1EYMA

Fk506 binding protein mutant, homodimeric complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKMDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FK506 BINDING PROTEIN
publication title A ligand-reversible dimerization system for controlling protein-protein interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2000-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1eymA00
2PPPA 4DRPA 3ODKA 4DZ3A 3O5EA 4ODQA 2XP8A 3JXVA 1FAPA 2XP7A 4DRJA 4DROA 2ZQUA 3PRDA 2K8IA 2UZ5A 2LKNA 1FKJA 4TW7A 5I98A 2LGOA 2Q5AA 2DG4A 2FKEA 3IKDA 4ITZA 1Y0OA 4JFKA 2ZQTA 1TCOC 3O5FA 4QT3A 2KGJA 3UQBA 1FKSA 1A7XA 1Q6UA 3JYMA 1D6OA 3KAHA 1P5QA 3RGCA 3UQIA 4DRNA 5B8IC 2RUDA 4TW6A 1PBKA 2XP5A 3O5MA 5HW6A 2OFNA 4DRMA 4TX0A 5J6EA 4DIPA 5DIVA 5HW8A 2AWGA 1YATA 1U79A 3O5PA 1ROTA 4MSPA 4DZ2A 3JYJA 4N19A 3UI4A 4G2PA 3NI6A 4IQCA 3TC5A 4BF8A 4W9QA 3KAFA 2F21A 2PV2A 3IHZA 2XPBA 1PINA 4W9PA 4ODKA 5HWCA 4JFJA 4JFLA 2F4EA 2ZR4A 1F8AB 3PA7A 1FKBA 2PV3A 4W9OA 2M1IA 4C02B 2RUQA 1C9HA 2KI3A 2VCDA 4R0XA 4TW8A 4JFMA 3MDYB 1D7JA 4DRHA 3CGNA 4QT2A 1R9HA 4J4NA 1Q6HA 4DT4A 1HXVA 3CGMA 4JYSA 4DRKA 4ODOA 5HKGA 1EYMA 5HT1A 4QIBA 1D7IA 4LAYA 4U84A 1Q6IA 4U85A 2MNTA 3O5KA 3O5RA 1BL4A 1FD9A 3TCZA 1FKIA 3KAIA 4DH0A 3KCEA 1QZ2A 1JNSA 4GIVA 1J6YA 2RUCA 1M5YA 4G50A 2M08A 3FAPA 2ITKA 4JFIA 2XP3A 4MGVA 3UQAA 5HWBA 3O5OA 1FJDA 3TDBA 1NMWA 2ZR6A 1FKTA 1L1PA 3O5LA 3O5DA 4IQ2A 1ROUA 2XP6A 1NSGA 3B7XA 1FKDA 2KE0A 2KR7A 2ZR5A 2F2DA 4TNSA 4ODPA 1D7HA 1QPLA 2M2AA 4DRQA 3UI5A 2XPAA 3LUOA 5HUAA 5BXJA 4ODRA 3EY6A 2FAPA 2PV1A 3IK8A 3I6CA 1J4RA 1J4HA 4NNRA 4ODNA 2Y78A 1B6CA 1FKLA 2L2SA 1QPFA 2MLYA 3O5IA 5HTGA 3KAGA 2LJ4A 4DRIA 4J4OA 5HW7A 3IKGA 4ODLA 4U86A 3UI6A 1N1AA 2MF9A 2MPHA 4LAVA 5DIUA 2ZQVA 3VAWA 1FKFA 3GPKA 3KADA 3RFWA 2DG3A 1FKRA 1JVWA 1F40A 3OOBA 2LPVA 1ZCNA 2RURA 1JNTA 2ZQSA 3O5GA 3WH0A 1YW5A 1FKHA 4O2TA 2RSEA 4IPXA 5GPGA 2XP4A 2MLZA 4LAWA 4TYOA 3NRKA 4FAPA 1J4IA 1BKFA 2PPOA 1FKGA 3O5QA 1KT0A 2MLXA 3PRBA 1FKKA 1W26A 3KABA 4FN2A 5D75A 4ODMA 1T11A 2PPNA 2KFWA 1KT1A 1Q1CA 2D9FA 2RQSA 1NMVA 3H9RB 3NTPA 3O5JA 2VN1A 3KACA 1EQ3A 4LAXA 2JZVA 2PBCA 2DG9A 2IF4A 2N87A 4GGQA 5DITA 3UF8A 2KO7A 2XP9A 3KZ7A 1ZK6A
chains in the Genus database with same CATH superfamily
2PPPA 4DRPA 3ODKA 1IX5A 1FAPA 4NZCA 2ZQUA 1FKJA 4TW7A 1D2KA 1K9TA 1W9VA 2DG4A 1E6ZA 3WD0A 3O5FA 1H0IA 4QT3A 1NH6A 4DRNA 1JCHB 3CHEA 3O5MA 3W4RA 1HKMA 4MTVA 1LJYA 2AWGA 4IT6A 4WJXA 1ROTA 4N19A 1KFWA 4P8XA 3UI4A 3NI6A 3TC5A 4BF8A 3ARSA 4W9QA 2PV2A 3FXYA 1GOIA 4DWSC 4C02B 1JNDA 2RUQA 1C9HA 3AS3A 3CZ8A 4Z2GA 3OA5A 1E15A 1HJXA 1R9HA 2DSWA 4J4NA 4Z2IA 1OGBA 1HKJA 1HXVA 3CGMA 2QF8A 4DRKA 1ZU8A 1E6PA 5HKGA 1D7IA 4LAYA 2YBUA 1Q6IA 3ARUA 3O5KA 1LL7A 3O5RA 3TCZA 3ARZA 4GIVA 3FAPA 2ITKA 3ARQA 4MGVA 3O5OA 1FJDA 3RM9A 4P8VA 1NMWA 1L1PA 1HJWA 2XP6A 3ALFA 2ZR5A 4TNSA 4ODPA 2M2AA 1XRVA 5GQBA 3I6CA 1J4RA 4NNRA 1HJVA 2DSUA 3QOKA 1E6NA 3O5IA 5GPRA 1W1TA 5HW7A 3IKGA 4URIA 2MPHA 5DIUA 1FKRA 2YBTA 2LPVA 3RMEA 3PR9A 1JNTA 4LGXA 1YW5A 4O2TA 2P4VA 4LAWA 3NRKA 1BKFA 1NWSA 3KABA 3O5JA 3H9RB 3NTPA 2A3AA 3ARYA 2DG9A 5DITA 3UF8A 5JH8A 4ZPWR 1FFQA 3PRDA 2K8IA 2LKNA 3WL1A 3ARVA 1LG1A 3IKDA 4ITZA 1Y0OA 4DWSA 2ZQTA 1JNEA 3B9AA 2EULA 2A3CA 1P5QA 4PTMA 5J6EA 4DIPA 5HW8A 4NSBA 2B31A 1YATA 3O5PA 4MAVA 4MSPA 4DZ2A 3JYJA 1ZBWA 3KAFA 2F21A 4S3KA 1PINA 2F4EA 3ARXA 2PV3A 4W9OA 2KI3A 4JFMA 1EDQA 3B9DA 1D7JA 4DRHA 4QZVB 4U84A 4Q7NA 2MNTA 4WKHA 1VF8A 3WD1A 2RUCA 1M5YA 4G50A 3ARTA 3WD2A 1ITXA 3G6LA 2ZR6A 3O5DA 1HKKA 4IQ2A 3B7XA 1FKDA 2AOSA 1D7HA 1QPLA 5HUAA 2DPEA 3AS2A 5BXJA 1GUVA 3EY6A 3IK8A 2PV1A 1J4HA 1B6CA 4MPKA 3KAGA 4MNJA 1N1AA 1X6LA 3VAWA 2ZQVA 3RFWA 3GPKA 3WKZA 3O5GA 1UR8A 3CHCA 1W9UA 1W1VA 4WKFA 4TYOA 3ARRA 1SR0A 2PPOA 1FKGA 1WNOA 4FN2A 5D75A 4ODMA 2DT2A 2PPNA 4IPXA 3KACA 4WK9A 1EQ3A 4GGQA 4Q22A 3RM4A 1ZK6A 1T11A 2F23A 4ZPVR 4DROA 2XP7A 4WKAA 5I98A 4L3NA 2ESCA 3CH9A 2PN0A 1LL4A 2FKEA 4JFKA 2KGJA 3UQBA 4ML4A 1FKSA 1A7XA 1NWRA 3UQIA 3RGCA 1ZL1A 3BXWA 2DT3A 4TW6A 1PBKA 1FFRA 2XP5A 5DO2A 4DRMA 1U79A 4G2PA 4IQCA 1X6NA 4P8WA 2OLHA 1W1YA 4ODKA 2DT0A 2ZR4A 4HARA 2M1IA 3B8SA 2FDMA 3AS1A 2VCDA 3GTYX 1CTNA 4R0XA 4TW8A 4Z2JA 3WD3A 1Q6HA 4DT4A 3AQUA 4JYSA 4ODOA 4ZS6A 4Z2KA 1EYMA 5HT1A 4W5UA 1LQ0A 1BL4A 1EHNA 4DH0A 1E44A 1QZ2A 2B5UB 1W1PA 1J6YA 4JFIA 2XP3A 3CHDA 5HWBA 3RM8A 3TDBA 1FKTA 3O5LA 4DRQA 2WM0A 4ODRA 1RD6A 4ODNA 1NWTA 3WIJA 2MLYA 1LG2A 4S3JA 2LJ4A 4DRIA 5DF0A 3UI6A 1E9LA 3AROA 1XHGA 4LAVA 1ZBKA 4MNLA 5DEZA 1JVWA 3WL0A 1F40A 1ZCNA 2RURA 2ZQSA 3WH0A 1OGGA 2RSEA 3G6MA 4Z2LA 1ZB5A 3BMBA 1O6IA 4P8UA 1EIBA 1KT0A 1SYTA 1FKKA 1W26A 4HBEA 1KT1A 3WD4A 1NMVA 2VN1A 4LAXA 2JZVA 3AS0A 2KO7A 3KZ7A 4DZ3A 3O5EA 4ODQA 2XP8A 3JXVA 4DRJA 1OWQA 2UZ5A 3WQVA 3PRAA 2LGOA 2Q5AA 1TCOC 1GPFA 3KAHA 1Q6UA 1HKIA 1D6OA 3JYMA 2IUZA 5B8IC 2RUDA 2ETNA 5HW6A 2OFNA 4TX0A 1H0GA 2WLZA 3B9EA 1NWUA 2O92A 1GRJA 5DIVA 4Z2HA 4MNMA 4MNKA 4ZPTR 3EIPA 3IHZA 2XPBA 4W9PA 5HWCA 4JFJA 4JFLA 4R5EA 3PA7A 1F8AB 1ZBCA 1FKBA 3WQWA 2WK2A 1TFVA 3MDYB 3CGNA 4QT2A 4HBOA 2WLYA 1W9PA 4KR0B 4QIBA 2A3BA 4U85A 2G41A 1FD9A 4UDMA 1FKIA 3KAIA 3KCEA 1JNSA 2O9OA 2PI6A 2M08A 3UQAA 4WIWA 2DT1A 2A3EA 3ARPA 1ROUA 1NSGA 3ALGA 2KE0A 1ZBVA 2KR7A 2F2DA 1WB0A 4L72B 1WAWA 3UI5A 2XPAA 3LUOA 2FAPA 3FY1A 2DSVA 3CHFA 2Y78A 1FKLA 2DSZA 2L2SA 1QPFA 5HTGA 1LL6A 3GU0A 4J4OA 4ODLA 4U86A 5HBFA 2MF9A 4KQZA 1E6RA 1FKFA 3KADA 2DG3A 4XAKA 3OOBA 4IT4A 4DWSB 1FKHA 3ARWA 5GPGA 2XP4A 2MLZA 4FAPA 1J4IA 2G8ZA 4DWSD 3O5QA 3PRBA 2MLXA 4AY1A 2KFWA 1Q1CA 2D9FA 2RQSA 1UR9A 2PBCA 2IF4A 2N87A 2XP9A
chains in the Genus database with same CATH topology
2PPPA 4DRPA 3ODKA 1IX5A 1FAPA 4NZCA 2ZQUA 1FKJA 4TW7A 1D2KA 1K9TA 1W9VA 2DG4A 1E6ZA 3WD0A 3O5FA 1H0IA 4QT3A 1NH6A 4DRNA 3CHEA 3O5MA 3W4RA 1HKMA 4MTVA 1LJYA 2AWGA 4IT6A 4WJXA 1ROTA 4N19A 1KFWA 4P8XA 3UI4A 3NI6A 3TC5A 4BF8A 3ARSA 4W9QA 2PV2A 3FXYA 1GOIA 4DWSC 4C02B 1JNDA 2RUQA 1C9HA 3AS3A 3CZ8A 4Z2GA 3OA5A 1E15A 1HJXA 1R9HA 2DSWA 4J4NA 4Z2IA 1OGBA 1HKJA 1HXVA 3CGMA 2QF8A 4DRKA 1ZU8A 1E6PA 5HKGA 1D7IA 4LAYA 2YBUA 1Q6IA 3ARUA 3O5KA 1LL7A 3O5RA 3TCZA 3ARZA 4GIVA 3FAPA 2ITKA 3ARQA 4MGVA 3O5OA 1FJDA 3RM9A 4P8VA 1NMWA 1L1PA 1HJWA 2XP6A 3ALFA 2ZR5A 4TNSA 4ODPA 2M2AA 1XRVA 5GQBA 3I6CA 1J4RA 4NNRA 1HJVA 2DSUA 3QOKA 1E6NA 3O5IA 5GPRA 1W1TA 5HW7A 3IKGA 4URIA 2MPHA 5DIUA 1FKRA 2YBTA 2LPVA 3RMEA 3PR9A 1JNTA 4LGXA 1YW5A 4O2TA 4LAWA 3NRKA 1BKFA 1NWSA 3KABA 3O5JA 3H9RB 3NTPA 2A3AA 3ARYA 2DG9A 5DITA 3UF8A 5JH8A 4ZPWR 1FFQA 3PRDA 2K8IA 2LKNA 3WL1A 3ARVA 1LG1A 3IKDA 4ITZA 1Y0OA 4DWSA 2ZQTA 1JNEA 3B9AA 2A3CA 1P5QA 4PTMA 5J6EA 4DIPA 5HW8A 4NSBA 2B31A 1YATA 3O5PA 4MAVA 4MSPA 4DZ2A 3JYJA 1ZBWA 3KAFA 2F21A 4S3KA 1PINA 2F4EA 3ARXA 2PV3A 4W9OA 2KI3A 4JFMA 1EDQA 3B9DA 1D7JA 4DRHA 4QZVB 4U84A 4Q7NA 2MNTA 4WKHA 1VF8A 3WD1A 2RUCA 1M5YA 4G50A 3ARTA 3WD2A 1ITXA 3G6LA 2ZR6A 3O5DA 1HKKA 4IQ2A 3B7XA 1FKDA 2AOSA 1D7HA 1QPLA 5HUAA 2DPEA 3AS2A 5BXJA 1GUVA 3EY6A 3IK8A 2PV1A 1J4HA 1B6CA 4MPKA 3KAGA 4MNJA 1N1AA 1X6LA 3VAWA 2ZQVA 3RFWA 3GPKA 3WKZA 3O5GA 1UR8A 3CHCA 1W9UA 1W1VA 4WKFA 4TYOA 3ARRA 1SR0A 2PPOA 1FKGA 1WNOA 4FN2A 5D75A 4ODMA 2DT2A 2PPNA 4IPXA 3KACA 4WK9A 1EQ3A 4GGQA 4Q22A 3RM4A 1ZK6A 1T11A 4ZPVR 4DROA 2XP7A 4WKAA 5I98A 4L3NA 2ESCA 3CH9A 1LL4A 2FKEA 4JFKA 2KGJA 3UQBA 4ML4A 1FKSA 1A7XA 1NWRA 3UQIA 3RGCA 1ZL1A 3BXWA 2DT3A 4TW6A 1PBKA 1FFRA 2XP5A 5DO2A 4DRMA 1U79A 4G2PA 4IQCA 1X6NA 4P8WA 2OLHA 1W1YA 4ODKA 2DT0A 2ZR4A 4HARA 2M1IA 3B8SA 2FDMA 3AS1A 2VCDA 1CTNA 4R0XA 4TW8A 4Z2JA 3WD3A 1Q6HA 4DT4A 3AQUA 4JYSA 4ODOA 4ZS6A 4Z2KA 1EYMA 5HT1A 4W5UA 1LQ0A 1BL4A 1EHNA 4DH0A 1QZ2A 1W1PA 1J6YA 4JFIA 2XP3A 3CHDA 5HWBA 3RM8A 3TDBA 1FKTA 3O5LA 4DRQA 2WM0A 4ODRA 1RD6A 4ODNA 1NWTA 3WIJA 2MLYA 1LG2A 4S3JA 2LJ4A 4DRIA 5DF0A 3UI6A 1E9LA 3AROA 1XHGA 4LAVA 1ZBKA 4MNLA 5DEZA 1JVWA 3WL0A 1F40A 1ZCNA 2RURA 2ZQSA 3WH0A 1OGGA 2RSEA 3G6MA 4Z2LA 1ZB5A 1O6IA 4P8UA 1EIBA 1KT0A 1SYTA 1FKKA 1W26A 4HBEA 1KT1A 3WD4A 1NMVA 2VN1A 4LAXA 2JZVA 3AS0A 2KO7A 3KZ7A 4DZ3A 3O5EA 4ODQA 2XP8A 3JXVA 4DRJA 1OWQA 2UZ5A 3WQVA 3PRAA 2LGOA 2Q5AA 1TCOC 1GPFA 3KAHA 1Q6UA 1HKIA 1D6OA 3JYMA 2IUZA 5B8IC 2RUDA 5HW6A 2OFNA 4TX0A 1H0GA 2WLZA 3B9EA 1NWUA 2O92A 5DIVA 4Z2HA 4MNMA 4MNKA 4ZPTR 3IHZA 2XPBA 4W9PA 5HWCA 4JFJA 4JFLA 4R5EA 3PA7A 1F8AB 1ZBCA 1FKBA 3WQWA 2WK2A 1TFVA 3MDYB 3CGNA 4QT2A 4HBOA 2WLYA 1W9PA 4KR0B 4QIBA 2A3BA 4U85A 2G41A 1FD9A 1FKIA 3KAIA 3KCEA 1JNSA 2O9OA 2PI6A 2M08A 3UQAA 4WIWA 2DT1A 2A3EA 3ARPA 1ROUA 1NSGA 3ALGA 2KE0A 1ZBVA 2KR7A 2F2DA 1WB0A 4L72B 1WAWA 3UI5A 2XPAA 3LUOA 2FAPA 3FY1A 2DSVA 3CHFA 2Y78A 1FKLA 2DSZA 2L2SA 1QPFA 5HTGA 1LL6A 4J4OA 4ODLA 4U86A 5HBFA 2MF9A 4KQZA 1E6RA 1FKFA 3KADA 2DG3A 4XAKA 3OOBA 4IT4A 4DWSB 1FKHA 3ARWA 5GPGA 2XP4A 2MLZA 4FAPA 1J4IA 2G8ZA 4DWSD 3O5QA 3PRBA 2MLXA 4AY1A 2KFWA 1Q1CA 2D9FA 2RQSA 1UR9A 2PBCA 2IF4A 2N87A 2XP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PPP A;  4DRP A;  3ODK A;  4DZ3 A;  3O5E A;  4ODQ A;  2XP8 A;  3JXV A;  1FAP A;  2XP7 A;  4DRJ A;  4DRO A;  2ZQU A;  3PRD A;  2K8I A;  2UZ5 A;  2LKN A;  1FKJ A;  4TW7 A;  5I98 A;  2LGO A;  2Q5A A;  2DG4 A;  2FKE A;  3IKD A;  4ITZ A;  1Y0O A;  4JFK A;  2ZQT A;  1TCO C;  3O5F A;  4QT3 A;  2KGJ A;  3UQB A;  1FKS A;  1A7X A;  1Q6U A;  3JYM A;  1D6O A;  3KAH A;  1P5Q A;  3RGC A;  3UQI A;  4DRN A;  5B8I C;  2RUD A;  4TW6 A;  1PBK A;  2XP5 A;  3O5M A;  5HW6 A;  2OFN A;  4DRM A;  4TX0 A;  5J6E A;  4DIP A;  5DIV A;  5HW8 A;  2AWG A;  1YAT A;  1U79 A;  3O5P A;  1ROT A;  4MSP A;  4DZ2 A;  3JYJ A;  4N19 A;  3UI4 A;  4G2P A;  3NI6 A;  4IQC A;  3TC5 A;  4BF8 A;  4W9Q A;  3KAF A;  2F21 A;  2PV2 A;  3IHZ A;  2XPB A;  1PIN A;  4W9P A;  4ODK A;  5HWC A;  4JFJ A;  4JFL A;  2F4E A;  2ZR4 A;  1F8A B;  3PA7 A;  1FKB A;  2PV3 A;  4W9O A;  2M1I A;  4C02 B;  2RUQ A;  1C9H A;  2KI3 A;  2VCD A;  4R0X A;  4TW8 A;  4JFM A;  3MDY B;  1D7J A;  4DRH A;  3CGN A;  4QT2 A;  1R9H A;  4J4N A;  1Q6H A;  4DT4 A;  1HXV A;  3CGM A;  4JYS A;  4DRK A;  4ODO A;  5HKG A;  1EYM A;  5HT1 A;  4QIB A;  1D7I A;  4LAY A;  4U84 A;  1Q6I A;  4U85 A;  2MNT A;  3O5K A;  3O5R A;  1BL4 A;  1FD9 A;  3TCZ A;  1FKI A;  3KAI A;  4DH0 A;  3KCE A;  1QZ2 A;  1JNS A;  4GIV A;  1J6Y A;  2RUC A;  1M5Y A;  4G50 A;  2M08 A;  3FAP A;  2ITK A;  4JFI A;  2XP3 A;  4MGV A;  3UQA A;  5HWB A;  3O5O A;  1FJD A;  3TDB A;  1NMW A;  2ZR6 A;  1FKT A;  1L1P A;  3O5L A;  3O5D A;  4IQ2 A;  1ROU A;  2XP6 A;  1NSG A;  3B7X A;  1FKD A;  2KE0 A;  2KR7 A;  2ZR5 A;  2F2D A;  4TNS A;  4ODP A;  1D7H A;  1QPL A;  2M2A A;  4DRQ A;  3UI5 A;  2XPA A;  3LUO A;  5HUA A;  5BXJ A;  4ODR A;  3EY6 A;  2FAP A;  2PV1 A;  3IK8 A;  3I6C A;  1J4R A;  1J4H A;  4NNR A;  4ODN A;  2Y78 A;  1B6C A;  1FKL A;  2L2S A;  1QPF A;  2MLY A;  3O5I A;  5HTG A;  3KAG A;  2LJ4 A;  4DRI A;  4J4O A;  5HW7 A;  3IKG A;  4ODL A;  4U86 A;  3UI6 A;  1N1A A;  2MF9 A;  2MPH A;  4LAV A;  5DIU A;  2ZQV A;  3VAW A;  1FKF A;  3GPK A;  3KAD A;  3RFW A;  2DG3 A;  1FKR A;  1JVW A;  1F40 A;  3OOB A;  2LPV A;  1ZCN A;  2RUR A;  1JNT A;  2ZQS A;  3O5G A;  3WH0 A;  1YW5 A;  1FKH A;  4O2T A;  2RSE A;  4IPX A;  5GPG A;  2XP4 A;  2MLZ A;  4LAW A;  4TYO A;  3NRK A;  4FAP A;  1J4I A;  1BKF A;  2PPO A;  1FKG A;  3O5Q A;  1KT0 A;  2MLX A;  3PRB A;  1FKK A;  1W26 A;  3KAB A;  4FN2 A;  5D75 A;  4ODM A;  1T11 A;  2PPN A;  2KFW A;  1KT1 A;  1Q1C A;  2D9F A;  2RQS A;  1NMV A;  3H9R B;  3NTP A;  3O5J A;  2VN1 A;  3KAC A;  1EQ3 A;  4LAX A;  2JZV A;  2PBC A;  2DG9 A;  2IF4 A;  2N87 A;  4GGQ A;  5DIT A;  3UF8 A;  2KO7 A;  2XP9 A;  3KZ7 A;  1ZK6 A; 
#chains in the Genus database with same CATH topology
 2PPP A;  4DRP A;  3ODK A;  1IX5 A;  1FAP A;  4NZC A;  2ZQU A;  1FKJ A;  4TW7 A;  1D2K A;  1K9T A;  1W9V A;  2DG4 A;  1E6Z A;  3WD0 A;  3O5F A;  1H0I A;  4QT3 A;  1NH6 A;  4DRN A;  1JCH B;  3CHE A;  3O5M A;  3W4R A;  1HKM A;  4MTV A;  1LJY A;  2AWG A;  4IT6 A;  4WJX A;  1ROT A;  4N19 A;  1KFW A;  4P8X A;  3UI4 A;  3NI6 A;  3TC5 A;  4BF8 A;  3ARS A;  4W9Q A;  2PV2 A;  3FXY A;  1GOI A;  4DWS C;  4C02 B;  1JND A;  2RUQ A;  1C9H A;  3AS3 A;  3CZ8 A;  4Z2G A;  3OA5 A;  1E15 A;  1HJX A;  1R9H A;  2DSW A;  4J4N A;  4Z2I A;  1OGB A;  1HKJ A;  1HXV A;  3CGM A;  2QF8 A;  4DRK A;  1ZU8 A;  1E6P A;  5HKG A;  1D7I A;  4LAY A;  2YBU A;  1Q6I A;  3ARU A;  3O5K A;  1LL7 A;  3O5R A;  3TCZ A;  3ARZ A;  4GIV A;  3FAP A;  2ITK A;  3ARQ A;  4MGV A;  3O5O A;  1FJD A;  3RM9 A;  4P8V A;  1NMW A;  1L1P A;  1HJW A;  2XP6 A;  3ALF A;  2ZR5 A;  4TNS A;  4ODP A;  2M2A A;  1XRV A;  5GQB A;  3I6C A;  1J4R A;  4NNR A;  1HJV A;  2DSU A;  3QOK A;  1E6N A;  3O5I A;  5GPR A;  1W1T A;  5HW7 A;  3IKG A;  4URI A;  2MPH A;  5DIU A;  1FKR A;  2YBT A;  2LPV A;  3RME A;  3PR9 A;  1JNT A;  4LGX A;  1YW5 A;  4O2T A;  2P4V A;  4LAW A;  3NRK A;  1BKF A;  1NWS A;  3KAB A;  3O5J A;  3H9R B;  3NTP A;  2A3A A;  3ARY A;  2DG9 A;  5DIT A;  3UF8 A;  5JH8 A;  4ZPW R;  1FFQ A;  3PRD A;  2K8I A;  2LKN A;  3WL1 A;  3ARV A;  1LG1 A;  3IKD A;  4ITZ A;  1Y0O A;  4DWS A;  2ZQT A;  1JNE A;  3B9A A;  2EUL A;  2A3C A;  1P5Q A;  4PTM A;  5J6E A;  4DIP A;  5HW8 A;  4NSB A;  2B31 A;  1YAT A;  3O5P A;  4MAV A;  4MSP A;  4DZ2 A;  3JYJ A;  1ZBW A;  3KAF A;  2F21 A;  4S3K A;  1PIN A;  2F4E A;  3ARX A;  2PV3 A;  4W9O A;  2KI3 A;  4JFM A;  1EDQ A;  3B9D A;  1D7J A;  4DRH A;  4QZV B;  4U84 A;  4Q7N A;  2MNT A;  4WKH A;  1VF8 A;  3WD1 A;  2RUC A;  1M5Y A;  4G50 A;  3ART A;  3WD2 A;  1ITX A;  3G6L A;  2ZR6 A;  3O5D A;  1HKK A;  4IQ2 A;  3B7X A;  1FKD A;  2AOS A;  1D7H A;  1QPL A;  5HUA A;  2DPE A;  3AS2 A;  5BXJ A;  1GUV A;  3EY6 A;  3IK8 A;  2PV1 A;  1J4H A;  1B6C A;  4MPK A;  3KAG A;  4MNJ A;  1N1A A;  1X6L A;  3VAW A;  2ZQV A;  3RFW A;  3GPK A;  3WKZ A;  3O5G A;  1UR8 A;  3CHC A;  1W9U A;  1W1V A;  4WKF A;  4TYO A;  3ARR A;  1SR0 A;  2PPO A;  1FKG A;  1WNO A;  4FN2 A;  5D75 A;  4ODM A;  2DT2 A;  2PPN A;  4IPX A;  3KAC A;  4WK9 A;  1EQ3 A;  4GGQ A;  4Q22 A;  3RM4 A;  1ZK6 A;  1T11 A;  2F23 A;  4ZPV R;  4DRO A;  2XP7 A;  4WKA A;  5I98 A;  4L3N A;  2ESC A;  3CH9 A;  2PN0 A;  1LL4 A;  2FKE A;  4JFK A;  2KGJ A;  3UQB A;  4ML4 A;  1FKS A;  1A7X A;  1NWR A;  3UQI A;  3RGC A;  1ZL1 A;  3BXW A;  2DT3 A;  4TW6 A;  1PBK A;  1FFR A;  2XP5 A;  5DO2 A;  4DRM A;  1U79 A;  4G2P A;  4IQC A;  1X6N A;  4P8W A;  2OLH A;  1W1Y A;  4ODK A;  2DT0 A;  2ZR4 A;  4HAR A;  2M1I A;  3B8S A;  2FDM A;  3AS1 A;  2VCD A;  3GTY X;  1CTN A;  4R0X A;  4TW8 A;  4Z2J A;  3WD3 A;  1Q6H A;  4DT4 A;  3AQU A;  4JYS A;  4ODO A;  4ZS6 A;  4Z2K A;  1EYM A;  5HT1 A;  4W5U A;  1LQ0 A;  1BL4 A;  1EHN A;  4DH0 A;  1E44 A;  1QZ2 A;  2B5U B;  1W1P A;  1J6Y A;  4JFI A;  2XP3 A;  3CHD A;  5HWB A;  3RM8 A;  3TDB A;  1FKT A;  3O5L A;  4DRQ A;  2WM0 A;  4ODR A;  1RD6 A;  4ODN A;  1NWT A;  3WIJ A;  2MLY A;  1LG2 A;  4S3J A;  2LJ4 A;  4DRI A;  5DF0 A;  3UI6 A;  1E9L A;  3ARO A;  1XHG A;  4LAV A;  1ZBK A;  4MNL A;  5DEZ A;  1JVW A;  3WL0 A;  1F40 A;  1ZCN A;  2RUR A;  2ZQS A;  3WH0 A;  1OGG A;  2RSE A;  3G6M A;  4Z2L A;  1ZB5 A;  3BMB A;  1O6I A;  4P8U A;  1EIB A;  1KT0 A;  1SYT A;  1FKK A;  1W26 A;  4HBE A;  1KT1 A;  3WD4 A;  1NMV A;  2VN1 A;  4LAX A;  2JZV A;  3AS0 A;  2KO7 A;  3KZ7 A;  4DZ3 A;  3O5E A;  4ODQ A;  2XP8 A;  3JXV A;  4DRJ A;  1OWQ A;  2UZ5 A;  3WQV A;  3PRA A;  2LGO A;  2Q5A A;  1TCO C;  1GPF A;  3KAH A;  1Q6U A;  1HKI A;  1D6O A;  3JYM A;  2IUZ A;  5B8I C;  2RUD A;  2ETN A;  5HW6 A;  2OFN A;  4TX0 A;  1H0G A;  2WLZ A;  3B9E A;  1NWU A;  2O92 A;  1GRJ A;  5DIV A;  4Z2H A;  4MNM A;  4MNK A;  4ZPT R;  3EIP A;  3IHZ A;  2XPB A;  4W9P A;  5HWC A;  4JFJ A;  4JFL A;  4R5E A;  3PA7 A;  1F8A B;  1ZBC A;  1FKB A;  3WQW A;  2WK2 A;  1TFV A;  3MDY B;  3CGN A;  4QT2 A;  4HBO A;  2WLY A;  1W9P A;  4KR0 B;  4QIB A;  2A3B A;  4U85 A;  2G41 A;  1FD9 A;  4UDM A;  1FKI A;  3KAI A;  3KCE A;  1JNS A;  2O9O A;  2PI6 A;  2M08 A;  3UQA A;  4WIW A;  2DT1 A;  2A3E A;  3ARP A;  1ROU A;  1NSG A;  3ALG A;  2KE0 A;  1ZBV A;  2KR7 A;  2F2D A;  1WB0 A;  4L72 B;  1WAW A;  3UI5 A;  2XPA A;  3LUO A;  2FAP A;  3FY1 A;  2DSV A;  3CHF A;  2Y78 A;  1FKL A;  2DSZ A;  2L2S A;  1QPF A;  5HTG A;  1LL6 A;  3GU0 A;  4J4O A;  4ODL A;  4U86 A;  5HBF A;  2MF9 A;  4KQZ A;  1E6R A;  1FKF A;  3KAD A;  2DG3 A;  4XAK A;  3OOB A;  4IT4 A;  4DWS B;  1FKH A;  3ARW A;  5GPG A;  2XP4 A;  2MLZ A;  4FAP A;  1J4I A;  2G8Z A;  4DWS D;  3O5Q A;  3PRB A;  2MLX A;  4AY1 A;  2KFW A;  1Q1C A;  2D9F A;  2RQS A;  1UR9 A;  2PBC A;  2IF4 A;  2N87 A;  2XP9 A; 
#chains in the Genus database with same CATH homology
 2PPP A;  4DRP A;  3ODK A;  1IX5 A;  1FAP A;  4NZC A;  2ZQU A;  1FKJ A;  4TW7 A;  1D2K A;  1K9T A;  1W9V A;  2DG4 A;  1E6Z A;  3WD0 A;  3O5F A;  1H0I A;  4QT3 A;  1NH6 A;  4DRN A;  3CHE A;  3O5M A;  3W4R A;  1HKM A;  4MTV A;  1LJY A;  2AWG A;  4IT6 A;  4WJX A;  1ROT A;  4N19 A;  1KFW A;  4P8X A;  3UI4 A;  3NI6 A;  3TC5 A;  4BF8 A;  3ARS A;  4W9Q A;  2PV2 A;  3FXY A;  1GOI A;  4DWS C;  4C02 B;  1JND A;  2RUQ A;  1C9H A;  3AS3 A;  3CZ8 A;  4Z2G A;  3OA5 A;  1E15 A;  1HJX A;  1R9H A;  2DSW A;  4J4N A;  4Z2I A;  1OGB A;  1HKJ A;  1HXV A;  3CGM A;  2QF8 A;  4DRK A;  1ZU8 A;  1E6P A;  5HKG A;  1D7I A;  4LAY A;  2YBU A;  1Q6I A;  3ARU A;  3O5K A;  1LL7 A;  3O5R A;  3TCZ A;  3ARZ A;  4GIV A;  3FAP A;  2ITK A;  3ARQ A;  4MGV A;  3O5O A;  1FJD A;  3RM9 A;  4P8V A;  1NMW A;  1L1P A;  1HJW A;  2XP6 A;  3ALF A;  2ZR5 A;  4TNS A;  4ODP A;  2M2A A;  1XRV A;  5GQB A;  3I6C A;  1J4R A;  4NNR A;  1HJV A;  2DSU A;  3QOK A;  1E6N A;  3O5I A;  5GPR A;  1W1T A;  5HW7 A;  3IKG A;  4URI A;  2MPH A;  5DIU A;  1FKR A;  2YBT A;  2LPV A;  3RME A;  3PR9 A;  1JNT A;  4LGX A;  1YW5 A;  4O2T A;  4LAW A;  3NRK A;  1BKF A;  1NWS A;  3KAB A;  3O5J A;  3H9R B;  3NTP A;  2A3A A;  3ARY A;  2DG9 A;  5DIT A;  3UF8 A;  5JH8 A;  4ZPW R;  1FFQ A;  3PRD A;  2K8I A;  2LKN A;  3WL1 A;  3ARV A;  1LG1 A;  3IKD A;  4ITZ A;  1Y0O A;  4DWS A;  2ZQT A;  1JNE A;  3B9A A;  2A3C A;  1P5Q A;  4PTM A;  5J6E A;  4DIP A;  5HW8 A;  4NSB A;  2B31 A;  1YAT A;  3O5P A;  4MAV A;  4MSP A;  4DZ2 A;  3JYJ A;  1ZBW A;  3KAF A;  2F21 A;  4S3K A;  1PIN A;  2F4E A;  3ARX A;  2PV3 A;  4W9O A;  2KI3 A;  4JFM A;  1EDQ A;  3B9D A;  1D7J A;  4DRH A;  4QZV B;  4U84 A;  4Q7N A;  2MNT A;  4WKH A;  1VF8 A;  3WD1 A;  2RUC A;  1M5Y A;  4G50 A;  3ART A;  3WD2 A;  1ITX A;  3G6L A;  2ZR6 A;  3O5D A;  1HKK A;  4IQ2 A;  3B7X A;  1FKD A;  2AOS A;  1D7H A;  1QPL A;  5HUA A;  2DPE A;  3AS2 A;  5BXJ A;  1GUV A;  3EY6 A;  3IK8 A;  2PV1 A;  1J4H A;  1B6C A;  4MPK A;  3KAG A;  4MNJ A;  1N1A A;  1X6L A;  3VAW A;  2ZQV A;  3RFW A;  3GPK A;  3WKZ A;  3O5G A;  1UR8 A;  3CHC A;  1W9U A;  1W1V A;  4WKF A;  4TYO A;  3ARR A;  1SR0 A;  2PPO A;  1FKG A;  1WNO A;  4FN2 A;  5D75 A;  4ODM A;  2DT2 A;  2PPN A;  4IPX A;  3KAC A;  4WK9 A;  1EQ3 A;  4GGQ A;  4Q22 A;  3RM4 A;  1ZK6 A;  1T11 A;  4ZPV R;  4DRO A;  2XP7 A;  4WKA A;  5I98 A;  4L3N A;  2ESC A;  3CH9 A;  1LL4 A;  2FKE A;  4JFK A;  2KGJ A;  3UQB A;  4ML4 A;  1FKS A;  1A7X A;  1NWR A;  3UQI A;  3RGC A;  1ZL1 A;  3BXW A;  2DT3 A;  4TW6 A;  1PBK A;  1FFR A;  2XP5 A;  5DO2 A;  4DRM A;  1U79 A;  4G2P A;  4IQC A;  1X6N A;  4P8W A;  2OLH A;  1W1Y A;  4ODK A;  2DT0 A;  2ZR4 A;  4HAR A;  2M1I A;  3B8S A;  2FDM A;  3AS1 A;  2VCD A;  1CTN A;  4R0X A;  4TW8 A;  4Z2J A;  3WD3 A;  1Q6H A;  4DT4 A;  3AQU A;  4JYS A;  4ODO A;  4ZS6 A;  4Z2K A;  1EYM A;  5HT1 A;  4W5U A;  1LQ0 A;  1BL4 A;  1EHN A;  4DH0 A;  1QZ2 A;  1W1P A;  1J6Y A;  4JFI A;  2XP3 A;  3CHD A;  5HWB A;  3RM8 A;  3TDB A;  1FKT A;  3O5L A;  4DRQ A;  2WM0 A;  4ODR A;  1RD6 A;  4ODN A;  1NWT A;  3WIJ A;  2MLY A;  1LG2 A;  4S3J A;  2LJ4 A;  4DRI A;  5DF0 A;  3UI6 A;  1E9L A;  3ARO A;  1XHG A;  4LAV A;  1ZBK A;  4MNL A;  5DEZ A;  1JVW A;  3WL0 A;  1F40 A;  1ZCN A;  2RUR A;  2ZQS A;  3WH0 A;  1OGG A;  2RSE A;  3G6M A;  4Z2L A;  1ZB5 A;  1O6I A;  4P8U A;  1EIB A;  1KT0 A;  1SYT A;  1FKK A;  1W26 A;  4HBE A;  1KT1 A;  3WD4 A;  1NMV A;  2VN1 A;  4LAX A;  2JZV A;  3AS0 A;  2KO7 A;  3KZ7 A;  4DZ3 A;  3O5E A;  4ODQ A;  2XP8 A;  3JXV A;  4DRJ A;  1OWQ A;  2UZ5 A;  3WQV A;  3PRA A;  2LGO A;  2Q5A A;  1TCO C;  1GPF A;  3KAH A;  1Q6U A;  1HKI A;  1D6O A;  3JYM A;  2IUZ A;  5B8I C;  2RUD A;  5HW6 A;  2OFN A;  4TX0 A;  1H0G A;  2WLZ A;  3B9E A;  1NWU A;  2O92 A;  5DIV A;  4Z2H A;  4MNM A;  4MNK A;  4ZPT R;  3IHZ A;  2XPB A;  4W9P A;  5HWC A;  4JFJ A;  4JFL A;  4R5E A;  3PA7 A;  1F8A B;  1ZBC A;  1FKB A;  3WQW A;  2WK2 A;  1TFV A;  3MDY B;  3CGN A;  4QT2 A;  4HBO A;  2WLY A;  1W9P A;  4KR0 B;  4QIB A;  2A3B A;  4U85 A;  2G41 A;  1FD9 A;  1FKI A;  3KAI A;  3KCE A;  1JNS A;  2O9O A;  2PI6 A;  2M08 A;  3UQA A;  4WIW A;  2DT1 A;  2A3E A;  3ARP A;  1ROU A;  1NSG A;  3ALG A;  2KE0 A;  1ZBV A;  2KR7 A;  2F2D A;  1WB0 A;  4L72 B;  1WAW A;  3UI5 A;  2XPA A;  3LUO A;  2FAP A;  3FY1 A;  2DSV A;  3CHF A;  2Y78 A;  1FKL A;  2DSZ A;  2L2S A;  1QPF A;  5HTG A;  1LL6 A;  4J4O A;  4ODL A;  4U86 A;  5HBF A;  2MF9 A;  4KQZ A;  1E6R A;  1FKF A;  3KAD A;  2DG3 A;  4XAK A;  3OOB A;  4IT4 A;  4DWS B;  1FKH A;  3ARW A;  5GPG A;  2XP4 A;  2MLZ A;  4FAP A;  1J4I A;  2G8Z A;  4DWS D;  3O5Q A;  3PRB A;  2MLX A;  4AY1 A;  2KFW A;  1Q1C A;  2D9F A;  2RQS A;  1UR9 A;  2PBC A;  2IF4 A;  2N87 A;  2XP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...