1EYMA

Fk506 binding protein mutant, homodimeric complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKMDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 BINDING PROTEIN
publication title A ligand-reversible dimerization system for controlling protein-protein interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 27
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2000-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1eymA00
4TW7A 4C02B 1F8AB 4ODKA 4QIBA 3TC5A 1FKGA 4DZ2A 2PPOA 4N19A 2XPAA 2DG3A 3NTPA 4ITZA 4QT3A 3NRKA 2XP5A 4DROA 3IK8A 2ZR6A 4ODPA 4TYOA 3KAHA 4ODNA 4DH0A 3PRDA 4ODQA 5DIUA 4DRQA 1Q1CA 2XP9A 1N1AA 2AWGA 4DIPA 2KFWA 1J6YA 2F4EA 4LAXA 3CGMA 3JYJA 3RGCA 4U86A 4DRKA 2PV2A 5J6EA 3KACA 3KAFA 3O5MA 2ZQVA 2XP3A 4DRNA 2KE0A 1M5YA 2XPBA 4QT2A 1JVWA 1JNTA 3O5KA 4LAWA 3UQBA 2PBCA 1Q6IA 2XP8A 1D6OA 4GGQA 1NSGA 4LAYA 1PINA 2M2AA 3CGNA 3KADA 5HWCA 1JNSA 2JZVA 5HKGA 4DRHA 4TW6A 1FKHA 2FKEA 2MF9A 1ZK6A 4J4OA 3KZ7A 4FN2A 3TCZA 1BL4A 2UZ5A 3KABA 3KAGA 4G2PA 1D7HA 2VCDA 2D9FA 1QZ2A 2XP7A 4O2TA 1TCOC 4ODOA 4TW8A 4W9PA 4G50A 1ZCNA 5DIVA 2KR7A 3JYMA 1FKFA 3UI6A 5BXJA 3TDBA 1PBKA 2F21A 5DITA 4JYSA 4JFLA 1Q6HA 3O5IA 4FAPA 1EQ3A 1J4HA 4IQCA 2M08A 5HTGA 1J4RA 4TX0A 4DT4A 1Q6UA 2ZR5A 1FKRA 3UF8A 3RFWA 2F2DA 4MSPA 1YW5A 2MNTA 2MLYA 1QPFA 2DG4A 4DRMA 2RUDA 1W26A 3UI4A 3PA7A 1FKBA 1D7IA 3UQIA 1EYMA 2PPPA 3OOBA 5HT1A 4TNSA 3O5PA 4R0XA 2ZQTA 4U84A 5HW8A 1FKDA 2MLXA 4DRJA 1P5QA 1FKIA 3UI5A 3MDYB 3O5QA 3NI6A 4J4NA 4LAVA 4ODMA 1QPLA 4DRPA 3WH0A 1D7JA 1ROUA 2RUCA 3O5JA 4U85A 3O5FA 1U79A 3ODKA 1R9HA 4JFKA 4DRIA 1B6CA 2RUQA 2PV1A 1BKFA 1KT0A 2IF4A 4IQ2A 4JFIA 5B8IC 2KI3A 2LJ4A 2VN1A 2Y78A 3FAPA 3O5EA 4DZ3A 5HW7A 1FKLA 4W9OA 5I98A 2RQSA 2FAPA 1FKSA 1NMWA 2Q5AA 1C9HA 2RURA 1Y0OA 4W9QA 4IPXA 1T11A 3EY6A 4ODLA 3IKGA 3GPKA 3LUOA 2MPHA 2ZQUA 3IKDA 2ZR4A 1L1PA 4NNRA 2ITKA 1F40A 3I6CA 4GIVA 1FJDA 5HW6A 1J4IA 2MLZA 1FKKA 3VAWA 2PPNA 1FKJA 2M1IA 1FKTA 3O5OA 3O5GA 3IHZA 4ODRA 1FD9A 2KGJA 2L2SA 2LKNA 2N87A 3B7XA 4JFJA 2XP4A 2LPVA 4JFMA 2K8IA 4MGVA 1YATA 1ROTA 1A7XA 2PV3A 5D75A 5HWBA 3H9RB 3O5LA 1FAPA 3KCEA 1HXVA 2LGOA 1KT1A 2OFNA 2RSEA 2XP6A 3O5DA 2DG9A 3KAIA 4BF8A 3UQAA 2ZQSA 5GPGA 3JXVA 5HUAA 3PRBA 3O5RA 1NMVA 2KO7A
chains in the Genus database with same CATH superfamily
3B9DA 3TC5A 4QIBA 4WKHA 1VF8A 2XPAA 5JH8A 4DROA 3IK8A 2WK2A 4ODPA 3AS3A 1E6PA 3KAHA 4DH0A 1X6NA 3PRDA 4DRQA 1LQ0A 2AWGA 3B9AA 4ZPTR 2KFWA 1J6YA 2F4EA 2DSWA 3KACA 3KAFA 2FDMA 1OWQA 1M5YA 4QT2A 4LAWA 3WD0A 1FFQA 4GGQA 4Z2GA 5HKGA 1NWSA 4DRHA 1RD6A 2MF9A 1ZK6A 2UZ5A 2F23A 4TW8A 4W9PA 3RMEA 3WQVA 5DIVA 3JYMA 3TDBA 4KQZA 4JYSA 3O5IA 2G8ZA 4IQCA 4URIA 3WD1A 4DT4A 4IT6A 1FKRA 1YW5A 2MLYA 2RUDA 1W26A 3B8SA 3AROA 1EYMA 2PPPA 4TNSA 3O5PA 4U84A 4DRJA 1FKIA 3MDYB 1HKMA 4DRPA 2P4VA 2DT3A 2RUCA 3GTYX 1U79A 1LG1A 3ARTA 1B6CA 2PV1A 4IQ2A 2IF4A 4S3KA 1W1YA 5HW7A 1OGBA 3CHDA 1FKSA 2Q5AA 2RURA 1Y0OA 4IT4A 1GRJA 4ZPWR 5HBFA 3GPKA 3LUOA 3IKDA 4NSBA 1HJWA 2ITKA 1F40A 1FKKA 1ITXA 1FKTA 3EIPA 2N87A 4JFJA 2AOSA 5DF0A 1YATA 1ROTA 1NWRA 1JCHB 1XHGA 5D75A 3H9RB 2LGOA 4UDMA 2XP6A 3PRBA 1GOIA 3O5RA 4MNLA 1NMVA 1HKIA 4C02B 4ZPVR 1F8AB 1SR0A 4DZ2A 3NTPA 4QT3A 5DEZA 2XP5A 3QOKA 4ODQA 1E6RA 1N1AA 1W1TA 1FFRA 4DIPA 4LAXA 3RGCA 3JYJA 4DRKA 5J6EA 1XRVA 4L72B 1ZB5A 2XP8A 4P8VA 5GQBA 3ALGA 4TW6A 4FN2A 3TCZA 1BL4A 3KAGA 4G2PA 1D7HA 2VCDA 4HBOA 4DWSB 2XP7A 2WLYA 1TCOC 2IUZA 1ZCNA 3ARVA 2KR7A 3ARWA 3PR9A 4P8UA 2F21A 3B9EA 5DITA 2B31A 4JFLA 4FAPA 5HTGA 1J4RA 4TX0A 4PTMA 1IX5A 3RFWA 4MSPA 2DG4A 4DRMA 4DWSD 3UI4A 3UI5A 3O5QA 3NI6A 3ARZA 4LAVA 1QPLA 4U85A 3G6MA 1EDQA 1R9HA 4WKFA 4DRIA 1W9UA 3WIJA 2LJ4A 1E6ZA 1EHNA 2RQSA 1C9HA 4MTVA 3CH9A 1T11A 3EY6A 3ARPA 1SYTA 4Z2LA 4MAVA 2ZR4A 4GIVA 3PRAA 1KFWA 1W9VA 1J4IA 2MLZA 3VAWA 2M1IA 3IHZA 2KGJA 1D2KA 4JFMA 2XP4A 4MGVA 3AS0A 2O9OA 1A7XA 4DWSC 5HWBA 3RM8A 5GPRA 3G6LA 3O5DA 1UR9A 2DG9A 1ZBCA 2ZQSA 4Q7NA 2PV3A 2PI6A 4ODKA 1FKGA 2PPOA 4N19A 1H0GA 2DG3A 4ITZA 2ZR6A 4TYOA 4ODNA 2EULA 1Q1CA 2XP9A 2A3EA 2A3BA 3CGMA 4U86A 2DPEA 3O5MA 2ZQVA 2WM0A 1JNTA 1Q6IA 5DO2A 4LAYA 1PINA 1TFVA 3KADA 5HWCA 2JZVA 1FKHA 4J4OA 2YBTA 3KABA 4ML4A 4ODOA 2PN0A 2DSZA 4L3NA 3CZ8A 3ARRA 5BXJA 3WL1A 1K9TA 2YBUA 1OGGA 1Q6HA 1EQ3A 2QF8A 2M08A 3WL0A 1Q6UA 2F2DA 3CHFA 2MNTA 1QPFA 3ALFA 1LJYA 2DT2A 4MNMA 1JNDA 3ARUA 1NWUA 1E6NA 3OOBA 5HT1A 2ZQTA 1P5QA 4Q22A 4J4NA 3AQUA 1ROUA 1W1VA 3ODKA 4P8WA 1HJVA 4JFKA 1HKJA 2RUQA 4JFIA 1BKFA 1KT0A 1GPFA 2OLHA 5B8IC 2DT1A 3RM9A 2KI3A 2VN1A 5I98A 3FAPA 4DZ3A 4Z2IA 1FKLA 3W4RA 2FAPA 1NMWA 1EIBA 1ZL1A 4IPXA 1LL4A 4ODLA 2MPHA 2ZQUA 1WNOA 4AY1A 4WIWA 4NNRA 1O6IA 3WKZA 3GU0A 4WK9A 3O5GA 4ODRA 4Z2JA 1FD9A 2LKNA 4LGXA 3B7XA 2LPVA 3OA5A 3FY1A 4P8XA 1LG2A 1HXVA 1W1PA 1E9LA 2OFNA 1JNEA 2RSEA 5GPGA 3JXVA 1NH6A 3O5FA 2Y78A 4TW7A 4Z2HA 2O92A 1HKKA 4ZS6A 3WD4A 3NRKA 4MPKA 2DT0A 5DIUA 4R5EA 2A3AA 1LL6A 4DWSA 2PV2A 1E44A 4KR0B 1ZBVA 2B5UB 1CTNA 2XP3A 4HBEA 4DRNA 2ESCA 2KE0A 2XPBA 3WQWA 1JVWA 4W5UA 3CHCA 3O5KA 3UQBA 2PBCA 1D6OA 1NSGA 2M2AA 3CGNA 1JNSA 2FKEA 3RM4A 3KZ7A 2D9FA 4QZVB 1QZ2A 4O2TA 3ARQA 4WJXA 4G50A 1WB0A 1FKFA 3UI6A 4NZCA 1PBKA 3AS2A 1W9PA 4MNJA 1J4HA 3WD3A 2ZR5A 3UF8A 1GUVA 3BXWA 3AS1A 3PA7A 1FKBA 1D7IA 3UQIA 5HW8A 4R0XA 1FKDA 2MLXA 3BMBA 4WKAA 4Z2KA 4ODMA 3WH0A 1D7JA 1ZU8A 3O5JA 1WAWA 3FXYA 2A3CA 3ARXA 1NWTA 1X6LA 3O5EA 4W9OA 3CHEA 1UR8A 4W9QA 1ZBWA 3IKGA 1HJXA 2WLZA 1L1PA 2DSVA 3ARYA 4XAKA 2ETNA 3I6CA 1FJDA 5HW6A 4S3JA 4HARA 1H0IA 2PPNA 1FKJA 2DSUA 3O5OA 3ARSA 2L2SA 2K8IA 2G41A 4MNKA 3O5LA 3KCEA 1E15A 1FAPA 1LL7A 1KT1A 3WD2A 3KAIA 1ZBKA 4BF8A 3UQAA 5HUAA 2KO7A
chains in the Genus database with same CATH topology
3B9DA 3TC5A 4QIBA 4WKHA 1VF8A 2XPAA 5JH8A 4DROA 3IK8A 2WK2A 4ODPA 3AS3A 1E6PA 3KAHA 4DH0A 1X6NA 3PRDA 4DRQA 1LQ0A 2AWGA 3B9AA 4ZPTR 2KFWA 1J6YA 2F4EA 2DSWA 3KACA 3KAFA 2FDMA 1OWQA 1M5YA 4QT2A 4LAWA 3WD0A 1FFQA 4GGQA 4Z2GA 5HKGA 1NWSA 4DRHA 1RD6A 2MF9A 1ZK6A 2UZ5A 4TW8A 4W9PA 3RMEA 3WQVA 5DIVA 3JYMA 3TDBA 4KQZA 4JYSA 3O5IA 2G8ZA 4IQCA 4URIA 3WD1A 4DT4A 4IT6A 1FKRA 1YW5A 2MLYA 2RUDA 1W26A 3B8SA 3AROA 1EYMA 2PPPA 4TNSA 3O5PA 4U84A 4DRJA 1FKIA 3MDYB 1HKMA 4DRPA 2DT3A 2RUCA 1U79A 1LG1A 3ARTA 1B6CA 2PV1A 4IQ2A 2IF4A 4S3KA 1W1YA 5HW7A 1OGBA 3CHDA 1FKSA 2Q5AA 2RURA 1Y0OA 4IT4A 4ZPWR 5HBFA 3GPKA 3LUOA 3IKDA 4NSBA 1HJWA 2ITKA 1F40A 1FKKA 1ITXA 1FKTA 2N87A 4JFJA 2AOSA 5DF0A 1YATA 1ROTA 1NWRA 1XHGA 5D75A 3H9RB 2LGOA 2XP6A 3PRBA 3O5RA 1GOIA 4MNLA 1NMVA 1HKIA 4C02B 4ZPVR 1F8AB 1SR0A 4DZ2A 3NTPA 4QT3A 5DEZA 2XP5A 3QOKA 4ODQA 1E6RA 1N1AA 1W1TA 1FFRA 4DIPA 4LAXA 3RGCA 3JYJA 4DRKA 5J6EA 1XRVA 4L72B 1ZB5A 2XP8A 4P8VA 5GQBA 3ALGA 4TW6A 4FN2A 3TCZA 1BL4A 3KAGA 4G2PA 1D7HA 2VCDA 4HBOA 4DWSB 2XP7A 2WLYA 1TCOC 2IUZA 1ZCNA 3ARVA 2KR7A 3ARWA 3PR9A 4P8UA 2F21A 3B9EA 5DITA 2B31A 4JFLA 4FAPA 5HTGA 1J4RA 4TX0A 4PTMA 1IX5A 3RFWA 4MSPA 2DG4A 4DRMA 4DWSD 3UI4A 3UI5A 3O5QA 3NI6A 3ARZA 4LAVA 1QPLA 4U85A 3G6MA 1EDQA 1R9HA 4WKFA 4DRIA 1W9UA 3WIJA 2LJ4A 1E6ZA 1EHNA 2RQSA 1C9HA 4MTVA 3CH9A 1T11A 3EY6A 3ARPA 1SYTA 4Z2LA 4MAVA 2ZR4A 4GIVA 3PRAA 1KFWA 1W9VA 1J4IA 2MLZA 3VAWA 2M1IA 3IHZA 2KGJA 1D2KA 4JFMA 2XP4A 4MGVA 3AS0A 2O9OA 1A7XA 4DWSC 5HWBA 3RM8A 5GPRA 3G6LA 3O5DA 1UR9A 2DG9A 1ZBCA 2ZQSA 4Q7NA 2PV3A 2PI6A 4ODKA 1FKGA 2PPOA 4N19A 1H0GA 2DG3A 4ITZA 2ZR6A 4TYOA 4ODNA 1Q1CA 2XP9A 2A3EA 2A3BA 3CGMA 4U86A 2DPEA 3O5MA 2ZQVA 2WM0A 1JNTA 1Q6IA 5DO2A 4LAYA 1PINA 1TFVA 3KADA 5HWCA 2JZVA 1FKHA 4J4OA 2YBTA 3KABA 4ML4A 4ODOA 2DSZA 4L3NA 3CZ8A 3ARRA 5BXJA 3WL1A 1K9TA 2YBUA 1OGGA 1Q6HA 1EQ3A 2QF8A 2M08A 3WL0A 1Q6UA 2F2DA 3CHFA 2MNTA 1QPFA 3ALFA 1LJYA 2DT2A 4MNMA 1JNDA 3ARUA 1NWUA 1E6NA 3OOBA 5HT1A 2ZQTA 1P5QA 4Q22A 4J4NA 3AQUA 1ROUA 1W1VA 3ODKA 4P8WA 1HJVA 4JFKA 1HKJA 2RUQA 4JFIA 1BKFA 1KT0A 1GPFA 2OLHA 5B8IC 2DT1A 3RM9A 2KI3A 2VN1A 5I98A 3FAPA 4DZ3A 4Z2IA 1FKLA 3W4RA 2FAPA 1NMWA 1EIBA 1ZL1A 4IPXA 1LL4A 4ODLA 2MPHA 2ZQUA 1WNOA 4AY1A 4WIWA 4NNRA 1O6IA 3WKZA 4WK9A 3O5GA 4ODRA 4Z2JA 1FD9A 2LKNA 4LGXA 3B7XA 2LPVA 3OA5A 3FY1A 4P8XA 1LG2A 1HXVA 1W1PA 1E9LA 2OFNA 1JNEA 2RSEA 5GPGA 3JXVA 1NH6A 3O5FA 2Y78A 4TW7A 4Z2HA 2O92A 1HKKA 4ZS6A 3WD4A 3NRKA 4MPKA 2DT0A 5DIUA 4R5EA 2A3AA 1LL6A 4DWSA 2PV2A 4KR0B 1ZBVA 1CTNA 2XP3A 4HBEA 4DRNA 2ESCA 2KE0A 2XPBA 3WQWA 1JVWA 4W5UA 3CHCA 3O5KA 3UQBA 2PBCA 1D6OA 1NSGA 2M2AA 3CGNA 1JNSA 2FKEA 3RM4A 3KZ7A 2D9FA 4QZVB 1QZ2A 4O2TA 3ARQA 4WJXA 4G50A 1WB0A 1FKFA 3UI6A 4NZCA 1PBKA 3AS2A 1W9PA 4MNJA 1J4HA 3WD3A 2ZR5A 3UF8A 1GUVA 3BXWA 3AS1A 3PA7A 1FKBA 1D7IA 3UQIA 5HW8A 4R0XA 1FKDA 2MLXA 4WKAA 4Z2KA 4ODMA 3WH0A 1D7JA 1ZU8A 3O5JA 1WAWA 3FXYA 2A3CA 3ARXA 1NWTA 1X6LA 3O5EA 4W9OA 3CHEA 1UR8A 4W9QA 1ZBWA 3IKGA 1HJXA 2WLZA 1L1PA 2DSVA 3ARYA 4XAKA 3I6CA 1FJDA 5HW6A 4S3JA 4HARA 1H0IA 2PPNA 1FKJA 2DSUA 3O5OA 3ARSA 2L2SA 2K8IA 2G41A 4MNKA 3O5LA 3KCEA 1E15A 1FAPA 1LL7A 1KT1A 3WD2A 3KAIA 1ZBKA 4BF8A 3UQAA 5HUAA 2KO7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TW7 A;  4C02 B;  1F8A B;  4ODK A;  4QIB A;  3TC5 A;  1FKG A;  4DZ2 A;  2PPO A;  4N19 A;  2XPA A;  2DG3 A;  3NTP A;  4ITZ A;  4QT3 A;  3NRK A;  2XP5 A;  4DRO A;  3IK8 A;  2ZR6 A;  4ODP A;  4TYO A;  3KAH A;  4ODN A;  4DH0 A;  3PRD A;  4ODQ A;  5DIU A;  4DRQ A;  1Q1C A;  2XP9 A;  1N1A A;  2AWG A;  4DIP A;  2KFW A;  1J6Y A;  2F4E A;  4LAX A;  3CGM A;  3JYJ A;  3RGC A;  4U86 A;  4DRK A;  2PV2 A;  5J6E A;  3KAC A;  3KAF A;  3O5M A;  2ZQV A;  2XP3 A;  4DRN A;  2KE0 A;  1M5Y A;  2XPB A;  4QT2 A;  1JVW A;  1JNT A;  3O5K A;  4LAW A;  3UQB A;  2PBC A;  1Q6I A;  2XP8 A;  1D6O A;  4GGQ A;  1NSG A;  4LAY A;  1PIN A;  2M2A A;  3CGN A;  3KAD A;  5HWC A;  1JNS A;  2JZV A;  5HKG A;  4DRH A;  4TW6 A;  1FKH A;  2FKE A;  2MF9 A;  1ZK6 A;  4J4O A;  3KZ7 A;  4FN2 A;  3TCZ A;  1BL4 A;  2UZ5 A;  3KAB A;  3KAG A;  4G2P A;  1D7H A;  2VCD A;  2D9F A;  1QZ2 A;  2XP7 A;  4O2T A;  1TCO C;  4ODO A;  4TW8 A;  4W9P A;  4G50 A;  1ZCN A;  5DIV A;  2KR7 A;  3JYM A;  1FKF A;  3UI6 A;  5BXJ A;  3TDB A;  1PBK A;  2F21 A;  5DIT A;  4JYS A;  4JFL A;  1Q6H A;  3O5I A;  4FAP A;  1EQ3 A;  1J4H A;  4IQC A;  2M08 A;  5HTG A;  1J4R A;  4TX0 A;  4DT4 A;  1Q6U A;  2ZR5 A;  1FKR A;  3UF8 A;  3RFW A;  2F2D A;  4MSP A;  1YW5 A;  2MNT A;  2MLY A;  1QPF A;  2DG4 A;  4DRM A;  2RUD A;  1W26 A;  3UI4 A;  3PA7 A;  1FKB A;  1D7I A;  3UQI A;  1EYM A;  2PPP A;  3OOB A;  5HT1 A;  4TNS A;  3O5P A;  4R0X A;  2ZQT A;  4U84 A;  5HW8 A;  1FKD A;  2MLX A;  4DRJ A;  1P5Q A;  1FKI A;  3UI5 A;  3MDY B;  3O5Q A;  3NI6 A;  4J4N A;  4LAV A;  4ODM A;  1QPL A;  4DRP A;  3WH0 A;  1D7J A;  1ROU A;  2RUC A;  3O5J A;  4U85 A;  3O5F A;  1U79 A;  3ODK A;  1R9H A;  4JFK A;  4DRI A;  1B6C A;  2RUQ A;  2PV1 A;  1BKF A;  1KT0 A;  2IF4 A;  4IQ2 A;  4JFI A;  5B8I C;  2KI3 A;  2LJ4 A;  2VN1 A;  2Y78 A;  3FAP A;  3O5E A;  4DZ3 A;  5HW7 A;  1FKL A;  4W9O A;  5I98 A;  2RQS A;  2FAP A;  1FKS A;  1NMW A;  2Q5A A;  1C9H A;  2RUR A;  1Y0O A;  4W9Q A;  4IPX A;  1T11 A;  3EY6 A;  4ODL A;  3IKG A;  3GPK A;  3LUO A;  2MPH A;  2ZQU A;  3IKD A;  2ZR4 A;  1L1P A;  4NNR A;  2ITK A;  1F40 A;  3I6C A;  4GIV A;  1FJD A;  5HW6 A;  1J4I A;  2MLZ A;  1FKK A;  3VAW A;  2PPN A;  1FKJ A;  2M1I A;  1FKT A;  3O5O A;  3O5G A;  3IHZ A;  4ODR A;  1FD9 A;  2KGJ A;  2L2S A;  2LKN A;  2N87 A;  3B7X A;  4JFJ A;  2XP4 A;  2LPV A;  4JFM A;  2K8I A;  4MGV A;  1YAT A;  1ROT A;  1A7X A;  2PV3 A;  5D75 A;  5HWB A;  3H9R B;  3O5L A;  1FAP A;  3KCE A;  1HXV A;  2LGO A;  1KT1 A;  2OFN A;  2RSE A;  2XP6 A;  3O5D A;  2DG9 A;  3KAI A;  4BF8 A;  3UQA A;  2ZQS A;  5GPG A;  3JXV A;  5HUA A;  3PRB A;  3O5R A;  1NMV A;  2KO7 A; 
#chains in the Genus database with same CATH topology
 3B9D A;  3TC5 A;  4QIB A;  4WKH A;  1VF8 A;  2XPA A;  5JH8 A;  4DRO A;  3IK8 A;  2WK2 A;  4ODP A;  3AS3 A;  1E6P A;  3KAH A;  4DH0 A;  1X6N A;  3PRD A;  4DRQ A;  1LQ0 A;  2AWG A;  3B9A A;  4ZPT R;  2KFW A;  1J6Y A;  2F4E A;  2DSW A;  3KAC A;  3KAF A;  2FDM A;  1OWQ A;  1M5Y A;  4QT2 A;  4LAW A;  3WD0 A;  1FFQ A;  4GGQ A;  4Z2G A;  5HKG A;  1NWS A;  4DRH A;  1RD6 A;  2MF9 A;  1ZK6 A;  2UZ5 A;  2F23 A;  4TW8 A;  4W9P A;  3RME A;  3WQV A;  5DIV A;  3JYM A;  3TDB A;  4KQZ A;  4JYS A;  3O5I A;  2G8Z A;  4IQC A;  4URI A;  3WD1 A;  4DT4 A;  4IT6 A;  1FKR A;  1YW5 A;  2MLY A;  2RUD A;  1W26 A;  3B8S A;  3ARO A;  1EYM A;  2PPP A;  4TNS A;  3O5P A;  4U84 A;  4DRJ A;  1FKI A;  3MDY B;  1HKM A;  4DRP A;  2P4V A;  2DT3 A;  2RUC A;  3GTY X;  1U79 A;  1LG1 A;  3ART A;  1B6C A;  2PV1 A;  4IQ2 A;  2IF4 A;  4S3K A;  1W1Y A;  5HW7 A;  1OGB A;  3CHD A;  1FKS A;  2Q5A A;  2RUR A;  1Y0O A;  4IT4 A;  1GRJ A;  4ZPW R;  5HBF A;  3GPK A;  3LUO A;  3IKD A;  4NSB A;  1HJW A;  2ITK A;  1F40 A;  1FKK A;  1ITX A;  1FKT A;  3EIP A;  2N87 A;  4JFJ A;  2AOS A;  5DF0 A;  1YAT A;  1ROT A;  1NWR A;  1JCH B;  1XHG A;  5D75 A;  3H9R B;  2LGO A;  4UDM A;  2XP6 A;  3PRB A;  1GOI A;  3O5R A;  4MNL A;  1NMV A;  1HKI A;  4C02 B;  4ZPV R;  1F8A B;  1SR0 A;  4DZ2 A;  3NTP A;  4QT3 A;  5DEZ A;  2XP5 A;  3QOK A;  4ODQ A;  1E6R A;  1N1A A;  1W1T A;  1FFR A;  4DIP A;  4LAX A;  3RGC A;  3JYJ A;  4DRK A;  5J6E A;  1XRV A;  4L72 B;  1ZB5 A;  2XP8 A;  4P8V A;  5GQB A;  3ALG A;  4TW6 A;  4FN2 A;  3TCZ A;  1BL4 A;  3KAG A;  4G2P A;  1D7H A;  2VCD A;  4HBO A;  4DWS B;  2XP7 A;  2WLY A;  1TCO C;  2IUZ A;  1ZCN A;  3ARV A;  2KR7 A;  3ARW A;  3PR9 A;  4P8U A;  2F21 A;  3B9E A;  5DIT A;  2B31 A;  4JFL A;  4FAP A;  5HTG A;  1J4R A;  4TX0 A;  4PTM A;  1IX5 A;  3RFW A;  4MSP A;  2DG4 A;  4DRM A;  4DWS D;  3UI4 A;  3UI5 A;  3O5Q A;  3NI6 A;  3ARZ A;  4LAV A;  1QPL A;  4U85 A;  3G6M A;  1EDQ A;  1R9H A;  4WKF A;  4DRI A;  1W9U A;  3WIJ A;  2LJ4 A;  1E6Z A;  1EHN A;  2RQS A;  1C9H A;  4MTV A;  3CH9 A;  1T11 A;  3EY6 A;  3ARP A;  1SYT A;  4Z2L A;  4MAV A;  2ZR4 A;  4GIV A;  3PRA A;  1KFW A;  1W9V A;  1J4I A;  2MLZ A;  3VAW A;  2M1I A;  3IHZ A;  2KGJ A;  1D2K A;  4JFM A;  2XP4 A;  4MGV A;  3AS0 A;  2O9O A;  1A7X A;  4DWS C;  5HWB A;  3RM8 A;  5GPR A;  3G6L A;  3O5D A;  1UR9 A;  2DG9 A;  1ZBC A;  2ZQS A;  4Q7N A;  2PV3 A;  2PI6 A;  4ODK A;  1FKG A;  2PPO A;  4N19 A;  1H0G A;  2DG3 A;  4ITZ A;  2ZR6 A;  4TYO A;  4ODN A;  2EUL A;  1Q1C A;  2XP9 A;  2A3E A;  2A3B A;  3CGM A;  4U86 A;  2DPE A;  3O5M A;  2ZQV A;  2WM0 A;  1JNT A;  1Q6I A;  5DO2 A;  4LAY A;  1PIN A;  1TFV A;  3KAD A;  5HWC A;  2JZV A;  1FKH A;  4J4O A;  2YBT A;  3KAB A;  4ML4 A;  4ODO A;  2PN0 A;  2DSZ A;  4L3N A;  3CZ8 A;  3ARR A;  5BXJ A;  3WL1 A;  1K9T A;  2YBU A;  1OGG A;  1Q6H A;  1EQ3 A;  2QF8 A;  2M08 A;  3WL0 A;  1Q6U A;  2F2D A;  3CHF A;  2MNT A;  1QPF A;  3ALF A;  1LJY A;  2DT2 A;  4MNM A;  1JND A;  3ARU A;  1NWU A;  1E6N A;  3OOB A;  5HT1 A;  2ZQT A;  1P5Q A;  4Q22 A;  4J4N A;  3AQU A;  1ROU A;  1W1V A;  3ODK A;  4P8W A;  1HJV A;  4JFK A;  1HKJ A;  2RUQ A;  4JFI A;  1BKF A;  1KT0 A;  1GPF A;  2OLH A;  5B8I C;  2DT1 A;  3RM9 A;  2KI3 A;  2VN1 A;  5I98 A;  3FAP A;  4DZ3 A;  4Z2I A;  1FKL A;  3W4R A;  2FAP A;  1NMW A;  1EIB A;  1ZL1 A;  4IPX A;  1LL4 A;  4ODL A;  2MPH A;  2ZQU A;  1WNO A;  4AY1 A;  4WIW A;  4NNR A;  1O6I A;  3WKZ A;  3GU0 A;  4WK9 A;  3O5G A;  4ODR A;  4Z2J A;  1FD9 A;  2LKN A;  4LGX A;  3B7X A;  2LPV A;  3OA5 A;  3FY1 A;  4P8X A;  1LG2 A;  1HXV A;  1W1P A;  1E9L A;  2OFN A;  1JNE A;  2RSE A;  5GPG A;  3JXV A;  1NH6 A;  3O5F A;  2Y78 A;  4TW7 A;  4Z2H A;  2O92 A;  1HKK A;  4ZS6 A;  3WD4 A;  3NRK A;  4MPK A;  2DT0 A;  5DIU A;  4R5E A;  2A3A A;  1LL6 A;  4DWS A;  2PV2 A;  1E44 A;  4KR0 B;  1ZBV A;  2B5U B;  1CTN A;  2XP3 A;  4HBE A;  4DRN A;  2ESC A;  2KE0 A;  2XPB A;  3WQW A;  1JVW A;  4W5U A;  3CHC A;  3O5K A;  3UQB A;  2PBC A;  1D6O A;  1NSG A;  2M2A A;  3CGN A;  1JNS A;  2FKE A;  3RM4 A;  3KZ7 A;  2D9F A;  4QZV B;  1QZ2 A;  4O2T A;  3ARQ A;  4WJX A;  4G50 A;  1WB0 A;  1FKF A;  3UI6 A;  4NZC A;  1PBK A;  3AS2 A;  1W9P A;  4MNJ A;  1J4H A;  3WD3 A;  2ZR5 A;  3UF8 A;  1GUV A;  3BXW A;  3AS1 A;  3PA7 A;  1FKB A;  1D7I A;  3UQI A;  5HW8 A;  4R0X A;  1FKD A;  2MLX A;  3BMB A;  4WKA A;  4Z2K A;  4ODM A;  3WH0 A;  1D7J A;  1ZU8 A;  3O5J A;  1WAW A;  3FXY A;  2A3C A;  3ARX A;  1NWT A;  1X6L A;  3O5E A;  4W9O A;  3CHE A;  1UR8 A;  4W9Q A;  1ZBW A;  3IKG A;  1HJX A;  2WLZ A;  1L1P A;  2DSV A;  3ARY A;  4XAK A;  2ETN A;  3I6C A;  1FJD A;  5HW6 A;  4S3J A;  4HAR A;  1H0I A;  2PPN A;  1FKJ A;  2DSU A;  3O5O A;  3ARS A;  2L2S A;  2K8I A;  2G41 A;  4MNK A;  3O5L A;  3KCE A;  1E15 A;  1FAP A;  1LL7 A;  1KT1 A;  3WD2 A;  3KAI A;  1ZBK A;  4BF8 A;  3UQA A;  5HUA A;  2KO7 A; 
#chains in the Genus database with same CATH homology
 3B9D A;  3TC5 A;  4QIB A;  4WKH A;  1VF8 A;  2XPA A;  5JH8 A;  4DRO A;  3IK8 A;  2WK2 A;  4ODP A;  3AS3 A;  1E6P A;  3KAH A;  4DH0 A;  1X6N A;  3PRD A;  4DRQ A;  1LQ0 A;  2AWG A;  3B9A A;  4ZPT R;  2KFW A;  1J6Y A;  2F4E A;  2DSW A;  3KAC A;  3KAF A;  2FDM A;  1OWQ A;  1M5Y A;  4QT2 A;  4LAW A;  3WD0 A;  1FFQ A;  4GGQ A;  4Z2G A;  5HKG A;  1NWS A;  4DRH A;  1RD6 A;  2MF9 A;  1ZK6 A;  2UZ5 A;  4TW8 A;  4W9P A;  3RME A;  3WQV A;  5DIV A;  3JYM A;  3TDB A;  4KQZ A;  4JYS A;  3O5I A;  2G8Z A;  4IQC A;  4URI A;  3WD1 A;  4DT4 A;  4IT6 A;  1FKR A;  1YW5 A;  2MLY A;  2RUD A;  1W26 A;  3B8S A;  3ARO A;  1EYM A;  2PPP A;  4TNS A;  3O5P A;  4U84 A;  4DRJ A;  1FKI A;  3MDY B;  1HKM A;  4DRP A;  2DT3 A;  2RUC A;  1U79 A;  1LG1 A;  3ART A;  1B6C A;  2PV1 A;  4IQ2 A;  2IF4 A;  4S3K A;  1W1Y A;  5HW7 A;  1OGB A;  3CHD A;  1FKS A;  2Q5A A;  2RUR A;  1Y0O A;  4IT4 A;  4ZPW R;  5HBF A;  3GPK A;  3LUO A;  3IKD A;  4NSB A;  1HJW A;  2ITK A;  1F40 A;  1FKK A;  1ITX A;  1FKT A;  2N87 A;  4JFJ A;  2AOS A;  5DF0 A;  1YAT A;  1ROT A;  1NWR A;  1XHG A;  5D75 A;  3H9R B;  2LGO A;  2XP6 A;  3PRB A;  3O5R A;  1GOI A;  4MNL A;  1NMV A;  1HKI A;  4C02 B;  4ZPV R;  1F8A B;  1SR0 A;  4DZ2 A;  3NTP A;  4QT3 A;  5DEZ A;  2XP5 A;  3QOK A;  4ODQ A;  1E6R A;  1N1A A;  1W1T A;  1FFR A;  4DIP A;  4LAX A;  3RGC A;  3JYJ A;  4DRK A;  5J6E A;  1XRV A;  4L72 B;  1ZB5 A;  2XP8 A;  4P8V A;  5GQB A;  3ALG A;  4TW6 A;  4FN2 A;  3TCZ A;  1BL4 A;  3KAG A;  4G2P A;  1D7H A;  2VCD A;  4HBO A;  4DWS B;  2XP7 A;  2WLY A;  1TCO C;  2IUZ A;  1ZCN A;  3ARV A;  2KR7 A;  3ARW A;  3PR9 A;  4P8U A;  2F21 A;  3B9E A;  5DIT A;  2B31 A;  4JFL A;  4FAP A;  5HTG A;  1J4R A;  4TX0 A;  4PTM A;  1IX5 A;  3RFW A;  4MSP A;  2DG4 A;  4DRM A;  4DWS D;  3UI4 A;  3UI5 A;  3O5Q A;  3NI6 A;  3ARZ A;  4LAV A;  1QPL A;  4U85 A;  3G6M A;  1EDQ A;  1R9H A;  4WKF A;  4DRI A;  1W9U A;  3WIJ A;  2LJ4 A;  1E6Z A;  1EHN A;  2RQS A;  1C9H A;  4MTV A;  3CH9 A;  1T11 A;  3EY6 A;  3ARP A;  1SYT A;  4Z2L A;  4MAV A;  2ZR4 A;  4GIV A;  3PRA A;  1KFW A;  1W9V A;  1J4I A;  2MLZ A;  3VAW A;  2M1I A;  3IHZ A;  2KGJ A;  1D2K A;  4JFM A;  2XP4 A;  4MGV A;  3AS0 A;  2O9O A;  1A7X A;  4DWS C;  5HWB A;  3RM8 A;  5GPR A;  3G6L A;  3O5D A;  1UR9 A;  2DG9 A;  1ZBC A;  2ZQS A;  4Q7N A;  2PV3 A;  2PI6 A;  4ODK A;  1FKG A;  2PPO A;  4N19 A;  1H0G A;  2DG3 A;  4ITZ A;  2ZR6 A;  4TYO A;  4ODN A;  1Q1C A;  2XP9 A;  2A3E A;  2A3B A;  3CGM A;  4U86 A;  2DPE A;  3O5M A;  2ZQV A;  2WM0 A;  1JNT A;  1Q6I A;  5DO2 A;  4LAY A;  1PIN A;  1TFV A;  3KAD A;  5HWC A;  2JZV A;  1FKH A;  4J4O A;  2YBT A;  3KAB A;  4ML4 A;  4ODO A;  2DSZ A;  4L3N A;  3CZ8 A;  3ARR A;  5BXJ A;  3WL1 A;  1K9T A;  2YBU A;  1OGG A;  1Q6H A;  1EQ3 A;  2QF8 A;  2M08 A;  3WL0 A;  1Q6U A;  2F2D A;  3CHF A;  2MNT A;  1QPF A;  3ALF A;  1LJY A;  2DT2 A;  4MNM A;  1JND A;  3ARU A;  1NWU A;  1E6N A;  3OOB A;  5HT1 A;  2ZQT A;  1P5Q A;  4Q22 A;  4J4N A;  3AQU A;  1ROU A;  1W1V A;  3ODK A;  4P8W A;  1HJV A;  4JFK A;  1HKJ A;  2RUQ A;  4JFI A;  1BKF A;  1KT0 A;  1GPF A;  2OLH A;  5B8I C;  2DT1 A;  3RM9 A;  2KI3 A;  2VN1 A;  5I98 A;  3FAP A;  4DZ3 A;  4Z2I A;  1FKL A;  3W4R A;  2FAP A;  1NMW A;  1EIB A;  1ZL1 A;  4IPX A;  1LL4 A;  4ODL A;  2MPH A;  2ZQU A;  1WNO A;  4AY1 A;  4WIW A;  4NNR A;  1O6I A;  3WKZ A;  4WK9 A;  3O5G A;  4ODR A;  4Z2J A;  1FD9 A;  2LKN A;  4LGX A;  3B7X A;  2LPV A;  3OA5 A;  3FY1 A;  4P8X A;  1LG2 A;  1HXV A;  1W1P A;  1E9L A;  2OFN A;  1JNE A;  2RSE A;  5GPG A;  3JXV A;  1NH6 A;  3O5F A;  2Y78 A;  4TW7 A;  4Z2H A;  2O92 A;  1HKK A;  4ZS6 A;  3WD4 A;  3NRK A;  4MPK A;  2DT0 A;  5DIU A;  4R5E A;  2A3A A;  1LL6 A;  4DWS A;  2PV2 A;  4KR0 B;  1ZBV A;  1CTN A;  2XP3 A;  4HBE A;  4DRN A;  2ESC A;  2KE0 A;  2XPB A;  3WQW A;  1JVW A;  4W5U A;  3CHC A;  3O5K A;  3UQB A;  2PBC A;  1D6O A;  1NSG A;  2M2A A;  3CGN A;  1JNS A;  2FKE A;  3RM4 A;  3KZ7 A;  2D9F A;  4QZV B;  1QZ2 A;  4O2T A;  3ARQ A;  4WJX A;  4G50 A;  1WB0 A;  1FKF A;  3UI6 A;  4NZC A;  1PBK A;  3AS2 A;  1W9P A;  4MNJ A;  1J4H A;  3WD3 A;  2ZR5 A;  3UF8 A;  1GUV A;  3BXW A;  3AS1 A;  3PA7 A;  1FKB A;  1D7I A;  3UQI A;  5HW8 A;  4R0X A;  1FKD A;  2MLX A;  4WKA A;  4Z2K A;  4ODM A;  3WH0 A;  1D7J A;  1ZU8 A;  3O5J A;  1WAW A;  3FXY A;  2A3C A;  3ARX A;  1NWT A;  1X6L A;  3O5E A;  4W9O A;  3CHE A;  1UR8 A;  4W9Q A;  1ZBW A;  3IKG A;  1HJX A;  2WLZ A;  1L1P A;  2DSV A;  3ARY A;  4XAK A;  3I6C A;  1FJD A;  5HW6 A;  4S3J A;  4HAR A;  1H0I A;  2PPN A;  1FKJ A;  2DSU A;  3O5O A;  3ARS A;  2L2S A;  2K8I A;  2G41 A;  4MNK A;  3O5L A;  3KCE A;  1E15 A;  1FAP A;  1LL7 A;  1KT1 A;  3WD2 A;  3KAI A;  1ZBK A;  4BF8 A;  3UQA A;  5HUA A;  2KO7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...