1F40A

Solution structure of fkbp12 complexed with gpi-1046, a neurotrophic ligand
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a neurotrophic ligand bound to FKBP12 and its effects on protein dynamics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords FK506 BINDING PROTEIN (FKBP12)
total genus 28
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2000-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1f40A00
4O2TA 2D9FA 2PPNA 5B8IC 4LAWA 4DRHA 4JFJA 3KAIA 3O5FA 5HWBA 4DT4A 2UZ5A 1T11A 1NMVA 1ROTA 1YW5A 4C02B 4TX0A 1FKLA 2KR7A 1W26A 2XP3A 3UI5A 3JYJA 2XPBA 1D6OA 2ZR5A 3H9RB 1KT0A 2ITKA 1FJDA 2ZQUA 2K8IA 4GGQA 4NNRA 4DZ3A 1J4RA 3KABA 1FKHA 3MDYB 3O5LA 4JFIA 4W9QA 5HW7A 3KAGA 4ODMA 3UQIA 1J4IA 3O5QA 5HUAA 2RURA 2FAPA 1FKSA 3JYMA 1FKIA 2ZQVA 1R9HA 3KZ7A 2KGJA 4LAYA 2LGOA 3UI6A 4DRPA 4U85A 4ODLA 2JZVA 1F40A 3EY6A 4DRIA 2ZQTA 4LAVA 4DRKA 1NMWA 5HT1A 3O5JA 1QPFA 4DROA 3CGNA 1TCOC 4JFMA 4ODRA 3CGMA 4ODNA 2M1IA 1J6YA 2XP5A 5DITA 4U86A 4FN2A 3VAWA 1NSGA 1ROUA 3B7XA 1KT1A 4DRNA 4DRJA 5GPGA 1QPLA 4ODPA 3GPKA 4FAPA 3NRKA 4W9OA 2KE0A 2KO7A 2XPAA 1Q1CA 2AWGA 4LAXA 3TCZA 4QT2A 3KAHA 2F21A 3JXVA 3O5KA 4G2PA 4G50A 1D7JA 2VN1A 2Q5AA 4J4NA 2LJ4A 4U84A 5D75A 2OFNA 2VCDA 1ZCNA 1BL4A 4GIVA 3O5DA 1FD9A 2MLXA 2ZR6A 1FKBA 3PRDA 1D7HA 1M5YA 2MLYA 1PBKA 2RSEA 3IHZA 3PA7A 4J4OA 4JFKA 1QZ2A 1YATA 2DG9A 2RUCA 2PBCA 3UI4A 4DZ2A 2DG4A 2MF9A 2KI3A 1JNTA 4R0XA 4MGVA 2N87A 4TNSA 4TW7A 2DG3A 4TW8A 3UF8A 1FKTA 3UQBA 1FKJA 2MLZA 1HXVA 4DRMA 3PRBA 4JFLA 3IK8A 1FKKA 1N1AA 1FKDA 3IKGA 5HTGA 1JNSA 4JYSA 1FKFA 3O5MA 5J6EA 4DIPA 5HW8A 4ODOA 2Y78A 2RQSA 5BXJA 3RGCA 3I6CA 4ODKA 3UQAA 4TYOA 2PPOA 1L1PA 2XP4A 3LUOA 3O5RA 3RFWA 5HWCA 2PV2A 3KACA 1EYMA 3NI6A 1B6CA 2FKEA 3OOBA 4IQ2A 4DRQA 5HW6A 1D7IA 1PINA 2L2SA 4N19A 3TDBA 2KFWA 1JVWA 4ITZA 1FKRA 3O5IA 1BKFA 3O5EA 2ZQSA 3WH0A 1EQ3A 1ZK6A 4TW6A 2ZR4A 4QT3A 2M2AA 3O5GA 4BF8A 1A7XA 2XP6A 3NTPA 3KAFA 2F4EA 2F2DA 1P5QA 2LKNA 3KADA 1Q6HA 5HKGA 2IF4A 3O5OA 4W9PA 2MPHA 1F8AB 2RUQA 3TC5A 2MNTA 4IQCA 2XP8A 2M08A 2PV3A 4MSPA 1FAPA 3ODKA 1J4HA 1Q6UA 4ODQA 2PV1A 3IKDA 1Q6IA 3O5PA 2RUDA 4IPXA 5DIVA 2XP9A 1C9HA 3FAPA 5I98A 1U79A 4QIBA 1FKGA 3KCEA 2LPVA 2PPPA 1Y0OA 5DIUA 4DH0A 2XP7A
chains in the Genus database with same CATH superfamily
1HKMA 4L72B 1NMVA 1ROTA 1FKLA 2KR7A 4QZVB 3UI5A 2ZR5A 1CTNA 2ITKA 1ITXA 2K8IA 4NNRA 4MAVA 5GQBA 1FKHA 2A3CA 1D2KA 1J4IA 4MNMA 2RURA 3JYMA 1R9HA 3BMBA 4DRIA 4Z2JA 4IT6A 1JNDA 1XHGA 4S3JA 4DRKA 1NWSA 2YBUA 5DO2A 4S3KA 1EIBA 2XP5A 1JCHB 4MPKA 4U86A 5DITA 2A3BA 1W9PA 3AQUA 1KT1A 1K9TA 5GPGA 3GPKA 3ALGA 2KE0A 1Q1CA 2AWGA 3KAHA 5JH8A 1E15A 4WKAA 2LJ4A 2VCDA 1ZBWA 1BL4A 3O5DA 1X6LA 3B9EA 1E6NA 2ZR6A 1FKBA 1M5YA 2RSEA 1PBKA 3WQWA 3UI4A 4MNLA 4L3NA 4TNSA 1XRVA 4XAKA 3UF8A 1FKJA 1LQ0A 2MLZA 3EIPA 3CZ8A 3PRBA 4DRMA 1LL4A 2DPEA 1FKKA 1N1AA 1NWUA 4JYSA 2B5UB 5J6EA 3WKZA 1HKIA 5HW8A 2Y78A 2WK2A 3AS3A 1OGGA 5DEZA 3I6CA 2DSWA 4LGXA 1L1PA 4DRQA 1HJVA 4Q22A 2ETNA 1FKRA 3O5IA 4Z2LA 2XP6A 2F4EA 3O5OA 4W9PA 4WK9A 1F8AB 4R5EA 1W9UA 1FAPA 1EDQA 1HKKA 5HBFA 3ODKA 3ARPA 1Q6UA 3O5PA 4IPXA 1Q6IA 5I98A 2RUDA 1JNEA 1U79A 4WKHA 2LPVA 3W4RA 1D7JA 3RFWA 3RM8A 4DRHA 3KAIA 2DT2A 3O5FA 4MNJA 5HWBA 1T11A 4P8WA 1FFRA 4TX0A 1HJXA 3ARZA 1W1VA 3JYJA 2O9OA 2YBTA 1KT0A 3RM4A 4GGQA 4DZ3A 1J4RA 3MDYB 3O5LA 3WD2A 1E6PA 1FKSA 1FKIA 1LL7A 2LGOA 2B31A 4U85A 4ODLA 2O92A 4DWSC 2WLZA 4HARA 2G8ZA 1NMWA 5HT1A 1QPFA 1TCOC 1X6NA 3ARQA 3B7XA 4DRNA 1QPLA 4ODPA 5DF0A 1ZU8A 4LAXA 1NWTA 2F21A 4G50A 4GIVA 1FD9A 1GPFA 4Z2HA 2ESCA 2MLYA 2WM0A 3PA7A 4DZ2A 2PBCA 3WD3A 2DG4A 4R0XA 3ARSA 1LJYA 4MGVA 4TW7A 1ZBKA 2DG3A 2DSUA 1E6RA 2PI6A 3B9DA 3IK8A 1FKDA 1FKFA 1W1TA 3AS2A 1NWRA 4ODKA 1EYMA 1B6CA 2OLHA 1O6IA 1D7IA 1PINA 2L2SA 4N19A 3TDBA 4ZPWR 3WL1A 4ITZA 3BXWA 1BKFA 3B9AA 2M2AA 3NTPA 4P8VA 1E44A 4ZPVR 3KADA 2LKNA 2DT0A 1Q6HA 4P8XA 5GPRA 1E6ZA 4IQCA 4MSPA 4ZPTR 2XP9A 4NSBA 4KQZA 4LAYA 1Y0OA 4MNKA 3TC5A 4DH0A 3GU0A 2D9FA 4O2TA 4PTMA 2PPNA 5B8IC 4LAWA 1RD6A 3ARWA 3WD4A 1ZL1A 1H0IA 3ARUA 2UZ5A 4C02B 1YW5A 2PN0A 1D6OA 1GUVA 1FJDA 2ZQUA 4ZS6A 3ARXA 3KAGA 4ODMA 3UQIA 3ARVA 2FAPA 3PRAA 1FFQA 2ZQVA 3KZ7A 4Z2IA 1LL6A 1TFVA 1VF8A 2IUZA 2KGJA 3UI6A 4DRPA 2JZVA 1F40A 2DSVA 2DT1A 3O5JA 4JFMA 4ODNA 3WIJA 2M1IA 4FN2A 2A3EA 3VAWA 1LG2A 1ZBVA 4DRJA 3NRKA 3ALFA 2XPAA 1SYTA 3B8SA 4QT2A 4G2PA 4J4NA 3O5KA 2Q5AA 4U84A 5D75A 2OFNA 1ZCNA 2MLXA 3PRDA 1D7HA 4QIBA 4P8UA 1QZ2A 1YATA 2DG9A 4URIA 1UR9A 1WAWA 1W1PA 2MF9A 4TW8A 3UQBA 1HXVA 1W1YA 4JFLA 2P4VA 3IKGA 3WD0A 1EHNA 1JNSA 3O5MA 1OGBA 3CHEA 5BXJA 2AOSA 3RGCA 2PPOA 4DWSB 2XP4A 2QF8A 3O5RA 2PV2A 4IQ2A 5HW6A 1H0GA 4UDMA 1IX5A 2A3AA 1ZK6A 2ZR4A 4WIWA 3O5GA 4BF8A 1E9LA 1HKJA 3KAFA 1P5QA 3CHDA 5HKGA 2MPHA 2RUQA 4KR0B 2XP8A 3GTYX 4ML4A 4DWSD 4ODQA 2PV1A 5DIVA 1C9HA 3FAPA 3KCEA 4Z2GA 1NH6A 3FXYA 2G41A 3QOKA 4JFJA 4MTVA 4DT4A 3ARTA 3G6MA 4HBEA 2DT3A 1W26A 2XP3A 2XPBA 1ZBCA 3H9RB 3KABA 4WJXA 4JFIA 4W9QA 5HW7A 3O5QA 2FDMA 5HUAA 3ARRA 4Z2KA 1HJWA 1ZB5A 1WNOA 3AS1A 2F23A 1UR8A 3EY6A 2ZQTA 3RM9A 4LAVA 1WB0A 4DROA 3CGNA 4ODRA 3CGMA 4Q7NA 1J6YA 2WLYA 3WQVA 4DWSA 1NSGA 1ROUA 4NZCA 3RMEA 4FAPA 3FY1A 4W9OA 3TCZA 2KO7A 3WL0A 1GOIA 3JXVA 2VN1A 3ARYA 3PR9A 3CHCA 4J4OA 3IHZA 4JFKA 2RUCA 2KI3A 1JNTA 2N87A 1FKTA 1SR0A 5HTGA 1W9VA 3CH9A 3WD1A 1OWQA 4DIPA 4ODOA 2RQSA 2DSZA 3AS0A 3UQAA 4TYOA 3LUOA 5HWCA 3KACA 3OOBA 3NI6A 3CHFA 2FKEA 2KFWA 1JVWA 1KFWA 3O5EA 2ZQSA 4AY1A 3WH0A 1EQ3A 4TW6A 4QT3A 1A7XA 3G6LA 2F2DA 4WKFA 2IF4A 2MNTA 4W5UA 2M08A 2EULA 1LG1A 1GRJA 2PV3A 4HBOA 4IT4A 1J4HA 3AROA 3OA5A 3IKDA 1FKGA 2PPPA 5DIUA 2XP7A
chains in the Genus database with same CATH topology
1HKMA 4L72B 1NMVA 1ROTA 1FKLA 2KR7A 4QZVB 3UI5A 2ZR5A 1CTNA 2ITKA 1ITXA 2K8IA 4NNRA 4MAVA 5GQBA 1FKHA 2A3CA 1D2KA 1J4IA 4MNMA 2RURA 3JYMA 1R9HA 4DRIA 4Z2JA 4IT6A 1JNDA 1XHGA 4S3JA 4DRKA 1NWSA 2YBUA 5DO2A 4S3KA 1EIBA 2XP5A 4MPKA 4U86A 5DITA 2A3BA 1W9PA 3AQUA 1KT1A 1K9TA 5GPGA 3GPKA 3ALGA 2KE0A 1Q1CA 2AWGA 3KAHA 5JH8A 1E15A 4WKAA 2LJ4A 2VCDA 1ZBWA 1BL4A 3O5DA 1X6LA 3B9EA 1E6NA 2ZR6A 1FKBA 1M5YA 2RSEA 1PBKA 3WQWA 3UI4A 4MNLA 4L3NA 4TNSA 1XRVA 4XAKA 3UF8A 1FKJA 1LQ0A 2MLZA 3CZ8A 3PRBA 4DRMA 1LL4A 2DPEA 1FKKA 1N1AA 1NWUA 4JYSA 5J6EA 3WKZA 1HKIA 5HW8A 2Y78A 2WK2A 3AS3A 1OGGA 5DEZA 3I6CA 2DSWA 4LGXA 1L1PA 4DRQA 1HJVA 4Q22A 1FKRA 3O5IA 4Z2LA 2XP6A 2F4EA 3O5OA 4W9PA 4WK9A 1F8AB 4R5EA 1W9UA 1FAPA 1EDQA 1HKKA 5HBFA 3ODKA 3ARPA 1Q6UA 3O5PA 4IPXA 1Q6IA 5I98A 2RUDA 1JNEA 1U79A 4WKHA 2LPVA 3W4RA 1D7JA 3RFWA 3RM8A 4DRHA 3KAIA 2DT2A 3O5FA 4MNJA 5HWBA 1T11A 4P8WA 1FFRA 4TX0A 1HJXA 3ARZA 1W1VA 3JYJA 2O9OA 2YBTA 1KT0A 3RM4A 4GGQA 4DZ3A 1J4RA 3MDYB 3O5LA 3WD2A 1E6PA 1FKSA 1FKIA 1LL7A 2LGOA 2B31A 4U85A 4ODLA 2O92A 4DWSC 2WLZA 4HARA 2G8ZA 1NMWA 5HT1A 1QPFA 1TCOC 1X6NA 3ARQA 3B7XA 4DRNA 1QPLA 4ODPA 5DF0A 1ZU8A 4LAXA 1NWTA 2F21A 4G50A 4GIVA 1FD9A 1GPFA 4Z2HA 2ESCA 2MLYA 2WM0A 3PA7A 4DZ2A 2PBCA 3WD3A 2DG4A 4R0XA 3ARSA 1LJYA 4MGVA 4TW7A 1ZBKA 2DG3A 2DSUA 1E6RA 2PI6A 3B9DA 3IK8A 1FKDA 1FKFA 1W1TA 3AS2A 1NWRA 4ODKA 1EYMA 1B6CA 2OLHA 1O6IA 1D7IA 1PINA 2L2SA 4N19A 3TDBA 4ZPWR 3WL1A 4ITZA 3BXWA 1BKFA 3B9AA 2M2AA 3NTPA 4P8VA 4ZPVR 3KADA 2LKNA 2DT0A 1Q6HA 4P8XA 5GPRA 1E6ZA 4IQCA 4MSPA 4ZPTR 2XP9A 4NSBA 4KQZA 4LAYA 1Y0OA 4MNKA 3TC5A 4DH0A 4O2TA 2D9FA 4PTMA 2PPNA 5B8IC 4LAWA 1RD6A 3ARWA 3WD4A 1ZL1A 1H0IA 3ARUA 2UZ5A 4C02B 1YW5A 1D6OA 1GUVA 1FJDA 2ZQUA 4ZS6A 3ARXA 3KAGA 4ODMA 3UQIA 3ARVA 2FAPA 3PRAA 1FFQA 2ZQVA 3KZ7A 4Z2IA 1LL6A 1TFVA 1VF8A 2IUZA 2KGJA 3UI6A 4DRPA 2JZVA 1F40A 2DSVA 2DT1A 3O5JA 4JFMA 4ODNA 3WIJA 2M1IA 4FN2A 2A3EA 3VAWA 1LG2A 1ZBVA 4DRJA 3NRKA 3ALFA 2XPAA 1SYTA 3B8SA 4QT2A 4J4NA 4G2PA 3O5KA 2Q5AA 4U84A 5D75A 2OFNA 1ZCNA 2MLXA 3PRDA 1D7HA 4QIBA 4P8UA 1QZ2A 1YATA 2DG9A 4URIA 1UR9A 1WAWA 1W1PA 2MF9A 4TW8A 3UQBA 1HXVA 1W1YA 4JFLA 3WD0A 3IKGA 1JNSA 1EHNA 3O5MA 1OGBA 3CHEA 5BXJA 2AOSA 3RGCA 2PPOA 4DWSB 2XP4A 2QF8A 3O5RA 2PV2A 4IQ2A 5HW6A 1H0GA 1IX5A 2A3AA 1ZK6A 2ZR4A 4WIWA 3O5GA 4BF8A 1E9LA 1HKJA 3KAFA 1P5QA 3CHDA 5HKGA 2MPHA 2RUQA 4KR0B 2XP8A 4ML4A 4DWSD 4ODQA 2PV1A 5DIVA 1C9HA 3FAPA 3KCEA 4Z2GA 1NH6A 3FXYA 2G41A 3QOKA 4JFJA 4MTVA 4DT4A 3ARTA 3G6MA 4HBEA 2DT3A 1W26A 2XP3A 2XPBA 1ZBCA 3H9RB 3KABA 4WJXA 4JFIA 4W9QA 5HW7A 3O5QA 2FDMA 5HUAA 3ARRA 4Z2KA 1HJWA 1ZB5A 1WNOA 3AS1A 1UR8A 3EY6A 2ZQTA 3RM9A 4LAVA 1WB0A 4DROA 3CGNA 4ODRA 3CGMA 4Q7NA 1J6YA 2WLYA 3WQVA 4DWSA 1NSGA 1ROUA 4NZCA 3RMEA 4FAPA 3FY1A 4W9OA 3TCZA 2KO7A 3WL0A 1GOIA 3JXVA 2VN1A 3ARYA 3PR9A 3CHCA 4J4OA 3IHZA 4JFKA 2RUCA 2KI3A 1JNTA 2N87A 1FKTA 1SR0A 5HTGA 1W9VA 3CH9A 3WD1A 1OWQA 4DIPA 4ODOA 2RQSA 2DSZA 3AS0A 3UQAA 4TYOA 3LUOA 5HWCA 3KACA 3OOBA 3NI6A 3CHFA 2FKEA 2KFWA 1JVWA 1KFWA 3O5EA 2ZQSA 4AY1A 3WH0A 1EQ3A 4TW6A 4QT3A 1A7XA 3G6LA 2F2DA 4WKFA 2IF4A 2MNTA 4W5UA 2M08A 1LG1A 2PV3A 4HBOA 4IT4A 1J4HA 3AROA 3OA5A 3IKDA 1FKGA 2PPPA 5DIUA 2XP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O2T A;  2D9F A;  2PPN A;  5B8I C;  4LAW A;  4DRH A;  4JFJ A;  3KAI A;  3O5F A;  5HWB A;  4DT4 A;  2UZ5 A;  1T11 A;  1NMV A;  1ROT A;  1YW5 A;  4C02 B;  4TX0 A;  1FKL A;  2KR7 A;  1W26 A;  2XP3 A;  3UI5 A;  3JYJ A;  2XPB A;  1D6O A;  2ZR5 A;  3H9R B;  1KT0 A;  2ITK A;  1FJD A;  2ZQU A;  2K8I A;  4GGQ A;  4NNR A;  4DZ3 A;  1J4R A;  3KAB A;  1FKH A;  3MDY B;  3O5L A;  4JFI A;  4W9Q A;  5HW7 A;  3KAG A;  4ODM A;  3UQI A;  1J4I A;  3O5Q A;  5HUA A;  2RUR A;  2FAP A;  1FKS A;  3JYM A;  1FKI A;  2ZQV A;  1R9H A;  3KZ7 A;  2KGJ A;  4LAY A;  2LGO A;  3UI6 A;  4DRP A;  4U85 A;  4ODL A;  2JZV A;  1F40 A;  3EY6 A;  4DRI A;  2ZQT A;  4LAV A;  4DRK A;  1NMW A;  5HT1 A;  3O5J A;  1QPF A;  4DRO A;  3CGN A;  1TCO C;  4JFM A;  4ODR A;  3CGM A;  4ODN A;  2M1I A;  1J6Y A;  2XP5 A;  5DIT A;  4U86 A;  4FN2 A;  3VAW A;  1NSG A;  1ROU A;  3B7X A;  1KT1 A;  4DRN A;  4DRJ A;  5GPG A;  1QPL A;  4ODP A;  3GPK A;  4FAP A;  3NRK A;  4W9O A;  2KE0 A;  2KO7 A;  2XPA A;  1Q1C A;  2AWG A;  4LAX A;  3TCZ A;  4QT2 A;  3KAH A;  2F21 A;  3JXV A;  3O5K A;  4G2P A;  4G50 A;  1D7J A;  2VN1 A;  2Q5A A;  4J4N A;  2LJ4 A;  4U84 A;  5D75 A;  2OFN A;  2VCD A;  1ZCN A;  1BL4 A;  4GIV A;  3O5D A;  1FD9 A;  2MLX A;  2ZR6 A;  1FKB A;  3PRD A;  1D7H A;  1M5Y A;  2MLY A;  1PBK A;  2RSE A;  3IHZ A;  3PA7 A;  4J4O A;  4JFK A;  1QZ2 A;  1YAT A;  2DG9 A;  2RUC A;  2PBC A;  3UI4 A;  4DZ2 A;  2DG4 A;  2MF9 A;  2KI3 A;  1JNT A;  4R0X A;  4MGV A;  2N87 A;  4TNS A;  4TW7 A;  2DG3 A;  4TW8 A;  3UF8 A;  1FKT A;  3UQB A;  1FKJ A;  2MLZ A;  1HXV A;  4DRM A;  3PRB A;  4JFL A;  3IK8 A;  1FKK A;  1N1A A;  1FKD A;  3IKG A;  5HTG A;  1JNS A;  4JYS A;  1FKF A;  3O5M A;  5J6E A;  4DIP A;  5HW8 A;  4ODO A;  2Y78 A;  2RQS A;  5BXJ A;  3RGC A;  3I6C A;  4ODK A;  3UQA A;  4TYO A;  2PPO A;  1L1P A;  2XP4 A;  3LUO A;  3O5R A;  3RFW A;  5HWC A;  2PV2 A;  3KAC A;  1EYM A;  3NI6 A;  1B6C A;  2FKE A;  3OOB A;  4IQ2 A;  4DRQ A;  5HW6 A;  1D7I A;  1PIN A;  2L2S A;  4N19 A;  3TDB A;  2KFW A;  1JVW A;  4ITZ A;  1FKR A;  3O5I A;  1BKF A;  3O5E A;  2ZQS A;  3WH0 A;  1EQ3 A;  1ZK6 A;  4TW6 A;  2ZR4 A;  4QT3 A;  2M2A A;  3O5G A;  4BF8 A;  1A7X A;  2XP6 A;  3NTP A;  3KAF A;  2F4E A;  2F2D A;  1P5Q A;  2LKN A;  3KAD A;  1Q6H A;  5HKG A;  2IF4 A;  3O5O A;  4W9P A;  2MPH A;  1F8A B;  2RUQ A;  3TC5 A;  2MNT A;  4IQC A;  2XP8 A;  2M08 A;  2PV3 A;  4MSP A;  1FAP A;  3ODK A;  1J4H A;  1Q6U A;  4ODQ A;  2PV1 A;  3IKD A;  1Q6I A;  3O5P A;  2RUD A;  4IPX A;  5DIV A;  2XP9 A;  1C9H A;  3FAP A;  5I98 A;  1U79 A;  4QIB A;  1FKG A;  3KCE A;  2LPV A;  2PPP A;  1Y0O A;  5DIU A;  4DH0 A;  2XP7 A; 
#chains in the Genus database with same CATH topology
 1HKM A;  4L72 B;  1NMV A;  1ROT A;  1FKL A;  2KR7 A;  4QZV B;  3UI5 A;  2ZR5 A;  1CTN A;  2ITK A;  1ITX A;  2K8I A;  4NNR A;  4MAV A;  5GQB A;  1FKH A;  2A3C A;  1D2K A;  1J4I A;  4MNM A;  2RUR A;  3JYM A;  1R9H A;  3BMB A;  4DRI A;  4Z2J A;  4IT6 A;  1JND A;  1XHG A;  4S3J A;  4DRK A;  1NWS A;  2YBU A;  5DO2 A;  4S3K A;  1EIB A;  2XP5 A;  1JCH B;  4MPK A;  4U86 A;  5DIT A;  2A3B A;  1W9P A;  3AQU A;  1KT1 A;  1K9T A;  5GPG A;  3GPK A;  3ALG A;  2KE0 A;  1Q1C A;  2AWG A;  3KAH A;  5JH8 A;  1E15 A;  4WKA A;  2LJ4 A;  2VCD A;  1ZBW A;  1BL4 A;  3O5D A;  1X6L A;  3B9E A;  1E6N A;  2ZR6 A;  1FKB A;  1M5Y A;  2RSE A;  1PBK A;  3WQW A;  3UI4 A;  4MNL A;  4L3N A;  4TNS A;  1XRV A;  4XAK A;  3UF8 A;  1FKJ A;  1LQ0 A;  2MLZ A;  3EIP A;  3CZ8 A;  3PRB A;  4DRM A;  1LL4 A;  2DPE A;  1FKK A;  1N1A A;  1NWU A;  4JYS A;  2B5U B;  5J6E A;  3WKZ A;  1HKI A;  5HW8 A;  2Y78 A;  2WK2 A;  3AS3 A;  1OGG A;  5DEZ A;  3I6C A;  2DSW A;  4LGX A;  1L1P A;  4DRQ A;  1HJV A;  4Q22 A;  2ETN A;  1FKR A;  3O5I A;  4Z2L A;  2XP6 A;  2F4E A;  3O5O A;  4W9P A;  4WK9 A;  1F8A B;  4R5E A;  1W9U A;  1FAP A;  1EDQ A;  1HKK A;  5HBF A;  3ODK A;  3ARP A;  1Q6U A;  3O5P A;  4IPX A;  1Q6I A;  5I98 A;  2RUD A;  1JNE A;  1U79 A;  4WKH A;  2LPV A;  3W4R A;  1D7J A;  3RFW A;  3RM8 A;  4DRH A;  3KAI A;  2DT2 A;  3O5F A;  4MNJ A;  5HWB A;  1T11 A;  4P8W A;  1FFR A;  4TX0 A;  1HJX A;  3ARZ A;  1W1V A;  3JYJ A;  2O9O A;  2YBT A;  1KT0 A;  3RM4 A;  4GGQ A;  4DZ3 A;  1J4R A;  3MDY B;  3O5L A;  3WD2 A;  1E6P A;  1FKS A;  1FKI A;  1LL7 A;  2LGO A;  2B31 A;  4U85 A;  4ODL A;  2O92 A;  4DWS C;  2WLZ A;  4HAR A;  2G8Z A;  1NMW A;  5HT1 A;  1QPF A;  1TCO C;  1X6N A;  3ARQ A;  3B7X A;  4DRN A;  1QPL A;  4ODP A;  5DF0 A;  1ZU8 A;  4LAX A;  1NWT A;  2F21 A;  4G50 A;  4GIV A;  1FD9 A;  1GPF A;  4Z2H A;  2ESC A;  2MLY A;  2WM0 A;  3PA7 A;  4DZ2 A;  2PBC A;  3WD3 A;  2DG4 A;  4R0X A;  3ARS A;  1LJY A;  4MGV A;  4TW7 A;  1ZBK A;  2DG3 A;  2DSU A;  1E6R A;  2PI6 A;  3B9D A;  3IK8 A;  1FKD A;  1FKF A;  1W1T A;  3AS2 A;  1NWR A;  4ODK A;  1EYM A;  1B6C A;  2OLH A;  1O6I A;  1D7I A;  1PIN A;  2L2S A;  4N19 A;  3TDB A;  4ZPW R;  3WL1 A;  4ITZ A;  3BXW A;  1BKF A;  3B9A A;  2M2A A;  3NTP A;  4P8V A;  1E44 A;  4ZPV R;  3KAD A;  2LKN A;  2DT0 A;  1Q6H A;  4P8X A;  5GPR A;  1E6Z A;  4IQC A;  4MSP A;  4ZPT R;  2XP9 A;  4NSB A;  4KQZ A;  4LAY A;  1Y0O A;  4MNK A;  3TC5 A;  4DH0 A;  3GU0 A;  2D9F A;  4O2T A;  4PTM A;  2PPN A;  5B8I C;  4LAW A;  1RD6 A;  3ARW A;  3WD4 A;  1ZL1 A;  1H0I A;  3ARU A;  2UZ5 A;  4C02 B;  1YW5 A;  2PN0 A;  1D6O A;  1GUV A;  1FJD A;  2ZQU A;  4ZS6 A;  3ARX A;  3KAG A;  4ODM A;  3UQI A;  3ARV A;  2FAP A;  3PRA A;  1FFQ A;  2ZQV A;  3KZ7 A;  4Z2I A;  1LL6 A;  1TFV A;  1VF8 A;  2IUZ A;  2KGJ A;  3UI6 A;  4DRP A;  2JZV A;  1F40 A;  2DSV A;  2DT1 A;  3O5J A;  4JFM A;  4ODN A;  3WIJ A;  2M1I A;  4FN2 A;  2A3E A;  3VAW A;  1LG2 A;  1ZBV A;  4DRJ A;  3NRK A;  3ALF A;  2XPA A;  1SYT A;  3B8S A;  4QT2 A;  4G2P A;  4J4N A;  3O5K A;  2Q5A A;  4U84 A;  5D75 A;  2OFN A;  1ZCN A;  2MLX A;  3PRD A;  1D7H A;  4QIB A;  4P8U A;  1QZ2 A;  1YAT A;  2DG9 A;  4URI A;  1UR9 A;  1WAW A;  1W1P A;  2MF9 A;  4TW8 A;  3UQB A;  1HXV A;  1W1Y A;  4JFL A;  2P4V A;  3IKG A;  3WD0 A;  1EHN A;  1JNS A;  3O5M A;  1OGB A;  3CHE A;  5BXJ A;  2AOS A;  3RGC A;  2PPO A;  4DWS B;  2XP4 A;  2QF8 A;  3O5R A;  2PV2 A;  4IQ2 A;  5HW6 A;  1H0G A;  4UDM A;  1IX5 A;  2A3A A;  1ZK6 A;  2ZR4 A;  4WIW A;  3O5G A;  4BF8 A;  1E9L A;  1HKJ A;  3KAF A;  1P5Q A;  3CHD A;  5HKG A;  2MPH A;  2RUQ A;  4KR0 B;  2XP8 A;  3GTY X;  4ML4 A;  4DWS D;  4ODQ A;  2PV1 A;  5DIV A;  1C9H A;  3FAP A;  3KCE A;  4Z2G A;  1NH6 A;  3FXY A;  2G41 A;  3QOK A;  4JFJ A;  4MTV A;  4DT4 A;  3ART A;  3G6M A;  4HBE A;  2DT3 A;  1W26 A;  2XP3 A;  2XPB A;  1ZBC A;  3H9R B;  3KAB A;  4WJX A;  4JFI A;  4W9Q A;  5HW7 A;  3O5Q A;  2FDM A;  5HUA A;  3ARR A;  4Z2K A;  1HJW A;  1ZB5 A;  1WNO A;  3AS1 A;  2F23 A;  1UR8 A;  3EY6 A;  2ZQT A;  3RM9 A;  4LAV A;  1WB0 A;  4DRO A;  3CGN A;  4ODR A;  3CGM A;  4Q7N A;  1J6Y A;  2WLY A;  3WQV A;  4DWS A;  1NSG A;  1ROU A;  4NZC A;  3RME A;  4FAP A;  3FY1 A;  4W9O A;  3TCZ A;  2KO7 A;  3WL0 A;  1GOI A;  3JXV A;  2VN1 A;  3ARY A;  3PR9 A;  3CHC A;  4J4O A;  3IHZ A;  4JFK A;  2RUC A;  2KI3 A;  1JNT A;  2N87 A;  1FKT A;  1SR0 A;  5HTG A;  1W9V A;  3CH9 A;  3WD1 A;  1OWQ A;  4DIP A;  4ODO A;  2RQS A;  2DSZ A;  3AS0 A;  3UQA A;  4TYO A;  3LUO A;  5HWC A;  3KAC A;  3OOB A;  3NI6 A;  3CHF A;  2FKE A;  2KFW A;  1JVW A;  1KFW A;  3O5E A;  2ZQS A;  4AY1 A;  3WH0 A;  1EQ3 A;  4TW6 A;  4QT3 A;  1A7X A;  3G6L A;  2F2D A;  4WKF A;  2IF4 A;  2MNT A;  4W5U A;  2M08 A;  2EUL A;  1LG1 A;  1GRJ A;  2PV3 A;  4HBO A;  4IT4 A;  1J4H A;  3ARO A;  3OA5 A;  3IKD A;  1FKG A;  2PPP A;  5DIU A;  2XP7 A; 
#chains in the Genus database with same CATH homology
 1HKM A;  4L72 B;  1NMV A;  1ROT A;  1FKL A;  2KR7 A;  4QZV B;  3UI5 A;  2ZR5 A;  1CTN A;  2ITK A;  1ITX A;  2K8I A;  4NNR A;  4MAV A;  5GQB A;  1FKH A;  2A3C A;  1D2K A;  1J4I A;  4MNM A;  2RUR A;  3JYM A;  1R9H A;  4DRI A;  4Z2J A;  4IT6 A;  1JND A;  1XHG A;  4S3J A;  4DRK A;  1NWS A;  2YBU A;  5DO2 A;  4S3K A;  1EIB A;  2XP5 A;  4MPK A;  4U86 A;  5DIT A;  2A3B A;  1W9P A;  3AQU A;  1KT1 A;  1K9T A;  5GPG A;  3GPK A;  3ALG A;  2KE0 A;  1Q1C A;  2AWG A;  3KAH A;  5JH8 A;  1E15 A;  4WKA A;  2LJ4 A;  2VCD A;  1ZBW A;  1BL4 A;  3O5D A;  1X6L A;  3B9E A;  1E6N A;  2ZR6 A;  1FKB A;  1M5Y A;  2RSE A;  1PBK A;  3WQW A;  3UI4 A;  4MNL A;  4L3N A;  4TNS A;  1XRV A;  4XAK A;  3UF8 A;  1FKJ A;  1LQ0 A;  2MLZ A;  3CZ8 A;  3PRB A;  4DRM A;  1LL4 A;  2DPE A;  1FKK A;  1N1A A;  1NWU A;  4JYS A;  5J6E A;  3WKZ A;  1HKI A;  5HW8 A;  2Y78 A;  2WK2 A;  3AS3 A;  1OGG A;  5DEZ A;  3I6C A;  2DSW A;  4LGX A;  1L1P A;  4DRQ A;  1HJV A;  4Q22 A;  1FKR A;  3O5I A;  4Z2L A;  2XP6 A;  2F4E A;  3O5O A;  4W9P A;  4WK9 A;  1F8A B;  4R5E A;  1W9U A;  1FAP A;  1EDQ A;  1HKK A;  5HBF A;  3ODK A;  3ARP A;  1Q6U A;  3O5P A;  4IPX A;  1Q6I A;  5I98 A;  2RUD A;  1JNE A;  1U79 A;  4WKH A;  2LPV A;  3W4R A;  1D7J A;  3RFW A;  3RM8 A;  4DRH A;  3KAI A;  2DT2 A;  3O5F A;  4MNJ A;  5HWB A;  1T11 A;  4P8W A;  1FFR A;  4TX0 A;  1HJX A;  3ARZ A;  1W1V A;  3JYJ A;  2O9O A;  2YBT A;  1KT0 A;  3RM4 A;  4GGQ A;  4DZ3 A;  1J4R A;  3MDY B;  3O5L A;  3WD2 A;  1E6P A;  1FKS A;  1FKI A;  1LL7 A;  2LGO A;  2B31 A;  4U85 A;  4ODL A;  2O92 A;  4DWS C;  2WLZ A;  4HAR A;  2G8Z A;  1NMW A;  5HT1 A;  1QPF A;  1TCO C;  1X6N A;  3ARQ A;  3B7X A;  4DRN A;  1QPL A;  4ODP A;  5DF0 A;  1ZU8 A;  4LAX A;  1NWT A;  2F21 A;  4G50 A;  4GIV A;  1FD9 A;  1GPF A;  4Z2H A;  2ESC A;  2MLY A;  2WM0 A;  3PA7 A;  4DZ2 A;  2PBC A;  3WD3 A;  2DG4 A;  4R0X A;  3ARS A;  1LJY A;  4MGV A;  4TW7 A;  1ZBK A;  2DG3 A;  2DSU A;  1E6R A;  2PI6 A;  3B9D A;  3IK8 A;  1FKD A;  1FKF A;  1W1T A;  3AS2 A;  1NWR A;  4ODK A;  1EYM A;  1B6C A;  2OLH A;  1O6I A;  1D7I A;  1PIN A;  2L2S A;  4N19 A;  3TDB A;  4ZPW R;  3WL1 A;  4ITZ A;  3BXW A;  1BKF A;  3B9A A;  2M2A A;  3NTP A;  4P8V A;  4ZPV R;  3KAD A;  2LKN A;  2DT0 A;  1Q6H A;  4P8X A;  5GPR A;  1E6Z A;  4IQC A;  4MSP A;  4ZPT R;  2XP9 A;  4NSB A;  4KQZ A;  4LAY A;  1Y0O A;  4MNK A;  3TC5 A;  4DH0 A;  4O2T A;  2D9F A;  4PTM A;  2PPN A;  5B8I C;  4LAW A;  1RD6 A;  3ARW A;  3WD4 A;  1ZL1 A;  1H0I A;  3ARU A;  2UZ5 A;  4C02 B;  1YW5 A;  1D6O A;  1GUV A;  1FJD A;  2ZQU A;  4ZS6 A;  3ARX A;  3KAG A;  4ODM A;  3UQI A;  3ARV A;  2FAP A;  3PRA A;  1FFQ A;  2ZQV A;  3KZ7 A;  4Z2I A;  1LL6 A;  1TFV A;  1VF8 A;  2IUZ A;  2KGJ A;  3UI6 A;  4DRP A;  2JZV A;  1F40 A;  2DSV A;  2DT1 A;  3O5J A;  4JFM A;  4ODN A;  3WIJ A;  2M1I A;  4FN2 A;  2A3E A;  3VAW A;  1LG2 A;  1ZBV A;  4DRJ A;  3NRK A;  3ALF A;  2XPA A;  1SYT A;  3B8S A;  4QT2 A;  4J4N A;  4G2P A;  3O5K A;  2Q5A A;  4U84 A;  5D75 A;  2OFN A;  1ZCN A;  2MLX A;  3PRD A;  1D7H A;  4QIB A;  4P8U A;  1QZ2 A;  1YAT A;  2DG9 A;  4URI A;  1UR9 A;  1WAW A;  1W1P A;  2MF9 A;  4TW8 A;  3UQB A;  1HXV A;  1W1Y A;  4JFL A;  3WD0 A;  3IKG A;  1JNS A;  1EHN A;  3O5M A;  1OGB A;  3CHE A;  5BXJ A;  2AOS A;  3RGC A;  2PPO A;  4DWS B;  2XP4 A;  2QF8 A;  3O5R A;  2PV2 A;  4IQ2 A;  5HW6 A;  1H0G A;  1IX5 A;  2A3A A;  1ZK6 A;  2ZR4 A;  4WIW A;  3O5G A;  4BF8 A;  1E9L A;  1HKJ A;  3KAF A;  1P5Q A;  3CHD A;  5HKG A;  2MPH A;  2RUQ A;  4KR0 B;  2XP8 A;  4ML4 A;  4DWS D;  4ODQ A;  2PV1 A;  5DIV A;  1C9H A;  3FAP A;  3KCE A;  4Z2G A;  1NH6 A;  3FXY A;  2G41 A;  3QOK A;  4JFJ A;  4MTV A;  4DT4 A;  3ART A;  3G6M A;  4HBE A;  2DT3 A;  1W26 A;  2XP3 A;  2XPB A;  1ZBC A;  3H9R B;  3KAB A;  4WJX A;  4JFI A;  4W9Q A;  5HW7 A;  3O5Q A;  2FDM A;  5HUA A;  3ARR A;  4Z2K A;  1HJW A;  1ZB5 A;  1WNO A;  3AS1 A;  1UR8 A;  3EY6 A;  2ZQT A;  3RM9 A;  4LAV A;  1WB0 A;  4DRO A;  3CGN A;  4ODR A;  3CGM A;  4Q7N A;  1J6Y A;  2WLY A;  3WQV A;  4DWS A;  1NSG A;  1ROU A;  4NZC A;  3RME A;  4FAP A;  3FY1 A;  4W9O A;  3TCZ A;  2KO7 A;  3WL0 A;  1GOI A;  3JXV A;  2VN1 A;  3ARY A;  3PR9 A;  3CHC A;  4J4O A;  3IHZ A;  4JFK A;  2RUC A;  2KI3 A;  1JNT A;  2N87 A;  1FKT A;  1SR0 A;  5HTG A;  1W9V A;  3CH9 A;  3WD1 A;  1OWQ A;  4DIP A;  4ODO A;  2RQS A;  2DSZ A;  3AS0 A;  3UQA A;  4TYO A;  3LUO A;  5HWC A;  3KAC A;  3OOB A;  3NI6 A;  3CHF A;  2FKE A;  2KFW A;  1JVW A;  1KFW A;  3O5E A;  2ZQS A;  4AY1 A;  3WH0 A;  1EQ3 A;  4TW6 A;  4QT3 A;  1A7X A;  3G6L A;  2F2D A;  4WKF A;  2IF4 A;  2MNT A;  4W5U A;  2M08 A;  1LG1 A;  2PV3 A;  4HBO A;  4IT4 A;  1J4H A;  3ARO A;  3OA5 A;  3IKD A;  1FKG A;  2PPP A;  5DIU A;  2XP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...