1FKFA

Atomic structure of fkbp-fk506, an immunophilin-immunosuppressant complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic structure of FKBP-FK506, an immunophilin-immunosuppressant complex.
pubmed rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords FK506 BINDING PROTEIN
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1991-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkfA00
3KADA 1A7XA 3O5FA 1D6OA 2ZQVA 2RURA 3IKGA 3VAWA 3ODKA 3RFWA 1Q1CA 4DRQA 4G50A 4DZ2A 4TW6A 1FKGA 1ROTA 1Y0OA 2F4EA 2LJ4A 2UZ5A 5HT1A 1FKDA 4LAVA 2RUQA 2JZVA 4W9QA 4NNRA 4DROA 3PRBA 1FD9A 1NMWA 1YW5A 2IF4A 2XP8A 4FN2A 3RGCA 2ZR4A 3KAFA 3O5PA 2LKNA 3O5LA 4IQ2A 5HW6A 1JVWA 3JYMA 2LPVA 1W26A 4JFKA 2Q5AA 2PV2A 2LGOA 2AWGA 4ODRA 1T11A 1ROUA 5HWCA 2KE0A 3GPKA 2MLXA 2KO7A 2PV3A 3KAIA 2XP5A 4FAPA 3H9RB 4O2TA 4DH0A 2ZR6A 1QPFA 3KZ7A 3JXVA 4DIPA 4ODPA 3UQIA 3NRKA 2KI3A 4DRMA 3UQBA 2OFNA 2RSEA 5HUAA 3O5KA 1C9HA 3IHZA 4GIVA 5HWBA 2L2SA 2Y78A 4IQCA 4JFMA 3O5DA 4IPXA 4ODQA 4ODNA 5GPGA 1NSGA 1U79A 5D75A 1J4HA 1BKFA 1F8AB 2RUDA 4N19A 1PINA 3O5OA 1NMVA 2K8IA 3CGMA 3EY6A 3PA7A 4QT3A 4TNSA 2PPPA 5HKGA 3UQAA 1F40A 1PBKA 2MNTA 2ZQSA 4ODMA 1TCOC 3IKDA 4J4OA 1D7IA 1FKJA 1FKRA 1D7JA 1FKBA 1ZCNA 1J4RA 1FKIA 2F21A 3UI6A 4DZ3A 1ZK6A 5I98A 3KAHA 1EYMA 3NTPA 1N1AA 3O5RA 4LAXA 3FAPA 4W9PA 1Q6IA 4JFJA 2FKEA 4DRNA 5DITA 3PRDA 4LAYA 4TYOA 3O5MA 4ODKA 1J6YA 5DIUA 3KAGA 1EQ3A 2VCDA 1Q6UA 2M08A 2XPBA 4JFLA 1D7HA 3KCEA 4U86A 2XP9A 5BXJA 2N87A 1L1PA 3KACA 2F2DA 3MDYB 4U84A 2PPNA 2XP4A 1JNSA 4DRPA 1JNTA 1HXVA 4TX0A 4BF8A 2ZR5A 1P5QA 3KABA 2FAPA 3O5GA 5HW8A 1Q6HA 4ODLA 3UI5A 2PPOA 4DRKA 5HW7A 1KT0A 4DRHA 1FKHA 4DRIA 1YATA 3CGNA 2DG4A 1FKKA 4TW8A 3TC5A 4DRJA 1FJDA 2XP3A 3O5IA 2DG9A 3LUOA 1FKSA 1R9HA 2M2AA 2MPHA 2XP6A 3B7XA 5B8IC 2ITKA 2MLZA 4ITZA 5HTGA 4LAWA 4MGVA 4U85A 1QPLA 1B6CA 2PBCA 4GGQA 4J4NA 4JFIA 2KFWA 4TW7A 2VN1A 4JYSA 3IK8A 3O5QA 3UI4A 4MSPA 3JYJA 1BL4A 1M5YA 2M1IA 3OOBA 3I6CA 2PV1A 2MF9A 1KT1A 1FAPA 2MLYA 2XPAA 4QIBA 4QT2A 5DIVA 5J6EA 1J4IA 2KGJA 4W9OA 4DT4A 1FKLA 3O5EA 3NI6A 4G2PA 2ZQUA 4R0XA 3UF8A 1QZ2A 4C02B 3TCZA 1FKTA 2KR7A 2D9FA 2XP7A 2RQSA 2DG3A 3TDBA 3WH0A 4ODOA 1FKFA 3O5JA 2ZQTA 2RUCA
chains in the Genus database with same CATH superfamily
3KADA 1A7XA 3O5FA 2ZQVA 2QF8A 1LQ0A 4DRQA 1H0IA 1ROTA 2LJ4A 2F4EA 1W1TA 3ARSA 5HT1A 3WKZA 4LAVA 2JZVA 4W9QA 1YW5A 4FN2A 1NWRA 3KAFA 2LKNA 4IQ2A 1TFVA 2PI6A 2AWGA 1ROUA 4L72B 3GPKA 3B9AA 5GPRA 4P8VA 4PTMA 3WQVA 4ODPA 3UQIA 1ZL1A 5HUAA 4Z2LA 2L2SA 4ODQA 5GPGA 3O5DA 1HKIA 1U79A 1OGGA 1BKFA 3WL1A 3FY1A 1PINA 3ALGA 3WD2A 5HKGA 3UQAA 4ML4A 1F40A 1E6RA 2ZQSA 4ODMA 1UR8A 4MNJA 3IKDA 3WQWA 1O6IA 1XHGA 1D7IA 1X6LA 3PR9A 1HJWA 3KAHA 2WK2A 1LG1A 3B8SA 4JFJA 2A3AA 1WAWA 3KCEA 2N87A 1W9UA 4DRPA 3WL0A 4WK9A 1W1YA 1P5QA 2FAPA 3AS0A 3O5GA 1Q6HA 5HW8A 2PPOA 1KT0A 4Z2IA 1FKKA 4DRJA 3CH9A 2XP3A 2DG9A 5B8IC 1FKSA 4ITZA 5HTGA 4LAWA 3RMEA 1B6CA 1JCHB 4J4NA 2WM0A 4ZPVR 1FFRA 2KFWA 3EIPA 4JYSA 3IK8A 3O5QA 3JYJA 3I6CA 2PV1A 1LL7A 1JNDA 1FAPA 4WJXA 5J6EA 3O5EA 4C02B 1FKTA 2XP7A 1NWTA 1ZU8A 2DG3A 2RQSA 3GTYX 4DWSA 1D6OA 3ALFA 3GU0A 3WD4A 5JH8A 4DZ2A 4TW6A 2UZ5A 1VF8A 4WIWA 4NNRA 2ETNA 3ARQA 3RGCA 3O5PA 3O5LA 4JFKA 1W26A 3ARYA 3AQUA 2LGOA 2DT0A 4ZPTR 2XP5A 2OLHA 1OGBA 2DT1A 4MPKA 4O2TA 2ZR6A 3KZ7A 3JXVA 1ZB5A 1W1PA 2KI3A 2OFNA 3G6MA 3O5KA 2A3BA 4DRNA 2Y78A 4JFMA 1ZBWA 4ODNA 4QZVB 5DEZA 3ARXA 5D75A 4N19A 1HJXA 3OA5A 2WLYA 1H0GA 2K8IA 3PA7A 2PPPA 1PBKA 2MNTA 1TCOC 1K9TA 4MAVA 1FKJA 2O9OA 1GUVA 1FKBA 1ITXA 3UI6A 1Q6IA 1HKMA 2FKEA 5DITA 2PN0A 3PRDA 3ARRA 3O5MA 2P4VA 4ODKA 5DIUA 4JFLA 1D7HA 4U86A 4DWSC 5GQBA 1LJYA 4U84A 4WKAA 2PPNA 1HXVA 4TX0A 2YBTA 4MNKA 4Q22A 3TC5A 4XAKA 2XP6A 4L3NA 2MLZA 4U85A 1SR0A 4P8UA 4TW7A 2VN1A 2DSVA 4MSPA 1WB0A 2A3CA 3OOBA 1GRJA 4P8WA 1KT1A 2DPEA 3AS2A 1ZBCA 4DT4A 4Z2KA 1LL4A 3UF8A 3TCZA 2DT2A 3TDBA 3WH0A 3B9EA 4URIA 2B5UB 3WD0A 3ARTA 4G50A 1E6ZA 1FKGA 1Y0OA 1FKDA 3AS1A 2RUQA 3PRBA 1FD9A 1NMWA 2IF4A 2DSWA 1HJVA 1JVWA 2LPVA 4HARA 3BMBA 2PV2A 5HWCA 3ARUA 2KE0A 2KO7A 4R5EA 3KAIA 1OWQA 4DH0A 2YBUA 3WIJA 1QPFA 3AS3A 4LGXA 3NRKA 1C9HA 4W5UA 4GIVA 5HWBA 4IQCA 4IPXA 1NSGA 1JNEA 2G41A 5HBFA 2RUDA 1NH6A 3PRAA 1NMVA 4TNSA 4QT3A 3ARZA 2B31A 1D7JA 1ZBVA 1ZCNA 1J4RA 1FKIA 2F21A 1FFQA 4UDMA 4Z2GA 3O5RA 1N1AA 3CHCA 3FAPA 4W9PA 4LAYA 4TYOA 1EQ3A 2VCDA 4ZS6A 2WLZA 1UR9A 1L1PA 3CHFA 1RD6A 2XP4A 1JNSA 1LG2A 1JNTA 4BF8A 2ZR5A 3KABA 3CHDA 4DWSB 2EULA 3UI5A 5DO2A 3ARVA 1E44A 1E9LA 1GOIA 1FKHA 4DRIA 4Z2HA 3CGNA 1LL6A 1EHNA 4IT4A 4WKHA 1GPFA 3LUOA 3B7XA 1ZBKA 2PBCA 4DRMA 3UI4A 3B9DA 2AOSA 1M5YA 3ARWA 4WKFA 5DIVA 1EIBA 3ARPA 1KFWA 3G6LA 2KGJA 3RM4A 4G2PA 2G8ZA 1XRVA 2ZQUA 2D9FA 1W1VA 4ODOA 1FKFA 4NSBA 2RUCA 2DSZA 2FDMA 3IKGA 1HKKA 2RURA 3VAWA 3ODKA 3RFWA 4HBEA 1Q1CA 3AROA 2O92A 4DROA 2XP8A 2ZR4A 3W4RA 5HW6A 3JYMA 1NWUA 2Q5AA 4S3JA 4ODRA 1T11A 3QOKA 2MLXA 2PV3A 2IUZA 4FAPA 3WD1A 3H9RB 1HKJA 3CZ8A 4DIPA 2DT3A 4DWSD 3UQBA 2RSEA 3IHZA 4KQZA 2ESCA 1J4HA 1F8AB 1E6NA 3O5OA 3EY6A 3CGMA 1E15A 3RM8A 2DSUA 4ZPWR 1EDQA 4J4OA 4AY1A 4HBOA 1FKRA 4P8XA 4DZ3A 1ZK6A 5I98A 1D2KA 1EYMA 3NTPA 4LAXA 3FXYA 4IT6A 4MTVA 5DF0A 1J6YA 3KAGA 2A3EA 3CHEA 1Q6UA 2M08A 2XPBA 4Z2JA 2XP9A 5BXJA 4MNLA 3KACA 2F2DA 3MDYB 4Q7NA 4KR0B 1W9VA 4ODLA 4DRKA 1CTNA 5HW7A 4DRHA 1YATA 1IX5A 2DG4A 4TW8A 1X6NA 1FJDA 3O5IA 1NWSA 1R9HA 1W9PA 2M2AA 2MPHA 2ITKA 1WNOA 4MGVA 1QPLA 4GGQA 4JFIA 1BL4A 2M1IA 2MF9A 3RM9A 2MLYA 4MNMA 1E6PA 2XPAA 4QIBA 4QT2A 3WD3A 1J4IA 4W9OA 1SYTA 1FKLA 3NI6A 3BXWA 4R0XA 1QZ2A 4NZCA 2KR7A 3O5JA 2ZQTA 2F23A 4S3KA
chains in the Genus database with same CATH topology
3KADA 1A7XA 3O5FA 2ZQVA 2QF8A 1LQ0A 4DRQA 1H0IA 1ROTA 2LJ4A 2F4EA 1W1TA 3ARSA 5HT1A 3WKZA 4LAVA 2JZVA 4W9QA 1YW5A 4FN2A 1NWRA 3KAFA 2LKNA 4IQ2A 1TFVA 2PI6A 2AWGA 1ROUA 4L72B 3GPKA 3B9AA 5GPRA 4P8VA 4PTMA 3WQVA 4ODPA 3UQIA 1ZL1A 5HUAA 4Z2LA 2L2SA 4ODQA 5GPGA 3O5DA 1HKIA 1U79A 1OGGA 1BKFA 3WL1A 3FY1A 1PINA 3ALGA 3WD2A 5HKGA 3UQAA 4ML4A 1F40A 1E6RA 2ZQSA 4ODMA 1UR8A 4MNJA 3IKDA 3WQWA 1O6IA 1XHGA 1D7IA 1X6LA 3PR9A 1HJWA 3KAHA 2WK2A 1LG1A 3B8SA 4JFJA 2A3AA 1WAWA 3KCEA 2N87A 1W9UA 4DRPA 3WL0A 4WK9A 1W1YA 1P5QA 2FAPA 3AS0A 3O5GA 1Q6HA 5HW8A 2PPOA 1KT0A 4Z2IA 1FKKA 4DRJA 3CH9A 2XP3A 2DG9A 5B8IC 1FKSA 4ITZA 5HTGA 4LAWA 3RMEA 1B6CA 4J4NA 2WM0A 4ZPVR 1FFRA 2KFWA 4JYSA 3IK8A 3O5QA 3JYJA 3I6CA 2PV1A 1LL7A 1JNDA 1FAPA 4WJXA 5J6EA 3O5EA 4C02B 1FKTA 2XP7A 1NWTA 1ZU8A 2DG3A 2RQSA 4DWSA 1D6OA 3ALFA 3WD4A 5JH8A 4DZ2A 4TW6A 2UZ5A 1VF8A 4WIWA 4NNRA 3ARQA 3RGCA 3O5PA 3O5LA 4JFKA 1W26A 3ARYA 3AQUA 2LGOA 2DT0A 4ZPTR 2XP5A 2OLHA 1OGBA 2DT1A 4MPKA 4O2TA 2ZR6A 3KZ7A 3JXVA 1ZB5A 1W1PA 2KI3A 2OFNA 3G6MA 3O5KA 2A3BA 4DRNA 2Y78A 4JFMA 1ZBWA 4ODNA 4QZVB 5DEZA 3ARXA 5D75A 4N19A 1HJXA 3OA5A 2WLYA 1H0GA 2K8IA 3PA7A 2PPPA 1PBKA 2MNTA 1TCOC 1K9TA 4MAVA 1FKJA 2O9OA 1GUVA 1FKBA 1ITXA 3UI6A 1Q6IA 1HKMA 2FKEA 5DITA 3PRDA 3ARRA 3O5MA 4ODKA 5DIUA 4JFLA 1D7HA 4U86A 4DWSC 5GQBA 1LJYA 4U84A 4WKAA 2PPNA 1HXVA 4TX0A 2YBTA 4MNKA 4Q22A 3TC5A 4XAKA 2XP6A 4L3NA 2MLZA 4U85A 1SR0A 4P8UA 4TW7A 2VN1A 2DSVA 4MSPA 1WB0A 2A3CA 3OOBA 4P8WA 1KT1A 2DPEA 3AS2A 1ZBCA 4DT4A 4Z2KA 1LL4A 3UF8A 3TCZA 2DT2A 3TDBA 3WH0A 3B9EA 4URIA 3WD0A 3ARTA 4G50A 1E6ZA 1FKGA 1Y0OA 1FKDA 3AS1A 2RUQA 3PRBA 1FD9A 1NMWA 2IF4A 2DSWA 1HJVA 1JVWA 2LPVA 4HARA 2PV2A 5HWCA 3ARUA 2KE0A 2KO7A 4R5EA 3KAIA 1OWQA 4DH0A 2YBUA 3WIJA 1QPFA 3AS3A 4LGXA 3NRKA 1C9HA 4W5UA 4GIVA 5HWBA 4IQCA 4IPXA 1NSGA 1JNEA 2G41A 5HBFA 2RUDA 1NH6A 3PRAA 1NMVA 4TNSA 4QT3A 3ARZA 2B31A 1D7JA 1ZBVA 1ZCNA 1J4RA 1FKIA 2F21A 1FFQA 4Z2GA 3O5RA 1N1AA 3CHCA 3FAPA 4W9PA 4LAYA 4TYOA 1EQ3A 2VCDA 4ZS6A 2WLZA 1UR9A 1L1PA 3CHFA 1RD6A 2XP4A 1JNSA 1LG2A 1JNTA 4BF8A 2ZR5A 3KABA 3CHDA 4DWSB 3UI5A 5DO2A 3ARVA 1E9LA 1GOIA 1FKHA 4DRIA 4Z2HA 3CGNA 1LL6A 1EHNA 4IT4A 4WKHA 1GPFA 3LUOA 3B7XA 1ZBKA 2PBCA 4DRMA 3UI4A 3B9DA 2AOSA 1M5YA 3ARWA 4WKFA 5DIVA 1EIBA 3ARPA 1KFWA 3G6LA 2KGJA 3RM4A 4G2PA 2G8ZA 1XRVA 2ZQUA 2D9FA 1W1VA 4ODOA 1FKFA 4NSBA 2RUCA 2DSZA 2FDMA 3IKGA 1HKKA 2RURA 3VAWA 3ODKA 3RFWA 4HBEA 1Q1CA 3AROA 2O92A 4DROA 2XP8A 2ZR4A 3W4RA 5HW6A 3JYMA 1NWUA 2Q5AA 4S3JA 4ODRA 1T11A 3QOKA 2MLXA 2PV3A 2IUZA 4FAPA 3WD1A 3H9RB 1HKJA 3CZ8A 4DIPA 2DT3A 4DWSD 3UQBA 2RSEA 3IHZA 4KQZA 2ESCA 1J4HA 1F8AB 1E6NA 3O5OA 3EY6A 3CGMA 1E15A 3RM8A 2DSUA 4ZPWR 1EDQA 4J4OA 4AY1A 4HBOA 1FKRA 4P8XA 4DZ3A 1ZK6A 5I98A 1D2KA 1EYMA 3NTPA 4LAXA 3FXYA 4IT6A 4MTVA 5DF0A 1J6YA 3KAGA 2A3EA 3CHEA 1Q6UA 2M08A 2XPBA 4Z2JA 2XP9A 5BXJA 4MNLA 3KACA 2F2DA 3MDYB 4Q7NA 4KR0B 1W9VA 4ODLA 4DRKA 1CTNA 5HW7A 4DRHA 1YATA 1IX5A 2DG4A 4TW8A 1X6NA 1FJDA 3O5IA 1NWSA 1R9HA 1W9PA 2M2AA 2MPHA 2ITKA 1WNOA 4MGVA 1QPLA 4GGQA 4JFIA 1BL4A 2M1IA 2MF9A 3RM9A 2MLYA 4MNMA 1E6PA 2XPAA 4QIBA 4QT2A 3WD3A 1J4IA 4W9OA 1SYTA 1FKLA 3NI6A 3BXWA 4R0XA 1QZ2A 4NZCA 2KR7A 3O5JA 2ZQTA 4S3KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KAD A;  1A7X A;  3O5F A;  1D6O A;  2ZQV A;  2RUR A;  3IKG A;  3VAW A;  3ODK A;  3RFW A;  1Q1C A;  4DRQ A;  4G50 A;  4DZ2 A;  4TW6 A;  1FKG A;  1ROT A;  1Y0O A;  2F4E A;  2LJ4 A;  2UZ5 A;  5HT1 A;  1FKD A;  4LAV A;  2RUQ A;  2JZV A;  4W9Q A;  4NNR A;  4DRO A;  3PRB A;  1FD9 A;  1NMW A;  1YW5 A;  2IF4 A;  2XP8 A;  4FN2 A;  3RGC A;  2ZR4 A;  3KAF A;  3O5P A;  2LKN A;  3O5L A;  4IQ2 A;  5HW6 A;  1JVW A;  3JYM A;  2LPV A;  1W26 A;  4JFK A;  2Q5A A;  2PV2 A;  2LGO A;  2AWG A;  4ODR A;  1T11 A;  1ROU A;  5HWC A;  2KE0 A;  3GPK A;  2MLX A;  2KO7 A;  2PV3 A;  3KAI A;  2XP5 A;  4FAP A;  3H9R B;  4O2T A;  4DH0 A;  2ZR6 A;  1QPF A;  3KZ7 A;  3JXV A;  4DIP A;  4ODP A;  3UQI A;  3NRK A;  2KI3 A;  4DRM A;  3UQB A;  2OFN A;  2RSE A;  5HUA A;  3O5K A;  1C9H A;  3IHZ A;  4GIV A;  5HWB A;  2L2S A;  2Y78 A;  4IQC A;  4JFM A;  3O5D A;  4IPX A;  4ODQ A;  4ODN A;  5GPG A;  1NSG A;  1U79 A;  5D75 A;  1J4H A;  1BKF A;  1F8A B;  2RUD A;  4N19 A;  1PIN A;  3O5O A;  1NMV A;  2K8I A;  3CGM A;  3EY6 A;  3PA7 A;  4QT3 A;  4TNS A;  2PPP A;  5HKG A;  3UQA A;  1F40 A;  1PBK A;  2MNT A;  2ZQS A;  4ODM A;  1TCO C;  3IKD A;  4J4O A;  1D7I A;  1FKJ A;  1FKR A;  1D7J A;  1FKB A;  1ZCN A;  1J4R A;  1FKI A;  2F21 A;  3UI6 A;  4DZ3 A;  1ZK6 A;  5I98 A;  3KAH A;  1EYM A;  3NTP A;  1N1A A;  3O5R A;  4LAX A;  3FAP A;  4W9P A;  1Q6I A;  4JFJ A;  2FKE A;  4DRN A;  5DIT A;  3PRD A;  4LAY A;  4TYO A;  3O5M A;  4ODK A;  1J6Y A;  5DIU A;  3KAG A;  1EQ3 A;  2VCD A;  1Q6U A;  2M08 A;  2XPB A;  4JFL A;  1D7H A;  3KCE A;  4U86 A;  2XP9 A;  5BXJ A;  2N87 A;  1L1P A;  3KAC A;  2F2D A;  3MDY B;  4U84 A;  2PPN A;  2XP4 A;  1JNS A;  4DRP A;  1JNT A;  1HXV A;  4TX0 A;  4BF8 A;  2ZR5 A;  1P5Q A;  3KAB A;  2FAP A;  3O5G A;  5HW8 A;  1Q6H A;  4ODL A;  3UI5 A;  2PPO A;  4DRK A;  5HW7 A;  1KT0 A;  4DRH A;  1FKH A;  4DRI A;  1YAT A;  3CGN A;  2DG4 A;  1FKK A;  4TW8 A;  3TC5 A;  4DRJ A;  1FJD A;  2XP3 A;  3O5I A;  2DG9 A;  3LUO A;  1FKS A;  1R9H A;  2M2A A;  2MPH A;  2XP6 A;  3B7X A;  5B8I C;  2ITK A;  2MLZ A;  4ITZ A;  5HTG A;  4LAW A;  4MGV A;  4U85 A;  1QPL A;  1B6C A;  2PBC A;  4GGQ A;  4J4N A;  4JFI A;  2KFW A;  4TW7 A;  2VN1 A;  4JYS A;  3IK8 A;  3O5Q A;  3UI4 A;  4MSP A;  3JYJ A;  1BL4 A;  1M5Y A;  2M1I A;  3OOB A;  3I6C A;  2PV1 A;  2MF9 A;  1KT1 A;  1FAP A;  2MLY A;  2XPA A;  4QIB A;  4QT2 A;  5DIV A;  5J6E A;  1J4I A;  2KGJ A;  4W9O A;  4DT4 A;  1FKL A;  3O5E A;  3NI6 A;  4G2P A;  2ZQU A;  4R0X A;  3UF8 A;  1QZ2 A;  4C02 B;  3TCZ A;  1FKT A;  2KR7 A;  2D9F A;  2XP7 A;  2RQS A;  2DG3 A;  3TDB A;  3WH0 A;  4ODO A;  1FKF A;  3O5J A;  2ZQT A;  2RUC A; 
#chains in the Genus database with same CATH topology
 3KAD A;  1A7X A;  3O5F A;  2ZQV A;  2QF8 A;  1LQ0 A;  4DRQ A;  1H0I A;  1ROT A;  2LJ4 A;  2F4E A;  1W1T A;  3ARS A;  5HT1 A;  3WKZ A;  4LAV A;  2JZV A;  4W9Q A;  1YW5 A;  4FN2 A;  1NWR A;  3KAF A;  2LKN A;  4IQ2 A;  1TFV A;  2PI6 A;  2AWG A;  1ROU A;  4L72 B;  3GPK A;  3B9A A;  5GPR A;  4P8V A;  4PTM A;  3WQV A;  4ODP A;  3UQI A;  1ZL1 A;  5HUA A;  4Z2L A;  2L2S A;  4ODQ A;  5GPG A;  3O5D A;  1HKI A;  1U79 A;  1OGG A;  1BKF A;  3WL1 A;  3FY1 A;  1PIN A;  3ALG A;  3WD2 A;  5HKG A;  3UQA A;  4ML4 A;  1F40 A;  1E6R A;  2ZQS A;  4ODM A;  1UR8 A;  4MNJ A;  3IKD A;  3WQW A;  1O6I A;  1XHG A;  1D7I A;  1X6L A;  3PR9 A;  1HJW A;  3KAH A;  2WK2 A;  1LG1 A;  3B8S A;  4JFJ A;  2A3A A;  1WAW A;  3KCE A;  2N87 A;  1W9U A;  4DRP A;  3WL0 A;  4WK9 A;  1W1Y A;  1P5Q A;  2FAP A;  3AS0 A;  3O5G A;  1Q6H A;  5HW8 A;  2PPO A;  1KT0 A;  4Z2I A;  1FKK A;  4DRJ A;  3CH9 A;  2XP3 A;  2DG9 A;  5B8I C;  1FKS A;  4ITZ A;  5HTG A;  4LAW A;  3RME A;  1B6C A;  1JCH B;  4J4N A;  2WM0 A;  4ZPV R;  1FFR A;  2KFW A;  3EIP A;  4JYS A;  3IK8 A;  3O5Q A;  3JYJ A;  3I6C A;  2PV1 A;  1LL7 A;  1JND A;  1FAP A;  4WJX A;  5J6E A;  3O5E A;  4C02 B;  1FKT A;  2XP7 A;  1NWT A;  1ZU8 A;  2DG3 A;  2RQS A;  3GTY X;  4DWS A;  1D6O A;  3ALF A;  3GU0 A;  3WD4 A;  5JH8 A;  4DZ2 A;  4TW6 A;  2UZ5 A;  1VF8 A;  4WIW A;  4NNR A;  2ETN A;  3ARQ A;  3RGC A;  3O5P A;  3O5L A;  4JFK A;  1W26 A;  3ARY A;  3AQU A;  2LGO A;  2DT0 A;  4ZPT R;  2XP5 A;  2OLH A;  1OGB A;  2DT1 A;  4MPK A;  4O2T A;  2ZR6 A;  3KZ7 A;  3JXV A;  1ZB5 A;  1W1P A;  2KI3 A;  2OFN A;  3G6M A;  3O5K A;  2A3B A;  4DRN A;  2Y78 A;  4JFM A;  1ZBW A;  4ODN A;  4QZV B;  5DEZ A;  3ARX A;  5D75 A;  4N19 A;  1HJX A;  3OA5 A;  2WLY A;  1H0G A;  2K8I A;  3PA7 A;  2PPP A;  1PBK A;  2MNT A;  1TCO C;  1K9T A;  4MAV A;  1FKJ A;  2O9O A;  1GUV A;  1FKB A;  1ITX A;  3UI6 A;  1Q6I A;  1HKM A;  2FKE A;  5DIT A;  2PN0 A;  3PRD A;  3ARR A;  3O5M A;  2P4V A;  4ODK A;  5DIU A;  4JFL A;  1D7H A;  4U86 A;  4DWS C;  5GQB A;  1LJY A;  4U84 A;  4WKA A;  2PPN A;  1HXV A;  4TX0 A;  2YBT A;  4MNK A;  4Q22 A;  3TC5 A;  4XAK A;  2XP6 A;  4L3N A;  2MLZ A;  4U85 A;  1SR0 A;  4P8U A;  4TW7 A;  2VN1 A;  2DSV A;  4MSP A;  1WB0 A;  2A3C A;  3OOB A;  1GRJ A;  4P8W A;  1KT1 A;  2DPE A;  3AS2 A;  1ZBC A;  4DT4 A;  4Z2K A;  1LL4 A;  3UF8 A;  3TCZ A;  2DT2 A;  3TDB A;  3WH0 A;  3B9E A;  4URI A;  2B5U B;  3WD0 A;  3ART A;  4G50 A;  1E6Z A;  1FKG A;  1Y0O A;  1FKD A;  3AS1 A;  2RUQ A;  3PRB A;  1FD9 A;  1NMW A;  2IF4 A;  2DSW A;  1HJV A;  1JVW A;  2LPV A;  4HAR A;  3BMB A;  2PV2 A;  5HWC A;  3ARU A;  2KE0 A;  2KO7 A;  4R5E A;  3KAI A;  1OWQ A;  4DH0 A;  2YBU A;  3WIJ A;  1QPF A;  3AS3 A;  4LGX A;  3NRK A;  1C9H A;  4W5U A;  4GIV A;  5HWB A;  4IQC A;  4IPX A;  1NSG A;  1JNE A;  2G41 A;  5HBF A;  2RUD A;  1NH6 A;  3PRA A;  1NMV A;  4TNS A;  4QT3 A;  3ARZ A;  2B31 A;  1D7J A;  1ZBV A;  1ZCN A;  1J4R A;  1FKI A;  2F21 A;  1FFQ A;  4UDM A;  4Z2G A;  3O5R A;  1N1A A;  3CHC A;  3FAP A;  4W9P A;  4LAY A;  4TYO A;  1EQ3 A;  2VCD A;  4ZS6 A;  2WLZ A;  1UR9 A;  1L1P A;  3CHF A;  1RD6 A;  2XP4 A;  1JNS A;  1LG2 A;  1JNT A;  4BF8 A;  2ZR5 A;  3KAB A;  3CHD A;  4DWS B;  2EUL A;  3UI5 A;  5DO2 A;  3ARV A;  1E44 A;  1E9L A;  1GOI A;  1FKH A;  4DRI A;  4Z2H A;  3CGN A;  1LL6 A;  1EHN A;  4IT4 A;  4WKH A;  1GPF A;  3LUO A;  3B7X A;  1ZBK A;  2PBC A;  4DRM A;  3UI4 A;  3B9D A;  2AOS A;  1M5Y A;  3ARW A;  4WKF A;  5DIV A;  1EIB A;  3ARP A;  1KFW A;  3G6L A;  2KGJ A;  3RM4 A;  4G2P A;  2G8Z A;  1XRV A;  2ZQU A;  2D9F A;  1W1V A;  4ODO A;  1FKF A;  4NSB A;  2RUC A;  2DSZ A;  2FDM A;  3IKG A;  1HKK A;  2RUR A;  3VAW A;  3ODK A;  3RFW A;  4HBE A;  1Q1C A;  3ARO A;  2O92 A;  4DRO A;  2XP8 A;  2ZR4 A;  3W4R A;  5HW6 A;  3JYM A;  1NWU A;  2Q5A A;  4S3J A;  4ODR A;  1T11 A;  3QOK A;  2MLX A;  2PV3 A;  2IUZ A;  4FAP A;  3WD1 A;  3H9R B;  1HKJ A;  3CZ8 A;  4DIP A;  2DT3 A;  4DWS D;  3UQB A;  2RSE A;  3IHZ A;  4KQZ A;  2ESC A;  1J4H A;  1F8A B;  1E6N A;  3O5O A;  3EY6 A;  3CGM A;  1E15 A;  3RM8 A;  2DSU A;  4ZPW R;  1EDQ A;  4J4O A;  4AY1 A;  4HBO A;  1FKR A;  4P8X A;  4DZ3 A;  1ZK6 A;  5I98 A;  1D2K A;  1EYM A;  3NTP A;  4LAX A;  3FXY A;  4IT6 A;  4MTV A;  5DF0 A;  1J6Y A;  3KAG A;  2A3E A;  3CHE A;  1Q6U A;  2M08 A;  2XPB A;  4Z2J A;  2XP9 A;  5BXJ A;  4MNL A;  3KAC A;  2F2D A;  3MDY B;  4Q7N A;  4KR0 B;  1W9V A;  4ODL A;  4DRK A;  1CTN A;  5HW7 A;  4DRH A;  1YAT A;  1IX5 A;  2DG4 A;  4TW8 A;  1X6N A;  1FJD A;  3O5I A;  1NWS A;  1R9H A;  1W9P A;  2M2A A;  2MPH A;  2ITK A;  1WNO A;  4MGV A;  1QPL A;  4GGQ A;  4JFI A;  1BL4 A;  2M1I A;  2MF9 A;  3RM9 A;  2MLY A;  4MNM A;  1E6P A;  2XPA A;  4QIB A;  4QT2 A;  3WD3 A;  1J4I A;  4W9O A;  1SYT A;  1FKL A;  3NI6 A;  3BXW A;  4R0X A;  1QZ2 A;  4NZC A;  2KR7 A;  3O5J A;  2ZQT A;  2F23 A;  4S3K A; 
#chains in the Genus database with same CATH homology
 3KAD A;  1A7X A;  3O5F A;  2ZQV A;  2QF8 A;  1LQ0 A;  4DRQ A;  1H0I A;  1ROT A;  2LJ4 A;  2F4E A;  1W1T A;  3ARS A;  5HT1 A;  3WKZ A;  4LAV A;  2JZV A;  4W9Q A;  1YW5 A;  4FN2 A;  1NWR A;  3KAF A;  2LKN A;  4IQ2 A;  1TFV A;  2PI6 A;  2AWG A;  1ROU A;  4L72 B;  3GPK A;  3B9A A;  5GPR A;  4P8V A;  4PTM A;  3WQV A;  4ODP A;  3UQI A;  1ZL1 A;  5HUA A;  4Z2L A;  2L2S A;  4ODQ A;  5GPG A;  3O5D A;  1HKI A;  1U79 A;  1OGG A;  1BKF A;  3WL1 A;  3FY1 A;  1PIN A;  3ALG A;  3WD2 A;  5HKG A;  3UQA A;  4ML4 A;  1F40 A;  1E6R A;  2ZQS A;  4ODM A;  1UR8 A;  4MNJ A;  3IKD A;  3WQW A;  1O6I A;  1XHG A;  1D7I A;  1X6L A;  3PR9 A;  1HJW A;  3KAH A;  2WK2 A;  1LG1 A;  3B8S A;  4JFJ A;  2A3A A;  1WAW A;  3KCE A;  2N87 A;  1W9U A;  4DRP A;  3WL0 A;  4WK9 A;  1W1Y A;  1P5Q A;  2FAP A;  3AS0 A;  3O5G A;  1Q6H A;  5HW8 A;  2PPO A;  1KT0 A;  4Z2I A;  1FKK A;  4DRJ A;  3CH9 A;  2XP3 A;  2DG9 A;  5B8I C;  1FKS A;  4ITZ A;  5HTG A;  4LAW A;  3RME A;  1B6C A;  4J4N A;  2WM0 A;  4ZPV R;  1FFR A;  2KFW A;  4JYS A;  3IK8 A;  3O5Q A;  3JYJ A;  3I6C A;  2PV1 A;  1LL7 A;  1JND A;  1FAP A;  4WJX A;  5J6E A;  3O5E A;  4C02 B;  1FKT A;  2XP7 A;  1NWT A;  1ZU8 A;  2DG3 A;  2RQS A;  4DWS A;  1D6O A;  3ALF A;  3WD4 A;  5JH8 A;  4DZ2 A;  4TW6 A;  2UZ5 A;  1VF8 A;  4WIW A;  4NNR A;  3ARQ A;  3RGC A;  3O5P A;  3O5L A;  4JFK A;  1W26 A;  3ARY A;  3AQU A;  2LGO A;  2DT0 A;  4ZPT R;  2XP5 A;  2OLH A;  1OGB A;  2DT1 A;  4MPK A;  4O2T A;  2ZR6 A;  3KZ7 A;  3JXV A;  1ZB5 A;  1W1P A;  2KI3 A;  2OFN A;  3G6M A;  3O5K A;  2A3B A;  4DRN A;  2Y78 A;  4JFM A;  1ZBW A;  4ODN A;  4QZV B;  5DEZ A;  3ARX A;  5D75 A;  4N19 A;  1HJX A;  3OA5 A;  2WLY A;  1H0G A;  2K8I A;  3PA7 A;  2PPP A;  1PBK A;  2MNT A;  1TCO C;  1K9T A;  4MAV A;  1FKJ A;  2O9O A;  1GUV A;  1FKB A;  1ITX A;  3UI6 A;  1Q6I A;  1HKM A;  2FKE A;  5DIT A;  3PRD A;  3ARR A;  3O5M A;  4ODK A;  5DIU A;  4JFL A;  1D7H A;  4U86 A;  4DWS C;  5GQB A;  1LJY A;  4U84 A;  4WKA A;  2PPN A;  1HXV A;  4TX0 A;  2YBT A;  4MNK A;  4Q22 A;  3TC5 A;  4XAK A;  2XP6 A;  4L3N A;  2MLZ A;  4U85 A;  1SR0 A;  4P8U A;  4TW7 A;  2VN1 A;  2DSV A;  4MSP A;  1WB0 A;  2A3C A;  3OOB A;  4P8W A;  1KT1 A;  2DPE A;  3AS2 A;  1ZBC A;  4DT4 A;  4Z2K A;  1LL4 A;  3UF8 A;  3TCZ A;  2DT2 A;  3TDB A;  3WH0 A;  3B9E A;  4URI A;  3WD0 A;  3ART A;  4G50 A;  1E6Z A;  1FKG A;  1Y0O A;  1FKD A;  3AS1 A;  2RUQ A;  3PRB A;  1FD9 A;  1NMW A;  2IF4 A;  2DSW A;  1HJV A;  1JVW A;  2LPV A;  4HAR A;  2PV2 A;  5HWC A;  3ARU A;  2KE0 A;  2KO7 A;  4R5E A;  3KAI A;  1OWQ A;  4DH0 A;  2YBU A;  3WIJ A;  1QPF A;  3AS3 A;  4LGX A;  3NRK A;  1C9H A;  4W5U A;  4GIV A;  5HWB A;  4IQC A;  4IPX A;  1NSG A;  1JNE A;  2G41 A;  5HBF A;  2RUD A;  1NH6 A;  3PRA A;  1NMV A;  4TNS A;  4QT3 A;  3ARZ A;  2B31 A;  1D7J A;  1ZBV A;  1ZCN A;  1J4R A;  1FKI A;  2F21 A;  1FFQ A;  4Z2G A;  3O5R A;  1N1A A;  3CHC A;  3FAP A;  4W9P A;  4LAY A;  4TYO A;  1EQ3 A;  2VCD A;  4ZS6 A;  2WLZ A;  1UR9 A;  1L1P A;  3CHF A;  1RD6 A;  2XP4 A;  1JNS A;  1LG2 A;  1JNT A;  4BF8 A;  2ZR5 A;  3KAB A;  3CHD A;  4DWS B;  3UI5 A;  5DO2 A;  3ARV A;  1E9L A;  1GOI A;  1FKH A;  4DRI A;  4Z2H A;  3CGN A;  1LL6 A;  1EHN A;  4IT4 A;  4WKH A;  1GPF A;  3LUO A;  3B7X A;  1ZBK A;  2PBC A;  4DRM A;  3UI4 A;  3B9D A;  2AOS A;  1M5Y A;  3ARW A;  4WKF A;  5DIV A;  1EIB A;  3ARP A;  1KFW A;  3G6L A;  2KGJ A;  3RM4 A;  4G2P A;  2G8Z A;  1XRV A;  2ZQU A;  2D9F A;  1W1V A;  4ODO A;  1FKF A;  4NSB A;  2RUC A;  2DSZ A;  2FDM A;  3IKG A;  1HKK A;  2RUR A;  3VAW A;  3ODK A;  3RFW A;  4HBE A;  1Q1C A;  3ARO A;  2O92 A;  4DRO A;  2XP8 A;  2ZR4 A;  3W4R A;  5HW6 A;  3JYM A;  1NWU A;  2Q5A A;  4S3J A;  4ODR A;  1T11 A;  3QOK A;  2MLX A;  2PV3 A;  2IUZ A;  4FAP A;  3WD1 A;  3H9R B;  1HKJ A;  3CZ8 A;  4DIP A;  2DT3 A;  4DWS D;  3UQB A;  2RSE A;  3IHZ A;  4KQZ A;  2ESC A;  1J4H A;  1F8A B;  1E6N A;  3O5O A;  3EY6 A;  3CGM A;  1E15 A;  3RM8 A;  2DSU A;  4ZPW R;  1EDQ A;  4J4O A;  4AY1 A;  4HBO A;  1FKR A;  4P8X A;  4DZ3 A;  1ZK6 A;  5I98 A;  1D2K A;  1EYM A;  3NTP A;  4LAX A;  3FXY A;  4IT6 A;  4MTV A;  5DF0 A;  1J6Y A;  3KAG A;  2A3E A;  3CHE A;  1Q6U A;  2M08 A;  2XPB A;  4Z2J A;  2XP9 A;  5BXJ A;  4MNL A;  3KAC A;  2F2D A;  3MDY B;  4Q7N A;  4KR0 B;  1W9V A;  4ODL A;  4DRK A;  1CTN A;  5HW7 A;  4DRH A;  1YAT A;  1IX5 A;  2DG4 A;  4TW8 A;  1X6N A;  1FJD A;  3O5I A;  1NWS A;  1R9H A;  1W9P A;  2M2A A;  2MPH A;  2ITK A;  1WNO A;  4MGV A;  1QPL A;  4GGQ A;  4JFI A;  1BL4 A;  2M1I A;  2MF9 A;  3RM9 A;  2MLY A;  4MNM A;  1E6P A;  2XPA A;  4QIB A;  4QT2 A;  3WD3 A;  1J4I A;  4W9O A;  1SYT A;  1FKL A;  3NI6 A;  3BXW A;  4R0X A;  1QZ2 A;  4NZC A;  2KR7 A;  3O5J A;  2ZQT A;  4S3K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...