1EYMA

Fk506 binding protein mutant, homodimeric complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKMDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 BINDING PROTEIN
publication title A ligand-reversible dimerization system for controlling protein-protein interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 27
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2000-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1eymA00
4TW8A 3MDYB 4JFIA 3O5GA 3WH0A 1FAPA 1FKTA 1M5YA 4ITZA 3TC5A 3I6CA 4FAPA 5HWBA 2VCDA 5J6EA 4DIPA 2XP9A 1J4IA 1FKJA 1FKLA 3B7XA 3KAIA 1FKKA 2FAPA 2MLYA 3FAPA 2RUQA 4JFLA 3UQBA 5HT1A 4W9OA 4DROA 5HW6A 4ODMA 3JYJA 1JVWA 3NRKA 4TNSA 2KE0A 2ITKA 2MPHA 2XP8A 5B8IC 2XP3A 3KAHA 2PPOA 4QT3A 4IQCA 1QPLA 4DRIA 4DRQA 1KT1A 2D9FA 4JFMA 1FKSA 2KGJA 1PINA 1Q6IA 4J4NA 3OOBA 4G2PA 1EYMA 3GPKA 2PPPA 3NTPA 3O5OA 2LKNA 1ZK6A 2PV2A 4ODQA 2M2AA 4LAYA 5BXJA 1FD9A 3TCZA 2LPVA 2M1IA 4QT2A 3TDBA 2MLZA 1Q6UA 4ODLA 1QZ2A 3VAWA 3ODKA 2ZQSA 3JYMA 1D6OA 3CGMA 3O5IA 4DRPA 1A7XA 2PBCA 2ZQVA 2RUDA 3O5JA 1J6YA 1ROTA 1ZCNA 2LGOA 4IPXA 4U85A 3KAFA 1NMWA 3PA7A 1W26A 2MNTA 3RGCA 3KABA 4TW6A 5DIUA 2ZR6A 4U84A 5DIVA 5HW7A 2LJ4A 4R0XA 1R9HA 2XP4A 2ZQUA 1KT0A 1U79A 4W9QA 2XP7A 3JXVA 3KACA 1Y0OA 3KZ7A 4LAWA 4W9PA 2UZ5A 3O5PA 3UQIA 3NI6A 4TYOA 2XP5A 1T11A 1F40A 4GIVA 1BL4A 4ODRA 4DRKA 3O5QA 2DG3A 4FN2A 4IQ2A 5HKGA 3LUOA 1F8AB 4GGQA 4ODKA 3UF8A 2VN1A 3PRDA 2MF9A 1C9HA 4ODPA 3O5MA 2K8IA 2DG4A 2KFWA 2ZR5A 1EQ3A 4G50A 3IK8A 1FKGA 3O5LA 1D7IA 4DRHA 1NSGA 1YW5A 2F2DA 2N87A 2RURA 3UI6A 1L1PA 3IHZA 2RSEA 2IF4A 3PRBA 3UI5A 2KI3A 3O5FA 4BF8A 3EY6A 2DG9A 1HXVA 2XP6A 3KADA 1TCOC 4ODNA 1N1AA 2XPBA 2OFNA 2ZR4A 4J4OA 1JNSA 5HWCA 4TW7A 2ZQTA 1ROUA 4DH0A 1B6CA 2JZVA 2KO7A 3H9RB 4U86A 5DITA 3KAGA 4DRNA 5HUAA 2RUCA 1FKFA 5I98A 5HTGA 2RQSA 4ODOA 3O5KA 4DZ3A 4DZ2A 3IKDA 4MSPA 3RFWA 1FKIA 1QPFA 2AWGA 2Q5AA 1FKHA 4MGVA 4O2TA 5D75A 4DT4A 2XPAA 4JYSA 3KCEA 2MLXA 5GPGA 3UQAA 5HW8A 2PPNA 1FKBA 3O5EA 4JFKA 4N19A 1Q6HA 1D7HA 2PV1A 1P5QA 2Y78A 4LAVA 1JNTA 2L2SA 1Q1CA 4C02B 4DRMA 1YATA 2F4EA 3UI4A 1J4RA 1FJDA 4NNRA 4QIBA 2PV3A 4LAXA 2M08A 4JFJA 2KR7A 1PBKA 1D7JA 1FKDA 1NMVA 4DRJA 1FKRA 3O5RA 2F21A 1BKFA 2FKEA 3IKGA 4TX0A 3CGNA 1J4HA 3O5DA
chains in the Genus database with same CATH superfamily
1EIBA 1XRVA 4DWSA 1SYTA 1X6NA 4DIPA 1HKKA 1J4IA 3B7XA 1FKLA 2FAPA 3AS3A 3WQVA 4W9OA 4DROA 2YBTA 2ESCA 3FXYA 3JYJA 2KE0A 4DRQA 1FKSA 1NWRA 2KGJA 1Q6IA 4MNMA 3GPKA 3NTPA 5GPRA 3FY1A 4ZS6A 1GUVA 3RMEA 2WM0A 3JYMA 3O5IA 2WLYA 3KAFA 3PA7A 1W26A 2MNTA 3WQWA 3KABA 4IT4A 4TW6A 5HW7A 1KT0A 4W9QA 2XP7A 4L72B 3JXVA 1Y0OA 3KZ7A 4TYOA 1F40A 1BL4A 1JNDA 2DG3A 5HKGA 1F8AB 3AS2A 1C9HA 1OGBA 4MNLA 2K8IA 3RM4A 3B9EA 1H0GA 1EQ3A 1E44A 3GTYX 3O5LA 4MTVA 1L1PA 2DSWA 3B9DA 3CH9A 2KI3A 1GRJA 1W1TA 4S3JA 2OFNA 1LL7A 2ZR4A 4ZPTR 4TW7A 4MPKA 3ARQA 4U86A 5DO2A 3KAGA 3CHDA 2RUCA 1FKFA 5HTGA 2RQSA 3O5KA 4DZ3A 4QZVB 2PI6A 2DSUA 5HBFA 1FKIA 1QPFA 1FKHA 4DT4A 2PPNA 1FKBA 1RD6A 4N19A 1Q6HA 3WD0A 1D7HA 2Y78A 2F23A 2L2SA 1ZBWA 2F4EA 4WKHA 2PV3A 4LAXA 1OGGA 1PBKA 1D7JA 1FKDA 1X6LA 3ALGA 4URIA 3MDYB 3AQUA 1LJYA 2G41A 4MAVA 3GU0A 3G6LA 4P8XA 4Z2KA 4JFLA 3FAPA 3UQBA 4WKFA 1O6IA 3PR9A 1JVWA 2MPHA 2XP3A 5DF0A 4QT3A 1PINA 2A3AA 1ZK6A 3ARXA 2M2AA 1ZB5A 4LAYA 1FD9A 3TCZA 5BXJA 2M1IA 4QT2A 4Z2LA 1QZ2A 3VAWA 3WD3A 4DRPA 4P8VA 1FFQA 4HBOA 3RM8A 3O5JA 1ZCNA 3B9AA 1W1YA 4Q7NA 5DIVA 2ZR6A 4U84A 2O92A 2LJ4A 3AS1A 2ZQUA 4DWSB 1ZL1A 3O5PA 3UQIA 3NI6A 2XP5A 4ODRA 4DRKA 1W9VA 2DT2A 4IQ2A 3LUOA 4ODKA 3ARRA 1E15A 3O5MA 4MNKA 1JNEA 1NWTA 3WD1A 1D7IA 1LG1A 2F2DA 3UI6A 4DRHA 4Z2JA 3IHZA 2RSEA 3ARWA 4BF8A 3EY6A 2DG9A 2XP6A 1N1AA 1W1VA 1HJWA 2WK2A 1JNSA 2ZQTA 1ROUA 1B6CA 4ZPVR 1ZBVA 4WK9A 5I98A 1WNOA 1E6RA 1NWUA 4WIWA 3RFWA 4ML4A 5D75A 4P8WA 2XPAA 4JYSA 3AS0A 2DT1A 1JNTA 4Z2GA 3CHCA 1FJDA 4NNRA 3WD4A 1HKIA 1ZU8A 2M08A 4DRJA 1BKFA 1E9LA 4JFIA 2B5UB 1FKTA 1M5YA 4ITZA 5J6EA 3I6CA 2EULA 3ARZA 4MNJA 2P4VA 2RUQA 1WB0A 5HT1A 5HW6A 4W5UA 2XP8A 1QPLA 2A3BA 4DRIA 1KT1A 4HBEA 2WLZA 4J4NA 1EYMA 2G8ZA 2PPPA 2FDMA 2LKNA 3O5OA 3ARVA 3TDBA 1HJXA 1Q6UA 4ODLA 1LL4A 1D6OA 3CGMA 1ITXA 3ARTA 2PBCA 1J6YA 1ROTA 4IPXA 5HWCA 3RGCA 1E6PA 4Z2HA 1FFRA 4DWSC 1R9HA 5GQBA 3KACA 4LAWA 4W9PA 2B31A 3ARUA 1UR9A 3O5QA 2A3EA 1W1PA 4GGQA 3UF8A 4IT6A 2VN1A 4ODPA 4R5EA 1VF8A 2DG4A 4NSBA 2ZR5A 4G50A 1FKGA 2N87A 3CHFA 1LG2A 2IF4A 1HJVA 4LGXA 1HXVA 1SR0A 1TCOC 1H0IA 4J4OA 4P8UA 3ALFA 3WIJA 3EIPA 2JZVA 2AOSA 2IUZA 5DITA 4DRNA 5HUAA 3WD2A 4ODOA 1IX5A 4DZ2A 3IKDA 4MSPA 1E6ZA 2AWGA 4MGVA 4O2TA 3ARYA 3KCEA 2MLXA 3W4RA 3UQAA 3O5EA 2PV1A 1P5QA 1Q1CA 4KQZA 1KFWA 2DSZA 3UI4A 1EDQA 4QIBA 4WKAA 1D2KA 3BMBA 3WL1A 1K9TA 1LQ0A 4JFJA 2KR7A 1FKRA 1NMVA 3O5RA 2FKEA 3PRAA 3IKGA 4TX0A 4PTMA 1J4HA 3RM9A 3O5DA 4Z2IA 4TW8A 1HKMA 3O5GA 3WH0A 1FAPA 4FAPA 3TC5A 5HWBA 2VCDA 1ZBCA 4L3NA 5DEZA 3KAIA 2XP9A 1FKJA 2A3CA 1UR8A 1FKKA 2MLYA 4ODMA 3NRKA 4TNSA 2ETNA 4UDMA 2ITKA 5B8IC 1WAWA 3KAHA 2PPOA 4IQCA 1NWSA 2D9FA 4JFMA 1HKJA 2O9OA 3OOBA 1JCHB 2PN0A 3WKZA 1E6NA 2PV2A 4ODQA 3G6MA 2LPVA 2DSVA 2MLZA 3ODKA 2ZQSA 4WJXA 1A7XA 3B8SA 1LL6A 2ZQVA 2RUDA 2LGOA 4U85A 1NMWA 1XHGA 5DIUA 1TFVA 4R0XA 2DT0A 2XP4A 1U79A 4S3KA 2YBUA 4KR0B 2UZ5A 2QF8A 1T11A 4GIVA 4FN2A 1CTNA 3PRDA 2MF9A 4AY1A 4DWSD 2KFWA 3ARSA 3CZ8A 1ZBKA 3IK8A 2OLHA 1W9PA 3WL0A 1NSGA 1YW5A 4Q22A 5JH8A 2RURA 2DT3A 1OWQA 3PRBA 3UI5A 3O5FA 1W9UA 1NH6A 1EHNA 3KADA 4ODNA 3AROA 4HARA 2XPBA 3CHEA 1GOIA 4DH0A 4XAKA 2KO7A 3H9RB 2DPEA 2Q5AA 5GPGA 5HW8A 3OA5A 4JFKA 4LAVA 4DRMA 4C02B 1YATA 1J4RA 3BXWA 3QOKA 1GPFA 2F21A 4NZCA 4ZPWR 3ARPA 3CGNA 4G2PA
chains in the Genus database with same CATH topology
1EIBA 1XRVA 4DWSA 1SYTA 1X6NA 4DIPA 1HKKA 1J4IA 3B7XA 1FKLA 2FAPA 3AS3A 3WQVA 4W9OA 4DROA 2YBTA 2ESCA 3FXYA 3JYJA 2KE0A 4DRQA 1FKSA 1NWRA 2KGJA 1Q6IA 4MNMA 3GPKA 3NTPA 5GPRA 3FY1A 4ZS6A 1GUVA 3RMEA 2WM0A 3JYMA 3O5IA 2WLYA 3KAFA 3PA7A 1W26A 2MNTA 3WQWA 3KABA 4IT4A 4TW6A 5HW7A 1KT0A 4W9QA 2XP7A 4L72B 3JXVA 1Y0OA 3KZ7A 4TYOA 1F40A 1BL4A 1JNDA 2DG3A 5HKGA 1F8AB 3AS2A 1C9HA 1OGBA 4MNLA 2K8IA 3RM4A 3B9EA 1H0GA 1EQ3A 3O5LA 4MTVA 1L1PA 2DSWA 3B9DA 3CH9A 2KI3A 1W1TA 4S3JA 2OFNA 1LL7A 2ZR4A 4ZPTR 4TW7A 4MPKA 3ARQA 4U86A 5DO2A 3KAGA 3CHDA 2RUCA 1FKFA 5HTGA 2RQSA 3O5KA 4DZ3A 4QZVB 2PI6A 2DSUA 5HBFA 1FKIA 1QPFA 1FKHA 4DT4A 2PPNA 1FKBA 1RD6A 4N19A 1Q6HA 3WD0A 1D7HA 2Y78A 2L2SA 1ZBWA 2F4EA 4WKHA 2PV3A 4LAXA 1OGGA 1PBKA 1D7JA 1FKDA 1X6LA 3ALGA 4URIA 3MDYB 3AQUA 1LJYA 2G41A 4MAVA 3G6LA 4P8XA 4Z2KA 4JFLA 3FAPA 3UQBA 4WKFA 1O6IA 3PR9A 1JVWA 2MPHA 2XP3A 5DF0A 4QT3A 1PINA 2A3AA 1ZK6A 3ARXA 2M2AA 1ZB5A 4LAYA 1FD9A 3TCZA 5BXJA 2M1IA 4QT2A 4Z2LA 1QZ2A 3VAWA 3WD3A 4DRPA 4P8VA 1FFQA 4HBOA 3RM8A 3O5JA 1ZCNA 3B9AA 1W1YA 4Q7NA 5DIVA 2ZR6A 4U84A 2O92A 2LJ4A 3AS1A 2ZQUA 4DWSB 1ZL1A 3O5PA 3UQIA 3NI6A 2XP5A 4ODRA 4DRKA 1W9VA 2DT2A 4IQ2A 3LUOA 4ODKA 3ARRA 1E15A 3O5MA 4MNKA 1JNEA 1NWTA 3WD1A 1D7IA 1LG1A 2F2DA 3UI6A 4DRHA 4Z2JA 3IHZA 2RSEA 3ARWA 4BF8A 3EY6A 2DG9A 2XP6A 1N1AA 1W1VA 1HJWA 2WK2A 1JNSA 2ZQTA 1ROUA 1B6CA 4ZPVR 1ZBVA 4WK9A 5I98A 1WNOA 1E6RA 1NWUA 4WIWA 3RFWA 4ML4A 5D75A 4P8WA 2XPAA 4JYSA 3AS0A 2DT1A 1JNTA 4Z2GA 3CHCA 1FJDA 4NNRA 3WD4A 1HKIA 1ZU8A 2M08A 4DRJA 1BKFA 1E9LA 4JFIA 1FKTA 1M5YA 4ITZA 5J6EA 3I6CA 3ARZA 4MNJA 2RUQA 1WB0A 5HT1A 5HW6A 4W5UA 2XP8A 1QPLA 2A3BA 4DRIA 1KT1A 4HBEA 2WLZA 4J4NA 1EYMA 2G8ZA 2PPPA 2FDMA 2LKNA 3O5OA 3ARVA 3TDBA 1HJXA 1Q6UA 4ODLA 1LL4A 1D6OA 3CGMA 1ITXA 3ARTA 2PBCA 1J6YA 1ROTA 4IPXA 5HWCA 3RGCA 1E6PA 4Z2HA 1FFRA 4DWSC 1R9HA 5GQBA 3KACA 4LAWA 4W9PA 2B31A 3ARUA 1UR9A 3O5QA 2A3EA 1W1PA 4GGQA 3UF8A 4IT6A 2VN1A 4ODPA 4R5EA 1VF8A 2DG4A 4NSBA 2ZR5A 4G50A 1FKGA 2N87A 3CHFA 1LG2A 2IF4A 1HJVA 4LGXA 1HXVA 1SR0A 1TCOC 1H0IA 4J4OA 4P8UA 3ALFA 3WIJA 2JZVA 2AOSA 2IUZA 5DITA 4DRNA 5HUAA 3WD2A 4ODOA 1IX5A 4DZ2A 3IKDA 4MSPA 1E6ZA 2AWGA 4MGVA 4O2TA 3ARYA 3KCEA 2MLXA 3W4RA 3UQAA 3O5EA 2PV1A 1P5QA 1Q1CA 4KQZA 1KFWA 2DSZA 3UI4A 1EDQA 4QIBA 4WKAA 1D2KA 3WL1A 1K9TA 1LQ0A 4JFJA 2KR7A 1FKRA 1NMVA 3O5RA 2FKEA 3PRAA 3IKGA 4TX0A 4PTMA 1J4HA 3RM9A 3O5DA 4Z2IA 4TW8A 1HKMA 3O5GA 3WH0A 1FAPA 4FAPA 3TC5A 5HWBA 2VCDA 1ZBCA 4L3NA 5DEZA 2XP9A 3KAIA 1FKJA 2A3CA 1UR8A 1FKKA 2MLYA 4ODMA 3NRKA 4TNSA 2ITKA 5B8IC 1WAWA 3KAHA 2PPOA 4IQCA 1NWSA 2D9FA 4JFMA 1HKJA 2O9OA 3OOBA 3WKZA 1E6NA 2PV2A 4ODQA 3G6MA 2LPVA 2DSVA 2MLZA 3ODKA 2ZQSA 4WJXA 1A7XA 3B8SA 1LL6A 2ZQVA 2RUDA 2LGOA 4U85A 1NMWA 1XHGA 5DIUA 1TFVA 4R0XA 2DT0A 2XP4A 1U79A 4S3KA 2YBUA 4KR0B 2UZ5A 2QF8A 1T11A 4GIVA 4FN2A 1CTNA 3PRDA 2MF9A 4AY1A 4DWSD 2KFWA 3ARSA 3CZ8A 1ZBKA 3IK8A 2OLHA 1W9PA 3WL0A 1NSGA 1YW5A 4Q22A 5JH8A 2RURA 2DT3A 1OWQA 3PRBA 3UI5A 3O5FA 1W9UA 1NH6A 1EHNA 3KADA 4ODNA 3AROA 4HARA 2XPBA 3CHEA 1GOIA 4DH0A 4XAKA 2KO7A 3H9RB 2DPEA 2Q5AA 5GPGA 5HW8A 3OA5A 4JFKA 4LAVA 4DRMA 4C02B 1YATA 1J4RA 3BXWA 3QOKA 1GPFA 2F21A 4NZCA 4ZPWR 3ARPA 3CGNA 4G2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TW8 A;  3MDY B;  4JFI A;  3O5G A;  3WH0 A;  1FAP A;  1FKT A;  1M5Y A;  4ITZ A;  3TC5 A;  3I6C A;  4FAP A;  5HWB A;  2VCD A;  5J6E A;  4DIP A;  2XP9 A;  1J4I A;  1FKJ A;  1FKL A;  3B7X A;  3KAI A;  1FKK A;  2FAP A;  2MLY A;  3FAP A;  2RUQ A;  4JFL A;  3UQB A;  5HT1 A;  4W9O A;  4DRO A;  5HW6 A;  4ODM A;  3JYJ A;  1JVW A;  3NRK A;  4TNS A;  2KE0 A;  2ITK A;  2MPH A;  2XP8 A;  5B8I C;  2XP3 A;  3KAH A;  2PPO A;  4QT3 A;  4IQC A;  1QPL A;  4DRI A;  4DRQ A;  1KT1 A;  2D9F A;  4JFM A;  1FKS A;  2KGJ A;  1PIN A;  1Q6I A;  4J4N A;  3OOB A;  4G2P A;  1EYM A;  3GPK A;  2PPP A;  3NTP A;  3O5O A;  2LKN A;  1ZK6 A;  2PV2 A;  4ODQ A;  2M2A A;  4LAY A;  5BXJ A;  1FD9 A;  3TCZ A;  2LPV A;  2M1I A;  4QT2 A;  3TDB A;  2MLZ A;  1Q6U A;  4ODL A;  1QZ2 A;  3VAW A;  3ODK A;  2ZQS A;  3JYM A;  1D6O A;  3CGM A;  3O5I A;  4DRP A;  1A7X A;  2PBC A;  2ZQV A;  2RUD A;  3O5J A;  1J6Y A;  1ROT A;  1ZCN A;  2LGO A;  4IPX A;  4U85 A;  3KAF A;  1NMW A;  3PA7 A;  1W26 A;  2MNT A;  3RGC A;  3KAB A;  4TW6 A;  5DIU A;  2ZR6 A;  4U84 A;  5DIV A;  5HW7 A;  2LJ4 A;  4R0X A;  1R9H A;  2XP4 A;  2ZQU A;  1KT0 A;  1U79 A;  4W9Q A;  2XP7 A;  3JXV A;  3KAC A;  1Y0O A;  3KZ7 A;  4LAW A;  4W9P A;  2UZ5 A;  3O5P A;  3UQI A;  3NI6 A;  4TYO A;  2XP5 A;  1T11 A;  1F40 A;  4GIV A;  1BL4 A;  4ODR A;  4DRK A;  3O5Q A;  2DG3 A;  4FN2 A;  4IQ2 A;  5HKG A;  3LUO A;  1F8A B;  4GGQ A;  4ODK A;  3UF8 A;  2VN1 A;  3PRD A;  2MF9 A;  1C9H A;  4ODP A;  3O5M A;  2K8I A;  2DG4 A;  2KFW A;  2ZR5 A;  1EQ3 A;  4G50 A;  3IK8 A;  1FKG A;  3O5L A;  1D7I A;  4DRH A;  1NSG A;  1YW5 A;  2F2D A;  2N87 A;  2RUR A;  3UI6 A;  1L1P A;  3IHZ A;  2RSE A;  2IF4 A;  3PRB A;  3UI5 A;  2KI3 A;  3O5F A;  4BF8 A;  3EY6 A;  2DG9 A;  1HXV A;  2XP6 A;  3KAD A;  1TCO C;  4ODN A;  1N1A A;  2XPB A;  2OFN A;  2ZR4 A;  4J4O A;  1JNS A;  5HWC A;  4TW7 A;  2ZQT A;  1ROU A;  4DH0 A;  1B6C A;  2JZV A;  2KO7 A;  3H9R B;  4U86 A;  5DIT A;  3KAG A;  4DRN A;  5HUA A;  2RUC A;  1FKF A;  5I98 A;  5HTG A;  2RQS A;  4ODO A;  3O5K A;  4DZ3 A;  4DZ2 A;  3IKD A;  4MSP A;  3RFW A;  1FKI A;  1QPF A;  2AWG A;  2Q5A A;  1FKH A;  4MGV A;  4O2T A;  5D75 A;  4DT4 A;  2XPA A;  4JYS A;  3KCE A;  2MLX A;  5GPG A;  3UQA A;  5HW8 A;  2PPN A;  1FKB A;  3O5E A;  4JFK A;  4N19 A;  1Q6H A;  1D7H A;  2PV1 A;  1P5Q A;  2Y78 A;  4LAV A;  1JNT A;  2L2S A;  1Q1C A;  4C02 B;  4DRM A;  1YAT A;  2F4E A;  3UI4 A;  1J4R A;  1FJD A;  4NNR A;  4QIB A;  2PV3 A;  4LAX A;  2M08 A;  4JFJ A;  2KR7 A;  1PBK A;  1D7J A;  1FKD A;  1NMV A;  4DRJ A;  1FKR A;  3O5R A;  2F21 A;  1BKF A;  2FKE A;  3IKG A;  4TX0 A;  3CGN A;  1J4H A;  3O5D A; 
#chains in the Genus database with same CATH topology
 1EIB A;  1XRV A;  4DWS A;  1SYT A;  1X6N A;  4DIP A;  1HKK A;  1J4I A;  3B7X A;  1FKL A;  2FAP A;  3AS3 A;  3WQV A;  4W9O A;  4DRO A;  2YBT A;  2ESC A;  3FXY A;  3JYJ A;  2KE0 A;  4DRQ A;  1FKS A;  1NWR A;  2KGJ A;  1Q6I A;  4MNM A;  3GPK A;  3NTP A;  5GPR A;  3FY1 A;  4ZS6 A;  1GUV A;  3RME A;  2WM0 A;  3JYM A;  3O5I A;  2WLY A;  3KAF A;  3PA7 A;  1W26 A;  2MNT A;  3WQW A;  3KAB A;  4IT4 A;  4TW6 A;  5HW7 A;  1KT0 A;  4W9Q A;  2XP7 A;  4L72 B;  3JXV A;  1Y0O A;  3KZ7 A;  4TYO A;  1F40 A;  1BL4 A;  1JND A;  2DG3 A;  5HKG A;  1F8A B;  3AS2 A;  1C9H A;  1OGB A;  4MNL A;  2K8I A;  3RM4 A;  3B9E A;  1H0G A;  1EQ3 A;  1E44 A;  3GTY X;  3O5L A;  4MTV A;  1L1P A;  2DSW A;  3B9D A;  3CH9 A;  2KI3 A;  1GRJ A;  1W1T A;  4S3J A;  2OFN A;  1LL7 A;  2ZR4 A;  4ZPT R;  4TW7 A;  4MPK A;  3ARQ A;  4U86 A;  5DO2 A;  3KAG A;  3CHD A;  2RUC A;  1FKF A;  5HTG A;  2RQS A;  3O5K A;  4DZ3 A;  4QZV B;  2PI6 A;  2DSU A;  5HBF A;  1FKI A;  1QPF A;  1FKH A;  4DT4 A;  2PPN A;  1FKB A;  1RD6 A;  4N19 A;  1Q6H A;  3WD0 A;  1D7H A;  2Y78 A;  2F23 A;  2L2S A;  1ZBW A;  2F4E A;  4WKH A;  2PV3 A;  4LAX A;  1OGG A;  1PBK A;  1D7J A;  1FKD A;  1X6L A;  3ALG A;  4URI A;  3MDY B;  3AQU A;  1LJY A;  2G41 A;  4MAV A;  3GU0 A;  3G6L A;  4P8X A;  4Z2K A;  4JFL A;  3FAP A;  3UQB A;  4WKF A;  1O6I A;  3PR9 A;  1JVW A;  2MPH A;  2XP3 A;  5DF0 A;  4QT3 A;  1PIN A;  2A3A A;  1ZK6 A;  3ARX A;  2M2A A;  1ZB5 A;  4LAY A;  1FD9 A;  3TCZ A;  5BXJ A;  2M1I A;  4QT2 A;  4Z2L A;  1QZ2 A;  3VAW A;  3WD3 A;  4DRP A;  4P8V A;  1FFQ A;  4HBO A;  3RM8 A;  3O5J A;  1ZCN A;  3B9A A;  1W1Y A;  4Q7N A;  5DIV A;  2ZR6 A;  4U84 A;  2O92 A;  2LJ4 A;  3AS1 A;  2ZQU A;  4DWS B;  1ZL1 A;  3O5P A;  3UQI A;  3NI6 A;  2XP5 A;  4ODR A;  4DRK A;  1W9V A;  2DT2 A;  4IQ2 A;  3LUO A;  4ODK A;  3ARR A;  1E15 A;  3O5M A;  4MNK A;  1JNE A;  1NWT A;  3WD1 A;  1D7I A;  1LG1 A;  2F2D A;  3UI6 A;  4DRH A;  4Z2J A;  3IHZ A;  2RSE A;  3ARW A;  4BF8 A;  3EY6 A;  2DG9 A;  2XP6 A;  1N1A A;  1W1V A;  1HJW A;  2WK2 A;  1JNS A;  2ZQT A;  1ROU A;  1B6C A;  4ZPV R;  1ZBV A;  4WK9 A;  5I98 A;  1WNO A;  1E6R A;  1NWU A;  4WIW A;  3RFW A;  4ML4 A;  5D75 A;  4P8W A;  2XPA A;  4JYS A;  3AS0 A;  2DT1 A;  1JNT A;  4Z2G A;  3CHC A;  1FJD A;  4NNR A;  3WD4 A;  1HKI A;  1ZU8 A;  2M08 A;  4DRJ A;  1BKF A;  1E9L A;  4JFI A;  2B5U B;  1FKT A;  1M5Y A;  4ITZ A;  5J6E A;  3I6C A;  2EUL A;  3ARZ A;  4MNJ A;  2P4V A;  2RUQ A;  1WB0 A;  5HT1 A;  5HW6 A;  4W5U A;  2XP8 A;  1QPL A;  2A3B A;  4DRI A;  1KT1 A;  4HBE A;  2WLZ A;  4J4N A;  1EYM A;  2G8Z A;  2PPP A;  2FDM A;  2LKN A;  3O5O A;  3ARV A;  3TDB A;  1HJX A;  1Q6U A;  4ODL A;  1LL4 A;  1D6O A;  3CGM A;  1ITX A;  3ART A;  2PBC A;  1J6Y A;  1ROT A;  4IPX A;  5HWC A;  3RGC A;  1E6P A;  4Z2H A;  1FFR A;  4DWS C;  1R9H A;  5GQB A;  3KAC A;  4LAW A;  4W9P A;  2B31 A;  3ARU A;  1UR9 A;  3O5Q A;  2A3E A;  1W1P A;  4GGQ A;  3UF8 A;  4IT6 A;  2VN1 A;  4ODP A;  4R5E A;  1VF8 A;  2DG4 A;  4NSB A;  2ZR5 A;  4G50 A;  1FKG A;  2N87 A;  3CHF A;  1LG2 A;  2IF4 A;  1HJV A;  4LGX A;  1HXV A;  1SR0 A;  1TCO C;  1H0I A;  4J4O A;  4P8U A;  3ALF A;  3WIJ A;  3EIP A;  2JZV A;  2AOS A;  2IUZ A;  5DIT A;  4DRN A;  5HUA A;  3WD2 A;  4ODO A;  1IX5 A;  4DZ2 A;  3IKD A;  4MSP A;  1E6Z A;  2AWG A;  4MGV A;  4O2T A;  3ARY A;  3KCE A;  2MLX A;  3W4R A;  3UQA A;  3O5E A;  2PV1 A;  1P5Q A;  1Q1C A;  4KQZ A;  1KFW A;  2DSZ A;  3UI4 A;  1EDQ A;  4QIB A;  4WKA A;  1D2K A;  3BMB A;  3WL1 A;  1K9T A;  1LQ0 A;  4JFJ A;  2KR7 A;  1FKR A;  1NMV A;  3O5R A;  2FKE A;  3PRA A;  3IKG A;  4TX0 A;  4PTM A;  1J4H A;  3RM9 A;  3O5D A;  4Z2I A;  4TW8 A;  1HKM A;  3O5G A;  3WH0 A;  1FAP A;  4FAP A;  3TC5 A;  5HWB A;  2VCD A;  1ZBC A;  4L3N A;  5DEZ A;  3KAI A;  2XP9 A;  1FKJ A;  2A3C A;  1UR8 A;  1FKK A;  2MLY A;  4ODM A;  3NRK A;  4TNS A;  2ETN A;  4UDM A;  2ITK A;  5B8I C;  1WAW A;  3KAH A;  2PPO A;  4IQC A;  1NWS A;  2D9F A;  4JFM A;  1HKJ A;  2O9O A;  3OOB A;  1JCH B;  2PN0 A;  3WKZ A;  1E6N A;  2PV2 A;  4ODQ A;  3G6M A;  2LPV A;  2DSV A;  2MLZ A;  3ODK A;  2ZQS A;  4WJX A;  1A7X A;  3B8S A;  1LL6 A;  2ZQV A;  2RUD A;  2LGO A;  4U85 A;  1NMW A;  1XHG A;  5DIU A;  1TFV A;  4R0X A;  2DT0 A;  2XP4 A;  1U79 A;  4S3K A;  2YBU A;  4KR0 B;  2UZ5 A;  2QF8 A;  1T11 A;  4GIV A;  4FN2 A;  1CTN A;  3PRD A;  2MF9 A;  4AY1 A;  4DWS D;  2KFW A;  3ARS A;  3CZ8 A;  1ZBK A;  3IK8 A;  2OLH A;  1W9P A;  3WL0 A;  1NSG A;  1YW5 A;  4Q22 A;  5JH8 A;  2RUR A;  2DT3 A;  1OWQ A;  3PRB A;  3UI5 A;  3O5F A;  1W9U A;  1NH6 A;  1EHN A;  3KAD A;  4ODN A;  3ARO A;  4HAR A;  2XPB A;  3CHE A;  1GOI A;  4DH0 A;  4XAK A;  2KO7 A;  3H9R B;  2DPE A;  2Q5A A;  5GPG A;  5HW8 A;  3OA5 A;  4JFK A;  4LAV A;  4DRM A;  4C02 B;  1YAT A;  1J4R A;  3BXW A;  3QOK A;  1GPF A;  2F21 A;  4NZC A;  4ZPW R;  3ARP A;  3CGN A;  4G2P A; 
#chains in the Genus database with same CATH homology
 1EIB A;  1XRV A;  4DWS A;  1SYT A;  1X6N A;  4DIP A;  1HKK A;  1J4I A;  3B7X A;  1FKL A;  2FAP A;  3AS3 A;  3WQV A;  4W9O A;  4DRO A;  2YBT A;  2ESC A;  3FXY A;  3JYJ A;  2KE0 A;  4DRQ A;  1FKS A;  1NWR A;  2KGJ A;  1Q6I A;  4MNM A;  3GPK A;  3NTP A;  5GPR A;  3FY1 A;  4ZS6 A;  1GUV A;  3RME A;  2WM0 A;  3JYM A;  3O5I A;  2WLY A;  3KAF A;  3PA7 A;  1W26 A;  2MNT A;  3WQW A;  3KAB A;  4IT4 A;  4TW6 A;  5HW7 A;  1KT0 A;  4W9Q A;  2XP7 A;  4L72 B;  3JXV A;  1Y0O A;  3KZ7 A;  4TYO A;  1F40 A;  1BL4 A;  1JND A;  2DG3 A;  5HKG A;  1F8A B;  3AS2 A;  1C9H A;  1OGB A;  4MNL A;  2K8I A;  3RM4 A;  3B9E A;  1H0G A;  1EQ3 A;  3O5L A;  4MTV A;  1L1P A;  2DSW A;  3B9D A;  3CH9 A;  2KI3 A;  1W1T A;  4S3J A;  2OFN A;  1LL7 A;  2ZR4 A;  4ZPT R;  4TW7 A;  4MPK A;  3ARQ A;  4U86 A;  5DO2 A;  3KAG A;  3CHD A;  2RUC A;  1FKF A;  5HTG A;  2RQS A;  3O5K A;  4DZ3 A;  4QZV B;  2PI6 A;  2DSU A;  5HBF A;  1FKI A;  1QPF A;  1FKH A;  4DT4 A;  2PPN A;  1FKB A;  1RD6 A;  4N19 A;  1Q6H A;  3WD0 A;  1D7H A;  2Y78 A;  2L2S A;  1ZBW A;  2F4E A;  4WKH A;  2PV3 A;  4LAX A;  1OGG A;  1PBK A;  1D7J A;  1FKD A;  1X6L A;  3ALG A;  4URI A;  3MDY B;  3AQU A;  1LJY A;  2G41 A;  4MAV A;  3G6L A;  4P8X A;  4Z2K A;  4JFL A;  3FAP A;  3UQB A;  4WKF A;  1O6I A;  3PR9 A;  1JVW A;  2MPH A;  2XP3 A;  5DF0 A;  4QT3 A;  1PIN A;  2A3A A;  1ZK6 A;  3ARX A;  2M2A A;  1ZB5 A;  4LAY A;  1FD9 A;  3TCZ A;  5BXJ A;  2M1I A;  4QT2 A;  4Z2L A;  1QZ2 A;  3VAW A;  3WD3 A;  4DRP A;  4P8V A;  1FFQ A;  4HBO A;  3RM8 A;  3O5J A;  1ZCN A;  3B9A A;  1W1Y A;  4Q7N A;  5DIV A;  2ZR6 A;  4U84 A;  2O92 A;  2LJ4 A;  3AS1 A;  2ZQU A;  4DWS B;  1ZL1 A;  3O5P A;  3UQI A;  3NI6 A;  2XP5 A;  4ODR A;  4DRK A;  1W9V A;  2DT2 A;  4IQ2 A;  3LUO A;  4ODK A;  3ARR A;  1E15 A;  3O5M A;  4MNK A;  1JNE A;  1NWT A;  3WD1 A;  1D7I A;  1LG1 A;  2F2D A;  3UI6 A;  4DRH A;  4Z2J A;  3IHZ A;  2RSE A;  3ARW A;  4BF8 A;  3EY6 A;  2DG9 A;  2XP6 A;  1N1A A;  1W1V A;  1HJW A;  2WK2 A;  1JNS A;  2ZQT A;  1ROU A;  1B6C A;  4ZPV R;  1ZBV A;  4WK9 A;  5I98 A;  1WNO A;  1E6R A;  1NWU A;  4WIW A;  3RFW A;  4ML4 A;  5D75 A;  4P8W A;  2XPA A;  4JYS A;  3AS0 A;  2DT1 A;  1JNT A;  4Z2G A;  3CHC A;  1FJD A;  4NNR A;  3WD4 A;  1HKI A;  1ZU8 A;  2M08 A;  4DRJ A;  1BKF A;  1E9L A;  4JFI A;  1FKT A;  1M5Y A;  4ITZ A;  5J6E A;  3I6C A;  3ARZ A;  4MNJ A;  2RUQ A;  1WB0 A;  5HT1 A;  5HW6 A;  4W5U A;  2XP8 A;  1QPL A;  2A3B A;  4DRI A;  1KT1 A;  4HBE A;  2WLZ A;  4J4N A;  1EYM A;  2G8Z A;  2PPP A;  2FDM A;  2LKN A;  3O5O A;  3ARV A;  3TDB A;  1HJX A;  1Q6U A;  4ODL A;  1LL4 A;  1D6O A;  3CGM A;  1ITX A;  3ART A;  2PBC A;  1J6Y A;  1ROT A;  4IPX A;  5HWC A;  3RGC A;  1E6P A;  4Z2H A;  1FFR A;  4DWS C;  1R9H A;  5GQB A;  3KAC A;  4LAW A;  4W9P A;  2B31 A;  3ARU A;  1UR9 A;  3O5Q A;  2A3E A;  1W1P A;  4GGQ A;  3UF8 A;  4IT6 A;  2VN1 A;  4ODP A;  4R5E A;  1VF8 A;  2DG4 A;  4NSB A;  2ZR5 A;  4G50 A;  1FKG A;  2N87 A;  3CHF A;  1LG2 A;  2IF4 A;  1HJV A;  4LGX A;  1HXV A;  1SR0 A;  1TCO C;  1H0I A;  4J4O A;  4P8U A;  3ALF A;  3WIJ A;  2JZV A;  2AOS A;  2IUZ A;  5DIT A;  4DRN A;  5HUA A;  3WD2 A;  4ODO A;  1IX5 A;  4DZ2 A;  3IKD A;  4MSP A;  1E6Z A;  2AWG A;  4MGV A;  4O2T A;  3ARY A;  3KCE A;  2MLX A;  3W4R A;  3UQA A;  3O5E A;  2PV1 A;  1P5Q A;  1Q1C A;  4KQZ A;  1KFW A;  2DSZ A;  3UI4 A;  1EDQ A;  4QIB A;  4WKA A;  1D2K A;  3WL1 A;  1K9T A;  1LQ0 A;  4JFJ A;  2KR7 A;  1FKR A;  1NMV A;  3O5R A;  2FKE A;  3PRA A;  3IKG A;  4TX0 A;  4PTM A;  1J4H A;  3RM9 A;  3O5D A;  4Z2I A;  4TW8 A;  1HKM A;  3O5G A;  3WH0 A;  1FAP A;  4FAP A;  3TC5 A;  5HWB A;  2VCD A;  1ZBC A;  4L3N A;  5DEZ A;  2XP9 A;  3KAI A;  1FKJ A;  2A3C A;  1UR8 A;  1FKK A;  2MLY A;  4ODM A;  3NRK A;  4TNS A;  2ITK A;  5B8I C;  1WAW A;  3KAH A;  2PPO A;  4IQC A;  1NWS A;  2D9F A;  4JFM A;  1HKJ A;  2O9O A;  3OOB A;  3WKZ A;  1E6N A;  2PV2 A;  4ODQ A;  3G6M A;  2LPV A;  2DSV A;  2MLZ A;  3ODK A;  2ZQS A;  4WJX A;  1A7X A;  3B8S A;  1LL6 A;  2ZQV A;  2RUD A;  2LGO A;  4U85 A;  1NMW A;  1XHG A;  5DIU A;  1TFV A;  4R0X A;  2DT0 A;  2XP4 A;  1U79 A;  4S3K A;  2YBU A;  4KR0 B;  2UZ5 A;  2QF8 A;  1T11 A;  4GIV A;  4FN2 A;  1CTN A;  3PRD A;  2MF9 A;  4AY1 A;  4DWS D;  2KFW A;  3ARS A;  3CZ8 A;  1ZBK A;  3IK8 A;  2OLH A;  1W9P A;  3WL0 A;  1NSG A;  1YW5 A;  4Q22 A;  5JH8 A;  2RUR A;  2DT3 A;  1OWQ A;  3PRB A;  3UI5 A;  3O5F A;  1W9U A;  1NH6 A;  1EHN A;  3KAD A;  4ODN A;  3ARO A;  4HAR A;  2XPB A;  3CHE A;  1GOI A;  4DH0 A;  4XAK A;  2KO7 A;  3H9R B;  2DPE A;  2Q5A A;  5GPG A;  5HW8 A;  3OA5 A;  4JFK A;  4LAV A;  4DRM A;  4C02 B;  1YAT A;  1J4R A;  3BXW A;  3QOK A;  1GPF A;  2F21 A;  4NZC A;  4ZPW R;  3ARP A;  3CGN A;  4G2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...