1F40A

Solution structure of fkbp12 complexed with gpi-1046, a neurotrophic ligand
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 BINDING PROTEIN (FKBP12)
publication title Solution structure of a neurotrophic ligand bound to FKBP12 and its effects on protein dynamics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 28
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2000-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1f40A00
1QZ2A 2JZVA 1NMVA 1QPLA 4IQCA 1QPFA 5I98A 1D7JA 1Q6HA 2DG4A 4GGQA 3KACA 4O2TA 1HXVA 1KT0A 2ZR4A 3IK8A 3O5KA 1YATA 1D6OA 3NI6A 1J4HA 5HT1A 2PPOA 2MLXA 1EYMA 1M5YA 1ROTA 1ROUA 2PPPA 1T11A 2PPNA 3O5MA 3PRBA 1ZK6A 4ODMA 2VN1A 4W9OA 4DRKA 1D7IA 1J4RA 3O5IA 5HTGA 2RURA 4TX0A 5HUAA 2RUDA 2MLZA 4FAPA 4U84A 4MSPA 2AWGA 1C9HA 2FKEA 2ZQTA 3UI5A 4TYOA 3KAFA 3KAHA 4QIBA 5D75A 2MPHA 3CGMA 3O5OA 4W9QA 2KFWA 2D9FA 4JYSA 3NTPA 3NRKA 3CGNA 4ODNA 5HWBA 2XPAA 2RUQA 1A7XA 2LPVA 1NMWA 2LJ4A 4R0XA 5DIUA 4DRIA 3O5QA 1J6YA 2LKNA 1JNSA 5HW8A 3LUOA 3O5LA 3O5RA 4W9PA 3WH0A 4G50A 1PBKA 3UI6A 4DRHA 5HW7A 4JFIA 3UQBA 1PINA 2KE0A 4J4OA 1U79A 1F8AB 4LAXA 3UQAA 3O5EA 2F21A 4JFKA 4QT3A 1KT1A 1FJDA 4ODLA 3I6CA 3KAGA 4NNRA 4IQ2A 4DT4A 1FKTA 2ZR6A 1JNTA 4FN2A 3ODKA 2ZQVA 3TDBA 1NSGA 1P5QA 1W26A 2KR7A 4QT2A 2DG3A 1FKDA 1FKJA 3EY6A 3MDYB 4ITZA 1Q6UA 3JXVA 1N1AA 4DRQA 1B6CA 2MNTA 2RQSA 2XP7A 4N19A 4DRNA 1FKLA 5HW6A 2FAPA 4DROA 1L1PA 5HKGA 3JYJA 3KADA 4BF8A 2F4EA 2F2DA 3UF8A 5DIVA 3KZ7A 3B7XA 5BXJA 3JYMA 2KI3A 4ODOA 3VAWA 3UI4A 2ZR5A 2OFNA 1R9HA 1Y0OA 4TW8A 1Q6IA 4TW7A 3FAPA 1FD9A 2N87A 3RGCA 3TCZA 3KABA 2L2SA 2MLYA 3TC5A 4DRMA 3GPKA 1ZCNA 3KCEA 2PV2A 3H9RB 4JFMA 1TCOC 4DZ2A 2XP9A 1Q1CA 2ZQSA 2K8IA 5DITA 1FKSA 4U85A 4IPXA 2ITKA 2M2AA 2VCDA 1FKIA 3KAIA 4LAYA 2XPBA 3O5GA 4ODRA 3IKDA 2MF9A 2PBCA 4ODPA 2KGJA 3PRDA 1D7HA 2DG9A 4JFLA 2Y78A 3O5JA 4U86A 5B8IC 1YW5A 4TNSA 4JFJA 3RFWA 4MGVA 4TW6A 2M08A 4ODKA 1EQ3A 5J6EA 4ODQA 4DIPA 1FAPA 4DZ3A 3O5FA 1BKFA 2M1IA 3O5PA 2RUCA 1JVWA 2PV3A 2RSEA 1J4IA 2XP8A 2XP4A 3OOBA 2IF4A 2PV1A 4LAWA 5HWCA 1FKRA 3IKGA 4J4NA 1FKFA 4C02B 2LGOA 4DRJA 2XP3A 1FKBA 4GIVA 4LAVA 2ZQUA 1FKKA 3UQIA 1FKHA 2Q5AA 2XP6A 3IHZA 2XP5A 2KO7A 3O5DA 4DH0A 2UZ5A 1FKGA 1BL4A 5GPGA 4DRPA 1F40A 3PA7A 4G2PA
chains in the Genus database with same CATH superfamily
1E44A 1NMVA 1D7JA 1OWQA 3CH9A 1KT0A 1HJWA 5HT1A 3ARWA 1J4HA 2DSUA 1GRJA 3NI6A 1ROTA 1ROUA 2PN0A 3O5MA 1T11A 4DRKA 3WL1A 5HTGA 1JCHB 2RURA 4TX0A 2RUDA 2ESCA 2MLZA 1CTNA 2FKEA 1JNEA 2G8ZA 3KAHA 3CGMA 3WD2A 3AS2A 4HBOA 2DT3A 3GU0A 2XPAA 1HKJA 2A3CA 4R0XA 3AS1A 3O5RA 1TFVA 1NWRA 3UQBA 2KE0A 3RM9A 4Z2GA 5HBFA 1KT1A 3I6CA 4URIA 1JNDA 4IQ2A 2P4VA 1FKTA 1EIBA 4ITZA 4DRQA 1B6CA 3BXWA 4Q7NA 1NH6A 3KZ7A 1EDQA 3G6LA 2KI3A 5JH8A 3RGCA 3TC5A 2MLYA 3GPKA 3WD1A 3H9RB 4JFMA 4WKFA 1E15A 1Q1CA 2AOSA 1ZBCA 2B5UB 1SYTA 1ZL1A 4IPXA 2ITKA 1VF8A 3O5GA 4HARA 4ODRA 3IKDA 4Z2LA 3PRDA 4UDMA 4JFLA 4ZS6A 2PI6A 5B8IC 1UR9A 1YW5A 4MGVA 1LJYA 4TW6A 1W9UA 2M08A 4ODKA 1FFRA 1WB0A 3CHFA 1BKFA 3O5PA 2RUCA 5HWCA 2IF4A 1FKRA 4NZCA 5DO2A 2LGOA 1H0GA 4LAVA 2DSWA 4L72B 2Q5AA 2XP5A 2KO7A 2DT0A 3PA7A 1QPFA 1YATA 2MLXA 4ML4A 1EYMA 1M5YA 1W1YA 4P8WA 1ZK6A 5GPRA 1J4RA 4FAPA 2DSVA 4U84A 2AWGA 3KAFA 4QIBA 2MPHA 4P8VA 1X6NA 4ZPVR 1WNOA 1HKMA 3NRKA 3QOKA 4ODNA 1LG2A 2RUQA 1A7XA 5DIUA 2LJ4A 3O5QA 1LL4A 4QZVB 5HW8A 3LUOA 3O5LA 4W9PA 1E6NA 1UR8A 3CHCA 4DRHA 1RD6A 4JFIA 4J4OA 4HBEA 3WQWA 4LAXA 4DWSD 3UQAA 3O5EA 4JFKA 2B31A 1W9VA 4ODLA 1LQ0A 4Z2HA 1W1PA 1W9PA 1NSGA 2KR7A 4QT2A 2DG3A 1FKDA 3EY6A 1Q6UA 1GPFA 1O6IA 2MNTA 4N19A 3ARVA 2WLZA 4PTMA 4W5UA 1L1PA 3KADA 4BF8A 2F2DA 1XRVA 4ODOA 4L3NA 1R9HA 1Y0OA 1FJDA 1Q6IA 1W1VA 2QF8A 3KABA 4Q22A 1ZCNA 3ARPA 1ZBKA 2ZQSA 2K8IA 3RM4A 1OGBA 4AY1A 1HKIA 4KR0B 4ZPTR 4XAKA 1WAWA 2DG9A 3CHDA 4U86A 3ARXA 4JFJA 3ARTA 3B9EA 1EQ3A 3AS0A 4ODQA 3OOBA 1J4IA 4LAWA 3IKGA 3WD3A 1HJXA 1E6ZA 1GUVA 2XP6A 3O5DA 1E6RA 2UZ5A 1FKGA 1BL4A 1NWSA 1F40A 1QZ2A 1QPLA 4IQCA 3WKZA 2DG4A 3GTYX 2ZR4A 3O5KA 1D6OA 4DWSA 2PPOA 3ARSA 3PRBA 4ODMA 3B9DA 1D7IA 3O5IA 5HUAA 4IT4A 2ZQTA 1C9HA 2G41A 4R5EA 3ARQA 4JYSA 4Z2IA 3CGNA 5HWBA 2DT1A 1X6LA 2LPVA 1NMWA 4DRIA 2O92A 3AROA 3W4RA 3WH0A 1PBKA 3UI6A 1ZB5A 3ARRA 1U79A 1F8AB 4MNJA 4NNRA 4DT4A 2ZR6A 4WK9A 1W26A 4MNLA 3EIPA 1NWUA 3WD0A 3ALFA 1LG1A 4WJXA 3JXVA 1N1AA 3ARZA 1FKLA 5HW6A 3WD4A 2FAPA 2WM0A 1LL7A 4MTVA 5HKGA 1OGGA 2DT2A 3FXYA 2F4EA 1HJVA 4DRPA 3UI4A 2ZR5A 1J6YA 4TW8A 4TW7A 3PR9A 1HKKA 2N87A 4Z2KA 2L2SA 4DRMA 4S3JA 2PV2A 2O9OA 5DITA 4MPKA 3CZ8A 2IUZA 3WIJA 1NWTA 2MF9A 2WK2A 3BMBA 4ODPA 3O5JA 3B9AA 4TNSA 4S3KA 5J6EA 2EULA 2M1IA 2XP8A 2PV3A 2RSEA 4J4NA 3WL0A 4DRJA 1FKBA 1K9TA 1FKHA 2A3AA 5GPGA 2WLYA 2JZVA 5I98A 2FDMA 1ITXA 1Q6HA 1GOIA 3KACA 4GGQA 4O2TA 1HXVA 2YBTA 3IK8A 2DSZA 2PPPA 5D75A 2PPNA 3G6MA 4W9OA 2VN1A 3AS3A 1E9LA 1ZBWA 3OA5A 1ZBVA 4MSPA 4WKAA 4DWSB 3UI5A 4TYOA 2ETNA 4ZPWR 3O5OA 4W9QA 2KFWA 2D9FA 2YBUA 3NTPA 3ARUA 1JNSA 2LKNA 1W1TA 4MNMA 4WIWA 4G50A 5HW7A 1E6PA 1PINA 3AQUA 2F21A 4QT3A 4P8XA 4NSBA 3KAGA 4MNKA 1JNTA 3ARYA 3CHEA 3ODKA 2ZQVA 4FN2A 1P5QA 3TDBA 1IX5A 1D2KA 4Z2JA 1FKJA 3MDYB 3RMEA 2RQSA 2XP7A 4DRNA 1XHGA 1EHNA 1ZU8A 4DROA 3JYJA 1SR0A 3RM8A 3UF8A 4IT6A 5DIVA 3B7XA 5BXJA 3JYMA 2A3EA 3PRAA 3VAWA 2OFNA 3FAPA 1FD9A 3TCZA 3KCEA 3FY1A 2DPEA 5GQBA 1TCOC 4WKHA 4DZ2A 2XP9A 1FKSA 4U85A 2M2AA 2VCDA 1FKIA 3KAIA 4LGXA 4LAYA 2XPBA 2F23A 3ALGA 2OLHA 3B8SA 2PBCA 2KGJA 1D7HA 2Y78A 4P8UA 5DF0A 1LL6A 3RFWA 3WQVA 4DIPA 1FAPA 4DZ3A 3O5FA 4KQZA 1JVWA 2XP4A 2PV1A 4MAVA 5DEZA 4DWSC 1KFWA 1FKFA 4C02B 1FFQA 2XP3A 4GIVA 2ZQUA 1FKKA 3UQIA 3IHZA 4DH0A 2A3BA 1H0IA 4G2PA
chains in the Genus database with same CATH topology
1NMVA 1D7JA 1OWQA 3CH9A 1KT0A 1HJWA 5HT1A 3ARWA 1J4HA 2DSUA 3NI6A 1ROTA 1ROUA 3O5MA 1T11A 4DRKA 3WL1A 5HTGA 2RURA 4TX0A 2RUDA 2ESCA 2MLZA 1CTNA 2FKEA 1JNEA 2G8ZA 3KAHA 3CGMA 3WD2A 3AS2A 4HBOA 2DT3A 2XPAA 1HKJA 2A3CA 4R0XA 3AS1A 3O5RA 1TFVA 1NWRA 3UQBA 2KE0A 3RM9A 4Z2GA 5HBFA 1KT1A 3I6CA 4URIA 1JNDA 4IQ2A 1FKTA 1EIBA 4ITZA 4DRQA 1B6CA 3BXWA 4Q7NA 1NH6A 3KZ7A 1EDQA 3G6LA 2KI3A 5JH8A 3RGCA 3TC5A 2MLYA 3GPKA 3WD1A 3H9RB 4JFMA 4WKFA 1E15A 1Q1CA 2AOSA 1ZBCA 1SYTA 1ZL1A 4IPXA 2ITKA 1VF8A 3O5GA 4HARA 4ODRA 3IKDA 4Z2LA 3PRDA 4JFLA 4ZS6A 2PI6A 5B8IC 1UR9A 1YW5A 4MGVA 1LJYA 4TW6A 1W9UA 2M08A 4ODKA 1FFRA 1WB0A 3CHFA 1BKFA 3O5PA 2RUCA 5HWCA 2IF4A 1FKRA 4NZCA 5DO2A 2LGOA 1H0GA 4LAVA 2DSWA 4L72B 2Q5AA 2XP5A 2KO7A 2DT0A 3PA7A 1QPFA 1YATA 2MLXA 4ML4A 1EYMA 1M5YA 1W1YA 4P8WA 1ZK6A 5GPRA 1J4RA 4FAPA 2DSVA 4U84A 2AWGA 3KAFA 4QIBA 2MPHA 4P8VA 1X6NA 4ZPVR 1WNOA 1HKMA 3NRKA 3QOKA 4ODNA 1LG2A 2RUQA 1A7XA 5DIUA 2LJ4A 3O5QA 1LL4A 4QZVB 5HW8A 3LUOA 3O5LA 4W9PA 1E6NA 1UR8A 3CHCA 4DRHA 1RD6A 4JFIA 4J4OA 4HBEA 3WQWA 4LAXA 4DWSD 3UQAA 3O5EA 4JFKA 2B31A 1W9VA 4ODLA 1LQ0A 4Z2HA 1W1PA 1W9PA 1NSGA 2KR7A 4QT2A 2DG3A 1FKDA 3EY6A 1Q6UA 1GPFA 1O6IA 2MNTA 4N19A 3ARVA 2WLZA 4PTMA 4W5UA 1L1PA 3KADA 4BF8A 2F2DA 1XRVA 4ODOA 4L3NA 1R9HA 1Y0OA 1FJDA 1Q6IA 1W1VA 2QF8A 3KABA 4Q22A 1ZCNA 3ARPA 1ZBKA 2ZQSA 2K8IA 3RM4A 1OGBA 4AY1A 1HKIA 4KR0B 4ZPTR 4XAKA 1WAWA 2DG9A 3CHDA 4U86A 3ARXA 4JFJA 3ARTA 3B9EA 1EQ3A 3AS0A 4ODQA 3OOBA 1J4IA 4LAWA 3IKGA 3WD3A 1HJXA 1E6ZA 1GUVA 2XP6A 3O5DA 1E6RA 2UZ5A 1FKGA 1BL4A 1NWSA 1F40A 1QZ2A 1QPLA 4IQCA 3WKZA 2DG4A 2ZR4A 3O5KA 1D6OA 4DWSA 2PPOA 3ARSA 3PRBA 4ODMA 3B9DA 1D7IA 3O5IA 5HUAA 4IT4A 2ZQTA 1C9HA 2G41A 4R5EA 3ARQA 4JYSA 4Z2IA 3CGNA 5HWBA 2DT1A 1X6LA 2LPVA 1NMWA 4DRIA 2O92A 3AROA 3W4RA 3WH0A 1PBKA 3UI6A 1ZB5A 3ARRA 1U79A 1F8AB 4MNJA 4NNRA 4DT4A 2ZR6A 4WK9A 1W26A 4MNLA 1NWUA 3WD0A 3ALFA 1LG1A 4WJXA 3JXVA 1N1AA 3ARZA 1FKLA 5HW6A 3WD4A 2FAPA 2WM0A 1LL7A 4MTVA 5HKGA 1OGGA 2DT2A 3FXYA 2F4EA 1HJVA 4DRPA 3UI4A 2ZR5A 1J6YA 4TW8A 4TW7A 3PR9A 1HKKA 2N87A 4Z2KA 2L2SA 4DRMA 4S3JA 2PV2A 2O9OA 5DITA 4MPKA 3CZ8A 2IUZA 3WIJA 1NWTA 2MF9A 2WK2A 4ODPA 3O5JA 3B9AA 4TNSA 4S3KA 5J6EA 2M1IA 2XP8A 2PV3A 2RSEA 4J4NA 3WL0A 4DRJA 1FKBA 1K9TA 1FKHA 2A3AA 5GPGA 2WLYA 2JZVA 5I98A 2FDMA 1ITXA 1Q6HA 1GOIA 3KACA 4GGQA 4O2TA 1HXVA 2YBTA 3IK8A 2DSZA 2PPPA 5D75A 2PPNA 3G6MA 4W9OA 2VN1A 3AS3A 1E9LA 1ZBWA 3OA5A 1ZBVA 4MSPA 4WKAA 4DWSB 3UI5A 4TYOA 4ZPWR 3O5OA 4W9QA 2KFWA 2D9FA 2YBUA 3NTPA 3ARUA 1JNSA 2LKNA 1W1TA 4MNMA 4WIWA 4G50A 5HW7A 1E6PA 1PINA 3AQUA 2F21A 4QT3A 4P8XA 4NSBA 3KAGA 4MNKA 1JNTA 3ARYA 3CHEA 3ODKA 2ZQVA 4FN2A 1P5QA 3TDBA 1IX5A 1D2KA 4Z2JA 1FKJA 3MDYB 3RMEA 2RQSA 2XP7A 4DRNA 1XHGA 1EHNA 1ZU8A 4DROA 3JYJA 1SR0A 3RM8A 3UF8A 4IT6A 5DIVA 3B7XA 5BXJA 3JYMA 2A3EA 3PRAA 3VAWA 2OFNA 3FAPA 1FD9A 3TCZA 3KCEA 3FY1A 2DPEA 5GQBA 1TCOC 4WKHA 4DZ2A 2XP9A 1FKSA 4U85A 2M2AA 2VCDA 1FKIA 3KAIA 4LGXA 4LAYA 2XPBA 3B8SA 3ALGA 2OLHA 2PBCA 2KGJA 1D7HA 2Y78A 4P8UA 5DF0A 1LL6A 3RFWA 3WQVA 4DIPA 1FAPA 4DZ3A 3O5FA 4KQZA 1JVWA 2XP4A 2PV1A 4MAVA 5DEZA 4DWSC 1KFWA 1FKFA 4C02B 1FFQA 2XP3A 4GIVA 2ZQUA 1FKKA 3UQIA 3IHZA 4DH0A 2A3BA 1H0IA 4G2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZ2 A;  2JZV A;  1NMV A;  1QPL A;  4IQC A;  1QPF A;  5I98 A;  1D7J A;  1Q6H A;  2DG4 A;  4GGQ A;  3KAC A;  4O2T A;  1HXV A;  1KT0 A;  2ZR4 A;  3IK8 A;  3O5K A;  1YAT A;  1D6O A;  3NI6 A;  1J4H A;  5HT1 A;  2PPO A;  2MLX A;  1EYM A;  1M5Y A;  1ROT A;  1ROU A;  2PPP A;  1T11 A;  2PPN A;  3O5M A;  3PRB A;  1ZK6 A;  4ODM A;  2VN1 A;  4W9O A;  4DRK A;  1D7I A;  1J4R A;  3O5I A;  5HTG A;  2RUR A;  4TX0 A;  5HUA A;  2RUD A;  2MLZ A;  4FAP A;  4U84 A;  4MSP A;  2AWG A;  1C9H A;  2FKE A;  2ZQT A;  3UI5 A;  4TYO A;  3KAF A;  3KAH A;  4QIB A;  5D75 A;  2MPH A;  3CGM A;  3O5O A;  4W9Q A;  2KFW A;  2D9F A;  4JYS A;  3NTP A;  3NRK A;  3CGN A;  4ODN A;  5HWB A;  2XPA A;  2RUQ A;  1A7X A;  2LPV A;  1NMW A;  2LJ4 A;  4R0X A;  5DIU A;  4DRI A;  3O5Q A;  1J6Y A;  2LKN A;  1JNS A;  5HW8 A;  3LUO A;  3O5L A;  3O5R A;  4W9P A;  3WH0 A;  4G50 A;  1PBK A;  3UI6 A;  4DRH A;  5HW7 A;  4JFI A;  3UQB A;  1PIN A;  2KE0 A;  4J4O A;  1U79 A;  1F8A B;  4LAX A;  3UQA A;  3O5E A;  2F21 A;  4JFK A;  4QT3 A;  1KT1 A;  1FJD A;  4ODL A;  3I6C A;  3KAG A;  4NNR A;  4IQ2 A;  4DT4 A;  1FKT A;  2ZR6 A;  1JNT A;  4FN2 A;  3ODK A;  2ZQV A;  3TDB A;  1NSG A;  1P5Q A;  1W26 A;  2KR7 A;  4QT2 A;  2DG3 A;  1FKD A;  1FKJ A;  3EY6 A;  3MDY B;  4ITZ A;  1Q6U A;  3JXV A;  1N1A A;  4DRQ A;  1B6C A;  2MNT A;  2RQS A;  2XP7 A;  4N19 A;  4DRN A;  1FKL A;  5HW6 A;  2FAP A;  4DRO A;  1L1P A;  5HKG A;  3JYJ A;  3KAD A;  4BF8 A;  2F4E A;  2F2D A;  3UF8 A;  5DIV A;  3KZ7 A;  3B7X A;  5BXJ A;  3JYM A;  2KI3 A;  4ODO A;  3VAW A;  3UI4 A;  2ZR5 A;  2OFN A;  1R9H A;  1Y0O A;  4TW8 A;  1Q6I A;  4TW7 A;  3FAP A;  1FD9 A;  2N87 A;  3RGC A;  3TCZ A;  3KAB A;  2L2S A;  2MLY A;  3TC5 A;  4DRM A;  3GPK A;  1ZCN A;  3KCE A;  2PV2 A;  3H9R B;  4JFM A;  1TCO C;  4DZ2 A;  2XP9 A;  1Q1C A;  2ZQS A;  2K8I A;  5DIT A;  1FKS A;  4U85 A;  4IPX A;  2ITK A;  2M2A A;  2VCD A;  1FKI A;  3KAI A;  4LAY A;  2XPB A;  3O5G A;  4ODR A;  3IKD A;  2MF9 A;  2PBC A;  4ODP A;  2KGJ A;  3PRD A;  1D7H A;  2DG9 A;  4JFL A;  2Y78 A;  3O5J A;  4U86 A;  5B8I C;  1YW5 A;  4TNS A;  4JFJ A;  3RFW A;  4MGV A;  4TW6 A;  2M08 A;  4ODK A;  1EQ3 A;  5J6E A;  4ODQ A;  4DIP A;  1FAP A;  4DZ3 A;  3O5F A;  1BKF A;  2M1I A;  3O5P A;  2RUC A;  1JVW A;  2PV3 A;  2RSE A;  1J4I A;  2XP8 A;  2XP4 A;  3OOB A;  2IF4 A;  2PV1 A;  4LAW A;  5HWC A;  1FKR A;  3IKG A;  4J4N A;  1FKF A;  4C02 B;  2LGO A;  4DRJ A;  2XP3 A;  1FKB A;  4GIV A;  4LAV A;  2ZQU A;  1FKK A;  3UQI A;  1FKH A;  2Q5A A;  2XP6 A;  3IHZ A;  2XP5 A;  2KO7 A;  3O5D A;  4DH0 A;  2UZ5 A;  1FKG A;  1BL4 A;  5GPG A;  4DRP A;  1F40 A;  3PA7 A;  4G2P A; 
#chains in the Genus database with same CATH topology
 1E44 A;  1NMV A;  1D7J A;  1OWQ A;  3CH9 A;  1KT0 A;  1HJW A;  5HT1 A;  3ARW A;  1J4H A;  2DSU A;  1GRJ A;  3NI6 A;  1ROT A;  1ROU A;  2PN0 A;  3O5M A;  1T11 A;  4DRK A;  3WL1 A;  5HTG A;  1JCH B;  2RUR A;  4TX0 A;  2RUD A;  2ESC A;  2MLZ A;  1CTN A;  2FKE A;  1JNE A;  2G8Z A;  3KAH A;  3CGM A;  3WD2 A;  3AS2 A;  4HBO A;  2DT3 A;  3GU0 A;  2XPA A;  1HKJ A;  2A3C A;  4R0X A;  3AS1 A;  3O5R A;  1TFV A;  1NWR A;  3UQB A;  2KE0 A;  3RM9 A;  4Z2G A;  5HBF A;  1KT1 A;  3I6C A;  4URI A;  1JND A;  4IQ2 A;  2P4V A;  1FKT A;  1EIB A;  4ITZ A;  4DRQ A;  1B6C A;  3BXW A;  4Q7N A;  1NH6 A;  3KZ7 A;  1EDQ A;  3G6L A;  2KI3 A;  5JH8 A;  3RGC A;  3TC5 A;  2MLY A;  3GPK A;  3WD1 A;  3H9R B;  4JFM A;  4WKF A;  1E15 A;  1Q1C A;  2AOS A;  1ZBC A;  2B5U B;  1SYT A;  1ZL1 A;  4IPX A;  2ITK A;  1VF8 A;  3O5G A;  4HAR A;  4ODR A;  3IKD A;  4Z2L A;  3PRD A;  4UDM A;  4JFL A;  4ZS6 A;  2PI6 A;  5B8I C;  1UR9 A;  1YW5 A;  4MGV A;  1LJY A;  4TW6 A;  1W9U A;  2M08 A;  4ODK A;  1FFR A;  1WB0 A;  3CHF A;  1BKF A;  3O5P A;  2RUC A;  5HWC A;  2IF4 A;  1FKR A;  4NZC A;  5DO2 A;  2LGO A;  1H0G A;  4LAV A;  2DSW A;  4L72 B;  2Q5A A;  2XP5 A;  2KO7 A;  2DT0 A;  3PA7 A;  1QPF A;  1YAT A;  2MLX A;  4ML4 A;  1EYM A;  1M5Y A;  1W1Y A;  4P8W A;  1ZK6 A;  5GPR A;  1J4R A;  4FAP A;  2DSV A;  4U84 A;  2AWG A;  3KAF A;  4QIB A;  2MPH A;  4P8V A;  1X6N A;  4ZPV R;  1WNO A;  1HKM A;  3NRK A;  3QOK A;  4ODN A;  1LG2 A;  2RUQ A;  1A7X A;  5DIU A;  2LJ4 A;  3O5Q A;  1LL4 A;  4QZV B;  5HW8 A;  3LUO A;  3O5L A;  4W9P A;  1E6N A;  1UR8 A;  3CHC A;  4DRH A;  1RD6 A;  4JFI A;  4J4O A;  4HBE A;  3WQW A;  4LAX A;  4DWS D;  3UQA A;  3O5E A;  4JFK A;  2B31 A;  1W9V A;  4ODL A;  1LQ0 A;  4Z2H A;  1W1P A;  1W9P A;  1NSG A;  2KR7 A;  4QT2 A;  2DG3 A;  1FKD A;  3EY6 A;  1Q6U A;  1GPF A;  1O6I A;  2MNT A;  4N19 A;  3ARV A;  2WLZ A;  4PTM A;  4W5U A;  1L1P A;  3KAD A;  4BF8 A;  2F2D A;  1XRV A;  4ODO A;  4L3N A;  1R9H A;  1Y0O A;  1FJD A;  1Q6I A;  1W1V A;  2QF8 A;  3KAB A;  4Q22 A;  1ZCN A;  3ARP A;  1ZBK A;  2ZQS A;  2K8I A;  3RM4 A;  1OGB A;  4AY1 A;  1HKI A;  4KR0 B;  4ZPT R;  4XAK A;  1WAW A;  2DG9 A;  3CHD A;  4U86 A;  3ARX A;  4JFJ A;  3ART A;  3B9E A;  1EQ3 A;  3AS0 A;  4ODQ A;  3OOB A;  1J4I A;  4LAW A;  3IKG A;  3WD3 A;  1HJX A;  1E6Z A;  1GUV A;  2XP6 A;  3O5D A;  1E6R A;  2UZ5 A;  1FKG A;  1BL4 A;  1NWS A;  1F40 A;  1QZ2 A;  1QPL A;  4IQC A;  3WKZ A;  2DG4 A;  3GTY X;  2ZR4 A;  3O5K A;  1D6O A;  4DWS A;  2PPO A;  3ARS A;  3PRB A;  4ODM A;  3B9D A;  1D7I A;  3O5I A;  5HUA A;  4IT4 A;  2ZQT A;  1C9H A;  2G41 A;  4R5E A;  3ARQ A;  4JYS A;  4Z2I A;  3CGN A;  5HWB A;  2DT1 A;  1X6L A;  2LPV A;  1NMW A;  4DRI A;  2O92 A;  3ARO A;  3W4R A;  3WH0 A;  1PBK A;  3UI6 A;  1ZB5 A;  3ARR A;  1U79 A;  1F8A B;  4MNJ A;  4NNR A;  4DT4 A;  2ZR6 A;  4WK9 A;  1W26 A;  4MNL A;  3EIP A;  1NWU A;  3WD0 A;  3ALF A;  1LG1 A;  4WJX A;  3JXV A;  1N1A A;  3ARZ A;  1FKL A;  5HW6 A;  3WD4 A;  2FAP A;  2WM0 A;  1LL7 A;  4MTV A;  5HKG A;  1OGG A;  2DT2 A;  3FXY A;  2F4E A;  1HJV A;  4DRP A;  3UI4 A;  2ZR5 A;  1J6Y A;  4TW8 A;  4TW7 A;  3PR9 A;  1HKK A;  2N87 A;  4Z2K A;  2L2S A;  4DRM A;  4S3J A;  2PV2 A;  2O9O A;  5DIT A;  4MPK A;  3CZ8 A;  2IUZ A;  3WIJ A;  1NWT A;  2MF9 A;  2WK2 A;  3BMB A;  4ODP A;  3O5J A;  3B9A A;  4TNS A;  4S3K A;  5J6E A;  2EUL A;  2M1I A;  2XP8 A;  2PV3 A;  2RSE A;  4J4N A;  3WL0 A;  4DRJ A;  1FKB A;  1K9T A;  1FKH A;  2A3A A;  5GPG A;  2WLY A;  2JZV A;  5I98 A;  2FDM A;  1ITX A;  1Q6H A;  1GOI A;  3KAC A;  4GGQ A;  4O2T A;  1HXV A;  2YBT A;  3IK8 A;  2DSZ A;  2PPP A;  5D75 A;  2PPN A;  3G6M A;  4W9O A;  2VN1 A;  3AS3 A;  1E9L A;  1ZBW A;  3OA5 A;  1ZBV A;  4MSP A;  4WKA A;  4DWS B;  3UI5 A;  4TYO A;  2ETN A;  4ZPW R;  3O5O A;  4W9Q A;  2KFW A;  2D9F A;  2YBU A;  3NTP A;  3ARU A;  1JNS A;  2LKN A;  1W1T A;  4MNM A;  4WIW A;  4G50 A;  5HW7 A;  1E6P A;  1PIN A;  3AQU A;  2F21 A;  4QT3 A;  4P8X A;  4NSB A;  3KAG A;  4MNK A;  1JNT A;  3ARY A;  3CHE A;  3ODK A;  2ZQV A;  4FN2 A;  1P5Q A;  3TDB A;  1IX5 A;  1D2K A;  4Z2J A;  1FKJ A;  3MDY B;  3RME A;  2RQS A;  2XP7 A;  4DRN A;  1XHG A;  1EHN A;  1ZU8 A;  4DRO A;  3JYJ A;  1SR0 A;  3RM8 A;  3UF8 A;  4IT6 A;  5DIV A;  3B7X A;  5BXJ A;  3JYM A;  2A3E A;  3PRA A;  3VAW A;  2OFN A;  3FAP A;  1FD9 A;  3TCZ A;  3KCE A;  3FY1 A;  2DPE A;  5GQB A;  1TCO C;  4WKH A;  4DZ2 A;  2XP9 A;  1FKS A;  4U85 A;  2M2A A;  2VCD A;  1FKI A;  3KAI A;  4LGX A;  4LAY A;  2XPB A;  2F23 A;  3ALG A;  2OLH A;  3B8S A;  2PBC A;  2KGJ A;  1D7H A;  2Y78 A;  4P8U A;  5DF0 A;  1LL6 A;  3RFW A;  3WQV A;  4DIP A;  1FAP A;  4DZ3 A;  3O5F A;  4KQZ A;  1JVW A;  2XP4 A;  2PV1 A;  4MAV A;  5DEZ A;  4DWS C;  1KFW A;  1FKF A;  4C02 B;  1FFQ A;  2XP3 A;  4GIV A;  2ZQU A;  1FKK A;  3UQI A;  3IHZ A;  4DH0 A;  2A3B A;  1H0I A;  4G2P A; 
#chains in the Genus database with same CATH homology
 1NMV A;  1D7J A;  1OWQ A;  3CH9 A;  1KT0 A;  1HJW A;  5HT1 A;  3ARW A;  1J4H A;  2DSU A;  3NI6 A;  1ROT A;  1ROU A;  3O5M A;  1T11 A;  4DRK A;  3WL1 A;  5HTG A;  2RUR A;  4TX0 A;  2RUD A;  2ESC A;  2MLZ A;  1CTN A;  2FKE A;  1JNE A;  2G8Z A;  3KAH A;  3CGM A;  3WD2 A;  3AS2 A;  4HBO A;  2DT3 A;  2XPA A;  1HKJ A;  2A3C A;  4R0X A;  3AS1 A;  3O5R A;  1TFV A;  1NWR A;  3UQB A;  2KE0 A;  3RM9 A;  4Z2G A;  5HBF A;  1KT1 A;  3I6C A;  4URI A;  1JND A;  4IQ2 A;  1FKT A;  1EIB A;  4ITZ A;  4DRQ A;  1B6C A;  3BXW A;  4Q7N A;  1NH6 A;  3KZ7 A;  1EDQ A;  3G6L A;  2KI3 A;  5JH8 A;  3RGC A;  3TC5 A;  2MLY A;  3GPK A;  3WD1 A;  3H9R B;  4JFM A;  4WKF A;  1E15 A;  1Q1C A;  2AOS A;  1ZBC A;  1SYT A;  1ZL1 A;  4IPX A;  2ITK A;  1VF8 A;  3O5G A;  4HAR A;  4ODR A;  3IKD A;  4Z2L A;  3PRD A;  4JFL A;  4ZS6 A;  2PI6 A;  5B8I C;  1UR9 A;  1YW5 A;  4MGV A;  1LJY A;  4TW6 A;  1W9U A;  2M08 A;  4ODK A;  1FFR A;  1WB0 A;  3CHF A;  1BKF A;  3O5P A;  2RUC A;  5HWC A;  2IF4 A;  1FKR A;  4NZC A;  5DO2 A;  2LGO A;  1H0G A;  4LAV A;  2DSW A;  4L72 B;  2Q5A A;  2XP5 A;  2KO7 A;  2DT0 A;  3PA7 A;  1QPF A;  1YAT A;  2MLX A;  4ML4 A;  1EYM A;  1M5Y A;  1W1Y A;  4P8W A;  1ZK6 A;  5GPR A;  1J4R A;  4FAP A;  2DSV A;  4U84 A;  2AWG A;  3KAF A;  4QIB A;  2MPH A;  4P8V A;  1X6N A;  4ZPV R;  1WNO A;  1HKM A;  3NRK A;  3QOK A;  4ODN A;  1LG2 A;  2RUQ A;  1A7X A;  5DIU A;  2LJ4 A;  3O5Q A;  1LL4 A;  4QZV B;  5HW8 A;  3LUO A;  3O5L A;  4W9P A;  1E6N A;  1UR8 A;  3CHC A;  4DRH A;  1RD6 A;  4JFI A;  4J4O A;  4HBE A;  3WQW A;  4LAX A;  4DWS D;  3UQA A;  3O5E A;  4JFK A;  2B31 A;  1W9V A;  4ODL A;  1LQ0 A;  4Z2H A;  1W1P A;  1W9P A;  1NSG A;  2KR7 A;  4QT2 A;  2DG3 A;  1FKD A;  3EY6 A;  1Q6U A;  1GPF A;  1O6I A;  2MNT A;  4N19 A;  3ARV A;  2WLZ A;  4PTM A;  4W5U A;  1L1P A;  3KAD A;  4BF8 A;  2F2D A;  1XRV A;  4ODO A;  4L3N A;  1R9H A;  1Y0O A;  1FJD A;  1Q6I A;  1W1V A;  2QF8 A;  3KAB A;  4Q22 A;  1ZCN A;  3ARP A;  1ZBK A;  2ZQS A;  2K8I A;  3RM4 A;  1OGB A;  4AY1 A;  1HKI A;  4KR0 B;  4ZPT R;  4XAK A;  1WAW A;  2DG9 A;  3CHD A;  4U86 A;  3ARX A;  4JFJ A;  3ART A;  3B9E A;  1EQ3 A;  3AS0 A;  4ODQ A;  3OOB A;  1J4I A;  4LAW A;  3IKG A;  3WD3 A;  1HJX A;  1E6Z A;  1GUV A;  2XP6 A;  3O5D A;  1E6R A;  2UZ5 A;  1FKG A;  1BL4 A;  1NWS A;  1F40 A;  1QZ2 A;  1QPL A;  4IQC A;  3WKZ A;  2DG4 A;  2ZR4 A;  3O5K A;  1D6O A;  4DWS A;  2PPO A;  3ARS A;  3PRB A;  4ODM A;  3B9D A;  1D7I A;  3O5I A;  5HUA A;  4IT4 A;  2ZQT A;  1C9H A;  2G41 A;  4R5E A;  3ARQ A;  4JYS A;  4Z2I A;  3CGN A;  5HWB A;  2DT1 A;  1X6L A;  2LPV A;  1NMW A;  4DRI A;  2O92 A;  3ARO A;  3W4R A;  3WH0 A;  1PBK A;  3UI6 A;  1ZB5 A;  3ARR A;  1U79 A;  1F8A B;  4MNJ A;  4NNR A;  4DT4 A;  2ZR6 A;  4WK9 A;  1W26 A;  4MNL A;  1NWU A;  3WD0 A;  3ALF A;  1LG1 A;  4WJX A;  3JXV A;  1N1A A;  3ARZ A;  1FKL A;  5HW6 A;  3WD4 A;  2FAP A;  2WM0 A;  1LL7 A;  4MTV A;  5HKG A;  1OGG A;  2DT2 A;  3FXY A;  2F4E A;  1HJV A;  4DRP A;  3UI4 A;  2ZR5 A;  1J6Y A;  4TW8 A;  4TW7 A;  3PR9 A;  1HKK A;  2N87 A;  4Z2K A;  2L2S A;  4DRM A;  4S3J A;  2PV2 A;  2O9O A;  5DIT A;  4MPK A;  3CZ8 A;  2IUZ A;  3WIJ A;  1NWT A;  2MF9 A;  2WK2 A;  4ODP A;  3O5J A;  3B9A A;  4TNS A;  4S3K A;  5J6E A;  2M1I A;  2XP8 A;  2PV3 A;  2RSE A;  4J4N A;  3WL0 A;  4DRJ A;  1FKB A;  1K9T A;  1FKH A;  2A3A A;  5GPG A;  2WLY A;  2JZV A;  5I98 A;  2FDM A;  1ITX A;  1Q6H A;  1GOI A;  3KAC A;  4GGQ A;  4O2T A;  1HXV A;  2YBT A;  3IK8 A;  2DSZ A;  2PPP A;  5D75 A;  2PPN A;  3G6M A;  4W9O A;  2VN1 A;  3AS3 A;  1E9L A;  1ZBW A;  3OA5 A;  1ZBV A;  4MSP A;  4WKA A;  4DWS B;  3UI5 A;  4TYO A;  4ZPW R;  3O5O A;  4W9Q A;  2KFW A;  2D9F A;  2YBU A;  3NTP A;  3ARU A;  1JNS A;  2LKN A;  1W1T A;  4MNM A;  4WIW A;  4G50 A;  5HW7 A;  1E6P A;  1PIN A;  3AQU A;  2F21 A;  4QT3 A;  4P8X A;  4NSB A;  3KAG A;  4MNK A;  1JNT A;  3ARY A;  3CHE A;  3ODK A;  2ZQV A;  4FN2 A;  1P5Q A;  3TDB A;  1IX5 A;  1D2K A;  4Z2J A;  1FKJ A;  3MDY B;  3RME A;  2RQS A;  2XP7 A;  4DRN A;  1XHG A;  1EHN A;  1ZU8 A;  4DRO A;  3JYJ A;  1SR0 A;  3RM8 A;  3UF8 A;  4IT6 A;  5DIV A;  3B7X A;  5BXJ A;  3JYM A;  2A3E A;  3PRA A;  3VAW A;  2OFN A;  3FAP A;  1FD9 A;  3TCZ A;  3KCE A;  3FY1 A;  2DPE A;  5GQB A;  1TCO C;  4WKH A;  4DZ2 A;  2XP9 A;  1FKS A;  4U85 A;  2M2A A;  2VCD A;  1FKI A;  3KAI A;  4LGX A;  4LAY A;  2XPB A;  3B8S A;  3ALG A;  2OLH A;  2PBC A;  2KGJ A;  1D7H A;  2Y78 A;  4P8U A;  5DF0 A;  1LL6 A;  3RFW A;  3WQV A;  4DIP A;  1FAP A;  4DZ3 A;  3O5F A;  4KQZ A;  1JVW A;  2XP4 A;  2PV1 A;  4MAV A;  5DEZ A;  4DWS C;  1KFW A;  1FKF A;  4C02 B;  1FFQ A;  2XP3 A;  4GIV A;  2ZQU A;  1FKK A;  3UQI A;  3IHZ A;  4DH0 A;  2A3B A;  1H0I A;  4G2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...