1FKFA

Atomic structure of fkbp-fk506, an immunophilin-immunosuppressant complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 BINDING PROTEIN
publication title Atomic structure of FKBP-FK506, an immunophilin-immunosuppressant complex.
pubmed rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1991-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkfA00
2PV2A 2ZQTA 3JYJA 1J6YA 2ITKA 4C02B 4FN2A 2PV1A 4TW8A 2VCDA 3IKGA 2MF9A 4ODMA 3UQBA 4LAVA 3RGCA 3WH0A 3O5FA 1J4RA 2LKNA 1Q6UA 3KZ7A 1KT0A 4ODOA 3UI5A 2RURA 1PINA 1D7HA 2KFWA 4N19A 2KGJA 4DRNA 4J4NA 4ODKA 3O5LA 4DRJA 3O5DA 4R0XA 2ZQUA 4U86A 3UI4A 4ITZA 5HW6A 3NRKA 3O5RA 4LAXA 1NMVA 1ZK6A 5GPGA 5BXJA 1M5YA 5HWBA 3KACA 2FAPA 2ZR6A 2XP9A 4DZ2A 1FKJA 1YW5A 1ZCNA 1JNTA 4JFIA 4W9QA 4LAYA 1QPFA 4O2TA 3O5QA 1R9HA 2DG9A 2LJ4A 2RQSA 4TW6A 4GGQA 1KT1A 4DRIA 2PV3A 2UZ5A 3KAGA 5I98A 1FKRA 3RFWA 5HUAA 1J4IA 2AWGA 5B8IC 2MPHA 2F4EA 4IQCA 4DROA 2M1IA 2M2AA 3PA7A 5HT1A 3CGMA 4QIBA 5DIVA 1FKSA 4FAPA 4TW7A 2D9FA 4NNRA 5HW8A 3UI6A 5DIUA 2RUCA 5HKGA 4MSPA 4ODPA 4DIPA 4QT2A 4DRHA 4BF8A 1YATA 3JXVA 2L2SA 3IHZA 4DH0A 3UQAA 1BL4A 2XP7A 4W9OA 1EQ3A 2PBCA 2XPBA 2ZR4A 4ODQA 2RUQA 5HTGA 2JZVA 4DZ3A 4U85A 2PPNA 4JFKA 3O5GA 2KR7A 1FKHA 3IKDA 1TCOC 1QZ2A 3VAWA 4LAWA 4JFLA 1FD9A 1Q6IA 4DRPA 4JFJA 3O5KA 1QPLA 1HXVA 1EYMA 1ROTA 2XPAA 2Y78A 2LGOA 4DRKA 1JVWA 3KAFA 4G50A 3TC5A 1FKKA 4DRQA 1FKBA 1FKGA 3UQIA 2ZQVA 3OOBA 4ODNA 1C9HA 4QT3A 2KE0A 3PRDA 1L1PA 2IF4A 2N87A 1Y0OA 3TDBA 1B6CA 3H9RB 1FKIA 3LUOA 2LPVA 4TX0A 3I6CA 1U79A 1Q1CA 2VN1A 1JNSA 2MNTA 3B7XA 3O5EA 3O5PA 2MLYA 1J4HA 1NMWA 1Q6HA 1A7XA 4IPXA 3KABA 4G2PA 2KI3A 2RUDA 2XP6A 3IK8A 3NI6A 4TYOA 1D6OA 1NSGA 2XP8A 4JFMA 5DITA 1W26A 2PPOA 3KAIA 4ODRA 2ZR5A 1FKFA 3MDYB 2DG4A 3FAPA 4MGVA 2XP5A 1PBKA 4JYSA 2Q5AA 1FKTA 1FKDA 4J4OA 2PPPA 2XP3A 4W9PA 1FKLA 1D7JA 4U84A 1BKFA 2ZQSA 4ODLA 3KADA 2DG3A 5HW7A 1ROUA 4DRMA 3PRBA 2MLXA 1N1AA 3KAHA 2M08A 3GPKA 3O5OA 3O5IA 1D7IA 4IQ2A 4DT4A 2FKEA 2F21A 4GIVA 2K8IA 1FJDA 3NTPA 3JYMA 1T11A 2RSEA 4TNSA 5J6EA 2XP4A 5HWCA 2MLZA 3O5MA 5D75A 2OFNA 1F40A 1FAPA 1F8AB 3UF8A 1P5QA 3CGNA 3O5JA 3KCEA 3EY6A 2F2DA 2KO7A 3TCZA 3ODKA
chains in the Genus database with same CATH superfamily
2ZQTA 3IKGA 3RMEA 4ODMA 3WH0A 3WKZA 3O5FA 1J4RA 2LKNA 2P4VA 1Q6UA 1KT0A 1ZBWA 3WL0A 2DPEA 4J4NA 2YBTA 3UI4A 4ITZA 3O5RA 1ZK6A 1E44A 3ARXA 2AOSA 5GPRA 2FAPA 1JNEA 1FKJA 2DT3A 4LAYA 4O2TA 4DWSB 2DG9A 2PV3A 2UZ5A 1SR0A 3KAGA 1FKRA 5HUAA 2MPHA 2F4EA 4ML4A 4DROA 4MNJA 1E15A 1FKSA 4FAPA 4MAVA 1ITXA 4DIPA 2A3EA 4QT2A 4DRHA 3RM4A 3ARSA 3UQAA 1GUVA 2PBCA 2A3BA 1HKJA 3G6MA 2JZVA 3GTYX 3OA5A 3O5GA 4R5EA 1QZ2A 1TCOC 1WNOA 1NWUA 1EYMA 3ARZA 1OGBA 3TC5A 1FKKA 4DRQA 1FKGA 3B9EA 2A3AA 2ZQVA 3OOBA 2KE0A 3PRDA 4HBOA 1FFRA 1L1PA 2IF4A 1ZBVA 4L72B 1O6IA 2LPVA 4ZPVR 3ARPA 1Q1CA 1RD6A 2MNTA 2MLYA 3KABA 4G2PA 2KI3A 2RUDA 2XP6A 3NI6A 1D6OA 2XP8A 1E6RA 2PPOA 1UR8A 3RM8A 4MNKA 1FKFA 4Q7NA 1H0GA 4MGVA 2Q5AA 1FKTA 1FKDA 1OGGA 4Z2LA 4MNMA 4W9PA 2ZQSA 4DWSA 1ROUA 4DRMA 1XRVA 2MLXA 2DT0A 2DSVA 3QOKA 3CHCA 1FJDA 3JYMA 2XP4A 5HWCA 2OFNA 1F40A 1F8AB 3UF8A 3O5JA 2O92A 3KCEA 3EY6A 4P8WA 3JYJA 3PR9A 2ITKA 4C02B 3ARUA 2VCDA 1JCHB 2MF9A 1NWRA 3WIJA 1X6NA 2RURA 1D7HA 2B31A 2KFWA 4ODKA 3O5DA 4U86A 5HW6A 3NRKA 5GPGA 5BXJA 2ZR6A 4DZ2A 1ZCNA 4WK9A 4JFIA 1HJWA 4W5UA 1R9HA 2LJ4A 4KR0B 1H0IA 1W9VA 4WKFA 2M1IA 5DIVA 5JH8A 5HW8A 2RUCA 5HKGA 4P8XA 4MSPA 4WKHA 4AY1A 3FXYA 3IHZA 3WQVA 2F23A 1E6NA 1LL6A 2ZR4A 3B8SA 4DZ3A 3CHDA 2PPNA 4JFKA 1K9TA 3B9AA 2WM0A 1FKHA 3IKDA 1HXVA 1GPFA 3CHFA 4JFJA 3O5KA 1ROTA 3ARYA 2Y78A 1KFWA 1W1PA 3KAFA 3WL1A 1FKBA 3UQIA 1C9HA 4QT3A 1Y0OA 2PI6A 3H9RB 1FKIA 3LUOA 3I6CA 1U79A 3O5EA 1J4HA 4HARA 1A7XA 1W9PA 3IK8A 4TYOA 4JFMA 2EULA 3KAIA 4ODRA 2ZR5A 3MDYB 2DG4A 4WIWA 4HBEA 1UR9A 1GOIA 4JYSA 3AS0A 2DT1A 1FKLA 1TFVA 3AS3A 4KQZA 3KADA 3ALGA 3ARWA 1N1AA 4ZPWR 3GPKA 4WJXA 4Z2JA 3UQBA 4GIVA 1CTNA 4TNSA 3ALFA 3O5MA 5D75A 1P5QA 3CGNA 3TCZA 3ODKA 1J6YA 1D2KA 2DSUA 4Z2HA 4ZPTR 3RGCA 3WD0A 1LQ0A 1PINA 1W9UA 2B5UB 4N19A 1W1VA 3WD2A 4DRNA 2WLYA 3AQUA 2ZQUA 3ARQA 4R0XA 4NZCA 3AROA 1LJYA 3KACA 1LL7A 4Z2IA 1YW5A 1QPFA 1GRJA 2OLHA 3O5QA 4MPKA 2DSWA 4TW6A 4GGQA 3AS1A 4QZVB 3RFWA 3PA7A 5DF0A 5HT1A 1EHNA 4QIBA 4TW7A 2D9FA 4NNRA 4UDMA 4Z2KA 3WD1A 5DIUA 1LG1A 4BF8A 1YATA 3JXVA 2L2SA 3WD4A 4DH0A 1BL4A 4W9OA 1HKIA 2DSZA 2XPBA 1EQ3A 2WK2A 4ODQA 5HTGA 3FY1A 2G8ZA 1E6PA 3W4RA 2FDMA 1HJVA 4JFLA 4DRPA 4LGXA 2XPAA 1VF8A 2LGOA 4DRKA 1JVWA 4XAKA 4NSBA 4ODNA 3TDBA 2QF8A 4TX0A 3O5PA 3ARVA 1W1YA 1NMWA 5DEZA 4S3KA 1NSGA 4P8UA 1XHGA 4WKAA 4IT4A 2XP5A 2O9OA 3WQWA 1HKKA 4J4OA 1HKMA 2XP3A 3AS2A 1EDQA 1LL4A 2DG3A 3BMBA 5HW7A 3PRBA 3KAHA 2M08A 3O5IA 2FKEA 2DT2A 3CZ8A 1T11A 2RSEA 4DWSC 4URIA 3CH9A 1ZBCA 2F2DA 2PV2A 4FN2A 2PV1A 4TW8A 2A3CA 4LAVA 3KZ7A 4ODOA 3UI5A 2KGJA 3O5LA 4DRJA 4P8VA 1WB0A 4LAXA 1NMVA 1M5YA 5HWBA 1IX5A 2IUZA 2XP9A 3RM9A 4W9QA 1JNTA 2RQSA 1KT1A 4DRIA 5I98A 3G6LA 4Z2GA 1J4IA 2AWGA 2G41A 5B8IC 4IQCA 1LG2A 2M2AA 3CGMA 1NH6A 1E9LA 3UI6A 1NWTA 4ODPA 4PTMA 1ZU8A 2XP7A 3ARRA 2RUQA 1NWSA 4MNLA 4U85A 1HJXA 2KR7A 3BXWA 3CHEA 3VAWA 4LAWA 1FD9A 1Q6IA 1ZB5A 1QPLA 1ZL1A 4L3NA 3PRAA 4G50A 1EIBA 3ARTA 2PN0A 2N87A 1B6CA 1ZBKA 2VN1A 2YBUA 1JNSA 3EIPA 3B7XA 1Q6HA 4IPXA 4MTVA 5GQBA 5DITA 1W26A 1X6LA 1E6ZA 3FAPA 4Q22A 1PBKA 2PPPA 2ESCA 3WD3A 1D7JA 4U84A 1BKFA 4ODLA 1JNDA 2ETNA 3O5OA 4IQ2A 4ZS6A 4DT4A 1D7IA 5HBFA 2F21A 1WAWA 2K8IA 1OWQA 3B9DA 3NTPA 4IT6A 4DWSD 1SYTA 5J6EA 2MLZA 3GU0A 1FFQA 1FAPA 1W1TA 4S3JA 2KO7A 2WLZA 5DO2A
chains in the Genus database with same CATH topology
2ZQTA 3IKGA 3RMEA 4ODMA 3WH0A 3WKZA 3O5FA 1J4RA 2LKNA 1Q6UA 1KT0A 1ZBWA 3WL0A 2DPEA 4J4NA 2YBTA 3UI4A 4ITZA 3O5RA 1ZK6A 3ARXA 2AOSA 5GPRA 2FAPA 1JNEA 1FKJA 2DT3A 4LAYA 4O2TA 4DWSB 2DG9A 2PV3A 2UZ5A 1SR0A 3KAGA 1FKRA 5HUAA 2MPHA 2F4EA 4ML4A 4DROA 4MNJA 1E15A 1FKSA 4FAPA 4MAVA 1ITXA 4DIPA 2A3EA 4QT2A 4DRHA 3RM4A 3ARSA 3UQAA 1GUVA 2PBCA 2A3BA 1HKJA 3G6MA 2JZVA 3OA5A 3O5GA 4R5EA 1QZ2A 1TCOC 1WNOA 1NWUA 1EYMA 3ARZA 1OGBA 3TC5A 1FKKA 4DRQA 1FKGA 3B9EA 2A3AA 2ZQVA 3OOBA 2KE0A 3PRDA 4HBOA 1FFRA 1L1PA 2IF4A 1ZBVA 4L72B 1O6IA 2LPVA 4ZPVR 3ARPA 1Q1CA 1RD6A 2MNTA 2MLYA 3KABA 4G2PA 2KI3A 2RUDA 2XP6A 3NI6A 1D6OA 2XP8A 1E6RA 2PPOA 1UR8A 3RM8A 4MNKA 1FKFA 4Q7NA 1H0GA 4MGVA 2Q5AA 1FKTA 1FKDA 1OGGA 4Z2LA 4MNMA 4W9PA 2ZQSA 4DWSA 1ROUA 4DRMA 1XRVA 2MLXA 2DT0A 2DSVA 3QOKA 3CHCA 1FJDA 3JYMA 2XP4A 5HWCA 2OFNA 1F40A 1F8AB 3UF8A 3O5JA 2O92A 3KCEA 3EY6A 4P8WA 3JYJA 3PR9A 2ITKA 4C02B 3ARUA 2VCDA 2MF9A 1NWRA 3WIJA 1X6NA 2RURA 1D7HA 2B31A 2KFWA 4ODKA 3O5DA 4U86A 5HW6A 3NRKA 5GPGA 5BXJA 2ZR6A 4DZ2A 1ZCNA 4WK9A 4JFIA 1HJWA 4W5UA 1R9HA 2LJ4A 4KR0B 1H0IA 1W9VA 4WKFA 2M1IA 5DIVA 5JH8A 5HW8A 2RUCA 5HKGA 4P8XA 4MSPA 4WKHA 4AY1A 3FXYA 3IHZA 3WQVA 1E6NA 1LL6A 2ZR4A 3B8SA 4DZ3A 3CHDA 2PPNA 4JFKA 1K9TA 3B9AA 2WM0A 1FKHA 3IKDA 1HXVA 1GPFA 3CHFA 4JFJA 3O5KA 1ROTA 3ARYA 2Y78A 1KFWA 1W1PA 3KAFA 3WL1A 1FKBA 3UQIA 1C9HA 4QT3A 1Y0OA 2PI6A 3H9RB 1FKIA 3LUOA 3I6CA 1U79A 3O5EA 1J4HA 4HARA 1A7XA 1W9PA 3IK8A 4TYOA 4JFMA 3KAIA 4ODRA 2ZR5A 3MDYB 2DG4A 4WIWA 4HBEA 1UR9A 1GOIA 4JYSA 3AS0A 2DT1A 1FKLA 1TFVA 3AS3A 4KQZA 3KADA 3ALGA 3ARWA 1N1AA 4ZPWR 3GPKA 4WJXA 4Z2JA 3UQBA 4GIVA 1CTNA 4TNSA 3ALFA 3O5MA 5D75A 1P5QA 3CGNA 3TCZA 3ODKA 1J6YA 1D2KA 2DSUA 4Z2HA 4ZPTR 3RGCA 3WD0A 1LQ0A 1PINA 1W9UA 4N19A 1W1VA 3WD2A 4DRNA 2WLYA 3AQUA 2ZQUA 3ARQA 4R0XA 4NZCA 3AROA 1LJYA 3KACA 1LL7A 4Z2IA 1YW5A 1QPFA 2OLHA 3O5QA 4MPKA 2DSWA 4TW6A 4GGQA 3AS1A 4QZVB 3RFWA 3PA7A 5DF0A 5HT1A 1EHNA 4QIBA 4TW7A 2D9FA 4NNRA 4Z2KA 3WD1A 5DIUA 1LG1A 4BF8A 1YATA 3JXVA 2L2SA 3WD4A 4DH0A 1BL4A 4W9OA 1HKIA 2DSZA 2XPBA 1EQ3A 2WK2A 4ODQA 5HTGA 3FY1A 2G8ZA 1E6PA 3W4RA 2FDMA 1HJVA 4JFLA 4DRPA 4LGXA 2XPAA 1VF8A 2LGOA 4DRKA 1JVWA 4XAKA 4NSBA 4ODNA 3TDBA 2QF8A 4TX0A 3O5PA 3ARVA 1W1YA 1NMWA 5DEZA 4S3KA 1NSGA 4P8UA 1XHGA 4WKAA 4IT4A 2XP5A 2O9OA 3WQWA 1HKKA 4J4OA 1HKMA 2XP3A 3AS2A 1EDQA 1LL4A 2DG3A 5HW7A 3PRBA 3KAHA 2M08A 3O5IA 2FKEA 2DT2A 3CZ8A 1T11A 2RSEA 4DWSC 4URIA 3CH9A 1ZBCA 2F2DA 2PV2A 4FN2A 2PV1A 4TW8A 2A3CA 4LAVA 3KZ7A 4ODOA 3UI5A 2KGJA 3O5LA 4DRJA 4P8VA 1WB0A 4LAXA 1NMVA 1M5YA 5HWBA 1IX5A 2IUZA 2XP9A 3RM9A 4W9QA 1JNTA 2RQSA 1KT1A 4DRIA 5I98A 3G6LA 4Z2GA 1J4IA 2AWGA 2G41A 5B8IC 4IQCA 1LG2A 2M2AA 3CGMA 1NH6A 1E9LA 3UI6A 1NWTA 4ODPA 4PTMA 1ZU8A 2XP7A 3ARRA 2RUQA 1NWSA 4MNLA 4U85A 1HJXA 2KR7A 3BXWA 3CHEA 3VAWA 4LAWA 1FD9A 1Q6IA 1ZB5A 1QPLA 1ZL1A 4L3NA 3PRAA 4G50A 1EIBA 3ARTA 2N87A 1B6CA 1ZBKA 2VN1A 2YBUA 1JNSA 3B7XA 1Q6HA 4IPXA 4MTVA 5GQBA 5DITA 1W26A 1X6LA 1E6ZA 3FAPA 4Q22A 1PBKA 2PPPA 2ESCA 3WD3A 1D7JA 4U84A 1BKFA 4ODLA 1JNDA 3O5OA 4IQ2A 4ZS6A 4DT4A 1D7IA 5HBFA 2F21A 1WAWA 2K8IA 1OWQA 3B9DA 3NTPA 4IT6A 4DWSD 1SYTA 5J6EA 2MLZA 1FFQA 1FAPA 1W1TA 4S3JA 2KO7A 2WLZA 5DO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PV2 A;  2ZQT A;  3JYJ A;  1J6Y A;  2ITK A;  4C02 B;  4FN2 A;  2PV1 A;  4TW8 A;  2VCD A;  3IKG A;  2MF9 A;  4ODM A;  3UQB A;  4LAV A;  3RGC A;  3WH0 A;  3O5F A;  1J4R A;  2LKN A;  1Q6U A;  3KZ7 A;  1KT0 A;  4ODO A;  3UI5 A;  2RUR A;  1PIN A;  1D7H A;  2KFW A;  4N19 A;  2KGJ A;  4DRN A;  4J4N A;  4ODK A;  3O5L A;  4DRJ A;  3O5D A;  4R0X A;  2ZQU A;  4U86 A;  3UI4 A;  4ITZ A;  5HW6 A;  3NRK A;  3O5R A;  4LAX A;  1NMV A;  1ZK6 A;  5GPG A;  5BXJ A;  1M5Y A;  5HWB A;  3KAC A;  2FAP A;  2ZR6 A;  2XP9 A;  4DZ2 A;  1FKJ A;  1YW5 A;  1ZCN A;  1JNT A;  4JFI A;  4W9Q A;  4LAY A;  1QPF A;  4O2T A;  3O5Q A;  1R9H A;  2DG9 A;  2LJ4 A;  2RQS A;  4TW6 A;  4GGQ A;  1KT1 A;  4DRI A;  2PV3 A;  2UZ5 A;  3KAG A;  5I98 A;  1FKR A;  3RFW A;  5HUA A;  1J4I A;  2AWG A;  5B8I C;  2MPH A;  2F4E A;  4IQC A;  4DRO A;  2M1I A;  2M2A A;  3PA7 A;  5HT1 A;  3CGM A;  4QIB A;  5DIV A;  1FKS A;  4FAP A;  4TW7 A;  2D9F A;  4NNR A;  5HW8 A;  3UI6 A;  5DIU A;  2RUC A;  5HKG A;  4MSP A;  4ODP A;  4DIP A;  4QT2 A;  4DRH A;  4BF8 A;  1YAT A;  3JXV A;  2L2S A;  3IHZ A;  4DH0 A;  3UQA A;  1BL4 A;  2XP7 A;  4W9O A;  1EQ3 A;  2PBC A;  2XPB A;  2ZR4 A;  4ODQ A;  2RUQ A;  5HTG A;  2JZV A;  4DZ3 A;  4U85 A;  2PPN A;  4JFK A;  3O5G A;  2KR7 A;  1FKH A;  3IKD A;  1TCO C;  1QZ2 A;  3VAW A;  4LAW A;  4JFL A;  1FD9 A;  1Q6I A;  4DRP A;  4JFJ A;  3O5K A;  1QPL A;  1HXV A;  1EYM A;  1ROT A;  2XPA A;  2Y78 A;  2LGO A;  4DRK A;  1JVW A;  3KAF A;  4G50 A;  3TC5 A;  1FKK A;  4DRQ A;  1FKB A;  1FKG A;  3UQI A;  2ZQV A;  3OOB A;  4ODN A;  1C9H A;  4QT3 A;  2KE0 A;  3PRD A;  1L1P A;  2IF4 A;  2N87 A;  1Y0O A;  3TDB A;  1B6C A;  3H9R B;  1FKI A;  3LUO A;  2LPV A;  4TX0 A;  3I6C A;  1U79 A;  1Q1C A;  2VN1 A;  1JNS A;  2MNT A;  3B7X A;  3O5E A;  3O5P A;  2MLY A;  1J4H A;  1NMW A;  1Q6H A;  1A7X A;  4IPX A;  3KAB A;  4G2P A;  2KI3 A;  2RUD A;  2XP6 A;  3IK8 A;  3NI6 A;  4TYO A;  1D6O A;  1NSG A;  2XP8 A;  4JFM A;  5DIT A;  1W26 A;  2PPO A;  3KAI A;  4ODR A;  2ZR5 A;  1FKF A;  3MDY B;  2DG4 A;  3FAP A;  4MGV A;  2XP5 A;  1PBK A;  4JYS A;  2Q5A A;  1FKT A;  1FKD A;  4J4O A;  2PPP A;  2XP3 A;  4W9P A;  1FKL A;  1D7J A;  4U84 A;  1BKF A;  2ZQS A;  4ODL A;  3KAD A;  2DG3 A;  5HW7 A;  1ROU A;  4DRM A;  3PRB A;  2MLX A;  1N1A A;  3KAH A;  2M08 A;  3GPK A;  3O5O A;  3O5I A;  1D7I A;  4IQ2 A;  4DT4 A;  2FKE A;  2F21 A;  4GIV A;  2K8I A;  1FJD A;  3NTP A;  3JYM A;  1T11 A;  2RSE A;  4TNS A;  5J6E A;  2XP4 A;  5HWC A;  2MLZ A;  3O5M A;  5D75 A;  2OFN A;  1F40 A;  1FAP A;  1F8A B;  3UF8 A;  1P5Q A;  3CGN A;  3O5J A;  3KCE A;  3EY6 A;  2F2D A;  2KO7 A;  3TCZ A;  3ODK A; 
#chains in the Genus database with same CATH topology
 2ZQT A;  3IKG A;  3RME A;  4ODM A;  3WH0 A;  3WKZ A;  3O5F A;  1J4R A;  2LKN A;  2P4V A;  1Q6U A;  1KT0 A;  1ZBW A;  3WL0 A;  2DPE A;  4J4N A;  2YBT A;  3UI4 A;  4ITZ A;  3O5R A;  1ZK6 A;  1E44 A;  3ARX A;  2AOS A;  5GPR A;  2FAP A;  1JNE A;  1FKJ A;  2DT3 A;  4LAY A;  4O2T A;  4DWS B;  2DG9 A;  2PV3 A;  2UZ5 A;  1SR0 A;  3KAG A;  1FKR A;  5HUA A;  2MPH A;  2F4E A;  4ML4 A;  4DRO A;  4MNJ A;  1E15 A;  1FKS A;  4FAP A;  4MAV A;  1ITX A;  4DIP A;  2A3E A;  4QT2 A;  4DRH A;  3RM4 A;  3ARS A;  3UQA A;  1GUV A;  2PBC A;  2A3B A;  1HKJ A;  3G6M A;  2JZV A;  3GTY X;  3OA5 A;  3O5G A;  4R5E A;  1QZ2 A;  1TCO C;  1WNO A;  1NWU A;  1EYM A;  3ARZ A;  1OGB A;  3TC5 A;  1FKK A;  4DRQ A;  1FKG A;  3B9E A;  2A3A A;  2ZQV A;  3OOB A;  2KE0 A;  3PRD A;  4HBO A;  1FFR A;  1L1P A;  2IF4 A;  1ZBV A;  4L72 B;  1O6I A;  2LPV A;  4ZPV R;  3ARP A;  1Q1C A;  1RD6 A;  2MNT A;  2MLY A;  3KAB A;  4G2P A;  2KI3 A;  2RUD A;  2XP6 A;  3NI6 A;  1D6O A;  2XP8 A;  1E6R A;  2PPO A;  1UR8 A;  3RM8 A;  4MNK A;  1FKF A;  4Q7N A;  1H0G A;  4MGV A;  2Q5A A;  1FKT A;  1FKD A;  1OGG A;  4Z2L A;  4MNM A;  4W9P A;  2ZQS A;  4DWS A;  1ROU A;  4DRM A;  1XRV A;  2MLX A;  2DT0 A;  2DSV A;  3QOK A;  3CHC A;  1FJD A;  3JYM A;  2XP4 A;  5HWC A;  2OFN A;  1F40 A;  1F8A B;  3UF8 A;  3O5J A;  2O92 A;  3KCE A;  3EY6 A;  4P8W A;  3JYJ A;  3PR9 A;  2ITK A;  4C02 B;  3ARU A;  2VCD A;  1JCH B;  2MF9 A;  1NWR A;  3WIJ A;  1X6N A;  2RUR A;  1D7H A;  2B31 A;  2KFW A;  4ODK A;  3O5D A;  4U86 A;  5HW6 A;  3NRK A;  5GPG A;  5BXJ A;  2ZR6 A;  4DZ2 A;  1ZCN A;  4WK9 A;  4JFI A;  1HJW A;  4W5U A;  1R9H A;  2LJ4 A;  4KR0 B;  1H0I A;  1W9V A;  4WKF A;  2M1I A;  5DIV A;  5JH8 A;  5HW8 A;  2RUC A;  5HKG A;  4P8X A;  4MSP A;  4WKH A;  4AY1 A;  3FXY A;  3IHZ A;  3WQV A;  2F23 A;  1E6N A;  1LL6 A;  2ZR4 A;  3B8S A;  4DZ3 A;  3CHD A;  2PPN A;  4JFK A;  1K9T A;  3B9A A;  2WM0 A;  1FKH A;  3IKD A;  1HXV A;  1GPF A;  3CHF A;  4JFJ A;  3O5K A;  1ROT A;  3ARY A;  2Y78 A;  1KFW A;  1W1P A;  3KAF A;  3WL1 A;  1FKB A;  3UQI A;  1C9H A;  4QT3 A;  1Y0O A;  2PI6 A;  3H9R B;  1FKI A;  3LUO A;  3I6C A;  1U79 A;  3O5E A;  1J4H A;  4HAR A;  1A7X A;  1W9P A;  3IK8 A;  4TYO A;  4JFM A;  2EUL A;  3KAI A;  4ODR A;  2ZR5 A;  3MDY B;  2DG4 A;  4WIW A;  4HBE A;  1UR9 A;  1GOI A;  4JYS A;  3AS0 A;  2DT1 A;  1FKL A;  1TFV A;  3AS3 A;  4KQZ A;  3KAD A;  3ALG A;  3ARW A;  1N1A A;  4ZPW R;  3GPK A;  4WJX A;  4Z2J A;  3UQB A;  4GIV A;  1CTN A;  4TNS A;  3ALF A;  3O5M A;  5D75 A;  1P5Q A;  3CGN A;  3TCZ A;  3ODK A;  1J6Y A;  1D2K A;  2DSU A;  4Z2H A;  4ZPT R;  3RGC A;  3WD0 A;  1LQ0 A;  1PIN A;  1W9U A;  2B5U B;  4N19 A;  1W1V A;  3WD2 A;  4DRN A;  2WLY A;  3AQU A;  2ZQU A;  3ARQ A;  4R0X A;  4NZC A;  3ARO A;  1LJY A;  3KAC A;  1LL7 A;  4Z2I A;  1YW5 A;  1QPF A;  1GRJ A;  2OLH A;  3O5Q A;  4MPK A;  2DSW A;  4TW6 A;  4GGQ A;  3AS1 A;  4QZV B;  3RFW A;  3PA7 A;  5DF0 A;  5HT1 A;  1EHN A;  4QIB A;  4TW7 A;  2D9F A;  4NNR A;  4UDM A;  4Z2K A;  3WD1 A;  5DIU A;  1LG1 A;  4BF8 A;  1YAT A;  3JXV A;  2L2S A;  3WD4 A;  4DH0 A;  1BL4 A;  4W9O A;  1HKI A;  2DSZ A;  2XPB A;  1EQ3 A;  2WK2 A;  4ODQ A;  5HTG A;  3FY1 A;  2G8Z A;  1E6P A;  3W4R A;  2FDM A;  1HJV A;  4JFL A;  4DRP A;  4LGX A;  2XPA A;  1VF8 A;  2LGO A;  4DRK A;  1JVW A;  4XAK A;  4NSB A;  4ODN A;  3TDB A;  2QF8 A;  4TX0 A;  3O5P A;  3ARV A;  1W1Y A;  1NMW A;  5DEZ A;  4S3K A;  1NSG A;  4P8U A;  1XHG A;  4WKA A;  4IT4 A;  2XP5 A;  2O9O A;  3WQW A;  1HKK A;  4J4O A;  1HKM A;  2XP3 A;  3AS2 A;  1EDQ A;  1LL4 A;  2DG3 A;  3BMB A;  5HW7 A;  3PRB A;  3KAH A;  2M08 A;  3O5I A;  2FKE A;  2DT2 A;  3CZ8 A;  1T11 A;  2RSE A;  4DWS C;  4URI A;  3CH9 A;  1ZBC A;  2F2D A;  2PV2 A;  4FN2 A;  2PV1 A;  4TW8 A;  2A3C A;  4LAV A;  3KZ7 A;  4ODO A;  3UI5 A;  2KGJ A;  3O5L A;  4DRJ A;  4P8V A;  1WB0 A;  4LAX A;  1NMV A;  1M5Y A;  5HWB A;  1IX5 A;  2IUZ A;  2XP9 A;  3RM9 A;  4W9Q A;  1JNT A;  2RQS A;  1KT1 A;  4DRI A;  5I98 A;  3G6L A;  4Z2G A;  1J4I A;  2AWG A;  2G41 A;  5B8I C;  4IQC A;  1LG2 A;  2M2A A;  3CGM A;  1NH6 A;  1E9L A;  3UI6 A;  1NWT A;  4ODP A;  4PTM A;  1ZU8 A;  2XP7 A;  3ARR A;  2RUQ A;  1NWS A;  4MNL A;  4U85 A;  1HJX A;  2KR7 A;  3BXW A;  3CHE A;  3VAW A;  4LAW A;  1FD9 A;  1Q6I A;  1ZB5 A;  1QPL A;  1ZL1 A;  4L3N A;  3PRA A;  4G50 A;  1EIB A;  3ART A;  2PN0 A;  2N87 A;  1B6C A;  1ZBK A;  2VN1 A;  2YBU A;  1JNS A;  3EIP A;  3B7X A;  1Q6H A;  4IPX A;  4MTV A;  5GQB A;  5DIT A;  1W26 A;  1X6L A;  1E6Z A;  3FAP A;  4Q22 A;  1PBK A;  2PPP A;  2ESC A;  3WD3 A;  1D7J A;  4U84 A;  1BKF A;  4ODL A;  1JND A;  2ETN A;  3O5O A;  4IQ2 A;  4ZS6 A;  4DT4 A;  1D7I A;  5HBF A;  2F21 A;  1WAW A;  2K8I A;  1OWQ A;  3B9D A;  3NTP A;  4IT6 A;  4DWS D;  1SYT A;  5J6E A;  2MLZ A;  3GU0 A;  1FFQ A;  1FAP A;  1W1T A;  4S3J A;  2KO7 A;  2WLZ A;  5DO2 A; 
#chains in the Genus database with same CATH homology
 2ZQT A;  3IKG A;  3RME A;  4ODM A;  3WH0 A;  3WKZ A;  3O5F A;  1J4R A;  2LKN A;  1Q6U A;  1KT0 A;  1ZBW A;  3WL0 A;  2DPE A;  4J4N A;  2YBT A;  3UI4 A;  4ITZ A;  3O5R A;  1ZK6 A;  3ARX A;  2AOS A;  5GPR A;  2FAP A;  1JNE A;  1FKJ A;  2DT3 A;  4LAY A;  4O2T A;  4DWS B;  2DG9 A;  2PV3 A;  2UZ5 A;  1SR0 A;  3KAG A;  1FKR A;  5HUA A;  2MPH A;  2F4E A;  4ML4 A;  4DRO A;  4MNJ A;  1E15 A;  1FKS A;  4FAP A;  4MAV A;  1ITX A;  4DIP A;  2A3E A;  4QT2 A;  4DRH A;  3RM4 A;  3ARS A;  3UQA A;  1GUV A;  2PBC A;  2A3B A;  1HKJ A;  3G6M A;  2JZV A;  3OA5 A;  3O5G A;  4R5E A;  1QZ2 A;  1TCO C;  1WNO A;  1NWU A;  1EYM A;  3ARZ A;  1OGB A;  3TC5 A;  1FKK A;  4DRQ A;  1FKG A;  3B9E A;  2A3A A;  2ZQV A;  3OOB A;  2KE0 A;  3PRD A;  4HBO A;  1FFR A;  1L1P A;  2IF4 A;  1ZBV A;  4L72 B;  1O6I A;  2LPV A;  4ZPV R;  3ARP A;  1Q1C A;  1RD6 A;  2MNT A;  2MLY A;  3KAB A;  4G2P A;  2KI3 A;  2RUD A;  2XP6 A;  3NI6 A;  1D6O A;  2XP8 A;  1E6R A;  2PPO A;  1UR8 A;  3RM8 A;  4MNK A;  1FKF A;  4Q7N A;  1H0G A;  4MGV A;  2Q5A A;  1FKT A;  1FKD A;  1OGG A;  4Z2L A;  4MNM A;  4W9P A;  2ZQS A;  4DWS A;  1ROU A;  4DRM A;  1XRV A;  2MLX A;  2DT0 A;  2DSV A;  3QOK A;  3CHC A;  1FJD A;  3JYM A;  2XP4 A;  5HWC A;  2OFN A;  1F40 A;  1F8A B;  3UF8 A;  3O5J A;  2O92 A;  3KCE A;  3EY6 A;  4P8W A;  3JYJ A;  3PR9 A;  2ITK A;  4C02 B;  3ARU A;  2VCD A;  2MF9 A;  1NWR A;  3WIJ A;  1X6N A;  2RUR A;  1D7H A;  2B31 A;  2KFW A;  4ODK A;  3O5D A;  4U86 A;  5HW6 A;  3NRK A;  5GPG A;  5BXJ A;  2ZR6 A;  4DZ2 A;  1ZCN A;  4WK9 A;  4JFI A;  1HJW A;  4W5U A;  1R9H A;  2LJ4 A;  4KR0 B;  1H0I A;  1W9V A;  4WKF A;  2M1I A;  5DIV A;  5JH8 A;  5HW8 A;  2RUC A;  5HKG A;  4P8X A;  4MSP A;  4WKH A;  4AY1 A;  3FXY A;  3IHZ A;  3WQV A;  1E6N A;  1LL6 A;  2ZR4 A;  3B8S A;  4DZ3 A;  3CHD A;  2PPN A;  4JFK A;  1K9T A;  3B9A A;  2WM0 A;  1FKH A;  3IKD A;  1HXV A;  1GPF A;  3CHF A;  4JFJ A;  3O5K A;  1ROT A;  3ARY A;  2Y78 A;  1KFW A;  1W1P A;  3KAF A;  3WL1 A;  1FKB A;  3UQI A;  1C9H A;  4QT3 A;  1Y0O A;  2PI6 A;  3H9R B;  1FKI A;  3LUO A;  3I6C A;  1U79 A;  3O5E A;  1J4H A;  4HAR A;  1A7X A;  1W9P A;  3IK8 A;  4TYO A;  4JFM A;  3KAI A;  4ODR A;  2ZR5 A;  3MDY B;  2DG4 A;  4WIW A;  4HBE A;  1UR9 A;  1GOI A;  4JYS A;  3AS0 A;  2DT1 A;  1FKL A;  1TFV A;  3AS3 A;  4KQZ A;  3KAD A;  3ALG A;  3ARW A;  1N1A A;  4ZPW R;  3GPK A;  4WJX A;  4Z2J A;  3UQB A;  4GIV A;  1CTN A;  4TNS A;  3ALF A;  3O5M A;  5D75 A;  1P5Q A;  3CGN A;  3TCZ A;  3ODK A;  1J6Y A;  1D2K A;  2DSU A;  4Z2H A;  4ZPT R;  3RGC A;  3WD0 A;  1LQ0 A;  1PIN A;  1W9U A;  4N19 A;  1W1V A;  3WD2 A;  4DRN A;  2WLY A;  3AQU A;  2ZQU A;  3ARQ A;  4R0X A;  4NZC A;  3ARO A;  1LJY A;  3KAC A;  1LL7 A;  4Z2I A;  1YW5 A;  1QPF A;  2OLH A;  3O5Q A;  4MPK A;  2DSW A;  4TW6 A;  4GGQ A;  3AS1 A;  4QZV B;  3RFW A;  3PA7 A;  5DF0 A;  5HT1 A;  1EHN A;  4QIB A;  4TW7 A;  2D9F A;  4NNR A;  4Z2K A;  3WD1 A;  5DIU A;  1LG1 A;  4BF8 A;  1YAT A;  3JXV A;  2L2S A;  3WD4 A;  4DH0 A;  1BL4 A;  4W9O A;  1HKI A;  2DSZ A;  2XPB A;  1EQ3 A;  2WK2 A;  4ODQ A;  5HTG A;  3FY1 A;  2G8Z A;  1E6P A;  3W4R A;  2FDM A;  1HJV A;  4JFL A;  4DRP A;  4LGX A;  2XPA A;  1VF8 A;  2LGO A;  4DRK A;  1JVW A;  4XAK A;  4NSB A;  4ODN A;  3TDB A;  2QF8 A;  4TX0 A;  3O5P A;  3ARV A;  1W1Y A;  1NMW A;  5DEZ A;  4S3K A;  1NSG A;  4P8U A;  1XHG A;  4WKA A;  4IT4 A;  2XP5 A;  2O9O A;  3WQW A;  1HKK A;  4J4O A;  1HKM A;  2XP3 A;  3AS2 A;  1EDQ A;  1LL4 A;  2DG3 A;  5HW7 A;  3PRB A;  3KAH A;  2M08 A;  3O5I A;  2FKE A;  2DT2 A;  3CZ8 A;  1T11 A;  2RSE A;  4DWS C;  4URI A;  3CH9 A;  1ZBC A;  2F2D A;  2PV2 A;  4FN2 A;  2PV1 A;  4TW8 A;  2A3C A;  4LAV A;  3KZ7 A;  4ODO A;  3UI5 A;  2KGJ A;  3O5L A;  4DRJ A;  4P8V A;  1WB0 A;  4LAX A;  1NMV A;  1M5Y A;  5HWB A;  1IX5 A;  2IUZ A;  2XP9 A;  3RM9 A;  4W9Q A;  1JNT A;  2RQS A;  1KT1 A;  4DRI A;  5I98 A;  3G6L A;  4Z2G A;  1J4I A;  2AWG A;  2G41 A;  5B8I C;  4IQC A;  1LG2 A;  2M2A A;  3CGM A;  1NH6 A;  1E9L A;  3UI6 A;  1NWT A;  4ODP A;  4PTM A;  1ZU8 A;  2XP7 A;  3ARR A;  2RUQ A;  1NWS A;  4MNL A;  4U85 A;  1HJX A;  2KR7 A;  3BXW A;  3CHE A;  3VAW A;  4LAW A;  1FD9 A;  1Q6I A;  1ZB5 A;  1QPL A;  1ZL1 A;  4L3N A;  3PRA A;  4G50 A;  1EIB A;  3ART A;  2N87 A;  1B6C A;  1ZBK A;  2VN1 A;  2YBU A;  1JNS A;  3B7X A;  1Q6H A;  4IPX A;  4MTV A;  5GQB A;  5DIT A;  1W26 A;  1X6L A;  1E6Z A;  3FAP A;  4Q22 A;  1PBK A;  2PPP A;  2ESC A;  3WD3 A;  1D7J A;  4U84 A;  1BKF A;  4ODL A;  1JND A;  3O5O A;  4IQ2 A;  4ZS6 A;  4DT4 A;  1D7I A;  5HBF A;  2F21 A;  1WAW A;  2K8I A;  1OWQ A;  3B9D A;  3NTP A;  4IT6 A;  4DWS D;  1SYT A;  5J6E A;  2MLZ A;  1FFQ A;  1FAP A;  1W1T A;  4S3J A;  2KO7 A;  2WLZ A;  5DO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...