1F40A

Solution structure of fkbp12 complexed with gpi-1046, a neurotrophic ligand
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FK506 BINDING PROTEIN (FKBP12)
publication title Solution structure of a neurotrophic ligand bound to FKBP12 and its effects on protein dynamics.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2000-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1f40A00
3PRBA 3KAHA 4U84A 5HWCA 5J6EA 4W9OA 3TDBA 1QPFA 2LGOA 3IKDA 2RQSA 2XP8A 3JXVA 2ZQUA 4ODKA 3UI6A 4ODQA 4BF8A 4FAPA 1EQ3A 3UI5A 1JVWA 3ODKA 2XP7A 2LJ4A 2RSEA 1FKIA 3O5JA 1FKGA 4O2TA 3MDYB 1Q6IA 1D7JA 1FKLA 1P5QA 3PA7A 1J6YA 3O5GA 4DZ2A 1C9HA 2DG4A 2KGJA 2MPHA 3KAFA 1JNTA 4LAYA 1B6CA 3H9RB 3UF8A 1FKJA 2D9FA 4DH0A 1YATA 2XPAA 4DRHA 4GGQA 5HWBA 3IK8A 3O5KA 4QT2A 2XP3A 3VAWA 5I98A 4N19A 5GPGA 2PPPA 2PPOA 3TCZA 2M1IA 4QT3A 2AWGA 2L2SA 3O5MA 5DIVA 5HUAA 2XP9A 3O5FA 4JFIA 3I6CA 3FAPA 3KAIA 5D75A 5BXJA 3O5EA 4JYSA 4U86A 5HW8A 4TYOA 2PBCA 2N87A 1FD9A 1ROUA 3O5IA 2LKNA 4IQCA 2KR7A 2FKEA 2M2AA 4DRKA 3JYJA 4ODRA 2PPNA 4G2PA 3O5LA 4ITZA 3O5OA 1KT0A 2VN1A 1A7XA 4QIBA 1NMVA 2XP5A 5HW6A 1FKFA 1FKHA 1HXVA 2XP4A 2MF9A 2VCDA 4ODOA 2F21A 3LUOA 2ITKA 4ODLA 1D7HA 3OOBA 1FKTA 3UQIA 1QPLA 3EY6A 3PRDA 1D7IA 3IKGA 2XPBA 2PV2A 3TC5A 2KO7A 1PINA 3JYMA 2ZQSA 1FAPA 4ODNA 2M08A 4DRJA 1FKBA 2IF4A 2Q5AA 1QZ2A 3KABA 3KACA 1L1PA 4JFMA 4GIVA 1NMWA 3NI6A 4JFLA 4G50A 4TW6A 3WH0A 2RUQA 2ZR6A 4DIPA 2RUDA 4DRIA 1M5YA 2F2DA 2MNTA 1Q6HA 4U85A 4W9PA 1N1AA 3O5QA 1FKKA 4IQ2A 4JFJA 1W26A 4TNSA 4DT4A 1FKRA 3KAGA 4DZ3A 1Y0OA 4DROA 3UI4A 2K8IA 5HTGA 2ZR5A 4C02B 4W9QA 3CGNA 3NTPA 1D6OA 2DG3A 4JFKA 2KFWA 3KZ7A 4TW7A 1FJDA 1Q1CA 1FKDA 3B7XA 4LAVA 5B8IC 2ZR4A 3UQAA 1F40A 2OFNA 1NSGA 4FN2A 3O5PA 4ODMA 3KADA 4J4OA 3UQBA 3KCEA 3NRKA 4LAXA 4DRQA 3O5RA 3RGCA 1ROTA 5HT1A 2PV3A 4IPXA 4NNRA 2MLZA 2RURA 1FKSA 3O5DA 5DIUA 2JZVA 3GPKA 4MGVA 1YW5A 3IHZA 1U79A 1JNSA 1Q6UA 2KE0A 2RUCA 4DRMA 1F8AB 2XP6A 4R0XA 1EYMA 4TX0A 1J4IA 2ZQTA 4J4NA 5HW7A 1J4HA 5DITA 1ZK6A 5HKGA 1ZCNA 1KT1A 3CGMA 2FAPA 2MLXA 3RFWA 2UZ5A 2KI3A 1R9HA 2MLYA 4MSPA 4DRPA 2DG9A 2Y78A 2ZQVA 4TW8A 2PV1A 4DRNA 1J4RA 1T11A 1TCOC 4LAWA 1BL4A 1BKFA 1PBKA 2F4EA 4ODPA 2LPVA
chains in the Genus database with same CATH superfamily
1GOIA 3ARZA 4U84A 1NWUA 2LGOA 3IKDA 2XP8A 4L72B 4FAPA 2ZQUA 4ODQA 2IUZA 3UI5A 1KFWA 3B9AA 1FKIA 4WK9A 5GQBA 1FKLA 1J6YA 2DT0A 2OLHA 2WLYA 2DG4A 2G41A 1WAWA 4N19A 2PPPA 3TCZA 2M1IA 3B9DA 1LG2A 2L2SA 5DIVA 4Z2KA 3CHFA 3I6CA 4HBOA 3FXYA 1W9VA 4JYSA 1WNOA 2DSVA 1HKJA 1HKMA 3CZ8A 1ROUA 3ARTA 4AY1A 2FKEA 4XAKA 2PPNA 3O5LA 4ITZA 4P8VA 3RM8A 2VCDA 2F21A 3LUOA 4ODLA 1D7HA 3OOBA 3WD4A 2G8ZA 3TC5A 3IKGA 2PV2A 2F23A 2KO7A 1PINA 2DT3A 3G6MA 4MNKA 4ODNA 1FKBA 3QOKA 1VF8A 4WKHA 1E44A 2WLZA 4DRIA 1OGBA 1N1AA 4DZ3A 2WK2A 4C02B 3EIPA 1D6OA 2DG3A 2KFWA 1FJDA 4LAVA 5B8IC 4WIWA 3WIJA 3UQAA 1XRVA 2OFNA 1ZBKA 3WD0A 3KCEA 4W5UA 3UQBA 2PV3A 1EDQA 5DO2A 1W1PA 3WD2A 2MLZA 1FKSA 3O5DA 4WKFA 2JZVA 4MGVA 3WD1A 4J4NA 4P8WA 1LL6A 3WD3A 2MLXA 3CHDA 2KI3A 2DG9A 2ZQVA 1W9UA 3ARSA 4ZPTR 1BL4A 4ODPA 4TYOA 1ZU8A 5HWCA 2QF8A 5HWBA 1QPFA 2A3AA 4ODKA 4BF8A 3ALFA 3ODKA 1ZBWA 3CHEA 3FY1A 5DEZA 4MAVA 4DZ2A 4LAYA 1B6CA 2A3EA 2D9FA 4DH0A 1YATA 4DRHA 1H0IA 1OGGA 3O5KA 3VAWA 4QT2A 5GPGA 2PPOA 1EIBA 1GPFA 4KQZA 4QT3A 5HUAA 4ZS6A 5D75A 2ETNA 1ZBVA 4U86A 5HW8A 2N87A 3RM4A 3PRAA 4IQCA 3JYJA 4ODRA 4G2PA 3WQVA 3O5OA 1KT0A 4PTMA 1LL4A 3AS2A 3WL1A 2XP5A 5HW6A 3OA5A 3ARRA 1IX5A 1FKHA 1HXVA 2XP4A 4DWSA 2WM0A 1HJWA 1OWQA 4MTVA 4S3KA 1QPLA 3EY6A 4R5EA 3AROA 3GTYX 2B31A 4Z2LA 3ALGA 3KABA 4Z2IA 4GIVA 4JFLA 2O92A 2RUDA 1E15A 2F2DA 1Q6HA 3ARYA 4W9PA 3O5QA 1FKKA 4JFJA 4DT4A 3KAGA 1E6RA 4DROA 1E6NA 1XHGA 2K8IA 1GRJA 2ZR5A 3UI4A 3AS0A 4Q7NA 1JNEA 3ARPA 3NTPA 5JH8A 3ARQA 1ITXA 4ODMA 1H0GA 4LAXA 4DRQA 3RGCA 5HT1A 3B9EA 2YBTA 5DIUA 1NWTA 4MNMA 4DRMA 2RUCA 1F8AB 3WL0A 1J4IA 1TFVA 2ZQTA 5HW7A 5DITA 1ZK6A 1EHNA 2FDMA 3CGMA 2FAPA 1ZBCA 3RFWA 4MNJA 1R9HA 3ARWA 3AS3A 3AS1A 1J4RA 1CTNA 2F4EA 4DWSB 2LPVA 3PRBA 3KAHA 4IT6A 5DF0A 4QZVB 1E9LA 2EULA 3ARVA 2XP7A 2LJ4A 1W9PA 1LQ0A 1D7JA 1C9HA 1SYTA 2KGJA 2MPHA 3KAFA 3H9RB 1FKJA 1D2KA 2XPAA 3IK8A 2XP3A 4LGXA 5I98A 4JFIA 3O5FA 3KAIA 4HARA 4UDMA 1FD9A 3O5IA 2KR7A 4QIBA 4ODOA 1E6ZA 4NZCA 4Z2GA 1FKTA 3RM9A 3UQIA 1D7IA 2XPBA 3JYMA 1FAPA 5HBFA 2YBUA 1NMWA 3WH0A 4DIPA 2ZR6A 1E6PA 1W1VA 1M5YA 2DSUA 4S3JA 4IT4A 4U85A 4IQ2A 4TNSA 1W26A 3CH9A 4HBEA 3AQUA 5HTGA 1GUVA 4DWSD 3PR9A 2PI6A 4WKAA 1FFRA 4TW7A 1Q1CA 1FKDA 3B7XA 2ZR4A 1F40A 2DT1A 2A3BA 2PN0A 1LL7A 1NSGA 3O5PA 3KADA 3NRKA 3O5RA 4ML4A 4IPXA 2AOSA 1X6NA 3IHZA 4MNLA 1JNSA 4Q22A 1Q6UA 2KE0A 4R0XA 4TX0A 3WQWA 1J4HA 1O6IA 2A3CA 5HKGA 1ZCNA 1KT1A 1NWRA 4ZPVR 1RD6A 2ESCA 2MLYA 4DRPA 2Y78A 4TW8A 1HKIA 1T11A 1TCOC 1PBKA 1BKFA 2DT2A 1HKKA 4Z2JA 5J6EA 4W9OA 3TDBA 3UI6A 2RQSA 3JXVA 1EQ3A 1HJXA 1JVWA 2RSEA 2DSZA 4P8XA 3O5JA 1FKGA 4O2TA 3MDYB 1Q6IA 4ZPWR 1P5QA 3PA7A 3O5GA 1JNTA 3UF8A 4GGQA 1LG1A 4URIA 2AWGA 1K9TA 3O5MA 2XP9A 1W1YA 3FAPA 5BXJA 3O5EA 2PBCA 4P8UA 1W1TA 1JNDA 1FFQA 1JCHB 2LKNA 2M2AA 4DRKA 1LJYA 1SR0A 2VN1A 4WJXA 1A7XA 1NMVA 3G6LA 1FKFA 1UR9A 3WKZA 2MF9A 2B5UB 2ITKA 4MPKA 3PRDA 2ZQSA 2M08A 3BXWA 4DRJA 2IF4A 2Q5AA 1QZ2A 3ARUA 3KACA 1L1PA 1NH6A 4JFMA 3NI6A 4G50A 4TW6A 2RUQA 2MNTA 1NWSA 1FKRA 1Y0OA 3RMEA 4W9QA 3CGNA 2P4VA 4JFKA 3KZ7A 3CHCA 3GU0A 1HJVA 4KR0B 1X6LA 4FN2A 4Z2HA 4J4OA 4L3NA 1ROTA 2DSWA 2RURA 4DWSC 3GPKA 5GPRA 1YW5A 4NSBA 3B8SA 1ZB5A 1U79A 3BMBA 3W4RA 2XP6A 1EYMA 2DPEA 1UR8A 3ARXA 1ZL1A 2UZ5A 4MSPA 1WB0A 2PV1A 4DRNA 2O9OA 4LAWA 4NNRA
chains in the Genus database with same CATH topology
1GOIA 3ARZA 4U84A 1NWUA 2LGOA 3IKDA 2XP8A 4L72B 4FAPA 2ZQUA 4ODQA 2IUZA 3UI5A 1KFWA 3B9AA 1FKIA 4WK9A 5GQBA 1FKLA 1J6YA 2DT0A 2OLHA 2WLYA 2DG4A 2G41A 1WAWA 4N19A 2PPPA 3TCZA 2M1IA 3B9DA 1LG2A 2L2SA 5DIVA 4Z2KA 3CHFA 3I6CA 4HBOA 3FXYA 1W9VA 4JYSA 1WNOA 2DSVA 1HKJA 1HKMA 3CZ8A 1ROUA 3ARTA 4AY1A 2FKEA 4XAKA 2PPNA 3O5LA 4ITZA 4P8VA 3RM8A 2VCDA 2F21A 3LUOA 4ODLA 1D7HA 3OOBA 3WD4A 2G8ZA 3TC5A 3IKGA 2PV2A 2KO7A 1PINA 2DT3A 3G6MA 4MNKA 4ODNA 1FKBA 3QOKA 1VF8A 4WKHA 2WLZA 4DRIA 1OGBA 1N1AA 4DZ3A 2WK2A 4C02B 1D6OA 2DG3A 2KFWA 1FJDA 4LAVA 5B8IC 4WIWA 3WIJA 3UQAA 1XRVA 2OFNA 1ZBKA 3WD0A 3KCEA 4W5UA 3UQBA 2PV3A 1EDQA 5DO2A 1W1PA 3WD2A 2MLZA 1FKSA 3O5DA 4WKFA 2JZVA 4MGVA 3WD1A 4J4NA 4P8WA 1LL6A 3WD3A 2MLXA 3CHDA 2KI3A 2DG9A 2ZQVA 1W9UA 3ARSA 4ZPTR 1BL4A 4ODPA 4TYOA 1ZU8A 5HWCA 2QF8A 5HWBA 1QPFA 2A3AA 4ODKA 4BF8A 3ALFA 3ODKA 1ZBWA 3CHEA 3FY1A 5DEZA 4MAVA 4DZ2A 4LAYA 1B6CA 2A3EA 2D9FA 4DH0A 1YATA 4DRHA 1H0IA 1OGGA 3O5KA 3VAWA 4QT2A 5GPGA 2PPOA 1EIBA 1GPFA 4KQZA 4QT3A 5HUAA 4ZS6A 5D75A 1ZBVA 4U86A 5HW8A 2N87A 3RM4A 3PRAA 4IQCA 3JYJA 4ODRA 4G2PA 3WQVA 3O5OA 1KT0A 4PTMA 1LL4A 3AS2A 3WL1A 2XP5A 5HW6A 3OA5A 3ARRA 1IX5A 1FKHA 1HXVA 2XP4A 4DWSA 2WM0A 1HJWA 1OWQA 4MTVA 4S3KA 1QPLA 3EY6A 4R5EA 3AROA 2B31A 4Z2LA 3ALGA 3KABA 4Z2IA 4GIVA 4JFLA 2O92A 2RUDA 1E15A 2F2DA 1Q6HA 3ARYA 4W9PA 3O5QA 1FKKA 4JFJA 4DT4A 3KAGA 1E6RA 4DROA 1E6NA 1XHGA 2K8IA 2ZR5A 3UI4A 3AS0A 4Q7NA 1JNEA 3ARPA 3NTPA 5JH8A 3ARQA 1ITXA 4ODMA 1H0GA 4LAXA 4DRQA 3RGCA 5HT1A 3B9EA 2YBTA 5DIUA 1NWTA 4MNMA 4DRMA 2RUCA 1F8AB 3WL0A 1J4IA 1TFVA 2ZQTA 5HW7A 5DITA 1ZK6A 1EHNA 2FDMA 3CGMA 2FAPA 1ZBCA 3RFWA 4MNJA 1R9HA 3ARWA 3AS3A 3AS1A 1J4RA 1CTNA 2F4EA 4DWSB 2LPVA 3PRBA 3KAHA 4IT6A 5DF0A 4QZVB 1E9LA 3ARVA 2XP7A 2LJ4A 1W9PA 1LQ0A 1D7JA 1C9HA 1SYTA 2KGJA 2MPHA 3KAFA 3H9RB 1FKJA 1D2KA 2XPAA 3IK8A 2XP3A 4LGXA 5I98A 4JFIA 3O5FA 3KAIA 4HARA 1FD9A 3O5IA 2KR7A 4QIBA 4ODOA 1E6ZA 4NZCA 4Z2GA 1FKTA 3RM9A 3UQIA 1D7IA 2XPBA 3JYMA 1FAPA 5HBFA 2YBUA 1NMWA 3WH0A 4DIPA 2ZR6A 1E6PA 1W1VA 1M5YA 2DSUA 4S3JA 4IT4A 4U85A 4IQ2A 4TNSA 1W26A 3CH9A 4HBEA 3AQUA 5HTGA 1GUVA 4DWSD 3PR9A 2PI6A 4WKAA 1FFRA 4TW7A 1Q1CA 1FKDA 3B7XA 2ZR4A 1F40A 2DT1A 2A3BA 1LL7A 1NSGA 3O5PA 3KADA 3NRKA 3O5RA 4ML4A 4IPXA 2AOSA 1X6NA 3IHZA 4MNLA 1JNSA 4Q22A 1Q6UA 2KE0A 4R0XA 4TX0A 3WQWA 1J4HA 1O6IA 2A3CA 5HKGA 1ZCNA 1KT1A 1NWRA 4ZPVR 1RD6A 2ESCA 2MLYA 4DRPA 2Y78A 4TW8A 1HKIA 1T11A 1TCOC 1PBKA 1BKFA 2DT2A 1HKKA 4Z2JA 5J6EA 4W9OA 3TDBA 3UI6A 2RQSA 3JXVA 1EQ3A 1HJXA 1JVWA 2RSEA 2DSZA 4P8XA 3O5JA 1FKGA 4O2TA 3MDYB 1Q6IA 4ZPWR 1P5QA 3PA7A 3O5GA 1JNTA 3UF8A 4GGQA 1LG1A 4URIA 2AWGA 1K9TA 3O5MA 2XP9A 1W1YA 3FAPA 5BXJA 3O5EA 2PBCA 4P8UA 1W1TA 1JNDA 1FFQA 2LKNA 2M2AA 4DRKA 1LJYA 1SR0A 2VN1A 4WJXA 1A7XA 1NMVA 3G6LA 1FKFA 1UR9A 3WKZA 2MF9A 2ITKA 4MPKA 3PRDA 2ZQSA 2M08A 3BXWA 4DRJA 2IF4A 2Q5AA 1QZ2A 3ARUA 3KACA 1L1PA 1NH6A 4JFMA 3NI6A 4G50A 4TW6A 2RUQA 2MNTA 1NWSA 1FKRA 1Y0OA 3RMEA 4W9QA 3CGNA 4JFKA 3KZ7A 3CHCA 1HJVA 4KR0B 1X6LA 4FN2A 4Z2HA 4J4OA 4L3NA 1ROTA 2DSWA 2RURA 4DWSC 3GPKA 5GPRA 1YW5A 4NSBA 3B8SA 1ZB5A 1U79A 3W4RA 2XP6A 1EYMA 2DPEA 1UR8A 3ARXA 1ZL1A 2UZ5A 4MSPA 1WB0A 2PV1A 4DRNA 2O9OA 4LAWA 4NNRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PRB A;  3KAH A;  4U84 A;  5HWC A;  5J6E A;  4W9O A;  3TDB A;  1QPF A;  2LGO A;  3IKD A;  2RQS A;  2XP8 A;  3JXV A;  2ZQU A;  4ODK A;  3UI6 A;  4ODQ A;  4BF8 A;  4FAP A;  1EQ3 A;  3UI5 A;  1JVW A;  3ODK A;  2XP7 A;  2LJ4 A;  2RSE A;  1FKI A;  3O5J A;  1FKG A;  4O2T A;  3MDY B;  1Q6I A;  1D7J A;  1FKL A;  1P5Q A;  3PA7 A;  1J6Y A;  3O5G A;  4DZ2 A;  1C9H A;  2DG4 A;  2KGJ A;  2MPH A;  3KAF A;  1JNT A;  4LAY A;  1B6C A;  3H9R B;  3UF8 A;  1FKJ A;  2D9F A;  4DH0 A;  1YAT A;  2XPA A;  4DRH A;  4GGQ A;  5HWB A;  3IK8 A;  3O5K A;  4QT2 A;  2XP3 A;  3VAW A;  5I98 A;  4N19 A;  5GPG A;  2PPP A;  2PPO A;  3TCZ A;  2M1I A;  4QT3 A;  2AWG A;  2L2S A;  3O5M A;  5DIV A;  5HUA A;  2XP9 A;  3O5F A;  4JFI A;  3I6C A;  3FAP A;  3KAI A;  5D75 A;  5BXJ A;  3O5E A;  4JYS A;  4U86 A;  5HW8 A;  4TYO A;  2PBC A;  2N87 A;  1FD9 A;  1ROU A;  3O5I A;  2LKN A;  4IQC A;  2KR7 A;  2FKE A;  2M2A A;  4DRK A;  3JYJ A;  4ODR A;  2PPN A;  4G2P A;  3O5L A;  4ITZ A;  3O5O A;  1KT0 A;  2VN1 A;  1A7X A;  4QIB A;  1NMV A;  2XP5 A;  5HW6 A;  1FKF A;  1FKH A;  1HXV A;  2XP4 A;  2MF9 A;  2VCD A;  4ODO A;  2F21 A;  3LUO A;  2ITK A;  4ODL A;  1D7H A;  3OOB A;  1FKT A;  3UQI A;  1QPL A;  3EY6 A;  3PRD A;  1D7I A;  3IKG A;  2XPB A;  2PV2 A;  3TC5 A;  2KO7 A;  1PIN A;  3JYM A;  2ZQS A;  1FAP A;  4ODN A;  2M08 A;  4DRJ A;  1FKB A;  2IF4 A;  2Q5A A;  1QZ2 A;  3KAB A;  3KAC A;  1L1P A;  4JFM A;  4GIV A;  1NMW A;  3NI6 A;  4JFL A;  4G50 A;  4TW6 A;  3WH0 A;  2RUQ A;  2ZR6 A;  4DIP A;  2RUD A;  4DRI A;  1M5Y A;  2F2D A;  2MNT A;  1Q6H A;  4U85 A;  4W9P A;  1N1A A;  3O5Q A;  1FKK A;  4IQ2 A;  4JFJ A;  1W26 A;  4TNS A;  4DT4 A;  1FKR A;  3KAG A;  4DZ3 A;  1Y0O A;  4DRO A;  3UI4 A;  2K8I A;  5HTG A;  2ZR5 A;  4C02 B;  4W9Q A;  3CGN A;  3NTP A;  1D6O A;  2DG3 A;  4JFK A;  2KFW A;  3KZ7 A;  4TW7 A;  1FJD A;  1Q1C A;  1FKD A;  3B7X A;  4LAV A;  5B8I C;  2ZR4 A;  3UQA A;  1F40 A;  2OFN A;  1NSG A;  4FN2 A;  3O5P A;  4ODM A;  3KAD A;  4J4O A;  3UQB A;  3KCE A;  3NRK A;  4LAX A;  4DRQ A;  3O5R A;  3RGC A;  1ROT A;  5HT1 A;  2PV3 A;  4IPX A;  4NNR A;  2MLZ A;  2RUR A;  1FKS A;  3O5D A;  5DIU A;  2JZV A;  3GPK A;  4MGV A;  1YW5 A;  3IHZ A;  1U79 A;  1JNS A;  1Q6U A;  2KE0 A;  2RUC A;  4DRM A;  1F8A B;  2XP6 A;  4R0X A;  1EYM A;  4TX0 A;  1J4I A;  2ZQT A;  4J4N A;  5HW7 A;  1J4H A;  5DIT A;  1ZK6 A;  5HKG A;  1ZCN A;  1KT1 A;  3CGM A;  2FAP A;  2MLX A;  3RFW A;  2UZ5 A;  2KI3 A;  1R9H A;  2MLY A;  4MSP A;  4DRP A;  2DG9 A;  2Y78 A;  2ZQV A;  4TW8 A;  2PV1 A;  4DRN A;  1J4R A;  1T11 A;  1TCO C;  4LAW A;  1BL4 A;  1BKF A;  1PBK A;  2F4E A;  4ODP A;  2LPV A; 
#chains in the Genus database with same CATH topology
 1GOI A;  3ARZ A;  4U84 A;  1NWU A;  2LGO A;  3IKD A;  2XP8 A;  4L72 B;  4FAP A;  2ZQU A;  4ODQ A;  2IUZ A;  3UI5 A;  1KFW A;  3B9A A;  1FKI A;  4WK9 A;  5GQB A;  1FKL A;  1J6Y A;  2DT0 A;  2OLH A;  2WLY A;  2DG4 A;  2G41 A;  1WAW A;  4N19 A;  2PPP A;  3TCZ A;  2M1I A;  3B9D A;  1LG2 A;  2L2S A;  5DIV A;  4Z2K A;  3CHF A;  3I6C A;  4HBO A;  3FXY A;  1W9V A;  4JYS A;  1WNO A;  2DSV A;  1HKJ A;  1HKM A;  3CZ8 A;  1ROU A;  3ART A;  4AY1 A;  2FKE A;  4XAK A;  2PPN A;  3O5L A;  4ITZ A;  4P8V A;  3RM8 A;  2VCD A;  2F21 A;  3LUO A;  4ODL A;  1D7H A;  3OOB A;  3WD4 A;  2G8Z A;  3TC5 A;  3IKG A;  2PV2 A;  2F23 A;  2KO7 A;  1PIN A;  2DT3 A;  3G6M A;  4MNK A;  4ODN A;  1FKB A;  3QOK A;  1VF8 A;  4WKH A;  1E44 A;  2WLZ A;  4DRI A;  1OGB A;  1N1A A;  4DZ3 A;  2WK2 A;  4C02 B;  3EIP A;  1D6O A;  2DG3 A;  2KFW A;  1FJD A;  4LAV A;  5B8I C;  4WIW A;  3WIJ A;  3UQA A;  1XRV A;  2OFN A;  1ZBK A;  3WD0 A;  3KCE A;  4W5U A;  3UQB A;  2PV3 A;  1EDQ A;  5DO2 A;  1W1P A;  3WD2 A;  2MLZ A;  1FKS A;  3O5D A;  4WKF A;  2JZV A;  4MGV A;  3WD1 A;  4J4N A;  4P8W A;  1LL6 A;  3WD3 A;  2MLX A;  3CHD A;  2KI3 A;  2DG9 A;  2ZQV A;  1W9U A;  3ARS A;  4ZPT R;  1BL4 A;  4ODP A;  4TYO A;  1ZU8 A;  5HWC A;  2QF8 A;  5HWB A;  1QPF A;  2A3A A;  4ODK A;  4BF8 A;  3ALF A;  3ODK A;  1ZBW A;  3CHE A;  3FY1 A;  5DEZ A;  4MAV A;  4DZ2 A;  4LAY A;  1B6C A;  2A3E A;  2D9F A;  4DH0 A;  1YAT A;  4DRH A;  1H0I A;  1OGG A;  3O5K A;  3VAW A;  4QT2 A;  5GPG A;  2PPO A;  1EIB A;  1GPF A;  4KQZ A;  4QT3 A;  5HUA A;  4ZS6 A;  5D75 A;  2ETN A;  1ZBV A;  4U86 A;  5HW8 A;  2N87 A;  3RM4 A;  3PRA A;  4IQC A;  3JYJ A;  4ODR A;  4G2P A;  3WQV A;  3O5O A;  1KT0 A;  4PTM A;  1LL4 A;  3AS2 A;  3WL1 A;  2XP5 A;  5HW6 A;  3OA5 A;  3ARR A;  1IX5 A;  1FKH A;  1HXV A;  2XP4 A;  4DWS A;  2WM0 A;  1HJW A;  1OWQ A;  4MTV A;  4S3K A;  1QPL A;  3EY6 A;  4R5E A;  3ARO A;  3GTY X;  2B31 A;  4Z2L A;  3ALG A;  3KAB A;  4Z2I A;  4GIV A;  4JFL A;  2O92 A;  2RUD A;  1E15 A;  2F2D A;  1Q6H A;  3ARY A;  4W9P A;  3O5Q A;  1FKK A;  4JFJ A;  4DT4 A;  3KAG A;  1E6R A;  4DRO A;  1E6N A;  1XHG A;  2K8I A;  1GRJ A;  2ZR5 A;  3UI4 A;  3AS0 A;  4Q7N A;  1JNE A;  3ARP A;  3NTP A;  5JH8 A;  3ARQ A;  1ITX A;  4ODM A;  1H0G A;  4LAX A;  4DRQ A;  3RGC A;  5HT1 A;  3B9E A;  2YBT A;  5DIU A;  1NWT A;  4MNM A;  4DRM A;  2RUC A;  1F8A B;  3WL0 A;  1J4I A;  1TFV A;  2ZQT A;  5HW7 A;  5DIT A;  1ZK6 A;  1EHN A;  2FDM A;  3CGM A;  2FAP A;  1ZBC A;  3RFW A;  4MNJ A;  1R9H A;  3ARW A;  3AS3 A;  3AS1 A;  1J4R A;  1CTN A;  2F4E A;  4DWS B;  2LPV A;  3PRB A;  3KAH A;  4IT6 A;  5DF0 A;  4QZV B;  1E9L A;  2EUL A;  3ARV A;  2XP7 A;  2LJ4 A;  1W9P A;  1LQ0 A;  1D7J A;  1C9H A;  1SYT A;  2KGJ A;  2MPH A;  3KAF A;  3H9R B;  1FKJ A;  1D2K A;  2XPA A;  3IK8 A;  2XP3 A;  4LGX A;  5I98 A;  4JFI A;  3O5F A;  3KAI A;  4HAR A;  4UDM A;  1FD9 A;  3O5I A;  2KR7 A;  4QIB A;  4ODO A;  1E6Z A;  4NZC A;  4Z2G A;  1FKT A;  3RM9 A;  3UQI A;  1D7I A;  2XPB A;  3JYM A;  1FAP A;  5HBF A;  2YBU A;  1NMW A;  3WH0 A;  4DIP A;  2ZR6 A;  1E6P A;  1W1V A;  1M5Y A;  2DSU A;  4S3J A;  4IT4 A;  4U85 A;  4IQ2 A;  4TNS A;  1W26 A;  3CH9 A;  4HBE A;  3AQU A;  5HTG A;  1GUV A;  4DWS D;  3PR9 A;  2PI6 A;  4WKA A;  1FFR A;  4TW7 A;  1Q1C A;  1FKD A;  3B7X A;  2ZR4 A;  1F40 A;  2DT1 A;  2A3B A;  2PN0 A;  1LL7 A;  1NSG A;  3O5P A;  3KAD A;  3NRK A;  3O5R A;  4ML4 A;  4IPX A;  2AOS A;  1X6N A;  3IHZ A;  4MNL A;  1JNS A;  4Q22 A;  1Q6U A;  2KE0 A;  4R0X A;  4TX0 A;  3WQW A;  1J4H A;  1O6I A;  2A3C A;  5HKG A;  1ZCN A;  1KT1 A;  1NWR A;  4ZPV R;  1RD6 A;  2ESC A;  2MLY A;  4DRP A;  2Y78 A;  4TW8 A;  1HKI A;  1T11 A;  1TCO C;  1PBK A;  1BKF A;  2DT2 A;  1HKK A;  4Z2J A;  5J6E A;  4W9O A;  3TDB A;  3UI6 A;  2RQS A;  3JXV A;  1EQ3 A;  1HJX A;  1JVW A;  2RSE A;  2DSZ A;  4P8X A;  3O5J A;  1FKG A;  4O2T A;  3MDY B;  1Q6I A;  4ZPW R;  1P5Q A;  3PA7 A;  3O5G A;  1JNT A;  3UF8 A;  4GGQ A;  1LG1 A;  4URI A;  2AWG A;  1K9T A;  3O5M A;  2XP9 A;  1W1Y A;  3FAP A;  5BXJ A;  3O5E A;  2PBC A;  4P8U A;  1W1T A;  1JND A;  1FFQ A;  1JCH B;  2LKN A;  2M2A A;  4DRK A;  1LJY A;  1SR0 A;  2VN1 A;  4WJX A;  1A7X A;  1NMV A;  3G6L A;  1FKF A;  1UR9 A;  3WKZ A;  2MF9 A;  2B5U B;  2ITK A;  4MPK A;  3PRD A;  2ZQS A;  2M08 A;  3BXW A;  4DRJ A;  2IF4 A;  2Q5A A;  1QZ2 A;  3ARU A;  3KAC A;  1L1P A;  1NH6 A;  4JFM A;  3NI6 A;  4G50 A;  4TW6 A;  2RUQ A;  2MNT A;  1NWS A;  1FKR A;  1Y0O A;  3RME A;  4W9Q A;  3CGN A;  2P4V A;  4JFK A;  3KZ7 A;  3CHC A;  3GU0 A;  1HJV A;  4KR0 B;  1X6L A;  4FN2 A;  4Z2H A;  4J4O A;  4L3N A;  1ROT A;  2DSW A;  2RUR A;  4DWS C;  3GPK A;  5GPR A;  1YW5 A;  4NSB A;  3B8S A;  1ZB5 A;  1U79 A;  3BMB A;  3W4R A;  2XP6 A;  1EYM A;  2DPE A;  1UR8 A;  3ARX A;  1ZL1 A;  2UZ5 A;  4MSP A;  1WB0 A;  2PV1 A;  4DRN A;  2O9O A;  4LAW A;  4NNR A; 
#chains in the Genus database with same CATH homology
 1GOI A;  3ARZ A;  4U84 A;  1NWU A;  2LGO A;  3IKD A;  2XP8 A;  4L72 B;  4FAP A;  2ZQU A;  4ODQ A;  2IUZ A;  3UI5 A;  1KFW A;  3B9A A;  1FKI A;  4WK9 A;  5GQB A;  1FKL A;  1J6Y A;  2DT0 A;  2OLH A;  2WLY A;  2DG4 A;  2G41 A;  1WAW A;  4N19 A;  2PPP A;  3TCZ A;  2M1I A;  3B9D A;  1LG2 A;  2L2S A;  5DIV A;  4Z2K A;  3CHF A;  3I6C A;  4HBO A;  3FXY A;  1W9V A;  4JYS A;  1WNO A;  2DSV A;  1HKJ A;  1HKM A;  3CZ8 A;  1ROU A;  3ART A;  4AY1 A;  2FKE A;  4XAK A;  2PPN A;  3O5L A;  4ITZ A;  4P8V A;  3RM8 A;  2VCD A;  2F21 A;  3LUO A;  4ODL A;  1D7H A;  3OOB A;  3WD4 A;  2G8Z A;  3TC5 A;  3IKG A;  2PV2 A;  2KO7 A;  1PIN A;  2DT3 A;  3G6M A;  4MNK A;  4ODN A;  1FKB A;  3QOK A;  1VF8 A;  4WKH A;  2WLZ A;  4DRI A;  1OGB A;  1N1A A;  4DZ3 A;  2WK2 A;  4C02 B;  1D6O A;  2DG3 A;  2KFW A;  1FJD A;  4LAV A;  5B8I C;  4WIW A;  3WIJ A;  3UQA A;  1XRV A;  2OFN A;  1ZBK A;  3WD0 A;  3KCE A;  4W5U A;  3UQB A;  2PV3 A;  1EDQ A;  5DO2 A;  1W1P A;  3WD2 A;  2MLZ A;  1FKS A;  3O5D A;  4WKF A;  2JZV A;  4MGV A;  3WD1 A;  4J4N A;  4P8W A;  1LL6 A;  3WD3 A;  2MLX A;  3CHD A;  2KI3 A;  2DG9 A;  2ZQV A;  1W9U A;  3ARS A;  4ZPT R;  1BL4 A;  4ODP A;  4TYO A;  1ZU8 A;  5HWC A;  2QF8 A;  5HWB A;  1QPF A;  2A3A A;  4ODK A;  4BF8 A;  3ALF A;  3ODK A;  1ZBW A;  3CHE A;  3FY1 A;  5DEZ A;  4MAV A;  4DZ2 A;  4LAY A;  1B6C A;  2A3E A;  2D9F A;  4DH0 A;  1YAT A;  4DRH A;  1H0I A;  1OGG A;  3O5K A;  3VAW A;  4QT2 A;  5GPG A;  2PPO A;  1EIB A;  1GPF A;  4KQZ A;  4QT3 A;  5HUA A;  4ZS6 A;  5D75 A;  1ZBV A;  4U86 A;  5HW8 A;  2N87 A;  3RM4 A;  3PRA A;  4IQC A;  3JYJ A;  4ODR A;  4G2P A;  3WQV A;  3O5O A;  1KT0 A;  4PTM A;  1LL4 A;  3AS2 A;  3WL1 A;  2XP5 A;  5HW6 A;  3OA5 A;  3ARR A;  1IX5 A;  1FKH A;  1HXV A;  2XP4 A;  4DWS A;  2WM0 A;  1HJW A;  1OWQ A;  4MTV A;  4S3K A;  1QPL A;  3EY6 A;  4R5E A;  3ARO A;  2B31 A;  4Z2L A;  3ALG A;  3KAB A;  4Z2I A;  4GIV A;  4JFL A;  2O92 A;  2RUD A;  1E15 A;  2F2D A;  1Q6H A;  3ARY A;  4W9P A;  3O5Q A;  1FKK A;  4JFJ A;  4DT4 A;  3KAG A;  1E6R A;  4DRO A;  1E6N A;  1XHG A;  2K8I A;  2ZR5 A;  3UI4 A;  3AS0 A;  4Q7N A;  1JNE A;  3ARP A;  3NTP A;  5JH8 A;  3ARQ A;  1ITX A;  4ODM A;  1H0G A;  4LAX A;  4DRQ A;  3RGC A;  5HT1 A;  3B9E A;  2YBT A;  5DIU A;  1NWT A;  4MNM A;  4DRM A;  2RUC A;  1F8A B;  3WL0 A;  1J4I A;  1TFV A;  2ZQT A;  5HW7 A;  5DIT A;  1ZK6 A;  1EHN A;  2FDM A;  3CGM A;  2FAP A;  1ZBC A;  3RFW A;  4MNJ A;  1R9H A;  3ARW A;  3AS3 A;  3AS1 A;  1J4R A;  1CTN A;  2F4E A;  4DWS B;  2LPV A;  3PRB A;  3KAH A;  4IT6 A;  5DF0 A;  4QZV B;  1E9L A;  3ARV A;  2XP7 A;  2LJ4 A;  1W9P A;  1LQ0 A;  1D7J A;  1C9H A;  1SYT A;  2KGJ A;  2MPH A;  3KAF A;  3H9R B;  1FKJ A;  1D2K A;  2XPA A;  3IK8 A;  2XP3 A;  4LGX A;  5I98 A;  4JFI A;  3O5F A;  3KAI A;  4HAR A;  1FD9 A;  3O5I A;  2KR7 A;  4QIB A;  4ODO A;  1E6Z A;  4NZC A;  4Z2G A;  1FKT A;  3RM9 A;  3UQI A;  1D7I A;  2XPB A;  3JYM A;  1FAP A;  5HBF A;  2YBU A;  1NMW A;  3WH0 A;  4DIP A;  2ZR6 A;  1E6P A;  1W1V A;  1M5Y A;  2DSU A;  4S3J A;  4IT4 A;  4U85 A;  4IQ2 A;  4TNS A;  1W26 A;  3CH9 A;  4HBE A;  3AQU A;  5HTG A;  1GUV A;  4DWS D;  3PR9 A;  2PI6 A;  4WKA A;  1FFR A;  4TW7 A;  1Q1C A;  1FKD A;  3B7X A;  2ZR4 A;  1F40 A;  2DT1 A;  2A3B A;  1LL7 A;  1NSG A;  3O5P A;  3KAD A;  3NRK A;  3O5R A;  4ML4 A;  4IPX A;  2AOS A;  1X6N A;  3IHZ A;  4MNL A;  1JNS A;  4Q22 A;  1Q6U A;  2KE0 A;  4R0X A;  4TX0 A;  3WQW A;  1J4H A;  1O6I A;  2A3C A;  5HKG A;  1ZCN A;  1KT1 A;  1NWR A;  4ZPV R;  1RD6 A;  2ESC A;  2MLY A;  4DRP A;  2Y78 A;  4TW8 A;  1HKI A;  1T11 A;  1TCO C;  1PBK A;  1BKF A;  2DT2 A;  1HKK A;  4Z2J A;  5J6E A;  4W9O A;  3TDB A;  3UI6 A;  2RQS A;  3JXV A;  1EQ3 A;  1HJX A;  1JVW A;  2RSE A;  2DSZ A;  4P8X A;  3O5J A;  1FKG A;  4O2T A;  3MDY B;  1Q6I A;  4ZPW R;  1P5Q A;  3PA7 A;  3O5G A;  1JNT A;  3UF8 A;  4GGQ A;  1LG1 A;  4URI A;  2AWG A;  1K9T A;  3O5M A;  2XP9 A;  1W1Y A;  3FAP A;  5BXJ A;  3O5E A;  2PBC A;  4P8U A;  1W1T A;  1JND A;  1FFQ A;  2LKN A;  2M2A A;  4DRK A;  1LJY A;  1SR0 A;  2VN1 A;  4WJX A;  1A7X A;  1NMV A;  3G6L A;  1FKF A;  1UR9 A;  3WKZ A;  2MF9 A;  2ITK A;  4MPK A;  3PRD A;  2ZQS A;  2M08 A;  3BXW A;  4DRJ A;  2IF4 A;  2Q5A A;  1QZ2 A;  3ARU A;  3KAC A;  1L1P A;  1NH6 A;  4JFM A;  3NI6 A;  4G50 A;  4TW6 A;  2RUQ A;  2MNT A;  1NWS A;  1FKR A;  1Y0O A;  3RME A;  4W9Q A;  3CGN A;  4JFK A;  3KZ7 A;  3CHC A;  1HJV A;  4KR0 B;  1X6L A;  4FN2 A;  4Z2H A;  4J4O A;  4L3N A;  1ROT A;  2DSW A;  2RUR A;  4DWS C;  3GPK A;  5GPR A;  1YW5 A;  4NSB A;  3B8S A;  1ZB5 A;  1U79 A;  3W4R A;  2XP6 A;  1EYM A;  2DPE A;  1UR8 A;  3ARX A;  1ZL1 A;  2UZ5 A;  4MSP A;  1WB0 A;  2PV1 A;  4DRN A;  2O9O A;  4LAW A;  4NNR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...