1EYMA

Fk506 binding protein mutant, homodimeric complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKMDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 BINDING PROTEIN
publication title A ligand-reversible dimerization system for controlling protein-protein interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 27
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2000-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1eymA00
2ZR4A 3JYJA 3O5MA 1A7XA 3O5JA 3O5QA 3NI6A 3O5EA 4ODPA 3O5RA 4LAYA 4TW7A 1L1PA 4TNSA 1U79A 1ROTA 4C02B 3O5FA 2M08A 1PINA 2MPHA 3KAFA 3KAIA 4DRJA 1HXVA 3RFWA 4JFKA 1F40A 1W26A 1JNSA 4TX0A 5HWBA 1J4IA 3O5PA 3UQBA 1N1AA 5HUAA 1T11A 3IHZA 4JFMA 1FKLA 4N19A 5J6EA 2ZQTA 3UI6A 1FKHA 4JFIA 2RURA 4ODOA 2D9FA 4FN2A 1ZK6A 1J6YA 2XP7A 2KO7A 3KABA 1Q6UA 3O5LA 1NMWA 1FKTA 4DIPA 3B7XA 1ROUA 1JVWA 3IK8A 5D75A 3VAWA 4O2TA 4DZ3A 1FKBA 2XP5A 4DT4A 4QIBA 2K8IA 5HTGA 2RUDA 2LPVA 3KACA 1D7HA 1M5YA 4W9QA 4DRPA 1Q6HA 2RSEA 2VN1A 4J4OA 3KADA 4DRIA 2LGOA 4LAVA 2L2SA 1F8AB 4J4NA 5HW7A 3UQAA 2KR7A 1FKIA 3O5KA 3IKGA 2MNTA 2N87A 3IKDA 3O5OA 4JFJA 2XP8A 4W9PA 2XP3A 4QT2A 3OOBA 4G2PA 4DH0A 2PV2A 4MSPA 1BKFA 5DIVA 4FAPA 2RUQA 1QPFA 2OFNA 3TC5A 1FKFA 1Q1CA 1D6OA 1J4HA 2FAPA 2VCDA 3JYMA 4U84A 2PPPA 2DG3A 3PRDA 3FAPA 4DROA 3EY6A 2PPOA 4DRQA 5B8IC 2ZR5A 1FJDA 2MLXA 2ZQVA 1FD9A 2ZQUA 2AWGA 4QT3A 2RUCA 5I98A 3TCZA 4ODMA 1YATA 3CGNA 4U85A 2DG4A 2LJ4A 4ODNA 2PBCA 2FKEA 4ODRA 3LUOA 1EYMA 1ZCNA 4MGVA 1JNTA 3UF8A 3O5IA 4BF8A 1FKDA 4DZ2A 4W9OA 4DRMA 3KAHA 3CGMA 2XPBA 4DRHA 3UQIA 3KCEA 4TYOA 1NSGA 4IQCA 1KT1A 2ZQSA 1FKGA 1Y0OA 3PRBA 4R0XA 3NRKA 2XPAA 1C9HA 1QZ2A 4U86A 5HW6A 1J4RA 5HT1A 2KFWA 5HWCA 4LAWA 4DRKA 4JYSA 3WH0A 4JFLA 3JXVA 1FKKA 2MLZA 2XP6A 3KAGA 3O5GA 5HKGA 3KZ7A 5HW8A 4ODKA 2ZR6A 4GIVA 1EQ3A 3UI4A 1R9HA 2RQSA 3MDYB 1B6CA 1D7IA 2KI3A 4TW8A 3UI5A 1TCOC 3TDBA 2PPNA 4IPXA 2KGJA 1KT0A 3RGCA 4ODQA 3O5DA 2DG9A 3I6CA 3ODKA 5DIUA 4IQ2A 5BXJA 2XP9A 2PV1A 2IF4A 2MF9A 4DRNA 2F21A 2ITKA 1BL4A 2UZ5A 4GGQA 4LAXA 1QPLA 2F4EA 4NNRA 1NMVA 1FKSA 2LKNA 2M1IA 3PA7A 4ODLA 3NTPA 3H9RB 2M2AA 4ITZA 1FAPA 4TW6A 1FKRA 1D7JA 2F2DA 5GPGA 2MLYA 3GPKA 2Q5AA 2XP4A 2Y78A 1YW5A 2JZVA 5DITA 1P5QA 2PV3A 2KE0A 1Q6IA 4G50A 1PBKA 1FKJA
chains in the Genus database with same CATH superfamily
4WIWA 3ARYA 1UR9A 1A7XA 2DT0A 3O5EA 4ODPA 2EULA 3ARWA 4IT6A 1JNEA 4C02B 1XRVA 3RM4A 2M08A 1PINA 3ARVA 5JH8A 4DRJA 3AS2A 1N1AA 5HUAA 1T11A 4JFMA 5J6EA 3WL0A 1J6YA 2XP7A 4IT4A 3KABA 4DZ3A 3AS1A 3PRAA 2G8ZA 4R5EA 2RUDA 1LJYA 3CHEA 4ZPVR 4DWSA 2RSEA 2B5UB 2WK2A 3KADA 3CHDA 1E6PA 4P8UA 4J4NA 3UQAA 2DT2A 3W4RA 4MNKA 1W9UA 2XP8A 4W9PA 4W5UA 4QT2A 2PV2A 4MPKA 4URIA 2RUQA 4P8VA 1QPFA 3WQVA 3FAPA 4DRQA 2ZR5A 2MLXA 1ZU8A 1HJWA 2ZQUA 3ARSA 1W1YA 3B9DA 4QT3A 1YATA 2DG4A 4ODNA 1SYTA 2FKEA 4ODRA 1LL6A 1EYMA 3O5IA 3WD3A 4DRMA 3KAHA 4DWSC 4P8XA 2DT1A 1FFQA 1NSGA 1ZBCA 1KT1A 1FKGA 3PRBA 1C9HA 1QZ2A 1OGBA 3B8SA 4LAWA 2ESCA 3FXYA 3JXVA 2MLZA 1EQ3A 1R9HA 2RQSA 3UI5A 1D7IA 4TW8A 3TDBA 2PPNA 4ODQA 2DG9A 4Z2LA 3I6CA 3WD1A 1FFRA 3B9AA 5BXJA 2UZ5A 4GGQA 1OWQA 1SR0A 2PI6A 3AQUA 1NMVA 4WKFA 3NTPA 3EIPA 4ITZA 3WD4A 4TW6A 4NSBA 3RM9A 1E6RA 2MLYA 4WKAA 2XP4A 1RD6A 4S3JA 3JYJA 1EIBA 2DSWA 1LG2A 3O5QA 4LAYA 1L1PA 4TNSA 1NH6A 1U79A 3BXWA 4Z2GA 1HXVA 4NZCA 3RFWA 1F40A 1EDQA 4TX0A 3UQBA 2FDMA 3UI6A 5GQBA 1VF8A 4JFIA 2WM0A 4MTVA 3B7XA 1ROUA 2XP5A 4XAKA 2K8IA 2ETNA 5HTGA 2LPVA 3KACA 2A3CA 4LAVA 1WAWA 1X6NA 1GUVA 3O5OA 1EHNA 4ZS6A 2XP3A 4Z2HA 4DH0A 3ALFA 4MSPA 2OFNA 3TC5A 1Q1CA 1GRJA 1J4HA 2FAPA 2ZQVA 2YBTA 2RUCA 4P8WA 2LJ4A 3CH9A 4MGVA 1IX5A 5DO2A 4KR0B 2F23A 3CHFA 1W1TA 1XHGA 4DZ2A 4W9OA 1LL4A 1E44A 3CGMA 3WKZA 5HBFA 2O92A 4Z2IA 2ZQSA 1Y0OA 1ZBWA 4R0XA 4U86A 3WD0A 1FKKA 3O5GA 5HKGA 2A3EA 3ARUA 2ZR6A 4GIVA 3UI4A 4ZPWR 3BMBA 2KGJA 4PTMA 2A3AA 3ODKA 5DIUA 4IQ2A 2XP9A 1E6NA 4WK9A 2PV1A 2MF9A 3B9EA 2ITKA 3WL1A 4LAXA 1QPLA 2F4EA 1FKSA 2M2AA 3GPKA 5DITA 1YW5A 2JZVA 3RM8A 2PV3A 1Q6IA 1FKJA 1JCHB 1K9TA 4Q7NA 3RMEA 3O5RA 4TW7A 1E6ZA 1ROTA 3ARRA 4KQZA 3KAFA 1W26A 2DT3A 3WQWA 5HWBA 1J4IA 4N19A 3IHZA 1FKLA 2RURA 4ODOA 1Q6UA 4ZPTR 3O5LA 1NMWA 3CZ8A 1JVWA 5D75A 1FKBA 1OGGA 4QIBA 2DSZA 4Z2KA 1M5YA 4W9QA 4DRPA 4DWSB 3AS0A 4DRIA 2DSUA 2LGOA 1W1VA 1W9VA 2L2SA 1FKIA 4HBEA 3O5KA 1ZBKA 2MNTA 1ZB5A 2YBUA 2WLYA 1X6LA 4Z2JA 2G41A 3OOBA 4G2PA 1HKMA 1ZBVA 4FAPA 1D6OA 2VCDA 3JYMA 2PPPA 2DG3A 5B8IC 3EY6A 2PPOA 1FJDA 4ML4A 1FD9A 2AWGA 5I98A 3TCZA 1NWSA 3CGNA 5GPRA 3LUOA 3OA5A 1NWUA 3G6MA 4DRHA 3UQIA 4TYOA 2O9OA 1LG1A 4IQCA 5HW6A 2XPAA 4QZVB 5HT1A 3ARTA 5HWCA 3WH0A 4JFLA 2XP6A 3KAGA 3ARQA 1H0GA 3G6LA 5DF0A 4IPXA 1GOIA 1KT0A 1LL7A 1NWRA 3AROA 3RGCA 2B31A 3O5DA 5DEZA 1LQ0A 4HBOA 2IF4A 4DRNA 3WD2A 1ITXA 4NNRA 3QOKA 2LKNA 1FAPA 1D7JA 5GPGA 1P5QA 1W1PA 2KE0A 4G50A 4HARA 2QF8A 4WKHA 2ZR4A 3O5MA 3O5JA 4L3NA 3NI6A 1GPFA 3AS3A 3O5FA 1CTNA 1E15A 2MPHA 3KAIA 1JNSA 4JFKA 3O5PA 4UDMA 2ZQTA 1FKHA 3GU0A 2D9FA 4FN2A 1ZK6A 3ARPA 2DPEA 2KO7A 1FKTA 4DIPA 3IK8A 1KFWA 3VAWA 4O2TA 2IUZA 2WLZA 4DT4A 1JNDA 1D7HA 1HJXA 1NWTA 1Q6HA 2VN1A 3GTYX 4J4OA 3ARZA 4S3KA 1F8AB 5HW7A 2KR7A 3IKGA 1HJVA 2A3BA 4MNJA 3WIJA 4WJXA 2N87A 3IKDA 4JFJA 4Q22A 2OLHA 3ARXA 1BKFA 5DIVA 1FKFA 3CHCA 4U84A 3PRDA 4DROA 1ZL1A 4MAVA 4LGXA 4ODMA 4U85A 2PBCA 4AY1A 3ALGA 1ZCNA 4L72B 1JNTA 3UF8A 4BF8A 1FKDA 1W9PA 2XPBA 3KCEA 2AOSA 4MNLA 3NRKA 1WNOA 1J4RA 2KFWA 4DRKA 4DWSD 2P4VA 4JYSA 2DSVA 3KZ7A 5HW8A 4ODKA 1WB0A 3MDYB 1B6CA 2KI3A 1TCOC 1HKKA 1UR8A 3FY1A 1O6IA 2F21A 1BL4A 1TFVA 3PR9A 1H0IA 4ODLA 2M1IA 3PA7A 4MNMA 1D2KA 2PN0A 3H9RB 1HKJA 1FKRA 2F2DA 1E9LA 2Q5AA 2Y78A 1HKIA 1PBKA
chains in the Genus database with same CATH topology
4WIWA 3ARYA 1UR9A 1A7XA 2DT0A 3O5EA 4ODPA 3ARWA 4IT6A 1JNEA 4C02B 1XRVA 3RM4A 2M08A 1PINA 3ARVA 5JH8A 4DRJA 3AS2A 1N1AA 5HUAA 1T11A 4JFMA 5J6EA 3WL0A 1J6YA 2XP7A 4IT4A 3KABA 4DZ3A 3AS1A 3PRAA 2G8ZA 4R5EA 2RUDA 1LJYA 3CHEA 4ZPVR 4DWSA 2RSEA 2WK2A 3KADA 3CHDA 1E6PA 4P8UA 4J4NA 3UQAA 2DT2A 3W4RA 4MNKA 1W9UA 2XP8A 4W9PA 4W5UA 4QT2A 2PV2A 4MPKA 4URIA 2RUQA 4P8VA 1QPFA 3WQVA 3FAPA 4DRQA 2ZR5A 2MLXA 1ZU8A 1HJWA 2ZQUA 3ARSA 1W1YA 3B9DA 4QT3A 1YATA 2DG4A 4ODNA 1SYTA 2FKEA 4ODRA 1LL6A 1EYMA 3O5IA 3WD3A 4DRMA 3KAHA 4DWSC 4P8XA 2DT1A 1FFQA 1NSGA 1ZBCA 1KT1A 1FKGA 3PRBA 1C9HA 1QZ2A 1OGBA 3B8SA 4LAWA 2ESCA 3FXYA 3JXVA 2MLZA 1EQ3A 1R9HA 2RQSA 3UI5A 1D7IA 4TW8A 3TDBA 2PPNA 4ODQA 2DG9A 4Z2LA 3I6CA 3WD1A 1FFRA 3B9AA 5BXJA 2UZ5A 4GGQA 1OWQA 1SR0A 2PI6A 3AQUA 1NMVA 4WKFA 3NTPA 4ITZA 3WD4A 4TW6A 4NSBA 3RM9A 1E6RA 2MLYA 4WKAA 2XP4A 1RD6A 4S3JA 3JYJA 1EIBA 2DSWA 1LG2A 3O5QA 4LAYA 1L1PA 4TNSA 1NH6A 1U79A 3BXWA 4Z2GA 1HXVA 4NZCA 3RFWA 1F40A 1EDQA 4TX0A 3UQBA 2FDMA 3UI6A 5GQBA 1VF8A 4JFIA 2WM0A 4MTVA 3B7XA 1ROUA 2XP5A 4XAKA 2K8IA 5HTGA 2LPVA 3KACA 2A3CA 4LAVA 1WAWA 1X6NA 1GUVA 3O5OA 1EHNA 4ZS6A 2XP3A 4Z2HA 4DH0A 3ALFA 4MSPA 2OFNA 3TC5A 1Q1CA 1J4HA 2FAPA 2ZQVA 2YBTA 2RUCA 4P8WA 2LJ4A 3CH9A 4MGVA 1IX5A 5DO2A 4KR0B 3CHFA 1W1TA 1XHGA 4DZ2A 4W9OA 1LL4A 3CGMA 3WKZA 5HBFA 2O92A 4Z2IA 2ZQSA 1Y0OA 1ZBWA 4R0XA 4U86A 3WD0A 1FKKA 3O5GA 5HKGA 2A3EA 3ARUA 2ZR6A 4GIVA 3UI4A 4ZPWR 2KGJA 4PTMA 2A3AA 3ODKA 5DIUA 4IQ2A 2XP9A 1E6NA 4WK9A 2PV1A 2MF9A 3B9EA 2ITKA 3WL1A 4LAXA 1QPLA 2F4EA 1FKSA 2M2AA 3GPKA 5DITA 1YW5A 2JZVA 3RM8A 2PV3A 1Q6IA 1FKJA 1K9TA 4Q7NA 3RMEA 3O5RA 4TW7A 1E6ZA 1ROTA 3ARRA 4KQZA 3KAFA 1W26A 2DT3A 3WQWA 5HWBA 1J4IA 4N19A 3IHZA 1FKLA 2RURA 4ODOA 1Q6UA 4ZPTR 3O5LA 1NMWA 3CZ8A 1JVWA 5D75A 1FKBA 1OGGA 4QIBA 2DSZA 4Z2KA 1M5YA 4W9QA 4DRPA 4DWSB 3AS0A 4DRIA 2DSUA 2LGOA 1W1VA 1W9VA 2L2SA 1FKIA 4HBEA 3O5KA 1ZBKA 2MNTA 1ZB5A 2YBUA 2WLYA 1X6LA 4Z2JA 2G41A 3OOBA 4G2PA 1HKMA 1ZBVA 4FAPA 1D6OA 2VCDA 3JYMA 2PPPA 2DG3A 5B8IC 3EY6A 2PPOA 1FJDA 4ML4A 1FD9A 2AWGA 5I98A 3TCZA 1NWSA 3CGNA 5GPRA 3LUOA 3OA5A 1NWUA 3G6MA 4DRHA 3UQIA 4TYOA 2O9OA 1LG1A 4IQCA 5HW6A 2XPAA 4QZVB 5HT1A 3ARTA 5HWCA 3WH0A 4JFLA 2XP6A 3KAGA 3ARQA 1H0GA 3G6LA 5DF0A 4IPXA 1GOIA 1KT0A 1LL7A 1NWRA 3AROA 3RGCA 2B31A 3O5DA 5DEZA 1LQ0A 4HBOA 2IF4A 4DRNA 3WD2A 1ITXA 4NNRA 3QOKA 2LKNA 1FAPA 1D7JA 5GPGA 1P5QA 1W1PA 2KE0A 4G50A 4HARA 2QF8A 4WKHA 2ZR4A 3O5MA 3O5JA 4L3NA 3NI6A 1GPFA 3AS3A 3O5FA 1CTNA 1E15A 2MPHA 3KAIA 1JNSA 4JFKA 3O5PA 2ZQTA 1FKHA 2D9FA 4FN2A 1ZK6A 3ARPA 2DPEA 2KO7A 1FKTA 4DIPA 3IK8A 1KFWA 3VAWA 4O2TA 2IUZA 2WLZA 4DT4A 1JNDA 1D7HA 1HJXA 1NWTA 1Q6HA 2VN1A 4J4OA 3ARZA 4S3KA 1F8AB 5HW7A 2KR7A 3IKGA 1HJVA 2A3BA 4MNJA 3WIJA 4WJXA 2N87A 3IKDA 4JFJA 4Q22A 2OLHA 3ARXA 1BKFA 5DIVA 1FKFA 3CHCA 4U84A 3PRDA 4DROA 1ZL1A 4MAVA 4LGXA 4ODMA 4U85A 2PBCA 4AY1A 3ALGA 1ZCNA 4L72B 1JNTA 3UF8A 4BF8A 1FKDA 1W9PA 2XPBA 3KCEA 2AOSA 4MNLA 3NRKA 1WNOA 1J4RA 2KFWA 4DRKA 4DWSD 4JYSA 2DSVA 3KZ7A 5HW8A 4ODKA 1WB0A 3MDYB 1B6CA 2KI3A 1TCOC 1HKKA 1UR8A 3FY1A 1O6IA 2F21A 1BL4A 1TFVA 3PR9A 1H0IA 4ODLA 2M1IA 3PA7A 4MNMA 1D2KA 3H9RB 1HKJA 1FKRA 2F2DA 1E9LA 2Q5AA 2Y78A 1HKIA 1PBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZR4 A;  3JYJ A;  3O5M A;  1A7X A;  3O5J A;  3O5Q A;  3NI6 A;  3O5E A;  4ODP A;  3O5R A;  4LAY A;  4TW7 A;  1L1P A;  4TNS A;  1U79 A;  1ROT A;  4C02 B;  3O5F A;  2M08 A;  1PIN A;  2MPH A;  3KAF A;  3KAI A;  4DRJ A;  1HXV A;  3RFW A;  4JFK A;  1F40 A;  1W26 A;  1JNS A;  4TX0 A;  5HWB A;  1J4I A;  3O5P A;  3UQB A;  1N1A A;  5HUA A;  1T11 A;  3IHZ A;  4JFM A;  1FKL A;  4N19 A;  5J6E A;  2ZQT A;  3UI6 A;  1FKH A;  4JFI A;  2RUR A;  4ODO A;  2D9F A;  4FN2 A;  1ZK6 A;  1J6Y A;  2XP7 A;  2KO7 A;  3KAB A;  1Q6U A;  3O5L A;  1NMW A;  1FKT A;  4DIP A;  3B7X A;  1ROU A;  1JVW A;  3IK8 A;  5D75 A;  3VAW A;  4O2T A;  4DZ3 A;  1FKB A;  2XP5 A;  4DT4 A;  4QIB A;  2K8I A;  5HTG A;  2RUD A;  2LPV A;  3KAC A;  1D7H A;  1M5Y A;  4W9Q A;  4DRP A;  1Q6H A;  2RSE A;  2VN1 A;  4J4O A;  3KAD A;  4DRI A;  2LGO A;  4LAV A;  2L2S A;  1F8A B;  4J4N A;  5HW7 A;  3UQA A;  2KR7 A;  1FKI A;  3O5K A;  3IKG A;  2MNT A;  2N87 A;  3IKD A;  3O5O A;  4JFJ A;  2XP8 A;  4W9P A;  2XP3 A;  4QT2 A;  3OOB A;  4G2P A;  4DH0 A;  2PV2 A;  4MSP A;  1BKF A;  5DIV A;  4FAP A;  2RUQ A;  1QPF A;  2OFN A;  3TC5 A;  1FKF A;  1Q1C A;  1D6O A;  1J4H A;  2FAP A;  2VCD A;  3JYM A;  4U84 A;  2PPP A;  2DG3 A;  3PRD A;  3FAP A;  4DRO A;  3EY6 A;  2PPO A;  4DRQ A;  5B8I C;  2ZR5 A;  1FJD A;  2MLX A;  2ZQV A;  1FD9 A;  2ZQU A;  2AWG A;  4QT3 A;  2RUC A;  5I98 A;  3TCZ A;  4ODM A;  1YAT A;  3CGN A;  4U85 A;  2DG4 A;  2LJ4 A;  4ODN A;  2PBC A;  2FKE A;  4ODR A;  3LUO A;  1EYM A;  1ZCN A;  4MGV A;  1JNT A;  3UF8 A;  3O5I A;  4BF8 A;  1FKD A;  4DZ2 A;  4W9O A;  4DRM A;  3KAH A;  3CGM A;  2XPB A;  4DRH A;  3UQI A;  3KCE A;  4TYO A;  1NSG A;  4IQC A;  1KT1 A;  2ZQS A;  1FKG A;  1Y0O A;  3PRB A;  4R0X A;  3NRK A;  2XPA A;  1C9H A;  1QZ2 A;  4U86 A;  5HW6 A;  1J4R A;  5HT1 A;  2KFW A;  5HWC A;  4LAW A;  4DRK A;  4JYS A;  3WH0 A;  4JFL A;  3JXV A;  1FKK A;  2MLZ A;  2XP6 A;  3KAG A;  3O5G A;  5HKG A;  3KZ7 A;  5HW8 A;  4ODK A;  2ZR6 A;  4GIV A;  1EQ3 A;  3UI4 A;  1R9H A;  2RQS A;  3MDY B;  1B6C A;  1D7I A;  2KI3 A;  4TW8 A;  3UI5 A;  1TCO C;  3TDB A;  2PPN A;  4IPX A;  2KGJ A;  1KT0 A;  3RGC A;  4ODQ A;  3O5D A;  2DG9 A;  3I6C A;  3ODK A;  5DIU A;  4IQ2 A;  5BXJ A;  2XP9 A;  2PV1 A;  2IF4 A;  2MF9 A;  4DRN A;  2F21 A;  2ITK A;  1BL4 A;  2UZ5 A;  4GGQ A;  4LAX A;  1QPL A;  2F4E A;  4NNR A;  1NMV A;  1FKS A;  2LKN A;  2M1I A;  3PA7 A;  4ODL A;  3NTP A;  3H9R B;  2M2A A;  4ITZ A;  1FAP A;  4TW6 A;  1FKR A;  1D7J A;  2F2D A;  5GPG A;  2MLY A;  3GPK A;  2Q5A A;  2XP4 A;  2Y78 A;  1YW5 A;  2JZV A;  5DIT A;  1P5Q A;  2PV3 A;  2KE0 A;  1Q6I A;  4G50 A;  1PBK A;  1FKJ A; 
#chains in the Genus database with same CATH topology
 4WIW A;  3ARY A;  1UR9 A;  1A7X A;  2DT0 A;  3O5E A;  4ODP A;  2EUL A;  3ARW A;  4IT6 A;  1JNE A;  4C02 B;  1XRV A;  3RM4 A;  2M08 A;  1PIN A;  3ARV A;  5JH8 A;  4DRJ A;  3AS2 A;  1N1A A;  5HUA A;  1T11 A;  4JFM A;  5J6E A;  3WL0 A;  1J6Y A;  2XP7 A;  4IT4 A;  3KAB A;  4DZ3 A;  3AS1 A;  3PRA A;  2G8Z A;  4R5E A;  2RUD A;  1LJY A;  3CHE A;  4ZPV R;  4DWS A;  2RSE A;  2B5U B;  2WK2 A;  3KAD A;  3CHD A;  1E6P A;  4P8U A;  4J4N A;  3UQA A;  2DT2 A;  3W4R A;  4MNK A;  1W9U A;  2XP8 A;  4W9P A;  4W5U A;  4QT2 A;  2PV2 A;  4MPK A;  4URI A;  2RUQ A;  4P8V A;  1QPF A;  3WQV A;  3FAP A;  4DRQ A;  2ZR5 A;  2MLX A;  1ZU8 A;  1HJW A;  2ZQU A;  3ARS A;  1W1Y A;  3B9D A;  4QT3 A;  1YAT A;  2DG4 A;  4ODN A;  1SYT A;  2FKE A;  4ODR A;  1LL6 A;  1EYM A;  3O5I A;  3WD3 A;  4DRM A;  3KAH A;  4DWS C;  4P8X A;  2DT1 A;  1FFQ A;  1NSG A;  1ZBC A;  1KT1 A;  1FKG A;  3PRB A;  1C9H A;  1QZ2 A;  1OGB A;  3B8S A;  4LAW A;  2ESC A;  3FXY A;  3JXV A;  2MLZ A;  1EQ3 A;  1R9H A;  2RQS A;  3UI5 A;  1D7I A;  4TW8 A;  3TDB A;  2PPN A;  4ODQ A;  2DG9 A;  4Z2L A;  3I6C A;  3WD1 A;  1FFR A;  3B9A A;  5BXJ A;  2UZ5 A;  4GGQ A;  1OWQ A;  1SR0 A;  2PI6 A;  3AQU A;  1NMV A;  4WKF A;  3NTP A;  3EIP A;  4ITZ A;  3WD4 A;  4TW6 A;  4NSB A;  3RM9 A;  1E6R A;  2MLY A;  4WKA A;  2XP4 A;  1RD6 A;  4S3J A;  3JYJ A;  1EIB A;  2DSW A;  1LG2 A;  3O5Q A;  4LAY A;  1L1P A;  4TNS A;  1NH6 A;  1U79 A;  3BXW A;  4Z2G A;  1HXV A;  4NZC A;  3RFW A;  1F40 A;  1EDQ A;  4TX0 A;  3UQB A;  2FDM A;  3UI6 A;  5GQB A;  1VF8 A;  4JFI A;  2WM0 A;  4MTV A;  3B7X A;  1ROU A;  2XP5 A;  4XAK A;  2K8I A;  2ETN A;  5HTG A;  2LPV A;  3KAC A;  2A3C A;  4LAV A;  1WAW A;  1X6N A;  1GUV A;  3O5O A;  1EHN A;  4ZS6 A;  2XP3 A;  4Z2H A;  4DH0 A;  3ALF A;  4MSP A;  2OFN A;  3TC5 A;  1Q1C A;  1GRJ A;  1J4H A;  2FAP A;  2ZQV A;  2YBT A;  2RUC A;  4P8W A;  2LJ4 A;  3CH9 A;  4MGV A;  1IX5 A;  5DO2 A;  4KR0 B;  2F23 A;  3CHF A;  1W1T A;  1XHG A;  4DZ2 A;  4W9O A;  1LL4 A;  1E44 A;  3CGM A;  3WKZ A;  5HBF A;  2O92 A;  4Z2I A;  2ZQS A;  1Y0O A;  1ZBW A;  4R0X A;  4U86 A;  3WD0 A;  1FKK A;  3O5G A;  5HKG A;  2A3E A;  3ARU A;  2ZR6 A;  4GIV A;  3UI4 A;  4ZPW R;  3BMB A;  2KGJ A;  4PTM A;  2A3A A;  3ODK A;  5DIU A;  4IQ2 A;  2XP9 A;  1E6N A;  4WK9 A;  2PV1 A;  2MF9 A;  3B9E A;  2ITK A;  3WL1 A;  4LAX A;  1QPL A;  2F4E A;  1FKS A;  2M2A A;  3GPK A;  5DIT A;  1YW5 A;  2JZV A;  3RM8 A;  2PV3 A;  1Q6I A;  1FKJ A;  1JCH B;  1K9T A;  4Q7N A;  3RME A;  3O5R A;  4TW7 A;  1E6Z A;  1ROT A;  3ARR A;  4KQZ A;  3KAF A;  1W26 A;  2DT3 A;  3WQW A;  5HWB A;  1J4I A;  4N19 A;  3IHZ A;  1FKL A;  2RUR A;  4ODO A;  1Q6U A;  4ZPT R;  3O5L A;  1NMW A;  3CZ8 A;  1JVW A;  5D75 A;  1FKB A;  1OGG A;  4QIB A;  2DSZ A;  4Z2K A;  1M5Y A;  4W9Q A;  4DRP A;  4DWS B;  3AS0 A;  4DRI A;  2DSU A;  2LGO A;  1W1V A;  1W9V A;  2L2S A;  1FKI A;  4HBE A;  3O5K A;  1ZBK A;  2MNT A;  1ZB5 A;  2YBU A;  2WLY A;  1X6L A;  4Z2J A;  2G41 A;  3OOB A;  4G2P A;  1HKM A;  1ZBV A;  4FAP A;  1D6O A;  2VCD A;  3JYM A;  2PPP A;  2DG3 A;  5B8I C;  3EY6 A;  2PPO A;  1FJD A;  4ML4 A;  1FD9 A;  2AWG A;  5I98 A;  3TCZ A;  1NWS A;  3CGN A;  5GPR A;  3LUO A;  3OA5 A;  1NWU A;  3G6M A;  4DRH A;  3UQI A;  4TYO A;  2O9O A;  1LG1 A;  4IQC A;  5HW6 A;  2XPA A;  4QZV B;  5HT1 A;  3ART A;  5HWC A;  3WH0 A;  4JFL A;  2XP6 A;  3KAG A;  3ARQ A;  1H0G A;  3G6L A;  5DF0 A;  4IPX A;  1GOI A;  1KT0 A;  1LL7 A;  1NWR A;  3ARO A;  3RGC A;  2B31 A;  3O5D A;  5DEZ A;  1LQ0 A;  4HBO A;  2IF4 A;  4DRN A;  3WD2 A;  1ITX A;  4NNR A;  3QOK A;  2LKN A;  1FAP A;  1D7J A;  5GPG A;  1P5Q A;  1W1P A;  2KE0 A;  4G50 A;  4HAR A;  2QF8 A;  4WKH A;  2ZR4 A;  3O5M A;  3O5J A;  4L3N A;  3NI6 A;  1GPF A;  3AS3 A;  3O5F A;  1CTN A;  1E15 A;  2MPH A;  3KAI A;  1JNS A;  4JFK A;  3O5P A;  4UDM A;  2ZQT A;  1FKH A;  3GU0 A;  2D9F A;  4FN2 A;  1ZK6 A;  3ARP A;  2DPE A;  2KO7 A;  1FKT A;  4DIP A;  3IK8 A;  1KFW A;  3VAW A;  4O2T A;  2IUZ A;  2WLZ A;  4DT4 A;  1JND A;  1D7H A;  1HJX A;  1NWT A;  1Q6H A;  2VN1 A;  3GTY X;  4J4O A;  3ARZ A;  4S3K A;  1F8A B;  5HW7 A;  2KR7 A;  3IKG A;  1HJV A;  2A3B A;  4MNJ A;  3WIJ A;  4WJX A;  2N87 A;  3IKD A;  4JFJ A;  4Q22 A;  2OLH A;  3ARX A;  1BKF A;  5DIV A;  1FKF A;  3CHC A;  4U84 A;  3PRD A;  4DRO A;  1ZL1 A;  4MAV A;  4LGX A;  4ODM A;  4U85 A;  2PBC A;  4AY1 A;  3ALG A;  1ZCN A;  4L72 B;  1JNT A;  3UF8 A;  4BF8 A;  1FKD A;  1W9P A;  2XPB A;  3KCE A;  2AOS A;  4MNL A;  3NRK A;  1WNO A;  1J4R A;  2KFW A;  4DRK A;  4DWS D;  2P4V A;  4JYS A;  2DSV A;  3KZ7 A;  5HW8 A;  4ODK A;  1WB0 A;  3MDY B;  1B6C A;  2KI3 A;  1TCO C;  1HKK A;  1UR8 A;  3FY1 A;  1O6I A;  2F21 A;  1BL4 A;  1TFV A;  3PR9 A;  1H0I A;  4ODL A;  2M1I A;  3PA7 A;  4MNM A;  1D2K A;  2PN0 A;  3H9R B;  1HKJ A;  1FKR A;  2F2D A;  1E9L A;  2Q5A A;  2Y78 A;  1HKI A;  1PBK A; 
#chains in the Genus database with same CATH homology
 4WIW A;  3ARY A;  1UR9 A;  1A7X A;  2DT0 A;  3O5E A;  4ODP A;  3ARW A;  4IT6 A;  1JNE A;  4C02 B;  1XRV A;  3RM4 A;  2M08 A;  1PIN A;  3ARV A;  5JH8 A;  4DRJ A;  3AS2 A;  1N1A A;  5HUA A;  1T11 A;  4JFM A;  5J6E A;  3WL0 A;  1J6Y A;  2XP7 A;  4IT4 A;  3KAB A;  4DZ3 A;  3AS1 A;  3PRA A;  2G8Z A;  4R5E A;  2RUD A;  1LJY A;  3CHE A;  4ZPV R;  4DWS A;  2RSE A;  2WK2 A;  3KAD A;  3CHD A;  1E6P A;  4P8U A;  4J4N A;  3UQA A;  2DT2 A;  3W4R A;  4MNK A;  1W9U A;  2XP8 A;  4W9P A;  4W5U A;  4QT2 A;  2PV2 A;  4MPK A;  4URI A;  2RUQ A;  4P8V A;  1QPF A;  3WQV A;  3FAP A;  4DRQ A;  2ZR5 A;  2MLX A;  1ZU8 A;  1HJW A;  2ZQU A;  3ARS A;  1W1Y A;  3B9D A;  4QT3 A;  1YAT A;  2DG4 A;  4ODN A;  1SYT A;  2FKE A;  4ODR A;  1LL6 A;  1EYM A;  3O5I A;  3WD3 A;  4DRM A;  3KAH A;  4DWS C;  4P8X A;  2DT1 A;  1FFQ A;  1NSG A;  1ZBC A;  1KT1 A;  1FKG A;  3PRB A;  1C9H A;  1QZ2 A;  1OGB A;  3B8S A;  4LAW A;  2ESC A;  3FXY A;  3JXV A;  2MLZ A;  1EQ3 A;  1R9H A;  2RQS A;  3UI5 A;  1D7I A;  4TW8 A;  3TDB A;  2PPN A;  4ODQ A;  2DG9 A;  4Z2L A;  3I6C A;  3WD1 A;  1FFR A;  3B9A A;  5BXJ A;  2UZ5 A;  4GGQ A;  1OWQ A;  1SR0 A;  2PI6 A;  3AQU A;  1NMV A;  4WKF A;  3NTP A;  4ITZ A;  3WD4 A;  4TW6 A;  4NSB A;  3RM9 A;  1E6R A;  2MLY A;  4WKA A;  2XP4 A;  1RD6 A;  4S3J A;  3JYJ A;  1EIB A;  2DSW A;  1LG2 A;  3O5Q A;  4LAY A;  1L1P A;  4TNS A;  1NH6 A;  1U79 A;  3BXW A;  4Z2G A;  1HXV A;  4NZC A;  3RFW A;  1F40 A;  1EDQ A;  4TX0 A;  3UQB A;  2FDM A;  3UI6 A;  5GQB A;  1VF8 A;  4JFI A;  2WM0 A;  4MTV A;  3B7X A;  1ROU A;  2XP5 A;  4XAK A;  2K8I A;  5HTG A;  2LPV A;  3KAC A;  2A3C A;  4LAV A;  1WAW A;  1X6N A;  1GUV A;  3O5O A;  1EHN A;  4ZS6 A;  2XP3 A;  4Z2H A;  4DH0 A;  3ALF A;  4MSP A;  2OFN A;  3TC5 A;  1Q1C A;  1J4H A;  2FAP A;  2ZQV A;  2YBT A;  2RUC A;  4P8W A;  2LJ4 A;  3CH9 A;  4MGV A;  1IX5 A;  5DO2 A;  4KR0 B;  3CHF A;  1W1T A;  1XHG A;  4DZ2 A;  4W9O A;  1LL4 A;  3CGM A;  3WKZ A;  5HBF A;  2O92 A;  4Z2I A;  2ZQS A;  1Y0O A;  1ZBW A;  4R0X A;  4U86 A;  3WD0 A;  1FKK A;  3O5G A;  5HKG A;  2A3E A;  3ARU A;  2ZR6 A;  4GIV A;  3UI4 A;  4ZPW R;  2KGJ A;  4PTM A;  2A3A A;  3ODK A;  5DIU A;  4IQ2 A;  2XP9 A;  1E6N A;  4WK9 A;  2PV1 A;  2MF9 A;  3B9E A;  2ITK A;  3WL1 A;  4LAX A;  1QPL A;  2F4E A;  1FKS A;  2M2A A;  3GPK A;  5DIT A;  1YW5 A;  2JZV A;  3RM8 A;  2PV3 A;  1Q6I A;  1FKJ A;  1K9T A;  4Q7N A;  3RME A;  3O5R A;  4TW7 A;  1E6Z A;  1ROT A;  3ARR A;  4KQZ A;  3KAF A;  1W26 A;  2DT3 A;  3WQW A;  5HWB A;  1J4I A;  4N19 A;  3IHZ A;  1FKL A;  2RUR A;  4ODO A;  1Q6U A;  4ZPT R;  3O5L A;  1NMW A;  3CZ8 A;  1JVW A;  5D75 A;  1FKB A;  1OGG A;  4QIB A;  2DSZ A;  4Z2K A;  1M5Y A;  4W9Q A;  4DRP A;  4DWS B;  3AS0 A;  4DRI A;  2DSU A;  2LGO A;  1W1V A;  1W9V A;  2L2S A;  1FKI A;  4HBE A;  3O5K A;  1ZBK A;  2MNT A;  1ZB5 A;  2YBU A;  2WLY A;  1X6L A;  4Z2J A;  2G41 A;  3OOB A;  4G2P A;  1HKM A;  1ZBV A;  4FAP A;  1D6O A;  2VCD A;  3JYM A;  2PPP A;  2DG3 A;  5B8I C;  3EY6 A;  2PPO A;  1FJD A;  4ML4 A;  1FD9 A;  2AWG A;  5I98 A;  3TCZ A;  1NWS A;  3CGN A;  5GPR A;  3LUO A;  3OA5 A;  1NWU A;  3G6M A;  4DRH A;  3UQI A;  4TYO A;  2O9O A;  1LG1 A;  4IQC A;  5HW6 A;  2XPA A;  4QZV B;  5HT1 A;  3ART A;  5HWC A;  3WH0 A;  4JFL A;  2XP6 A;  3KAG A;  3ARQ A;  1H0G A;  3G6L A;  5DF0 A;  4IPX A;  1GOI A;  1KT0 A;  1LL7 A;  1NWR A;  3ARO A;  3RGC A;  2B31 A;  3O5D A;  5DEZ A;  1LQ0 A;  4HBO A;  2IF4 A;  4DRN A;  3WD2 A;  1ITX A;  4NNR A;  3QOK A;  2LKN A;  1FAP A;  1D7J A;  5GPG A;  1P5Q A;  1W1P A;  2KE0 A;  4G50 A;  4HAR A;  2QF8 A;  4WKH A;  2ZR4 A;  3O5M A;  3O5J A;  4L3N A;  3NI6 A;  1GPF A;  3AS3 A;  3O5F A;  1CTN A;  1E15 A;  2MPH A;  3KAI A;  1JNS A;  4JFK A;  3O5P A;  2ZQT A;  1FKH A;  2D9F A;  4FN2 A;  1ZK6 A;  3ARP A;  2DPE A;  2KO7 A;  1FKT A;  4DIP A;  3IK8 A;  1KFW A;  3VAW A;  4O2T A;  2IUZ A;  2WLZ A;  4DT4 A;  1JND A;  1D7H A;  1HJX A;  1NWT A;  1Q6H A;  2VN1 A;  4J4O A;  3ARZ A;  4S3K A;  1F8A B;  5HW7 A;  2KR7 A;  3IKG A;  1HJV A;  2A3B A;  4MNJ A;  3WIJ A;  4WJX A;  2N87 A;  3IKD A;  4JFJ A;  4Q22 A;  2OLH A;  3ARX A;  1BKF A;  5DIV A;  1FKF A;  3CHC A;  4U84 A;  3PRD A;  4DRO A;  1ZL1 A;  4MAV A;  4LGX A;  4ODM A;  4U85 A;  2PBC A;  4AY1 A;  3ALG A;  1ZCN A;  4L72 B;  1JNT A;  3UF8 A;  4BF8 A;  1FKD A;  1W9P A;  2XPB A;  3KCE A;  2AOS A;  4MNL A;  3NRK A;  1WNO A;  1J4R A;  2KFW A;  4DRK A;  4DWS D;  4JYS A;  2DSV A;  3KZ7 A;  5HW8 A;  4ODK A;  1WB0 A;  3MDY B;  1B6C A;  2KI3 A;  1TCO C;  1HKK A;  1UR8 A;  3FY1 A;  1O6I A;  2F21 A;  1BL4 A;  1TFV A;  3PR9 A;  1H0I A;  4ODL A;  2M1I A;  3PA7 A;  4MNM A;  1D2K A;  3H9R B;  1HKJ A;  1FKR A;  2F2D A;  1E9L A;  2Q5A A;  2Y78 A;  1HKI A;  1PBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...