3WIJA 3TDBA 3O5FA 4WK9A 1QZ2A 3UI5A 4DT4A 1FKJA 4FAPA 1FJDA 1BKFA 2DSWA 4R0XA 1FKIA 4ITZA 4DWSA 4MTVA 4U84A 1W9UA 5HW8A 4AY1A 3G6MA 2WM0A 1W1YA 2KI3A 3PRBA 4G50A 1E6NA 2MF9A 4Z2GA 2RUQA 3IKDA 2JZVA 3NTPA 2WLYA 5B8IC 1QPFA 2RQSA 3CHDA 2IF4A 2Y78A 2F4EA 1ROUA 4G2PA 1D7HA 1GOIA 2XP5A 5HBFA 5DIUA 2DT2A 1W26A 1D7IA 4L3NA 3I6CA 3UI4A 4QZVB 4IPXA 3TCZA 4NNRA 3KAHA 1OGBA 2ZQVA 2D9FA 3IK8A 4DWSB 4WKHA 3LUOA 3FAPA 1P5QA 2DPEA 2RUDA 3B8SA 2ITKA 2O9OA 1F8AB 3KABA 3ARXA 3CZ8A 3KAFA 1Q6IA 1NWTA 1LL4A 2DSUA 4ODQA 1W9PA 4KR0B 2MNTA 1JNTA 2ZQUA 1W9VA 3JYJA 3RM4A 3PRAA 5DF0A 4MGVA 4W9PA 4ZPTR 2L2SA 1C9HA 1ZK6A 2VN1A 1FAPA 1SYTA 1FKBA 2B31A 2WK2A 2WLZA 1LQ0A 4DH0A 3CHEA 2ZQTA 2A3EA 3WH0A 4JFMA 4DWSC 1ITXA 2DG3A 4J4NA 1E6RA 3W4RA 1EDQA 4W9QA 4WJXA 3WL1A 3UQBA 1SR0A 1W1VA 2A3AA 3RMEA 1F40A 2KFWA 1KFWA 1EYMA 2UZ5A 1ZCNA 3B7XA 3O5QA 1NWSA 4MNMA 4DZ2A 1R9HA 1L1PA 2XP3A 3UF8A 1HKIA 5GPGA 3ARVA 3CHFA 1HJXA 2M2AA 1Q6UA 2LPVA 2AWGA 3WL0A 2G41A 3O5KA 1FKRA 4NSBA 2VCDA 2A3BA 1ZU8A 5HUAA 5D75A 4ZS6A 1Q6HA 2RURA 4ODLA 3ALGA 3AS1A 1N1AA 2PPOA 4C02B 2KO7A 1FKDA 4HBEA 1HKJA 1VF8A 4TW8A 4LAXA 4MAVA 2MLZA 2XP4A 2ZR6A 2A3CA 4DROA 3ODKA 1Y0OA 4P8WA 4IT6A 4HARA 2DT3A 3MDYB 3UI6A 3NI6A 1ZBVA 3O5DA 4MNJA 2KR7A 2K8IA 3ARQA 2PV1A 5HTGA 1WB0A 3AQUA 3JXVA 1YATA 5DIVA 2IUZA 3IKGA 1J6YA 4S3JA 4LAVA 4Z2IA 1ZBWA 1JVWA 1U79A 4PTMA 1HJVA 1NWUA 2LGOA 4TNSA 1Q1CA 4LAWA 4DRKA 2PPNA 1J4RA 1PBKA 5HW6A 2YBUA 4QT3A 3B9DA 3O5PA 4KQZA 2DG4A 1HJWA 3PRDA 4JYSA 4W5UA 3WD1A 5DO2A 4ZPVR 1NMVA 1J4IA 1FFRA 3RGCA 2PI6A 1EQ3A 4GIVA 4ZPWR 1LG2A 2FDMA 3ARPA 4IQCA 1ROTA 4IT4A 2QF8A 1WNOA 1WAWA 4ODKA 2MPHA 3ARYA 1W1TA 4NZCA 3JYMA 2F21A 2M1IA 1IX5A 4W9OA 2MLXA 3AROA 3EY6A 3WQWA 2G8ZA 1FKLA 1NSGA 3FXYA 1E9LA 4R5EA 2PBCA 2F2DA 4QT2A 1GPFA 1FKHA 4TYOA 3WD4A 1H0GA 1RD6A 4N19A 4DWSD 4WKFA 1JNDA 5HWCA 4BF8A 2O92A 4O2TA 3BXWA 4S3KA 3WQVA 1UR8A 4WKAA 1HXVA 3O5JA 3RM8A 3RM9A 4Q7NA 3UQIA 2DSVA 1TFVA 5BXJA 3CH9A 3ARRA 2ZR4A 3ARUA 2Q5AA 4ODPA 4MPKA 2DG9A 2PPPA 1X6LA 1PINA 3IHZA 3ARSA 3B9EA 3RFWA 2OFNA 1E15A 4LGXA 4QIBA 1NH6A 4ML4A 1ZBCA 1ZBKA 1XHGA 2DT1A 3CGNA 3B9AA 3WKZA 1FKSA 1D2KA 3KACA 2RSEA 3G6LA 1LL6A 2N87A 5JH8A 3KAGA 2KE0A 4L72B 2ZQSA 3CGMA 3VAWA 2M08A 3O5IA 1FKGA 1QPLA 2YBTA 4HBOA 4Z2JA 4LAYA 5HT1A 3O5GA 3PA7A 2XPBA 2DSZA 1JNSA 2FAPA 2AOSA 4J4OA 1LJYA 1EHNA 1FKKA 4TW6A 3KAIA 4DRQA 3ALFA 1NWRA 2KGJA 5I98A 2XP8A 4DRPA 3TC5A 1H0IA 1OWQA 1XRVA 3O5OA 2ZR5A 2PV3A 4ODOA 1A7XA 3QOKA 2ESCA 4MSPA 4JFIA 4TW7A 3O5RA 1HKKA 1YW5A 2PV2A 2FKEA 1K9TA 5HKGA 1ZB5A 1EIBA 1X6NA 3WD0A 2XP9A 1FFQA 1M5YA 4XAKA 4TX0A 1LL7A 3AS3A 1BL4A 5HWBA 1J4HA 4WIWA 4URIA 3O5LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JZV A;  3NTP A;  2VCD A;  1HXV A;  1FKF A;  3O5J A;  5B8I C;  5HUA A;  1QPF A;  2RQS A;  5D75 A;  2IF4 A;  2Y78 A;  1Q6H A;  2RUR A;  1NMW A;  2F4E A;  5HW7 A;  4ODL A;  1ROU A;  4G2P A;  1D7H A;  4DRN A;  2XP5 A;  1N1A A;  3UQI A;  5DIU A;  2PPO A;  4C02 B;  1KT1 A;  2KO7 A;  1B6C A;  5BXJ A;  1FKD A;  1D7I A;  1W26 A;  3I6C A;  4TW8 A;  3UI4 A;  4IPX A;  4LAX A;  3TCZ A;  1D7J A;  2MLZ A;  4U86 A;  2ZR4 A;  2XP4 A;  2ZR6 A;  2Q5A A;  4NNR A;  3KAH A;  4DRO A;  3ODK A;  4ODP A;  4DIP A;  1Y0O A;  2ZQV A;  2DG9 A;  2D9F A;  2PPP A;  3IK8 A;  1TCO C;  4U85 A;  4FN2 A;  1PIN A;  3IHZ A;  3KAD A;  3LUO A;  3FAP A;  4JFK A;  3MDY B;  3RFW A;  1P5Q A;  2OFN A;  3NI6 A;  3UI6 A;  3O5D A;  4DZ3 A;  4QIB A;  2KR7 A;  2K8I A;  2RUD A;  2XP7 A;  4GGQ A;  1D6O A;  2ITK A;  3CGN A;  2LKN A;  2PV1 A;  5HTG A;  1F8A B;  1FKS A;  4JFL A;  1FKT A;  2XPA A;  5DIT A;  3JXV A;  3KAB A;  3KAF A;  1Q6I A;  1YAT A;  1FD9 A;  2RSE A;  3KAC A;  3KCE A;  2N87 A;  4ODQ A;  5DIV A;  3IKG A;  3KAG A;  3KZ7 A;  1J6Y A;  4LAV A;  1JVW A;  1U79 A;  2MNT A;  2KE0 A;  2MLY A;  2ZQS A;  3CGM A;  4JFJ A;  3VAW A;  5J6E A;  2M08 A;  1JNT A;  2ZQU A;  3O5I A;  4DRH A;  1FKG A;  1QPL A;  3JYJ A;  2LGO A;  3NRK A;  4TNS A;  3H9R B;  1Q1C A;  4LAY A;  5HT1 A;  4LAW A;  3O5G A;  2PPN A;  4MGV A;  4DRK A;  1J4R A;  4W9P A;  3OOB A;  1PBK A;  3PA7 A;  2XPB A;  5HW6 A;  3UQA A;  1JNS A;  3GPK A;  2L2S A;  4QT3 A;  2FAP A;  3O5P A;  4J4O A;  2DG4 A;  1C9H A;  1FKK A;  4TW6 A;  3KAI A;  1ZK6 A;  2VN1 A;  4DRQ A;  1FAP A;  1FKB A;  1KT0 A;  3PRD A;  4JYS A;  2XP6 A;  4ODN A;  2LJ4 A;  1NMV A;  4IQ2 A;  2KGJ A;  5I98 A;  2XP8 A;  4DRP A;  3TC5 A;  4DRJ A;  4DRM A;  1T11 A;  1J4I A;  4ODR A;  4DH0 A;  3RGC A;  3O5O A;  4DRI A;  1EQ3 A;  2ZR5 A;  3O5M A;  4GIV A;  2PV3 A;  2RUC A;  2ZQT A;  4ODM A;  4ODO A;  3O5E A;  4IQC A;  3WH0 A;  4JFM A;  1ROT A;  2DG3 A;  3TDB A;  4J4N A;  4ODK A;  1A7X A;  2MPH A;  4W9Q A;  3UQB A;  4MSP A;  4JFI A;  3O5F A;  4TW7 A;  1QZ2 A;  3JYM A;  3O5R A;  1FKJ A;  2F21 A;  2M1I A;  3UI5 A;  4DT4 A;  4FAP A;  4W9O A;  1FJD A;  1YW5 A;  2PV2 A;  2MLX A;  1F40 A;  3EY6 A;  1BKF A;  2KFW A;  1EYM A;  2FKE A;  2UZ5 A;  4R0X A;  5HKG A;  1FKL A;  1NSG A;  1FKI A;  4ITZ A;  2XP9 A;  4U84 A;  1ZCN A;  3B7X A;  2PBC A;  3O5Q A;  1M5Y A;  2F2D A;  4QT2 A;  4DZ2 A;  5HW8 A;  1R9H A;  1L1P A;  1FKH A;  4TX0 A;  2XP3 A;  3UF8 A;  4TYO A;  5GPG A;  1BL4 A;  5HWB A;  1J4H A;  2M2A A;  1Q6U A;  4N19 A;  2KI3 A;  2LPV A;  2AWG A;  3O5L A;  4BF8 A;  5HWC A;  3PRB A;  4O2T A;  4G50 A;  3O5K A;  1FKR A;  2MF9 A;  2RUQ A;  3IKD A; 
#chains in the Genus database with same CATH topology
 3ARZ A;  1FKF A;  1O6I A;  2OLH A;  1JNE A;  4P8U A;  1GUV A;  4P8V A;  1NMW A;  5HW7 A;  4DRN A;  1W1P A;  1KT1 A;  4P8X A;  1B6C A;  3WD3 A;  1HKM A;  1D7J A;  4U86 A;  4DIP A;  1TCO C;  4U85 A;  4FN2 A;  1ZL1 A;  3KAD A;  4JFK A;  4DZ3 A;  2XP7 A;  1E6P A;  4GGQ A;  1D6O A;  3GU0 A;  2LKN A;  3CHC A;  4JFL A;  4Z2L A;  5DIT A;  1FKT A;  2XPA A;  2DT0 A;  1OGG A;  3KCE A;  1FD9 A;  3ARW A;  1UR9 A;  3AS2 A;  3KZ7 A;  2MLY A;  4JFJ A;  5J6E A;  4DRH A;  3AS0 A;  3NRK A;  4Z2K A;  3WD2 A;  3H9R B;  3PR9 A;  4MNL A;  4Z2H A;  3OOB A;  1E6Z A;  3UQA A;  5GQB A;  3GPK A;  5GPR A;  5DEZ A;  1CTN A;  4ODN A;  1KT0 A;  2XP6 A;  4Q22 A;  2LJ4 A;  4IQ2 A;  1LG1 A;  2EUL A;  4MNK A;  4DRJ A;  4DRM A;  1T11 A;  4ODR A;  3ART A;  3OA5 A;  4DRI A;  3O5M A;  1E44 A;  2RUC A;  3FY1 A;  4ODM A;  3O5E A;  3WIJ A;  3TDB A;  3O5F A;  4WK9 A;  1QZ2 A;  3UI5 A;  4DT4 A;  1FKJ A;  4FAP A;  1FJD A;  1BKF A;  2DSW A;  4R0X A;  1FKI A;  4ITZ A;  4DWS A;  4MTV A;  4U84 A;  1W9U A;  5HW8 A;  4AY1 A;  3G6M A;  2WM0 A;  1W1Y A;  3BMB A;  2KI3 A;  3PRB A;  4G50 A;  1E6N A;  2MF9 A;  4Z2G A;  2RUQ A;  3IKD A;  2JZV A;  3NTP A;  2WLY A;  5B8I C;  1QPF A;  2RQS A;  3CHD A;  2IF4 A;  2Y78 A;  2F4E A;  1ROU A;  4G2P A;  1D7H A;  1GOI A;  2XP5 A;  5HBF A;  5DIU A;  2DT2 A;  1W26 A;  1D7I A;  4L3N A;  3I6C A;  3UI4 A;  4QZV B;  4IPX A;  2F23 A;  3TCZ A;  4NNR A;  3KAH A;  1OGB A;  2ZQV A;  2D9F A;  3IK8 A;  4DWS B;  4WKH A;  3LUO A;  3FAP A;  4UDM A;  1P5Q A;  2DPE A;  2RUD A;  3B8S A;  2ITK A;  2O9O A;  1F8A B;  3KAB A;  3ARX A;  3CZ8 A;  3KAF A;  1Q6I A;  1NWT A;  1LL4 A;  2DSU A;  4ODQ A;  1W9P A;  4KR0 B;  2MNT A;  1JNT A;  2ZQU A;  1W9V A;  1JCH B;  3JYJ A;  3RM4 A;  3PRA A;  5DF0 A;  4MGV A;  4W9P A;  4ZPT R;  2L2S A;  2P4V A;  1C9H A;  1ZK6 A;  2VN1 A;  1FAP A;  1SYT A;  1FKB A;  2B31 A;  2WK2 A;  2WLZ A;  1LQ0 A;  4DH0 A;  3CHE A;  2ZQT A;  2A3E A;  3WH0 A;  4JFM A;  4DWS C;  1ITX A;  2DG3 A;  4J4N A;  1E6R A;  3W4R A;  1EDQ A;  4W9Q A;  4WJX A;  3WL1 A;  3EIP A;  3UQB A;  1SR0 A;  1W1V A;  2A3A A;  3RME A;  1F40 A;  2KFW A;  1KFW A;  1EYM A;  2UZ5 A;  1ZCN A;  3B7X A;  3O5Q A;  1NWS A;  4MNM A;  4DZ2 A;  1R9H A;  1L1P A;  3GTY X;  2XP3 A;  3UF8 A;  1HKI A;  5GPG A;  3ARV A;  3CHF A;  1HJX A;  2M2A A;  1Q6U A;  2LPV A;  2AWG A;  3WL0 A;  2G41 A;  3O5K A;  1FKR A;  4NSB A;  2VCD A;  2A3B A;  1ZU8 A;  5HUA A;  5D75 A;  4ZS6 A;  1Q6H A;  2RUR A;  4ODL A;  3ALG A;  3AS1 A;  1N1A A;  2PPO A;  4C02 B;  2KO7 A;  1FKD A;  4HBE A;  1HKJ A;  1VF8 A;  4TW8 A;  4LAX A;  4MAV A;  2MLZ A;  2XP4 A;  2ZR6 A;  2A3C A;  4DRO A;  3ODK A;  1Y0O A;  4P8W A;  4IT6 A;  4HAR A;  2DT3 A;  3MDY B;  3UI6 A;  3NI6 A;  1ZBV A;  3O5D A;  4MNJ A;  2KR7 A;  2K8I A;  3ARQ A;  2PV1 A;  5HTG A;  1WB0 A;  3AQU A;  3JXV A;  1YAT A;  5DIV A;  2IUZ A;  3IKG A;  1J6Y A;  4S3J A;  4LAV A;  4Z2I A;  1ZBW A;  1JVW A;  1U79 A;  4PTM A;  1HJV A;  1NWU A;  2LGO A;  4TNS A;  1Q1C A;  4LAW A;  4DRK A;  2PPN A;  1J4R A;  1PBK A;  5HW6 A;  2YBU A;  4QT3 A;  3B9D A;  3O5P A;  4KQZ A;  2DG4 A;  1HJW A;  3PRD A;  4JYS A;  4W5U A;  3WD1 A;  5DO2 A;  4ZPV R;  1NMV A;  1J4I A;  1FFR A;  3RGC A;  2PI6 A;  1EQ3 A;  4GIV A;  4ZPW R;  1LG2 A;  2FDM A;  3ARP A;  4IQC A;  1ROT A;  4IT4 A;  2QF8 A;  1WNO A;  1WAW A;  4ODK A;  2MPH A;  3ARY A;  1W1T A;  4NZC A;  2ETN A;  3JYM A;  2F21 A;  2M1I A;  1IX5 A;  4W9O A;  2MLX A;  3ARO A;  3EY6 A;  3WQW A;  2G8Z A;  1FKL A;  1NSG A;  3FXY A;  1E9L A;  4R5E A;  2PBC A;  2F2D A;  4QT2 A;  1GPF A;  1FKH A;  4TYO A;  3WD4 A;  1H0G A;  1RD6 A;  4N19 A;  4DWS D;  4WKF A;  1JND A;  5HWC A;  4BF8 A;  2O92 A;  4O2T A;  3BXW A;  4S3K A;  3WQV A;  1UR8 A;  4WKA A;  1HXV A;  3O5J A;  3RM8 A;  3RM9 A;  4Q7N A;  3UQI A;  2DSV A;  1TFV A;  5BXJ A;  3CH9 A;  3ARR A;  2ZR4 A;  3ARU A;  2Q5A A;  4ODP A;  4MPK A;  2DG9 A;  2PPP A;  1X6L A;  1PIN A;  3IHZ A;  3ARS A;  3B9E A;  3RFW A;  2OFN A;  1E15 A;  4LGX A;  4QIB A;  1NH6 A;  4ML4 A;  1ZBC A;  1ZBK A;  1XHG A;  2DT1 A;  3CGN A;  3B9A A;  3WKZ A;  1FKS A;  1D2K A;  3KAC A;  2RSE A;  3G6L A;  1LL6 A;  2N87 A;  5JH8 A;  3KAG A;  2KE0 A;  4L72 B;  2ZQS A;  3CGM A;  3VAW A;  2M08 A;  3O5I A;  1FKG A;  1QPL A;  2YBT A;  4HBO A;  4Z2J A;  4LAY A;  2PN0 A;  1GRJ A;  5HT1 A;  3O5G A;  3PA7 A;  2XPB A;  2DSZ A;  1JNS A;  2FAP A;  2AOS A;  4J4O A;  1LJY A;  1EHN A;  1FKK A;  4TW6 A;  3KAI A;  4DRQ A;  3ALF A;  1NWR A;  2KGJ A;  5I98 A;  2XP8 A;  4DRP A;  3TC5 A;  1H0I A;  1OWQ A;  1XRV A;  3O5O A;  2ZR5 A;  2PV3 A;  4ODO A;  1A7X A;  3QOK A;  2ESC A;  4MSP A;  4JFI A;  4TW7 A;  3O5R A;  1HKK A;  1YW5 A;  2PV2 A;  2FKE A;  1K9T A;  5HKG A;  1ZB5 A;  1EIB A;  1X6N A;  3WD0 A;  2XP9 A;  2B5U B;  1FFQ A;  1M5Y A;  4XAK A;  4TX0 A;  1LL7 A;  3AS3 A;  1BL4 A;  5HWB A;  1J4H A;  4WIW A;  4URI A;  3O5L A; 
#chains in the Genus database with same CATH homology
 3ARZ A;  1FKF A;  1O6I A;  2OLH A;  1JNE A;  4P8U A;  1GUV A;  4P8V A;  1NMW A;  5HW7 A;  4DRN A;  1W1P A;  1KT1 A;  4P8X A;  1B6C A;  3WD3 A;  1HKM A;  1D7J A;  4U86 A;  4DIP A;  1TCO C;  4U85 A;  4FN2 A;  1ZL1 A;  3KAD A;  4JFK A;  4DZ3 A;  2XP7 A;  1E6P A;  4GGQ A;  1D6O A;  2LKN A;  3CHC A;  4JFL A;  4Z2L A;  5DIT A;  1FKT A;  2XPA A;  2DT0 A;  1OGG A;  3KCE A;  1FD9 A;  3ARW A;  1UR9 A;  3AS2 A;  3KZ7 A;  2MLY A;  4JFJ A;  5J6E A;  4DRH A;  3AS0 A;  3NRK A;  4Z2K A;  3WD2 A;  3H9R B;  3PR9 A;  4MNL A;  4Z2H A;  3OOB A;  1E6Z A;  3UQA A;  5GQB A;  3GPK A;  5GPR A;  5DEZ A;  1CTN A;  4ODN A;  1KT0 A;  2XP6 A;  4Q22 A;  2LJ4 A;  4IQ2 A;  1LG1 A;  4MNK A;  4DRJ A;  4DRM A;  1T11 A;  4ODR A;  3ART A;  3OA5 A;  4DRI A;  3O5M A;  2RUC A;  3FY1 A;  4ODM A;  3O5E A;  3WIJ A;  3TDB A;  3O5F A;  4WK9 A;  1QZ2 A;  3UI5 A;  4DT4 A;  1FKJ A;  4FAP A;  1FJD A;  1BKF A;  2DSW A;  4R0X A;  1FKI A;  4ITZ A;  4DWS A;  4MTV A;  4U84 A;  1W9U A;  5HW8 A;  4AY1 A;  3G6M A;  2WM0 A;  1W1Y A;  2KI3 A;  3PRB A;  4G50 A;  1E6N A;  2MF9 A;  4Z2G A;  2RUQ A;  3IKD A;  2JZV A;  3NTP A;  2WLY A;  5B8I C;  1QPF A;  2RQS A;  3CHD A;  2IF4 A;  2Y78 A;  2F4E A;  1ROU A;  4G2P A;  1D7H A;  1GOI A;  2XP5 A;  5HBF A;  5DIU A;  2DT2 A;  1W26 A;  1D7I A;  4L3N A;  3I6C A;  3UI4 A;  4QZV B;  4IPX A;  3TCZ A;  4NNR A;  3KAH A;  1OGB A;  2ZQV A;  2D9F A;  3IK8 A;  4DWS B;  4WKH A;  3LUO A;  3FAP A;  1P5Q A;  2DPE A;  2RUD A;  3B8S A;  2ITK A;  2O9O A;  1F8A B;  3KAB A;  3ARX A;  3CZ8 A;  3KAF A;  1Q6I A;  1NWT A;  1LL4 A;  2DSU A;  4ODQ A;  1W9P A;  4KR0 B;  2MNT A;  1JNT A;  2ZQU A;  1W9V A;  3JYJ A;  3RM4 A;  3PRA A;  5DF0 A;  4MGV A;  4W9P A;  4ZPT R;  2L2S A;  1C9H A;  1ZK6 A;  2VN1 A;  1FAP A;  1SYT A;  1FKB A;  2B31 A;  2WK2 A;  2WLZ A;  1LQ0 A;  4DH0 A;  3CHE A;  2ZQT A;  2A3E A;  3WH0 A;  4JFM A;  4DWS C;  1ITX A;  2DG3 A;  4J4N A;  1E6R A;  3W4R A;  1EDQ A;  4W9Q A;  4WJX A;  3WL1 A;  3UQB A;  1SR0 A;  1W1V A;  2A3A A;  3RME A;  1F40 A;  2KFW A;  1KFW A;  1EYM A;  2UZ5 A;  1ZCN A;  3B7X A;  3O5Q A;  1NWS A;  4MNM A;  4DZ2 A;  1R9H A;  1L1P A;  2XP3 A;  3UF8 A;  1HKI A;  5GPG A;  3ARV A;  3CHF A;  1HJX A;  2M2A A;  1Q6U A;  2LPV A;  2AWG A;  3WL0 A;  2G41 A;  3O5K A;  1FKR A;  4NSB A;  2VCD A;  2A3B A;  1ZU8 A;  5HUA A;  5D75 A;  4ZS6 A;  1Q6H A;  2RUR A;  4ODL A;  3ALG A;  3AS1 A;  1N1A A;  2PPO A;  4C02 B;  2KO7 A;  1FKD A;  4HBE A;  1HKJ A;  1VF8 A;  4TW8 A;  4LAX A;  4MAV A;  2MLZ A;  2XP4 A;  2ZR6 A;  2A3C A;  4DRO A;  3ODK A;  1Y0O A;  4P8W A;  4IT6 A;  4HAR A;  2DT3 A;  3MDY B;  3UI6 A;  3NI6 A;  1ZBV A;  3O5D A;  4MNJ A;  2KR7 A;  2K8I A;  3ARQ A;  2PV1 A;  5HTG A;  1WB0 A;  3AQU A;  3JXV A;  1YAT A;  5DIV A;  2IUZ A;  3IKG A;  1J6Y A;  4S3J A;  4LAV A;  4Z2I A;  1ZBW A;  1JVW A;  1U79 A;  4PTM A;  1HJV A;  1NWU A;  2LGO A;  4TNS A;  1Q1C A;  4LAW A;  4DRK A;  2PPN A;  1J4R A;  1PBK A;  5HW6 A;  2YBU A;  4QT3 A;  3B9D A;  3O5P A;  4KQZ A;  2DG4 A;  1HJW A;  3PRD A;  4JYS A;  4W5U A;  3WD1 A;  5DO2 A;  4ZPV R;  1NMV A;  1J4I A;  1FFR A;  3RGC A;  2PI6 A;  1EQ3 A;  4GIV A;  4ZPW R;  1LG2 A;  2FDM A;  3ARP A;  4IQC A;  1ROT A;  4IT4 A;  2QF8 A;  1WNO A;  1WAW A;  4ODK A;  2MPH A;  3ARY A;  1W1T A;  4NZC A;  3JYM A;  2F21 A;  2M1I A;  1IX5 A;  4W9O A;  2MLX A;  3ARO A;  3EY6 A;  3WQW A;  2G8Z A;  1FKL A;  1NSG A;  3FXY A;  1E9L A;  4R5E A;  2PBC A;  2F2D A;  4QT2 A;  1GPF A;  1FKH A;  4TYO A;  3WD4 A;  1H0G A;  1RD6 A;  4N19 A;  4DWS D;  4WKF A;  1JND A;  5HWC A;  4BF8 A;  2O92 A;  4O2T A;  3BXW A;  4S3K A;  3WQV A;  1UR8 A;  4WKA A;  1HXV A;  3O5J A;  3RM8 A;  3RM9 A;  4Q7N A;  3UQI A;  2DSV A;  1TFV A;  5BXJ A;  3CH9 A;  3ARR A;  2ZR4 A;  3ARU A;  2Q5A A;  4ODP A;  4MPK A;  2DG9 A;  2PPP A;  1X6L A;  1PIN A;  3IHZ A;  3ARS A;  3B9E A;  3RFW A;  2OFN A;  1E15 A;  4LGX A;  4QIB A;  1NH6 A;  4ML4 A;  1ZBC A;  1ZBK A;  1XHG A;  2DT1 A;  3CGN A;  3B9A A;  3WKZ A;  1FKS A;  1D2K A;  3KAC A;  2RSE A;  3G6L A;  1LL6 A;  2N87 A;  5JH8 A;  3KAG A;  2KE0 A;  4L72 B;  2ZQS A;  3CGM A;  3VAW A;  2M08 A;  3O5I A;  1FKG A;  1QPL A;  2YBT A;  4HBO A;  4Z2J A;  4LAY A;  5HT1 A;  3O5G A;  3PA7 A;  2XPB A;  2DSZ A;  1JNS A;  2FAP A;  2AOS A;  4J4O A;  1LJY A;  1EHN A;  1FKK A;  4TW6 A;  3KAI A;  4DRQ A;  3ALF A;  1NWR A;  2KGJ A;  5I98 A;  2XP8 A;  4DRP A;  3TC5 A;  1H0I A;  1OWQ A;  1XRV A;  3O5O A;  2ZR5 A;  2PV3 A;  4ODO A;  1A7X A;  3QOK A;  2ESC A;  4MSP A;  4JFI A;  4TW7 A;  3O5R A;  1HKK A;  1YW5 A;  2PV2 A;  2FKE A;  1K9T A;  5HKG A;  1ZB5 A;  1EIB A;  1X6N A;  3WD0 A;  2XP9 A;  1FFQ A;  1M5Y A;  4XAK A;  4TX0 A;  1LL7 A;  3AS3 A;  1BL4 A;  5HWB A;  1J4H A;  4WIW A;  4URI A;  3O5L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...