1EYMA

Fk506 binding protein mutant, homodimeric complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKMDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A ligand-reversible dimerization system for controlling protein-protein interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords FK506 BINDING PROTEIN
total genus 27
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2000-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1eymA00
1KT0A 3UQBA 4JFMA 4U84A 2ZR6A 4R0XA 5DITA 1HXVA 2RURA 2M08A 4TX0A 4DRIA 4JFJA 4JYSA 2XP7A 4TYOA 4TW7A 1JNTA 2MF9A 2RSEA 2ZQTA 3WH0A 1NMWA 1J4RA 2OFNA 2F2DA 1Q6HA 1FKHA 4G50A 3KABA 1M5YA 1R9HA 2LPVA 2ZQSA 4TNSA 3O5EA 2KE0A 3FAPA 3NTPA 5HTGA 1YW5A 3H9RB 3TC5A 2XP9A 3NI6A 4DZ3A 1ROUA 3JYJA 3KCEA 3NRKA 3GPKA 1J4IA 4GGQA 4QIBA 2AWGA 2DG4A 3UI4A 1T11A 2LKNA 2PV1A 1FKLA 1Q6UA 1BL4A 1D7HA 1NSGA 1FAPA 2XP4A 5D75A 4DH0A 3ODKA 2PV2A 4JFIA 4ODPA 1QZ2A 4DIPA 3EY6A 4MSPA 2FKEA 1J4HA 4ODRA 4J4OA 2DG9A 1J6YA 3RFWA 2Q5AA 3PRBA 5HW8A 1YATA 1C9HA 5B8IC 3O5JA 3UQAA 4U86A 3O5OA 2PPPA 1W26A 3I6CA 3IKDA 3UI6A 3TDBA 5HUAA 5DIUA 3KAHA 2MPHA 3O5IA 2RUDA 3O5DA 4DRKA 3JXVA 2Y78A 2ITKA 3UF8A 4DRNA 3IKGA 3PA7A 2XP6A 2VCDA 1Q1CA 2KGJA 1FKSA 1FJDA 1ROTA 2XP8A 3KZ7A 1ZCNA 2XP3A 2XP5A 2MNTA 4ODMA 5GPGA 2F4EA 1B6CA 4ODOA 2LJ4A 1D7IA 3O5QA 4FN2A 3KACA 4ODQA 1KT1A 3O5LA 4ODKA 4W9OA 5HW6A 3B7XA 1Q6IA 2MLXA 4QT2A 3O5FA 2F21A 1FKRA 2JZVA 3PRDA 3KAFA 2K8IA 4ITZA 4JFLA 2PPNA 2XPBA 1FKJA 2IF4A 2L2SA 1PINA 1D6OA 4W9QA 2ZQVA 1FKDA 1FKIA 4G2PA 4ODLA 5DIVA 3IK8A 3O5RA 4W9PA 1A7XA 2RQSA 4DRHA 3MDYB 3RGCA 4O2TA 2RUQA 3O5GA 5HW7A 5HKGA 4DZ2A 2UZ5A 1Y0OA 1FKTA 4BF8A 2N87A 3CGMA 4DT4A 1U79A 2M2AA 1P5QA 1FD9A 2MLZA 1PBKA 2M1IA 1FKKA 2PPOA 3IHZA 4TW6A 4DRMA 4JFKA 2VN1A 4J4NA 2LGOA 1L1PA 1QPLA 3UI5A 5HWBA 2KI3A 2MLYA 4LAWA 5J6EA 3KAGA 4LAYA 4LAXA 3JYMA 1EQ3A 3KAIA 1FKGA 5BXJA 3O5PA 4DRPA 1F8AB 2XPAA 4IQCA 3CGNA 3TCZA 2KO7A 2D9FA 2ZQUA 1TCOC 2ZR4A 3LUOA 4LAVA 3O5MA 4TW8A 2RUCA 4IPXA 4DROA 1FKBA 2KR7A 3VAWA 3UQIA 1N1AA 2ZR5A 2PV3A 3OOBA 4IQ2A 4DRQA 2PBCA 1F40A 4FAPA 5I98A 1JVWA 4C02B 1FKFA 2DG3A 1EYMA 4MGVA 4N19A 4U85A 4GIVA 2KFWA 4QT3A 3O5KA 4DRJA 2FAPA 3KADA 1QPFA 4ODNA 5HWCA 1BKFA 1NMVA 1JNSA 4NNRA 5HT1A 1ZK6A 1D7JA
chains in the Genus database with same CATH superfamily
3UQBA 4JFMA 3WD0A 2RURA 1JNEA 2M08A 3CH9A 4MNLA 4TX0A 4JYSA 2O92A 1HKIA 1NMWA 2OFNA 3CHDA 4DWSA 1Q6HA 1FKHA 3KABA 1R9HA 4IT4A 3O5EA 4UDMA 2XP9A 1JNDA 3NI6A 4DZ3A 1ROUA 2PV1A 1FKLA 4MAVA 5D75A 4ZPTR 1GPFA 4DWSB 1HKMA 1WAWA 5HW8A 1WNOA 1FFRA 4L3NA 5B8IC 3UQAA 3AS2A 1LL6A 5HUAA 3WD3A 3KAHA 1FFQA 2ITKA 1UR9A 4HARA 3IKGA 2XP6A 2VCDA 1FJDA 1FKSA 3ARPA 1K9TA 4ODMA 5DEZA 5GPGA 2F4EA 3OA5A 3PR9A 4ODOA 4ODQA 4P8VA 4MTVA 4W9OA 4AY1A 3AQUA 1FKRA 5HBFA 4Q22A 1OGGA 1FKJA 2IF4A 2L2SA 1FKIA 3FXYA 1E6RA 4DWSC 3PRAA 2RQSA 4O2TA 2RUQA 1NWSA 3ALGA 3O5GA 3WL1A 3CGMA 1U79A 2M2AA 1W1TA 2DSZA 1FD9A 1E44A 1FKKA 2PPOA 3IHZA 3WIJA 1SYTA 2VN1A 3B9EA 4LAYA 4LAXA 1EQ3A 4DRPA 2DT0A 1TCOC 1LG2A 4TW8A 4IPXA 4DROA 2KR7A 3VAWA 3UQIA 2PV3A 3G6MA 4ZPVR 3RM9A 1KFWA 1FKFA 3CZ8A 4MGVA 3BXWA 3WD4A 4DRJA 2FAPA 4ODNA 1CTNA 2DPEA 2DSWA 5DITA 2DT3A 3ALFA 1HXVA 4ML4A 4R5EA 4DRIA 1O6IA 3CHCA 2MF9A 4ZPWR 1J4RA 4QZVB 2F2DA 4G50A 4TNSA 5HTGA 4L72B 3H9RB 3AROA 3ARUA 3JYJA 4GGQA 1HJVA 4S3KA 4WKHA 1BL4A 2XP4A 4IT6A 4DH0A 3ARXA 4S3JA 3EY6A 1ZU8A 4ODRA 3ARYA 2DG9A 1J6YA 3RFWA 2PI6A 3RMEA 1C9HA 4PTMA 2PPPA 3IKDA 3I6CA 3TDBA 3CHFA 4Z2HA 2MPHA 2B5UB 3O5DA 3JXVA 3UF8A 1NWRA 3AS1A 1ROTA 2XP8A 3KZ7A 1W1VA 2XP3A 2XP5A 2MNTA 1RD6A 1ZBKA 1D7IA 2LJ4A 3ARRA 3KACA 4P8WA 4Z2JA 2G8ZA 4P8UA 4KR0B 5DO2A 3KAFA 2K8IA 3WQWA 2XPBA 5DF0A 1PINA 4HBEA 4W9QA 2ZQVA 2WK2A 1FKDA 4G2PA 3ARSA 1VF8A 3IK8A 4Q7NA 4WKFA 1W1YA 5HW7A 1WB0A 1UR8A 3RM4A 2UZ5A 4XAKA 1FKTA 2MLZA 5JH8A 4DRMA 4TW6A 4J4NA 1L1PA 3EIPA 2KI3A 2B31A 5GPRA 1LJYA 1ZL1A 2F23A 1F8AB 1D2KA 1W9PA 2D9FA 2WLZA 2ZQUA 2ZR4A 2ETNA 4LAVA 3BMBA 2ZR5A 3OOBA 4DRQA 4FAPA 5I98A 1JVWA 2DG3A 1EYMA 3B8SA 2DSUA 3GTYX 1GUVA 5HWCA 1XHGA 1JNSA 4MPKA 5HT1A 1ZK6A 1P5QA 4U84A 4JFJA 4TYOA 2XP7A 2ZQTA 1LL4A 1W9VA 1M5YA 3NTPA 3KCEA 3WL0A 3GPKA 4QIBA 2DG4A 1T11A 2LKNA 1Q6UA 1ZBVA 1D7HA 1FAPA 1OWQA 1QZ2A 2FKEA 1OGBA 1YATA 1HKJA 1E6ZA 3GU0A 3O5JA 4U86A 3UI6A 4KQZA 3O5IA 2RUDA 2Y78A 3PA7A 1Q1CA 2KGJA 4LGXA 1ZCNA 1E15A 2WLYA 3O5QA 1KT1A 4ODKA 1Q6IA 4QT2A 4HBOA 2F21A 1H0IA 2FDMA 4Z2LA 2JZVA 4ITZA 1EDQA 4Z2IA 1D6OA 2DSVA 4ODLA 5DIVA 4Z2KA 1W9UA 3O5RA 4W9PA 2A3AA 3MDYB 4WK9A 2AOSA 3WD2A 1HJWA 2WM0A 2ESCA 1ZBWA 1ZBCA 3CHEA 4MNMA 1JCHB 1W1PA 1QPLA 2A3CA 1HJXA 5HWBA 3JYMA 2DT2A 3KAIA 1FKGA 3W4RA 5BXJA 2XPAA 4IQCA 3TCZA 1LQ0A 2KO7A 3QOKA 3LUOA 3O5MA 2RUCA 1X6NA 1IX5A 2A3BA 1N1AA 1F40A 3ARZA 2PBCA 4U85A 2YBUA 1HKKA 1TFVA 3O5KA 3KADA 2QF8A 1QPFA 4NSBA 3AS0A 1XRVA 2DT1A 2P4VA 4Z2GA 4C02B 1D7JA 1KT0A 3ARWA 4WJXA 2ZR6A 4R0XA 1EHNA 1H0GA 4TW7A 1JNTA 1GOIA 2RSEA 3WH0A 2O9OA 3WD1A 2LPVA 2ZQSA 3WKZA 2KE0A 3FAPA 3ARVA 1YW5A 3G6LA 4ZS6A 3TC5A 1ITXA 3NRKA 1J4IA 3UI4A 2AWGA 1NSGA 3ODKA 2PV2A 4JFIA 4ODPA 4DIPA 4MSPA 1J4HA 4J4OA 2PN0A 1LG1A 2Q5AA 3PRBA 3O5OA 1SR0A 1W26A 2OLHA 2EULA 5DIUA 1E6NA 4DWSD 4DRKA 4P8XA 2YBTA 1E9LA 4DRNA 5GQBA 2G41A 1ZB5A 4NZCA 1B6CA 4FN2A 3O5LA 5HW6A 3B7XA 2MLXA 3O5FA 3B9DA 4URIA 3PRDA 4JFLA 2PPNA 1X6LA 4WIWA 2A3EA 1A7XA 4DRHA 3RGCA 5HKGA 4DZ2A 1LL7A 1Y0OA 4BF8A 3WQVA 2N87A 4DT4A 1EIBA 1PBKA 2M1IA 3AS3A 4JFKA 4W5UA 2LGOA 1E6PA 3UI5A 1NWTA 2MLYA 4LAWA 5J6EA 3KAGA 4MNJA 1NH6A 3O5PA 4WKAA 3ARQA 3CGNA 4MNKA 1FKBA 3FY1A 1GRJA 4IQ2A 3B9AA 1NWUA 4N19A 4GIVA 2KFWA 4QT3A 3ARTA 3RM8A 2IUZA 1BKFA 1NMVA 4NNRA
chains in the Genus database with same CATH topology
3UQBA 4JFMA 3WD0A 2RURA 1JNEA 2M08A 3CH9A 4MNLA 4TX0A 4JYSA 2O92A 1HKIA 1NMWA 2OFNA 3CHDA 4DWSA 1Q6HA 1FKHA 3KABA 1R9HA 4IT4A 3O5EA 2XP9A 1JNDA 3NI6A 4DZ3A 1ROUA 2PV1A 1FKLA 4MAVA 5D75A 4ZPTR 1GPFA 4DWSB 1HKMA 1WAWA 5HW8A 1WNOA 1FFRA 4L3NA 5B8IC 3UQAA 3AS2A 1LL6A 5HUAA 3WD3A 3KAHA 1FFQA 2ITKA 1UR9A 4HARA 3IKGA 2XP6A 2VCDA 1FJDA 1FKSA 3ARPA 1K9TA 4ODMA 5DEZA 5GPGA 2F4EA 3OA5A 3PR9A 4ODOA 4ODQA 4P8VA 4MTVA 4W9OA 4AY1A 3AQUA 1FKRA 5HBFA 4Q22A 1OGGA 1FKJA 2IF4A 2L2SA 1FKIA 3FXYA 1E6RA 4DWSC 3PRAA 2RQSA 4O2TA 2RUQA 1NWSA 3ALGA 3O5GA 3WL1A 3CGMA 1U79A 2M2AA 1W1TA 2DSZA 1FD9A 1FKKA 2PPOA 3IHZA 3WIJA 1SYTA 2VN1A 3B9EA 4LAYA 4LAXA 1EQ3A 4DRPA 2DT0A 1TCOC 1LG2A 4TW8A 4IPXA 4DROA 2KR7A 3VAWA 3UQIA 2PV3A 3G6MA 4ZPVR 3RM9A 1KFWA 1FKFA 3CZ8A 4MGVA 3BXWA 3WD4A 4DRJA 2FAPA 4ODNA 1CTNA 2DPEA 2DSWA 5DITA 2DT3A 3ALFA 1HXVA 4ML4A 4R5EA 4DRIA 1O6IA 3CHCA 2MF9A 4ZPWR 1J4RA 4QZVB 2F2DA 4G50A 4TNSA 5HTGA 4L72B 3H9RB 3AROA 3ARUA 3JYJA 4GGQA 1HJVA 4S3KA 4WKHA 1BL4A 2XP4A 4IT6A 4DH0A 3ARXA 4S3JA 3EY6A 1ZU8A 4ODRA 3ARYA 2DG9A 1J6YA 3RFWA 2PI6A 3RMEA 1C9HA 4PTMA 2PPPA 3IKDA 3I6CA 3TDBA 3CHFA 4Z2HA 2MPHA 3O5DA 3JXVA 3UF8A 1NWRA 3AS1A 1ROTA 2XP8A 3KZ7A 1W1VA 2XP3A 2XP5A 2MNTA 1RD6A 1ZBKA 1D7IA 2LJ4A 3ARRA 3KACA 4P8WA 4Z2JA 2G8ZA 4P8UA 4KR0B 5DO2A 3KAFA 2K8IA 3WQWA 2XPBA 5DF0A 1PINA 4HBEA 4W9QA 2ZQVA 2WK2A 1FKDA 4G2PA 3ARSA 1VF8A 3IK8A 4Q7NA 4WKFA 1W1YA 5HW7A 1WB0A 1UR8A 3RM4A 2UZ5A 4XAKA 1FKTA 2MLZA 5JH8A 4DRMA 4TW6A 4J4NA 1L1PA 2KI3A 2B31A 5GPRA 1LJYA 1ZL1A 1F8AB 1D2KA 1W9PA 2D9FA 2WLZA 2ZQUA 2ZR4A 4LAVA 2ZR5A 3OOBA 4DRQA 4FAPA 5I98A 1JVWA 2DG3A 1EYMA 3B8SA 2DSUA 1GUVA 5HWCA 1XHGA 1JNSA 4MPKA 5HT1A 1ZK6A 1P5QA 4U84A 4JFJA 4TYOA 2XP7A 2ZQTA 1LL4A 1W9VA 1M5YA 3NTPA 3KCEA 3WL0A 3GPKA 4QIBA 2DG4A 1T11A 2LKNA 1Q6UA 1ZBVA 1D7HA 1FAPA 1OWQA 1QZ2A 2FKEA 1OGBA 1YATA 1HKJA 1E6ZA 3O5JA 4U86A 3UI6A 4KQZA 3O5IA 2RUDA 2Y78A 3PA7A 1Q1CA 2KGJA 4LGXA 1ZCNA 1E15A 2WLYA 3O5QA 1KT1A 4ODKA 1Q6IA 4QT2A 4HBOA 2F21A 1H0IA 2FDMA 4Z2LA 2JZVA 4ITZA 1EDQA 4Z2IA 1D6OA 2DSVA 4ODLA 5DIVA 4Z2KA 1W9UA 3O5RA 4W9PA 2A3AA 3MDYB 4WK9A 2AOSA 3WD2A 1HJWA 2WM0A 2ESCA 1ZBWA 1ZBCA 3CHEA 4MNMA 1W1PA 1QPLA 2A3CA 1HJXA 5HWBA 3JYMA 2DT2A 3KAIA 1FKGA 3W4RA 5BXJA 2XPAA 4IQCA 3TCZA 1LQ0A 2KO7A 3QOKA 3LUOA 3O5MA 2RUCA 1X6NA 1IX5A 2A3BA 1N1AA 1F40A 3ARZA 2PBCA 4U85A 2YBUA 1HKKA 1TFVA 3O5KA 3KADA 2QF8A 1QPFA 4NSBA 3AS0A 1XRVA 2DT1A 4Z2GA 4C02B 1D7JA 1KT0A 3ARWA 4WJXA 2ZR6A 4R0XA 1EHNA 1H0GA 4TW7A 1JNTA 1GOIA 2RSEA 3WH0A 2O9OA 3WD1A 2LPVA 2ZQSA 3WKZA 2KE0A 3FAPA 3ARVA 1YW5A 3G6LA 4ZS6A 3TC5A 1ITXA 3NRKA 1J4IA 3UI4A 2AWGA 1NSGA 3ODKA 2PV2A 4JFIA 4ODPA 4DIPA 4MSPA 1J4HA 4J4OA 1LG1A 2Q5AA 3PRBA 1SR0A 3O5OA 1W26A 2OLHA 5DIUA 1E6NA 4DWSD 4DRKA 4P8XA 2YBTA 1E9LA 4DRNA 5GQBA 2G41A 1ZB5A 4NZCA 1B6CA 4FN2A 3O5LA 5HW6A 3B7XA 2MLXA 3O5FA 3B9DA 4URIA 3PRDA 4JFLA 2PPNA 1X6LA 4WIWA 2A3EA 1A7XA 4DRHA 3RGCA 5HKGA 4DZ2A 1LL7A 1Y0OA 4BF8A 3WQVA 2N87A 4DT4A 1EIBA 1PBKA 2M1IA 3AS3A 4JFKA 4W5UA 2LGOA 1E6PA 3UI5A 1NWTA 2MLYA 4LAWA 5J6EA 3KAGA 4MNJA 1NH6A 3O5PA 4WKAA 3ARQA 3CGNA 4MNKA 1FKBA 3FY1A 4IQ2A 3B9AA 1NWUA 4N19A 4GIVA 2KFWA 4QT3A 3ARTA 3RM8A 2IUZA 1BKFA 1NMVA 4NNRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KT0 A;  3UQB A;  4JFM A;  4U84 A;  2ZR6 A;  4R0X A;  5DIT A;  1HXV A;  2RUR A;  2M08 A;  4TX0 A;  4DRI A;  4JFJ A;  4JYS A;  2XP7 A;  4TYO A;  4TW7 A;  1JNT A;  2MF9 A;  2RSE A;  2ZQT A;  3WH0 A;  1NMW A;  1J4R A;  2OFN A;  2F2D A;  1Q6H A;  1FKH A;  4G50 A;  3KAB A;  1M5Y A;  1R9H A;  2LPV A;  2ZQS A;  4TNS A;  3O5E A;  2KE0 A;  3FAP A;  3NTP A;  5HTG A;  1YW5 A;  3H9R B;  3TC5 A;  2XP9 A;  3NI6 A;  4DZ3 A;  1ROU A;  3JYJ A;  3KCE A;  3NRK A;  3GPK A;  1J4I A;  4GGQ A;  4QIB A;  2AWG A;  2DG4 A;  3UI4 A;  1T11 A;  2LKN A;  2PV1 A;  1FKL A;  1Q6U A;  1BL4 A;  1D7H A;  1NSG A;  1FAP A;  2XP4 A;  5D75 A;  4DH0 A;  3ODK A;  2PV2 A;  4JFI A;  4ODP A;  1QZ2 A;  4DIP A;  3EY6 A;  4MSP A;  2FKE A;  1J4H A;  4ODR A;  4J4O A;  2DG9 A;  1J6Y A;  3RFW A;  2Q5A A;  3PRB A;  5HW8 A;  1YAT A;  1C9H A;  5B8I C;  3O5J A;  3UQA A;  4U86 A;  3O5O A;  2PPP A;  1W26 A;  3I6C A;  3IKD A;  3UI6 A;  3TDB A;  5HUA A;  5DIU A;  3KAH A;  2MPH A;  3O5I A;  2RUD A;  3O5D A;  4DRK A;  3JXV A;  2Y78 A;  2ITK A;  3UF8 A;  4DRN A;  3IKG A;  3PA7 A;  2XP6 A;  2VCD A;  1Q1C A;  2KGJ A;  1FKS A;  1FJD A;  1ROT A;  2XP8 A;  3KZ7 A;  1ZCN A;  2XP3 A;  2XP5 A;  2MNT A;  4ODM A;  5GPG A;  2F4E A;  1B6C A;  4ODO A;  2LJ4 A;  1D7I A;  3O5Q A;  4FN2 A;  3KAC A;  4ODQ A;  1KT1 A;  3O5L A;  4ODK A;  4W9O A;  5HW6 A;  3B7X A;  1Q6I A;  2MLX A;  4QT2 A;  3O5F A;  2F21 A;  1FKR A;  2JZV A;  3PRD A;  3KAF A;  2K8I A;  4ITZ A;  4JFL A;  2PPN A;  2XPB A;  1FKJ A;  2IF4 A;  2L2S A;  1PIN A;  1D6O A;  4W9Q A;  2ZQV A;  1FKD A;  1FKI A;  4G2P A;  4ODL A;  5DIV A;  3IK8 A;  3O5R A;  4W9P A;  1A7X A;  2RQS A;  4DRH A;  3MDY B;  3RGC A;  4O2T A;  2RUQ A;  3O5G A;  5HW7 A;  5HKG A;  4DZ2 A;  2UZ5 A;  1Y0O A;  1FKT A;  4BF8 A;  2N87 A;  3CGM A;  4DT4 A;  1U79 A;  2M2A A;  1P5Q A;  1FD9 A;  2MLZ A;  1PBK A;  2M1I A;  1FKK A;  2PPO A;  3IHZ A;  4TW6 A;  4DRM A;  4JFK A;  2VN1 A;  4J4N A;  2LGO A;  1L1P A;  1QPL A;  3UI5 A;  5HWB A;  2KI3 A;  2MLY A;  4LAW A;  5J6E A;  3KAG A;  4LAY A;  4LAX A;  3JYM A;  1EQ3 A;  3KAI A;  1FKG A;  5BXJ A;  3O5P A;  4DRP A;  1F8A B;  2XPA A;  4IQC A;  3CGN A;  3TCZ A;  2KO7 A;  2D9F A;  2ZQU A;  1TCO C;  2ZR4 A;  3LUO A;  4LAV A;  3O5M A;  4TW8 A;  2RUC A;  4IPX A;  4DRO A;  1FKB A;  2KR7 A;  3VAW A;  3UQI A;  1N1A A;  2ZR5 A;  2PV3 A;  3OOB A;  4IQ2 A;  4DRQ A;  2PBC A;  1F40 A;  4FAP A;  5I98 A;  1JVW A;  4C02 B;  1FKF A;  2DG3 A;  1EYM A;  4MGV A;  4N19 A;  4U85 A;  4GIV A;  2KFW A;  4QT3 A;  3O5K A;  4DRJ A;  2FAP A;  3KAD A;  1QPF A;  4ODN A;  5HWC A;  1BKF A;  1NMV A;  1JNS A;  4NNR A;  5HT1 A;  1ZK6 A;  1D7J A; 
#chains in the Genus database with same CATH topology
 3UQB A;  4JFM A;  3WD0 A;  2RUR A;  1JNE A;  2M08 A;  3CH9 A;  4MNL A;  4TX0 A;  4JYS A;  2O92 A;  1HKI A;  1NMW A;  2OFN A;  3CHD A;  4DWS A;  1Q6H A;  1FKH A;  3KAB A;  1R9H A;  4IT4 A;  3O5E A;  4UDM A;  2XP9 A;  1JND A;  3NI6 A;  4DZ3 A;  1ROU A;  2PV1 A;  1FKL A;  4MAV A;  5D75 A;  4ZPT R;  1GPF A;  4DWS B;  1HKM A;  1WAW A;  5HW8 A;  1WNO A;  1FFR A;  4L3N A;  5B8I C;  3UQA A;  3AS2 A;  1LL6 A;  5HUA A;  3WD3 A;  3KAH A;  1FFQ A;  2ITK A;  1UR9 A;  4HAR A;  3IKG A;  2XP6 A;  2VCD A;  1FJD A;  1FKS A;  3ARP A;  1K9T A;  4ODM A;  5DEZ A;  5GPG A;  2F4E A;  3OA5 A;  3PR9 A;  4ODO A;  4ODQ A;  4P8V A;  4MTV A;  4W9O A;  4AY1 A;  3AQU A;  1FKR A;  5HBF A;  4Q22 A;  1OGG A;  1FKJ A;  2IF4 A;  2L2S A;  1FKI A;  3FXY A;  1E6R A;  4DWS C;  3PRA A;  2RQS A;  4O2T A;  2RUQ A;  1NWS A;  3ALG A;  3O5G A;  3WL1 A;  3CGM A;  1U79 A;  2M2A A;  1W1T A;  2DSZ A;  1FD9 A;  1E44 A;  1FKK A;  2PPO A;  3IHZ A;  3WIJ A;  1SYT A;  2VN1 A;  3B9E A;  4LAY A;  4LAX A;  1EQ3 A;  4DRP A;  2DT0 A;  1TCO C;  1LG2 A;  4TW8 A;  4IPX A;  4DRO A;  2KR7 A;  3VAW A;  3UQI A;  2PV3 A;  3G6M A;  4ZPV R;  3RM9 A;  1KFW A;  1FKF A;  3CZ8 A;  4MGV A;  3BXW A;  3WD4 A;  4DRJ A;  2FAP A;  4ODN A;  1CTN A;  2DPE A;  2DSW A;  5DIT A;  2DT3 A;  3ALF A;  1HXV A;  4ML4 A;  4R5E A;  4DRI A;  1O6I A;  3CHC A;  2MF9 A;  4ZPW R;  1J4R A;  4QZV B;  2F2D A;  4G50 A;  4TNS A;  5HTG A;  4L72 B;  3H9R B;  3ARO A;  3ARU A;  3JYJ A;  4GGQ A;  1HJV A;  4S3K A;  4WKH A;  1BL4 A;  2XP4 A;  4IT6 A;  4DH0 A;  3ARX A;  4S3J A;  3EY6 A;  1ZU8 A;  4ODR A;  3ARY A;  2DG9 A;  1J6Y A;  3RFW A;  2PI6 A;  3RME A;  1C9H A;  4PTM A;  2PPP A;  3IKD A;  3I6C A;  3TDB A;  3CHF A;  4Z2H A;  2MPH A;  2B5U B;  3O5D A;  3JXV A;  3UF8 A;  1NWR A;  3AS1 A;  1ROT A;  2XP8 A;  3KZ7 A;  1W1V A;  2XP3 A;  2XP5 A;  2MNT A;  1RD6 A;  1ZBK A;  1D7I A;  2LJ4 A;  3ARR A;  3KAC A;  4P8W A;  4Z2J A;  2G8Z A;  4P8U A;  4KR0 B;  5DO2 A;  3KAF A;  2K8I A;  3WQW A;  2XPB A;  5DF0 A;  1PIN A;  4HBE A;  4W9Q A;  2ZQV A;  2WK2 A;  1FKD A;  4G2P A;  3ARS A;  1VF8 A;  3IK8 A;  4Q7N A;  4WKF A;  1W1Y A;  5HW7 A;  1WB0 A;  1UR8 A;  3RM4 A;  2UZ5 A;  4XAK A;  1FKT A;  2MLZ A;  5JH8 A;  4DRM A;  4TW6 A;  4J4N A;  1L1P A;  3EIP A;  2KI3 A;  2B31 A;  5GPR A;  1LJY A;  1ZL1 A;  2F23 A;  1F8A B;  1D2K A;  1W9P A;  2D9F A;  2WLZ A;  2ZQU A;  2ZR4 A;  2ETN A;  4LAV A;  3BMB A;  2ZR5 A;  3OOB A;  4DRQ A;  4FAP A;  5I98 A;  1JVW A;  2DG3 A;  1EYM A;  3B8S A;  2DSU A;  3GTY X;  1GUV A;  5HWC A;  1XHG A;  1JNS A;  4MPK A;  5HT1 A;  1ZK6 A;  1P5Q A;  4U84 A;  4JFJ A;  4TYO A;  2XP7 A;  2ZQT A;  1LL4 A;  1W9V A;  1M5Y A;  3NTP A;  3KCE A;  3WL0 A;  3GPK A;  4QIB A;  2DG4 A;  1T11 A;  2LKN A;  1Q6U A;  1ZBV A;  1D7H A;  1FAP A;  1OWQ A;  1QZ2 A;  2FKE A;  1OGB A;  1YAT A;  1HKJ A;  1E6Z A;  3GU0 A;  3O5J A;  4U86 A;  3UI6 A;  4KQZ A;  3O5I A;  2RUD A;  2Y78 A;  3PA7 A;  1Q1C A;  2KGJ A;  4LGX A;  1ZCN A;  1E15 A;  2WLY A;  3O5Q A;  1KT1 A;  4ODK A;  1Q6I A;  4QT2 A;  4HBO A;  2F21 A;  1H0I A;  2FDM A;  4Z2L A;  2JZV A;  4ITZ A;  1EDQ A;  4Z2I A;  1D6O A;  2DSV A;  4ODL A;  5DIV A;  4Z2K A;  1W9U A;  3O5R A;  4W9P A;  2A3A A;  3MDY B;  4WK9 A;  2AOS A;  3WD2 A;  1HJW A;  2WM0 A;  2ESC A;  1ZBW A;  1ZBC A;  3CHE A;  4MNM A;  1JCH B;  1W1P A;  1QPL A;  2A3C A;  1HJX A;  5HWB A;  3JYM A;  2DT2 A;  3KAI A;  1FKG A;  3W4R A;  5BXJ A;  2XPA A;  4IQC A;  3TCZ A;  1LQ0 A;  2KO7 A;  3QOK A;  3LUO A;  3O5M A;  2RUC A;  1X6N A;  1IX5 A;  2A3B A;  1N1A A;  1F40 A;  3ARZ A;  2PBC A;  4U85 A;  2YBU A;  1HKK A;  1TFV A;  3O5K A;  3KAD A;  2QF8 A;  1QPF A;  4NSB A;  3AS0 A;  1XRV A;  2DT1 A;  2P4V A;  4Z2G A;  4C02 B;  1D7J A;  1KT0 A;  3ARW A;  4WJX A;  2ZR6 A;  4R0X A;  1EHN A;  1H0G A;  4TW7 A;  1JNT A;  1GOI A;  2RSE A;  3WH0 A;  2O9O A;  3WD1 A;  2LPV A;  2ZQS A;  3WKZ A;  2KE0 A;  3FAP A;  3ARV A;  1YW5 A;  3G6L A;  4ZS6 A;  3TC5 A;  1ITX A;  3NRK A;  1J4I A;  3UI4 A;  2AWG A;  1NSG A;  3ODK A;  2PV2 A;  4JFI A;  4ODP A;  4DIP A;  4MSP A;  1J4H A;  4J4O A;  2PN0 A;  1LG1 A;  2Q5A A;  3PRB A;  3O5O A;  1SR0 A;  1W26 A;  2OLH A;  2EUL A;  5DIU A;  1E6N A;  4DWS D;  4DRK A;  4P8X A;  2YBT A;  1E9L A;  4DRN A;  5GQB A;  2G41 A;  1ZB5 A;  4NZC A;  1B6C A;  4FN2 A;  3O5L A;  5HW6 A;  3B7X A;  2MLX A;  3O5F A;  3B9D A;  4URI A;  3PRD A;  4JFL A;  2PPN A;  1X6L A;  4WIW A;  2A3E A;  1A7X A;  4DRH A;  3RGC A;  5HKG A;  4DZ2 A;  1LL7 A;  1Y0O A;  4BF8 A;  3WQV A;  2N87 A;  4DT4 A;  1EIB A;  1PBK A;  2M1I A;  3AS3 A;  4JFK A;  4W5U A;  2LGO A;  1E6P A;  3UI5 A;  1NWT A;  2MLY A;  4LAW A;  5J6E A;  3KAG A;  4MNJ A;  1NH6 A;  3O5P A;  4WKA A;  3ARQ A;  3CGN A;  4MNK A;  1FKB A;  3FY1 A;  1GRJ A;  4IQ2 A;  3B9A A;  1NWU A;  4N19 A;  4GIV A;  2KFW A;  4QT3 A;  3ART A;  3RM8 A;  2IUZ A;  1BKF A;  1NMV A;  4NNR A; 
#chains in the Genus database with same CATH homology
 3UQB A;  4JFM A;  3WD0 A;  2RUR A;  1JNE A;  2M08 A;  3CH9 A;  4MNL A;  4TX0 A;  4JYS A;  2O92 A;  1HKI A;  1NMW A;  2OFN A;  3CHD A;  4DWS A;  1Q6H A;  1FKH A;  3KAB A;  1R9H A;  4IT4 A;  3O5E A;  2XP9 A;  1JND A;  3NI6 A;  4DZ3 A;  1ROU A;  2PV1 A;  1FKL A;  4MAV A;  5D75 A;  4ZPT R;  1GPF A;  4DWS B;  1HKM A;  1WAW A;  5HW8 A;  1WNO A;  1FFR A;  4L3N A;  5B8I C;  3UQA A;  3AS2 A;  1LL6 A;  5HUA A;  3WD3 A;  3KAH A;  1FFQ A;  2ITK A;  1UR9 A;  4HAR A;  3IKG A;  2XP6 A;  2VCD A;  1FJD A;  1FKS A;  3ARP A;  1K9T A;  4ODM A;  5DEZ A;  5GPG A;  2F4E A;  3OA5 A;  3PR9 A;  4ODO A;  4ODQ A;  4P8V A;  4MTV A;  4W9O A;  4AY1 A;  3AQU A;  1FKR A;  5HBF A;  4Q22 A;  1OGG A;  1FKJ A;  2IF4 A;  2L2S A;  1FKI A;  3FXY A;  1E6R A;  4DWS C;  3PRA A;  2RQS A;  4O2T A;  2RUQ A;  1NWS A;  3ALG A;  3O5G A;  3WL1 A;  3CGM A;  1U79 A;  2M2A A;  1W1T A;  2DSZ A;  1FD9 A;  1FKK A;  2PPO A;  3IHZ A;  3WIJ A;  1SYT A;  2VN1 A;  3B9E A;  4LAY A;  4LAX A;  1EQ3 A;  4DRP A;  2DT0 A;  1TCO C;  1LG2 A;  4TW8 A;  4IPX A;  4DRO A;  2KR7 A;  3VAW A;  3UQI A;  2PV3 A;  3G6M A;  4ZPV R;  3RM9 A;  1KFW A;  1FKF A;  3CZ8 A;  4MGV A;  3BXW A;  3WD4 A;  4DRJ A;  2FAP A;  4ODN A;  1CTN A;  2DPE A;  2DSW A;  5DIT A;  2DT3 A;  3ALF A;  1HXV A;  4ML4 A;  4R5E A;  4DRI A;  1O6I A;  3CHC A;  2MF9 A;  4ZPW R;  1J4R A;  4QZV B;  2F2D A;  4G50 A;  4TNS A;  5HTG A;  4L72 B;  3H9R B;  3ARO A;  3ARU A;  3JYJ A;  4GGQ A;  1HJV A;  4S3K A;  4WKH A;  1BL4 A;  2XP4 A;  4IT6 A;  4DH0 A;  3ARX A;  4S3J A;  3EY6 A;  1ZU8 A;  4ODR A;  3ARY A;  2DG9 A;  1J6Y A;  3RFW A;  2PI6 A;  3RME A;  1C9H A;  4PTM A;  2PPP A;  3IKD A;  3I6C A;  3TDB A;  3CHF A;  4Z2H A;  2MPH A;  3O5D A;  3JXV A;  3UF8 A;  1NWR A;  3AS1 A;  1ROT A;  2XP8 A;  3KZ7 A;  1W1V A;  2XP3 A;  2XP5 A;  2MNT A;  1RD6 A;  1ZBK A;  1D7I A;  2LJ4 A;  3ARR A;  3KAC A;  4P8W A;  4Z2J A;  2G8Z A;  4P8U A;  4KR0 B;  5DO2 A;  3KAF A;  2K8I A;  3WQW A;  2XPB A;  5DF0 A;  1PIN A;  4HBE A;  4W9Q A;  2ZQV A;  2WK2 A;  1FKD A;  4G2P A;  3ARS A;  1VF8 A;  3IK8 A;  4Q7N A;  4WKF A;  1W1Y A;  5HW7 A;  1WB0 A;  1UR8 A;  3RM4 A;  2UZ5 A;  4XAK A;  1FKT A;  2MLZ A;  5JH8 A;  4DRM A;  4TW6 A;  4J4N A;  1L1P A;  2KI3 A;  2B31 A;  5GPR A;  1LJY A;  1ZL1 A;  1F8A B;  1D2K A;  1W9P A;  2D9F A;  2WLZ A;  2ZQU A;  2ZR4 A;  4LAV A;  2ZR5 A;  3OOB A;  4DRQ A;  4FAP A;  5I98 A;  1JVW A;  2DG3 A;  1EYM A;  3B8S A;  2DSU A;  1GUV A;  5HWC A;  1XHG A;  1JNS A;  4MPK A;  5HT1 A;  1ZK6 A;  1P5Q A;  4U84 A;  4JFJ A;  4TYO A;  2XP7 A;  2ZQT A;  1LL4 A;  1W9V A;  1M5Y A;  3NTP A;  3KCE A;  3WL0 A;  3GPK A;  4QIB A;  2DG4 A;  1T11 A;  2LKN A;  1Q6U A;  1ZBV A;  1D7H A;  1FAP A;  1OWQ A;  1QZ2 A;  2FKE A;  1OGB A;  1YAT A;  1HKJ A;  1E6Z A;  3O5J A;  4U86 A;  3UI6 A;  4KQZ A;  3O5I A;  2RUD A;  2Y78 A;  3PA7 A;  1Q1C A;  2KGJ A;  4LGX A;  1ZCN A;  1E15 A;  2WLY A;  3O5Q A;  1KT1 A;  4ODK A;  1Q6I A;  4QT2 A;  4HBO A;  2F21 A;  1H0I A;  2FDM A;  4Z2L A;  2JZV A;  4ITZ A;  1EDQ A;  4Z2I A;  1D6O A;  2DSV A;  4ODL A;  5DIV A;  4Z2K A;  1W9U A;  3O5R A;  4W9P A;  2A3A A;  3MDY B;  4WK9 A;  2AOS A;  3WD2 A;  1HJW A;  2WM0 A;  2ESC A;  1ZBW A;  1ZBC A;  3CHE A;  4MNM A;  1W1P A;  1QPL A;  2A3C A;  1HJX A;  5HWB A;  3JYM A;  2DT2 A;  3KAI A;  1FKG A;  3W4R A;  5BXJ A;  2XPA A;  4IQC A;  3TCZ A;  1LQ0 A;  2KO7 A;  3QOK A;  3LUO A;  3O5M A;  2RUC A;  1X6N A;  1IX5 A;  2A3B A;  1N1A A;  1F40 A;  3ARZ A;  2PBC A;  4U85 A;  2YBU A;  1HKK A;  1TFV A;  3O5K A;  3KAD A;  2QF8 A;  1QPF A;  4NSB A;  3AS0 A;  1XRV A;  2DT1 A;  4Z2G A;  4C02 B;  1D7J A;  1KT0 A;  3ARW A;  4WJX A;  2ZR6 A;  4R0X A;  1EHN A;  1H0G A;  4TW7 A;  1JNT A;  1GOI A;  2RSE A;  3WH0 A;  2O9O A;  3WD1 A;  2LPV A;  2ZQS A;  3WKZ A;  2KE0 A;  3FAP A;  3ARV A;  1YW5 A;  3G6L A;  4ZS6 A;  3TC5 A;  1ITX A;  3NRK A;  1J4I A;  3UI4 A;  2AWG A;  1NSG A;  3ODK A;  2PV2 A;  4JFI A;  4ODP A;  4DIP A;  4MSP A;  1J4H A;  4J4O A;  1LG1 A;  2Q5A A;  3PRB A;  1SR0 A;  3O5O A;  1W26 A;  2OLH A;  5DIU A;  1E6N A;  4DWS D;  4DRK A;  4P8X A;  2YBT A;  1E9L A;  4DRN A;  5GQB A;  2G41 A;  1ZB5 A;  4NZC A;  1B6C A;  4FN2 A;  3O5L A;  5HW6 A;  3B7X A;  2MLX A;  3O5F A;  3B9D A;  4URI A;  3PRD A;  4JFL A;  2PPN A;  1X6L A;  4WIW A;  2A3E A;  1A7X A;  4DRH A;  3RGC A;  5HKG A;  4DZ2 A;  1LL7 A;  1Y0O A;  4BF8 A;  3WQV A;  2N87 A;  4DT4 A;  1EIB A;  1PBK A;  2M1I A;  3AS3 A;  4JFK A;  4W5U A;  2LGO A;  1E6P A;  3UI5 A;  1NWT A;  2MLY A;  4LAW A;  5J6E A;  3KAG A;  4MNJ A;  1NH6 A;  3O5P A;  4WKA A;  3ARQ A;  3CGN A;  4MNK A;  1FKB A;  3FY1 A;  4IQ2 A;  3B9A A;  1NWU A;  4N19 A;  4GIV A;  2KFW A;  4QT3 A;  3ART A;  3RM8 A;  2IUZ A;  1BKF A;  1NMV A;  4NNR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...