1ZB5A

Recognition of peptide ligands by signalling protein from porcine mammary gland (spp-40): crystal structure of the complex of spp-40 with a peptide trp-pro-trp at 2.45a resolution
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
361
structure length
361
Chain Sequence
b'YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNFGPQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGQEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGKSFTLASSKTDVGAPVSGPGIPGQFTKEKGILAYYEICDFLQGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLARA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords signal processing protein
publication title Recognition of peptide ligands by signalling protein from porcine mammary gland (SPP-40): Crystal structure of the complex of SPP-40 with a peptide Trp-Pro-Trp at 2.45A resolution
rcsb
source organism Sus scrofa
molecule tags Signaling protein
total genus 122
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2005-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1zb5A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1zb5A01
1JZ3A 5DO8A 3RIKA 4GINA 4PYSA 3VX1A 1B30A 1V03A 3VPLA 2V3GA 1N82A 2X0YA 2CBJA 1VJZA 2Y24A 1C3FA 3L2MA 1KWKA 3W27A 3RM9A 1DWHM 3WELA 3ZSTA 2CKRA 3WDPP 4TOQA 2DSKA 5ECUA 3NJ3A 4X0NA 3IANA 2ZWZA 3S6TA 3ZMRA 4P8XA 1JZ5A 2ZX9A 4UR9A 2DIEA 1KBKA 2E9MA 3EMQA 1XHGA 3WUBA 1KGXA 1W3LA 3K8MA 1J9YA 1B3VA 3VOCA 3VD4A 2YBTA 1C93A 3ZSSA 5E70A 5DT5A 2ZXQA 3UR7A 3U5YA 1C91A 2XIIA 4FLOA 4W93A 3U57A 4LXFA 4ACZA 2E0PA 5CSUA 3ARPA 1BQCA 3CTTA 3TTQA 1W32A 1M7XA 4MAVA 2Y5EA 1QW8A 3FY1A 4PCTA 1E9LA 2EEXA 2XGBA 1G0CA 5A6SA 2VCCA 1BYCA 4PN2A 3CZ8A 3VGBA 3OB8A 1QBBA 1J11A 5ABHA 5EMYA 5A2BA 1CPUA 2VR4A 4IPLA 1XYZA 2WWDA 1E1FA 3D5HA 2VZUA 2BY3A 5LYRA 3CZJA 1BG4A 2W63A 4D6FA 3VGFA 3WMBA 3WL1A 4W85A 2WW5A 5I24A 1UYQA 1LWHA 4KRTA 1ITCA 1ZJBA 3VD7A 1CXFA 2J74A 5ABFB 2D0HA 3KZSA 5HXMA 3L4VA 1K9DA 3AHVA 3IJ8A 3MU7A 2OYKA 2J78A 4WKAA 4W89A 4JCLA 2VURA 3SCUA 1KGWA 1LWJA 2VRQA 2XSAA 4PMRA 3N9KA 2EJ1A 3SCTA 4HZ7A 5E6ZA 4JCMA 3WMSA 5D4YA 3KWXA 2ZUSA 1A47A 2QMKA 4CN6A 4UQCA 3PTMA 2CKSA 2DT0A 4Y7EA 1QPKA 4D71A 4M56A 1ISVA 4V28A 2WC3A 2G3IA 3OZOA 1V02E 3LMYA 5IHRA 4OUEA 4PMYA 1UD2A 1I1XA 1Q6FA 3WIJA 1E4MM 4MNJA 1GOKA 2GJRA 1RP9A 4M29A 2BVYA 3AXHA 2VZVA 3CUJA 1QBAA 1HN1A 4IM4A 1HT6A 4C7FA 2ZX6A 4C7GA 2ZUNA 2G3JA 2WHLA 5I0DA 5A8MA 5JIPA 2XFYA 4W86A 3PN8A 3DHUA 3TTYA 3QR3A 1JNEA 4ML4A 3IK2A 4PBGA 1UG6A 4UCFA 3AIVA 5C71A 2YLAA 3VM7A 2WCAA 4HOZA 2XIBA 3GDBA 1GOWA 2UY2A 4IUGA 3WENA 2WBGA 2QV4A 4ACYA 3TOPA 1MVYA 1CZ1A 1B3YA 3AICA 4CD6A 4GQQA 2Y8VA 5I78A 3MV11 4GO8A 2CETA 4JFTA 5AYBA 3W82A 4MNLA 3MMUA 3WNNA 4J3XA 1Q4NX 3VIOA 3ZR5A 1JZ4A 1UR8A 3M46A 5CZKA 4TVCA 1V3KA 1EXPA 1UD4A 2FGZA 3FHQA 1PZ2A 2ZXDA 1GJUA 4UFKA 1NWRA 1XD0A 1CLVA 4JL1A 1B31A 2ZWYA 4AXNA 1GCYA 4J3TA 2CHOA 1A3HA 1ZBWA 4DWSD 2BHYA 3GNOA 3LPGA 4MAZA 2VTFA 3F4VA 1G5AA 2VX6A 1HXJA 1EQCA 4CD4A 1JF6A 4BQ5A 5A2AA 1FFRA 1MFVA 1B9ZA 2RGLA 3W24A 4S3KA 3OGRA 1MQPA 2D24A 1WP6A 4MJ4A 3VD5A 3CZEA 2FHFA 5E6YA 3WNMA 4AEEA 1UH3A 1MW1A 3FHAA 4FF5A 4W8BA 4YHGA 4A3HA 1V3IA 2WMIA 4EAMA 3HU7A 1CGXA 1JXKA 1PEZA 3WDJA 1E40A 2OWCA 5A3HA 1JZ2A 3CBWA 1Q6EA 5CPTA 2NT1A 1CLXA 4F79A 1UZ4A 2G3NA 3B9AA 1JFXA 1W9VA 2WSKA 1V3JA 3VD9A 1UR0A 4F66A 3PZMA 4PUEA 4TVUA 1CENA 4WSJA 2ZX7A 3VIGA 2E9LA 1W1VA 2UY5A 4JHZA 4MJ2A 4S3JA 5GNXA 4BQ2A 5ABFA 4BQ4A 3BAYA 3AHYA 5E09A 1TFVA 1IZJA 4CU8A 5JUVA 3OLIA 1BGGA 4OOUA 2J4GA 2CCRA 1XYFA 2WKLA 1EHNA 3GBDA 4GZJA 5AC4A 3B9DA 1V3HA 2E4TA 1QOXA 2BHZA 4PMQA 1EO7A 3UR8A 4HTYA 1UKPA 1BGAA 2PWDA 1EHAA 1B0IA 1FP8A 1E5JA 1HJQA 1SFSA 2W91A 3PTQA 3A4AA 7A3HA 1XC6A 1VFFA 3EDEA 1GHRA 4GPNA 5LA2A 3W37A 1W9PA 4JKKA 5A6JA 2XFRA 1C8XA 4KH2A 2ZX8A 2OWXA 2D3LA 5KZ6A 1NARA 4UOZA 1J0IA 1XSJA 3W26A 2JEPA 1WDQA 1QW9A 1DP0A 2WANA 2XTKA 5A69A 4KGJA 4D72A 3TP4A 4AD2A 3MUZ1 1ZB5A 3ARYA 3WD3A 5A94A 3AS0A 1EO5A 2VT0A 1W2PA 1KCLA 1M01A 2WYSA 3ARVA 4TXEA 4HMEA 1J0YA 4PMNA 3TTOA 1KR1A 1JZ7A 1BTCA 3KL5A 1MW3A 1R7AA 1X6LA 4MB4A 5JIWA 2WLZA 1GQLA 1NWUA 1F4HA 5FD0A 4H2CA 1BHGA 2WLYA 3VIHA 1H5VA 2D1ZA 4W5ZA 4HOWA 4AZGA 3PZ9A 1OIMA 2VX5A 4AD5A 4H8VA 3WH8A 5I3DA 2J79A 4HOXA 5IFTA 1E6PA 2ZIDA 4CCEA 2WVVB 2OYMA 4YN5A 1QI2A 4BCEA 1J0HA 1H2JA 4ZE4A 1QI0A 1CECA 4U31A 4H8HA 1DWAM 2V38A 5CPQA 3I3EA 1GJWA 4WLCA 2E9BA 1K9EA 5CJ5A 3ARUA 1JD7A 1TE1A 1HL8A 1JYWA 2W67A 3U7BA 4PCSA 1TG7A 4QFUA 3A3HA 4PTVA 2Y4SA 1UQZA 2PBOA 2Z1KA 1HJUA 3VIKA 3W28A 1JGIA 4P7NA 1B3ZA 5A6LA 1UWSA 3MMDA 8CGTA 1U2YA 1J0ZA 2ZICA 2E8ZA 3T2QA 1UWUA 1JXJA 4EK7A 1CIUA 4BQ3A 3BAKA 2CITA 4HA1A 4J3VA 4CKQA 2VQUA 1E5NA 1VRXA 1G01A 2A3HA 4UQEA 1WAWA 2J75A 1H4PA 2X2YA 2VQTA 1US3A 1TCMA 1GVYA 2JIEA 3WQ6A 4CVWA 1E3ZA 5E9AA 1JD9A 3WN6A 1HF6A 5EBAA 1UKTA 2WXDM 3CHCA 5HNNA 5BXTA 1ISXA 3PZOA 3APGA 1R7OA 4JFVA 1MFUA 4JFSA 2YBUA 2D2OA 3CZGA 1CXLA 1H09A 2WZEA 1LG1A 2J8FA 1OGSA 1B3WA 1UA7A 3L4UA 1MW0A 3KL3A 4X0VA 4DUVA 2A3BA 3VX0A 1E4IA 4WSKA 1E4NA 2XVGA 4W7VA 5A95A 4BZYA 2NSXA 1X1NA 1EGZA 2NW0A 1G94A 3GH5A 3GNPA 1HNYA 1KBBA 2PF0A 2PWHA 3WY1A 5FL0A 3W0KA 2DT1A 2VOTA 4WKHA 3L4ZA 2YIHA 1CXIA 5AC5A 1LL6A 1CGVA 2EO7A 2XSBA 4TTGA 1E6RA 1D7FA 3AYRA 2VZTA 2XVLA 4Z2GA 2UY3A 2ZXBA 3KE0A 4Q7NA 5I2UA 4LGXA 3HN3A 3WH9A 1E70M 1LG2A 1UH2A 1EOMA 2VRJA 1JI2A 2GSJA 3WD0A 2DIJA 3CO4A 1GOOA 4AD1A 3K4DA 2J25A 2A3CA 3BAJA 1FA2A 2UWFA 2JE8A 4P8WA 3L4XA 1WZLA 2W66A 1GVIA 1JFHA 1V6WA 5A6KA 1H49A 4U5IA 3O2LA 3WD1A 3WL0A 2FHCA 3ARQA 2BY1A 3ZJ8A 1OCQA 2JF7A 3AYSA 1E4LA 3N18A 2QMJA 5M17A 3MUAA 5M3WA 3VDBA 1HKKA 4HA3A 4ZXLA 5I23A 3I3BA 1E0XA 1UKOA 1GQKA 1YHTA 4H41A 1UR1A 3N13A 3OGVA 1W3JA 3O9NA 1ITXA 1DWJM 4AZBA 4JKLA 3GM8A 2BXZA 4HMCA 4H8UA 4B9ZA 4ATDA 1E56A 4H7VA 2WVVA 2J7EA 2TAAA 2CNCA 4LX4A 4B16A 3EDKA 2GDVA 2VL4A 1QHZA 2YA2A 2QPSA 2J77A 1J10A 1UR9A 1TR1A 5LA0A 1WB0A 5EFFA 3MSDA 5M03A 1GQJA 3EDJA 1BAGA 4LPCA 2QLYA 1HIZA 2WMIB 2Z1SA 4R5EA 3F5KA 2O9OA 2ZUUA 3GBEA 1NQ6A 2YL6A 4N0RA 4AIEA 3UESA 4DM2A 1M53A 4W8AA 2YA1A 3L4WA 3QHOA 3WBAA 1JZ6A 1WE5A 5D8WA 2FH8A 5DMYA 1HJXA 3DECA 3PZTA 3VIFA 4AISA 4W87A 2XPKA 4P8VA 4FLQA 5A8NA 1D2KA 1XCWA 1PX8A 4GZEA 1G1YA 1HKJA 4B9YA 1JL8A 3W29A 2EPOA 1R8LA 1E6XM 1BYAA 5JBDA 4KGLA 4J28A 2WSPA 3GNRA 3K46A 2DT3A 4CGTA 4PSRA 1AMYA 5A6BA 4D6DA 1JDAA 1CXHA 3BGAA 1WDPA 5HDRA 1XCXA 1EQPA 3IJ9A 2OSWA 1V6VA 3WFLA 1WDRA 3UERA 3T2OA 2D0GA 5JH8A 1ISYA 1VIWA 2DH3A 4E2OA 3QHNA 3GH4A 5AYIA 4AYSA 1JG9A 3AIRA 2J8GA 2AMGA 4MNMA 5CG0A 1J01A 1E73M 1OSEA 1Q6CA 4KRUA 1V3LA 5HBFA 2FGLA 3WMCA 1UHVA 3ZJ7A 4W88A 4QCFA 2B31A 2JFEX 1EDGA 3T0BA 4DWSC 1VF8A 4F9JA 3VIMA 2EPLX 5BWFA 4AWEA 1KWGA 5D9PA 4W84A 3A47A 1V0NA 2W62A 4CD5A 1U33A 2WHKA 3DYOA 4UFIA 2J7CA 2VR5A 4PMDA 3K4AA 4PMVA 4TUFA 4YHEA 4KWUA 1Z32X 2IXVA 3U5UA 3RCNA 1K9FA 3M6DA 3DHPA 4UQDA 2W92A 1XH2A 3WF0A 4Z2HA 3WF3A 2YL9A 1NWTA 3DC0A 1W1PA 3QOKA 1TA3B 1V3MA 4W7WA 2OYLA 1V08A 3E1F1 3HMCA 2WCSA 4MB1A 3VGHA 5BXSA 2O9RA 2OSXA 1BF2A 1KR0A 3VINA 4B3LA 3CIVA 1CGYA 7TAAA 2NT0A 3ALGA 1EDTA 1GQIA 3AIBA 2PWFA 4P7RA 4QDMA 3VM5A 3WDIA 1CNVA 1W91A 3L4YA 4AZ7A 3AS2A 1GOIA 3ZR6A 1LQ0A 2OWWA 1K9TA 3EDDA 2EBNA 1HP4A 3RM8A 4E8DA 1RPKA 4OOZA 1ZJAA 4QLLA 4XZWA 3W6LA 1LL7A 1G9HA 1UKSA 2V3FA 3CUFA 4MDPA 5ABGA 2W4XA 4PSPA 3MUY1 4PMXA 3ZT7A 4IPNB 1NOUA 2G4FA 2WCGA 4JZ5A 1BLIA 3A6OA 3NUKA 2O9PA 4H04A 3MANA 3BMWA 2DQXA 4L4PA 4OKDA 3PZUA 3MO4A 3NSXA 2YL8A 3HJEA 3AMDA 2VX4A 1J12A 4W8LA 3VDCA 3A4WA 4M8UA 3WD4A 1PX3A 2CIPA 4D6IA 4URIA 2QPUA 2ZUWA 3K1DA 1DWIM 3EDFA 1AVAA 1S46A 2BVTA 4PUDA 3CHEA 1HVQA 4Z2JA 4GQRA 4E8CA 1GPFA 3AHZA 3PZIA 2ZUMA 2DPEA 4AW7A 1X6NA 3POHA 2VO5A 3WF4A 3WUFA 1C92A 2FHBA 3GXDA 5HOSA 4AD4A 5A6BD 2WMFA 1NH6A 3B8SA 4DUWA 2BVDA 4CUCA 2DSUA 4R27A 4JKMA 3RPMA 4QP0A 5E0FA 1DEDA 1V0LA 8A3HA 3AJ7A 3NYDA 1GUVA 1KFWA 3FAWA 1B2YA 3VMOA 4FLSA 1PIGA 2CYGA 3WUGA 4XX6A 3WSUA 1OGBA 2YLLA 2CBUA 1QNQA 1B1YA 3SCNA 2DT2A 2ESCA 1NM9A 3UG4A 1MWOA 2X8RA 1WNOA 1BYDA 1BPLB 2WHMA 3NDYA 2RGMA 3AXXA 5D8ZA 1CGTA 4TTUA 4NSBA 5D9NA 3CLWA 1OM0A 2XM1A 3BCFA 3MMWA 2VNCA 3SEPA 1V6YA 1PIFA 1JYVA 2BY0A 1MXDA 1I75A 1E55A 3QHMA 1VAHA 1FOBA 2VVSA 4EANA 3AIEA 1TUXA 2WK2A 5CGTA 5A1AA 2W61A 5BXRA 4TVDA 3RJXA 1IT0A 3W6MA 3K8LA 4M24A 2Y2WA 1GHSA 1VEPA 3OLEA 1JAEA 3UCQA 5BYWA 2DSZA 1NOFA 1DHKA 5KEZA 1UWIA 4OIFA 1Y7VA 4UQ9A 3W4RA 4HA4A 3QGVA 1OB0A 1OINA 3PZNA 2AOSA 2VJXA 4IISA 3AMLA 5A8QA 2WB5A 4UNIA 1VFUA 2C0HA 1M03A 4Z2KA 3VO0A 2QF8A 4HMDA 3J7HA 4M1RA 3WKZA 1ISZA 4TX6A 3THDA 3FN9A 1TA3A 3SUWA 3SCWA 3VMPA 5DF0A 1R87A 3ARXA 1UD6A 4UZSA 3ZOAA 4LYPA 1GZJA 4AZIA 4PMUA 1NOWA 2EPNA 2FDMA 4UOJA 1UA3A 3ZIZA 3BAIA 2WM0A 1E15A 3VTRA 3LPOA 1CXEA 2HVMA 1JDCA 2YJQA 1PX4A 5FKYA 3NIYA 2WWCA 4EE9A 4CU7A 4NI3A 1L0PA 3MSGA 4MPKA 3IAPA 3SUUA 4K68A 1EDQA 1ZL1A 1RH9A 5GNZA 3AFBA 4P7QA 3WNKA 5A8PA 2GK1B 5FIPA 1HVXA 2BHUA 3BAWA 4WF7A 1SMDA 4AD0A 1KQYA 2PWEA 5CGMA 1WZKA 5BROA 1CDGA 3DYMA 1TMQA 1VEMA 5DEZA 4XB3A 1TZ7A 2XWEA 2XFFA 3CUIA 4GO9A 4D6EA 2WNWA 3NSMA 2VCAA 2X09A 1P6WA 1H0IA 1L8NA 1W3KA 6A3HA 2WHJA 1KXVA 4GZIA 4U3AA 3NSNA 3BSGA 4QAWA 1VEOA 5FL1A 3VNZA 5M5DA 1UUQA 4GI6A 4J3WA 4CD8A 4D1JA 3T08A 2GFTA 3UEQA 3AZRA 4LYQA 1FHDA 2XUCA 4HZ8A 1QNSA 3CUGA 1UD8A 4HPGA 1E72M 1F4AA 3UG5A 5EB8A 3RILA 1DWFM 3TONA 1E0VA 4D6JA 3CZLA 4B3KA 4GI8A 1KXHA 3AHTA 1JIBA 1VBUA 2WAGA 3WDRA 2O92A 1JAKA 5E0CA 1AQHA 2VRKA 3VNYA 3MUIA 3L2LA 3BXWA 3RMEA 3SCRA 3LPPA 3WH6A 2ZXAA 3OLGA 4Z2IA 3GZAA 1GONA 4CCCA 1E1EA 3AMCA 1OD0A 3OA5A 1PPIA 6TAAA 3AISA 1VFMA 4NF7A 4ZE5A 3W25A 5CXPA 1LLOA 4WJXA 1U30A 2IXUA 4OBSA 3WBEA 2E40A 1BVZA 4RE4A 3KL0A 2VMFA 1W1TA 3UG3A 2VZOA 1B3XA 4V2XA 2ZUVA 4E4PA 1JYXA 1SMAA 1PZ3A 4CN4A 4AMCA 1E3XA 2DGAA 5GPRA 5FOOA 2W5FA 1QHOA 5LA1A 3OG2A 1JYNA 3WEOA 4NRRA 5HPOA 3IAQA 3AZSA 1E6NA 1UD5A 2E3ZA 4CVUA 1HJWA 2VI0A 1PAMA 2J7FA 2ZOXA 4ZENA 1XSKA 3M07A 3DYPA 3K8KA 1HL9A 3L4TA 4UFMA 4PTWA 1UWTA 3FW6A 1QI5A 4A4AA 1VBRA 4Z2LA 1ZU8A 1GW1A 5A2CA 4DWSA 1HJVA 3ZM8A 3EMCA 2XHYA 3OIHA 1V6XA 3NCOA 4JHOA 4HU0A 1VENA 1OBAA 1EA9C 3W53A 4FLRA 2YDRA 4GXPA 3ZJ6A 3BC9A 5I5RA 4V27A 4AZCB 3WNPA 3SCSA 2CBIA 1UWQA 2EXOA 1MXGA 5JBFA 1OGGA 4MTVA 1VFOA 4J27A 2ZUTA 5GQBA 3AIWA 2GK1A 2YOCA 1E6ZA 3RO8A 3VGDA 3T0DA 1BVNP 4WIWA 5A6AA 4M80A 1EH9A 2GJXA 1UR2A 1HKIA 3AIQA 1OIFA 2V3DA 1SR0A 3NDZA 4PTMA 1VB9A 4HU8A 2PI6A 2Y8KA 3KEHA 1V0MA 3THCA 2XVPA 1UQYA 1CGWA 3VDAA 3AI0A 3SCPA 3ARRA 3FAXA 2V5DA 5JBEA 3MS8A 2GDUA 4AIUA 2C7FA 3AS3A 3TTSA 2WC4A 4CD7A 2WZIA 4J7RA 3WEMA 1ISWA 7CGTA 3ZQ9A 1W3HA 1BYBA 1XD1A 1J0KA 1WZMA 1VJSA 4WK9A 5I77A 3WQ8A 5F7UA 1FFQA 1R85A 4J3SA 1GOQA 1J18A 2IUZA 1FP9A 3VVGA 4RE3A 1W2VA 4PEEA 1LJYA 5EFDA 5A6MA 2WMGA 3WQ5A 3AS1A 3ARTA 2F2HA 3ECQA 2J7BA 4MNKA 4QCEA 2X1IA 3I3DA 4DUXA 2OLHA 4AZ5A 1QHPA 5HPCA 2ZX5A 1UWRA 3VILA 3AQUA 3WQVA 3ALFA 3GXMA 3SURA 3S2CA 4GIAA 2DSWA 4F9DA 4A3YA 4MB3A 4P7OA 4PRWA 1TVPA 2CBVA 3GH7A 1CWYA 5DT7A 5CPSA 1E6QM 3BH4A 3CZKA 4Q22A 3AXIA 4UFJA 1OT1A 2O9TA 1ZBKA 2PC8A 2J7GA 2EPMX 3CPUA 3SIMA 3RM4A 3AMGA 5A8OA 1QNOA 2X0HA 1OD8A 4P8UA 5TD4A 5IDIA 5BRPA 1JZ8A 1MYRA 4HZ6A 2VX7A 2XYLA 2WVSA 1PJ9A 4UQBA 1H11A 2AAAA 3UETA 2Q8XA 3RDKA 1CXKA 3SUVA 3FXYA 1AQMA 2JIWA 3VDHA 2DH2A 1MW2A 1Q6DA 4OJYA 3BCDA 4GI9A 1KB3A 3GXIA 1C8YA 5CSYA 3W81A 1C8QA 3PHAA 3CGTA 4HP5A 1KXTA 1YQ2A 6CGTA 3GYCA 5FCZA 3W38A 3O6AA 4MADA 4AEFA 5C70A 1FHLA 2GJPA 4UOQA 4AZHA 4CU6A 2CERA 2VUYA 3SCOA 1FH9A 4UFLA 2BNJA 5IFPA 1MQRA 1NP0A 3PZGA 3VIIA 2WMJA 1UR4A 4D6CA 2D3NA 1GORA 4J3UA 4QLKA 5CLWA 3T0AA 3EMZA 4XZBA 3VIJA 3WNLA 3PZVA 4AZCA 2XVNA 3SCQA 3BMVA 4TX8A 4BA0A 2JALA 4BF7A 1ZBVA 4CCDA 2BV9A 5BRQA 3N17A 1HP5A 3AZTA 2WVUA 4UFHA 1WCGA 2DDXA 3TA9A 1FH8A 2XWDA 1GNXA 3FNDA 4F8XA 1TVNA 2DEPA 4BS0A 1WZAA 3T09A 5BCAA 2VC9A 1C7SA 3BSHA 4D1IA 2BXYA 3SUTA 1KXQA 4CN1A 3CMJA 3SCVA 5CLTA 1E0WA 1QNPA 5BXPA 2YL5A 3WQ4A 1NP2A 5D9MA 1C90A 3N11A 1O7AA 2HISA 3RJYA 2PB1A 1WDSA 3EYPA 1ZS2A 2GUYA 3BLKA 1LF1A 1CTNA 3POCA 2GVYA 3OLDA 4RL3A 2ZE0A 4GKLA 4LYRA 3OBAA 3VUPA 4U33A 3WD2A 2WBKA 2WC7A 1E43A 2PBGA 1CYGA 3WDHA 1M04A 2XVKA 3ZO9A 2MANA 1UOKA 4MDOA 2D22A 1XV8A 1UKQA 4FMVA 3M7SA 3AMKA 4ZXOA 1V02A 1B90A 4W7UA 1CGUA 3VU2A 3WEZA 4C7DA 2F8QA 4M82A 2E8YA 3AIUA 5IHSA 1ECEA 4L4OA 3VGEA 1RD6A 3OGSA 3BAXA 4DM1A 1OWQA 4XV0A 1V0KA 5DFAA 4JIEA 3N1AA 4QLJA 4YPJA 1ESWA 3WQWA 2EQDA 4M81A 2VVNA 4OZOA 5I79A 4PMOA 2G8ZA 2JEQA 4D6HA 2YA0A 1PBGA 3SUSA 1I1WA 1JI1A 5ABEA 5GNYA 2YDQA 4NZCA 2XGIA 2QHAA 2D23A 1DTUA 3QOMA 1WO2A 1DWGM 1US2A 4FK9A 4ATWA 4OBRA 4AC1X 1KCKA 2A3AA 2DSVA 4AZ6A 3D3AA 5D9OA 5C8BB 2EPKX 3B9EA 3WNOA 3VMNA 4ATLA 4UQAA 1MQQA 4PMZA 2J62A 5I6SA 1IV8A 1D3CA 3ZT6A 4MB5A 1QI3A 2V5CA 3A4XA 4X9YA 4U5KA 4UTFA 1E6SM 1EIBA 3PBGA 9CGTA 4ZFMA 3ZT5A 4U2ZA 4ZEPA 3CMGA 3AHXA 1H3GA 4DWSB 3CUHA 1BFNA 1WPCA 4LQ1A 3VGGA 4JAWA 3F5JA 4KMQA 1QVBA 2F61A 1Q6GA 1XRVA 2VCBA 3II1A 3ARWA 3N12A 4ACZB 2BS9A 3MKKA 2WMKA 1XSIA 5CQ1A 2G41A 1K6AA 4D6GA 1J0JA 2YDSA 1EOKA 3CH9A 4XUYA 2V3EA 1W1YA 3VKKA 2CXGA 3ARZA 1O6IA 4EKJA 3VIPA 1C7TA 3GXFA 1HKMA 2GJXB 3ZJKA 1R86A 2UY4A 3G6LA 1HJSA 3U7VA 2FH6A 2A3EA 2J7DA 4AD3A 1XH0A 1RP8A 1KQZA 1UH4A 3CHFA 2WZHA 1W9BM 2BY2A 1W9DM 2OSYA 3G6MA 3PTKA 1H41A 1SYTA 1LL4A 2XJ7A 2J7HA 2PWGA 1E71M 1CEOA 3IJ7A 2JF6A 4JFWA 4W5UA 1GOMA 4U2YA 3VD3A 3AROA 1QI4A 4B15A 2WVTA 2D20A 3EBVA 4U3CA 1ZBCA 2BFGA 3WF2A 4WKFA 1KGUA 3WUEA 3MV01 1IZKA 1HX0A 1W9UA 1JF5A 1BG9A 3N04A 1XH1A 3PZQA 2J47A 4RE2A 2YKKA 3GTNA 1NWSA 2XG9A 4P7LA 3F5LA 3WF1A 2G3MA 4HPHA 4JFUA 1H0GA 2CHNA 1W9XA 1XGZA 2CEQA 4JL2A 5AY7A 1CBGA 1ODZA 2WPGA 2C8NA 3ARSA 1FH7A 1UZ1A 2X05A 4NRSA 3LPFA 1JDDA 1UD3A 2XM2A 1V6UA 3BLPX 2CPUA 3N15A 4PTXA 3WDQA 1JNDA 2WKGA 1H1NA 4AY1A 1ODUA 1AQ0A 2D0FA 2VZSA 2CESA 1BSIA 3OZPA 1OT2A 4N42A 3WH7A 3WH5A 4UZUA 3CHDA 1WKYA 3T2PA 1QNRA 3JUGA 4AIOA 3AOFA 2WMHA 3WFZA 5IXEA
chains in the Genus database with same CATH superfamily
1JZ3A 4HNLA 1XIJA 3TJXA 2PDBA 2PGEA 1TTPA 4M3PA 1N82A 4GVIA 4N7QA 5EBUA 2V5KA 1POJA 1C3FA 3L2MA 1T41A 3RM9A 4LEQA 4YWSA 1QWGA 4ZSTA 3NJ3A 2RDUA 2QEZA 3O1NA 2CZDA 3S6TA 3CNYA 4C91A 3ZMRA 4P8XA 2MPHA 1JZ5A 2FKEA 1KBKA 3TFCA 1YDVA 1XHGA 1KGXA 3RLUA 1N55A 3SRFA 3VOCA 1X38A 4WVXA 2OKTA 3CT7A 3EX2A 5DT5A 3UR7A 3TAKA 2HS8A 1XLBA 1C91A 2H3BA 4ACZA 3KAGA 3ARPA 4D9PA 3CTTA 3KRBA 2QR6A 2CZEA 5HJYA 4GXMA 1VJIA 2Y5EA 3ITOA 3FY1A 4JY9A 4X2PA 1G0CA 3EY6A 3ITVA 3PWGA 4X63A 4Y9PA 3REQA 3UXAA 4EOUA 1J11A 5ABHA 4JTTA 2DZVA 3JXVA 3WLPA 4LY4A 5A2BA 4ADUA 4IPLA 1F5ZA 3KP1A 1XYZA 1FBAA 1BG4A 5BXJA 1S5TA 4JBRA 1FDYA 2G3FA 3N4AA 1YTDA 5C9WA 4LOCA 1TV2A 4W85A 2WW5A 4IWWA 3RLGA 5I24A 1UYQA 1LWHA 4DRHA 3URQA 2PTXA 1ZJBA 2F23A 3MT1A 8XIMA 2J74A 2X42A 2YYTA 4QX4A 4F40A 3CB3A 4GQGA 2OEJA 5KETA 5C2CA 3MU7A 2G96A 4DO5A 2VURA 3SCUA 2XSAA 4PMRA 2PDFA 1P1MA 1YADA 2AL1A 3JZUA 4UTHA 4HZ7A 4AEOA 2L2SA 3H7RA 4JCMA 2YYUA 1A47A 4DO6A 4QQUA 1DOSA 4XAYA 4DF0A 3IARA 4I9TA 4D71A 1DE6A 1K4GA 3TEVA 4M56A 1ISVA 4IL0A 4QE1A 4QE5A 4FEZA 2HCVA 3OZOA 3LMYA 2QGYA 3OVGA 5IHRA 3HFYA 1FKSA 1UD2A 1I1XA 3WIJA 1D3GA 4MNJA 2GJRA 2XP8A 3OOBA 2BVYA 3AXHA 2VZVA 3O3RA 3FAPA 4O17A 3W2LA 4IM4A 1EX5A 1HT6A 2WOQA 4C7GA 2V82A 2WHLA 3NYZA 3V0TA 1GG1A 3R13A 2CLFA 2GQ9A 1QAPA 4NX5A 2PZ0A 3QR3A 2OOGA 3EGJA 3E02A 1UG6A 3AIVA 5C71A 4HOZA 3BARA 3LDVA 2C91A 4GFSA 2C14A 4W9TA 1I4NA 3WENA 1MVYA 3M16A 4HCLA 1CZ1A 4CD6A 2Y8VA 4XK2A 4IJCA 3MV11 3FJ6A 4MNLA 3ORWA 3UZZA 3ZR5A 2A79A 5AECA 4DPPA 2ZXDA 3DFSA 1XD0A 1XBXA 3QXBA 4BI5A 2OOFA 2ZWYA 3G3MA 3O6CA 4O14A 2P53A 2CHOA 1ZBWA 1MDLA 4Y8FA 4DWSD 1JCNA 3KBVA 2VTFA 4ODPA 3P84A 2VX6A 3RX4A 3ZVHA 4RZ6A 7ENLA 1UROA 4BQ5A 3W73A 2OG9A 2RGLA 2P76A 2WV8A 3G5EA 2WQDA 1H5YA 4JQ1A 1XL9A 3QEZA 1UH3A 5AC8A 1Q5MA 3FXGA 3R8GA 3WQOA 3H7VA 4W8BA 4FF5A 4YHGA 1Q6RA 1V3IA 3U9IA 4EWJA 1T40A 4AMAA 3UPBA 4J4OA 1XDJA 1DJYA 1JXKA 5DXXA 1E40A 3W1PA 3U2EA 2IKHA 1JZ2A 5AKQA 3TNBA 3UF9A 4NG3A 3B9AA 9RUBA 3T4WA 1JFXA 4E2DA 3N3TA 3PSWA 3P93A 2Z27A 1WXYA 3PZMA 4PUEA 2YW4A 3W76A 4KPLA 3VIGA 2YCEA 2P8BA 5GNXA 4S3JA 2QUTA 3NZPA 1EA0A 4IF2A 2KR7A 1IZJA 2PS2A 2WSRA 3OLIA 2MLYA 3FJLA 4Q7IA 1GGOA 3O07A 3W71A 3BOXA 2WKLA 1EHNA 3GBDA 3W7DA 5ENLA 1UKPA 1BGAA 1LT8A 1VBHA 2ZR5A 5FAGA 3PTQA 3A4AA 3E2VA 3A3WA 3DESA 1EJXC 1GRJA 4A8LA 1GHRA 2X1RA 4JKKA 4IQDA 1BKHA 5EKYA 1F40A 3HO8A 5D75A 3R0DA 2YW3A 4UOZA 3M47A 1WDQA 3QW3A 2XTKA 2E77A 4KGJA 1VLWA 2W6RA 4H7CA 3KOXA 5J5RA 1ZB5A 1KFEA 2E6DA 3QPEA 3MVIA 3RCYA 4C6DA 3XIMA 1KCLA 3S4TA 3ARVA 3G1HA 1AK5A 1GZGA 4E4UA 4PRTA 1KM3A 4HNCA 4IIHA 3KL5A 1MW3A 1EEPA 2NQ9A 4NAFB 3QQ0A 1X6LA 3B0VC 4KS0A 1PTAA 3TROA 4WDTA 1SW7A 5DY2A 1XIDA 1YW1A 3Q94A 1W1A1 1BHGA 2ZZ7A 3VIHA 2QJJA 1HG3A 4AZGA 2Y7FA 1FVPA 3BG3A 3ZXWA 2DZXA 3TLQA 2I17A 2P50A 3WH8A 5AZ0A 4Q7BA 1TZZA 4F2TA 2OYMA 2IW0A 2C15A 4ZE4A 4GYFA 4V1XA 1S5VA 3I3EA 2E9BA 4LJ3A 3TSDA 1W1B1 1JYWA 3VZYA 1TG7A 2LJ4A 3PPHA 4QFUA 3DDMA 4ZCWA 3GDRA 4PTVA 4LAXA 4L1WA 3P3BA 2I5QA 4P7NA 1DBTA 1QNVA 5A6LA 4YTTA 3R1ZA 2ZRXA 3Q37A 4KFPA 4JN7A 3DOPA 4DI9A 1YYAA 4BQ3A 5DMLA 5D33A 4LUIA 2Z24A 3E2SA 3SECA 4PH6A 1NU5A 4MG4A 4LRSA 2A3HA 3GXPA 4UQEA 1WAWA 2GLKA 3BG9A 3WBWA 1R6WA 4LU0A 3RHGA 1EYWA 3S83A 4ZSUA 1F05A 1PE1A 3V1HA 1EGVA 2Z26A 1EWEA 1VFLA 5E9AA 1JD9A 4IT1A 3WN6A 3MMTA 5EBAA 5F1UA 2WXDM 1RJQA 3KLKA 3APGA 2DW7A 4B92A 1MFUA 4JFSA 2I5GA 3CZGA 5LIWX 1CXLA 1GWJA 3VA8A 3O5QA 1LG1A 2E28A 2J8FA 2I7GA 1PO9A 1UA7A 1FCBA 3OYZA 1CB2A 3L4UA 4DUVA 3LXBA 3VX0A 5A95A 1ZENA 4BZYA 1EGZA 5A6TC 3GH5A 3B4YA 3KRSA 4GY0A 1S3TC 5FL0A 3RK8A 2DT1A 2ETNA 3RFWA 2ZA1A 4WKHA 3L4ZA 5I3JA 3TYEA 4KCUA 1PKNA 2EO7A 1ONEA 1E6RA 1D7FA 1QPNA 1EYMA 2OZ0A 3W7EA 4Z2GA 1OFDA 1TPVA 3LHUA 3H21A 3SAZA 1E70M 1EOMA 2BASA 2X2GA 3M5ZA 2DIJA 2PDCA 1AH4A 2RDWA 2PZNA 1JDEA 1WZLA 1XGDA 2OKOA 4IXHA 4U5IA 3MHFA 3PR9A 1ITQA 2IKIA 5DY3A 3WL0A 1XQKA 2PPPA 3UQAA 2X16A 3H23A 3HB9A 3ZJ8A 5HW6A 1MSSA 1PKMA 4MSPA 1BWLA 1L1PA 4E8GA 4DO4A 3MUAA 3PAJA 2ISFA 4HA3A 3P74A 2VC5A 1E0XA 4Y9AA 3N34A 3UJFA 1GQKA 1YHTA 5L6UA 4O54A 4H41A 1UR1A 3DFHA 1XC4A 4PE8A 3O9NA 1NMWA 1EC7A 4XZLX 3HTWA 4RJEA 1DWJM 3KVMA 1EQ3A 5D03A 1Y65A 4LS1A 4DRNA 1HZYA 2C1HA 4B9ZA 2WVVA 1H7NA 4GUIA 4NJKA 3QBUA 4GNJA 3GE7A 1IXNA 1ZAJA 4GABA 2G4JA 2DZWA 5LA0A 3DBPA 5TBOA 5B8IC 3S6OA 3ZLFA 2YCLA 1XCFA 2VFEA 2DVTA 2GGIA 2FQIA 2YXGA 2ZRVA 3EDJA 4P5UA 1XGEA 3WJYA 1BAGA 2G50A 1UCWA 3N9SA 3F5KA 2RQSA 1D7KA 4LCSA 1U22A 4AIEA 1ZCNA 3IHZA 3L4WA 1BXNA 3JZEA 4GIYA 3FV9A 2IPWA 5LIYX 3CIWA 1WE5A 2M2AA 2REQB 3UY7A 5DMYA 1HJXA 3PZTA 3TR2A 1O68A 4AISA 3P61A 4P8VA 4NX0A 4FR1A 4QS6A 4IGHA 3PF3A 1FWBC 4GZEA 3ONCA 1G1YA 3C52A 1HKJA 1JL8A 3W29A 3DH7A 5CPNA 3JYMA 3HIJA 5F4SA 3GNRA 1JCLA 1MEWA 2DT3A 4CGTA 3SZ8A 2BXVA 5A6BA 3P14A 1E0TA 1CXHA 3H2OA 3BOLA 2ABAA 2PSNA 4E3TA 2EGZA 3HM7A 2F9RA 3E5PA 3FK4A 2RJHA 1VIWA 4XBKA 4EF8A 3M64A 4ZB2A 2ZRWA 5C9UA 1XKYA 5HUAA 3DBNA 1E9YB 1E73M 1OSEA 1Q6CA 4KRUA 4IMCA 5HBFA 5DCBA 4RNHA 1RHCA 1A5AA 3B0PA 2DZAA 4FXSA 1K7EA 3VC5A 4YL2A 3HPXA 3Q65A 3PP7A 4GIEA 3EWBX 5D9PA 4DJEC 3H53A 3SJ3A 1TWZA 3QY8A 3AXMA 3KXQA 4CD5A 3QMTA 4H19A 3NQ8A 4MZ1A 4IMDA 3U4FA 2PFHA 2VR5A 4PMDA 2OEMA 1QK0A 3K4AA 4TUFA 1RBLA 3NI6A 3L67A 4G56A 4A3QA 3M6DA 3HG4A 4BFAA 4JTHA 4RKAA 4JTJA 3RRXA 1T0OA 2A2IA 1XH2A 5MHBA 3WF0A 4IQCA 4Z2HA 4GX9A 1LBFA 3WF3A 2CXEA 2YL9A 1FWJC 3SB0A 3APYA 2ZVIA 1TA3B 1MZHA 3PJUA 3OJGA 4I9AA 3HMCA 3VGHA 1S2AA 1W26A 2B5UB 3B8VA 2OSXA 2Y1HA 1SUXA 5D2YA 5HA7A 1KR0A 4IIFA 3VINA 4HPXA 1Q2SA 3SGUA 2HWGA 4LC6A 4B5UA 7TAAA 1IIGA 2PDJA 1EPXA 3QQ1A 4CQBA 1K7FA 2PAJA 1W91A 3MJYA 2ZRZA 3NDOA 2IPGA 4JNYA 4DZIA 4B91A 5T9BG 4GHRA 1UR3M 3EDDA 3N29A 4R7JA 2HDJA 3PG8A 1RPKA 2JK2A 3W6LA 4GZ7A 1TX0A 1UKSA 4HNTA 2V3FA 4MDPA 2W4XA 3TCEA 5LGXA 3W7GA 3O0KA 2G4FA 3QKZA 2WCGA 1C8VA 2NVAA 2O9PA 4H04A 4NYUA 3U2CA 5RUBA 5EL1A 3PZUA 3NSXA 2YL8A 3AMDA 3HQNA 1TMLA 4ODMA 3FGCA 1EGMA 3M0KA 1OC6A 4OV4A 4O1AA 4IIBA 1DWIM 4QT2A 2PURA 4MMWA 4ODOA 4JDBA 2UV8G 2PEVA 3CHEA 1VCGA 2FGBA 2Z2AA 4Z2JA 4B5NA 4E8CA 2YCKX 2C79A 3AHZA 3PZIA 2DPEA 2BTMA 2VO5A 1C92A 1SFTA 2FHBA 1BRLA 4HJWA 2XP7A 1PBKA 3PUEA 1FJDA 3B8SA 4UBPC 3FLUA 4R27A 4JKMA 5E0FA 3AJ7A 3GC2A 3NYDA 1GUVA 5I7GA 1LROA 3VMOA 3OPSA 3ITTA 3WUGA 2YLLA 2CBUA 1JPDX 1MZRA 4A8NA 3SCNA 3UG4A 3UZXA 3MSYA 1E0UA 4KCTA 1O60A 2X8RA 1WNOA 2WHMA 2RGMA 1XLKA 4TTUA 4NSBA 3LX9A 1OFBA 5DCDA 4S3BA 3NEHA 3PRAA 2XM1A 3BCFA 2VNCA 3KWSA 5FJIA 5I06A 4N9CA 1E55A 3HGJA 3GW3A 4EANA 2E7FA 1TUXA 2QZRA 2W61A 3N4EA 2YSWA 4ZBCA 2E68A 1IT0A 3ATZA 2E1WA 3BL3A 1GHSA 1NSJA 3GQYA 4IPIA 5BYWA 3N6QA 1IWPA 3P7YA 1DHKA 1UWIA 3ZZ1A 3NQ7A 1VYPX 3EPMA 4FXRA 4O1EA 4F3HA 3NPVA 2VOMA 3IJLA 3PTDA 2AOSA 3PC0A 3TYDA 2PD9A 3HQPA 3AMLA 2WB5A 4UNIA 1VFUA 3UQIA 4FZIA 3IUHA 5CSSA 3M5YA 5C7HA 3P81A 3R94A 5FJTA 3SDOA 4J5NA 3UP8A 3SUWA 3TN5A 2J6XA 3EX1A 1UD6A 4KW2A 4L72B 3BOFA 3BZJA 2FDMA 4UOJA 1O4UA 3BAIA 1Q85A 3WZ0E 2HVMA 1JDCA 1PX4A 3NIYA 2WWCA 2P1FA 1J2BA 1FKKA 4I8DA 3O8AA 3SUUA 1I60A 2VDGA 1REQB 3W85A 1EDQA 4CLMA 5TNVA 1GTEA 2ZFAA 2GK1B 4P2VA 4EAYA 5FEXA 3AAMA 2BHUA 4JTCA 4L7ZA 1SMDA 4FAPA 3EWCA 1KQYA 2PWEA 5HWCA 3UWYA 1WZKA 5CGMA 3UCCA 2GVGA 3DYMA 3TN4A 2ATMA 2GQ8A 1JCXA 1O5RA 4XD6A 4GO9A 4D6EA 1FWTA 1ZGDA 4GMEA 2VCAA 3WLNA 3LCIA 3NSNA 1I2OA 3STPA 2PBCA 4YYFA 3MW7A 5H8PA 3WQCA 4A8RA 3TMLA 3MYPA 1EEXA 4GI6A 2PDLA 3LUTA 3M0JA 3T08A 3KLLA 1TMHA 3GIYA 3RAOA 3TQVA 3S5YA 9XIMA 1UASA 1QNSA 5T8GA 4AUBA 4C1LA 3UWVA 1KT1A 2NVCA 3EX3A 1FWHC 1JQVA 2NXIA 4WXZA 1DJIA 2ISDA 1ZPTA 3CZLA 4GI8A 1KXHA 3VK5A 3AWNA 1TTQA 3WBXA 5AFDA 2BMBA 3T0CA 2NQZA 1D9EA 2RUQA 2Y7GA 3CWOX 3L2LA 3BXWA 3LPPA 2ZXAA 3OLGA 4CCCA 4DVOA 2BGSA 4K2SA 2ZC1A 6TAAA 3I7RA 3MZNA 1BKFA 3CQIA 3W25A 2CLHA 4LAWA 3B9NA 4ZL1A 1XYBA 1SSDA 4WJXA 1U30A 4OBSA 1ICQA 3V75A 4KBXA 5SWUA 4RE4A 2D73A 5FEWA 2VZOA 1R0MA 4V2XA 2ZUVA 3BV4A 1R3YA 1PZ3A 3QV8A 3C0JA 3PJXA 4CN4A 4AMCA 1EPVA 1XRTA 5D32A 3QSRA 1D7IA 4Q8PA 1UC4A 3L9CA 2YZ5A 4NRRA 4O28A 3AZSA 3DHDA 3D0CA 4HYWA 2Q3OA 1IXOA 3T40A 4ECLA 3HPZA 4ZMGA 4LV4A 4Z1YA 3E0VA 4ZENA 1XSKA 3DYPA 3O6DA 1EBGA 5E1QA 2QGHA 3L4TA 2RURA 3LGDA 4PTWA 3SFWA 1QI5A 1VBRA 3LBOA 1GW1A 2PMQA 2NLYA 1CW2A 4PB5A 4DJEA 3CWHA 1EA9C 4WZHA 4DROA 4FLRA 4GXPA 5I5RA 2INEA 3TSBA 2X1SA 4V27A 1T6MA 5AYZA 4AZCB 3SCSA 1K6WA 3UXDA 5JBFA 1OGGA 1E6ZA 1EUAA 3VGDA 1BVNP 2DY3A 2VDIA 3VAVA 5A6AA 2KI3A 4M80A 3ABXA 4JNMA 2NX3A 1HKIA 3KAHA 2KX9A 3FA4A 1SR0A 3WJXA 3NDZA 4PTMA 1VB9A 3VCRA 1LDCA 2OB3A 4N19A 4HU8A 2PI6A 2Q5AA 3KEHA 2POZA 3IGHX 4AVNA 3THCA 1XBZA 3ARRA 3FDKA 1V51A 1FHUA 1P7TA 2GDUA 3EB3A 3HV9A 1A5MC 3AS3A 3HGRA 4Q33A 2QCCA 1PZ0A 3IEBA 1J0KA 2QDHA 5MKGA 1XWYA 3B9OA 2DVXA 4YCPA 5K2ZA 1J18A 2JQXA 1OYCA 4RNFA 2WMGA 2GSHA 3ECQA 1Q65A 1UMLA 4DUXA 1VPYA 5C9ZA 1K1DA 1QHPA 2ZX5A 1UWRA 3BQ5A 3AQUA 1X6UA 3FIGA 1V4YA 3W88A 3GXMA 6REQA 1ICPA 1C29A 2DSWA 4AHPA 1JQXA 3BUVA 1XLLA 3MPGA 1CWYA 5CPSA 1E6QM 3BH4A 1DJXA 4UFJA 2EPMX 3HURA 4UR8A 3W86A 3RM4A 4H4IA 3O5JA 3BCJA 1BWVA 2CC0A 4CNSA 1PDZA 3ZLGA 2NX1A 3STEA 3O5DA 2HXUA 1TPC1 4UQBA 4B5VA 3CASA 7REQA 3LGEA 3GVRA 3H9RB 4QJ4B 4HNUA 3FXYA 1AQMA 2DH2A 4OJYA 1KB3A 1C8YA 1C8QA 1YE4A 4OFCA 3PUGA 1KXTA 2LLEA 3T4CA 3I6TA 4EP8C 3KCJA 6CGTA 3N73A 3NL6A 5FCZA 1F8AB 3W38A 3O6AA 5K9CA 4GYPC 2RHGA 4AEFA 5C70A 1FHLA 1JPHA 4C1NB 1FWRA 3O5KA 4AZHA 2A6NA 4U85A 2VEPA 3SRHA 2GQ3A 1DVJA 4KEVA 3SCOA 1FH9A 2BNJA 1RJPA 4MPQA 1UB3A 1RA5A 3PZGA 1OF8A 4XBSA 4D6CA 2P3ZA 2IKGA 1KRBC 1ZSXA 4Q8QA 4K36A 5CZSA 4S2CA 4A21A 3K30A 5AZ1A 1KBLA 3TA6A 2A1YA 3MVTA 4JTQA 3ICJA 3SCQA 4AIBA 3TC7A 3KFTA 4FOUA 2Z0IA 4CCDA 2BV9A 4PEKA 4Y9OA 2J6VA 4UTIA 4UFHA 1WCGA 2OMAA 2ZADA 1FH8A 2XWDA 1GNXA 3FNDA 3AUOA 3N19B 1WZAA 3T09A 4BS0A 4B5TA 5BCAA 4D1IA 2Y5JA 3CMJA 5CLTA 1E0WA 1W5MA 3VKJA 4B2DD 2CLKA 5XIMA 5C0QA 3WQ4A 5D9MA 3W1AA 1XI3A 8TIMA 1O7AA 1O5KA 2HISA 5C5YA 3TQKA 3RJYA 3TW7A 3RGCA 1WDSA 4LS0A 2NVDA 2F2DA 3EYPA 1SZEA 3UVAA 1ZS2A 4IOTA 3BLKA 1LF1A 1S2WA 2GVYA 4MWAB 4GKLA 1NDYA 4JTSA 3WLIA 1K7XA 4IL2A 3PSVA 3NZGA 3R0KA 1E43A 4PTDA 2XH7A 4O18A 2WNZA 5JQ9A 3ANUA 4MDOA 1UKQA 4FMVA 3SIZA 1TV7A 5D04C 1D8WA 5D38A 3PBMA 4TIMA 3P62A 4I5RA 2E8YA 1JCHB 3G18A 5HT1A 3GYEA 2F7FA 3TZNA 1RD6A 4QG6A 3W9ZA 4HNNA 4LWWA 1OWQA 4XV0A 1FTXA 2ISVA 4GVHA 4QLJA 2VVNA 4OZOA 2VN1A 4GY1A 4PMOA 5FJOA 4YLWA 1NAL1 2B7PA 1KRCC 4PL2A 3WBYA 2ACUA 2NWRA 2YA0A 1PBGA 4MOZA 1R9YA 2YDQA 2XGIA 3BMXA 1DTUA 4NJHA 4PA8A 2PDIA 4PUMA 3NTYA 4KR0B 3R6IA 4KQZA 3LV6A 4Y9NA 3IK8A 4LAUA 4LRTA 5D2TA 3UA4A 3TQ0A 4IFKB 4K8HA 5AVNA 4ATLA 4UQAA 3EWYA 1IV8A 3R58A 4LY8A 4MLJA 4MB5A 1E6SM 3DENA 2GYIA 3V3WA 4ZFMA 3ZT5A 4U2ZA 2GJLA 1Q6LA 3AHXA 3FX4A 1H3GA 4I9JA 4DWSB 3LS9A 3Q45A 4C6MA 1WPCA 4OTKA 4W9PA 2Z4GA 3SN4A 3SR7A 3S5SA 1XRVA 4R9XA 4H00A 2TODA 1XSIA 1WKDA 1K6AA 1TREA 7PTDA 1J0JA 3GTHA 3LRKA 4C6BA 1T8QA 3VKKA 1I2NA 1EP2A 2CXGA 3W1XA 3ARZA 7TIMA 5BOEA 5BMXA 2ABBA 5DCEA 3QY7A 4DUOA 2DZUA 1EJTC 3UWQA 3ZJKA 1R86A 3TYBA 1HJSA 3U7VA 1ZK6A 5J04A 2A3EA 1LRQA 3C2FA 4S3EA 4AD3A 1RP8A 4LANA 4QTGA 4PFHA 3PTKA 3TW6A 4AQLA 1H41A 3DGBA 2XJ7A 4WY0B 3B8DA 4JFWA 4W5UA 4LUTA 2VELA 2WVTA 3WJZA 2D20A 3GVWA 3DKJA 1J6YA 3I4EA 1HGWA 1EC9A 4K3ZA 4WKFA 2PDHA 5CSRA 4BHYA 2Z28A 1IZKA 2WZMA 4O4WA 2YDAA 3C3NA 1BG9A 5IDZA 3BDKA 1DIDA 4RE2A 1R3SA 1NWSA 2BX7A 3WF1A 4E2BA 1XJBA 4GUFA 5IRPA 2CHNA 3EEGA 4GCXA 4JL2A 3TH6A 2QJIA 1TELA 4FS9A 3ARSA 4MKNA 2FTPA 5EMKA 3LPFA 1O66A 2PTDA 1YTEA 4QDWA 1Q7QA 3QKEA 1V6UA 2CPUA 3OVQA 5FEPA 2WKGA 3NOEA 2PDYA 5IBXC 3T44A 1SFJA 4DXXA 2R9RA 3JR2A 2VZSA 4Z0SA 5HMSA 3OZPA 2EPHA 4BEQA 3DKLA 4UZUA 1ECQA 1QNRA 2XP9A 5DLCA 1FXQA 1FWNA 1AL8A 1M65A 1XFCA 5HANA 1B30A 1V03A 4JQ3A 4PTNA 3VPLA 2V3GA 3WLJA 3CUZA 1VJZA 2JKEA 4DPQA 2CKRA 4DBEA 3G22A 4TOQA 1WOBA 2DSKA 3IANA 1VS1A 4U28A 5KITA 1ROUA 4KF1A 3NZQA 2ZX9A 4UR9A 2J9YA 5A8GA 1UUOA 3EMQA 1W3LA 3K8MA 4CQDA 3OBKA 2YBTA 3NPXA 3QC0A 1C93A 1F6YA 4IMGA 2FMOA 1P6BA 2WNQA 2VXNA 4DH0A 4C90A 4HBOA 2E5BA 2XIIA 1THFD 3GY1A 4GCAA 4KIRA 1LUCB 2A7RA 3S2LA 4Q4KA 1BQCA 3CC1A 2DJXA 1AJZA 4MAVA 3BLEA 1US0A 4FSAA 3CL6A 1TB3A 1GYMA 4PN2A 3CZ8A 3AALA 3T0TA 3EB4A 1QBBA 3PJWA 4ZTYA 2E6FA 2HROA 3RR1A 1S1RA 2WWDA 3D5HA 3NOYA 1YXDA 2BY3A 1J96A 1DL3A 1SPQA 3VAWA 3N6JA 2D2HA 3TN3A 3WL1A 1F8MA 3VKAA 3THQA 2E09A 3O05A 3LXCA 4KRTA 1ITCA 3UXKA 1CXFA 3NQCA 5ABFB 4B5XA 1NTHA 3SW6A 3V35A 4HHMA 1ZCCA 2HSAA 4MSSA 3KZSA 2C18A 3L4VA 3G1RA 1GZ1A 3IJ8A 3E9AA 2OYKA 4WKAA 3ZWTA 4DIPA 3GHSA 1LWJA 5D2VA 3CUXA 1Q66A 3I10A 3A9BA 3WMSA 1U1UA 3W74A 4CN6A 1RCXB 3IS4A 4LUSA 4JX6A 1WX0A 2QCDB 4DIAA 2HPMA 4V28A 4QM1A 4ZTXA 1TWIA 4ADSA 5LNVA 1EX1A 3OZMA 3ANVA 1XBVA 1GOKA 4PCPA 2HBVA 3CM4A 3U3HA 2FB2A 3S2MA 1ZALA 4C7FA 2ZX6A 2ZUNA 2G3JA 4W86A 2BOGX 4S3DA 4OWGA 5AVHA 4YNGA 4ML4A 4ODNA 5HQLA 3FYPA 3T8LA 3HPSA 1TPEA 2YLAA 1JDFA 3GUWA 3LM3A 3MHGA 3GDBA 3RCMA 5HWMA 4ACYA 3TOPA 2DORA 4IJBA 3CT2A 3AICA 4GQQA 2V81A 2FLIA 4GO8A 2CETA 3OHIA 2ANUA 3NZ1A 3LCXA 4MF4A 4J3XA 1ADSA 1UR8A 4KCVA 1JUKA 1R3VA 3S1GA 5CZKA 4QHRA 1V3KA 5HINA 1PZ2A 5F2LA 1G4TA 1GJUA 4PL1A 3EZ4A 4J3TA 1H7XA 3ES7A 4MAZA 4E3VA 1KM5A 3S9YA 4K7VA 3F4VA 1WYIA 4L6OA 1N2VA 5JU6A 1YDOA 1B9ZA 2D2GA 5AOUA 1D6OA 3KHJA 2W9MA 2D24A 4LYKA 2J24A 4QXIA 3Q67A 1TV4A 3DFOA 5E6YA 3WNMA 4WHBA 1VZWA 3RRAA 5EMUA 3UQBA 4JEQA 3LTPA 3GHUA 3OW1A 4NZFA 5GJMA 2WMIA 3B03A 4DT4A 4EAMA 5H8MA 2C1IA 1BF6A 4AVOA 1PEZA 4EF9A 3TR9A 5CJMA 3H24A 1DQWA 4AC7C 3PAOA 3CBWA 5CPTA 2NT1A 4NKCA 1UZ4A 2G3NA 2P4VA 1JCJA 1UR0A 3CQ0A 4F66A 1BL4A 1FKIA 1M1BA 4F0LA 2E9LA 3KUMA 4BQ2A 2ZKMX 4BQ4A 3B05A 3LHYA 3QPZA 3AHYA 4L5ZA 3TJLA 3KABA 4CU8A 3T55A 5BMWA 4D8LA 3TWBA 1BGGA 2PP1A 4RDZA 4OOUA 2J4GA 2Z29A 1QMLA 1XYFA 3CAVA 3W7HA 5T9CE 1QOXA 3EXSA 4XO7A 2BHZA 5HW7A 3MI2A 4HTYA 3R12A 1VFHA 1B0IA 3DXIA 1VPQA 1GVSA 2XISA 3PK7A 1TJPA 1UP2A 3TZFA 4WXYA 5CBIA 7A3HA 1TTJA 1S2CA 3IVSA 1XQLA 2IPFA 1NMVA 1QPLA 3BQ6A 3EDEA 4U10A 3WCZA 4O1DA 3N2BA 4TR9A 4GPNA 5LA2A 4Q8NA 1KC7A 4IZGA 4HT3A 3MI6A 2XFRA 1C8XA 1SR9A 4KH2A 2TMDA 3R7MA 1RA0A 1NARA 3LQGA 4JICA 1QW9A 5DN1A 2WANA 1UOZA 2DZTA 4DJFA 1RLCL 1XPYA 5G4EA 5A69A 2ZCGA 3F4NA 3ARYA 1EO5A 4ZO6A 1M01A 3W2NA 4MY1A 4AY8A 2VWSA 4IXXA 4TXEA 4S38A 1T8XA 4HMEA 4DNHA 3CAWA 1KR1A 1JZ7A 5G4HC 1FWEC 3NPWA 1R7AA 3S2JA 4MB4A 2C3ZA 3KOFA 3VKDA 1GQLA 5AC7A 1UMYA 2E5CA 1NWUA 3GR4A 5FD0A 4DZ5A 2D1ZA 4LALA 3MQTA 4H8VA 3P80A 3MA8A 2BG5A 1IGSA 2XP4A 1E6PA 2ZIDA 4CCEA 5HNTA 1QI2A 1J0HA 4I7VA 1DWAM 2VCDA 1T5AA 4MFDA 1MI3A 5CJ5A 1SVDA 3ARUA 1HL8A 1E1CB 1U5HA 2W67A 4DLFA 5EPDA 1XIIA 3A3HA 1W6TA 1FCUA 4GJIA 1WKFA 3F7JA 3LGGA 3CV1A 1UWSA 3K5XA 3DAQA 4UTTC 4JTFA 1DXFA 3V0UA 4EK7A 2KE0A 3UA3A 4NASA 5GJNA 4MY9A 4G7EA 3MI3A 4EIVA 1G01A 1ZZMA 2FVKA 1G6CA 3VZXA 3G1SA 4FX8A 1H4PA 2VQTA 3NL2A 2A6LA 1GVYA 2OZTA 2JIEA 1E3ZA 4C60A 4Q6JA 4FNRA 3WQDA 2J8TA 1HF6A 1UKTA 3LEPA 5GJPA 3WLLA 3CHCA 5HNNA 5BXTA 1ISXA 4JFVA 2PDNA 1R3TA 3I6RA 1QW7A 2WPBA 2D2OA 3BG5A 1D3HA 2WZEA 1E9ZB 4JXCA 2VUNA 1MW0A 2CW6A 4X0VA 1IT8A 2RDXA 3N25A 3LHZA 1E4IA 3IACA 2NLIA 1E4NA 2XVGA 4PC8A 4JIRA 4W7VA 4TW7A 4KRZA 3VOJA 1G94A 4ZQCA 4C5ZA 4KEMA 3GKAA 3GNPA 1EP3A 1HNYA 3FVDA 1XRSA 4ODKA 3UU0A 1GEQA 2VD8A 1WXZA 2ZR6A 3LBMA 3OA3A 4JPGA 2YIHA 1J4IA 5AC5A 1IR2A 2XSBA 4TTGA 2GVJA 2ZQVA 1W1ZA 4UCGA 3C0LA 2OODA 3KE0A 1ZJIA 2ALRA 3MWAA 4Q7NA 5CAKA 4MKSA 2RDTA 5FJRA 3W02A 4LGXA 1O1ZA 2PV2A 1XBYA 2V63A 2QNEA 1UH2A 1CT5A 2VRJA 3WD0A 2I9EA 4JYDA 2I9UA 3FEQA 1XLAA 4DBUA 2UWFA 3SN1A 2JE8A 4P8WA 2YFOA 5J6EA 1UP0A 5A6KA 2F2KA 2R1PA 1PCWA 1FKWA 1EF3A 2FHCA 3ARQA 3GSMA 3O5OA 2X0SA 2GDQA 3B4UA 3KAIA 3LV5A 4FA3A 1XUUA 3N18A 3R8RA 1HUVA 4PCFA 4O0ZA 4PRRA 4QRNA 3VDBA 4DHGA 5I23A 4I5UA 3MWCA 4KCWA 4CEUC 2QCLA 5LSMA 3N13A 3OGVA 1ITXA 4HB7A 3GM8A 3KADA 4ATDA 1E56A 2TYSA 4LX4A 4B16A 2CNCA 2GDVA 4XBJA 1QHZA 3OOQA 3IJDA 3HOJA 4HZMA 2NQ5A 1CX9A 1JUBA 1TR1A 2ON3A 1WB0A 1YXYA 1QJWA 5EFFA 3MSDA 1GQJA 4IJRA 4LPCA 2QLYA 1Q2RA 4GK8A 4DX3A 2O9OA 3KRUA 4TV6A 4DXVA 4LAZA 4DM2A 4N0RA 3GD6A 1M53A 4W8AA 2QJGA 4XISA 3DU0A 3M0HA 3H26A 3V1PA 1JZ6A 3KCOA 4PBFA 2FH8A 3VIFA 1TCOC 3LMZA 4W87A 2XPKA 2PE4A 4US5A 1D2KA 1XCWA 1PX8A 4AVFA 1UBPC 1Q63A 1BYAA 4JFLA 4N2YA 4KGLA 3O16A 3L7RA 4IMAA 3YPIA 3TC6A 2XIMA 4J28A 2WSPA 3W23A 3K46A 1W37A 2ZZ1A 3RU6A 2PWUA 2X7VA 3IGUA 4PSRA 1AMYA 3DFNA 1JDAA 8XIAA 4FNTA 3URNA 4IPJA 1EQPA 1K02A 3IJ9A 3W2KA 2GJNA 2WZTA 2OSWA 1V6VA 1UUMA 1S5NA 1TUFA 1VD6A 4YXGA 1TCDA 3WFLA 2QCFA 1FWGC 1FWDC 4UWMA 5B7YA 1ISYA 1ONXA 4MYAA 2K8IA 1XIGA 1M6JA 3QHNA 5HWNA 3GH4A 4RCXA 5AYIA 2AMGA 2FZNA 1K8YA 3VKBA 5D30A 3H6OA 5H2ZA 1V3LA 4DAFA 1XFBA 4IP4A 4XAKA 1L6FA 1GYNA 1HXVA 3ZJ7A 2UBPC 4LH8A 2JFEX 3EXTA 3T0BA 2R1MA 2BSLA 3CTLA 2EPLX 1KWGA 4NT0A 4W84A 5LIXX 1Q8JA 2W62A 4C6PA 3QV7A 4ZPTR 1U33A 3DYOA 3AWOA 4KWUA 1Z7AA 1Z32X 2A85A 2IXVA 3U5UA 1RAKA 3DIPA 4F0MA 3S5NA 3M9YA 1K9FA 3KOZA 4QNWA 4FX7A 4UQDA 1HQTA 4JTEA 3QF0A 4RXGA 2YFNA 3QN3A 4X3ZA 3DC0A 1IHIA 4AB4A 2OYLA 1V08A 1W5QA 3E1F1 5PTDA 4MB1A 2O9RA 4F4RA 1KV8A 1X1ZA 1M68A 3E49A 4B3LA 3CIVA 1CGYA 2YB4A 3ALGA 1RV8A 2F6KA 1NIUA 3W7RA 3WYZA 5K3VA 7ODCA 3OODA 3AIBA 4DZ3A 4DRIA 3VC6A 1DPMA 3H2AA 3WDIA 4DYJA 2QW5A 3EOEA 4AZ7A 2QAFA 3M5XA 1LQ0A 3DFPA 2EBNA 4QJ5B 1GPWA 3RM8A 1GTHA 3APTA 4MHBA 1AJ0A 2VFHA 4N6FA 4K1WA 2OT1A 4N9DA 4XZWA 3CUFA 3FJNA 2VGBA 3EWZA 4AFYA 1POKA 3E2RA 3ZT7A 4L64A 2ICSA 4C6EA 4H3DA 4L1GA 1BLIA 3A6OA 4WY0F 3SRDA 1YPIA 2A7NA 2P88A 4N4PA 3BMWA 4L4PA 1X98A 1MMFA 3HJEA 2REQA 2PU0A 2VX4A 3P8IA 3A4WA 1KRAC 4AYGA 2QQ6A 3WD4A 1PX3A 4YVVA 1EKOA 2PLCA 2ZUWA 3K1DA 2PF8A 1S46A 1RD5A 3GWQA 3HQ1A 4IGSA 1EZWA 1PVNA 4KQNA 3T78A 1KBJA 2B81A 1HVQA 1GPFA 4HARA 2OR2A 3GAKA 2FVLA 1QOPA 1TVLA 4L65A 3C5QA 1QR7A 3WF4A 3WUFA 3E0LA 3GXDA 1FKXA 5HOSA 3CHVA 3UD6A 3C0QA 4CUCA 2DSUA 2VEMA 4QP0A 1V0LA 4XKYB 2V6AA 1G4PA 3EOUA 1KFWA 1NELA 4IIGA 1FWIC 3P6LA 4FLSA 1XYCA 4DYEA 2WJFA 2ESCA 3S1WA 4O8AA 3W2MA 3L66A 1MWOA 1BYDA 3I6CA 1BPLB 3G0XA 3NDYA 3GU9A 1BXBA 5D8ZA 1CGTA 1GKQA 5AHLA 3GU0A 1A0EA 5D9NA 1ZJHA 4ZQPA 3W1QA 1MXDA 2CLOA 4FIQA 1I75A 2IQDA 4NUWA 4FALA 3AIEA 4FN2A 1XIBA 2GUUA 1AL7A 1YPFA 5F2MA 2B4GA 3TV8A 2ZRUA 1VEPA 3FSTA 2QCNA 3EKZA 2VJXA 1I2QA 3IIOA 3S46A 1VYRA 4IISA 3Q58A 4IUOA 4S3AA 1DORA 4H9UA 1M03A 4Z2KA 2AGTA 1J4EA 4XO6A 2ZZ4A 2CWXA 3J7HA 2XH4A 4O16A 1OZQA 3WKZA 2RAGA 1TA3A 3KW3A 5DF0A 4UZSA 3ZOAA 5TAOA 4ZVJA 2BGQA 4H6QA 4PMUA 1YNQA 4NAEB 2DV0A 3CS2A 1YTKA 2GOUA 5ABTA 2WM0A 1KM6A 3LPOA 1LT7A 4S3CA 4M19A 3L23A 1CXEA 5IOBA 3P82A 4K7YA 1SW3A 1L0PA 4MPKA 4A29A 1F8IA 1JRBA 4K68A 3H4XA 4DRQA 3N3MA 4J3ZA 5DX7A 5FIPA 1NVMA 2E25A 2HS6A 4HNOA 3BAWA 4WF7A 3RLHA 3CO8A 1XLEA 1RALA 3H2CA 5I02A 2O55A 4K6AA 1H7OA 3W7LA 4WJEA 5DEZA 1H7RA 2Z1WA 4LVGA 4XB3A 2XWEA 1J6PA 3QY6A 1QU4A 4WGXA 4DELA 4RE0A 2WNWA 3NSMA 4O52A 4OV9A 1P6WA 1H0IA 4QBXA 4BY3A 4A22A 3VKCA 3KACA 4TU1A 4A2SA 1TIWA 3VOFA 1PTGA 1SFLA 3FCPA 4XAPA 1UUQA 4J3WA 4HA0A 3IRSA 1O5QA 3MKCA 4LYQA 1FHDA 2XUCA 4HZ8A 5BZAA 1WA3A 4PBEA 5CJNA 3CUGA 3JW7A 1F4AA 3RFAA 3ITGA 3UG5A 3V16A 2TSYA 3RILA 3WLHA 5FF3A 3TONA 4I6KA 4YS1A 4DLMA 1VBUA 2WAGA 3WDRA 2W3ZA 4K8EA 1F3WA 5E0CA 1R3WA 4EVZA 3N2MA 4O1CA 4Z2IA 4PODA 3G1XA 3VYLA 3UVIA 4W9QA 1E1EA 1S2TA 2Z7KA 3PRDA 4ZE5A 3TNOA 3C6CA 1YPXA 2PDQA 5HR6A 3T07A 3GRIA 3WBEA 3L65A 3D3FA 4RW3A 4J40A 1AODA 3EOOA 1W1TA 3GKFA 3UG3A 1B3XA 1VBGA 1DIOA 2ACRA 4KEUA 1E3XA 2DGAA 3DHFA 5GPRA 3XINA 1SJCA 5FOOA 2BGNE 3PJTA 5LA1A 1SZGA 4W9OA 4J2MA 1E6NA 4CVUA 4AG0A 3H54A 2VI0A 3H12A 3W1UA 3K8KA 1MRQA 3Q4DA 5E0KA 2FZ9A 6ALDA 3NQBA 3BLOA 5I00A 1UP3A 3UI6A 1TJ1A 1BWKA 1QFEA 3EMCA 4DBDA 3D47A 1V6XA 4HU0A 1XLGA 2GUBA 1UW9A 1ZFJA 3A3XA 3MY9A 4XD3A 3ZJ6A 2J27A 3WNPA 1UWQA 1S1PA 2FFCA 4LB3A 4H9XA 1Q45A 5GQBA 2GK1A 4CNNA 3W7QA 1YX1A 5EA9A 1EH9A 1ICSA 1UR2A 3AIQA 4HHPA 1OIFA 4O8RA 3FGCB 4ZGYA 1M9HA 1JVWA 1VHNA 1WBHA 1Y5WA 3VNJA 1V0MA 4XSMA 4A3UA 2ZYFA 1BXCA 3B8IA 1NDVA 1UQYA 3VDAA 4KWVA 1I2RA 2BOFX 3GC4A 3NM1A 2MNRA 3R89A 4KT2A 1T96A 4AIUA 2GPTA 2WC4A 3TTSA 4FHAA 4J7RA 1SZNA 1KM4A 1M7OA 4AAJA 7CGTA 1XIFA 1BYBA 1XD1A 4H2HA 3F1QA 3FOKA 3QV6A 2ZR4A 3LCGA 3STGA 1GOQA 2IUZA 2Y85A 3CYJA 4JNZA 1W2VA 3G2GA 1LJYA 3CEPA 2X30A 5EFDA 4G6CA 2F2HA 4MNKA 4OU1A 1GVQA 1E51A 2X1IA 5AHFA 2OLHA 4G2PA 4MWAD 1Q3NA 3QSTA 4BKNA 3VILA 3NQFA 3WQVA 5KMYA 3ALFA 1W1IE 1SJDA 3DI0A 3SURA 3S2CA 4F9DA 2HRWA 4MB3A 4PRWA 3NWRA 2CBVA 2VENA 3GH7A 3NGFA 5U7SA 3UJEA 2DIKA 5D37A 4RPQA 4Q22A 2VEIA 1OT1A 1WOAA 4NJJA 2PC8A 4OQVA 1YBQB 3W1TA 1GVEA 2PGFA 2ZC8A 3SQLA 1QNOA 3IPWA 2X0HA 1HTIA 1R38A 1I8JA 5IDIA 1JZ8A 4GIVA 3QZAA 2MNTA 2VX7A 2ATSA 1RQBA 3I68A 2G0WA 1PJ9A 1ZAIA 4WX2A 2PN0A 1H11A 2AAMA 1RVKA 1F7BA 4KFOA 5AHEA 4WR3A 3VDHA 2C19A 4NHVA 3EPOA 4GFIA 3W81A 4HP5A 4O10A 2RH9A 4LUJA 4GH1A 1LP6A 1YQ2A 4E2VA 1XISA 5A5WA 1DQUA 4Z08A 1A3XA 1OFOA 4MADA 2A0NA 1VQTA 4L6HA 1BEUA 5CG7A 4UOQA 3O5MA 5DRIA 4C1KA 2VUYA 4LTSA 4HMNA 1LQAA 4UFLA 3HPFA 1MQRA 2D69A 2WMJA 1GORA 3TK7A 3SY5A 3KAFA 1LCOA 4L6DA 4IQEA 3KBJA 4XG1A 1OVDA 3KZPA 1RPXA 3A64A 3EEZA 3C2YA 4O13A 4AZCA 3DERA 2XVNA 3BGJA 3T6CA 3EWWA 3BMVA 4TX8A 4JFKA 2JALA 4L61A 3C86A 3T05A 4BF7A 1ZBVA 3UXIA 3LU2A 2Y7DA 3UNTA 3RMJA 4MZ8A 2DDXA 2BLEA 2FDSA 2NXHA 3CAQA 1VLIA 4LFYA 1TVNA 2VC9A 4MJMA 1C7SA 5C9RA 1DJZA 3SUTA 3TWAA 3L5LA 4LBRA 3E0WA 3G8EA 3EA2A 3GXTA 5CC5A 2YL5A 4A35A 3PANA 4U86A 1C90A 2C13A 3GPKA 1UIOA 2H8XA 2H9AB 2PB1A 2YX0A 2A4AA 2ZA3A 3H8AA 3POCA 3OLDA 1EL3A 2ZE0A 1O94A 1MUCA 3U4AA 3GR7A 4UMAA 4C5YA 3LUOA 3V4BA 2WBKA 2Q01A 1S3HA 4L9XA 3WDHA 1M04A 4UTKA 3ZO9A 4DJDD 2VFGA 5LGZA 1XV8A 3M7SA 6PTDA 4YMZA 4ROPA 3S1VA 2JKAA 3LZ3A 4C7DA 1UZHA 5CC6A 1ECEA 4JTRA 1EUNA 5FSDC 3H2NA 1HW6A 3WX7A 1KFLA 3ABZA 4RV8A 2VFFA 1QZ2A 3U48A 4JIEA 1UPMB 1JNTA 3IGSA 2GVEA 2PPNA 1ESWA 3EWDA 2EQDA 3H7UA 1GT8A 3NQDA 4M81A 2XDFA 3R10A 2Z1XA 2DUZA 3QRHA 1EJSC 1LORA 1PIIA 4HYVA 1FKTA 1OFQA 4E6MA 1BSLA 4ATWA 4OBRA 4N9EA 4GC3A 4AC1X 4Z1DA 4AZ6A 3D3AA 1TWSA 4IMEA 1U79A 1YATA 1W17A 5D2WA 3VE9A 2FZMA 1TWWA 2V5CA 3A4XA 5G4WA 1OCBA 4U5KA 1ZY9A 1EIBA 9CGTA 5CZ0A 4ZEPA 3OVRA 1IE7C 2HE8A 1R9ZA 1XLHA 1FDJA 1BFNA 3VGGA 4MKVA 4C1NA 3F5JA 4GY7A 1Q6GA 3S42A 2BS9A 3MKKA 1OQFA 3GS6A 2G41A 2YDSA 1EOKA 3WLMA 3M0YA 1ELSA 2V3EA 2YZRA 1PKLA 4F2BA 1W1YA 1FRBA 3GTXA 3SJNA 4EKJA 4F0KA 3ODKA 3GXFA 2Y5SA 3WQFA 3MZ2A 1RLDA 3ZFHA 4TX0A 3O5IA 1LOLA 1XH0A 4RZBA 4UIOA 1SJAA 1SJBA 1UH4A 3QMSA 2WZHA 5CPOA 1W9BM 2BY2A 3P0WA 1SYTA 1XIHA 2PWGA 4NZ1A 1DIEA 3RR4A 3W01A 2XN2A 1RQEA 1ME8A 4UMCA 3AROA 1QI4A 2I5IA 3WMLA 4A8IA 1VBJA 1ZBCA 3O5RA 1DYSA 3HFTA 1KGUA 3WUEA 3L5AA 5MKGB 3NQMA 1L6SA 3P8JA 2OPJA 4RLIA 1XH1A 1TV3A 2J47A 4GKTA 3NR0A 3C61A 4P7LA 3T8QA 3F5LA 3LCFA 4QE4A 4HPHA 4JFUA 4H7ZA 5AY7A 1O5XA 3FA3A 4GYKA 1O12A 1R9XA 1SZFA 4ONVA 2C8NA 3EKGA 3LLXA 1P4CA 4V1YA 3UCDA 4AY7A 3VNMA 1ZUAX 3GX9A 4C6LA 5F4WA 1KTBA 3UJ2A 2KGJA 1ZRQA 4RX0A 4EWND 3PNZA 3BLPX 1JNDA 1LRTA 3GFXA 2PLMA 1H1NA 1ODUA 4GRSA 3OQEA 4RPPA 3K4WA 2CESA 3NO1A 4NNCA 1OT2A 3O5PA 3P2VA 3CHDA 3GG7A 1WKYA 3JUGA 3NQGA 2O0TA 4ASTA 1EF2A 5DO8A 4GINA 1RQHA 3M44A 4PYSA 7REQB 3VX1A 4O0KA 2Y61A 2WM1A 4BWLC 4DRSA 4H1ZA 2X0YA 2CBJA 3WLOA 1KWKA 3W27A 4OBTA 3SGZA 1DWHM 3WELA 1KNWA 3E3HA 3N2OA 5ECUA 4AHOA 3LQLA 1R3QA 2ZWZA 1W5NA 2OJPA 2FJUB 4IFKA 1HGYA 1IXPA 4MUZA 1DXEA 1F3XA 2E9MA 1PUDA 4YTRA 4YTQA 1LOQA 1DE5A 1RUSA 2FFIA 4CQAA 1B3VA 1GQNA 5FACA 2VGIA 2XU2A 1IEIA 4XSLA 3P67A 3ZSSA 2V2HA 2QJNA 1Z69A 2EULA 4LB4A 4GJ1A 1XLIA 1G4EA 3H2FA 3CPRA 3L12A 4FLOA 3U57A 1NF0A 4S1FA 1XIEA 2R24A 2V68A 3OO2A 3IVUA 4CNUA 1QW8A 2EEXA 3R4IA 2YXOA 3MJMA 5CC3A 1OJXA 1BYCA 1GVOA 2DVUA 4QEHA 4IHCA 4ZB0A 3VGBA 2FYMA 3CU2A 3OB8A 2NWSA 5EMYA 3W3OA 2VR4A 2LKNA 1E1FA 2VZUA 3ID7A 4CNTA 5LYRA 3QGAC 3CZJA 1V8EA 3D6NA 4IP7A 2W63A 5E93A 3VGFA 4GUJA 2P0IA 4HU3A 1D8CA 5B80A 3M0LA 4WY0A 3WMBA 3C0SA 4H83A 2W79A 3NA8A 5CZTA 4B5SA 3EOLA 1R2RA 2ACSA 3LHVA 3KOWA 1L9WA 3VD7A 4U4MA 3B7XA 3L68A 5K9DA 1OF6A 3AHVA 2J78A 4XIAA 4W89A 4O53A 5CH9A 4S39A 4ODRA 4DWDA 3SCTA 3QYSA 1JUEA 5FJUA 5E6ZA 4AWUA 3KWXA 2ZUSA 3F2BA 4UQCA 1FY6A 2DT0A 4LAMA 2EF9A 2H90A 2WSYA 1Q7MA 4XD4A 2ZZ5A 2WC3A 4KKXA 2G3IA 1NQKA 3DN5A 1V02E 4H6KA 4OUEA 1JRCA 2I56A 3DFYA 4JTIA 3WLKX 1Q6FA 4DF1A 1VFTA 4M29A 4C6OA 2PC4A 3BJTA 3CUJA 2EKGA 1OG6A 1LWIA 1TZ9A 3LXAA 5I0DA 5A8MA 1VCFA 1VHCA 3SADA 3DHUA 3TTYA 1IWAA 5FJJA 1JNEA 5HULA 2INFA 4PBGA 3S6DA 3RX2A 4O1FA 3INPA 4GLEA 3CJPA 4UCFA 3GFZA 4NI8A 3VM7A 1YEYA 4KWSA 1FD9A 3WFAA 2FZDA 1XPGA 1AH3A 2WBGA 2QV4A 3T9PA 3VOHA 5I78A 1NDWA 4GI4A 3K1GA 4JFTA 5AYBA 3W82A 3MMUA 1Q4NX 3OU8A 5HMEA 3M46A 1PXGA 4ZB5A 5BNKA 1EXPA 1UD4A 2WNNA 4HIBA 3QTPA 4UFKA 2HZGA 4ODLA 1NWRA 5CPMA 1RY8A 4TMCA 3UNDA 4ZA0A 1K8XA 4AXNA 1VP5A 1GCYA 1A3HA 2XP6A 4GA8A 1IEXA 2BHYA 4ML9A 1G5AA 1K3UA 3RNDA 2V69A 3S5ZA 1JF6A 3ITYA 3DG6A 5A2AA 1FFRA 1MFVA 1TPDA 1ADOA 4QJ1A 1WP6A 4MJ4A 4EPKA 3TSMA 3CZEA 1OC5A 1NFPA 4FR6A 4HQVA 1IWBA 1MW1A 3FHAA 4I6VA 5G5IA 2YB1A 4A3HA 5ECVA 3LD5A 2PV1A 3HU7A 1CGXA 3WDJA 5HNUA 3W7CA 5A3HA 4PCNA 4EXQA 3AC0A 1FKJA 1CLXA 3O5FA 4LCRA 4NZ4A 1W9VA 1V3JA 3MB9A 4TVUA 1CENA 4H9YA 4LF1A 4PB3A 3PWAA 2UY5A 5DBTA 4MJ2A 3O5LA 5ABFA 3BAYA 1TFVA 3LERA 4H9TA 5JUVA 2X1UA 3LB0A 1H60A 2DW6A 4GZJA 5AC4A 3B9DA 4IFRA 2E4TA 2GGJA 3GZ3A 1EO7A 5BOFA 1OFRA 4ZQMA 3IKDA 2QV5A 4IP5A 2GWGA 2NV2A 4DYKA 1SFSA 2QCDA 1NFBA 3VDGA 4HGXA 2EG6A 2EG7A 4BJHA 2XINA 1IQ8A 5AHIA 3LHWA 1K4HA 4LNYA 3W72A 1W9PA 4B3ZA 3RF9A 5A6JA 1LRNA 4WDXA 2D3LA 5KSWA 2D9FA 1J0IA 1XSJA 1NSGA 2JEPA 1S5MA 3O5EA 1DP0A 3QVQA 1FKDA 3IIXA 3ES8A 3TMQA 3TP4A 4JX4A 4D72A 4H9ZA 4JR5A 4AD2A 4CCZA 3MUZ1 1B4KA 1P43A 3LTSA 3LNPA 3HGOA 2VT0A 1W2PA 2R91A 2ALDA 2WYSA 4WD0A 3SM0A 1BTCA 3OEXA 4AXKA 4KWWA 5CBJA 4GBDA 3IV8A 5JIWA 2QIWA 3RO6A 3DX5A 2NX9A 1ONWA 3QZEA 2GGGA 1F4HA 2WO5A 4H2CA 3XISA 3P0XA 5FF0A 4WDUA 1OIMA 4AD5A 3PY2A 2GOKA 2J79A 2BB0A 4HSNA 2CLMA 4KIEA 4BCEA 1H2JA 4NVTA 1CECA 4U31A 4H8HA 3TXVA 2V38A 5CPQA 3HF3A 1GJWA 4WLCA 4O4VA 5HATA 2POTA 3LCHA 4DEFA 1JD7A 4LC8A 4PCSA 2XH0A 4JX5A 1KFBA 1TKKA 3TKFA 4BWLA 2PBOA 2Z1KA 1HJUA 3W28A 4B90A 3PRBA 1B3ZA 3GLCA 3MMDA 3NRKA 8CGTA 4TO8A 3T81A 3WK1A 4J4NA 1KBIA 1UWUA 3G0UA 1A80A 2DU2A 1CIUA 3BAKA 1A5OC 2CITA 3B8TA 1J4RA 4CKQA 1FXPA 4AWTA 1CI1A 3O0FA 3W1RA 2NSOA 2TRSA 4B5WA 5HTGA 2X2YA 1US3A 1TCMA 1JGMA 3WQ6A 4CVWA 2VKZG 2DJLA 4JEJA 2OLAA 1UIPA 3T1GA 3M0IA 3WLRA 3ME3A 4PUUA 1AA1B 3IUDA 4PGLA 4WGHA 1R7OA 1DJHA 2GL5A 4DRPA 3MP5A 4RV3A 4WRHA 3T7VA 1F2JA 3T42A 4ZOEA 5FAJA 1H09A 3M0MA 2Z00A 1XP3A 1B3WA 1OX4B 4EACA 1LM1A 4Z1BA 1OY0A 2A3BA 4WSKA 3B3DA 4LUYA 4O2TA 4DAIA 9XIAA 4C65A 2NSXA 1X1NA 1PB0A 4QS5A 1KBBA 2XPAA 3C56A 2PWHA 1HKVA 2OX1A 3WY1A 4I3GA 3M4HA 1OG0A 3EAUA 1CXIA 2OLSA 3KCLA 1LL6A 1CGVA 2HMCA 2HV5A 2RJGA 2A3LA 4FPSA 2VZTA 2XVLA 3I4KA 2ZXBA 4I5XA 2QXWA 1M7JA 1EJVC 3S2NA 1D7JA 2QDDA 2BZNA 3AJXA 3WH9A 1LG2A 4NU7A 5HUPA 1JI2A 4QITA 4KERA 4JD4A 4CQCA 3CO4A 1GOOA 2J25A 3ZLHA 1J79A 1VC4A 4F0RA 3BAJA 4LSBA 3WH0A 1FA2A 4GJJA 5I3IA 2ZQTA 3G1FA 3L4XA 3PFMA 1RVGA 2ISSA 2W66A 1H49A 3PWIA 3HMJG 1OX6A 1F9CA 1C9WA 3O15A 4Q4SA 4IG2B 1OCQA 3AYSA 1E4LA 1MRAA 2Y7EA 3QTGA 2FIQA 5M17A 2PV3A 1XR2A 1UBSA 3KVKA 1OYBA 5T91A 1TRDA 1UKOA 3M6YA 4AZBA 4JKLA 1LZOA 4XZNX 4HMCA 4O50A 4H7VA 2TAAA 3EDKA 4YYCA 4HCDA 2YA2A 2FZBA 2QPSA 3KDNA 2J77A 1J10A 1UR9A 4Y2WA 3PB2A 2RFGA 2VP8A 1QCWA 1PV8A 4ZO8A 2OXNA 1E1CA 1GG0A 1JPMA 4RR4A 5M03A 1WAUA 3JU2A 1FKLA 2PLJA 4Y6GA 1HIZA 3NNTA 2WMIB 4R5EA 4FAMA 5F2IA 1EYEA 3GBEA 3H70A 1NQ6A 3KOYA 3IGXA 4GBUA 3TTEA 4DBSA 1YIXA 3GDKA 2YA1A 2OZ8A 3QHOA 3WBAA 1KFCA 3PULA 4H6EA 1WKEA 4DZ2A 1B57A 4NY2A 3DECA 1LYXA 2XIQA 3AUJA 3HJZA 4ERIA 3RX3A 2HVOA 4KETA 4QIUA 2EPOA 1E6XM 3LI1A 2V0TA 1KRMA 3RN6A 2OFNA 4XWUA 3IWPA 3AXKA 4MIMA 1X97A 3LSBA 4D6DA 4H6RA 3BGAA 1WDPA 3LSCA 5AB3A 5H91A 1XCXA 1QK2A 2OX4A 4MY8A 1V7YA 4EXAA 4O15A 3UERA 2D0GA 3P5YA 4HD5A 3MBDA 1QO2A 4E2OA 3L0NA 3H2EA 4QJ3B 5C9XA 1KV5A 1SO3A 4AYSA 1XLCA 3AIRA 2J8GA 3OZYA 4MNMA 1QASA 1J5TA