1FKFA

Atomic structure of fkbp-fk506, an immunophilin-immunosuppressant complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FK506 BINDING PROTEIN
publication title Atomic structure of FKBP-FK506, an immunophilin-immunosuppressant complex.
pubmed rcsb
source organism Homo sapiens
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1991-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkfA00
3H9RB 5HW8A 1JNTA 3IKGA 2XP7A 2KR7A 2PPOA 4LAXA 2Q5AA 1J4HA 1FKGA 1NMWA 2KFWA 4ODOA 4TW8A 3KABA 2JZVA 4JFKA 1ROTA 3IKDA 2F2DA 2MPHA 3B7XA 1D7IA 2AWGA 4GGQA 2MLYA 3PRBA 1FD9A 4ODRA 5BXJA 2PPNA 2MLZA 3KAGA 2ITKA 3RGCA 3WH0A 3NRKA 4DRKA 4G2PA 1P5QA 3KAHA 4LAVA 2FKEA 3I6CA 1NSGA 1D7HA 2RURA 5HW6A 1HXVA 3O5IA 3MDYB 2ZQTA 1A7XA 1QPFA 3UI6A 5DITA 3O5JA 3UQBA 2MNTA 2DG3A 1F40A 3IK8A 4U85A 5HW7A 4J4NA 4MSPA 4ODLA 3O5KA 1J4IA 2KGJA 5DIVA 5GPGA 1FKKA 1Y0OA 5HWBA 2DG9A 3O5EA 3UI5A 3EY6A 3TC5A 3UQIA 4IQ2A 2RSEA 4N19A 2XP9A 2F21A 3O5DA 2RUQA 2ZQVA 4O2TA 1FKTA 4ITZA 1J4RA 1R9HA 4DH0A 3KCEA 3KADA 3O5RA 2M1IA 1YATA 3VAWA 1EYMA 4BF8A 2ZQSA 4QT2A 4JFJA 2M08A 4DRQA 5HTGA 1FKRA 2XPAA 1ROUA 3JXVA 3KAFA 2VN1A 3FAPA 3O5FA 4FN2A 2N87A 3O5QA 1J6YA 1FKFA 3PRDA 4DRJA 4DRIA 3LUOA 1Q6UA 2FAPA 4IPXA 4ODKA 2ZQUA 2LJ4A 4IQCA 1BKFA 1FKLA 1D6OA 2Y78A 1PBKA 4DZ3A 2KI3A 4JYSA 4DT4A 1YW5A 2MF9A 2PV1A 3OOBA 4G50A 1FAPA 3RFWA 3CGMA 3O5MA 5HUAA 1T11A 4DIPA 3O5LA 2D9FA 2XPBA 2LGOA 3NI6A 3JYMA 1PINA 4R0XA 5HT1A 4QIBA 1N1AA 1Q6IA 2PV3A 3IHZA 4U84A 1L1PA 4JFMA 5DIUA 1FKIA 4W9OA 2RUCA 1QZ2A 3ODKA 2PBCA 1FKJA 4DRNA 4ODMA 2DG4A 4TNSA 1NMVA 2IF4A 2ZR6A 3GPKA 2PPPA 3KZ7A 1TCOC 2ZR4A 3O5PA 1Q6HA 2L2SA 2OFNA 4TX0A 2LKNA 3TDBA 3KAIA 3CGNA 4DRHA 1U79A 3O5GA 2ZR5A 1M5YA 4ODNA 3UF8A 2XP6A 4JFLA 4TYOA 4W9QA 2XP5A 4DZ2A 2K8IA 3O5OA 3NTPA 5HWCA 5I98A 5D75A 3PA7A 3UQAA 3TCZA 2XP4A 1KT1A 2KO7A 1W26A 4LAWA 4MGVA 1Q1CA 2F4EA 4C02B 2RUDA 4ODQA 2LPVA 1ZK6A 3JYJA 4DROA 5J6EA 4FAPA 4ODPA 2MLXA 2XP8A 1FJDA 5HKGA 1JVWA 2M2AA 1D7JA 1KT0A 1QPLA 2UZ5A 3KACA 4LAYA 4TW6A 4DRPA 1ZCNA 1JNSA 1FKBA 2XP3A 1C9HA 3UI4A 1B6CA 2VCDA 1F8AB 4QT3A 4J4OA 1EQ3A 4U86A 1BL4A 5B8IC 2PV2A 4NNRA 1FKHA 4GIVA 4JFIA 1FKSA 4TW7A 4W9PA 4DRMA 2RQSA 2KE0A 1FKDA
chains in the Genus database with same CATH superfamily
3H9RB 1JNTA 4W5UA 1W1TA 4MNMA 1W1PA 4NSBA 3B9DA 2MPHA 3B7XA 4AY1A 3KAGA 2ITKA 2OLHA 4L3NA 3RGCA 4P8VA 2RURA 5HW6A 3ALFA 3MDYB 3AQUA 3AS2A 3O5JA 5DITA 4MSPA 2KGJA 4NZCA 1ITXA 4MTVA 3O5EA 4LGXA 3TC5A 2RSEA 3B9AA 1J4RA 1LL7A 1ZBCA 5HTGA 3FAPA 3O5QA 1E6PA 1FKFA 1HJVA 4DRJA 3ARSA 1GUVA 1NWSA 1XRVA 1PBKA 2DT1A 2MF9A 4S3JA 1ZBKA 4G50A 1O6IA 2XPBA 3NI6A 3JYMA 4IT6A 1Q6IA 3IHZA 2IUZA 5DIUA 1UR8A 2RUCA 1QZ2A 2PBCA 3ARVA 2DG4A 4WJXA 3ARYA 2OFNA 4TX0A 3CGNA 3EIPA 3O5GA 2ZR5A 5GQBA 4W9QA 2XP5A 1GRJA 1GPFA 1HKMA 3GU0A 3ARZA 4URIA 3ARWA 4DROA 5J6EA 1SR0A 2MLXA 2M2AA 4LAYA 2WLYA 3AROA 2A3EA 4WK9A 1E6NA 3WKZA 1X6NA 2AOSA 4W9PA 4Z2LA 1E6RA 4P8UA 3RMEA 1OGGA 3ALGA 4HARA 2G8ZA 2A3BA 4ODOA 4TW8A 4JFKA 3WL0A 4GGQA 5DO2A 2MLYA 1W1VA 2PPNA 2WLZA 1JCHB 1K9TA 3NRKA 1P5QA 4LAVA 1NH6A 1NSGA 1D7HA 2PN0A 1HXVA 2DT0A 2ZQTA 4DWSB 1ZBWA 2MNTA 2DG3A 4J4NA 4ODLA 5GPGA 5DIVA 4MAVA 4Q22A 1FKKA 3EY6A 3UQIA 4N19A 2XP9A 2PI6A 3O5DA 4O2TA 1W9UA 4DH0A 3CHEA 3KCEA 3O5RA 1YATA 3GTYX 1EYMA 4QT2A 1ROUA 5GPRA 4S3KA 3ARXA 1JNDA 1Q6UA 4MPKA 4DZ3A 1BKFA 2Y78A 1LG1A 1YW5A 1OGBA 2PV1A 3WQWA 1FAPA 2D9FA 4R0XA 4WKFA 2WK2A 5HT1A 2PV3A 2DSUA 1FKIA 1EHNA 4ML4A 3ARTA 1WNOA 3OA5A 4DRNA 4ODMA 5DF0A 4ZS6A 4KQZA 3KZ7A 2IF4A 2ZR6A 1E6ZA 3GPKA 3ARQA 1W9PA 3TDBA 1D2KA 2LKNA 3KAIA 3B9EA 4DZ2A 1XHGA 1TFVA 2G41A 1OWQA 3O5OA 5D75A 2DSZA 3B8SA 3AS3A 2DPEA 1KT1A 4P8WA 2F4EA 2RUDA 3BXWA 2DSWA 4FAPA 5HKGA 3KACA 1FFRA 1JNSA 1FKBA 1GOIA 1NWUA 1EQ3A 4U86A 5B8IC 4Z2KA 2DT3A 4JFIA 1VF8A 4UDMA 2RQSA 1ZU8A 2KE0A 1E44A 2PPOA 4Q7NA 3FXYA 2KFWA 3KABA 2JZVA 2WM0A 3IKDA 2F2DA 1H0GA 3WIJA 1HKKA 3PRBA 1FD9A 4ODRA 5BXJA 2MLZA 4DWSD 3WH0A 4DRKA 4G2PA 2FKEA 3O5IA 4ZPTR 1QPFA 1E15A 4IT4A 3UQBA 3IK8A 4DWSA 3O5KA 2QF8A 3PRAA 4IQ2A 2F21A 2ZQVA 4PTMA 4ITZA 1R9HA 1W1YA 3KADA 3CZ8A 4DWSC 4L72B 2ZQSA 2M08A 3AS1A 1FKRA 1EDQA 3JXVA 2VN1A 4XAKA 3WD1A 3ARRA 2ETNA 2N87A 3RM9A 3PRDA 4DRIA 3LUOA 2FAPA 4IPXA 2ZQUA 2LJ4A 4IQCA 4WKAA 2KI3A 4JYSA 4DT4A 3OOBA 1ZBVA 1FFQA 4Z2JA 5HUAA 3CGMA 3O5MA 4DIPA 2F23A 3CHDA 2LGOA 3RM4A 5HWBA 1E9LA 1N1AA 4U84A 4JFMA 4W9OA 3CH9A 1FKJA 1Q6HA 1LL4A 4DRHA 2P4VA 4HBEA 1M5YA 4ODNA 3UF8A 2XP6A 1HJXA 2EULA 4JFLA 2A3CA 4TYOA 3WL1A 2K8IA 2YBUA 5I98A 4MNLA 3PA7A 3UQAA 3TCZA 2XP4A 4Z2GA 2KO7A 3G6LA 3QOKA 4LAWA 1Q1CA 4ODQA 3WD2A 4ODPA 1FJDA 1LQ0A 1KT0A 1QPLA 2UZ5A 1ZCNA 2XP3A 1C9HA 3UI4A 2VCDA 4QT3A 4J4OA 1KFWA 2PV2A 1FKHA 4GIVA 1FKSA 1WAWA 1LG2A 4MNJA 5HW8A 3IKGA 2XP7A 2KR7A 4P8XA 4LAXA 2Q5AA 1J4HA 4MNKA 4ZPWR 1FKGA 1NMWA 5DEZA 1ROTA 3RM8A 3WD3A 1JNEA 1D7IA 2AWGA 4ZPVR 4Z2HA 3KAHA 3I6CA 3AS0A 4Z2IA 1ZB5A 4WKHA 1A7XA 3UI6A 1F40A 4KR0B 4U85A 5HW7A 2B5UB 1J4IA 2DSVA 2B31A 1Y0OA 2DG9A 3BMBA 3G6MA 3UI5A 1IX5A 3WD4A 2O92A 2O9OA 1HKJA 2RUQA 1FKTA 1UR9A 1NWTA 2YBTA 2M1IA 3VAWA 3CHFA 3PR9A 4BF8A 4JFJA 1X6LA 4DRQA 2XPAA 3KAFA 3O5FA 4FN2A 1J6YA 1ZL1A 1W9VA 4ODKA 1FKLA 2ESCA 1D6OA 4R5EA 3RFWA 1NWRA 1T11A 3O5LA 3FY1A 5HBFA 1PINA 1L1PA 4QIBA 1WB0A 1SYTA 4HBOA 1H0IA 3WD0A 3ODKA 4TNSA 1NMVA 3O5PA 2PPPA 1TCOC 2ZR4A 1HJWA 2L2SA 3CHCA 1U79A 4WIWA 1EIBA 3WQVA 2FDMA 3NTPA 5HWCA 5JH8A 1CTNA 1LJYA 2A3AA 1LL6A 1W26A 1HKIA 3ARPA 4MGVA 4C02B 2LPVA 1RD6A 1ZK6A 3JYJA 2XP8A 1JVWA 1D7JA 3W4RA 3ARUA 4TW6A 4DRPA 1B6CA 1F8AB 1BL4A 4NNRA 4QZVB 4TW7A 4DRMA 2DT2A 1FKDA
chains in the Genus database with same CATH topology
3H9RB 1JNTA 4W5UA 1W1TA 4MNMA 1W1PA 4NSBA 3B9DA 2MPHA 3B7XA 4AY1A 3KAGA 2ITKA 2OLHA 4L3NA 3RGCA 4P8VA 2RURA 5HW6A 3ALFA 3MDYB 3AQUA 3AS2A 3O5JA 5DITA 4MSPA 2KGJA 4NZCA 1ITXA 4MTVA 3O5EA 4LGXA 3TC5A 2RSEA 3B9AA 1J4RA 1LL7A 1ZBCA 5HTGA 3FAPA 3O5QA 1E6PA 1FKFA 1HJVA 4DRJA 3ARSA 1GUVA 1NWSA 1XRVA 1PBKA 2DT1A 2MF9A 4S3JA 1ZBKA 4G50A 1O6IA 2XPBA 3NI6A 3JYMA 4IT6A 1Q6IA 3IHZA 2IUZA 5DIUA 1UR8A 2RUCA 1QZ2A 2PBCA 3ARVA 2DG4A 4WJXA 3ARYA 2OFNA 4TX0A 3CGNA 3O5GA 5GQBA 2ZR5A 4W9QA 2XP5A 1GPFA 1HKMA 3ARZA 4URIA 3ARWA 4DROA 5J6EA 1SR0A 2MLXA 2M2AA 4LAYA 2WLYA 3AROA 2A3EA 4WK9A 1E6NA 3WKZA 1X6NA 2AOSA 4W9PA 4Z2LA 1E6RA 4P8UA 3RMEA 1OGGA 3ALGA 4HARA 2G8ZA 2A3BA 4ODOA 4TW8A 4JFKA 3WL0A 4GGQA 5DO2A 2MLYA 1W1VA 2PPNA 2WLZA 1K9TA 3NRKA 1P5QA 4LAVA 1NH6A 1NSGA 1D7HA 1HXVA 2DT0A 2ZQTA 4DWSB 1ZBWA 2MNTA 2DG3A 4J4NA 4ODLA 5GPGA 5DIVA 4MAVA 4Q22A 1FKKA 3EY6A 3UQIA 4N19A 2XP9A 2PI6A 3O5DA 4O2TA 1W9UA 4DH0A 3CHEA 3KCEA 3O5RA 1YATA 1EYMA 4QT2A 1ROUA 5GPRA 4S3KA 3ARXA 1JNDA 1Q6UA 4MPKA 4DZ3A 1BKFA 2Y78A 1LG1A 1YW5A 1OGBA 2PV1A 3WQWA 1FAPA 2D9FA 4R0XA 4WKFA 2WK2A 5HT1A 2PV3A 2DSUA 1FKIA 1EHNA 4ML4A 3ARTA 1WNOA 3OA5A 4DRNA 4ODMA 5DF0A 4ZS6A 4KQZA 3KZ7A 2IF4A 2ZR6A 1E6ZA 3GPKA 3ARQA 1W9PA 3TDBA 1D2KA 2LKNA 3KAIA 3B9EA 4DZ2A 1XHGA 1TFVA 2G41A 1OWQA 3O5OA 5D75A 2DSZA 3B8SA 3AS3A 2DPEA 1KT1A 4P8WA 2F4EA 2RUDA 3BXWA 2DSWA 4FAPA 5HKGA 3KACA 1FFRA 1JNSA 1FKBA 1GOIA 1NWUA 1EQ3A 4U86A 5B8IC 4Z2KA 2DT3A 4JFIA 1VF8A 2RQSA 1ZU8A 2KE0A 2PPOA 4Q7NA 3FXYA 2KFWA 3KABA 2JZVA 2WM0A 3IKDA 2F2DA 1H0GA 3WIJA 1HKKA 3PRBA 1FD9A 4ODRA 5BXJA 2MLZA 4DWSD 3WH0A 4DRKA 4G2PA 2FKEA 3O5IA 4ZPTR 1QPFA 1E15A 4IT4A 3UQBA 3IK8A 4DWSA 3O5KA 2QF8A 3PRAA 4IQ2A 2F21A 2ZQVA 4PTMA 4ITZA 1R9HA 1W1YA 3KADA 3CZ8A 4DWSC 4L72B 2ZQSA 2M08A 3AS1A 1FKRA 1EDQA 3JXVA 2VN1A 4XAKA 3WD1A 3ARRA 2N87A 3RM9A 3PRDA 4DRIA 3LUOA 2FAPA 4IPXA 2ZQUA 2LJ4A 4IQCA 4WKAA 2KI3A 4JYSA 4DT4A 3OOBA 1ZBVA 1FFQA 4Z2JA 5HUAA 3CGMA 3O5MA 4DIPA 3CHDA 2LGOA 3RM4A 5HWBA 1E9LA 1N1AA 4U84A 4JFMA 4W9OA 3CH9A 1FKJA 1Q6HA 1LL4A 4DRHA 4HBEA 1M5YA 4ODNA 3UF8A 2XP6A 1HJXA 4JFLA 2A3CA 4TYOA 3WL1A 2K8IA 2YBUA 5I98A 4MNLA 3PA7A 3UQAA 3TCZA 2XP4A 4Z2GA 2KO7A 3G6LA 3QOKA 4LAWA 1Q1CA 4ODQA 3WD2A 4ODPA 1FJDA 1LQ0A 1KT0A 1QPLA 2UZ5A 1ZCNA 2XP3A 1C9HA 3UI4A 2VCDA 4QT3A 4J4OA 1KFWA 2PV2A 1FKHA 4GIVA 1FKSA 1WAWA 1LG2A 4MNJA 5HW8A 3IKGA 2XP7A 2KR7A 4P8XA 4LAXA 2Q5AA 1J4HA 4MNKA 4ZPWR 1FKGA 1NMWA 5DEZA 1ROTA 3RM8A 3WD3A 1JNEA 1D7IA 2AWGA 4ZPVR 4Z2HA 3KAHA 3I6CA 3AS0A 4Z2IA 1ZB5A 4WKHA 1A7XA 3UI6A 1F40A 4KR0B 4U85A 5HW7A 1J4IA 2DSVA 2B31A 1Y0OA 2DG9A 3G6MA 3UI5A 1IX5A 3WD4A 2O92A 2O9OA 1HKJA 2RUQA 1FKTA 1UR9A 1NWTA 2YBTA 2M1IA 3VAWA 3CHFA 3PR9A 4BF8A 4JFJA 1X6LA 4DRQA 2XPAA 3KAFA 3O5FA 4FN2A 1J6YA 1ZL1A 1W9VA 4ODKA 1FKLA 2ESCA 1D6OA 4R5EA 3RFWA 1NWRA 1T11A 3O5LA 3FY1A 5HBFA 1PINA 1L1PA 4QIBA 1WB0A 1SYTA 4HBOA 1H0IA 3WD0A 3ODKA 4TNSA 1NMVA 3O5PA 2PPPA 1TCOC 2ZR4A 1HJWA 2L2SA 3CHCA 1U79A 4WIWA 1EIBA 3WQVA 2FDMA 3NTPA 5HWCA 5JH8A 1CTNA 1LJYA 2A3AA 1LL6A 1W26A 1HKIA 3ARPA 4MGVA 4C02B 2LPVA 1RD6A 1ZK6A 3JYJA 2XP8A 1JVWA 1D7JA 3W4RA 3ARUA 4TW6A 4DRPA 1B6CA 1F8AB 1BL4A 4NNRA 4QZVB 4TW7A 4DRMA 2DT2A 1FKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H9R B;  5HW8 A;  1JNT A;  3IKG A;  2XP7 A;  2KR7 A;  2PPO A;  4LAX A;  2Q5A A;  1J4H A;  1FKG A;  1NMW A;  2KFW A;  4ODO A;  4TW8 A;  3KAB A;  2JZV A;  4JFK A;  1ROT A;  3IKD A;  2F2D A;  2MPH A;  3B7X A;  1D7I A;  2AWG A;  4GGQ A;  2MLY A;  3PRB A;  1FD9 A;  4ODR A;  5BXJ A;  2PPN A;  2MLZ A;  3KAG A;  2ITK A;  3RGC A;  3WH0 A;  3NRK A;  4DRK A;  4G2P A;  1P5Q A;  3KAH A;  4LAV A;  2FKE A;  3I6C A;  1NSG A;  1D7H A;  2RUR A;  5HW6 A;  1HXV A;  3O5I A;  3MDY B;  2ZQT A;  1A7X A;  1QPF A;  3UI6 A;  5DIT A;  3O5J A;  3UQB A;  2MNT A;  2DG3 A;  1F40 A;  3IK8 A;  4U85 A;  5HW7 A;  4J4N A;  4MSP A;  4ODL A;  3O5K A;  1J4I A;  2KGJ A;  5DIV A;  5GPG A;  1FKK A;  1Y0O A;  5HWB A;  2DG9 A;  3O5E A;  3UI5 A;  3EY6 A;  3TC5 A;  3UQI A;  4IQ2 A;  2RSE A;  4N19 A;  2XP9 A;  2F21 A;  3O5D A;  2RUQ A;  2ZQV A;  4O2T A;  1FKT A;  4ITZ A;  1J4R A;  1R9H A;  4DH0 A;  3KCE A;  3KAD A;  3O5R A;  2M1I A;  1YAT A;  3VAW A;  1EYM A;  4BF8 A;  2ZQS A;  4QT2 A;  4JFJ A;  2M08 A;  4DRQ A;  5HTG A;  1FKR A;  2XPA A;  1ROU A;  3JXV A;  3KAF A;  2VN1 A;  3FAP A;  3O5F A;  4FN2 A;  2N87 A;  3O5Q A;  1J6Y A;  1FKF A;  3PRD A;  4DRJ A;  4DRI A;  3LUO A;  1Q6U A;  2FAP A;  4IPX A;  4ODK A;  2ZQU A;  2LJ4 A;  4IQC A;  1BKF A;  1FKL A;  1D6O A;  2Y78 A;  1PBK A;  4DZ3 A;  2KI3 A;  4JYS A;  4DT4 A;  1YW5 A;  2MF9 A;  2PV1 A;  3OOB A;  4G50 A;  1FAP A;  3RFW A;  3CGM A;  3O5M A;  5HUA A;  1T11 A;  4DIP A;  3O5L A;  2D9F A;  2XPB A;  2LGO A;  3NI6 A;  3JYM A;  1PIN A;  4R0X A;  5HT1 A;  4QIB A;  1N1A A;  1Q6I A;  2PV3 A;  3IHZ A;  4U84 A;  1L1P A;  4JFM A;  5DIU A;  1FKI A;  4W9O A;  2RUC A;  1QZ2 A;  3ODK A;  2PBC A;  1FKJ A;  4DRN A;  4ODM A;  2DG4 A;  4TNS A;  1NMV A;  2IF4 A;  2ZR6 A;  3GPK A;  2PPP A;  3KZ7 A;  1TCO C;  2ZR4 A;  3O5P A;  1Q6H A;  2L2S A;  2OFN A;  4TX0 A;  2LKN A;  3TDB A;  3KAI A;  3CGN A;  4DRH A;  1U79 A;  3O5G A;  2ZR5 A;  1M5Y A;  4ODN A;  3UF8 A;  2XP6 A;  4JFL A;  4TYO A;  4W9Q A;  2XP5 A;  4DZ2 A;  2K8I A;  3O5O A;  3NTP A;  5HWC A;  5I98 A;  5D75 A;  3PA7 A;  3UQA A;  3TCZ A;  2XP4 A;  1KT1 A;  2KO7 A;  1W26 A;  4LAW A;  4MGV A;  1Q1C A;  2F4E A;  4C02 B;  2RUD A;  4ODQ A;  2LPV A;  1ZK6 A;  3JYJ A;  4DRO A;  5J6E A;  4FAP A;  4ODP A;  2MLX A;  2XP8 A;  1FJD A;  5HKG A;  1JVW A;  2M2A A;  1D7J A;  1KT0 A;  1QPL A;  2UZ5 A;  3KAC A;  4LAY A;  4TW6 A;  4DRP A;  1ZCN A;  1JNS A;  1FKB A;  2XP3 A;  1C9H A;  3UI4 A;  1B6C A;  2VCD A;  1F8A B;  4QT3 A;  4J4O A;  1EQ3 A;  4U86 A;  1BL4 A;  5B8I C;  2PV2 A;  4NNR A;  1FKH A;  4GIV A;  4JFI A;  1FKS A;  4TW7 A;  4W9P A;  4DRM A;  2RQS A;  2KE0 A;  1FKD A; 
#chains in the Genus database with same CATH topology
 3H9R B;  1JNT A;  4W5U A;  1W1T A;  4MNM A;  1W1P A;  4NSB A;  3B9D A;  2MPH A;  3B7X A;  4AY1 A;  3KAG A;  2ITK A;  2OLH A;  4L3N A;  3RGC A;  4P8V A;  2RUR A;  5HW6 A;  3ALF A;  3MDY B;  3AQU A;  3AS2 A;  3O5J A;  5DIT A;  4MSP A;  2KGJ A;  4NZC A;  1ITX A;  4MTV A;  3O5E A;  4LGX A;  3TC5 A;  2RSE A;  3B9A A;  1J4R A;  1LL7 A;  1ZBC A;  5HTG A;  3FAP A;  3O5Q A;  1E6P A;  1FKF A;  1HJV A;  4DRJ A;  3ARS A;  1GUV A;  1NWS A;  1XRV A;  1PBK A;  2DT1 A;  2MF9 A;  4S3J A;  1ZBK A;  4G50 A;  1O6I A;  2XPB A;  3NI6 A;  3JYM A;  4IT6 A;  1Q6I A;  3IHZ A;  2IUZ A;  5DIU A;  1UR8 A;  2RUC A;  1QZ2 A;  2PBC A;  3ARV A;  2DG4 A;  4WJX A;  3ARY A;  2OFN A;  4TX0 A;  3CGN A;  3EIP A;  3O5G A;  2ZR5 A;  5GQB A;  4W9Q A;  2XP5 A;  1GRJ A;  1GPF A;  1HKM A;  3GU0 A;  3ARZ A;  4URI A;  3ARW A;  4DRO A;  5J6E A;  1SR0 A;  2MLX A;  2M2A A;  4LAY A;  2WLY A;  3ARO A;  2A3E A;  4WK9 A;  1E6N A;  3WKZ A;  1X6N A;  2AOS A;  4W9P A;  4Z2L A;  1E6R A;  4P8U A;  3RME A;  1OGG A;  3ALG A;  4HAR A;  2G8Z A;  2A3B A;  4ODO A;  4TW8 A;  4JFK A;  3WL0 A;  4GGQ A;  5DO2 A;  2MLY A;  1W1V A;  2PPN A;  2WLZ A;  1JCH B;  1K9T A;  3NRK A;  1P5Q A;  4LAV A;  1NH6 A;  1NSG A;  1D7H A;  2PN0 A;  1HXV A;  2DT0 A;  2ZQT A;  4DWS B;  1ZBW A;  2MNT A;  2DG3 A;  4J4N A;  4ODL A;  5GPG A;  5DIV A;  4MAV A;  4Q22 A;  1FKK A;  3EY6 A;  3UQI A;  4N19 A;  2XP9 A;  2PI6 A;  3O5D A;  4O2T A;  1W9U A;  4DH0 A;  3CHE A;  3KCE A;  3O5R A;  1YAT A;  3GTY X;  1EYM A;  4QT2 A;  1ROU A;  5GPR A;  4S3K A;  3ARX A;  1JND A;  1Q6U A;  4MPK A;  4DZ3 A;  1BKF A;  2Y78 A;  1LG1 A;  1YW5 A;  1OGB A;  2PV1 A;  3WQW A;  1FAP A;  2D9F A;  4R0X A;  4WKF A;  2WK2 A;  5HT1 A;  2PV3 A;  2DSU A;  1FKI A;  1EHN A;  4ML4 A;  3ART A;  1WNO A;  3OA5 A;  4DRN A;  4ODM A;  5DF0 A;  4ZS6 A;  4KQZ A;  3KZ7 A;  2IF4 A;  2ZR6 A;  1E6Z A;  3GPK A;  3ARQ A;  1W9P A;  3TDB A;  1D2K A;  2LKN A;  3KAI A;  3B9E A;  4DZ2 A;  1XHG A;  1TFV A;  2G41 A;  1OWQ A;  3O5O A;  5D75 A;  2DSZ A;  3B8S A;  3AS3 A;  2DPE A;  1KT1 A;  4P8W A;  2F4E A;  2RUD A;  3BXW A;  2DSW A;  4FAP A;  5HKG A;  3KAC A;  1FFR A;  1JNS A;  1FKB A;  1GOI A;  1NWU A;  1EQ3 A;  4U86 A;  5B8I C;  4Z2K A;  2DT3 A;  4JFI A;  1VF8 A;  4UDM A;  2RQS A;  1ZU8 A;  2KE0 A;  1E44 A;  2PPO A;  4Q7N A;  3FXY A;  2KFW A;  3KAB A;  2JZV A;  2WM0 A;  3IKD A;  2F2D A;  1H0G A;  3WIJ A;  1HKK A;  3PRB A;  1FD9 A;  4ODR A;  5BXJ A;  2MLZ A;  4DWS D;  3WH0 A;  4DRK A;  4G2P A;  2FKE A;  3O5I A;  4ZPT R;  1QPF A;  1E15 A;  4IT4 A;  3UQB A;  3IK8 A;  4DWS A;  3O5K A;  2QF8 A;  3PRA A;  4IQ2 A;  2F21 A;  2ZQV A;  4PTM A;  4ITZ A;  1R9H A;  1W1Y A;  3KAD A;  3CZ8 A;  4DWS C;  4L72 B;  2ZQS A;  2M08 A;  3AS1 A;  1FKR A;  1EDQ A;  3JXV A;  2VN1 A;  4XAK A;  3WD1 A;  3ARR A;  2ETN A;  2N87 A;  3RM9 A;  3PRD A;  4DRI A;  3LUO A;  2FAP A;  4IPX A;  2ZQU A;  2LJ4 A;  4IQC A;  4WKA A;  2KI3 A;  4JYS A;  4DT4 A;  3OOB A;  1ZBV A;  1FFQ A;  4Z2J A;  5HUA A;  3CGM A;  3O5M A;  4DIP A;  2F23 A;  3CHD A;  2LGO A;  3RM4 A;  5HWB A;  1E9L A;  1N1A A;  4U84 A;  4JFM A;  4W9O A;  3CH9 A;  1FKJ A;  1Q6H A;  1LL4 A;  4DRH A;  2P4V A;  4HBE A;  1M5Y A;  4ODN A;  3UF8 A;  2XP6 A;  1HJX A;  2EUL A;  4JFL A;  2A3C A;  4TYO A;  3WL1 A;  2K8I A;  2YBU A;  5I98 A;  4MNL A;  3PA7 A;  3UQA A;  3TCZ A;  2XP4 A;  4Z2G A;  2KO7 A;  3G6L A;  3QOK A;  4LAW A;  1Q1C A;  4ODQ A;  3WD2 A;  4ODP A;  1FJD A;  1LQ0 A;  1KT0 A;  1QPL A;  2UZ5 A;  1ZCN A;  2XP3 A;  1C9H A;  3UI4 A;  2VCD A;  4QT3 A;  4J4O A;  1KFW A;  2PV2 A;  1FKH A;  4GIV A;  1FKS A;  1WAW A;  1LG2 A;  4MNJ A;  5HW8 A;  3IKG A;  2XP7 A;  2KR7 A;  4P8X A;  4LAX A;  2Q5A A;  1J4H A;  4MNK A;  4ZPW R;  1FKG A;  1NMW A;  5DEZ A;  1ROT A;  3RM8 A;  3WD3 A;  1JNE A;  1D7I A;  2AWG A;  4ZPV R;  4Z2H A;  3KAH A;  3I6C A;  3AS0 A;  4Z2I A;  1ZB5 A;  4WKH A;  1A7X A;  3UI6 A;  1F40 A;  4KR0 B;  4U85 A;  5HW7 A;  2B5U B;  1J4I A;  2DSV A;  2B31 A;  1Y0O A;  2DG9 A;  3BMB A;  3G6M A;  3UI5 A;  1IX5 A;  3WD4 A;  2O92 A;  2O9O A;  1HKJ A;  2RUQ A;  1FKT A;  1UR9 A;  1NWT A;  2YBT A;  2M1I A;  3VAW A;  3CHF A;  3PR9 A;  4BF8 A;  4JFJ A;  1X6L A;  4DRQ A;  2XPA A;  3KAF A;  3O5F A;  4FN2 A;  1J6Y A;  1ZL1 A;  1W9V A;  4ODK A;  1FKL A;  2ESC A;  1D6O A;  4R5E A;  3RFW A;  1NWR A;  1T11 A;  3O5L A;  3FY1 A;  5HBF A;  1PIN A;  1L1P A;  4QIB A;  1WB0 A;  1SYT A;  4HBO A;  1H0I A;  3WD0 A;  3ODK A;  4TNS A;  1NMV A;  3O5P A;  2PPP A;  1TCO C;  2ZR4 A;  1HJW A;  2L2S A;  3CHC A;  1U79 A;  4WIW A;  1EIB A;  3WQV A;  2FDM A;  3NTP A;  5HWC A;  5JH8 A;  1CTN A;  1LJY A;  2A3A A;  1LL6 A;  1W26 A;  1HKI A;  3ARP A;  4MGV A;  4C02 B;  2LPV A;  1RD6 A;  1ZK6 A;  3JYJ A;  2XP8 A;  1JVW A;  1D7J A;  3W4R A;  3ARU A;  4TW6 A;  4DRP A;  1B6C A;  1F8A B;  1BL4 A;  4NNR A;  4QZV B;  4TW7 A;  4DRM A;  2DT2 A;  1FKD A; 
#chains in the Genus database with same CATH homology
 3H9R B;  1JNT A;  4W5U A;  1W1T A;  4MNM A;  1W1P A;  4NSB A;  3B9D A;  2MPH A;  3B7X A;  4AY1 A;  3KAG A;  2ITK A;  2OLH A;  4L3N A;  3RGC A;  4P8V A;  2RUR A;  5HW6 A;  3ALF A;  3MDY B;  3AQU A;  3AS2 A;  3O5J A;  5DIT A;  4MSP A;  2KGJ A;  4NZC A;  1ITX A;  4MTV A;  3O5E A;  4LGX A;  3TC5 A;  2RSE A;  3B9A A;  1J4R A;  1LL7 A;  1ZBC A;  5HTG A;  3FAP A;  3O5Q A;  1E6P A;  1FKF A;  1HJV A;  4DRJ A;  3ARS A;  1GUV A;  1NWS A;  1XRV A;  1PBK A;  2DT1 A;  2MF9 A;  4S3J A;  1ZBK A;  4G50 A;  1O6I A;  2XPB A;  3NI6 A;  3JYM A;  4IT6 A;  1Q6I A;  3IHZ A;  2IUZ A;  5DIU A;  1UR8 A;  2RUC A;  1QZ2 A;  2PBC A;  3ARV A;  2DG4 A;  4WJX A;  3ARY A;  2OFN A;  4TX0 A;  3CGN A;  3O5G A;  5GQB A;  2ZR5 A;  4W9Q A;  2XP5 A;  1GPF A;  1HKM A;  3ARZ A;  4URI A;  3ARW A;  4DRO A;  5J6E A;  1SR0 A;  2MLX A;  2M2A A;  4LAY A;  2WLY A;  3ARO A;  2A3E A;  4WK9 A;  1E6N A;  3WKZ A;  1X6N A;  2AOS A;  4W9P A;  4Z2L A;  1E6R A;  4P8U A;  3RME A;  1OGG A;  3ALG A;  4HAR A;  2G8Z A;  2A3B A;  4ODO A;  4TW8 A;  4JFK A;  3WL0 A;  4GGQ A;  5DO2 A;  2MLY A;  1W1V A;  2PPN A;  2WLZ A;  1K9T A;  3NRK A;  1P5Q A;  4LAV A;  1NH6 A;  1NSG A;  1D7H A;  1HXV A;  2DT0 A;  2ZQT A;  4DWS B;  1ZBW A;  2MNT A;  2DG3 A;  4J4N A;  4ODL A;  5GPG A;  5DIV A;  4MAV A;  4Q22 A;  1FKK A;  3EY6 A;  3UQI A;  4N19 A;  2XP9 A;  2PI6 A;  3O5D A;  4O2T A;  1W9U A;  4DH0 A;  3CHE A;  3KCE A;  3O5R A;  1YAT A;  1EYM A;  4QT2 A;  1ROU A;  5GPR A;  4S3K A;  3ARX A;  1JND A;  1Q6U A;  4MPK A;  4DZ3 A;  1BKF A;  2Y78 A;  1LG1 A;  1YW5 A;  1OGB A;  2PV1 A;  3WQW A;  1FAP A;  2D9F A;  4R0X A;  4WKF A;  2WK2 A;  5HT1 A;  2PV3 A;  2DSU A;  1FKI A;  1EHN A;  4ML4 A;  3ART A;  1WNO A;  3OA5 A;  4DRN A;  4ODM A;  5DF0 A;  4ZS6 A;  4KQZ A;  3KZ7 A;  2IF4 A;  2ZR6 A;  1E6Z A;  3GPK A;  3ARQ A;  1W9P A;  3TDB A;  1D2K A;  2LKN A;  3KAI A;  3B9E A;  4DZ2 A;  1XHG A;  1TFV A;  2G41 A;  1OWQ A;  3O5O A;  5D75 A;  2DSZ A;  3B8S A;  3AS3 A;  2DPE A;  1KT1 A;  4P8W A;  2F4E A;  2RUD A;  3BXW A;  2DSW A;  4FAP A;  5HKG A;  3KAC A;  1FFR A;  1JNS A;  1FKB A;  1GOI A;  1NWU A;  1EQ3 A;  4U86 A;  5B8I C;  4Z2K A;  2DT3 A;  4JFI A;  1VF8 A;  2RQS A;  1ZU8 A;  2KE0 A;  2PPO A;  4Q7N A;  3FXY A;  2KFW A;  3KAB A;  2JZV A;  2WM0 A;  3IKD A;  2F2D A;  1H0G A;  3WIJ A;  1HKK A;  3PRB A;  1FD9 A;  4ODR A;  5BXJ A;  2MLZ A;  4DWS D;  3WH0 A;  4DRK A;  4G2P A;  2FKE A;  3O5I A;  4ZPT R;  1QPF A;  1E15 A;  4IT4 A;  3UQB A;  3IK8 A;  4DWS A;  3O5K A;  2QF8 A;  3PRA A;  4IQ2 A;  2F21 A;  2ZQV A;  4PTM A;  4ITZ A;  1R9H A;  1W1Y A;  3KAD A;  3CZ8 A;  4DWS C;  4L72 B;  2ZQS A;  2M08 A;  3AS1 A;  1FKR A;  1EDQ A;  3JXV A;  2VN1 A;  4XAK A;  3WD1 A;  3ARR A;  2N87 A;  3RM9 A;  3PRD A;  4DRI A;  3LUO A;  2FAP A;  4IPX A;  2ZQU A;  2LJ4 A;  4IQC A;  4WKA A;  2KI3 A;  4JYS A;  4DT4 A;  3OOB A;  1ZBV A;  1FFQ A;  4Z2J A;  5HUA A;  3CGM A;  3O5M A;  4DIP A;  3CHD A;  2LGO A;  3RM4 A;  5HWB A;  1E9L A;  1N1A A;  4U84 A;  4JFM A;  4W9O A;  3CH9 A;  1FKJ A;  1Q6H A;  1LL4 A;  4DRH A;  4HBE A;  1M5Y A;  4ODN A;  3UF8 A;  2XP6 A;  1HJX A;  4JFL A;  2A3C A;  4TYO A;  3WL1 A;  2K8I A;  2YBU A;  5I98 A;  4MNL A;  3PA7 A;  3UQA A;  3TCZ A;  2XP4 A;  4Z2G A;  2KO7 A;  3G6L A;  3QOK A;  4LAW A;  1Q1C A;  4ODQ A;  3WD2 A;  4ODP A;  1FJD A;  1LQ0 A;  1KT0 A;  1QPL A;  2UZ5 A;  1ZCN A;  2XP3 A;  1C9H A;  3UI4 A;  2VCD A;  4QT3 A;  4J4O A;  1KFW A;  2PV2 A;  1FKH A;  4GIV A;  1FKS A;  1WAW A;  1LG2 A;  4MNJ A;  5HW8 A;  3IKG A;  2XP7 A;  2KR7 A;  4P8X A;  4LAX A;  2Q5A A;  1J4H A;  4MNK A;  4ZPW R;  1FKG A;  1NMW A;  5DEZ A;  1ROT A;  3RM8 A;  3WD3 A;  1JNE A;  1D7I A;  2AWG A;  4ZPV R;  4Z2H A;  3KAH A;  3I6C A;  3AS0 A;  4Z2I A;  1ZB5 A;  4WKH A;  1A7X A;  3UI6 A;  1F40 A;  4KR0 B;  4U85 A;  5HW7 A;  1J4I A;  2DSV A;  2B31 A;  1Y0O A;  2DG9 A;  3G6M A;  3UI5 A;  1IX5 A;  3WD4 A;  2O92 A;  2O9O A;  1HKJ A;  2RUQ A;  1FKT A;  1UR9 A;  1NWT A;  2YBT A;  2M1I A;  3VAW A;  3CHF A;  3PR9 A;  4BF8 A;  4JFJ A;  1X6L A;  4DRQ A;  2XPA A;  3KAF A;  3O5F A;  4FN2 A;  1J6Y A;  1ZL1 A;  1W9V A;  4ODK A;  1FKL A;  2ESC A;  1D6O A;  4R5E A;  3RFW A;  1NWR A;  1T11 A;  3O5L A;  3FY1 A;  5HBF A;  1PIN A;  1L1P A;  4QIB A;  1WB0 A;  1SYT A;  4HBO A;  1H0I A;  3WD0 A;  3ODK A;  4TNS A;  1NMV A;  3O5P A;  2PPP A;  1TCO C;  2ZR4 A;  1HJW A;  2L2S A;  3CHC A;  1U79 A;  4WIW A;  1EIB A;  3WQV A;  2FDM A;  3NTP A;  5HWC A;  5JH8 A;  1CTN A;  1LJY A;  2A3A A;  1LL6 A;  1W26 A;  1HKI A;  3ARP A;  4MGV A;  4C02 B;  2LPV A;  1RD6 A;  1ZK6 A;  3JYJ A;  2XP8 A;  1JVW A;  1D7J A;  3W4R A;  3ARU A;  4TW6 A;  4DRP A;  1B6C A;  1F8A B;  1BL4 A;  4NNR A;  4QZV B;  4TW7 A;  4DRM A;  2DT2 A;  1FKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...