1FKFA

Atomic structure of fkbp-fk506, an immunophilin-immunosuppressant complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 BINDING PROTEIN
publication title Atomic structure of FKBP-FK506, an immunophilin-immunosuppressant complex.
pubmed rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1991-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkfA00
3IK8A 2PPPA 4LAYA 4W9PA 1NMVA 3KAFA 2Q5AA 4IQ2A 2F4EA 1U79A 3O5OA 2ZR6A 5BXJA 1J4HA 4DRJA 2KE0A 2M08A 1FKBA 4TW6A 1NSGA 2RSEA 4W9QA 2XPBA 4QT2A 4ODNA 1HXVA 2ZQSA 2XP5A 5HW6A 4DRHA 4DROA 1Q6UA 4C02B 2ZQTA 1FKGA 2MLXA 3KCEA 2XP4A 3KADA 4LAWA 3B7XA 1Q6HA 3FAPA 4ODRA 4G50A 1A7XA 3KAHA 4MGVA 4TW8A 1PBKA 4DZ2A 2ZR5A 1L1PA 2MNTA 2XP9A 1JVWA 2PPNA 1C9HA 2MLYA 3NRKA 4DRPA 3TC5A 2DG9A 5D75A 1JNSA 3O5JA 5HWCA 1EYMA 3O5FA 4MSPA 1QPLA 4DRIA 2KGJA 4JFIA 2PV3A 2VN1A 1D7IA 5HTGA 3EY6A 2FAPA 1D7HA 2JZVA 2UZ5A 3I6CA 3IKDA 2LGOA 3NI6A 3PRBA 1Q1CA 1JNTA 4QIBA 5HW8A 4JFMA 2KO7A 1FKSA 3IHZA 3PRDA 4LAXA 5HT1A 3CGNA 1EQ3A 1FKFA 2RURA 2VCDA 2AWGA 3KAIA 4FN2A 4JYSA 4IQCA 4BF8A 2ZR4A 3O5EA 1W26A 2ITKA 1P5QA 4JFLA 4TW7A 3UI4A 3UQAA 2KFWA 2KR7A 4ODLA 1FKTA 3O5DA 2PBCA 3O5RA 2ZQVA 4JFKA 4ODPA 4ITZA 1BL4A 3H9RB 3VAWA 5GPGA 5HWBA 1ROUA 3KABA 2K8IA 1F40A 3NTPA 4IPXA 4DH0A 4GGQA 2XP8A 1FKHA 2RUDA 3CGMA 3UQIA 4JFJA 1PINA 4DRMA 4DRKA 3UF8A 2FKEA 1ROTA 2XP7A 2ZQUA 4DT4A 2LJ4A 1FKKA 2F2DA 2F21A 5HUAA 3JXVA 3GPKA 1NMWA 2M1IA 1FKIA 3TDBA 3O5QA 4TX0A 2XPAA 2M2AA 2MF9A 1TCOC 3RGCA 3O5GA 1FD9A 4DIPA 3TCZA 3O5KA 4J4NA 2PV1A 3PA7A 3IKGA 2MLZA 2PPOA 1FKDA 3KAGA 2MPHA 2Y78A 1D7JA 4J4OA 4TYOA 4DRQA 4U86A 1BKFA 2XP3A 3RFWA 3UI5A 5J6EA 1B6CA 1M5YA 2DG4A 2LKNA 3UI6A 3UQBA 3O5LA 2RUCA 3O5MA 3O5PA 1KT0A 2OFNA 3O5IA 1YATA 1QPFA 4N19A 4ODQA 1D6OA 2L2SA 2PV2A 1FJDA 1FAPA 1ZCNA 3JYJA 2RQSA 1KT1A 1J6YA 4W9OA 1J4RA 4DZ3A 1QZ2A 4NNRA 3JYMA 3OOBA 4ODKA 1YW5A 1FKLA 3KACA 4ODOA 5DIVA 3WH0A 2LPVA 4R0XA 1F8AB 2N87A 4O2TA 4LAVA 4FAPA 5I98A 1ZK6A 2KI3A 3LUOA 3MDYB 4ODMA 1N1AA 1Q6IA 5HKGA 1T11A 3ODKA 4GIVA 1R9HA 2XP6A 4QT3A 5DIUA 1FKJA 1J4IA 1Y0OA 2IF4A 2D9FA 5HW7A 5B8IC 4G2PA 3KZ7A 1FKRA 2RUQA 4TNSA 4DRNA 2DG3A 4U84A 4U85A 5DITA
chains in the Genus database with same CATH superfamily
4ZS6A 2PPPA 4IQ2A 2F4EA 1K9TA 1U79A 5BXJA 1J4HA 2KE0A 1NWUA 3CHFA 2XPBA 4QT2A 4L3NA 4AY1A 5HW6A 1Q6UA 1FKGA 1Q6HA 4G50A 4MGVA 3KAHA 4TW8A 1H0IA 2MNTA 2PPNA 4Q7NA 3AS2A 3NRKA 3TC5A 5HWCA 4Z2IA 4MNKA 2DPEA 2VN1A 2FAPA 3IKDA 1GRJA 2UZ5A 3FY1A 1ITXA 3PRDA 3PRAA 3CHEA 1FKFA 4IT6A 4JYSA 2WM0A 2ZR4A 3WD3A 4WKFA 4S3JA 3O5DA 2PBCA 4JFKA 2G8ZA 4MNMA 4DWSB 1H0GA 4ZPWR 4P8UA 1TFVA 3KABA 1W9UA 3NTPA 3CGMA 3GTYX 3CH9A 2QF8A 1E6NA 1ROTA 2XP7A 2ZQUA 1LL7A 4P8VA 2LJ4A 2F2DA 3JXVA 1XRVA 1O6IA 3GPKA 1EIBA 4Z2JA 2XPAA 3RGCA 1TCOC 1FD9A 4Z2KA 4TYOA 4MNJA 4L72B 4WK9A 3UQBA 2RUCA 3O5MA 1GPFA 1LG1A 3ALFA 4N19A 2PV2A 3JYJA 2RQSA 1X6NA 4Q22A 3AS0A 1J4RA 2DSUA 1LL4A 1QZ2A 3WQWA 4ODKA 5DIVA 2LPVA 1F8AB 4FAPA 4DWSA 2KI3A 3ODKA 1R9HA 5DIUA 4QT3A 2IF4A 5HW7A 3KZ7A 4MNLA 1FKRA 2RUQA 2YBUA 4DRNA 1VF8A 3WL1A 4LAYA 1LG2A 3KAFA 3O5OA 4LGXA 4DRJA 3OA5A 1NSGA 1E6RA 1EHNA 4QZVB 4MPKA 2XP5A 4DRHA 4HARA 4DROA 3KCEA 2B31A 3B7XA 4ODRA 3WL0A 1SR0A 1PBKA 4DZ2A 4Z2HA 3GU0A 2XP9A 1ZBVA 3PR9A 4Z2GA 1C9HA 1LQ0A 1ZB5A 1HJVA 4KQZA 3O5JA 1QPLA 5DF0A 4DRIA 2PI6A 1D7IA 1W1YA 1D7HA 2G41A 1Q1CA 1JNEA 4UDMA 4JFMA 3ARVA 1EQ3A 2RURA 3ARRA 3UQAA 4TW7A 1WAWA 2KFWA 1IX5A 4ODPA 3AROA 3ARUA 3VAWA 5GPGA 1ROUA 1ZBKA 4IPXA 2RUDA 3AS3A 4NSBA 1W9VA 4DRMA 4DRKA 2FKEA 2DT1A 1FKKA 3WD2A 5HUAA 1X6LA 1ZBCA 3TDBA 3O5QA 4WJXA 4TX0A 3ARSA 1W1VA 4DIPA 4QIBA 2PV1A 3PA7A 3IKGA 2PPOA 2DSZA 1JCHB 3WD4A 4U86A 1BKFA 1W9PA 1GOIA 1B6CA 1M5YA 1JNDA 2LKNA 3WIJA 3O5LA 3B9EA 1HKMA 2EULA 1FJDA 1QPFA 1D6OA 1LJYA 1FAPA 3ARXA 1ZCNA 1J6YA 4NNRA 2ETNA 1YW5A 4ODOA 3KACA 1SYTA 5GQBA 1ZL1A 4R0XA 4ML4A 2N87A 4O2TA 4LAVA 2PN0A 4ZPVR 4W5UA 3FXYA 3LUOA 1N1AA 1Q6IA 1FKJA 1J4IA 5DEZA 2DT2A 3ARQA 4TNSA 4U84A 4W9PA 4WKHA 1CTNA 4P8WA 1WNOA 1FKBA 2M08A 4TW6A 2RSEA 4W9QA 2ZQSA 3ALGA 2A3CA 1E6PA 4C02B 2ZQTA 3AS1A 1NH6A 4WIWA 2XP4A 2A3AA 3FAPA 1A7XA 1OGGA 4XAKA 1JVWA 2MLYA 4DRPA 2DG9A 4P8XA 1NWTA 1JNSA 5GPRA 2A3EA 4S3KA 2KGJA 5DO2A 4JFIA 2DT3A 3EY6A 3I6CA 2LGOA 1FFRA 2KO7A 1EDQA 3CHCA 4LAXA 3CGNA 2VCDA 2AWGA 3KAIA 5HKGA 4IQCA 3UI4A 3O5EA 1W26A 1P5QA 4KR0B 3EIPA 3O5RA 4ITZA 1NWRA 1BL4A 1E9LA 3H9RB 4MAVA 2K8IA 4DH0A 4GGQA 2XP8A 3UQIA 1PINA 4PTMA 2O92A 3UF8A 4DT4A 1LL6A 3WKZA 1GUVA 2F21A 4MTVA 4HBOA 3G6MA 3RM8A 1NMWA 2M1IA 1FKIA 3B9AA 2M2AA 2MF9A 3BMBA 1XHGA 3O5KA 4J4NA 2A3BA 3WD0A 3KAGA 1FKDA 2Y78A 1D7JA 4HBEA 4J4OA 1HKIA 4DRQA 3W4RA 1W1PA 3UI5A 2DG4A 2OFNA 1YATA 4ODQA 1OGBA 2L2SA 1KT1A 4W9OA 4DZ3A 3JYMA 1FKLA 3WH0A 5I98A 1OWQA 1ZK6A 2WLZA 3MDYB 3G6LA 1T11A 2XP6A 4G2PA 4WKAA 4DWSC 3CHDA 2O9OA 2OLHA 1HJWA 4URIA 1E15A 3IK8A 1NMVA 2Q5AA 2ZR6A 1RD6A 3RM4A 4IT4A 4ODNA 1HXVA 3BXWA 1ZU8A 2AOSA 2WK2A 2B5UB 1KFWA 3ARTA 2MLXA 3KADA 4LAWA 2ZR5A 3WQVA 1WB0A 2FDMA 3WD1A 1HKJA 4ZPTR 5D75A 1EYMA 3O5FA 4MSPA 3B9DA 1D2KA 5HBFA 2PV3A 5HTGA 2JZVA 3PRBA 3ARZA 1ZBWA 3NI6A 1JNTA 3ARYA 5HW8A 1FKSA 3IHZA 5HT1A 4FN2A 1UR9A 4R5EA 1L1PA 4BF8A 1E44A 2ITKA 4JFLA 2KR7A 4ODLA 1FKTA 1W1TA 2ZQVA 3CZ8A 2DT0A 1UR8A 5HWBA 1F40A 3RMEA 1FFQA 1FKHA 4JFJA 3ARWA 1HJXA 2P4VA 2YBTA 3O5GA 3TCZA 3QOKA 2MLZA 3AQUA 2MPHA 2XP3A 3RFWA 5J6EA 1E6ZA 3UI6A 3O5PA 1KT0A 3O5IA 5JH8A 2DSWA 2ESCA 4NZCA 3OOBA 2DSVA 1HKKA 1NWSA 4ODMA 4GIVA 3B8SA 1Y0OA 2IUZA 2D9FA 5B8IC 3ARPA 3RM9A 4Z2LA 4DWSD 2WLYA 2DG3A 2F23A 4U85A 5DITA
chains in the Genus database with same CATH topology
4ZS6A 2PPPA 4IQ2A 2F4EA 1K9TA 1U79A 5BXJA 1J4HA 2KE0A 1NWUA 3CHFA 2XPBA 4QT2A 4L3NA 4AY1A 5HW6A 1Q6UA 1FKGA 1Q6HA 4G50A 4MGVA 3KAHA 4TW8A 1H0IA 2MNTA 2PPNA 4Q7NA 3AS2A 3NRKA 3TC5A 5HWCA 4Z2IA 4MNKA 2DPEA 2VN1A 2FAPA 3IKDA 2UZ5A 3FY1A 1ITXA 3PRDA 3PRAA 3CHEA 1FKFA 4IT6A 4JYSA 2WM0A 2ZR4A 3WD3A 4WKFA 4S3JA 3O5DA 2PBCA 4JFKA 2G8ZA 4MNMA 4DWSB 1H0GA 4ZPWR 4P8UA 1TFVA 3KABA 1W9UA 3NTPA 3CGMA 3CH9A 2QF8A 1E6NA 1ROTA 2XP7A 2ZQUA 1LL7A 4P8VA 2LJ4A 2F2DA 3JXVA 1XRVA 1O6IA 3GPKA 1EIBA 4Z2JA 2XPAA 3RGCA 1TCOC 1FD9A 4Z2KA 4TYOA 4MNJA 4L72B 4WK9A 3UQBA 2RUCA 3O5MA 1GPFA 1LG1A 3ALFA 4N19A 2PV2A 3JYJA 2RQSA 1X6NA 4Q22A 3AS0A 1J4RA 2DSUA 1LL4A 1QZ2A 3WQWA 4ODKA 5DIVA 2LPVA 1F8AB 4FAPA 4DWSA 2KI3A 3ODKA 1R9HA 5DIUA 4QT3A 2IF4A 5HW7A 3KZ7A 4MNLA 1FKRA 2RUQA 2YBUA 4DRNA 1VF8A 3WL1A 4LAYA 1LG2A 3KAFA 3O5OA 4LGXA 4DRJA 3OA5A 1NSGA 1E6RA 1EHNA 4QZVB 4MPKA 2XP5A 4DRHA 4HARA 4DROA 3KCEA 2B31A 3B7XA 4ODRA 3WL0A 1SR0A 1PBKA 4DZ2A 4Z2HA 2XP9A 1ZBVA 3PR9A 4Z2GA 1C9HA 1LQ0A 1ZB5A 1HJVA 4KQZA 3O5JA 1QPLA 5DF0A 4DRIA 2PI6A 1D7IA 1W1YA 1D7HA 2G41A 1Q1CA 1JNEA 4JFMA 3ARVA 1EQ3A 2RURA 3ARRA 3UQAA 4TW7A 1WAWA 2KFWA 1IX5A 4ODPA 3AROA 3ARUA 3VAWA 5GPGA 1ROUA 1ZBKA 4IPXA 2RUDA 3AS3A 4NSBA 1W9VA 4DRMA 4DRKA 2FKEA 2DT1A 1FKKA 3WD2A 5HUAA 1X6LA 1ZBCA 3TDBA 3O5QA 4WJXA 4TX0A 3ARSA 1W1VA 4DIPA 4QIBA 2PV1A 3PA7A 3IKGA 2PPOA 2DSZA 3WD4A 4U86A 1BKFA 1W9PA 1GOIA 1B6CA 1M5YA 1JNDA 2LKNA 3WIJA 3O5LA 3B9EA 1HKMA 1FJDA 1QPFA 1D6OA 1LJYA 1FAPA 3ARXA 1ZCNA 1J6YA 4NNRA 1YW5A 4ODOA 3KACA 1SYTA 5GQBA 1ZL1A 4R0XA 4ML4A 2N87A 4O2TA 4LAVA 4ZPVR 4W5UA 3FXYA 3LUOA 1N1AA 1Q6IA 1FKJA 1J4IA 5DEZA 2DT2A 3ARQA 4TNSA 4U84A 4W9PA 4WKHA 1CTNA 4P8WA 1WNOA 1FKBA 2M08A 4TW6A 2RSEA 4W9QA 2ZQSA 3ALGA 2A3CA 1E6PA 4C02B 2ZQTA 3AS1A 1NH6A 4WIWA 2XP4A 2A3AA 3FAPA 1A7XA 1OGGA 4XAKA 1JVWA 2MLYA 4DRPA 2DG9A 4P8XA 1NWTA 1JNSA 5GPRA 2A3EA 4S3KA 2KGJA 5DO2A 4JFIA 2DT3A 3EY6A 3I6CA 2LGOA 1FFRA 2KO7A 1EDQA 3CHCA 4LAXA 3CGNA 2VCDA 2AWGA 3KAIA 5HKGA 4IQCA 3UI4A 3O5EA 1W26A 1P5QA 4KR0B 3O5RA 4ITZA 1NWRA 1BL4A 1E9LA 3H9RB 4MAVA 2K8IA 4DH0A 4GGQA 2XP8A 3UQIA 1PINA 4PTMA 2O92A 3UF8A 4DT4A 1LL6A 3WKZA 1GUVA 2F21A 4MTVA 4HBOA 3G6MA 3RM8A 1NMWA 2M1IA 1FKIA 3B9AA 2M2AA 2MF9A 1XHGA 3O5KA 4J4NA 2A3BA 3WD0A 3KAGA 1FKDA 2Y78A 1D7JA 4HBEA 4J4OA 1HKIA 4DRQA 3W4RA 1W1PA 3UI5A 2DG4A 2OFNA 1YATA 4ODQA 1OGBA 2L2SA 1KT1A 4W9OA 4DZ3A 3JYMA 1FKLA 3WH0A 5I98A 1OWQA 1ZK6A 2WLZA 3MDYB 3G6LA 1T11A 2XP6A 4G2PA 4WKAA 4DWSC 3CHDA 2O9OA 2OLHA 1HJWA 4URIA 1E15A 3IK8A 1NMVA 2Q5AA 2ZR6A 1RD6A 3RM4A 4IT4A 4ODNA 1HXVA 3BXWA 1ZU8A 2AOSA 2WK2A 1KFWA 3ARTA 2MLXA 3KADA 4LAWA 2ZR5A 3WQVA 1WB0A 2FDMA 3WD1A 1HKJA 4ZPTR 5D75A 1EYMA 3O5FA 4MSPA 3B9DA 1D2KA 5HBFA 2PV3A 5HTGA 2JZVA 3PRBA 3ARZA 1ZBWA 3NI6A 1JNTA 3ARYA 5HW8A 1FKSA 3IHZA 5HT1A 4FN2A 1UR9A 4R5EA 1L1PA 4BF8A 4JFLA 2ITKA 2KR7A 4ODLA 1FKTA 1W1TA 2ZQVA 3CZ8A 2DT0A 1UR8A 5HWBA 1F40A 3RMEA 1FFQA 1FKHA 4JFJA 3ARWA 1HJXA 2YBTA 3O5GA 3TCZA 3QOKA 2MLZA 3AQUA 2MPHA 2XP3A 3RFWA 5J6EA 1E6ZA 3UI6A 3O5PA 1KT0A 3O5IA 5JH8A 2DSWA 2ESCA 4NZCA 3OOBA 2DSVA 1HKKA 1NWSA 4ODMA 4GIVA 3B8SA 1Y0OA 2IUZA 2D9FA 5B8IC 3ARPA 3RM9A 4Z2LA 4DWSD 2WLYA 2DG3A 4U85A 5DITA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IK8 A;  2PPP A;  4LAY A;  4W9P A;  1NMV A;  3KAF A;  2Q5A A;  4IQ2 A;  2F4E A;  1U79 A;  3O5O A;  2ZR6 A;  5BXJ A;  1J4H A;  4DRJ A;  2KE0 A;  2M08 A;  1FKB A;  4TW6 A;  1NSG A;  2RSE A;  4W9Q A;  2XPB A;  4QT2 A;  4ODN A;  1HXV A;  2ZQS A;  2XP5 A;  5HW6 A;  4DRH A;  4DRO A;  1Q6U A;  4C02 B;  2ZQT A;  1FKG A;  2MLX A;  3KCE A;  2XP4 A;  3KAD A;  4LAW A;  3B7X A;  1Q6H A;  3FAP A;  4ODR A;  4G50 A;  1A7X A;  3KAH A;  4MGV A;  4TW8 A;  1PBK A;  4DZ2 A;  2ZR5 A;  1L1P A;  2MNT A;  2XP9 A;  1JVW A;  2PPN A;  1C9H A;  2MLY A;  3NRK A;  4DRP A;  3TC5 A;  2DG9 A;  5D75 A;  1JNS A;  3O5J A;  5HWC A;  1EYM A;  3O5F A;  4MSP A;  1QPL A;  4DRI A;  2KGJ A;  4JFI A;  2PV3 A;  2VN1 A;  1D7I A;  5HTG A;  3EY6 A;  2FAP A;  1D7H A;  2JZV A;  2UZ5 A;  3I6C A;  3IKD A;  2LGO A;  3NI6 A;  3PRB A;  1Q1C A;  1JNT A;  4QIB A;  5HW8 A;  4JFM A;  2KO7 A;  1FKS A;  3IHZ A;  3PRD A;  4LAX A;  5HT1 A;  3CGN A;  1EQ3 A;  1FKF A;  2RUR A;  2VCD A;  2AWG A;  3KAI A;  4FN2 A;  4JYS A;  4IQC A;  4BF8 A;  2ZR4 A;  3O5E A;  1W26 A;  2ITK A;  1P5Q A;  4JFL A;  4TW7 A;  3UI4 A;  3UQA A;  2KFW A;  2KR7 A;  4ODL A;  1FKT A;  3O5D A;  2PBC A;  3O5R A;  2ZQV A;  4JFK A;  4ODP A;  4ITZ A;  1BL4 A;  3H9R B;  3VAW A;  5GPG A;  5HWB A;  1ROU A;  3KAB A;  2K8I A;  1F40 A;  3NTP A;  4IPX A;  4DH0 A;  4GGQ A;  2XP8 A;  1FKH A;  2RUD A;  3CGM A;  3UQI A;  4JFJ A;  1PIN A;  4DRM A;  4DRK A;  3UF8 A;  2FKE A;  1ROT A;  2XP7 A;  2ZQU A;  4DT4 A;  2LJ4 A;  1FKK A;  2F2D A;  2F21 A;  5HUA A;  3JXV A;  3GPK A;  1NMW A;  2M1I A;  1FKI A;  3TDB A;  3O5Q A;  4TX0 A;  2XPA A;  2M2A A;  2MF9 A;  1TCO C;  3RGC A;  3O5G A;  1FD9 A;  4DIP A;  3TCZ A;  3O5K A;  4J4N A;  2PV1 A;  3PA7 A;  3IKG A;  2MLZ A;  2PPO A;  1FKD A;  3KAG A;  2MPH A;  2Y78 A;  1D7J A;  4J4O A;  4TYO A;  4DRQ A;  4U86 A;  1BKF A;  2XP3 A;  3RFW A;  3UI5 A;  5J6E A;  1B6C A;  1M5Y A;  2DG4 A;  2LKN A;  3UI6 A;  3UQB A;  3O5L A;  2RUC A;  3O5M A;  3O5P A;  1KT0 A;  2OFN A;  3O5I A;  1YAT A;  1QPF A;  4N19 A;  4ODQ A;  1D6O A;  2L2S A;  2PV2 A;  1FJD A;  1FAP A;  1ZCN A;  3JYJ A;  2RQS A;  1KT1 A;  1J6Y A;  4W9O A;  1J4R A;  4DZ3 A;  1QZ2 A;  4NNR A;  3JYM A;  3OOB A;  4ODK A;  1YW5 A;  1FKL A;  3KAC A;  4ODO A;  5DIV A;  3WH0 A;  2LPV A;  4R0X A;  1F8A B;  2N87 A;  4O2T A;  4LAV A;  4FAP A;  5I98 A;  1ZK6 A;  2KI3 A;  3LUO A;  3MDY B;  4ODM A;  1N1A A;  1Q6I A;  5HKG A;  1T11 A;  3ODK A;  4GIV A;  1R9H A;  2XP6 A;  4QT3 A;  5DIU A;  1FKJ A;  1J4I A;  1Y0O A;  2IF4 A;  2D9F A;  5HW7 A;  5B8I C;  4G2P A;  3KZ7 A;  1FKR A;  2RUQ A;  4TNS A;  4DRN A;  2DG3 A;  4U84 A;  4U85 A;  5DIT A; 
#chains in the Genus database with same CATH topology
 4ZS6 A;  2PPP A;  4IQ2 A;  2F4E A;  1K9T A;  1U79 A;  5BXJ A;  1J4H A;  2KE0 A;  1NWU A;  3CHF A;  2XPB A;  4QT2 A;  4L3N A;  4AY1 A;  5HW6 A;  1Q6U A;  1FKG A;  1Q6H A;  4G50 A;  4MGV A;  3KAH A;  4TW8 A;  1H0I A;  2MNT A;  2PPN A;  4Q7N A;  3AS2 A;  3NRK A;  3TC5 A;  5HWC A;  4Z2I A;  4MNK A;  2DPE A;  2VN1 A;  2FAP A;  3IKD A;  1GRJ A;  2UZ5 A;  3FY1 A;  1ITX A;  3PRD A;  3PRA A;  3CHE A;  1FKF A;  4IT6 A;  4JYS A;  2WM0 A;  2ZR4 A;  3WD3 A;  4WKF A;  4S3J A;  3O5D A;  2PBC A;  4JFK A;  2G8Z A;  4MNM A;  4DWS B;  1H0G A;  4ZPW R;  4P8U A;  1TFV A;  3KAB A;  1W9U A;  3NTP A;  3CGM A;  3GTY X;  3CH9 A;  2QF8 A;  1E6N A;  1ROT A;  2XP7 A;  2ZQU A;  1LL7 A;  4P8V A;  2LJ4 A;  2F2D A;  3JXV A;  1XRV A;  1O6I A;  3GPK A;  1EIB A;  4Z2J A;  2XPA A;  3RGC A;  1TCO C;  1FD9 A;  4Z2K A;  4TYO A;  4MNJ A;  4L72 B;  4WK9 A;  3UQB A;  2RUC A;  3O5M A;  1GPF A;  1LG1 A;  3ALF A;  4N19 A;  2PV2 A;  3JYJ A;  2RQS A;  1X6N A;  4Q22 A;  3AS0 A;  1J4R A;  2DSU A;  1LL4 A;  1QZ2 A;  3WQW A;  4ODK A;  5DIV A;  2LPV A;  1F8A B;  4FAP A;  4DWS A;  2KI3 A;  3ODK A;  1R9H A;  5DIU A;  4QT3 A;  2IF4 A;  5HW7 A;  3KZ7 A;  4MNL A;  1FKR A;  2RUQ A;  2YBU A;  4DRN A;  1VF8 A;  3WL1 A;  4LAY A;  1LG2 A;  3KAF A;  3O5O A;  4LGX A;  4DRJ A;  3OA5 A;  1NSG A;  1E6R A;  1EHN A;  4QZV B;  4MPK A;  2XP5 A;  4DRH A;  4HAR A;  4DRO A;  3KCE A;  2B31 A;  3B7X A;  4ODR A;  3WL0 A;  1SR0 A;  1PBK A;  4DZ2 A;  4Z2H A;  3GU0 A;  2XP9 A;  1ZBV A;  3PR9 A;  4Z2G A;  1C9H A;  1LQ0 A;  1ZB5 A;  1HJV A;  4KQZ A;  3O5J A;  1QPL A;  5DF0 A;  4DRI A;  2PI6 A;  1D7I A;  1W1Y A;  1D7H A;  2G41 A;  1Q1C A;  1JNE A;  4UDM A;  4JFM A;  3ARV A;  1EQ3 A;  2RUR A;  3ARR A;  3UQA A;  4TW7 A;  1WAW A;  2KFW A;  1IX5 A;  4ODP A;  3ARO A;  3ARU A;  3VAW A;  5GPG A;  1ROU A;  1ZBK A;  4IPX A;  2RUD A;  3AS3 A;  4NSB A;  1W9V A;  4DRM A;  4DRK A;  2FKE A;  2DT1 A;  1FKK A;  3WD2 A;  5HUA A;  1X6L A;  1ZBC A;  3TDB A;  3O5Q A;  4WJX A;  4TX0 A;  3ARS A;  1W1V A;  4DIP A;  4QIB A;  2PV1 A;  3PA7 A;  3IKG A;  2PPO A;  2DSZ A;  1JCH B;  3WD4 A;  4U86 A;  1BKF A;  1W9P A;  1GOI A;  1B6C A;  1M5Y A;  1JND A;  2LKN A;  3WIJ A;  3O5L A;  3B9E A;  1HKM A;  2EUL A;  1FJD A;  1QPF A;  1D6O A;  1LJY A;  1FAP A;  3ARX A;  1ZCN A;  1J6Y A;  4NNR A;  2ETN A;  1YW5 A;  4ODO A;  3KAC A;  1SYT A;  5GQB A;  1ZL1 A;  4R0X A;  4ML4 A;  2N87 A;  4O2T A;  4LAV A;  2PN0 A;  4ZPV R;  4W5U A;  3FXY A;  3LUO A;  1N1A A;  1Q6I A;  1FKJ A;  1J4I A;  5DEZ A;  2DT2 A;  3ARQ A;  4TNS A;  4U84 A;  4W9P A;  4WKH A;  1CTN A;  4P8W A;  1WNO A;  1FKB A;  2M08 A;  4TW6 A;  2RSE A;  4W9Q A;  2ZQS A;  3ALG A;  2A3C A;  1E6P A;  4C02 B;  2ZQT A;  3AS1 A;  1NH6 A;  4WIW A;  2XP4 A;  2A3A A;  3FAP A;  1A7X A;  1OGG A;  4XAK A;  1JVW A;  2MLY A;  4DRP A;  2DG9 A;  4P8X A;  1NWT A;  1JNS A;  5GPR A;  2A3E A;  4S3K A;  2KGJ A;  5DO2 A;  4JFI A;  2DT3 A;  3EY6 A;  3I6C A;  2LGO A;  1FFR A;  2KO7 A;  1EDQ A;  3CHC A;  4LAX A;  3CGN A;  2VCD A;  2AWG A;  3KAI A;  5HKG A;  4IQC A;  3UI4 A;  3O5E A;  1W26 A;  1P5Q A;  4KR0 B;  3EIP A;  3O5R A;  4ITZ A;  1NWR A;  1BL4 A;  1E9L A;  3H9R B;  4MAV A;  2K8I A;  4DH0 A;  4GGQ A;  2XP8 A;  3UQI A;  1PIN A;  4PTM A;  2O92 A;  3UF8 A;  4DT4 A;  1LL6 A;  3WKZ A;  1GUV A;  2F21 A;  4MTV A;  4HBO A;  3G6M A;  3RM8 A;  1NMW A;  2M1I A;  1FKI A;  3B9A A;  2M2A A;  2MF9 A;  3BMB A;  1XHG A;  3O5K A;  4J4N A;  2A3B A;  3WD0 A;  3KAG A;  1FKD A;  2Y78 A;  1D7J A;  4HBE A;  4J4O A;  1HKI A;  4DRQ A;  3W4R A;  1W1P A;  3UI5 A;  2DG4 A;  2OFN A;  1YAT A;  4ODQ A;  1OGB A;  2L2S A;  1KT1 A;  4W9O A;  4DZ3 A;  3JYM A;  1FKL A;  3WH0 A;  5I98 A;  1OWQ A;  1ZK6 A;  2WLZ A;  3MDY B;  3G6L A;  1T11 A;  2XP6 A;  4G2P A;  4WKA A;  4DWS C;  3CHD A;  2O9O A;  2OLH A;  1HJW A;  4URI A;  1E15 A;  3IK8 A;  1NMV A;  2Q5A A;  2ZR6 A;  1RD6 A;  3RM4 A;  4IT4 A;  4ODN A;  1HXV A;  3BXW A;  1ZU8 A;  2AOS A;  2WK2 A;  2B5U B;  1KFW A;  3ART A;  2MLX A;  3KAD A;  4LAW A;  2ZR5 A;  3WQV A;  1WB0 A;  2FDM A;  3WD1 A;  1HKJ A;  4ZPT R;  5D75 A;  1EYM A;  3O5F A;  4MSP A;  3B9D A;  1D2K A;  5HBF A;  2PV3 A;  5HTG A;  2JZV A;  3PRB A;  3ARZ A;  1ZBW A;  3NI6 A;  1JNT A;  3ARY A;  5HW8 A;  1FKS A;  3IHZ A;  5HT1 A;  4FN2 A;  1UR9 A;  4R5E A;  1L1P A;  4BF8 A;  1E44 A;  2ITK A;  4JFL A;  2KR7 A;  4ODL A;  1FKT A;  1W1T A;  2ZQV A;  3CZ8 A;  2DT0 A;  1UR8 A;  5HWB A;  1F40 A;  3RME A;  1FFQ A;  1FKH A;  4JFJ A;  3ARW A;  1HJX A;  2P4V A;  2YBT A;  3O5G A;  3TCZ A;  3QOK A;  2MLZ A;  3AQU A;  2MPH A;  2XP3 A;  3RFW A;  5J6E A;  1E6Z A;  3UI6 A;  3O5P A;  1KT0 A;  3O5I A;  5JH8 A;  2DSW A;  2ESC A;  4NZC A;  3OOB A;  2DSV A;  1HKK A;  1NWS A;  4ODM A;  4GIV A;  3B8S A;  1Y0O A;  2IUZ A;  2D9F A;  5B8I C;  3ARP A;  3RM9 A;  4Z2L A;  4DWS D;  2WLY A;  2DG3 A;  2F23 A;  4U85 A;  5DIT A; 
#chains in the Genus database with same CATH homology
 4ZS6 A;  2PPP A;  4IQ2 A;  2F4E A;  1K9T A;  1U79 A;  5BXJ A;  1J4H A;  2KE0 A;  1NWU A;  3CHF A;  2XPB A;  4QT2 A;  4L3N A;  4AY1 A;  5HW6 A;  1Q6U A;  1FKG A;  1Q6H A;  4G50 A;  4MGV A;  3KAH A;  4TW8 A;  1H0I A;  2MNT A;  2PPN A;  4Q7N A;  3AS2 A;  3NRK A;  3TC5 A;  5HWC A;  4Z2I A;  4MNK A;  2DPE A;  2VN1 A;  2FAP A;  3IKD A;  2UZ5 A;  3FY1 A;  1ITX A;  3PRD A;  3PRA A;  3CHE A;  1FKF A;  4IT6 A;  4JYS A;  2WM0 A;  2ZR4 A;  3WD3 A;  4WKF A;  4S3J A;  3O5D A;  2PBC A;  4JFK A;  2G8Z A;  4MNM A;  4DWS B;  1H0G A;  4ZPW R;  4P8U A;  1TFV A;  3KAB A;  1W9U A;  3NTP A;  3CGM A;  3CH9 A;  2QF8 A;  1E6N A;  1ROT A;  2XP7 A;  2ZQU A;  1LL7 A;  4P8V A;  2LJ4 A;  2F2D A;  3JXV A;  1XRV A;  1O6I A;  3GPK A;  1EIB A;  4Z2J A;  2XPA A;  3RGC A;  1TCO C;  1FD9 A;  4Z2K A;  4TYO A;  4MNJ A;  4L72 B;  4WK9 A;  3UQB A;  2RUC A;  3O5M A;  1GPF A;  1LG1 A;  3ALF A;  4N19 A;  2PV2 A;  3JYJ A;  2RQS A;  1X6N A;  4Q22 A;  3AS0 A;  1J4R A;  2DSU A;  1LL4 A;  1QZ2 A;  3WQW A;  4ODK A;  5DIV A;  2LPV A;  1F8A B;  4FAP A;  4DWS A;  2KI3 A;  3ODK A;  1R9H A;  5DIU A;  4QT3 A;  2IF4 A;  5HW7 A;  3KZ7 A;  4MNL A;  1FKR A;  2RUQ A;  2YBU A;  4DRN A;  1VF8 A;  3WL1 A;  4LAY A;  1LG2 A;  3KAF A;  3O5O A;  4LGX A;  4DRJ A;  3OA5 A;  1NSG A;  1E6R A;  1EHN A;  4QZV B;  4MPK A;  2XP5 A;  4DRH A;  4HAR A;  4DRO A;  3KCE A;  2B31 A;  3B7X A;  4ODR A;  3WL0 A;  1SR0 A;  1PBK A;  4DZ2 A;  4Z2H A;  2XP9 A;  1ZBV A;  3PR9 A;  4Z2G A;  1C9H A;  1LQ0 A;  1ZB5 A;  1HJV A;  4KQZ A;  3O5J A;  1QPL A;  5DF0 A;  4DRI A;  2PI6 A;  1D7I A;  1W1Y A;  1D7H A;  2G41 A;  1Q1C A;  1JNE A;  4JFM A;  3ARV A;  1EQ3 A;  2RUR A;  3ARR A;  3UQA A;  4TW7 A;  1WAW A;  2KFW A;  1IX5 A;  4ODP A;  3ARO A;  3ARU A;  3VAW A;  5GPG A;  1ROU A;  1ZBK A;  4IPX A;  2RUD A;  3AS3 A;  4NSB A;  1W9V A;  4DRM A;  4DRK A;  2FKE A;  2DT1 A;  1FKK A;  3WD2 A;  5HUA A;  1X6L A;  1ZBC A;  3TDB A;  3O5Q A;  4WJX A;  4TX0 A;  3ARS A;  1W1V A;  4DIP A;  4QIB A;  2PV1 A;  3PA7 A;  3IKG A;  2PPO A;  2DSZ A;  3WD4 A;  4U86 A;  1BKF A;  1W9P A;  1GOI A;  1B6C A;  1M5Y A;  1JND A;  2LKN A;  3WIJ A;  3O5L A;  3B9E A;  1HKM A;  1FJD A;  1QPF A;  1D6O A;  1LJY A;  1FAP A;  3ARX A;  1ZCN A;  1J6Y A;  4NNR A;  1YW5 A;  4ODO A;  3KAC A;  1SYT A;  5GQB A;  1ZL1 A;  4R0X A;  4ML4 A;  2N87 A;  4O2T A;  4LAV A;  4ZPV R;  4W5U A;  3FXY A;  3LUO A;  1N1A A;  1Q6I A;  1FKJ A;  1J4I A;  5DEZ A;  2DT2 A;  3ARQ A;  4TNS A;  4U84 A;  4W9P A;  4WKH A;  1CTN A;  4P8W A;  1WNO A;  1FKB A;  2M08 A;  4TW6 A;  2RSE A;  4W9Q A;  2ZQS A;  3ALG A;  2A3C A;  1E6P A;  4C02 B;  2ZQT A;  3AS1 A;  1NH6 A;  4WIW A;  2XP4 A;  2A3A A;  3FAP A;  1A7X A;  1OGG A;  4XAK A;  1JVW A;  2MLY A;  4DRP A;  2DG9 A;  4P8X A;  1NWT A;  1JNS A;  5GPR A;  2A3E A;  4S3K A;  2KGJ A;  5DO2 A;  4JFI A;  2DT3 A;  3EY6 A;  3I6C A;  2LGO A;  1FFR A;  2KO7 A;  1EDQ A;  3CHC A;  4LAX A;  3CGN A;  2VCD A;  2AWG A;  3KAI A;  5HKG A;  4IQC A;  3UI4 A;  3O5E A;  1W26 A;  1P5Q A;  4KR0 B;  3O5R A;  4ITZ A;  1NWR A;  1BL4 A;  1E9L A;  3H9R B;  4MAV A;  2K8I A;  4DH0 A;  4GGQ A;  2XP8 A;  3UQI A;  1PIN A;  4PTM A;  2O92 A;  3UF8 A;  4DT4 A;  1LL6 A;  3WKZ A;  1GUV A;  2F21 A;  4MTV A;  4HBO A;  3G6M A;  3RM8 A;  1NMW A;  2M1I A;  1FKI A;  3B9A A;  2M2A A;  2MF9 A;  1XHG A;  3O5K A;  4J4N A;  2A3B A;  3WD0 A;  3KAG A;  1FKD A;  2Y78 A;  1D7J A;  4HBE A;  4J4O A;  1HKI A;  4DRQ A;  3W4R A;  1W1P A;  3UI5 A;  2DG4 A;  2OFN A;  1YAT A;  4ODQ A;  1OGB A;  2L2S A;  1KT1 A;  4W9O A;  4DZ3 A;  3JYM A;  1FKL A;  3WH0 A;  5I98 A;  1OWQ A;  1ZK6 A;  2WLZ A;  3MDY B;  3G6L A;  1T11 A;  2XP6 A;  4G2P A;  4WKA A;  4DWS C;  3CHD A;  2O9O A;  2OLH A;  1HJW A;  4URI A;  1E15 A;  3IK8 A;  1NMV A;  2Q5A A;  2ZR6 A;  1RD6 A;  3RM4 A;  4IT4 A;  4ODN A;  1HXV A;  3BXW A;  1ZU8 A;  2AOS A;  2WK2 A;  1KFW A;  3ART A;  2MLX A;  3KAD A;  4LAW A;  2ZR5 A;  3WQV A;  1WB0 A;  2FDM A;  3WD1 A;  1HKJ A;  4ZPT R;  5D75 A;  1EYM A;  3O5F A;  4MSP A;  3B9D A;  1D2K A;  5HBF A;  2PV3 A;  5HTG A;  2JZV A;  3PRB A;  3ARZ A;  1ZBW A;  3NI6 A;  1JNT A;  3ARY A;  5HW8 A;  1FKS A;  3IHZ A;  5HT1 A;  4FN2 A;  1UR9 A;  4R5E A;  1L1P A;  4BF8 A;  4JFL A;  2ITK A;  2KR7 A;  4ODL A;  1FKT A;  1W1T A;  2ZQV A;  3CZ8 A;  2DT0 A;  1UR8 A;  5HWB A;  1F40 A;  3RME A;  1FFQ A;  1FKH A;  4JFJ A;  3ARW A;  1HJX A;  2YBT A;  3O5G A;  3TCZ A;  3QOK A;  2MLZ A;  3AQU A;  2MPH A;  2XP3 A;  3RFW A;  5J6E A;  1E6Z A;  3UI6 A;  3O5P A;  1KT0 A;  3O5I A;  5JH8 A;  2DSW A;  2ESC A;  4NZC A;  3OOB A;  2DSV A;  1HKK A;  1NWS A;  4ODM A;  4GIV A;  3B8S A;  1Y0O A;  2IUZ A;  2D9F A;  5B8I C;  3ARP A;  3RM9 A;  4Z2L A;  4DWS D;  2WLY A;  2DG3 A;  4U85 A;  5DIT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...