1EYMA

Fk506 binding protein mutant, homodimeric complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKMDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A ligand-reversible dimerization system for controlling protein-protein interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords FK506 BINDING PROTEIN
total genus 27
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2000-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1eymA00
1FKTA 3JYMA 3UI5A 2RQSA 4U84A 3VAWA 1ROUA 3CGNA 2F21A 3UQIA 4IQ2A 5J6EA 4TYOA 3JXVA 3RGCA 1EQ3A 4MGVA 1FKRA 1D7JA 2ZQUA 2L2SA 4ODKA 4ODLA 1FKSA 1PBKA 2MPHA 1FD9A 2FAPA 1J4IA 4U86A 2M2AA 1A7XA 3O5IA 3I6CA 2ZR4A 2KFWA 1YATA 2IF4A 1EYMA 2VCDA 3EY6A 4ODOA 1FJDA 1FKKA 3KAIA 3TDBA 2KGJA 3IHZA 5B8IC 4DRMA 3B7XA 4JFMA 5HWCA 1N1AA 4BF8A 4GIVA 2Y78A 2PV1A 1JVWA 1FKBA 1FKJA 2RUQA 2XP7A 1Q6IA 2ZQSA 3JYJA 2PPOA 4DIPA 2MLYA 4JFKA 3KZ7A 5D75A 4ODMA 3O5KA 3UQAA 2ZR5A 1P5QA 1ZCNA 5HUAA 1JNTA 2F4EA 2MLXA 3PA7A 3PRDA 1Q1CA 3KAFA 4G50A 4ODNA 4DROA 3FAPA 1BKFA 5DIVA 4TNSA 2M1IA 2LJ4A 3TC5A 1FKHA 1YW5A 1B6CA 3O5MA 4LAWA 4J4OA 3NI6A 4ODRA 4ODPA 3O5FA 1J4RA 5BXJA 1C9HA 5I98A 4DRKA 3KADA 2ZQVA 4LAVA 2RSEA 2FKEA 1F8AB 3RFWA 4G2PA 2MLZA 1KT0A 2JZVA 1QPLA 1Q6UA 4DZ3A 2DG3A 1HXVA 1M5YA 4IQCA 2RUDA 4W9OA 3LUOA 4U85A 1J4HA 2D9FA 4QT3A 1R9HA 4GGQA 3KAGA 2PBCA 1QPFA 1U79A 2PPPA 2PPNA 4TW8A 4IPXA 3O5DA 2OFNA 4MSPA 3O5JA 4TX0A 3CGMA 3KACA 2K8IA 2UZ5A 3KAHA 2MF9A 4QT2A 3O5QA 3UF8A 5HW8A 1F40A 1W26A 3PRBA 4JFIA 1FKGA 3O5LA 4ODQA 4FAPA 2ZR6A 3IK8A 4LAYA 4DRJA 3OOBA 1ZK6A 2Q5AA 2AWGA 2LGOA 3O5RA 4JFLA 4NNRA 2XP4A 2LPVA 3KABA 1JNSA 1ROTA 4DRQA 4W9QA 1L1PA 4ITZA 1D7IA 3NRKA 1Y0OA 3O5EA 2N87A 2F2DA 2PV3A 2XP9A 4DH0A 4QIBA 4DRNA 2XP3A 2XP5A 4N19A 3O5GA 1D7HA 3O5PA 2RUCA 1NMWA 1PINA 4O2TA 2M08A 3IKGA 3O5OA 2ZQTA 4J4NA 3UI6A 2DG9A 5HWBA 4TW7A 2DG4A 1KT1A 2LKNA 3KCEA 1Q6HA 2RURA 1FKDA 5DIUA 2KE0A 4FN2A 3ODKA 3WH0A 4DT4A 3IKDA 5HKGA 5DITA 5HTGA 2KI3A 3UI4A 2XPBA 1D6OA 4TW6A 4C02B 4DRPA 1FKIA 2XP6A 3GPKA 5HW6A 2MNTA 3TCZA 3UQBA 2VN1A 1BL4A 4JFJA 4R0XA 1NMVA 1FAPA 1NSGA 1FKLA 1TCOC 2PV2A 5GPGA 1FKFA 4DRHA 2XP8A 4LAXA 4DZ2A 2ITKA 3MDYB 1QZ2A 5HW7A 3H9RB 5HT1A 1J6YA 4W9PA 2XPAA 4DRIA 2KO7A 4JYSA 3NTPA 2KR7A 1T11A
chains in the Genus database with same CATH superfamily
2RQSA 3CHDA 4QZVB 2F21A 3WL1A 4IQ2A 1EQ3A 1NWRA 1FKRA 1PBKA 2MPHA 2FAPA 4Z2KA 4U86A 3WD2A 4ODOA 3KAIA 1NWSA 2OLHA 1W1VA 3WD0A 3B7XA 2Y78A 2PV1A 1FKBA 3FY1A 2XP7A 2ZQSA 1Q6IA 4Z2JA 2MLYA 4P8UA 4JFKA 1LG1A 3O5KA 1GOIA 4PTMA 1E9LA 2DSWA 4HBEA 2MLXA 4G50A 3FAPA 4MAVA 2M1IA 4ZPWR 1ZU8A 1FKHA 2DT0A 3NI6A 1J4RA 5BXJA 1C9HA 1RD6A 2ZQVA 4LAVA 1F8AB 3RM4A 4R5EA 1E44A 1EDQA 1HKMA 1JNDA 2P4VA 3RM9A 3LUOA 2D9FA 1KFWA 4IT4A 3KAGA 1U79A 2PPPA 3O5DA 2UZ5A 1F40A 1W26A 2DT2A 4P8VA 4P8WA 1E15A 2Q5AA 5HBFA 1JNSA 3O5RA 1FFRA 1X6NA 1TFVA 4ZS6A 4DRQA 1L1PA 2A3EA 1NWUA 3O5EA 1ZL1A 2N87A 2O9OA 3ARVA 3ALFA 3O5PA 3WIJA 3IKGA 4XAKA 2DG4A 1JNEA 1KT1A 3RMEA 4HBOA 4KR0B 3AQUA 4DT4A 3WD3A 4ML4A 1FKIA 2XP6A 3UQBA 4R0XA 1TCOC 5GPGA 1FKFA 2B5UB 4Z2LA 1FKTA 2QF8A 4S3KA 4WKHA 3CGNA 3UQIA 3CHFA 1LL6A 4TYOA 3RGCA 4WIWA 2L2SA 3EIPA 1A7XA 3O5IA 2KFWA 4MPKA 5B8IC 3ARXA 3JYJA 2A3BA 4DIPA 2G41A 1NH6A 2DSUA 3UQAA 2PN0A 2F4EA 1Q1CA 2WLZA 3OA5A 4TNSA 3TC5A 4MNLA 1YW5A 2B31A 4LAWA 4Z2HA 2G8ZA 3FXYA 3O5FA 1ZBWA 4IT6A 1WNOA 4DRKA 4LGXA 3KADA 3WQWA 4MNJA 2DT1A 2RSEA 2FKEA 2JZVA 1QPLA 4IQCA 1W1YA 1NWTA 4U85A 1OGBA 1R9HA 5GPRA 1QPFA 3ARPA 2PPNA 2OFNA 4MSPA 1E6RA 1ZBCA 1E6PA 3O5JA 2K8IA 3KAHA 4TX0A 1HJVA 3O5QA 1SR0A 2FDMA 3O5LA 4ODQA 4FAPA 2EULA 4LAYA 4DRJA 2AOSA 2AWGA 4NNRA 3CHCA 3KABA 2LPVA 1H0IA 4ITZA 1LG2A 2PV3A 3QOKA 4Z2GA 3O5GA 1NMWA 3UI6A 1HJWA 2DG9A 4TW7A 4KQZA 2RURA 5DIUA 2KE0A 3ODKA 3WH0A 4WKAA 2KI3A 2XPBA 1D6OA 5HW6A 3B8SA 3GPKA 1O6IA 1BL4A 1FAPA 2XP8A 4DZ2A 5DF0A 1J6YA 3H9RB 4NZCA 4DRIA 1UR9A 1UR8A 2KO7A 3G6MA 3JYMA 3UI5A 2ESCA 3VAWA 3BXWA 3ARSA 5J6EA 1ZBKA 4MGVA 2ZQUA 1W9VA 4ODKA 1FKSA 3I6CA 2ZR4A 2IF4A 1EYMA 1H0GA 2VCDA 1HKKA 1FKKA 2PI6A 2WM0A 3TDBA 2KGJA 1W9PA 2YBUA 1E6ZA 3GTYX 4DRMA 4JFMA 1D2KA 2DSZA 1XRVA 1N1AA 3ARYA 4ZPVR 3ARWA 1HKJA 4WKFA 1JVWA 1FKJA 1HKIA 4ODMA 5JH8A 1P5QA 5HUAA 1JNTA 4ODNA 3PA7A 3PRDA 4DROA 1EIBA 5DIVA 2LJ4A 4J4OA 3AS1A 4DWSC 1SYTA 4DWSB 1KT0A 2RUDA 3ARZA 4W9OA 4WJXA 1EHNA 1LL4A 4QT3A 4GGQA 2PBCA 4TW8A 4IPXA 2DT3A 2DSVA 5HW8A 2MF9A 4QT2A 3PRAA 3PRBA 4WK9A 3B9AA 1GPFA 2DPEA 2ZR6A 3OOBA 1ZK6A 1LL7A 2LGOA 4JFLA 4MNMA 1FFQA 3GU0A 1ROTA 5DEZA 1LQ0A 4ZPTR 1K9TA 1Y0OA 3NRKA 2F2DA 4DH0A 4QIBA 2XP3A 2XP5A 3ARTA 3CZ8A 4N19A 1D7HA 1JCHB 3AS0A 4O2TA 4J4NA 3O5OA 3WD4A 5HWBA 4UDMA 3KCEA 2ETNA 2LKNA 4Z2IA 1Q6HA 2A3CA 3WQVA 4FN2A 1WAWA 5HTGA 3UI4A 4DRPA 3TCZA 2VN1A 1ITXA 1OWQA 4JFJA 5GQBA 1NSGA 2PV2A 4MTVA 4DRHA 1W1TA 4LAXA 1CTNA 3MDYB 1HJXA 2XPAA 3NTPA 3B9DA 3CHEA 4U84A 1ROUA 4Q22A 3JXVA 1IX5A 1D7JA 4ODLA 2F23A 1FD9A 1J4IA 2M2AA 3RM8A 1YATA 1FJDA 3EY6A 4S3JA 4W5UA 3IHZA 5HWCA 4L3NA 4BF8A 4GIVA 2RUQA 2PPOA 1X6LA 3KZ7A 5D75A 2O92A 2ZR5A 2YBTA 1ZCNA 3KAFA 4MNKA 3AS2A 4P8XA 1BKFA 1GUVA 1W1PA 3ALGA 4HARA 1B6CA 3O5MA 4ODRA 4ODPA 5I98A 3RFWA 4G2PA 2MLZA 3WL0A 4URIA 4DZ3A 1Q6UA 2DG3A 1HXVA 1M5YA 3B9EA 1J4HA 1W9UA 2WLYA 4L72B 5DO2A 3PR9A 3CGMA 3KACA 3UF8A 1XHGA 4JFIA 1FKGA 3W4RA 3IK8A 1VF8A 3BMBA 2XP4A 1E6NA 4W9QA 1D7IA 3WD1A 2XP9A 4DRNA 1ZBVA 4AY1A 2RUCA 1PINA 2M08A 2ZQTA 1WB0A 3G6LA 4NSBA 1OGGA 3ARUA 4Q7NA 1FKDA 2A3AA 3IKDA 5HKGA 1LJYA 3ARQA 5DITA 1GRJA 4DWSA 4TW6A 4C02B 2WK2A 2MNTA 2IUZA 1NMVA 1FKLA 3AS3A 3CH9A 3WKZA 2ITKA 5HW7A 1QZ2A 3ARRA 5HT1A 4W9PA 4JYSA 2KR7A 1ZB5A 4DWSD 1T11A 3AROA
chains in the Genus database with same CATH topology
2RQSA 3CHDA 4QZVB 2F21A 3WL1A 4IQ2A 1EQ3A 1NWRA 1FKRA 1PBKA 2MPHA 2FAPA 4Z2KA 4U86A 3WD2A 4ODOA 3KAIA 1NWSA 2OLHA 1W1VA 3WD0A 3B7XA 2Y78A 2PV1A 1FKBA 3FY1A 2XP7A 2ZQSA 1Q6IA 4Z2JA 2MLYA 4P8UA 4JFKA 1LG1A 3O5KA 1GOIA 4PTMA 1E9LA 2DSWA 4HBEA 2MLXA 4G50A 3FAPA 4MAVA 2M1IA 4ZPWR 1ZU8A 1FKHA 2DT0A 3NI6A 1J4RA 5BXJA 1C9HA 1RD6A 2ZQVA 4LAVA 1F8AB 3RM4A 4R5EA 1EDQA 1HKMA 1JNDA 3RM9A 3LUOA 2D9FA 1KFWA 4IT4A 3KAGA 1U79A 2PPPA 3O5DA 2UZ5A 1F40A 1W26A 2DT2A 4P8VA 4P8WA 1E15A 2Q5AA 5HBFA 1JNSA 1FFRA 1X6NA 3O5RA 1TFVA 4ZS6A 4DRQA 1L1PA 2A3EA 1NWUA 3O5EA 1ZL1A 2N87A 2O9OA 3ARVA 3ALFA 3O5PA 3WIJA 3IKGA 4XAKA 2DG4A 1JNEA 1KT1A 3RMEA 4HBOA 4KR0B 3AQUA 4DT4A 3WD3A 4ML4A 1FKIA 2XP6A 3UQBA 4R0XA 1TCOC 5GPGA 1FKFA 4Z2LA 1FKTA 2QF8A 4S3KA 4WKHA 3CGNA 3UQIA 3CHFA 1LL6A 4TYOA 3RGCA 4WIWA 2L2SA 1A7XA 3O5IA 2KFWA 4MPKA 5B8IC 3ARXA 3JYJA 2A3BA 4DIPA 2G41A 1NH6A 2DSUA 3UQAA 2F4EA 1Q1CA 2WLZA 3OA5A 4TNSA 3TC5A 4MNLA 1YW5A 2B31A 4LAWA 4Z2HA 2G8ZA 3FXYA 3O5FA 1ZBWA 4IT6A 1WNOA 4DRKA 4LGXA 3KADA 3WQWA 4MNJA 2DT1A 2RSEA 2FKEA 2JZVA 1QPLA 4IQCA 1W1YA 1NWTA 4U85A 1OGBA 1R9HA 5GPRA 1QPFA 3ARPA 2PPNA 2OFNA 4MSPA 1E6RA 1ZBCA 1E6PA 3O5JA 2K8IA 3KAHA 4TX0A 1HJVA 3O5QA 1SR0A 2FDMA 3O5LA 4ODQA 4FAPA 4LAYA 4DRJA 2AOSA 2AWGA 4NNRA 3CHCA 3KABA 2LPVA 1H0IA 4ITZA 1LG2A 2PV3A 3QOKA 4Z2GA 3O5GA 1NMWA 3UI6A 1HJWA 2DG9A 4TW7A 4KQZA 2RURA 5DIUA 2KE0A 3ODKA 3WH0A 4WKAA 2KI3A 2XPBA 1D6OA 5HW6A 3B8SA 3GPKA 1O6IA 1BL4A 1FAPA 2XP8A 4DZ2A 5DF0A 1J6YA 3H9RB 4NZCA 4DRIA 1UR9A 1UR8A 2KO7A 3G6MA 3JYMA 3UI5A 2ESCA 3VAWA 3BXWA 3ARSA 5J6EA 1ZBKA 4MGVA 2ZQUA 1W9VA 4ODKA 1FKSA 3I6CA 2ZR4A 2IF4A 1EYMA 1H0GA 2VCDA 1HKKA 1FKKA 2PI6A 2WM0A 3TDBA 2KGJA 1W9PA 2YBUA 1E6ZA 4DRMA 4JFMA 1D2KA 2DSZA 1XRVA 1N1AA 3ARYA 4ZPVR 3ARWA 1HKJA 4WKFA 1JVWA 1FKJA 1HKIA 4ODMA 5JH8A 1P5QA 5HUAA 1JNTA 4ODNA 3PA7A 3PRDA 4DROA 1EIBA 5DIVA 2LJ4A 4J4OA 3AS1A 4DWSC 1SYTA 4DWSB 1KT0A 2RUDA 3ARZA 4W9OA 4WJXA 1EHNA 1LL4A 4QT3A 4GGQA 2PBCA 4TW8A 4IPXA 2DT3A 2DSVA 5HW8A 2MF9A 4QT2A 3PRAA 3PRBA 4WK9A 3B9AA 1GPFA 2DPEA 2ZR6A 3OOBA 1ZK6A 1LL7A 2LGOA 4JFLA 4MNMA 1FFQA 1ROTA 5DEZA 1LQ0A 4ZPTR 1K9TA 1Y0OA 3NRKA 2F2DA 4DH0A 4QIBA 2XP3A 2XP5A 3ARTA 3CZ8A 4N19A 1D7HA 4O2TA 3AS0A 3WD4A 4J4NA 3O5OA 5HWBA 3KCEA 2LKNA 4Z2IA 1Q6HA 2A3CA 3WQVA 4FN2A 1WAWA 5HTGA 3UI4A 4DRPA 3TCZA 2VN1A 1ITXA 1OWQA 4JFJA 5GQBA 1NSGA 2PV2A 4MTVA 4DRHA 1W1TA 4LAXA 1CTNA 3MDYB 1HJXA 2XPAA 3NTPA 3B9DA 3CHEA 4U84A 1ROUA 4Q22A 3JXVA 1IX5A 1D7JA 4ODLA 1FD9A 1J4IA 2M2AA 3RM8A 1YATA 1FJDA 3EY6A 4S3JA 4W5UA 3IHZA 5HWCA 4L3NA 4BF8A 4GIVA 2RUQA 2PPOA 1X6LA 3KZ7A 5D75A 2O92A 2ZR5A 2YBTA 1ZCNA 3KAFA 4MNKA 3AS2A 4P8XA 1BKFA 1GUVA 1W1PA 3ALGA 4HARA 1B6CA 3O5MA 4ODRA 4ODPA 5I98A 3RFWA 4G2PA 2MLZA 3WL0A 4URIA 4DZ3A 1Q6UA 2DG3A 1HXVA 1M5YA 3B9EA 1J4HA 1W9UA 2WLYA 4L72B 5DO2A 3PR9A 3CGMA 3KACA 3UF8A 1XHGA 4JFIA 1FKGA 3W4RA 3IK8A 1VF8A 2XP4A 1E6NA 4W9QA 1D7IA 3WD1A 2XP9A 4DRNA 1ZBVA 4AY1A 2RUCA 1PINA 2M08A 2ZQTA 1WB0A 3G6LA 4NSBA 1OGGA 3ARUA 4Q7NA 1FKDA 2A3AA 3IKDA 5HKGA 1LJYA 3ARQA 5DITA 4DWSA 4TW6A 4C02B 2WK2A 2MNTA 2IUZA 1NMVA 1FKLA 3AS3A 3CH9A 3WKZA 2ITKA 5HW7A 1QZ2A 3ARRA 5HT1A 4W9PA 4JYSA 2KR7A 1ZB5A 4DWSD 1T11A 3AROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKT A;  3JYM A;  3UI5 A;  2RQS A;  4U84 A;  3VAW A;  1ROU A;  3CGN A;  2F21 A;  3UQI A;  4IQ2 A;  5J6E A;  4TYO A;  3JXV A;  3RGC A;  1EQ3 A;  4MGV A;  1FKR A;  1D7J A;  2ZQU A;  2L2S A;  4ODK A;  4ODL A;  1FKS A;  1PBK A;  2MPH A;  1FD9 A;  2FAP A;  1J4I A;  4U86 A;  2M2A A;  1A7X A;  3O5I A;  3I6C A;  2ZR4 A;  2KFW A;  1YAT A;  2IF4 A;  1EYM A;  2VCD A;  3EY6 A;  4ODO A;  1FJD A;  1FKK A;  3KAI A;  3TDB A;  2KGJ A;  3IHZ A;  5B8I C;  4DRM A;  3B7X A;  4JFM A;  5HWC A;  1N1A A;  4BF8 A;  4GIV A;  2Y78 A;  2PV1 A;  1JVW A;  1FKB A;  1FKJ A;  2RUQ A;  2XP7 A;  1Q6I A;  2ZQS A;  3JYJ A;  2PPO A;  4DIP A;  2MLY A;  4JFK A;  3KZ7 A;  5D75 A;  4ODM A;  3O5K A;  3UQA A;  2ZR5 A;  1P5Q A;  1ZCN A;  5HUA A;  1JNT A;  2F4E A;  2MLX A;  3PA7 A;  3PRD A;  1Q1C A;  3KAF A;  4G50 A;  4ODN A;  4DRO A;  3FAP A;  1BKF A;  5DIV A;  4TNS A;  2M1I A;  2LJ4 A;  3TC5 A;  1FKH A;  1YW5 A;  1B6C A;  3O5M A;  4LAW A;  4J4O A;  3NI6 A;  4ODR A;  4ODP A;  3O5F A;  1J4R A;  5BXJ A;  1C9H A;  5I98 A;  4DRK A;  3KAD A;  2ZQV A;  4LAV A;  2RSE A;  2FKE A;  1F8A B;  3RFW A;  4G2P A;  2MLZ A;  1KT0 A;  2JZV A;  1QPL A;  1Q6U A;  4DZ3 A;  2DG3 A;  1HXV A;  1M5Y A;  4IQC A;  2RUD A;  4W9O A;  3LUO A;  4U85 A;  1J4H A;  2D9F A;  4QT3 A;  1R9H A;  4GGQ A;  3KAG A;  2PBC A;  1QPF A;  1U79 A;  2PPP A;  2PPN A;  4TW8 A;  4IPX A;  3O5D A;  2OFN A;  4MSP A;  3O5J A;  4TX0 A;  3CGM A;  3KAC A;  2K8I A;  2UZ5 A;  3KAH A;  2MF9 A;  4QT2 A;  3O5Q A;  3UF8 A;  5HW8 A;  1F40 A;  1W26 A;  3PRB A;  4JFI A;  1FKG A;  3O5L A;  4ODQ A;  4FAP A;  2ZR6 A;  3IK8 A;  4LAY A;  4DRJ A;  3OOB A;  1ZK6 A;  2Q5A A;  2AWG A;  2LGO A;  3O5R A;  4JFL A;  4NNR A;  2XP4 A;  2LPV A;  3KAB A;  1JNS A;  1ROT A;  4DRQ A;  4W9Q A;  1L1P A;  4ITZ A;  1D7I A;  3NRK A;  1Y0O A;  3O5E A;  2N87 A;  2F2D A;  2PV3 A;  2XP9 A;  4DH0 A;  4QIB A;  4DRN A;  2XP3 A;  2XP5 A;  4N19 A;  3O5G A;  1D7H A;  3O5P A;  2RUC A;  1NMW A;  1PIN A;  4O2T A;  2M08 A;  3IKG A;  3O5O A;  2ZQT A;  4J4N A;  3UI6 A;  2DG9 A;  5HWB A;  4TW7 A;  2DG4 A;  1KT1 A;  2LKN A;  3KCE A;  1Q6H A;  2RUR A;  1FKD A;  5DIU A;  2KE0 A;  4FN2 A;  3ODK A;  3WH0 A;  4DT4 A;  3IKD A;  5HKG A;  5DIT A;  5HTG A;  2KI3 A;  3UI4 A;  2XPB A;  1D6O A;  4TW6 A;  4C02 B;  4DRP A;  1FKI A;  2XP6 A;  3GPK A;  5HW6 A;  2MNT A;  3TCZ A;  3UQB A;  2VN1 A;  1BL4 A;  4JFJ A;  4R0X A;  1NMV A;  1FAP A;  1NSG A;  1FKL A;  1TCO C;  2PV2 A;  5GPG A;  1FKF A;  4DRH A;  2XP8 A;  4LAX A;  4DZ2 A;  2ITK A;  3MDY B;  1QZ2 A;  5HW7 A;  3H9R B;  5HT1 A;  1J6Y A;  4W9P A;  2XPA A;  4DRI A;  2KO7 A;  4JYS A;  3NTP A;  2KR7 A;  1T11 A; 
#chains in the Genus database with same CATH topology
 2RQS A;  3CHD A;  4QZV B;  2F21 A;  3WL1 A;  4IQ2 A;  1EQ3 A;  1NWR A;  1FKR A;  1PBK A;  2MPH A;  2FAP A;  4Z2K A;  4U86 A;  3WD2 A;  4ODO A;  3KAI A;  1NWS A;  2OLH A;  1W1V A;  3WD0 A;  3B7X A;  2Y78 A;  2PV1 A;  1FKB A;  3FY1 A;  2XP7 A;  2ZQS A;  1Q6I A;  4Z2J A;  2MLY A;  4P8U A;  4JFK A;  1LG1 A;  3O5K A;  1GOI A;  4PTM A;  1E9L A;  2DSW A;  4HBE A;  2MLX A;  4G50 A;  3FAP A;  4MAV A;  2M1I A;  4ZPW R;  1ZU8 A;  1FKH A;  2DT0 A;  3NI6 A;  1J4R A;  5BXJ A;  1C9H A;  1RD6 A;  2ZQV A;  4LAV A;  1F8A B;  3RM4 A;  4R5E A;  1E44 A;  1EDQ A;  1HKM A;  1JND A;  2P4V A;  3RM9 A;  3LUO A;  2D9F A;  1KFW A;  4IT4 A;  3KAG A;  1U79 A;  2PPP A;  3O5D A;  2UZ5 A;  1F40 A;  1W26 A;  2DT2 A;  4P8V A;  4P8W A;  1E15 A;  2Q5A A;  5HBF A;  1JNS A;  3O5R A;  1FFR A;  1X6N A;  1TFV A;  4ZS6 A;  4DRQ A;  1L1P A;  2A3E A;  1NWU A;  3O5E A;  1ZL1 A;  2N87 A;  2O9O A;  3ARV A;  3ALF A;  3O5P A;  3WIJ A;  3IKG A;  4XAK A;  2DG4 A;  1JNE A;  1KT1 A;  3RME A;  4HBO A;  4KR0 B;  3AQU A;  4DT4 A;  3WD3 A;  4ML4 A;  1FKI A;  2XP6 A;  3UQB A;  4R0X A;  1TCO C;  5GPG A;  1FKF A;  2B5U B;  4Z2L A;  1FKT A;  2QF8 A;  4S3K A;  4WKH A;  3CGN A;  3UQI A;  3CHF A;  1LL6 A;  4TYO A;  3RGC A;  4WIW A;  2L2S A;  3EIP A;  1A7X A;  3O5I A;  2KFW A;  4MPK A;  5B8I C;  3ARX A;  3JYJ A;  2A3B A;  4DIP A;  2G41 A;  1NH6 A;  2DSU A;  3UQA A;  2PN0 A;  2F4E A;  1Q1C A;  2WLZ A;  3OA5 A;  4TNS A;  3TC5 A;  4MNL A;  1YW5 A;  2B31 A;  4LAW A;  4Z2H A;  2G8Z A;  3FXY A;  3O5F A;  1ZBW A;  4IT6 A;  1WNO A;  4DRK A;  4LGX A;  3KAD A;  3WQW A;  4MNJ A;  2DT1 A;  2RSE A;  2FKE A;  2JZV A;  1QPL A;  4IQC A;  1W1Y A;  1NWT A;  4U85 A;  1OGB A;  1R9H A;  5GPR A;  1QPF A;  3ARP A;  2PPN A;  2OFN A;  4MSP A;  1E6R A;  1ZBC A;  1E6P A;  3O5J A;  2K8I A;  3KAH A;  4TX0 A;  1HJV A;  3O5Q A;  1SR0 A;  2FDM A;  3O5L A;  4ODQ A;  4FAP A;  2EUL A;  4LAY A;  4DRJ A;  2AOS A;  2AWG A;  4NNR A;  3CHC A;  3KAB A;  2LPV A;  1H0I A;  4ITZ A;  1LG2 A;  2PV3 A;  3QOK A;  4Z2G A;  3O5G A;  1NMW A;  3UI6 A;  1HJW A;  2DG9 A;  4TW7 A;  4KQZ A;  2RUR A;  5DIU A;  2KE0 A;  3ODK A;  3WH0 A;  4WKA A;  2KI3 A;  2XPB A;  1D6O A;  5HW6 A;  3B8S A;  3GPK A;  1O6I A;  1BL4 A;  1FAP A;  2XP8 A;  4DZ2 A;  5DF0 A;  1J6Y A;  3H9R B;  4NZC A;  4DRI A;  1UR9 A;  1UR8 A;  2KO7 A;  3G6M A;  3JYM A;  3UI5 A;  2ESC A;  3VAW A;  3BXW A;  3ARS A;  5J6E A;  1ZBK A;  4MGV A;  2ZQU A;  1W9V A;  4ODK A;  1FKS A;  3I6C A;  2ZR4 A;  2IF4 A;  1EYM A;  1H0G A;  2VCD A;  1HKK A;  1FKK A;  2PI6 A;  2WM0 A;  3TDB A;  2KGJ A;  1W9P A;  2YBU A;  1E6Z A;  3GTY X;  4DRM A;  4JFM A;  1D2K A;  2DSZ A;  1XRV A;  1N1A A;  3ARY A;  4ZPV R;  3ARW A;  1HKJ A;  4WKF A;  1JVW A;  1FKJ A;  1HKI A;  4ODM A;  5JH8 A;  1P5Q A;  5HUA A;  1JNT A;  4ODN A;  3PA7 A;  3PRD A;  4DRO A;  1EIB A;  5DIV A;  2LJ4 A;  4J4O A;  3AS1 A;  4DWS C;  1SYT A;  4DWS B;  1KT0 A;  2RUD A;  3ARZ A;  4W9O A;  4WJX A;  1EHN A;  1LL4 A;  4QT3 A;  4GGQ A;  2PBC A;  4TW8 A;  4IPX A;  2DT3 A;  2DSV A;  5HW8 A;  2MF9 A;  4QT2 A;  3PRA A;  3PRB A;  4WK9 A;  3B9A A;  1GPF A;  2DPE A;  2ZR6 A;  3OOB A;  1ZK6 A;  1LL7 A;  2LGO A;  4JFL A;  4MNM A;  1FFQ A;  3GU0 A;  1ROT A;  5DEZ A;  1LQ0 A;  4ZPT R;  1K9T A;  1Y0O A;  3NRK A;  2F2D A;  4DH0 A;  4QIB A;  2XP3 A;  2XP5 A;  3ART A;  3CZ8 A;  4N19 A;  1D7H A;  1JCH B;  3AS0 A;  4O2T A;  4J4N A;  3O5O A;  3WD4 A;  5HWB A;  4UDM A;  3KCE A;  2ETN A;  2LKN A;  4Z2I A;  1Q6H A;  2A3C A;  3WQV A;  4FN2 A;  1WAW A;  5HTG A;  3UI4 A;  4DRP A;  3TCZ A;  2VN1 A;  1ITX A;  1OWQ A;  4JFJ A;  5GQB A;  1NSG A;  2PV2 A;  4MTV A;  4DRH A;  1W1T A;  4LAX A;  1CTN A;  3MDY B;  1HJX A;  2XPA A;  3NTP A;  3B9D A;  3CHE A;  4U84 A;  1ROU A;  4Q22 A;  3JXV A;  1IX5 A;  1D7J A;  4ODL A;  2F23 A;  1FD9 A;  1J4I A;  2M2A A;  3RM8 A;  1YAT A;  1FJD A;  3EY6 A;  4S3J A;  4W5U A;  3IHZ A;  5HWC A;  4L3N A;  4BF8 A;  4GIV A;  2RUQ A;  2PPO A;  1X6L A;  3KZ7 A;  5D75 A;  2O92 A;  2ZR5 A;  2YBT A;  1ZCN A;  3KAF A;  4MNK A;  3AS2 A;  4P8X A;  1BKF A;  1GUV A;  1W1P A;  3ALG A;  4HAR A;  1B6C A;  3O5M A;  4ODR A;  4ODP A;  5I98 A;  3RFW A;  4G2P A;  2MLZ A;  3WL0 A;  4URI A;  4DZ3 A;  1Q6U A;  2DG3 A;  1HXV A;  1M5Y A;  3B9E A;  1J4H A;  1W9U A;  2WLY A;  4L72 B;  5DO2 A;  3PR9 A;  3CGM A;  3KAC A;  3UF8 A;  1XHG A;  4JFI A;  1FKG A;  3W4R A;  3IK8 A;  1VF8 A;  3BMB A;  2XP4 A;  1E6N A;  4W9Q A;  1D7I A;  3WD1 A;  2XP9 A;  4DRN A;  1ZBV A;  4AY1 A;  2RUC A;  1PIN A;  2M08 A;  2ZQT A;  1WB0 A;  3G6L A;  4NSB A;  1OGG A;  3ARU A;  4Q7N A;  1FKD A;  2A3A A;  3IKD A;  5HKG A;  1LJY A;  3ARQ A;  5DIT A;  1GRJ A;  4DWS A;  4TW6 A;  4C02 B;  2WK2 A;  2MNT A;  2IUZ A;  1NMV A;  1FKL A;  3AS3 A;  3CH9 A;  3WKZ A;  2ITK A;  5HW7 A;  1QZ2 A;  3ARR A;  5HT1 A;  4W9P A;  4JYS A;  2KR7 A;  1ZB5 A;  4DWS D;  1T11 A;  3ARO A; 
#chains in the Genus database with same CATH homology
 2RQS A;  3CHD A;  4QZV B;  2F21 A;  3WL1 A;  4IQ2 A;  1EQ3 A;  1NWR A;  1FKR A;  1PBK A;  2MPH A;  2FAP A;  4Z2K A;  4U86 A;  3WD2 A;  4ODO A;  3KAI A;  1NWS A;  2OLH A;  1W1V A;  3WD0 A;  3B7X A;  2Y78 A;  2PV1 A;  1FKB A;  3FY1 A;  2XP7 A;  2ZQS A;  1Q6I A;  4Z2J A;  2MLY A;  4P8U A;  4JFK A;  1LG1 A;  3O5K A;  1GOI A;  4PTM A;  1E9L A;  2DSW A;  4HBE A;  2MLX A;  4G50 A;  3FAP A;  4MAV A;  2M1I A;  4ZPW R;  1ZU8 A;  1FKH A;  2DT0 A;  3NI6 A;  1J4R A;  5BXJ A;  1C9H A;  1RD6 A;  2ZQV A;  4LAV A;  1F8A B;  3RM4 A;  4R5E A;  1EDQ A;  1HKM A;  1JND A;  3RM9 A;  3LUO A;  2D9F A;  1KFW A;  4IT4 A;  3KAG A;  1U79 A;  2PPP A;  3O5D A;  2UZ5 A;  1F40 A;  1W26 A;  2DT2 A;  4P8V A;  4P8W A;  1E15 A;  2Q5A A;  5HBF A;  1JNS A;  1FFR A;  1X6N A;  3O5R A;  1TFV A;  4ZS6 A;  4DRQ A;  1L1P A;  2A3E A;  1NWU A;  3O5E A;  1ZL1 A;  2N87 A;  2O9O A;  3ARV A;  3ALF A;  3O5P A;  3WIJ A;  3IKG A;  4XAK A;  2DG4 A;  1JNE A;  1KT1 A;  3RME A;  4HBO A;  4KR0 B;  3AQU A;  4DT4 A;  3WD3 A;  4ML4 A;  1FKI A;  2XP6 A;  3UQB A;  4R0X A;  1TCO C;  5GPG A;  1FKF A;  4Z2L A;  1FKT A;  2QF8 A;  4S3K A;  4WKH A;  3CGN A;  3UQI A;  3CHF A;  1LL6 A;  4TYO A;  3RGC A;  4WIW A;  2L2S A;  1A7X A;  3O5I A;  2KFW A;  4MPK A;  5B8I C;  3ARX A;  3JYJ A;  2A3B A;  4DIP A;  2G41 A;  1NH6 A;  2DSU A;  3UQA A;  2F4E A;  1Q1C A;  2WLZ A;  3OA5 A;  4TNS A;  3TC5 A;  4MNL A;  1YW5 A;  2B31 A;  4LAW A;  4Z2H A;  2G8Z A;  3FXY A;  3O5F A;  1ZBW A;  4IT6 A;  1WNO A;  4DRK A;  4LGX A;  3KAD A;  3WQW A;  4MNJ A;  2DT1 A;  2RSE A;  2FKE A;  2JZV A;  1QPL A;  4IQC A;  1W1Y A;  1NWT A;  4U85 A;  1OGB A;  1R9H A;  5GPR A;  1QPF A;  3ARP A;  2PPN A;  2OFN A;  4MSP A;  1E6R A;  1ZBC A;  1E6P A;  3O5J A;  2K8I A;  3KAH A;  4TX0 A;  1HJV A;  3O5Q A;  1SR0 A;  2FDM A;  3O5L A;  4ODQ A;  4FAP A;  4LAY A;  4DRJ A;  2AOS A;  2AWG A;  4NNR A;  3CHC A;  3KAB A;  2LPV A;  1H0I A;  4ITZ A;  1LG2 A;  2PV3 A;  3QOK A;  4Z2G A;  3O5G A;  1NMW A;  3UI6 A;  1HJW A;  2DG9 A;  4TW7 A;  4KQZ A;  2RUR A;  5DIU A;  2KE0 A;  3ODK A;  3WH0 A;  4WKA A;  2KI3 A;  2XPB A;  1D6O A;  5HW6 A;  3B8S A;  3GPK A;  1O6I A;  1BL4 A;  1FAP A;  2XP8 A;  4DZ2 A;  5DF0 A;  1J6Y A;  3H9R B;  4NZC A;  4DRI A;  1UR9 A;  1UR8 A;  2KO7 A;  3G6M A;  3JYM A;  3UI5 A;  2ESC A;  3VAW A;  3BXW A;  3ARS A;  5J6E A;  1ZBK A;  4MGV A;  2ZQU A;  1W9V A;  4ODK A;  1FKS A;  3I6C A;  2ZR4 A;  2IF4 A;  1EYM A;  1H0G A;  2VCD A;  1HKK A;  1FKK A;  2PI6 A;  2WM0 A;  3TDB A;  2KGJ A;  1W9P A;  2YBU A;  1E6Z A;  4DRM A;  4JFM A;  1D2K A;  2DSZ A;  1XRV A;  1N1A A;  3ARY A;  4ZPV R;  3ARW A;  1HKJ A;  4WKF A;  1JVW A;  1FKJ A;  1HKI A;  4ODM A;  5JH8 A;  1P5Q A;  5HUA A;  1JNT A;  4ODN A;  3PA7 A;  3PRD A;  4DRO A;  1EIB A;  5DIV A;  2LJ4 A;  4J4O A;  3AS1 A;  4DWS C;  1SYT A;  4DWS B;  1KT0 A;  2RUD A;  3ARZ A;  4W9O A;  4WJX A;  1EHN A;  1LL4 A;  4QT3 A;  4GGQ A;  2PBC A;  4TW8 A;  4IPX A;  2DT3 A;  2DSV A;  5HW8 A;  2MF9 A;  4QT2 A;  3PRA A;  3PRB A;  4WK9 A;  3B9A A;  1GPF A;  2DPE A;  2ZR6 A;  3OOB A;  1ZK6 A;  1LL7 A;  2LGO A;  4JFL A;  4MNM A;  1FFQ A;  1ROT A;  5DEZ A;  1LQ0 A;  4ZPT R;  1K9T A;  1Y0O A;  3NRK A;  2F2D A;  4DH0 A;  4QIB A;  2XP3 A;  2XP5 A;  3ART A;  3CZ8 A;  4N19 A;  1D7H A;  4O2T A;  3AS0 A;  3WD4 A;  4J4N A;  3O5O A;  5HWB A;  3KCE A;  2LKN A;  4Z2I A;  1Q6H A;  2A3C A;  3WQV A;  4FN2 A;  1WAW A;  5HTG A;  3UI4 A;  4DRP A;  3TCZ A;  2VN1 A;  1ITX A;  1OWQ A;  4JFJ A;  5GQB A;  1NSG A;  2PV2 A;  4MTV A;  4DRH A;  1W1T A;  4LAX A;  1CTN A;  3MDY B;  1HJX A;  2XPA A;  3NTP A;  3B9D A;  3CHE A;  4U84 A;  1ROU A;  4Q22 A;  3JXV A;  1IX5 A;  1D7J A;  4ODL A;  1FD9 A;  1J4I A;  2M2A A;  3RM8 A;  1YAT A;  1FJD A;  3EY6 A;  4S3J A;  4W5U A;  3IHZ A;  5HWC A;  4L3N A;  4BF8 A;  4GIV A;  2RUQ A;  2PPO A;  1X6L A;  3KZ7 A;  5D75 A;  2O92 A;  2ZR5 A;  2YBT A;  1ZCN A;  3KAF A;  4MNK A;  3AS2 A;  4P8X A;  1BKF A;  1GUV A;  1W1P A;  3ALG A;  4HAR A;  1B6C A;  3O5M A;  4ODR A;  4ODP A;  5I98 A;  3RFW A;  4G2P A;  2MLZ A;  3WL0 A;  4URI A;  4DZ3 A;  1Q6U A;  2DG3 A;  1HXV A;  1M5Y A;  3B9E A;  1J4H A;  1W9U A;  2WLY A;  4L72 B;  5DO2 A;  3PR9 A;  3CGM A;  3KAC A;  3UF8 A;  1XHG A;  4JFI A;  1FKG A;  3W4R A;  3IK8 A;  1VF8 A;  2XP4 A;  1E6N A;  4W9Q A;  1D7I A;  3WD1 A;  2XP9 A;  4DRN A;  1ZBV A;  4AY1 A;  2RUC A;  1PIN A;  2M08 A;  2ZQT A;  1WB0 A;  3G6L A;  4NSB A;  1OGG A;  3ARU A;  4Q7N A;  1FKD A;  2A3A A;  3IKD A;  5HKG A;  1LJY A;  3ARQ A;  5DIT A;  4DWS A;  4TW6 A;  4C02 B;  2WK2 A;  2MNT A;  2IUZ A;  1NMV A;  1FKL A;  3AS3 A;  3CH9 A;  3WKZ A;  2ITK A;  5HW7 A;  1QZ2 A;  3ARR A;  5HT1 A;  4W9P A;  4JYS A;  2KR7 A;  1ZB5 A;  4DWS D;  1T11 A;  3ARO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...