1F40A

Solution structure of fkbp12 complexed with gpi-1046, a neurotrophic ligand
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 BINDING PROTEIN (FKBP12)
publication title Solution structure of a neurotrophic ligand bound to FKBP12 and its effects on protein dynamics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 28
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2000-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1f40A00
4IQ2A 3TC5A 1QZ2A 2DG3A 2RUDA 3B7XA 2DG4A 5DITA 3UI4A 3O5DA 2FKEA 2OFNA 4JFIA 2PV2A 3O5RA 4QIBA 2PPOA 4W9QA 3TCZA 1JNSA 4DIPA 1YATA 2F2DA 4ODQA 2Q5AA 2MLXA 1R9HA 4TX0A 2KO7A 2PV3A 1PBKA 2KE0A 2ZQVA 3ODKA 3GPKA 3I6CA 4JFJA 1D7IA 2MPHA 4ODOA 2MLYA 3UQIA 1J4IA 1TCOC 2KI3A 2MF9A 3FAPA 3KCEA 4DRMA 4QT2A 2RURA 1FKTA 3PRDA 4TW7A 2XP3A 4R0XA 1FKHA 4JFKA 2UZ5A 4ODNA 3NTPA 4MGVA 3CGNA 4U86A 3O5MA 3CGMA 1NSGA 1ZK6A 2RUQA 3O5GA 3KABA 5DIUA 4G50A 3TDBA 1B6CA 4QT3A 5HKGA 4G2PA 2KR7A 1FKSA 2Y78A 1C9HA 1HXVA 2M08A 4W9OA 4IQCA 4O2TA 4TNSA 3O5EA 3RFWA 4DRQA 2XP7A 2XPBA 5HT1A 4DRKA 3IKGA 2RQSA 2ZR4A 3RGCA 3H9RB 2JZVA 1FAPA 3IKDA 3O5FA 3KAHA 4DRIA 1FKFA 5B8IC 4U84A 3UI6A 3VAWA 5I98A 3KAIA 4U85A 3PRBA 1YW5A 2PBCA 4DRPA 4JFLA 2PPPA 3KAFA 1J4HA 2LGOA 1EYMA 1ROUA 1A7XA 1NMVA 2AWGA 2LPVA 5BXJA 3UQAA 4FAPA 4DH0A 2DG9A 3IK8A 2LJ4A 5DIVA 1N1AA 2KFWA 3PA7A 5HWCA 3O5OA 4LAXA 2ZR5A 3UQBA 2LKNA 3LUOA 5D75A 1D6OA 1F40A 5HW8A 1J6YA 4FN2A 4GIVA 1FJDA 1W26A 3IHZA 2F4EA 2ZR6A 1J4RA 1P5QA 1ZCNA 1FKRA 3UI5A 3KACA 1Y0OA 3KAGA 1ROTA 2PV1A 2L2SA 1BKFA 1F8AB 1KT1A 2ZQTA 1QPLA 3KZ7A 4LAVA 2KGJA 4J4OA 2PPNA 1D7HA 2D9FA 3EY6A 3KADA 1Q1CA 4LAWA 4TW8A 3O5PA 4JYSA 2FAPA 2VCDA 3JXVA 4JFMA 1D7JA 3O5IA 4TW6A 1FKDA 1Q6IA 4ODLA 2ZQUA 3OOBA 1JNTA 1FKGA 1JVWA 2IF4A 2XP4A 1U79A 2VN1A 4W9PA 2RSEA 2XP9A 4DRNA 2XP6A 4C02B 3NRKA 2MNTA 1NMWA 4J4NA 1FKLA 2ZQSA 3UF8A 2XP5A 3WH0A 3O5QA 3JYMA 4DRJA 3NI6A 4NNRA 5HW7A 1FKIA 4DT4A 1FD9A 2M2AA 2RUCA 2XPAA 4ITZA 4MSPA 4TYOA 1KT0A 2XP8A 3O5JA 5GPGA 3JYJA 4ODRA 1FKKA 5HW6A 1BL4A 3O5LA 1EQ3A 2M1IA 1Q6HA 5HTGA 3O5KA 4DRHA 5HWBA 1PINA 1Q6UA 1T11A 1L1PA 4N19A 4ODKA 4DZ2A 2F21A 4ODMA 4BF8A 4IPXA 5HUAA 2ITKA 1FKJA 1QPFA 2K8IA 4DZ3A 1M5YA 4LAYA 2MLZA 1FKBA 3MDYB 4GGQA 4DROA 5J6EA 2N87A 4ODPA
chains in the Genus database with same CATH superfamily
3B7XA 2OFNA 2WLZA 4P8XA 3WL0A 3CHEA 1VF8A 3AQUA 2KO7A 1PBKA 3CZ8A 3WD1A 1ZBCA 3WKZA 2A3EA 2PI6A 2G41A 2MLYA 1J4IA 2MF9A 2B5UB 2WK2A 3NTPA 4MGVA 1NSGA 3TDBA 3KABA 4G2PA 5GPRA 1LG1A 1HXVA 2P4VA 4DRQA 1W9VA 3AS2A 1WB0A 3WD0A 4WKAA 1E6PA 2WM0A 1FAPA 4S3JA 2PPPA 1EYMA 1ROUA 1A7XA 4PTMA 5BXJA 1K9TA 1X6LA 2DG9A 3ARPA 2DT0A 1N1AA 4XAKA 2O9OA 2ZR5A 4MNLA 1F40A 3ARQA 4FN2A 1FJDA 1W26A 3AS1A 1ZL1A 3KACA 2PV1A 2L2SA 1F8AB 4DWSB 2ZQTA 1E6RA 3KZ7A 2A3AA 2KGJA 4Z2IA 2D9FA 1Q1CA 4TW8A 3O5PA 2DSUA 2FAPA 2VCDA 1SYTA 3O5IA 1XRVA 2ZQUA 3OOBA 4URIA 2XP4A 4W9PA 3B8SA 4DRNA 2XP6A 4C02B 3NRKA 2ZQSA 4WJXA 3O5QA 4NNRA 5HW7A 3RM8A 2RUCA 2XPAA 4TYOA 4WKFA 2XP8A 2WLYA 3JYJA 1W1VA 4ODRA 5HW6A 2IUZA 3O5LA 3ARWA 3BMBA 1PINA 1FFQA 1X6NA 4NZCA 4MPKA 4ODMA 4QZVB 4LAYA 2MLZA 4DROA 4P8UA 1QZ2A 1ITXA 2DG3A 2DG4A 5DITA 3UI4A 5HBFA 2FKEA 4DWSA 3O5RA 4QIBA 2PPOA 3TCZA 1LL7A 4ODQA 2MLXA 1R9HA 4NSBA 4TX0A 2PV3A 1EIBA 1W1PA 3ODKA 4DWSD 3I6CA 1TCOC 2KI3A 3FAPA 1NWTA 1IX5A 4HARA 4IT4A 2O92A 4MNKA 3PRDA 4TW7A 2XP3A 4R0XA 4Z2GA 1JNDA 4JFKA 1NWRA 3AROA 4U86A 3O5MA 3CGMA 3O5GA 1B6CA 4QT3A 2KR7A 2Y78A 1HKKA 1LJYA 2M08A 2DT2A 2ESCA 2XPBA 5HT1A 2RQSA 3RGCA 3H9RB 3IKDA 3KAHA 4DRIA 1FKFA 3UI6A 1LG2A 1OGBA 4ZS6A 4IT6A 2LPVA 1E44A 4FAPA 3PRAA 4DH0A 3IK8A 1OGGA 1EDQA 5HWCA 4LAXA 3UQBA 4Q22A 1OWQA 4GIVA 1ZCNA 2EULA 1ROTA 1CTNA 1GRJA 1KT1A 1RD6A 1W1YA 2F23A 1QPLA 3EIPA 3KADA 3EY6A 3RM4A 1D7JA 1JNTA 1ZBKA 1NMWA 1HKMA 4J4NA 3WH0A 1FKIA 1FD9A 2M2AA 4MSPA 3O5JA 2B31A 1TFVA 4MNMA 2M1IA 1W9PA 5HTGA 5JH8A 5HWBA 4ODKA 3ALFA 3ARVA 3RM9A 2ITKA 1FKJA 4DZ3A 2DSVA 1FKBA 4P8VA 3TC5A 2DSWA 1E9LA 4JFIA 2PV2A 4ML4A 4W9QA 4DIPA 2QF8A 1H0IA 2F2DA 1E6ZA 1LQ0A 3QOKA 2KE0A 3WD2A 4ZPVR 2ZQVA 2G8ZA 4Z2LA 4UDMA 4DWSC 5DO2A 1D7IA 4ODOA 2DPEA 5DF0A 4MNJA 4QT2A 2RURA 1FKTA 1KFWA 3CH9A 1H0GA 4KR0B 5DEZA 1FKHA 4ODNA 3BXWA 2AOSA 2RUQA 1ZK6A 3ALGA 1HJVA 3CHDA 4G50A 1HKIA 4WK9A 4IQCA 2ETNA 3IKGA 2ZR4A 1E6NA 3VAWA 3ARTA 4U85A 1LL4A 1YW5A 4DRPA 3KAFA 1J4HA 2LGOA 4Z2KA 3WL1A 3CHFA 3WD3A 5DIVA 3PA7A 2YBTA 3O5OA 1HKJA 3CHCA 3G6MA 1GUVA 1D6OA 3WD4A 5HW8A 1J6YA 2F4EA 2ZR6A 3ARZA 1FKRA 1Y0OA 1ZB5A 3GU0A 1GOIA 1E15A 4J4OA 1D7HA 1NWSA 1D2KA 4LAWA 3WIJA 4HBOA 1JNEA 1ZU8A 4JFMA 1FKDA 4ODLA 1FFRA 1FKGA 1JVWA 2IF4A 1U79A 4Z2JA 2RSEA 3FXYA 1NH6A 2A3CA 3B9AA 4P8WA 1FKLA 2A3BA 3UF8A 3JYMA 3AS3A 5B8IC 1W1TA 1KT0A 4LGXA 5GPGA 4ZPTR 1BL4A 4ZPWR 1Q6HA 3O5KA 1Q6UA 1T11A 1L1PA 2PN0A 4N19A 4IPXA 3W4RA 3MDYB 4GGQA 2N87A 1UR9A 4IQ2A 2DT3A 2RUDA 3PR9A 3O5DA 1JNSA 1YATA 2Q5AA 4R5EA 3GPKA 4JFJA 4MAVA 4L72B 2MPHA 3UQIA 3WQWA 3KCEA 1UR8A 4KQZA 4DRMA 2DSZA 3RMEA 1LL6A 2UZ5A 4W5UA 3CGNA 1HJXA 5DIUA 5HKGA 2OLHA 1FKSA 1C9HA 1GPFA 3G6LA 4W9OA 3ARYA 4O2TA 3O5EA 4TNSA 3RFWA 2XP7A 4HBEA 3B9DA 4DRKA 3GTYX 2YBUA 2JZVA 3WQVA 3O5FA 4U84A 5I98A 3KAIA 3PRBA 4L3NA 2PBCA 4JFLA 1NMVA 2AWGA 3UQAA 1ZBWA 4AY1A 1XHGA 2LJ4A 2KFWA 4MTVA 3ARSA 5GQBA 2LKNA 3LUOA 5D75A 1JCHB 3ARUA 3IHZA 1J4RA 1P5QA 4WIWA 3UI5A 3KAGA 4S3KA 3AS0A 3ARRA 4Z2HA 1BKFA 1EHNA 1NWUA 1SR0A 3FY1A 1HJWA 4LAVA 2PPNA 4Q7NA 1WAWA 3OA5A 4JYSA 3JXVA 4TW6A 1Q6IA 2VN1A 4WKHA 2XP9A 1WNOA 2MNTA 2XP5A 1ZBVA 4DRJA 2DT1A 3NI6A 4DT4A 4ITZA 1W9UA 1FKKA 1EQ3A 2FDMA 4DRHA 4DZ2A 2F21A 4BF8A 5HUAA 1QPFA 2K8IA 1M5YA 1O6IA 5J6EA 3ARXA 4ODPA 3B9EA
chains in the Genus database with same CATH topology
3B7XA 2OFNA 2WLZA 4P8XA 3WL0A 3CHEA 1VF8A 3AQUA 2KO7A 1PBKA 3CZ8A 3WD1A 1ZBCA 3WKZA 2A3EA 2PI6A 2G41A 2MLYA 1J4IA 2MF9A 2WK2A 3NTPA 4MGVA 1NSGA 3TDBA 3KABA 4G2PA 5GPRA 1LG1A 1HXVA 4DRQA 1W9VA 3AS2A 1WB0A 3WD0A 4WKAA 1E6PA 2WM0A 1FAPA 4S3JA 2PPPA 1EYMA 1ROUA 1A7XA 4PTMA 5BXJA 1K9TA 1X6LA 2DG9A 3ARPA 2DT0A 1N1AA 4XAKA 2O9OA 2ZR5A 4MNLA 1F40A 3ARQA 4FN2A 1FJDA 1W26A 3AS1A 1ZL1A 3KACA 2PV1A 2L2SA 1F8AB 4DWSB 2ZQTA 1E6RA 3KZ7A 2A3AA 2KGJA 4Z2IA 2D9FA 1Q1CA 4TW8A 3O5PA 2DSUA 2FAPA 2VCDA 1SYTA 3O5IA 1XRVA 2ZQUA 3OOBA 4URIA 2XP4A 4W9PA 3B8SA 4DRNA 2XP6A 4C02B 3NRKA 2ZQSA 4WJXA 3O5QA 4NNRA 5HW7A 3RM8A 2RUCA 2XPAA 4TYOA 4WKFA 2XP8A 2WLYA 3JYJA 1W1VA 4ODRA 5HW6A 2IUZA 3O5LA 3ARWA 1PINA 1FFQA 1X6NA 4NZCA 4MPKA 4ODMA 4QZVB 4LAYA 2MLZA 4DROA 4P8UA 1QZ2A 1ITXA 2DG3A 2DG4A 5DITA 3UI4A 5HBFA 2FKEA 4DWSA 3O5RA 4QIBA 2PPOA 3TCZA 1LL7A 4ODQA 2MLXA 1R9HA 4NSBA 4TX0A 2PV3A 1EIBA 1W1PA 3ODKA 4DWSD 3I6CA 1TCOC 2KI3A 3FAPA 1NWTA 1IX5A 4HARA 4IT4A 2O92A 4MNKA 3PRDA 4TW7A 2XP3A 4R0XA 4Z2GA 1JNDA 4JFKA 1NWRA 3AROA 4U86A 3O5MA 3CGMA 3O5GA 1B6CA 4QT3A 2KR7A 2Y78A 1HKKA 1LJYA 2M08A 2DT2A 2ESCA 2XPBA 5HT1A 2RQSA 3RGCA 3H9RB 3IKDA 3KAHA 4DRIA 1FKFA 3UI6A 1LG2A 1OGBA 4ZS6A 4IT6A 2LPVA 4FAPA 3PRAA 4DH0A 3IK8A 1OGGA 1EDQA 5HWCA 4LAXA 3UQBA 4Q22A 1OWQA 4GIVA 1ZCNA 1ROTA 1CTNA 1KT1A 1RD6A 1W1YA 1QPLA 3KADA 3EY6A 3RM4A 1D7JA 1JNTA 1ZBKA 1NMWA 1HKMA 4J4NA 3WH0A 1FKIA 1FD9A 2M2AA 4MSPA 3O5JA 2B31A 1TFVA 4MNMA 2M1IA 1W9PA 5HTGA 5JH8A 5HWBA 4ODKA 3ALFA 3ARVA 3RM9A 2ITKA 1FKJA 4DZ3A 2DSVA 1FKBA 4P8VA 3TC5A 2DSWA 1E9LA 4JFIA 2PV2A 4ML4A 4W9QA 4DIPA 2QF8A 1H0IA 2F2DA 1E6ZA 1LQ0A 3QOKA 2KE0A 3WD2A 4ZPVR 2ZQVA 2G8ZA 4Z2LA 4DWSC 5DO2A 1D7IA 4ODOA 2DPEA 5DF0A 4MNJA 4QT2A 2RURA 1FKTA 1KFWA 3CH9A 1H0GA 4KR0B 5DEZA 1FKHA 4ODNA 3BXWA 2AOSA 2RUQA 1ZK6A 3ALGA 1HJVA 3CHDA 4G50A 1HKIA 4WK9A 4IQCA 3IKGA 2ZR4A 1E6NA 3VAWA 3ARTA 4U85A 1LL4A 1YW5A 4DRPA 3KAFA 1J4HA 2LGOA 4Z2KA 3WL1A 3CHFA 3WD3A 5DIVA 3PA7A 2YBTA 3O5OA 1HKJA 3CHCA 3G6MA 1GUVA 1D6OA 3WD4A 5HW8A 1J6YA 2F4EA 2ZR6A 3ARZA 1FKRA 1Y0OA 1ZB5A 1GOIA 1E15A 4J4OA 1D7HA 1NWSA 1D2KA 4LAWA 3WIJA 4HBOA 1JNEA 1ZU8A 4JFMA 1FKDA 4ODLA 1FFRA 1FKGA 1JVWA 2IF4A 1U79A 4Z2JA 2RSEA 3FXYA 1NH6A 2A3CA 3B9AA 4P8WA 1FKLA 2A3BA 3UF8A 3JYMA 3AS3A 5B8IC 1W1TA 1KT0A 4LGXA 5GPGA 4ZPTR 1BL4A 4ZPWR 1Q6HA 3O5KA 1Q6UA 1T11A 1L1PA 4N19A 4IPXA 3W4RA 3MDYB 4GGQA 2N87A 1UR9A 4IQ2A 2DT3A 2RUDA 3PR9A 3O5DA 1JNSA 1YATA 2Q5AA 4R5EA 3GPKA 4JFJA 4MAVA 4L72B 2MPHA 3UQIA 3WQWA 3KCEA 1UR8A 4KQZA 4DRMA 2DSZA 3RMEA 1LL6A 2UZ5A 4W5UA 3CGNA 1HJXA 5DIUA 5HKGA 2OLHA 1FKSA 1C9HA 1GPFA 3G6LA 4W9OA 3ARYA 4O2TA 3O5EA 4TNSA 3RFWA 2XP7A 4HBEA 3B9DA 4DRKA 2YBUA 2JZVA 3WQVA 3O5FA 4U84A 5I98A 3KAIA 3PRBA 4L3NA 2PBCA 4JFLA 1NMVA 2AWGA 3UQAA 1ZBWA 4AY1A 1XHGA 2LJ4A 2KFWA 4MTVA 3ARSA 5GQBA 2LKNA 3LUOA 5D75A 3ARUA 3IHZA 1J4RA 1P5QA 4WIWA 3UI5A 3KAGA 4S3KA 3AS0A 3ARRA 4Z2HA 1BKFA 1EHNA 1NWUA 1SR0A 3FY1A 1HJWA 4LAVA 2PPNA 4Q7NA 1WAWA 3OA5A 4JYSA 3JXVA 4TW6A 1Q6IA 2VN1A 4WKHA 2XP9A 1WNOA 2MNTA 2XP5A 1ZBVA 4DRJA 2DT1A 3NI6A 4DT4A 4ITZA 1W9UA 1FKKA 1EQ3A 2FDMA 4DRHA 4DZ2A 2F21A 4BF8A 5HUAA 1QPFA 2K8IA 1M5YA 1O6IA 5J6EA 3ARXA 4ODPA 3B9EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IQ2 A;  3TC5 A;  1QZ2 A;  2DG3 A;  2RUD A;  3B7X A;  2DG4 A;  5DIT A;  3UI4 A;  3O5D A;  2FKE A;  2OFN A;  4JFI A;  2PV2 A;  3O5R A;  4QIB A;  2PPO A;  4W9Q A;  3TCZ A;  1JNS A;  4DIP A;  1YAT A;  2F2D A;  4ODQ A;  2Q5A A;  2MLX A;  1R9H A;  4TX0 A;  2KO7 A;  2PV3 A;  1PBK A;  2KE0 A;  2ZQV A;  3ODK A;  3GPK A;  3I6C A;  4JFJ A;  1D7I A;  2MPH A;  4ODO A;  2MLY A;  3UQI A;  1J4I A;  1TCO C;  2KI3 A;  2MF9 A;  3FAP A;  3KCE A;  4DRM A;  4QT2 A;  2RUR A;  1FKT A;  3PRD A;  4TW7 A;  2XP3 A;  4R0X A;  1FKH A;  4JFK A;  2UZ5 A;  4ODN A;  3NTP A;  4MGV A;  3CGN A;  4U86 A;  3O5M A;  3CGM A;  1NSG A;  1ZK6 A;  2RUQ A;  3O5G A;  3KAB A;  5DIU A;  4G50 A;  3TDB A;  1B6C A;  4QT3 A;  5HKG A;  4G2P A;  2KR7 A;  1FKS A;  2Y78 A;  1C9H A;  1HXV A;  2M08 A;  4W9O A;  4IQC A;  4O2T A;  4TNS A;  3O5E A;  3RFW A;  4DRQ A;  2XP7 A;  2XPB A;  5HT1 A;  4DRK A;  3IKG A;  2RQS A;  2ZR4 A;  3RGC A;  3H9R B;  2JZV A;  1FAP A;  3IKD A;  3O5F A;  3KAH A;  4DRI A;  1FKF A;  5B8I C;  4U84 A;  3UI6 A;  3VAW A;  5I98 A;  3KAI A;  4U85 A;  3PRB A;  1YW5 A;  2PBC A;  4DRP A;  4JFL A;  2PPP A;  3KAF A;  1J4H A;  2LGO A;  1EYM A;  1ROU A;  1A7X A;  1NMV A;  2AWG A;  2LPV A;  5BXJ A;  3UQA A;  4FAP A;  4DH0 A;  2DG9 A;  3IK8 A;  2LJ4 A;  5DIV A;  1N1A A;  2KFW A;  3PA7 A;  5HWC A;  3O5O A;  4LAX A;  2ZR5 A;  3UQB A;  2LKN A;  3LUO A;  5D75 A;  1D6O A;  1F40 A;  5HW8 A;  1J6Y A;  4FN2 A;  4GIV A;  1FJD A;  1W26 A;  3IHZ A;  2F4E A;  2ZR6 A;  1J4R A;  1P5Q A;  1ZCN A;  1FKR A;  3UI5 A;  3KAC A;  1Y0O A;  3KAG A;  1ROT A;  2PV1 A;  2L2S A;  1BKF A;  1F8A B;  1KT1 A;  2ZQT A;  1QPL A;  3KZ7 A;  4LAV A;  2KGJ A;  4J4O A;  2PPN A;  1D7H A;  2D9F A;  3EY6 A;  3KAD A;  1Q1C A;  4LAW A;  4TW8 A;  3O5P A;  4JYS A;  2FAP A;  2VCD A;  3JXV A;  4JFM A;  1D7J A;  3O5I A;  4TW6 A;  1FKD A;  1Q6I A;  4ODL A;  2ZQU A;  3OOB A;  1JNT A;  1FKG A;  1JVW A;  2IF4 A;  2XP4 A;  1U79 A;  2VN1 A;  4W9P A;  2RSE A;  2XP9 A;  4DRN A;  2XP6 A;  4C02 B;  3NRK A;  2MNT A;  1NMW A;  4J4N A;  1FKL A;  2ZQS A;  3UF8 A;  2XP5 A;  3WH0 A;  3O5Q A;  3JYM A;  4DRJ A;  3NI6 A;  4NNR A;  5HW7 A;  1FKI A;  4DT4 A;  1FD9 A;  2M2A A;  2RUC A;  2XPA A;  4ITZ A;  4MSP A;  4TYO A;  1KT0 A;  2XP8 A;  3O5J A;  5GPG A;  3JYJ A;  4ODR A;  1FKK A;  5HW6 A;  1BL4 A;  3O5L A;  1EQ3 A;  2M1I A;  1Q6H A;  5HTG A;  3O5K A;  4DRH A;  5HWB A;  1PIN A;  1Q6U A;  1T11 A;  1L1P A;  4N19 A;  4ODK A;  4DZ2 A;  2F21 A;  4ODM A;  4BF8 A;  4IPX A;  5HUA A;  2ITK A;  1FKJ A;  1QPF A;  2K8I A;  4DZ3 A;  1M5Y A;  4LAY A;  2MLZ A;  1FKB A;  3MDY B;  4GGQ A;  4DRO A;  5J6E A;  2N87 A;  4ODP A; 
#chains in the Genus database with same CATH topology
 3B7X A;  2OFN A;  2WLZ A;  4P8X A;  3WL0 A;  3CHE A;  1VF8 A;  3AQU A;  2KO7 A;  1PBK A;  3CZ8 A;  3WD1 A;  1ZBC A;  3WKZ A;  2A3E A;  2PI6 A;  2G41 A;  2MLY A;  1J4I A;  2MF9 A;  2B5U B;  2WK2 A;  3NTP A;  4MGV A;  1NSG A;  3TDB A;  3KAB A;  4G2P A;  5GPR A;  1LG1 A;  1HXV A;  2P4V A;  4DRQ A;  1W9V A;  3AS2 A;  1WB0 A;  3WD0 A;  4WKA A;  1E6P A;  2WM0 A;  1FAP A;  4S3J A;  2PPP A;  1EYM A;  1ROU A;  1A7X A;  4PTM A;  5BXJ A;  1K9T A;  1X6L A;  2DG9 A;  3ARP A;  2DT0 A;  1N1A A;  4XAK A;  2O9O A;  2ZR5 A;  4MNL A;  1F40 A;  3ARQ A;  4FN2 A;  1FJD A;  1W26 A;  3AS1 A;  1ZL1 A;  3KAC A;  2PV1 A;  2L2S A;  1F8A B;  4DWS B;  2ZQT A;  1E6R A;  3KZ7 A;  2A3A A;  2KGJ A;  4Z2I A;  2D9F A;  1Q1C A;  4TW8 A;  3O5P A;  2DSU A;  2FAP A;  2VCD A;  1SYT A;  3O5I A;  1XRV A;  2ZQU A;  3OOB A;  4URI A;  2XP4 A;  4W9P A;  3B8S A;  4DRN A;  2XP6 A;  4C02 B;  3NRK A;  2ZQS A;  4WJX A;  3O5Q A;  4NNR A;  5HW7 A;  3RM8 A;  2RUC A;  2XPA A;  4TYO A;  4WKF A;  2XP8 A;  2WLY A;  3JYJ A;  1W1V A;  4ODR A;  5HW6 A;  2IUZ A;  3O5L A;  3ARW A;  3BMB A;  1PIN A;  1FFQ A;  1X6N A;  4NZC A;  4MPK A;  4ODM A;  4QZV B;  4LAY A;  2MLZ A;  4DRO A;  4P8U A;  1QZ2 A;  1ITX A;  2DG3 A;  2DG4 A;  5DIT A;  3UI4 A;  5HBF A;  2FKE A;  4DWS A;  3O5R A;  4QIB A;  2PPO A;  3TCZ A;  1LL7 A;  4ODQ A;  2MLX A;  1R9H A;  4NSB A;  4TX0 A;  2PV3 A;  1EIB A;  1W1P A;  3ODK A;  4DWS D;  3I6C A;  1TCO C;  2KI3 A;  3FAP A;  1NWT A;  1IX5 A;  4HAR A;  4IT4 A;  2O92 A;  4MNK A;  3PRD A;  4TW7 A;  2XP3 A;  4R0X A;  4Z2G A;  1JND A;  4JFK A;  1NWR A;  3ARO A;  4U86 A;  3O5M A;  3CGM A;  3O5G A;  1B6C A;  4QT3 A;  2KR7 A;  2Y78 A;  1HKK A;  1LJY A;  2M08 A;  2DT2 A;  2ESC A;  2XPB A;  5HT1 A;  2RQS A;  3RGC A;  3H9R B;  3IKD A;  3KAH A;  4DRI A;  1FKF A;  3UI6 A;  1LG2 A;  1OGB A;  4ZS6 A;  4IT6 A;  2LPV A;  1E44 A;  4FAP A;  3PRA A;  4DH0 A;  3IK8 A;  1OGG A;  1EDQ A;  5HWC A;  4LAX A;  3UQB A;  4Q22 A;  1OWQ A;  4GIV A;  1ZCN A;  2EUL A;  1ROT A;  1CTN A;  1GRJ A;  1KT1 A;  1RD6 A;  1W1Y A;  2F23 A;  1QPL A;  3EIP A;  3KAD A;  3EY6 A;  3RM4 A;  1D7J A;  1JNT A;  1ZBK A;  1NMW A;  1HKM A;  4J4N A;  3WH0 A;  1FKI A;  1FD9 A;  2M2A A;  4MSP A;  3O5J A;  2B31 A;  1TFV A;  4MNM A;  2M1I A;  1W9P A;  5HTG A;  5JH8 A;  5HWB A;  4ODK A;  3ALF A;  3ARV A;  3RM9 A;  2ITK A;  1FKJ A;  4DZ3 A;  2DSV A;  1FKB A;  4P8V A;  3TC5 A;  2DSW A;  1E9L A;  4JFI A;  2PV2 A;  4ML4 A;  4W9Q A;  4DIP A;  2QF8 A;  1H0I A;  2F2D A;  1E6Z A;  1LQ0 A;  3QOK A;  2KE0 A;  3WD2 A;  4ZPV R;  2ZQV A;  2G8Z A;  4Z2L A;  4UDM A;  4DWS C;  5DO2 A;  1D7I A;  4ODO A;  2DPE A;  5DF0 A;  4MNJ A;  4QT2 A;  2RUR A;  1FKT A;  1KFW A;  3CH9 A;  1H0G A;  4KR0 B;  5DEZ A;  1FKH A;  4ODN A;  3BXW A;  2AOS A;  2RUQ A;  1ZK6 A;  3ALG A;  1HJV A;  3CHD A;  4G50 A;  1HKI A;  4WK9 A;  4IQC A;  2ETN A;  3IKG A;  2ZR4 A;  1E6N A;  3VAW A;  3ART A;  4U85 A;  1LL4 A;  1YW5 A;  4DRP A;  3KAF A;  1J4H A;  2LGO A;  4Z2K A;  3WL1 A;  3CHF A;  3WD3 A;  5DIV A;  3PA7 A;  2YBT A;  3O5O A;  1HKJ A;  3CHC A;  3G6M A;  1GUV A;  1D6O A;  3WD4 A;  5HW8 A;  1J6Y A;  2F4E A;  2ZR6 A;  3ARZ A;  1FKR A;  1Y0O A;  1ZB5 A;  3GU0 A;  1GOI A;  1E15 A;  4J4O A;  1D7H A;  1NWS A;  1D2K A;  4LAW A;  3WIJ A;  4HBO A;  1JNE A;  1ZU8 A;  4JFM A;  1FKD A;  4ODL A;  1FFR A;  1FKG A;  1JVW A;  2IF4 A;  1U79 A;  4Z2J A;  2RSE A;  3FXY A;  1NH6 A;  2A3C A;  3B9A A;  4P8W A;  1FKL A;  2A3B A;  3UF8 A;  3JYM A;  3AS3 A;  5B8I C;  1W1T A;  1KT0 A;  4LGX A;  5GPG A;  4ZPT R;  1BL4 A;  4ZPW R;  1Q6H A;  3O5K A;  1Q6U A;  1T11 A;  1L1P A;  2PN0 A;  4N19 A;  4IPX A;  3W4R A;  3MDY B;  4GGQ A;  2N87 A;  1UR9 A;  4IQ2 A;  2DT3 A;  2RUD A;  3PR9 A;  3O5D A;  1JNS A;  1YAT A;  2Q5A A;  4R5E A;  3GPK A;  4JFJ A;  4MAV A;  4L72 B;  2MPH A;  3UQI A;  3WQW A;  3KCE A;  1UR8 A;  4KQZ A;  4DRM A;  2DSZ A;  3RME A;  1LL6 A;  2UZ5 A;  4W5U A;  3CGN A;  1HJX A;  5DIU A;  5HKG A;  2OLH A;  1FKS A;  1C9H A;  1GPF A;  3G6L A;  4W9O A;  3ARY A;  4O2T A;  3O5E A;  4TNS A;  3RFW A;  2XP7 A;  4HBE A;  3B9D A;  4DRK A;  3GTY X;  2YBU A;  2JZV A;  3WQV A;  3O5F A;  4U84 A;  5I98 A;  3KAI A;  3PRB A;  4L3N A;  2PBC A;  4JFL A;  1NMV A;  2AWG A;  3UQA A;  1ZBW A;  4AY1 A;  1XHG A;  2LJ4 A;  2KFW A;  4MTV A;  3ARS A;  5GQB A;  2LKN A;  3LUO A;  5D75 A;  1JCH B;  3ARU A;  3IHZ A;  1J4R A;  1P5Q A;  4WIW A;  3UI5 A;  3KAG A;  4S3K A;  3AS0 A;  3ARR A;  4Z2H A;  1BKF A;  1EHN A;  1NWU A;  1SR0 A;  3FY1 A;  1HJW A;  4LAV A;  2PPN A;  4Q7N A;  1WAW A;  3OA5 A;  4JYS A;  3JXV A;  4TW6 A;  1Q6I A;  2VN1 A;  4WKH A;  2XP9 A;  1WNO A;  2MNT A;  2XP5 A;  1ZBV A;  4DRJ A;  2DT1 A;  3NI6 A;  4DT4 A;  4ITZ A;  1W9U A;  1FKK A;  1EQ3 A;  2FDM A;  4DRH A;  4DZ2 A;  2F21 A;  4BF8 A;  5HUA A;  1QPF A;  2K8I A;  1M5Y A;  1O6I A;  5J6E A;  3ARX A;  4ODP A;  3B9E A; 
#chains in the Genus database with same CATH homology
 3B7X A;  2OFN A;  2WLZ A;  4P8X A;  3WL0 A;  3CHE A;  1VF8 A;  3AQU A;  2KO7 A;  1PBK A;  3CZ8 A;  3WD1 A;  1ZBC A;  3WKZ A;  2A3E A;  2PI6 A;  2G41 A;  2MLY A;  1J4I A;  2MF9 A;  2WK2 A;  3NTP A;  4MGV A;  1NSG A;  3TDB A;  3KAB A;  4G2P A;  5GPR A;  1LG1 A;  1HXV A;  4DRQ A;  1W9V A;  3AS2 A;  1WB0 A;  3WD0 A;  4WKA A;  1E6P A;  2WM0 A;  1FAP A;  4S3J A;  2PPP A;  1EYM A;  1ROU A;  1A7X A;  4PTM A;  5BXJ A;  1K9T A;  1X6L A;  2DG9 A;  3ARP A;  2DT0 A;  1N1A A;  4XAK A;  2O9O A;  2ZR5 A;  4MNL A;  1F40 A;  3ARQ A;  4FN2 A;  1FJD A;  1W26 A;  3AS1 A;  1ZL1 A;  3KAC A;  2PV1 A;  2L2S A;  1F8A B;  4DWS B;  2ZQT A;  1E6R A;  3KZ7 A;  2A3A A;  2KGJ A;  4Z2I A;  2D9F A;  1Q1C A;  4TW8 A;  3O5P A;  2DSU A;  2FAP A;  2VCD A;  1SYT A;  3O5I A;  1XRV A;  2ZQU A;  3OOB A;  4URI A;  2XP4 A;  4W9P A;  3B8S A;  4DRN A;  2XP6 A;  4C02 B;  3NRK A;  2ZQS A;  4WJX A;  3O5Q A;  4NNR A;  5HW7 A;  3RM8 A;  2RUC A;  2XPA A;  4TYO A;  4WKF A;  2XP8 A;  2WLY A;  3JYJ A;  1W1V A;  4ODR A;  5HW6 A;  2IUZ A;  3O5L A;  3ARW A;  1PIN A;  1FFQ A;  1X6N A;  4NZC A;  4MPK A;  4ODM A;  4QZV B;  4LAY A;  2MLZ A;  4DRO A;  4P8U A;  1QZ2 A;  1ITX A;  2DG3 A;  2DG4 A;  5DIT A;  3UI4 A;  5HBF A;  2FKE A;  4DWS A;  3O5R A;  4QIB A;  2PPO A;  3TCZ A;  1LL7 A;  4ODQ A;  2MLX A;  1R9H A;  4NSB A;  4TX0 A;  2PV3 A;  1EIB A;  1W1P A;  3ODK A;  4DWS D;  3I6C A;  1TCO C;  2KI3 A;  3FAP A;  1NWT A;  1IX5 A;  4HAR A;  4IT4 A;  2O92 A;  4MNK A;  3PRD A;  4TW7 A;  2XP3 A;  4R0X A;  4Z2G A;  1JND A;  4JFK A;  1NWR A;  3ARO A;  4U86 A;  3O5M A;  3CGM A;  3O5G A;  1B6C A;  4QT3 A;  2KR7 A;  2Y78 A;  1HKK A;  1LJY A;  2M08 A;  2DT2 A;  2ESC A;  2XPB A;  5HT1 A;  2RQS A;  3RGC A;  3H9R B;  3IKD A;  3KAH A;  4DRI A;  1FKF A;  3UI6 A;  1LG2 A;  1OGB A;  4ZS6 A;  4IT6 A;  2LPV A;  4FAP A;  3PRA A;  4DH0 A;  3IK8 A;  1OGG A;  1EDQ A;  5HWC A;  4LAX A;  3UQB A;  4Q22 A;  1OWQ A;  4GIV A;  1ZCN A;  1ROT A;  1CTN A;  1KT1 A;  1RD6 A;  1W1Y A;  1QPL A;  3KAD A;  3EY6 A;  3RM4 A;  1D7J A;  1JNT A;  1ZBK A;  1NMW A;  1HKM A;  4J4N A;  3WH0 A;  1FKI A;  1FD9 A;  2M2A A;  4MSP A;  3O5J A;  2B31 A;  1TFV A;  4MNM A;  2M1I A;  1W9P A;  5HTG A;  5JH8 A;  5HWB A;  4ODK A;  3ALF A;  3ARV A;  3RM9 A;  2ITK A;  1FKJ A;  4DZ3 A;  2DSV A;  1FKB A;  4P8V A;  3TC5 A;  2DSW A;  1E9L A;  4JFI A;  2PV2 A;  4ML4 A;  4W9Q A;  4DIP A;  2QF8 A;  1H0I A;  2F2D A;  1E6Z A;  1LQ0 A;  3QOK A;  2KE0 A;  3WD2 A;  4ZPV R;  2ZQV A;  2G8Z A;  4Z2L A;  4DWS C;  5DO2 A;  1D7I A;  4ODO A;  2DPE A;  5DF0 A;  4MNJ A;  4QT2 A;  2RUR A;  1FKT A;  1KFW A;  3CH9 A;  1H0G A;  4KR0 B;  5DEZ A;  1FKH A;  4ODN A;  3BXW A;  2AOS A;  2RUQ A;  1ZK6 A;  3ALG A;  1HJV A;  3CHD A;  4G50 A;  1HKI A;  4WK9 A;  4IQC A;  3IKG A;  2ZR4 A;  1E6N A;  3VAW A;  3ART A;  4U85 A;  1LL4 A;  1YW5 A;  4DRP A;  3KAF A;  1J4H A;  2LGO A;  4Z2K A;  3WL1 A;  3CHF A;  3WD3 A;  5DIV A;  3PA7 A;  2YBT A;  3O5O A;  1HKJ A;  3CHC A;  3G6M A;  1GUV A;  1D6O A;  3WD4 A;  5HW8 A;  1J6Y A;  2F4E A;  2ZR6 A;  3ARZ A;  1FKR A;  1Y0O A;  1ZB5 A;  1GOI A;  1E15 A;  4J4O A;  1D7H A;  1NWS A;  1D2K A;  4LAW A;  3WIJ A;  4HBO A;  1JNE A;  1ZU8 A;  4JFM A;  1FKD A;  4ODL A;  1FFR A;  1FKG A;  1JVW A;  2IF4 A;  1U79 A;  4Z2J A;  2RSE A;  3FXY A;  1NH6 A;  2A3C A;  3B9A A;  4P8W A;  1FKL A;  2A3B A;  3UF8 A;  3JYM A;  3AS3 A;  5B8I C;  1W1T A;  1KT0 A;  4LGX A;  5GPG A;  4ZPT R;  1BL4 A;  4ZPW R;  1Q6H A;  3O5K A;  1Q6U A;  1T11 A;  1L1P A;  4N19 A;  4IPX A;  3W4R A;  3MDY B;  4GGQ A;  2N87 A;  1UR9 A;  4IQ2 A;  2DT3 A;  2RUD A;  3PR9 A;  3O5D A;  1JNS A;  1YAT A;  2Q5A A;  4R5E A;  3GPK A;  4JFJ A;  4MAV A;  4L72 B;  2MPH A;  3UQI A;  3WQW A;  3KCE A;  1UR8 A;  4KQZ A;  4DRM A;  2DSZ A;  3RME A;  1LL6 A;  2UZ5 A;  4W5U A;  3CGN A;  1HJX A;  5DIU A;  5HKG A;  2OLH A;  1FKS A;  1C9H A;  1GPF A;  3G6L A;  4W9O A;  3ARY A;  4O2T A;  3O5E A;  4TNS A;  3RFW A;  2XP7 A;  4HBE A;  3B9D A;  4DRK A;  2YBU A;  2JZV A;  3WQV A;  3O5F A;  4U84 A;  5I98 A;  3KAI A;  3PRB A;  4L3N A;  2PBC A;  4JFL A;  1NMV A;  2AWG A;  3UQA A;  1ZBW A;  4AY1 A;  1XHG A;  2LJ4 A;  2KFW A;  4MTV A;  3ARS A;  5GQB A;  2LKN A;  3LUO A;  5D75 A;  3ARU A;  3IHZ A;  1J4R A;  1P5Q A;  4WIW A;  3UI5 A;  3KAG A;  4S3K A;  3AS0 A;  3ARR A;  4Z2H A;  1BKF A;  1EHN A;  1NWU A;  1SR0 A;  3FY1 A;  1HJW A;  4LAV A;  2PPN A;  4Q7N A;  1WAW A;  3OA5 A;  4JYS A;  3JXV A;  4TW6 A;  1Q6I A;  2VN1 A;  4WKH A;  2XP9 A;  1WNO A;  2MNT A;  2XP5 A;  1ZBV A;  4DRJ A;  2DT1 A;  3NI6 A;  4DT4 A;  4ITZ A;  1W9U A;  1FKK A;  1EQ3 A;  2FDM A;  4DRH A;  4DZ2 A;  2F21 A;  4BF8 A;  5HUA A;  1QPF A;  2K8I A;  1M5Y A;  1O6I A;  5J6E A;  3ARX A;  4ODP A;  3B9E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...