5GPGA

Co-crystal structure of the fk506 binding domain of human fkbp25, rapamycin and the frb domain of human mtor
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
110
Chain Sequence
SPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP3
publication title Proximity-Directed Labeling Reveals a New Rapamycin-Induced Heterodimer of FKBP25 and FRB in Live Cells
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/transferase
total genus 25
structure length 110
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5gpgA00
3O5PA 5BXJA 2ZQVA 3UI5A 1JVWA 3KAGA 3I6CA 3UF8A 2ZR5A 1FKFA 1FKDA 5I98A 4DH0A 3UQIA 1EQ3A 2AWGA 3EY6A 3KAHA 4LAWA 2M08A 1PINA 1ROTA 4MSPA 1J4HA 4JFLA 2KGJA 2RUDA 4W9QA 2XP5A 1J6YA 2M2AA 2MF9A 2KE0A 1FKBA 3JYMA 3NTPA 4LAYA 1FD9A 2IF4A 5HWBA 5DITA 2ZR4A 2MLXA 3OOBA 3UI4A 4DZ3A 3IK8A 5B8IC 4JYSA 1M5YA 3LUOA 2KR7A 2L2SA 2LKNA 4TW7A 5GPGA 4DRMA 4ODOA 5HWCA 1L1PA 2MLZA 3PRBA 4NNRA 2UZ5A 2FAPA 3O5FA 4U85A 4C02B 4DIPA 5HW7A 1T11A 1YW5A 3O5LA 1P5QA 2XPAA 4G50A 1C9HA 4JFIA 2PV3A 2K8IA 1Y0OA 1U79A 2MLYA 1FKTA 1QPLA 3IKDA 3KZ7A 3RFWA 1W26A 2ZQUA 1ZCNA 4DRJA 1TCOC 3O5RA 2PBCA 4DRPA 4DZ2A 3H9RB 2XP6A 1FKGA 3B7XA 1J4RA 1Q6IA 2PPOA 2VN1A 3PRDA 4N19A 4TX0A 2PV1A 3O5IA 3TCZA 3UQBA 2RUQA 1D6OA 5D75A 4GGQA 2KO7A 3O5EA 3NI6A 3UI6A 4U86A 1YATA 1Q1CA 4TW6A 4JFMA 3KACA 4IPXA 2KFWA 3KAFA 1FKKA 1ROUA 4ODPA 3TC5A 1JNTA 4R0XA 4DROA 1NMVA 1A7XA 4LAXA 3KADA 3CGMA 2PPNA 2PV2A 3IKGA 4QT2A 3ODKA 5HT1A 4J4OA 1F40A 5HW6A 3MDYB 1J4IA 3RGCA 2ZQSA 2RSEA 3KCEA 1ZK6A 2VCDA 2XP9A 4U84A 3KAIA 3O5GA 4JFKA 1D7JA 4TYOA 5HUAA 2F4EA 2LPVA 3O5KA 4ODQA 2RQSA 2ZQTA 2D9FA 2XP3A 2Y78A 5DIUA 4TW8A 2ITKA 3CGNA 2XP7A 3GPKA 3VAWA 4DT4A 1KT1A 1BL4A 4J4NA 3TDBA 4DRKA 4IQCA 2KI3A 1B6CA 2LJ4A 4LAVA 2M1IA 2Q5AA 1FKIA 1NMWA 2DG4A 2XPBA 4ITZA 4JFJA 3WH0A 4QT3A 2DG3A 3IHZA 1HXVA 1D7IA 5HTGA 4IQ2A 5J6EA 4FAPA 4FN2A 5DIVA 1F8AB 1R9HA 2MNTA 4DRHA 4G2PA 3O5MA 2LGOA 3O5JA 5HW8A 1BKFA 4TNSA 2JZVA 4ODLA 2MPHA 4ODKA 4DRIA 5HKGA 4BF8A 4DRNA 2F2DA 4O2TA 2ZR6A 1QPFA 4MGVA 4W9PA 2PPPA 3PA7A 1KT0A 3FAPA 1Q6UA 3JXVA 4ODRA 1Q6HA 1JNSA 4DRQA 2RURA 2RUCA 2OFNA 3NRKA 1NSGA 3O5QA 1QZ2A 3O5DA 3JYJA 1EYMA 1PBKA 1FKLA 1FKSA 1FJDA 3UQAA 2N87A 3KABA 3O5OA 1FKHA 1FKJA 1D7HA 1N1AA 2F21A 2FKEA 1FKRA 1FAPA 4ODMA 2XP4A 2XP8A 4GIVA 4ODNA 2DG9A 4W9OA 4QIBA
chains in the Genus database with same CATH superfamily
1FFRA 2ZR5A 2YBTA 1H0IA 3EY6A 3KAHA 3FXYA 3PR9A 3CHCA 1E6ZA 1FD9A 2IF4A 5DITA 1W1PA 2DSZA 5B8IC 3IK8A 3WKZA 1ZL1A 1SYTA 2L2SA 5GPGA 1L1PA 1NWSA 4MNJA 1YW5A 3PRAA 2ESCA 1P5QA 2XPAA 3RM9A 4MNLA 1ZBKA 5GPRA 1TCOC 1LL6A 4DZ2A 1UR9A 1WB0A 3H9RB 2PV1A 3O5IA 4S3JA 3TCZA 3UQBA 5D75A 3O5EA 3NI6A 4U86A 5HBFA 3ARWA 4ODPA 3TC5A 2FDMA 1JNTA 4MPKA 1ITXA 4LAXA 5HW6A 3ARPA 1J4IA 1ZK6A 3RMEA 5HUAA 4TYOA 1ZB5A 2ZQTA 4AY1A 2XP3A 2Y78A 5DIUA 3CGNA 1GOIA 2LJ4A 3BXWA 2M1IA 1W9PA 1LG1A 2DG3A 3IHZA 5DIVA 3AROA 4HBEA 4DRHA 4TNSA 2A3AA 2MPHA 4DRIA 1HJXA 3ARQA 2G41A 2F2DA 2ZR6A 4MGVA 4KQZA 1KT0A 3FAPA 1Q6UA 3WD3A 4DRQA 1E6PA 3NRKA 1HJVA 4NSBA 1PBKA 2PN0A 2WLYA 3GU0A 1FKHA 1EDQA 2FKEA 1OGGA 2XP4A 4ML4A 1OGBA 4ODNA 3O5PA 3UF8A 4WKHA 1FKFA 2DT1A 4URIA 1EQ3A 2M08A 1PINA 4MSPA 3RM8A 4P8VA 2A3CA 2XP5A 3WQWA 4LAYA 1ZBWA 3QOKA 2MLXA 1LQ0A 3LUOA 4DRMA 2MLZA 3PRBA 4NNRA 3O5FA 4U85A 5HW7A 1W1VA 4C02B 2PI6A 4DIPA 3O5LA 4L72B 3WIJA 4G50A 1C9HA 1RD6A 2K8IA 2MLYA 1OWQA 1FKTA 1QPLA 2B31A 2AOSA 2QF8A 1ZCNA 4DRJA 3O5RA 2XP6A 3ARUA 1J4RA 3B7XA 2PPOA 2VN1A 4LGXA 4Z2KA 3W4RA 2RUQA 1D6OA 2KO7A 4UDMA 3UI6A 4MAVA 1W9UA 4MNKA 1HKIA 4IPXA 2KFWA 1ROUA 1HKJA 4KR0B 4ZPTR 3ARZA 5DF0A 1A7XA 5HT1A 3IKGA 4J4OA 4R5EA 3RGCA 2ZQSA 3KCEA 3KAIA 4JFKA 3G6MA 2LPVA 3WL1A 1JCHB 1EHNA 2RQSA 3WD2A 2D9FA 4TW8A 2ITKA 3BMBA 3GPKA 4DT4A 1BL4A 4DRKA 4IQCA 1B6CA 4LAVA 1HKMA 1NMWA 3OA5A 3WH0A 1E44A 4WKAA 4FAPA 2MNTA 3O5MA 4Q7NA 3AS3A 1HJWA 2JZVA 1SR0A 4ODKA 3WL0A 5HKGA 2A3BA 1O6IA 1FFQA 3CZ8A 1LJYA 1QPFA 3ALFA 4Z2GA 3AS1A 1JNSA 4ODRA 1Q6HA 2RURA 1NSGA 1D2KA 4WKFA 3JYJA 1EYMA 5DEZA 3UQAA 3O5OA 1E6RA 4ODMA 1ZBCA 2DT3A 5BXJA 3KAGA 1NWRA 2IUZA 4DH0A 2AWGA 4LAWA 4L3NA 5GQBA 1ROTA 4W9QA 3G6LA 2P4VA 2MF9A 2KE0A 1FKBA 2O92A 3JYMA 1ZBVA 4Z2HA 2A3EA 3AQUA 3GTYX 3UI4A 4DZ3A 4IT6A 4JYSA 1M5YA 4ODOA 2FAPA 4ZS6A 1W9VA 1W1TA 4WIWA 4JFIA 1Y0OA 4DROA 1U79A 3IKDA 3WQVA 4Z2LA 1JNEA 1LL7A 2PBCA 1FKGA 2WLZA 1Q6IA 4JFMA 3KACA 3EIPA 1E15A 2G8ZA 1FKKA 4R0XA 2PV2A 2ETNA 4DWSD 3ARTA 2RSEA 1X6LA 2VCDA 3B9DA 3O5GA 4MNMA 1D7JA 1ZU8A 2F4EA 3B9AA 3ARRA 3O5KA 1GRJA 1IX5A 2WM0A 1KT1A 3TDBA 2EULA 2KI3A 2DSWA 2Q5AA 2DG4A 4XAKA 4MTVA 4ITZA 4JFJA 3WD1A 1CTNA 2DSUA 1F8AB 1R9HA 2WK2A 2LGOA 3O5JA 1BKFA 4ODLA 3B9EA 1UR8A 3WD4A 4DRNA 4WJXA 1H0GA 4P8UA 4O2TA 3PA7A 2OFNA 1LL4A 1GUVA 1QZ2A 4QZVB 1FKLA 1FJDA 3RM4A 2N87A 1FKJA 1D7HA 1N1AA 2F21A 4PTMA 3WD0A 4ZPVR 1KFWA 4W9OA 1XHGA 4P8XA 1TFVA 2ZQVA 4HARA 3UI5A 1JVWA 3I6CA 1FKDA 5I98A 3UQIA 1J4HA 4JFLA 2KGJA 2RUDA 1J6YA 2M2AA 3NTPA 3ARXA 5HWBA 4DWSB 4IT4A 1HKKA 2ZR4A 3OOBA 2DT0A 5HWCA 2KR7A 2DPEA 2LKNA 4TW7A 5JH8A 2B5UB 2UZ5A 3AS0A 1T11A 4HBOA 1K9TA 2PV3A 3KZ7A 3RFWA 4S3KA 1W26A 2ZQUA 1XRVA 1LG2A 1WNOA 4DRPA 4NZCA 3PRDA 1JNDA 4N19A 4TX0A 1NWUA 3ALGA 4GGQA 4ZPWR 1YATA 1Q1CA 4TW6A 4DWSA 3KAFA 4P8WA 5DO2A 1NMVA 3KADA 3CGMA 2PPNA 4QT2A 3ARYA 3ODKA 1F40A 1E9LA 4Z2JA 3MDYB 1GPFA 2XP9A 4U84A 2DT2A 1WAWA 4ODQA 3ARSA 2XP7A 3B8SA 3VAWA 4J4NA 1NWTA 4WK9A 3CHFA 1FKIA 2XPBA 2F23A 4QT3A 1HXVA 1D7IA 5HTGA 3ARVA 4IQ2A 5J6EA 1E6NA 4FN2A 4G2PA 1W1YA 5HW8A 2O9OA 4Z2IA 2DSVA 1NH6A 4BF8A 1VF8A 3CH9A 4W9PA 2PPPA 3JXVA 2RUCA 3CHDA 4DWSC 3O5QA 3CHEA 4Q22A 4W5UA 3O5DA 1FKSA 3FY1A 2OLHA 3KABA 3AS2A 2YBUA 1FKRA 1FAPA 1EIBA 1X6NA 2XP8A 4GIVA 2DG9A 4QIBA
chains in the Genus database with same CATH topology
1FFRA 2ZR5A 2YBTA 1H0IA 3EY6A 3KAHA 3FXYA 3PR9A 3CHCA 1E6ZA 1FD9A 2IF4A 5DITA 1W1PA 2DSZA 5B8IC 3IK8A 3WKZA 1ZL1A 1SYTA 2L2SA 5GPGA 1L1PA 1NWSA 4MNJA 1YW5A 3PRAA 2ESCA 1P5QA 2XPAA 3RM9A 4MNLA 1ZBKA 5GPRA 1TCOC 1LL6A 4DZ2A 1UR9A 1WB0A 3H9RB 2PV1A 3O5IA 4S3JA 3TCZA 3UQBA 5D75A 3O5EA 3NI6A 4U86A 5HBFA 3ARWA 4ODPA 3TC5A 2FDMA 1JNTA 4MPKA 1ITXA 4LAXA 5HW6A 3ARPA 1J4IA 1ZK6A 3RMEA 5HUAA 4TYOA 1ZB5A 2ZQTA 4AY1A 2XP3A 2Y78A 5DIUA 3CGNA 1GOIA 2LJ4A 3BXWA 2M1IA 1W9PA 1LG1A 2DG3A 3IHZA 5DIVA 3AROA 4HBEA 4DRHA 4TNSA 2A3AA 2MPHA 4DRIA 1HJXA 3ARQA 2G41A 2F2DA 2ZR6A 4MGVA 4KQZA 1KT0A 3FAPA 1Q6UA 3WD3A 4DRQA 1E6PA 3NRKA 1HJVA 4NSBA 1PBKA 2WLYA 1FKHA 1EDQA 2FKEA 1OGGA 2XP4A 4ML4A 1OGBA 4ODNA 3O5PA 3UF8A 4WKHA 1FKFA 2DT1A 4URIA 1EQ3A 2M08A 1PINA 4MSPA 3RM8A 4P8VA 2A3CA 2XP5A 3WQWA 4LAYA 1ZBWA 3QOKA 2MLXA 1LQ0A 3LUOA 4DRMA 2MLZA 3PRBA 4NNRA 3O5FA 4U85A 5HW7A 1W1VA 4C02B 2PI6A 4DIPA 3O5LA 4L72B 3WIJA 4G50A 1C9HA 1RD6A 2K8IA 2MLYA 1OWQA 1FKTA 1QPLA 2B31A 2AOSA 2QF8A 1ZCNA 4DRJA 3O5RA 2XP6A 3ARUA 1J4RA 3B7XA 2PPOA 2VN1A 4LGXA 4Z2KA 3W4RA 2RUQA 1D6OA 2KO7A 3UI6A 4MAVA 1W9UA 4MNKA 1HKIA 4IPXA 2KFWA 1ROUA 1HKJA 4KR0B 4ZPTR 3ARZA 5DF0A 1A7XA 5HT1A 3IKGA 4J4OA 4R5EA 3RGCA 2ZQSA 3KCEA 3KAIA 4JFKA 3G6MA 2LPVA 3WL1A 1EHNA 2RQSA 3WD2A 2D9FA 4TW8A 2ITKA 3GPKA 4DT4A 1BL4A 4DRKA 4IQCA 1B6CA 4LAVA 1HKMA 1NMWA 3OA5A 3WH0A 4WKAA 4FAPA 2MNTA 3O5MA 4Q7NA 3AS3A 1HJWA 2JZVA 1SR0A 4ODKA 3WL0A 5HKGA 2A3BA 1O6IA 1FFQA 3CZ8A 1LJYA 1QPFA 3ALFA 4Z2GA 3AS1A 1JNSA 4ODRA 1Q6HA 2RURA 1NSGA 1D2KA 4WKFA 3JYJA 1EYMA 5DEZA 3UQAA 3O5OA 1E6RA 4ODMA 1ZBCA 2DT3A 5BXJA 3KAGA 1NWRA 2IUZA 4DH0A 2AWGA 4LAWA 4L3NA 5GQBA 1ROTA 4W9QA 3G6LA 2MF9A 2KE0A 1FKBA 2O92A 3JYMA 1ZBVA 4Z2HA 2A3EA 3AQUA 3UI4A 4DZ3A 4IT6A 4JYSA 1M5YA 4ODOA 2FAPA 4ZS6A 1W9VA 1W1TA 4WIWA 4JFIA 1Y0OA 4DROA 1U79A 3IKDA 3WQVA 4Z2LA 1JNEA 1LL7A 2PBCA 1FKGA 2WLZA 1Q6IA 4JFMA 3KACA 1E15A 2G8ZA 1FKKA 4R0XA 2PV2A 4DWSD 3ARTA 2RSEA 1X6LA 2VCDA 3B9DA 3O5GA 4MNMA 1D7JA 1ZU8A 2F4EA 3B9AA 3ARRA 3O5KA 1IX5A 2WM0A 1KT1A 3TDBA 2KI3A 2DSWA 2Q5AA 2DG4A 4XAKA 4MTVA 4ITZA 4JFJA 3WD1A 1CTNA 2DSUA 1F8AB 1R9HA 2WK2A 2LGOA 3O5JA 1BKFA 4ODLA 3B9EA 1UR8A 3WD4A 4DRNA 4WJXA 1H0GA 4P8UA 4O2TA 3PA7A 2OFNA 1LL4A 1GUVA 1QZ2A 4QZVB 1FKLA 1FJDA 3RM4A 2N87A 1FKJA 1D7HA 1N1AA 2F21A 4PTMA 3WD0A 4ZPVR 1KFWA 4W9OA 1XHGA 4P8XA 1TFVA 2ZQVA 4HARA 3UI5A 1JVWA 3I6CA 1FKDA 5I98A 3UQIA 1J4HA 4JFLA 2KGJA 2RUDA 1J6YA 2M2AA 3NTPA 3ARXA 5HWBA 4DWSB 4IT4A 1HKKA 2ZR4A 3OOBA 2DT0A 5HWCA 2KR7A 2DPEA 2LKNA 4TW7A 5JH8A 2UZ5A 3AS0A 1T11A 4HBOA 1K9TA 2PV3A 3KZ7A 3RFWA 4S3KA 1W26A 2ZQUA 1XRVA 1LG2A 1WNOA 4DRPA 4NZCA 3PRDA 1JNDA 4N19A 4TX0A 1NWUA 3ALGA 4GGQA 4ZPWR 1YATA 1Q1CA 4TW6A 4DWSA 3KAFA 4P8WA 5DO2A 1NMVA 3KADA 3CGMA 2PPNA 4QT2A 3ARYA 3ODKA 1F40A 1E9LA 4Z2JA 3MDYB 1GPFA 2XP9A 4U84A 2DT2A 1WAWA 4ODQA 3ARSA 2XP7A 3B8SA 3VAWA 4J4NA 1NWTA 4WK9A 3CHFA 1FKIA 2XPBA 4QT3A 1HXVA 1D7IA 5HTGA 3ARVA 4IQ2A 5J6EA 1E6NA 4FN2A 4G2PA 1W1YA 5HW8A 2O9OA 4Z2IA 2DSVA 1NH6A 4BF8A 1VF8A 3CH9A 4W9PA 2PPPA 3JXVA 2RUCA 3CHDA 4DWSC 3O5QA 3CHEA 4Q22A 4W5UA 3O5DA 1FKSA 3FY1A 2OLHA 3KABA 3AS2A 2YBUA 1FKRA 1FAPA 1EIBA 1X6NA 2XP8A 4GIVA 2DG9A 4QIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5P A;  5BXJ A;  2ZQV A;  3UI5 A;  1JVW A;  3KAG A;  3I6C A;  3UF8 A;  2ZR5 A;  1FKF A;  1FKD A;  5I98 A;  4DH0 A;  3UQI A;  1EQ3 A;  2AWG A;  3EY6 A;  3KAH A;  4LAW A;  2M08 A;  1PIN A;  1ROT A;  4MSP A;  1J4H A;  4JFL A;  2KGJ A;  2RUD A;  4W9Q A;  2XP5 A;  1J6Y A;  2M2A A;  2MF9 A;  2KE0 A;  1FKB A;  3JYM A;  3NTP A;  4LAY A;  1FD9 A;  2IF4 A;  5HWB A;  5DIT A;  2ZR4 A;  2MLX A;  3OOB A;  3UI4 A;  4DZ3 A;  3IK8 A;  5B8I C;  4JYS A;  1M5Y A;  3LUO A;  2KR7 A;  2L2S A;  2LKN A;  4TW7 A;  5GPG A;  4DRM A;  4ODO A;  5HWC A;  1L1P A;  2MLZ A;  3PRB A;  4NNR A;  2UZ5 A;  2FAP A;  3O5F A;  4U85 A;  4C02 B;  4DIP A;  5HW7 A;  1T11 A;  1YW5 A;  3O5L A;  1P5Q A;  2XPA A;  4G50 A;  1C9H A;  4JFI A;  2PV3 A;  2K8I A;  1Y0O A;  1U79 A;  2MLY A;  1FKT A;  1QPL A;  3IKD A;  3KZ7 A;  3RFW A;  1W26 A;  2ZQU A;  1ZCN A;  4DRJ A;  1TCO C;  3O5R A;  2PBC A;  4DRP A;  4DZ2 A;  3H9R B;  2XP6 A;  1FKG A;  3B7X A;  1J4R A;  1Q6I A;  2PPO A;  2VN1 A;  3PRD A;  4N19 A;  4TX0 A;  2PV1 A;  3O5I A;  3TCZ A;  3UQB A;  2RUQ A;  1D6O A;  5D75 A;  4GGQ A;  2KO7 A;  3O5E A;  3NI6 A;  3UI6 A;  4U86 A;  1YAT A;  1Q1C A;  4TW6 A;  4JFM A;  3KAC A;  4IPX A;  2KFW A;  3KAF A;  1FKK A;  1ROU A;  4ODP A;  3TC5 A;  1JNT A;  4R0X A;  4DRO A;  1NMV A;  1A7X A;  4LAX A;  3KAD A;  3CGM A;  2PPN A;  2PV2 A;  3IKG A;  4QT2 A;  3ODK A;  5HT1 A;  4J4O A;  1F40 A;  5HW6 A;  3MDY B;  1J4I A;  3RGC A;  2ZQS A;  2RSE A;  3KCE A;  1ZK6 A;  2VCD A;  2XP9 A;  4U84 A;  3KAI A;  3O5G A;  4JFK A;  1D7J A;  4TYO A;  5HUA A;  2F4E A;  2LPV A;  3O5K A;  4ODQ A;  2RQS A;  2ZQT A;  2D9F A;  2XP3 A;  2Y78 A;  5DIU A;  4TW8 A;  2ITK A;  3CGN A;  2XP7 A;  3GPK A;  3VAW A;  4DT4 A;  1KT1 A;  1BL4 A;  4J4N A;  3TDB A;  4DRK A;  4IQC A;  2KI3 A;  1B6C A;  2LJ4 A;  4LAV A;  2M1I A;  2Q5A A;  1FKI A;  1NMW A;  2DG4 A;  2XPB A;  4ITZ A;  4JFJ A;  3WH0 A;  4QT3 A;  2DG3 A;  3IHZ A;  1HXV A;  1D7I A;  5HTG A;  4IQ2 A;  5J6E A;  4FAP A;  4FN2 A;  5DIV A;  1F8A B;  1R9H A;  2MNT A;  4DRH A;  4G2P A;  3O5M A;  2LGO A;  3O5J A;  5HW8 A;  1BKF A;  4TNS A;  2JZV A;  4ODL A;  2MPH A;  4ODK A;  4DRI A;  5HKG A;  4BF8 A;  4DRN A;  2F2D A;  4O2T A;  2ZR6 A;  1QPF A;  4MGV A;  4W9P A;  2PPP A;  3PA7 A;  1KT0 A;  3FAP A;  1Q6U A;  3JXV A;  4ODR A;  1Q6H A;  1JNS A;  4DRQ A;  2RUR A;  2RUC A;  2OFN A;  3NRK A;  1NSG A;  3O5Q A;  1QZ2 A;  3O5D A;  3JYJ A;  1EYM A;  1PBK A;  1FKL A;  1FKS A;  1FJD A;  3UQA A;  2N87 A;  3KAB A;  3O5O A;  1FKH A;  1FKJ A;  1D7H A;  1N1A A;  2F21 A;  2FKE A;  1FKR A;  1FAP A;  4ODM A;  2XP4 A;  2XP8 A;  4GIV A;  4ODN A;  2DG9 A;  4W9O A;  4QIB A; 
#chains in the Genus database with same CATH topology
 1FFR A;  2ZR5 A;  2YBT A;  1H0I A;  3EY6 A;  3KAH A;  3FXY A;  3PR9 A;  3CHC A;  1E6Z A;  1FD9 A;  2IF4 A;  5DIT A;  1W1P A;  2DSZ A;  5B8I C;  3IK8 A;  3WKZ A;  1ZL1 A;  1SYT A;  2L2S A;  5GPG A;  1L1P A;  1NWS A;  4MNJ A;  1YW5 A;  3PRA A;  2ESC A;  1P5Q A;  2XPA A;  3RM9 A;  4MNL A;  1ZBK A;  5GPR A;  1TCO C;  1LL6 A;  4DZ2 A;  1UR9 A;  1WB0 A;  3H9R B;  2PV1 A;  3O5I A;  4S3J A;  3TCZ A;  3UQB A;  5D75 A;  3O5E A;  3NI6 A;  4U86 A;  5HBF A;  3ARW A;  4ODP A;  3TC5 A;  2FDM A;  1JNT A;  4MPK A;  1ITX A;  4LAX A;  5HW6 A;  3ARP A;  1J4I A;  1ZK6 A;  3RME A;  5HUA A;  4TYO A;  1ZB5 A;  2ZQT A;  4AY1 A;  2XP3 A;  2Y78 A;  5DIU A;  3CGN A;  1GOI A;  2LJ4 A;  3BXW A;  2M1I A;  1W9P A;  1LG1 A;  2DG3 A;  3IHZ A;  5DIV A;  3ARO A;  4HBE A;  4DRH A;  4TNS A;  2A3A A;  2MPH A;  4DRI A;  1HJX A;  3ARQ A;  2G41 A;  2F2D A;  2ZR6 A;  4MGV A;  4KQZ A;  1KT0 A;  3FAP A;  1Q6U A;  3WD3 A;  4DRQ A;  1E6P A;  3NRK A;  1HJV A;  4NSB A;  1PBK A;  2PN0 A;  2WLY A;  3GU0 A;  1FKH A;  1EDQ A;  2FKE A;  1OGG A;  2XP4 A;  4ML4 A;  1OGB A;  4ODN A;  3O5P A;  3UF8 A;  4WKH A;  1FKF A;  2DT1 A;  4URI A;  1EQ3 A;  2M08 A;  1PIN A;  4MSP A;  3RM8 A;  4P8V A;  2A3C A;  2XP5 A;  3WQW A;  4LAY A;  1ZBW A;  3QOK A;  2MLX A;  1LQ0 A;  3LUO A;  4DRM A;  2MLZ A;  3PRB A;  4NNR A;  3O5F A;  4U85 A;  5HW7 A;  1W1V A;  4C02 B;  2PI6 A;  4DIP A;  3O5L A;  4L72 B;  3WIJ A;  4G50 A;  1C9H A;  1RD6 A;  2K8I A;  2MLY A;  1OWQ A;  1FKT A;  1QPL A;  2B31 A;  2AOS A;  2QF8 A;  1ZCN A;  4DRJ A;  3O5R A;  2XP6 A;  3ARU A;  1J4R A;  3B7X A;  2PPO A;  2VN1 A;  4LGX A;  4Z2K A;  3W4R A;  2RUQ A;  1D6O A;  2KO7 A;  4UDM A;  3UI6 A;  4MAV A;  1W9U A;  4MNK A;  1HKI A;  4IPX A;  2KFW A;  1ROU A;  1HKJ A;  4KR0 B;  4ZPT R;  3ARZ A;  5DF0 A;  1A7X A;  5HT1 A;  3IKG A;  4J4O A;  4R5E A;  3RGC A;  2ZQS A;  3KCE A;  3KAI A;  4JFK A;  3G6M A;  2LPV A;  3WL1 A;  1JCH B;  1EHN A;  2RQS A;  3WD2 A;  2D9F A;  4TW8 A;  2ITK A;  3BMB A;  3GPK A;  4DT4 A;  1BL4 A;  4DRK A;  4IQC A;  1B6C A;  4LAV A;  1HKM A;  1NMW A;  3OA5 A;  3WH0 A;  1E44 A;  4WKA A;  4FAP A;  2MNT A;  3O5M A;  4Q7N A;  3AS3 A;  1HJW A;  2JZV A;  1SR0 A;  4ODK A;  3WL0 A;  5HKG A;  2A3B A;  1O6I A;  1FFQ A;  3CZ8 A;  1LJY A;  1QPF A;  3ALF A;  4Z2G A;  3AS1 A;  1JNS A;  4ODR A;  1Q6H A;  2RUR A;  1NSG A;  1D2K A;  4WKF A;  3JYJ A;  1EYM A;  5DEZ A;  3UQA A;  3O5O A;  1E6R A;  4ODM A;  1ZBC A;  2DT3 A;  5BXJ A;  3KAG A;  1NWR A;  2IUZ A;  4DH0 A;  2AWG A;  4LAW A;  4L3N A;  5GQB A;  1ROT A;  4W9Q A;  3G6L A;  2P4V A;  2MF9 A;  2KE0 A;  1FKB A;  2O92 A;  3JYM A;  1ZBV A;  4Z2H A;  2A3E A;  3AQU A;  3GTY X;  3UI4 A;  4DZ3 A;  4IT6 A;  4JYS A;  1M5Y A;  4ODO A;  2FAP A;  4ZS6 A;  1W9V A;  1W1T A;  4WIW A;  4JFI A;  1Y0O A;  4DRO A;  1U79 A;  3IKD A;  3WQV A;  4Z2L A;  1JNE A;  1LL7 A;  2PBC A;  1FKG A;  2WLZ A;  1Q6I A;  4JFM A;  3KAC A;  3EIP A;  1E15 A;  2G8Z A;  1FKK A;  4R0X A;  2PV2 A;  2ETN A;  4DWS D;  3ART A;  2RSE A;  1X6L A;  2VCD A;  3B9D A;  3O5G A;  4MNM A;  1D7J A;  1ZU8 A;  2F4E A;  3B9A A;  3ARR A;  3O5K A;  1GRJ A;  1IX5 A;  2WM0 A;  1KT1 A;  3TDB A;  2EUL A;  2KI3 A;  2DSW A;  2Q5A A;  2DG4 A;  4XAK A;  4MTV A;  4ITZ A;  4JFJ A;  3WD1 A;  1CTN A;  2DSU A;  1F8A B;  1R9H A;  2WK2 A;  2LGO A;  3O5J A;  1BKF A;  4ODL A;  3B9E A;  1UR8 A;  3WD4 A;  4DRN A;  4WJX A;  1H0G A;  4P8U A;  4O2T A;  3PA7 A;  2OFN A;  1LL4 A;  1GUV A;  1QZ2 A;  4QZV B;  1FKL A;  1FJD A;  3RM4 A;  2N87 A;  1FKJ A;  1D7H A;  1N1A A;  2F21 A;  4PTM A;  3WD0 A;  4ZPV R;  1KFW A;  4W9O A;  1XHG A;  4P8X A;  1TFV A;  2ZQV A;  4HAR A;  3UI5 A;  1JVW A;  3I6C A;  1FKD A;  5I98 A;  3UQI A;  1J4H A;  4JFL A;  2KGJ A;  2RUD A;  1J6Y A;  2M2A A;  3NTP A;  3ARX A;  5HWB A;  4DWS B;  4IT4 A;  1HKK A;  2ZR4 A;  3OOB A;  2DT0 A;  5HWC A;  2KR7 A;  2DPE A;  2LKN A;  4TW7 A;  5JH8 A;  2B5U B;  2UZ5 A;  3AS0 A;  1T11 A;  4HBO A;  1K9T A;  2PV3 A;  3KZ7 A;  3RFW A;  4S3K A;  1W26 A;  2ZQU A;  1XRV A;  1LG2 A;  1WNO A;  4DRP A;  4NZC A;  3PRD A;  1JND A;  4N19 A;  4TX0 A;  1NWU A;  3ALG A;  4GGQ A;  4ZPW R;  1YAT A;  1Q1C A;  4TW6 A;  4DWS A;  3KAF A;  4P8W A;  5DO2 A;  1NMV A;  3KAD A;  3CGM A;  2PPN A;  4QT2 A;  3ARY A;  3ODK A;  1F40 A;  1E9L A;  4Z2J A;  3MDY B;  1GPF A;  2XP9 A;  4U84 A;  2DT2 A;  1WAW A;  4ODQ A;  3ARS A;  2XP7 A;  3B8S A;  3VAW A;  4J4N A;  1NWT A;  4WK9 A;  3CHF A;  1FKI A;  2XPB A;  2F23 A;  4QT3 A;  1HXV A;  1D7I A;  5HTG A;  3ARV A;  4IQ2 A;  5J6E A;  1E6N A;  4FN2 A;  4G2P A;  1W1Y A;  5HW8 A;  2O9O A;  4Z2I A;  2DSV A;  1NH6 A;  4BF8 A;  1VF8 A;  3CH9 A;  4W9P A;  2PPP A;  3JXV A;  2RUC A;  3CHD A;  4DWS C;  3O5Q A;  3CHE A;  4Q22 A;  4W5U A;  3O5D A;  1FKS A;  3FY1 A;  2OLH A;  3KAB A;  3AS2 A;  2YBU A;  1FKR A;  1FAP A;  1EIB A;  1X6N A;  2XP8 A;  4GIV A;  2DG9 A;  4QIB A; 
#chains in the Genus database with same CATH homology
 1FFR A;  2ZR5 A;  2YBT A;  1H0I A;  3EY6 A;  3KAH A;  3FXY A;  3PR9 A;  3CHC A;  1E6Z A;  1FD9 A;  2IF4 A;  5DIT A;  1W1P A;  2DSZ A;  5B8I C;  3IK8 A;  3WKZ A;  1ZL1 A;  1SYT A;  2L2S A;  5GPG A;  1L1P A;  1NWS A;  4MNJ A;  1YW5 A;  3PRA A;  2ESC A;  1P5Q A;  2XPA A;  3RM9 A;  4MNL A;  1ZBK A;  5GPR A;  1TCO C;  1LL6 A;  4DZ2 A;  1UR9 A;  1WB0 A;  3H9R B;  2PV1 A;  3O5I A;  4S3J A;  3TCZ A;  3UQB A;  5D75 A;  3O5E A;  3NI6 A;  4U86 A;  5HBF A;  3ARW A;  4ODP A;  3TC5 A;  2FDM A;  1JNT A;  4MPK A;  1ITX A;  4LAX A;  5HW6 A;  3ARP A;  1J4I A;  1ZK6 A;  3RME A;  5HUA A;  4TYO A;  1ZB5 A;  2ZQT A;  4AY1 A;  2XP3 A;  2Y78 A;  5DIU A;  3CGN A;  1GOI A;  2LJ4 A;  3BXW A;  2M1I A;  1W9P A;  1LG1 A;  2DG3 A;  3IHZ A;  5DIV A;  3ARO A;  4HBE A;  4DRH A;  4TNS A;  2A3A A;  2MPH A;  4DRI A;  1HJX A;  3ARQ A;  2G41 A;  2F2D A;  2ZR6 A;  4MGV A;  4KQZ A;  1KT0 A;  3FAP A;  1Q6U A;  3WD3 A;  4DRQ A;  1E6P A;  3NRK A;  1HJV A;  4NSB A;  1PBK A;  2WLY A;  1FKH A;  1EDQ A;  2FKE A;  1OGG A;  2XP4 A;  4ML4 A;  1OGB A;  4ODN A;  3O5P A;  3UF8 A;  4WKH A;  1FKF A;  2DT1 A;  4URI A;  1EQ3 A;  2M08 A;  1PIN A;  4MSP A;  3RM8 A;  4P8V A;  2A3C A;  2XP5 A;  3WQW A;  4LAY A;  1ZBW A;  3QOK A;  2MLX A;  1LQ0 A;  3LUO A;  4DRM A;  2MLZ A;  3PRB A;  4NNR A;  3O5F A;  4U85 A;  5HW7 A;  1W1V A;  4C02 B;  2PI6 A;  4DIP A;  3O5L A;  4L72 B;  3WIJ A;  4G50 A;  1C9H A;  1RD6 A;  2K8I A;  2MLY A;  1OWQ A;  1FKT A;  1QPL A;  2B31 A;  2AOS A;  2QF8 A;  1ZCN A;  4DRJ A;  3O5R A;  2XP6 A;  3ARU A;  1J4R A;  3B7X A;  2PPO A;  2VN1 A;  4LGX A;  4Z2K A;  3W4R A;  2RUQ A;  1D6O A;  2KO7 A;  3UI6 A;  4MAV A;  1W9U A;  4MNK A;  1HKI A;  4IPX A;  2KFW A;  1ROU A;  1HKJ A;  4KR0 B;  4ZPT R;  3ARZ A;  5DF0 A;  1A7X A;  5HT1 A;  3IKG A;  4J4O A;  4R5E A;  3RGC A;  2ZQS A;  3KCE A;  3KAI A;  4JFK A;  3G6M A;  2LPV A;  3WL1 A;  1EHN A;  2RQS A;  3WD2 A;  2D9F A;  4TW8 A;  2ITK A;  3GPK A;  4DT4 A;  1BL4 A;  4DRK A;  4IQC A;  1B6C A;  4LAV A;  1HKM A;  1NMW A;  3OA5 A;  3WH0 A;  4WKA A;  4FAP A;  2MNT A;  3O5M A;  4Q7N A;  3AS3 A;  1HJW A;  2JZV A;  1SR0 A;  4ODK A;  3WL0 A;  5HKG A;  2A3B A;  1O6I A;  1FFQ A;  3CZ8 A;  1LJY A;  1QPF A;  3ALF A;  4Z2G A;  3AS1 A;  1JNS A;  4ODR A;  1Q6H A;  2RUR A;  1NSG A;  1D2K A;  4WKF A;  3JYJ A;  1EYM A;  5DEZ A;  3UQA A;  3O5O A;  1E6R A;  4ODM A;  1ZBC A;  2DT3 A;  5BXJ A;  3KAG A;  1NWR A;  2IUZ A;  4DH0 A;  2AWG A;  4LAW A;  4L3N A;  5GQB A;  1ROT A;  4W9Q A;  3G6L A;  2MF9 A;  2KE0 A;  1FKB A;  2O92 A;  3JYM A;  1ZBV A;  4Z2H A;  2A3E A;  3AQU A;  3UI4 A;  4DZ3 A;  4IT6 A;  4JYS A;  1M5Y A;  4ODO A;  2FAP A;  4ZS6 A;  1W9V A;  1W1T A;  4WIW A;  4JFI A;  1Y0O A;  4DRO A;  1U79 A;  3IKD A;  3WQV A;  4Z2L A;  1JNE A;  1LL7 A;  2PBC A;  1FKG A;  2WLZ A;  1Q6I A;  4JFM A;  3KAC A;  1E15 A;  2G8Z A;  1FKK A;  4R0X A;  2PV2 A;  4DWS D;  3ART A;  2RSE A;  1X6L A;  2VCD A;  3B9D A;  3O5G A;  4MNM A;  1D7J A;  1ZU8 A;  2F4E A;  3B9A A;  3ARR A;  3O5K A;  1IX5 A;  2WM0 A;  1KT1 A;  3TDB A;  2KI3 A;  2DSW A;  2Q5A A;  2DG4 A;  4XAK A;  4MTV A;  4ITZ A;  4JFJ A;  3WD1 A;  1CTN A;  2DSU A;  1F8A B;  1R9H A;  2WK2 A;  2LGO A;  3O5J A;  1BKF A;  4ODL A;  3B9E A;  1UR8 A;  3WD4 A;  4DRN A;  4WJX A;  1H0G A;  4P8U A;  4O2T A;  3PA7 A;  2OFN A;  1LL4 A;  1GUV A;  1QZ2 A;  4QZV B;  1FKL A;  1FJD A;  3RM4 A;  2N87 A;  1FKJ A;  1D7H A;  1N1A A;  2F21 A;  4PTM A;  3WD0 A;  4ZPV R;  1KFW A;  4W9O A;  1XHG A;  4P8X A;  1TFV A;  2ZQV A;  4HAR A;  3UI5 A;  1JVW A;  3I6C A;  1FKD A;  5I98 A;  3UQI A;  1J4H A;  4JFL A;  2KGJ A;  2RUD A;  1J6Y A;  2M2A A;  3NTP A;  3ARX A;  5HWB A;  4DWS B;  4IT4 A;  1HKK A;  2ZR4 A;  3OOB A;  2DT0 A;  5HWC A;  2KR7 A;  2DPE A;  2LKN A;  4TW7 A;  5JH8 A;  2UZ5 A;  3AS0 A;  1T11 A;  4HBO A;  1K9T A;  2PV3 A;  3KZ7 A;  3RFW A;  4S3K A;  1W26 A;  2ZQU A;  1XRV A;  1LG2 A;  1WNO A;  4DRP A;  4NZC A;  3PRD A;  1JND A;  4N19 A;  4TX0 A;  1NWU A;  3ALG A;  4GGQ A;  4ZPW R;  1YAT A;  1Q1C A;  4TW6 A;  4DWS A;  3KAF A;  4P8W A;  5DO2 A;  1NMV A;  3KAD A;  3CGM A;  2PPN A;  4QT2 A;  3ARY A;  3ODK A;  1F40 A;  1E9L A;  4Z2J A;  3MDY B;  1GPF A;  2XP9 A;  4U84 A;  2DT2 A;  1WAW A;  4ODQ A;  3ARS A;  2XP7 A;  3B8S A;  3VAW A;  4J4N A;  1NWT A;  4WK9 A;  3CHF A;  1FKI A;  2XPB A;  4QT3 A;  1HXV A;  1D7I A;  5HTG A;  3ARV A;  4IQ2 A;  5J6E A;  1E6N A;  4FN2 A;  4G2P A;  1W1Y A;  5HW8 A;  2O9O A;  4Z2I A;  2DSV A;  1NH6 A;  4BF8 A;  1VF8 A;  3CH9 A;  4W9P A;  2PPP A;  3JXV A;  2RUC A;  3CHD A;  4DWS C;  3O5Q A;  3CHE A;  4Q22 A;  4W5U A;  3O5D A;  1FKS A;  3FY1 A;  2OLH A;  3KAB A;  3AS2 A;  2YBU A;  1FKR A;  1FAP A;  1EIB A;  1X6N A;  2XP8 A;  4GIV A;  2DG9 A;  4QIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...