1FKFA

Atomic structure of fkbp-fk506, an immunophilin-immunosuppressant complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic structure of FKBP-FK506, an immunophilin-immunosuppressant complex.
pubmed rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords FK506 BINDING PROTEIN
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1991-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkfA00
1JNSA 2XP8A 2LJ4A 4JFLA 5HKGA 4W9QA 2MLXA 1Q6IA 3O5LA 2KO7A 4JFJA 4U84A 1Q6HA 3UQIA 4DRKA 4QT3A 4GGQA 4O2TA 3OOBA 3IK8A 4JFMA 1FKFA 2AWGA 3B7XA 2KE0A 3NI6A 1F8AB 4FN2A 4ODRA 2RSEA 2ZR5A 1ROUA 1HXVA 4IQCA 5HWCA 5HTGA 1FJDA 3H9RB 1Y0OA 5HUAA 4ODOA 4DRIA 5J6EA 4QT2A 4DH0A 1F40A 1FKRA 1EQ3A 2XPBA 3KAGA 2PBCA 4LAVA 2KR7A 4IQ2A 1C9HA 3PRDA 4J4NA 4W9OA 3O5DA 1R9HA 2PPPA 5DITA 3UQAA 2M1IA 3O5MA 5HT1A 2XP7A 2ZQUA 2KGJA 2FAPA 3MDYB 4QIBA 1TCOC 3NTPA 4FAPA 1ZCNA 4JYSA 4TNSA 1J4RA 3CGMA 1FKGA 3NRKA 4TW6A 5HW7A 5DIUA 1L1PA 4TYOA 4BF8A 1J6YA 3KCEA 3UI5A 2RUDA 1D7HA 3UI4A 2XP6A 2VN1A 4N19A 2PPNA 3KACA 1J4IA 1FAPA 1QPFA 3O5RA 2N87A 2OFNA 3ODKA 4ODMA 3UQBA 3I6CA 1FKDA 5BXJA 2JZVA 2F21A 4DROA 4DT4A 5HWBA 1T11A 2DG3A 3VAWA 2KFWA 5I98A 2DG9A 3JXVA 2XP4A 3PA7A 3LUOA 2XP3A 4U85A 1YW5A 2M2AA 4GIVA 4DRMA 4DZ2A 4DRQA 3KAIA 1Q6UA 4ODNA 3IKGA 1EYMA 4LAWA 2XP9A 3IHZA 2MF9A 1NMVA 3GPKA 1M5YA 2ZR4A 1JNTA 3KAHA 1W26A 4IPXA 4DRPA 2RUCA 4TW8A 2D9FA 1Q1CA 2LGOA 1FKJA 3KAFA 3TDBA 2FKEA 3PRBA 2RQSA 3O5PA 2XP5A 4G2PA 2F4EA 3UF8A 2K8IA 3IKDA 4ODPA 3RGCA 1A7XA 1FKTA 2LKNA 3KABA 1FKKA 2L2SA 2VCDA 4W9PA 2ZQTA 3JYJA 1FKHA 4DRHA 1PINA 2ZR6A 4LAYA 4MGVA 2Y78A 4G50A 1ROTA 1J4HA 2RUQA 4DZ3A 3KZ7A 4ODKA 3TCZA 5HW6A 1FKBA 4TX0A 3O5IA 4J4OA 4TW7A 2MLZA 5HW8A 1P5QA 1FKSA 2PV3A 4ODQA 5GPGA 4DIPA 2Q5AA 3O5EA 3O5GA 2DG4A 2ITKA 2KI3A 2ZQVA 3JYMA 4U86A 3CGNA 1YATA 2LPVA 4LAXA 1BL4A 1D7JA 1KT1A 1NMWA 3O5FA 1JVWA 1U79A 2F2DA 2PV1A 1ZK6A 4DRNA 3TC5A 1FD9A 1NSGA 2MNTA 3O5QA 4DRJA 3EY6A 2PV2A 4NNRA 5B8IC 2ZQSA 3O5OA 1KT0A 2M08A 3FAPA 3UI6A 3WH0A 2RURA 1FKIA 1D6OA 3O5JA 1FKLA 4JFKA 2IF4A 5D75A 1D7IA 1B6CA 4R0XA 4JFIA 4MSPA 2UZ5A 2MPHA 1QZ2A 3RFWA 1BKFA 4ITZA 3O5KA 3KADA 1PBKA 4C02B 2MLYA 1N1AA 4ODLA 2XPAA 5DIVA 2PPOA 1QPLA
chains in the Genus database with same CATH superfamily
1ZBCA 2MLXA 1NWSA 2ESCA 2KO7A 3RM8A 1W1VA 3WL1A 4QT3A 1WB0A 1GUVA 3OOBA 4JFMA 5DF0A 2KE0A 4ODRA 5HWCA 1FJDA 5HUAA 4DRIA 3KAGA 2A3EA 2KR7A 3O5MA 1HJWA 2DSVA 3MDYB 1ZBWA 3NTPA 4R5EA 1J4RA 4TW6A 1NWRA 5HW7A 1L1PA 1W1PA 1J6YA 3KCEA 1LQ0A 1FAPA 5JH8A 3AS2A 3AQUA 3CHEA 3WD4A 3BMBA 2JZVA 1HJXA 2DSUA 3VAWA 2KFWA 1W9PA 3JXVA 4U85A 5DO2A 4DZ2A 4DRQA 3KAIA 4DWSC 2MF9A 1M5YA 2ZR4A 3KAHA 4WKFA 4IPXA 2D9FA 1FKJA 5DEZA 3KAFA 2QF8A 4Z2JA 4G2PA 2AOSA 1LL7A 4ODPA 2LKNA 1LG1A 1UR8A 4Q7NA 2A3CA 2VCDA 3FXYA 4DRHA 4URIA 3KZ7A 4ODKA 1E15A 1FKSA 4NSBA 4DIPA 3O5EA 2KI3A 1HKMA 3JYMA 1OGGA 2DSZA 1KT1A 2WLYA 1U79A 1ZBVA 3AS3A 2ETNA 3GTYX 3EY6A 3UI6A 3WH0A 2M08A 2RURA 1W9VA 2WM0A 2F23A 3ARSA 1FKLA 1NWTA 4L72B 4MSPA 2MPHA 1W1TA 3O5KA 2DT3A 4WJXA 3FY1A 4WIWA 2MLYA 1E44A 1N1AA 4ODLA 5B8IC 4IT6A 2N87A 3CZ8A 4ML4A 1HKIA 5HKGA 2YBUA 3O5LA 3ALFA 4U84A 3ARTA 3CH9A 4GGQA 4DWSA 1FKFA 2AWGA 2FDMA 3B7XA 2PN0A 2RSEA 2ZR5A 1ROUA 1HXVA 1GRJA 1ZB5A 5J6EA 4DH0A 1FKRA 4IQ2A 4P8VA 4W9OA 3UQAA 5DITA 1ITXA 3WL0A 5HT1A 1W9UA 2KGJA 2FAPA 4JYSA 4Z2IA 3CGMA 3NRKA 4WKAA 3AS1A 3UI4A 2DT2A 2VN1A 3ARQA 1NH6A 1QPFA 4KQZA 3UQBA 3ODKA 4ODMA 2IUZA 1E6NA 4ZPVR 3ARXA 1FKDA 2DT0A 5HWBA 2DG3A 1JNDA 4S3JA 2DG9A 1YW5A 2M2AA 4DRMA 1Q6UA 1EYMA 4LAWA 1W1YA 3IHZA 3W4RA 1JNTA 4PTMA 1W26A 1OGBA 3ARYA 1Q1CA 3G6MA 1FFRA 1SYTA 2FKEA 2G41A 3O5PA 2XP5A 3UF8A 1ZBKA 1A7XA 4S3KA 1VF8A 5HBFA 3RM4A 4W9PA 3CHDA 3JYJA 1TFVA 1PINA 3AROA 4LAYA 1K9TA 4DZ3A 5HW6A 4MNLA 1OWQA 4TX0A 4TW7A 2MLZA 1P5QA 3EIPA 5GPGA 2P4VA 2Q5AA 3O5GA 2ITKA 2OLHA 3OA5A 3CGNA 1YATA 1FFQA 1NMWA 1JVWA 2F2DA 4IT4A 4MNMA 2PV1A 4WK9A 4DRNA 3ARPA 2ZQSA 1KT0A 1FKIA 3PR9A 5D75A 1QZ2A 2B31A 4UDMA 2G8ZA 3WD1A 3G6LA 1SR0A 3PRAA 1QPLA 3ARUA 1JNSA 2XP8A 4W9QA 1Q6IA 4DRKA 3IK8A 1XHGA 2WLZA 3NI6A 4Z2KA 3ARZA 1ZL1A 3WQVA 4MNKA 4AY1A 1F40A 1EQ3A 2PBCA 4LAVA 1C9HA 2A3BA 4J4NA 3O5DA 1R9HA 2PPPA 3ARRA 1RD6A 2DT1A 2XP7A 1TCOC 3BXWA 4FAPA 4TNSA 1HJVA 2DPEA 2DSWA 4TYOA 1WAWA 3UI5A 2RUDA 2XP6A 4N19A 2PPNA 4L3NA 1J4IA 1E6ZA 2OFNA 3I6CA 1HKJA 4DROA 4DT4A 3B9DA 1T11A 4DWSD 3PA7A 4MNJA 3LUOA 2XP3A 2WK2A 1GOIA 1WNOA 4NZCA 4P8XA 1NMVA 1EIBA 4TW8A 3RMEA 3GU0A 3ARWA 3CHCA 2RQSA 1XRVA 2K8IA 3IKDA 4Z2LA 1ZU8A 2L2SA 1FKHA 3WKZA 4G50A 1ROTA 1J4HA 4W5UA 2PV3A 4ODQA 2ZQVA 4U86A 2LPVA 1BL4A 1KFWA 3O5FA 3O5OA 3FAPA 1D6OA 3O5JA 1D7IA 1B6CA 4R0XA 2UZ5A 3RFWA 4ITZA 3KADA 1PBKA 4C02B 3ARVA 5GQBA 1CTNA 2XPAA 3WIJA 1LL6A 2LJ4A 4JFLA 1E6PA 4JFJA 1Q6HA 3UQIA 4KR0B 4O2TA 1GPFA 1JCHB 1H0GA 4FN2A 1F8AB 3WD2A 4IQCA 5HTGA 3H9RB 4Z2GA 4HARA 1NWUA 1Y0OA 4ODOA 4QT2A 3WD0A 2XPBA 4ZS6A 3WD3A 3PRDA 1EHNA 1IX5A 2M1IA 1H0IA 3B9AA 2ZQUA 4QIBA 1ZCNA 2A3AA 1X6LA 1E9LA 1FKGA 1UR9A 4P8WA 5DIUA 1X6NA 4LGXA 4BF8A 1D7HA 3B9EA 3O5RA 3WQWA 1EDQA 3ALGA 5BXJA 2F21A 3CHFA 4P8UA 5I98A 4ZPTR 2XP4A 4MPKA 4XAKA 4GIVA 4ODNA 3IKGA 2EULA 2XP9A 3GPKA 1LG2A 2B5UB 4DRPA 2RUCA 2LGOA 3TDBA 3PRBA 4Q22A 2O9OA 1LJYA 4QZVB 2F4EA 3RGCA 1FKTA 3AS0A 2O92A 4MAVA 1LL4A 3KABA 1FKKA 2ZQTA 3QOKA 2PI6A 4HBOA 2ZR6A 4MGVA 4HBEA 2Y78A 4MTVA 2RUQA 4ZPWR 3TCZA 1FKBA 3O5IA 4J4OA 5GPRA 5HW8A 3B8SA 2DG4A 4DWSB 4LAXA 1O6IA 1D7JA 1ZK6A 3RM9A 3TC5A 1FD9A 1NSGA 2MNTA 3O5QA 4WKHA 4DRJA 2PV2A 4NNRA 2YBTA 4JFKA 2IF4A 4JFIA 1BKFA 1D2KA 1E6RA 4Z2HA 1JNEA 5DIVA 1HKKA 2PPOA 3KACA
chains in the Genus database with same CATH topology
1ZBCA 2MLXA 1NWSA 2ESCA 2KO7A 3RM8A 1W1VA 3WL1A 4QT3A 1WB0A 1GUVA 3OOBA 4JFMA 5DF0A 2KE0A 4ODRA 5HWCA 1FJDA 5HUAA 4DRIA 3KAGA 2A3EA 2KR7A 3O5MA 1HJWA 2DSVA 3MDYB 1ZBWA 3NTPA 4R5EA 1J4RA 4TW6A 1NWRA 5HW7A 1L1PA 1W1PA 1J6YA 3KCEA 1LQ0A 1FAPA 5JH8A 3AS2A 3AQUA 3CHEA 3WD4A 2JZVA 1HJXA 2DSUA 3VAWA 2KFWA 1W9PA 3JXVA 4U85A 5DO2A 4DZ2A 4DRQA 3KAIA 4DWSC 2MF9A 1M5YA 2ZR4A 3KAHA 4WKFA 4IPXA 2D9FA 1FKJA 5DEZA 3KAFA 2QF8A 4Z2JA 4G2PA 2AOSA 1LL7A 4ODPA 2LKNA 1LG1A 1UR8A 4Q7NA 2A3CA 2VCDA 3FXYA 4DRHA 4URIA 3KZ7A 4ODKA 1E15A 1FKSA 4NSBA 4DIPA 3O5EA 2KI3A 1HKMA 3JYMA 1OGGA 2DSZA 1KT1A 2WLYA 1U79A 1ZBVA 3AS3A 3EY6A 3UI6A 3WH0A 2M08A 2RURA 1W9VA 2WM0A 3ARSA 1FKLA 1NWTA 4L72B 4MSPA 2MPHA 1W1TA 3O5KA 2DT3A 4WJXA 3FY1A 4WIWA 2MLYA 1N1AA 4ODLA 5B8IC 4IT6A 2N87A 3CZ8A 4ML4A 1HKIA 5HKGA 2YBUA 3O5LA 3ALFA 4U84A 3ARTA 3CH9A 4GGQA 4DWSA 1FKFA 2AWGA 2FDMA 3B7XA 2RSEA 2ZR5A 1ROUA 1HXVA 1ZB5A 5J6EA 4DH0A 1FKRA 4IQ2A 4P8VA 4W9OA 3UQAA 5DITA 1ITXA 3WL0A 5HT1A 1W9UA 2KGJA 2FAPA 4JYSA 4Z2IA 3CGMA 3NRKA 4WKAA 3AS1A 3UI4A 2DT2A 2VN1A 3ARQA 1NH6A 1QPFA 4KQZA 3UQBA 3ODKA 4ODMA 2IUZA 1E6NA 4ZPVR 3ARXA 1FKDA 2DT0A 5HWBA 2DG3A 1JNDA 4S3JA 2DG9A 1YW5A 2M2AA 4DRMA 1Q6UA 1EYMA 4LAWA 1W1YA 3IHZA 3W4RA 1JNTA 4PTMA 1W26A 1OGBA 3ARYA 1Q1CA 3G6MA 1FFRA 1SYTA 2FKEA 2G41A 3O5PA 2XP5A 3UF8A 1ZBKA 1A7XA 4S3KA 1VF8A 5HBFA 3RM4A 4W9PA 3CHDA 3JYJA 1TFVA 1PINA 3AROA 4LAYA 1K9TA 4DZ3A 5HW6A 4MNLA 1OWQA 4TX0A 4TW7A 2MLZA 1P5QA 5GPGA 2Q5AA 3O5GA 2ITKA 2OLHA 3OA5A 3CGNA 1YATA 1FFQA 1NMWA 1JVWA 2F2DA 4IT4A 4MNMA 2PV1A 4WK9A 4DRNA 3ARPA 2ZQSA 1KT0A 1FKIA 3PR9A 5D75A 1QZ2A 2B31A 2G8ZA 3WD1A 3G6LA 1SR0A 3PRAA 1QPLA 3ARUA 1JNSA 2XP8A 4W9QA 1Q6IA 4DRKA 3IK8A 1XHGA 2WLZA 3NI6A 4Z2KA 3ARZA 1ZL1A 3WQVA 4MNKA 4AY1A 1F40A 1EQ3A 2PBCA 4LAVA 1C9HA 2A3BA 4J4NA 3O5DA 1R9HA 2PPPA 3ARRA 1RD6A 2DT1A 2XP7A 1TCOC 3BXWA 4FAPA 4TNSA 1HJVA 2DPEA 2DSWA 4TYOA 1WAWA 3UI5A 2RUDA 2XP6A 4N19A 2PPNA 4L3NA 1J4IA 1E6ZA 2OFNA 3I6CA 1HKJA 4DROA 4DT4A 3B9DA 1T11A 4DWSD 3PA7A 4MNJA 3LUOA 2XP3A 2WK2A 1GOIA 1WNOA 4NZCA 4P8XA 1NMVA 1EIBA 4TW8A 3RMEA 3ARWA 3CHCA 2RQSA 1XRVA 2K8IA 3IKDA 4Z2LA 1ZU8A 2L2SA 1FKHA 3WKZA 4G50A 1ROTA 1J4HA 4W5UA 2PV3A 4ODQA 2ZQVA 4U86A 2LPVA 1BL4A 1KFWA 3O5FA 3O5OA 3FAPA 1D6OA 3O5JA 1D7IA 1B6CA 4R0XA 2UZ5A 3RFWA 4ITZA 3KADA 1PBKA 4C02B 3ARVA 5GQBA 1CTNA 2XPAA 3WIJA 1LL6A 2LJ4A 4JFLA 1E6PA 4JFJA 1Q6HA 3UQIA 4KR0B 4O2TA 1GPFA 1H0GA 4FN2A 1F8AB 3WD2A 4IQCA 5HTGA 3H9RB 4Z2GA 4HARA 1NWUA 1Y0OA 4ODOA 4QT2A 3WD0A 2XPBA 4ZS6A 3WD3A 3PRDA 1EHNA 1IX5A 2M1IA 1H0IA 3B9AA 2ZQUA 4QIBA 1ZCNA 2A3AA 1X6LA 1E9LA 1FKGA 1UR9A 4P8WA 5DIUA 1X6NA 4LGXA 4BF8A 1D7HA 3B9EA 3O5RA 3WQWA 1EDQA 3ALGA 5BXJA 2F21A 3CHFA 4P8UA 5I98A 4ZPTR 2XP4A 4MPKA 4XAKA 4GIVA 4ODNA 3IKGA 2XP9A 3GPKA 1LG2A 4DRPA 2RUCA 2LGOA 3TDBA 3PRBA 4Q22A 2O9OA 1LJYA 4QZVB 2F4EA 3RGCA 1FKTA 3AS0A 2O92A 4MAVA 1LL4A 3KABA 1FKKA 2ZQTA 3QOKA 2PI6A 4HBOA 2ZR6A 4MGVA 4HBEA 2Y78A 4MTVA 2RUQA 4ZPWR 3TCZA 1FKBA 3O5IA 4J4OA 5GPRA 5HW8A 3B8SA 2DG4A 4DWSB 4LAXA 1O6IA 1D7JA 1ZK6A 3RM9A 3TC5A 1FD9A 1NSGA 2MNTA 3O5QA 4WKHA 4DRJA 2PV2A 4NNRA 2YBTA 4JFKA 2IF4A 4JFIA 1BKFA 1D2KA 1E6RA 4Z2HA 1JNEA 5DIVA 1HKKA 2PPOA 3KACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JNS A;  2XP8 A;  2LJ4 A;  4JFL A;  5HKG A;  4W9Q A;  2MLX A;  1Q6I A;  3O5L A;  2KO7 A;  4JFJ A;  4U84 A;  1Q6H A;  3UQI A;  4DRK A;  4QT3 A;  4GGQ A;  4O2T A;  3OOB A;  3IK8 A;  4JFM A;  1FKF A;  2AWG A;  3B7X A;  2KE0 A;  3NI6 A;  1F8A B;  4FN2 A;  4ODR A;  2RSE A;  2ZR5 A;  1ROU A;  1HXV A;  4IQC A;  5HWC A;  5HTG A;  1FJD A;  3H9R B;  1Y0O A;  5HUA A;  4ODO A;  4DRI A;  5J6E A;  4QT2 A;  4DH0 A;  1F40 A;  1FKR A;  1EQ3 A;  2XPB A;  3KAG A;  2PBC A;  4LAV A;  2KR7 A;  4IQ2 A;  1C9H A;  3PRD A;  4J4N A;  4W9O A;  3O5D A;  1R9H A;  2PPP A;  5DIT A;  3UQA A;  2M1I A;  3O5M A;  5HT1 A;  2XP7 A;  2ZQU A;  2KGJ A;  2FAP A;  3MDY B;  4QIB A;  1TCO C;  3NTP A;  4FAP A;  1ZCN A;  4JYS A;  4TNS A;  1J4R A;  3CGM A;  1FKG A;  3NRK A;  4TW6 A;  5HW7 A;  5DIU A;  1L1P A;  4TYO A;  4BF8 A;  1J6Y A;  3KCE A;  3UI5 A;  2RUD A;  1D7H A;  3UI4 A;  2XP6 A;  2VN1 A;  4N19 A;  2PPN A;  3KAC A;  1J4I A;  1FAP A;  1QPF A;  3O5R A;  2N87 A;  2OFN A;  3ODK A;  4ODM A;  3UQB A;  3I6C A;  1FKD A;  5BXJ A;  2JZV A;  2F21 A;  4DRO A;  4DT4 A;  5HWB A;  1T11 A;  2DG3 A;  3VAW A;  2KFW A;  5I98 A;  2DG9 A;  3JXV A;  2XP4 A;  3PA7 A;  3LUO A;  2XP3 A;  4U85 A;  1YW5 A;  2M2A A;  4GIV A;  4DRM A;  4DZ2 A;  4DRQ A;  3KAI A;  1Q6U A;  4ODN A;  3IKG A;  1EYM A;  4LAW A;  2XP9 A;  3IHZ A;  2MF9 A;  1NMV A;  3GPK A;  1M5Y A;  2ZR4 A;  1JNT A;  3KAH A;  1W26 A;  4IPX A;  4DRP A;  2RUC A;  4TW8 A;  2D9F A;  1Q1C A;  2LGO A;  1FKJ A;  3KAF A;  3TDB A;  2FKE A;  3PRB A;  2RQS A;  3O5P A;  2XP5 A;  4G2P A;  2F4E A;  3UF8 A;  2K8I A;  3IKD A;  4ODP A;  3RGC A;  1A7X A;  1FKT A;  2LKN A;  3KAB A;  1FKK A;  2L2S A;  2VCD A;  4W9P A;  2ZQT A;  3JYJ A;  1FKH A;  4DRH A;  1PIN A;  2ZR6 A;  4LAY A;  4MGV A;  2Y78 A;  4G50 A;  1ROT A;  1J4H A;  2RUQ A;  4DZ3 A;  3KZ7 A;  4ODK A;  3TCZ A;  5HW6 A;  1FKB A;  4TX0 A;  3O5I A;  4J4O A;  4TW7 A;  2MLZ A;  5HW8 A;  1P5Q A;  1FKS A;  2PV3 A;  4ODQ A;  5GPG A;  4DIP A;  2Q5A A;  3O5E A;  3O5G A;  2DG4 A;  2ITK A;  2KI3 A;  2ZQV A;  3JYM A;  4U86 A;  3CGN A;  1YAT A;  2LPV A;  4LAX A;  1BL4 A;  1D7J A;  1KT1 A;  1NMW A;  3O5F A;  1JVW A;  1U79 A;  2F2D A;  2PV1 A;  1ZK6 A;  4DRN A;  3TC5 A;  1FD9 A;  1NSG A;  2MNT A;  3O5Q A;  4DRJ A;  3EY6 A;  2PV2 A;  4NNR A;  5B8I C;  2ZQS A;  3O5O A;  1KT0 A;  2M08 A;  3FAP A;  3UI6 A;  3WH0 A;  2RUR A;  1FKI A;  1D6O A;  3O5J A;  1FKL A;  4JFK A;  2IF4 A;  5D75 A;  1D7I A;  1B6C A;  4R0X A;  4JFI A;  4MSP A;  2UZ5 A;  2MPH A;  1QZ2 A;  3RFW A;  1BKF A;  4ITZ A;  3O5K A;  3KAD A;  1PBK A;  4C02 B;  2MLY A;  1N1A A;  4ODL A;  2XPA A;  5DIV A;  2PPO A;  1QPL A; 
#chains in the Genus database with same CATH topology
 1ZBC A;  2MLX A;  1NWS A;  2ESC A;  2KO7 A;  3RM8 A;  1W1V A;  3WL1 A;  4QT3 A;  1WB0 A;  1GUV A;  3OOB A;  4JFM A;  5DF0 A;  2KE0 A;  4ODR A;  5HWC A;  1FJD A;  5HUA A;  4DRI A;  3KAG A;  2A3E A;  2KR7 A;  3O5M A;  1HJW A;  2DSV A;  3MDY B;  1ZBW A;  3NTP A;  4R5E A;  1J4R A;  4TW6 A;  1NWR A;  5HW7 A;  1L1P A;  1W1P A;  1J6Y A;  3KCE A;  1LQ0 A;  1FAP A;  5JH8 A;  3AS2 A;  3AQU A;  3CHE A;  3WD4 A;  3BMB A;  2JZV A;  1HJX A;  2DSU A;  3VAW A;  2KFW A;  1W9P A;  3JXV A;  4U85 A;  5DO2 A;  4DZ2 A;  4DRQ A;  3KAI A;  4DWS C;  2MF9 A;  1M5Y A;  2ZR4 A;  3KAH A;  4WKF A;  4IPX A;  2D9F A;  1FKJ A;  5DEZ A;  3KAF A;  2QF8 A;  4Z2J A;  4G2P A;  2AOS A;  1LL7 A;  4ODP A;  2LKN A;  1LG1 A;  1UR8 A;  4Q7N A;  2A3C A;  2VCD A;  3FXY A;  4DRH A;  4URI A;  3KZ7 A;  4ODK A;  1E15 A;  1FKS A;  4NSB A;  4DIP A;  3O5E A;  2KI3 A;  1HKM A;  3JYM A;  1OGG A;  2DSZ A;  1KT1 A;  2WLY A;  1U79 A;  1ZBV A;  3AS3 A;  2ETN A;  3GTY X;  3EY6 A;  3UI6 A;  3WH0 A;  2M08 A;  2RUR A;  1W9V A;  2WM0 A;  2F23 A;  3ARS A;  1FKL A;  1NWT A;  4L72 B;  4MSP A;  2MPH A;  1W1T A;  3O5K A;  2DT3 A;  4WJX A;  3FY1 A;  4WIW A;  2MLY A;  1E44 A;  1N1A A;  4ODL A;  5B8I C;  4IT6 A;  2N87 A;  3CZ8 A;  4ML4 A;  1HKI A;  5HKG A;  2YBU A;  3O5L A;  3ALF A;  4U84 A;  3ART A;  3CH9 A;  4GGQ A;  4DWS A;  1FKF A;  2AWG A;  2FDM A;  3B7X A;  2PN0 A;  2RSE A;  2ZR5 A;  1ROU A;  1HXV A;  1GRJ A;  1ZB5 A;  5J6E A;  4DH0 A;  1FKR A;  4IQ2 A;  4P8V A;  4W9O A;  3UQA A;  5DIT A;  1ITX A;  3WL0 A;  5HT1 A;  1W9U A;  2KGJ A;  2FAP A;  4JYS A;  4Z2I A;  3CGM A;  3NRK A;  4WKA A;  3AS1 A;  3UI4 A;  2DT2 A;  2VN1 A;  3ARQ A;  1NH6 A;  1QPF A;  4KQZ A;  3UQB A;  3ODK A;  4ODM A;  2IUZ A;  1E6N A;  4ZPV R;  3ARX A;  1FKD A;  2DT0 A;  5HWB A;  2DG3 A;  1JND A;  4S3J A;  2DG9 A;  1YW5 A;  2M2A A;  4DRM A;  1Q6U A;  1EYM A;  4LAW A;  1W1Y A;  3IHZ A;  3W4R A;  1JNT A;  4PTM A;  1W26 A;  1OGB A;  3ARY A;  1Q1C A;  3G6M A;  1FFR A;  1SYT A;  2FKE A;  2G41 A;  3O5P A;  2XP5 A;  3UF8 A;  1ZBK A;  1A7X A;  4S3K A;  1VF8 A;  5HBF A;  3RM4 A;  4W9P A;  3CHD A;  3JYJ A;  1TFV A;  1PIN A;  3ARO A;  4LAY A;  1K9T A;  4DZ3 A;  5HW6 A;  4MNL A;  1OWQ A;  4TX0 A;  4TW7 A;  2MLZ A;  1P5Q A;  3EIP A;  5GPG A;  2P4V A;  2Q5A A;  3O5G A;  2ITK A;  2OLH A;  3OA5 A;  3CGN A;  1YAT A;  1FFQ A;  1NMW A;  1JVW A;  2F2D A;  4IT4 A;  4MNM A;  2PV1 A;  4WK9 A;  4DRN A;  3ARP A;  2ZQS A;  1KT0 A;  1FKI A;  3PR9 A;  5D75 A;  1QZ2 A;  2B31 A;  4UDM A;  2G8Z A;  3WD1 A;  3G6L A;  1SR0 A;  3PRA A;  1QPL A;  3ARU A;  1JNS A;  2XP8 A;  4W9Q A;  1Q6I A;  4DRK A;  3IK8 A;  1XHG A;  2WLZ A;  3NI6 A;  4Z2K A;  3ARZ A;  1ZL1 A;  3WQV A;  4MNK A;  4AY1 A;  1F40 A;  1EQ3 A;  2PBC A;  4LAV A;  1C9H A;  2A3B A;  4J4N A;  3O5D A;  1R9H A;  2PPP A;  3ARR A;  1RD6 A;  2DT1 A;  2XP7 A;  1TCO C;  3BXW A;  4FAP A;  4TNS A;  1HJV A;  2DPE A;  2DSW A;  4TYO A;  1WAW A;  3UI5 A;  2RUD A;  2XP6 A;  4N19 A;  2PPN A;  4L3N A;  1J4I A;  1E6Z A;  2OFN A;  3I6C A;  1HKJ A;  4DRO A;  4DT4 A;  3B9D A;  1T11 A;  4DWS D;  3PA7 A;  4MNJ A;  3LUO A;  2XP3 A;  2WK2 A;  1GOI A;  1WNO A;  4NZC A;  4P8X A;  1NMV A;  1EIB A;  4TW8 A;  3RME A;  3GU0 A;  3ARW A;  3CHC A;  2RQS A;  1XRV A;  2K8I A;  3IKD A;  4Z2L A;  1ZU8 A;  2L2S A;  1FKH A;  3WKZ A;  4G50 A;  1ROT A;  1J4H A;  4W5U A;  2PV3 A;  4ODQ A;  2ZQV A;  4U86 A;  2LPV A;  1BL4 A;  1KFW A;  3O5F A;  3O5O A;  3FAP A;  1D6O A;  3O5J A;  1D7I A;  1B6C A;  4R0X A;  2UZ5 A;  3RFW A;  4ITZ A;  3KAD A;  1PBK A;  4C02 B;  3ARV A;  5GQB A;  1CTN A;  2XPA A;  3WIJ A;  1LL6 A;  2LJ4 A;  4JFL A;  1E6P A;  4JFJ A;  1Q6H A;  3UQI A;  4KR0 B;  4O2T A;  1GPF A;  1JCH B;  1H0G A;  4FN2 A;  1F8A B;  3WD2 A;  4IQC A;  5HTG A;  3H9R B;  4Z2G A;  4HAR A;  1NWU A;  1Y0O A;  4ODO A;  4QT2 A;  3WD0 A;  2XPB A;  4ZS6 A;  3WD3 A;  3PRD A;  1EHN A;  1IX5 A;  2M1I A;  1H0I A;  3B9A A;  2ZQU A;  4QIB A;  1ZCN A;  2A3A A;  1X6L A;  1E9L A;  1FKG A;  1UR9 A;  4P8W A;  5DIU A;  1X6N A;  4LGX A;  4BF8 A;  1D7H A;  3B9E A;  3O5R A;  3WQW A;  1EDQ A;  3ALG A;  5BXJ A;  2F21 A;  3CHF A;  4P8U A;  5I98 A;  4ZPT R;  2XP4 A;  4MPK A;  4XAK A;  4GIV A;  4ODN A;  3IKG A;  2EUL A;  2XP9 A;  3GPK A;  1LG2 A;  2B5U B;  4DRP A;  2RUC A;  2LGO A;  3TDB A;  3PRB A;  4Q22 A;  2O9O A;  1LJY A;  4QZV B;  2F4E A;  3RGC A;  1FKT A;  3AS0 A;  2O92 A;  4MAV A;  1LL4 A;  3KAB A;  1FKK A;  2ZQT A;  3QOK A;  2PI6 A;  4HBO A;  2ZR6 A;  4MGV A;  4HBE A;  2Y78 A;  4MTV A;  2RUQ A;  4ZPW R;  3TCZ A;  1FKB A;  3O5I A;  4J4O A;  5GPR A;  5HW8 A;  3B8S A;  2DG4 A;  4DWS B;  4LAX A;  1O6I A;  1D7J A;  1ZK6 A;  3RM9 A;  3TC5 A;  1FD9 A;  1NSG A;  2MNT A;  3O5Q A;  4WKH A;  4DRJ A;  2PV2 A;  4NNR A;  2YBT A;  4JFK A;  2IF4 A;  4JFI A;  1BKF A;  1D2K A;  1E6R A;  4Z2H A;  1JNE A;  5DIV A;  1HKK A;  2PPO A;  3KAC A; 
#chains in the Genus database with same CATH homology
 1ZBC A;  2MLX A;  1NWS A;  2ESC A;  2KO7 A;  3RM8 A;  1W1V A;  3WL1 A;  4QT3 A;  1WB0 A;  1GUV A;  3OOB A;  4JFM A;  5DF0 A;  2KE0 A;  4ODR A;  5HWC A;  1FJD A;  5HUA A;  4DRI A;  3KAG A;  2A3E A;  2KR7 A;  3O5M A;  1HJW A;  2DSV A;  3MDY B;  1ZBW A;  3NTP A;  4R5E A;  1J4R A;  4TW6 A;  1NWR A;  5HW7 A;  1L1P A;  1W1P A;  1J6Y A;  3KCE A;  1LQ0 A;  1FAP A;  5JH8 A;  3AS2 A;  3AQU A;  3CHE A;  3WD4 A;  2JZV A;  1HJX A;  2DSU A;  3VAW A;  2KFW A;  1W9P A;  3JXV A;  4U85 A;  5DO2 A;  4DZ2 A;  4DRQ A;  3KAI A;  4DWS C;  2MF9 A;  1M5Y A;  2ZR4 A;  3KAH A;  4WKF A;  4IPX A;  2D9F A;  1FKJ A;  5DEZ A;  3KAF A;  2QF8 A;  4Z2J A;  4G2P A;  2AOS A;  1LL7 A;  4ODP A;  2LKN A;  1LG1 A;  1UR8 A;  4Q7N A;  2A3C A;  2VCD A;  3FXY A;  4DRH A;  4URI A;  3KZ7 A;  4ODK A;  1E15 A;  1FKS A;  4NSB A;  4DIP A;  3O5E A;  2KI3 A;  1HKM A;  3JYM A;  1OGG A;  2DSZ A;  1KT1 A;  2WLY A;  1U79 A;  1ZBV A;  3AS3 A;  3EY6 A;  3UI6 A;  3WH0 A;  2M08 A;  2RUR A;  1W9V A;  2WM0 A;  3ARS A;  1FKL A;  1NWT A;  4L72 B;  4MSP A;  2MPH A;  1W1T A;  3O5K A;  2DT3 A;  4WJX A;  3FY1 A;  4WIW A;  2MLY A;  1N1A A;  4ODL A;  5B8I C;  4IT6 A;  2N87 A;  3CZ8 A;  4ML4 A;  1HKI A;  5HKG A;  2YBU A;  3O5L A;  3ALF A;  4U84 A;  3ART A;  3CH9 A;  4GGQ A;  4DWS A;  1FKF A;  2AWG A;  2FDM A;  3B7X A;  2RSE A;  2ZR5 A;  1ROU A;  1HXV A;  1ZB5 A;  5J6E A;  4DH0 A;  1FKR A;  4IQ2 A;  4P8V A;  4W9O A;  3UQA A;  5DIT A;  1ITX A;  3WL0 A;  5HT1 A;  1W9U A;  2KGJ A;  2FAP A;  4JYS A;  4Z2I A;  3CGM A;  3NRK A;  4WKA A;  3AS1 A;  3UI4 A;  2DT2 A;  2VN1 A;  3ARQ A;  1NH6 A;  1QPF A;  4KQZ A;  3UQB A;  3ODK A;  4ODM A;  2IUZ A;  1E6N A;  4ZPV R;  3ARX A;  1FKD A;  2DT0 A;  5HWB A;  2DG3 A;  1JND A;  4S3J A;  2DG9 A;  1YW5 A;  2M2A A;  4DRM A;  1Q6U A;  1EYM A;  4LAW A;  1W1Y A;  3IHZ A;  3W4R A;  1JNT A;  4PTM A;  1W26 A;  1OGB A;  3ARY A;  1Q1C A;  3G6M A;  1FFR A;  1SYT A;  2FKE A;  2G41 A;  3O5P A;  2XP5 A;  3UF8 A;  1ZBK A;  1A7X A;  4S3K A;  1VF8 A;  5HBF A;  3RM4 A;  4W9P A;  3CHD A;  3JYJ A;  1TFV A;  1PIN A;  3ARO A;  4LAY A;  1K9T A;  4DZ3 A;  5HW6 A;  4MNL A;  1OWQ A;  4TX0 A;  4TW7 A;  2MLZ A;  1P5Q A;  5GPG A;  2Q5A A;  3O5G A;  2ITK A;  2OLH A;  3OA5 A;  3CGN A;  1YAT A;  1FFQ A;  1NMW A;  1JVW A;  2F2D A;  4IT4 A;  4MNM A;  2PV1 A;  4WK9 A;  4DRN A;  3ARP A;  2ZQS A;  1KT0 A;  1FKI A;  3PR9 A;  5D75 A;  1QZ2 A;  2B31 A;  2G8Z A;  3WD1 A;  3G6L A;  1SR0 A;  3PRA A;  1QPL A;  3ARU A;  1JNS A;  2XP8 A;  4W9Q A;  1Q6I A;  4DRK A;  3IK8 A;  1XHG A;  2WLZ A;  3NI6 A;  4Z2K A;  3ARZ A;  1ZL1 A;  3WQV A;  4MNK A;  4AY1 A;  1F40 A;  1EQ3 A;  2PBC A;  4LAV A;  1C9H A;  2A3B A;  4J4N A;  3O5D A;  1R9H A;  2PPP A;  3ARR A;  1RD6 A;  2DT1 A;  2XP7 A;  1TCO C;  3BXW A;  4FAP A;  4TNS A;  1HJV A;  2DPE A;  2DSW A;  4TYO A;  1WAW A;  3UI5 A;  2RUD A;  2XP6 A;  4N19 A;  2PPN A;  4L3N A;  1J4I A;  1E6Z A;  2OFN A;  3I6C A;  1HKJ A;  4DRO A;  4DT4 A;  3B9D A;  1T11 A;  4DWS D;  3PA7 A;  4MNJ A;  3LUO A;  2XP3 A;  2WK2 A;  1GOI A;  1WNO A;  4NZC A;  4P8X A;  1NMV A;  1EIB A;  4TW8 A;  3RME A;  3ARW A;  3CHC A;  2RQS A;  1XRV A;  2K8I A;  3IKD A;  4Z2L A;  1ZU8 A;  2L2S A;  1FKH A;  3WKZ A;  4G50 A;  1ROT A;  1J4H A;  4W5U A;  2PV3 A;  4ODQ A;  2ZQV A;  4U86 A;  2LPV A;  1BL4 A;  1KFW A;  3O5F A;  3O5O A;  3FAP A;  1D6O A;  3O5J A;  1D7I A;  1B6C A;  4R0X A;  2UZ5 A;  3RFW A;  4ITZ A;  3KAD A;  1PBK A;  4C02 B;  3ARV A;  5GQB A;  1CTN A;  2XPA A;  3WIJ A;  1LL6 A;  2LJ4 A;  4JFL A;  1E6P A;  4JFJ A;  1Q6H A;  3UQI A;  4KR0 B;  4O2T A;  1GPF A;  1H0G A;  4FN2 A;  1F8A B;  3WD2 A;  4IQC A;  5HTG A;  3H9R B;  4Z2G A;  4HAR A;  1NWU A;  1Y0O A;  4ODO A;  4QT2 A;  3WD0 A;  2XPB A;  4ZS6 A;  3WD3 A;  3PRD A;  1EHN A;  1IX5 A;  2M1I A;  1H0I A;  3B9A A;  2ZQU A;  4QIB A;  1ZCN A;  2A3A A;  1X6L A;  1E9L A;  1FKG A;  1UR9 A;  4P8W A;  5DIU A;  1X6N A;  4LGX A;  4BF8 A;  1D7H A;  3B9E A;  3O5R A;  3WQW A;  1EDQ A;  3ALG A;  5BXJ A;  2F21 A;  3CHF A;  4P8U A;  5I98 A;  4ZPT R;  2XP4 A;  4MPK A;  4XAK A;  4GIV A;  4ODN A;  3IKG A;  2XP9 A;  3GPK A;  1LG2 A;  4DRP A;  2RUC A;  2LGO A;  3TDB A;  3PRB A;  4Q22 A;  2O9O A;  1LJY A;  4QZV B;  2F4E A;  3RGC A;  1FKT A;  3AS0 A;  2O92 A;  4MAV A;  1LL4 A;  3KAB A;  1FKK A;  2ZQT A;  3QOK A;  2PI6 A;  4HBO A;  2ZR6 A;  4MGV A;  4HBE A;  2Y78 A;  4MTV A;  2RUQ A;  4ZPW R;  3TCZ A;  1FKB A;  3O5I A;  4J4O A;  5GPR A;  5HW8 A;  3B8S A;  2DG4 A;  4DWS B;  4LAX A;  1O6I A;  1D7J A;  1ZK6 A;  3RM9 A;  3TC5 A;  1FD9 A;  1NSG A;  2MNT A;  3O5Q A;  4WKH A;  4DRJ A;  2PV2 A;  4NNR A;  2YBT A;  4JFK A;  2IF4 A;  4JFI A;  1BKF A;  1D2K A;  1E6R A;  4Z2H A;  1JNE A;  5DIV A;  1HKK A;  2PPO A;  3KAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...