1ZB5A

Recognition of peptide ligands by signalling protein from porcine mammary gland (spp-40): crystal structure of the complex of spp-40 with a peptide trp-pro-trp at 2.45a resolution
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNFGPQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGQEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGKSFTLASSKTDVGAPVSGPGIPGQFTKEKGILAYYEICDFLQGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords signal processing protein
publication title Recognition of peptide ligands by signalling protein from porcine mammary gland (SPP-40): Crystal structure of the complex of SPP-40 with a peptide Trp-Pro-Trp at 2.45A resolution
rcsb
source organism Sus scrofa
total genus 122
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2005-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1zb5A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1zb5A01
1L0PA 5HDRA 3NSNA 2WMFA 1PBGA 2XIBA 1HNYA 4PMDA 2OSXA 1QHZA 1GOIA 1DWJM 1NP2A 2D23A 2VZTA 5A8OA 2ZXBA 2ZUUA 4PEEA 2DGAA 3FHQA 1WPCA 2ZUVA 3CZ8A 1B3XA 4OBRA 2HVMA 5ABFB 2ZX6A 1Y7VA 4M82A 4LYQA 2WMIA 3ZMRA 3BLKA 1ECEA 4J3UA 4GPNA 1E1EA 4U3CA 1UWUA 2WHJA 2WHKA 4QLLA 4EK7A 4PTMA 5HPCA 1BYBA 5I77A 1WDQA 3ARRA 3GTNA 3EMQA 3ARVA 4BA0A 3T2QA 3WH5A 5A8NA 3VGGA 1B3YA 2DT3A 4TVUA 2X0YA 2CHNA 1BGGA 3FAXA 2VC9A 1Z32X 3SCWA 1YQ2A 8CGTA 1HKKA 3AMGA 1J0KA 3VILA 3EDKA 1Q6CA 4UQEA 2NT1A 1VFFA 1UWIA 2WK2A 1A47A 2VJXA 2W92A 4S3KA 2G3JA 4P8VA 1QVBA 2FH6A 4PSPA 1TCMA 4HOWA 5LA0A 4GI6A 4UCFA 1U30A 2VTFA 4B3LA 1G1YA 4LYPA 3LPFA 2WMIB 1K9EA 4PTWA 1BYAA 4UFHA 4UQCA 4OOUA 2V3EA 1UWSA 3ZJKA 1DHKA 1QI4A 3TTYA 1JFXA 1IV8A 1US3A 3WF2A 1JZ3A 4LQ1A 2UY3A 1R7OA 2D0HA 1TFVA 1J12A 3HU7A 4PMOA 4H8HA 4CD7A 4J3WA 2FDMA 3T0AA 4J3XA 4UFJA 3PZUA 1J18A 5A6BA 2EQDA 4TTGA 2GVYA 2WZIA 2UY4A 2RGMA 3BCDA 5BXRA 2WW5A 1WP6A 3CBWA 1V0LA 2D3NA 2G41A 1JL8A 4IM4A 5BRPA 1OINA 3MUZ1 4OOZA 2J47A 2W66A 4AYSA 3WNOA 4YHGA 3PTKA 2WNWA 3T0DA 1NARA 5CLWA 1CXLA 1H41A 1KCLA 3FN9A 1W32A 4OUEA 1VJZA 5M3WA 3CMGA 4LX4A 4Z2KA 2V3DA 4AXNA 1KR0A 3CZJA 3WQ4A 4ATWA 4P8XA 1V6WA 3WDJA 5CSYA 2BV9A 4A4AA 2WPGA 4GZJA 3F5JA 4M8UA 3AIWA 3T08A 1R86A 5A8MA 5BRQA 3WKZA 1VFOA 1H0GA 1C7SA 2D3LA 3MMWA 3WIJA 4OZOA 2J25A 1J10A 1WAWA 3W0KA 2Y4SA 2ZUNA 4BCEA 4P8UA 4RL3A 4NRSA 4PCTA 2Y8VA 3K8LA 4HZ7A 4ACYA 1PX3A 2BHUA 4XUYA 5I0DA 1FH9A 1HJQA 3O6AA 2W61A 4XB3A 4TX8A 3N12A 4YN5A 1FOBA 1CPUA 2CBUA 2WVVB 1OCQA 1J0ZA 3RJXA 3BAKA 5BWFA 3BMVA 4U33A 3A4WA 5KZ6A 1GPFA 4HZ8A 4DWSA 3KZSA 5HXMA 2VQUA 3L2MA 1E6RA 2FHCA 2VO5A 1QI3A 1G01A 4LXFA 5BCAA 5I3DA 4Z2HA 4W8BA 2XIIA 4B16A 3W29A 4WKFA 1W9VA 3N18A 2WMJA 4U2YA 1UKOA 9CGTA 4PTXA 2DSVA 4AD3A 2WWDA 2VR4A 1W1TA 1ODZA 4NZCA 4ATDA 4DWSD 2J7BA 2E9LA 2O9RA 3VD3A 2WKGA 4CD8A 3WH9A 1DP0A 2BHZA 4AISA 1B3WA 4KRTA 4W7WA 3WBAA 2PBOA 3WUBA 4D6GA 1QNQA 2VZOA 1W9BM 1EXPA 4OKDA 1OT2A 3W6LA 3A4XA 5GNZA 3RJYA 1GORA 4H8VA 4MNKA 1D2KA 3N17A 3SUUA 5A8QA 1CNVA 4PMXA 3WUFA 2EO7A 2VX4A 1QNPA 1B90A 1KGUA 3QR3A 4C7DA 1LG2A 2YIHA 3KEHA 3OLGA 5EBAA 2D2OA 1NP0A 1EDGA 4ZE5A 1BPLB 1KQYA 3AHZA 1KR1A 2GK1A 3W6MA 1JDDA 1J01A 4BQ4A 3UERA 3AI0A 3AXIA 3GH5A 2WMGA 5IHSA 1GOKA 2F2HA 1ZU8A 3PBGA 1E71M 2W5FA 3WD2A 3PTQA 4TTUA 3BSGA 4UQBA 5ECUA 3M07A 3K4DA 3U5UA 4W8AA 1TVNA 1EHAA 3VIKA 4PMZA 5E6ZA 4TX6A 1FFRA 5HPOA 4MADA 1HKIA 4LGXA 2ZE0A 1MXGA 4W85A 4M29A 3VIPA 4ZENA 3EMZA 2G3IA 4CU6A 1WO2A 5A2BA 1VFUA 3WBEA 3AZRA 1KXHA 1Q6GA 2JIEA 4WSJA 2BNJA 3W53A 4D6EA 2E3ZA 2EBNA 1M03A 3A6OA 3DC0A 2E40A 3O2LA 2CXGA 3QHNA 5I5RA 1J0HA 1LG1A 1UZ1A 4M24A 1OIMA 1GQIA 4C7GA 3GBDA 1TA3A 5EMYA 2FGZA 2CCRA 1TG7A 1CGXA 5M5DA 2FH8A 1V6XA 2EEXA 2JF7A 2V3GA 2ZWYA 3F5KA 2A3AA 4PCSA 3WQ8A 1JFHA 1UWQA 2IXVA 3AIRA 3NIYA 1E0WA 5IXEA 1GQLA 3W24A 3W38A 2MANA 2GK1B 3SCOA 3VX0A 1V3KA 1B30A 1ISVA 5IFTA 3OZPA 1WDPA 1CGVA 1GQJA 4QCEA 1A3HA 1V3HA 4YPJA 3IAQA 1C93A 4P7OA 3ZQ9A 1KWGA 2XSAA 4FF5A 1V6UA 2G8ZA 2V3FA 4PRWA 3GXDA 3AIVA 3EDJA 4OBSA 4UFKA 1M53A 2E0PA 3ZT5A 1B3ZA 3CLWA 3PZOA 1UA7A 1N82A 4GKLA 1PX8A 2VL4A 4UNIA 1AQMA 3SCTA 3U7VA 2C0HA 3VGDA 4AZIA 3MS8A 3CUIA 2WCSA 4PMVA 5JBDA 2GJPA 2VT0A 3VGHA 3WF0A 1HKMA 2A3CA 1HF6A 3W26A 3WNPA 3CHEA 4JHZA 1X6NA 1E6XM 1B1YA 1RH9A 2VVNA 1UD2A 3AHXA 2CNCA 1B0IA 1E1FA 2WVUA 1CZ1A 3QGVA 4W8LA 1C90A 1JF5A 1Q6EA 5BROA 1KFWA 4OJYA 1MVYA 2WSPA 4U31A 2J79A 4P8WA 3L4VA 3VIJA 1HJUA 3GNPA 3MMUA 1C8YA 3VIIA 4DUWA 1CGYA 3ZM8A 4JZ5A 1H09A 1UUQA 4J3TA 4CUCA 3L4ZA 4P7QA 1TUXA 1SMAA 1M7XA 1BYCA 1FHLA 1PAMA 4ZFMA 2WXDM 2XUCA 2Y8KA 3AMKA 3ZR6A 1ISYA 4D71A 1BVZA 1UKQA 4IUGA 1ZBKA 3EDDA 1M01A 5FIPA 2BY3A 3N11A 3CUGA 3VGBA 1E5NA 1H2JA 1WCGA 4MNLA 1KGWA 1C8XA 2O9PA 3WUEA 2TAAA 1UR8A 3WUGA 1L8NA 1V0MA 1JYWA 1E56A 2XWEA 2DSZA 2ZX7A 4WK9A 4PMNA 4KWUA 3CZKA 3VPLA 1CEOA 4D6IA 4FK9A 3N13A 4HU0A 3POHA 1JGIA 5LA2A 3WNLA 1E5JA 2DPEA 1I1XA 3WL1A 3FAWA 4W5ZA 1UR0A 3VIHA 2XFFA 4GIAA 1HJVA 1JXKA 3OGVA 1BSIA 1XH2A 1KBKA 5E0CA 5A8PA 1W9XA 4J27A 1KB3A 4P7NA 1KQZA 1LL7A 2CITA 2NT0A 5A1AA 4U5IA 3ZIZA 1GVIA 2EJ1A 2GJRA 2X2YA 3BAWA 3NUKA 4KGJA 4U2ZA 3BGAA 4EKJA 2DIEA 1JZ7A 1XYZA 1EQPA 1V3LA 4UR9A 2CKSA 3MUAA 4IPNB 3T0BA 1W2PA 1PZ2A 3ARWA 3RCNA 1E6NA 1V02A 4PMQA 3RIKA 2ZXDA 1QBAA 3WDRA 4JKLA 1M04A 2IUZA 2YBTA 3ARPA 1ZJBA 1H11A 3IJ8A 2VUYA 1OWQA 1VJSA 1E72M 2Q8XA 1UKSA 4CU8A 3AZTA 4P7RA 1E70M 1ITXA 1FP9A 4HA1A 1LF1A 3N04A 3L2LA 4HA3A 4J7RA 5DMYA 1F4HA 2OWWA 1BLIA 4GO9A 2E9BA 3N9KA 4M56A 4PMRA 1DEDA 3AXHA 2J7HA 5FD0A 4Q7NA 3MKKA 5IFPA 4HTYA 3TTOA 2ZUMA 1E6QM 4PMYA 2D0GA 3NJ3A 4QAWA 4NI3A 2ZX9A 4KMQA 2BY1A 3WH7A 3VD5A 1JD7A 1UWRA 4CCDA 1EIBA 5D9OA 3CGTA 4BQ2A 2E4TA 2WVTA 1BGAA 1ZBWA 1TMQA 1H0IA 1MQPA 3OLIA 1LQ0A 1WE5A 4U3AA 1DTUA 2BS9A 4E8DA 3UESA 4PN2A 5A6MA 5CPQA 1CENA 3AIEA 3PZQA 2J74A 3FY1A 3PHAA 3CZEA 1XCWA 2QV4A 5HOSA 3M6DA 3BAXA 1OD8A 1K9TA 4AD2A 3MV01 2DT2A 2V38A 2Y2WA 3VO0A 1GONA 1JAKA 1MXDA 3ARSA 1E0VA 1GOMA 5DT7A 1IZJA 2J77A 3KE0A 1FHDA 5ABGA 2WWCA 3F4VA 1UQYA 1QNSA 1E4IA 2ZICA 1BTCA 3AROA 4KRUA 5A2AA 1BG4A 3RM9A 1W9UA 2ZOXA 1NQ6A 3WSUA 1R87A 3RM8A 2DT1A 3SUTA 3FHAA 1SMDA 2DH2A 3WDHA 2OYKA 1UD4A 5I2UA 1K9FA 1EOKA 4MB5A 1HXJA 4W84A 3U57A 3WMCA 3TTSA 2DDXA 1XSJA 2D24A 4M80A 5KEZA 2PI6A 4MAZA 3WEZA 3VIOA 1UOKA 4GQQA 1GVYA 4HMDA 1V6VA 2C7FA 4FLOA 2XGIA 1WDRA 4UOQA 1W91A 2BY2A 3A47A 1QOXA 3GM8A 2XWDA 1VEMA 1C91A 2Y5EA 2B31A 1WZLA 1JYNA 3AIQA 1JZ2A 4UOZA 3RO8A 3GNOA 4BZYA 1CGTA 4GI8A 2YLAA 1H49A 4CGTA 3WQVA 4V27A 5CQ1A 1OSEA 2XGBA 5AY7A 2EXOA 4F66A 2YBUA 3T2PA 1WB0A 2W4XA 2XFYA 1E4MM 3WEMA 4XV0A 3MSDA 3TP4A 4WIWA 3VNYA 3BXWA 4H41A 4GO8A 1SYTA 2WC3A 5D8ZA 1UQZA 3GH7A 2V5CA 5DO8A 2VX6A 3WF3A 5A6AA 4PYSA 3CHCA 2YL9A 3SCRA 4PUEA 1HP4A 4AZ7A 1W2VA 1DWIM 1XSIA 3B8SA 1EO7A 4HOZA 2YL5A 2Y24A 3UEQA 4J28A 1KWKA 1DWGM 1BAGA 2WBKA 3AISA 3SUSA 5I78A 4WF7A 3AXXA 4CVUA 4J3VA 4M1RA 2EPOA 4NRRA 2YJQA 3PZNA 5M03A 1BVNP 1J11A 2YL6A 4H2CA 3SCVA 4EAMA 4F9JA 2VCCA 4JFUA 1VFMA 1RP8A 4W86A 2YLLA 1NWRA 2VCBA 4PMUA 1EDTA 2UWFA 5AC4A 5CJ5A 4BF7A 1W9PA 3L4WA 3AHYA 1E73M 2QPUA 3TOPA 2FGLA 3DECA 1GJUA 5JBFA 4QLKA 1YHTA 3WQ6A 1TE1A 3CTTA 4DWSC 3VINA 1UYQA 3B9DA 3ARXA 5FL0A 5FOOA 1AQ0A 2QLYA 1CWYA 3BSHA 3KL5A 3L4UA 3JUGA 3WQWA 2E8YA 3SCSA 1O6IA 1KBBA 1V03A 1FH8A 2YKKA 4CD5A 2WAGA 3S2CA 1UZ4A 2WHLA 3OZOA 5AYIA 4S3JA 3ZT6A 3AZSA 1GOOA 4DM1A 5CZKA 3B9AA 1KGXA 4HU8A 1OT1A 1G0CA 1LWJA 3IANA 5I79A 4ZE4A 3I3DA 1DWHM 5CGMA 3AMCA 1LL4A 1WNOA 1E55A 4R5EA 2BVDA 4JKKA 4JIEA 4DWSB 4AMCA 5A95A 5A6KA 5I24A 2ZX8A 3UR7A 1BFNA 2PWFA 1PEZA 2XPKA 2YDRA 3VM7A 3KL3A 1E9LA 5GNXA 2X0HA 3BLPX 1UH2A 5FKYA 4D1JA 6A3HA 2W63A 4IISA 5ABHA 2V5DA 1ODUA 4Y7EA 1ISXA 2DSWA 3WEOA 1AQHA 3SCUA 2XVLA 3ARUA 1VB9A 3K46A 3VDHA 2EPMX 4UFLA 3VMNA 2PWHA 1QPKA 3WD0A 4UFMA 3LPOA 2J62A 3EBVA 3BAJA 1QW9A 3SEPA 3VMPA 3PZGA 5I23A 1V3JA 4QFUA 4GXPA 3VKKA 1HIZA 1X1NA 5JIPA 3AFBA 4MB1A 4UTFA 3MUY1 1TR1A 3AJ7A 3PZTA 4B3KA 3DYOA 4LYRA 4JFVA 4MAVA 2PWGA 2GDUA 1HVQA 3ALGA 1HP5A 4W93A 3WN6A 3SCQA 4AD5A 3D3AA 4ACZA 3NSXA 3T2OA 6CGTA 4RE3A 3WDIA 1UHVA 4NF7A 2E8ZA 4JKMA 3RILA 3CUHA 2GSJA 3CHDA 3MSGA 1MFUA 1H3GA 3WF4A 3IJ7A 1XH0A 1VF8A 7CGTA 2BXYA 5FL1A 3PN8A 5D9PA 3WY1A 2WM0A 3RDKA 1WDSA 4PBGA 1UD8A 1J0IA 3GNRA 3U7BA 8A3HA 2XM1A 1W3LA 4JHOA 3VD9A 4A3HA 1BG9A 1XD0A 3AMLA 3WD1A 1E6SM 1MYRA 1Q4NX 2OWCA 3SUWA 1CXEA 4WSKA 3CHFA 1OBAA 4X0NA 2J7FA 3VDBA 3MUIA 4B15A 3EMCA 4UFIA 4URIA 1MQQA 1G9HA 3T09A 1EDQA 2G3MA 1ESWA 3W82A 2G4FA 4WKHA 1TA3B 4JFWA 4W7UA 4CVWA 4HZ6A 1UR2A 5C71A 1JG9A 4AIOA 4D72A 2HISA 2XVPA 4D6HA 5JH8A 1GUVA 3ZSSA 1W3HA 4RE2A 4ACZB 1B31A 1NWSA 1WKYA 4D6CA 1DWAM 2XYLA 3K8KA 4AZCA 5DEZA 3APGA 5ABEA 4AEFA 1LJYA 2WBGA 1QHPA 4V2XA 1QNRA 4Z2LA 1FH7A 3K4AA 1JI1A 2OSWA 2DSKA 5CPTA 4B9ZA 5D4YA 4AD4A 3W4RA 2W91A 4QLJA 2QHAA 5CPSA 1VEOA 4AY1A 1E4LA 4GZEA 2O9TA 4FMVA 4GZIA 4MDOA 2XTKA 3CZLA 2ZXAA 2CYGA 2AOSA 2CKRA 3AHTA 1EGZA 2OYLA 1J0JA 4NSBA 3QHOA 2CESA 4CN1A 3VD4A 1KXTA 2XVGA 3AOFA 2WSKA 2QMKA 1HVXA 2VURA 2DQXA 3AIBA 4CCCA 1UR4A 4X0VA 4N42A 2PWDA 7A3HA 1J9YA 1QI5A 3PZVA 1CIUA 3TONA 5EB8A 3AHVA 4MDPA 3K8MA 1MFVA 3AICA 2WHMA 1I1WA 2VX5A 1K6AA 3BH4A 5ABFA 1U2YA 4N0RA 3AS0A 1EH9A 1E43A 1ZBVA 1VBUA 1VRXA 4WKAA 4DM2A 2VOTA 4AZCB 3N1AA 2FHFA 4AEEA 4AD0A 4MNJA 1G94A 2PC8A 2WKLA 3AIUA 4AIUA 1D3CA 3GXMA 2VZVA 1HL9A 4HOXA 2QF8A 2X8RA 1JZ5A 2J7DA 4W89A 3WENA 2VRQA 5CG0A 4MB3A 1JI2A 3GBEA 3DYPA 4GQRA 2WLYA 1BQCA 1WZKA 1GOWA 4F9DA 3DHPA 4AZ5A 1PIFA 2IXUA 2QPSA 3GZAA 5JBEA 1UG6A 2UY2A 3ZJ6A 3ARQA 4MJ4A 1VEPA 3RMEA 4ML4A 5IHRA 4D6DA 1JZ4A 3CUJA 1HJXA 1H5VA 4PSRA 3BC9A 2O92A 1QW8A 2WMHA 1UH3A 2GJXA 2PB1A 2Z1SA 2VZSA 4QCFA 1OGBA 3VMOA 3ZT7A 1CLVA 1ZJAA 1CXKA 3M7SA 4XZWA 2WZHA 3WD3A 4CD6A 5A3HA 2GFTA 2WC7A 2D0FA 3VGFA 2YA0A 4EANA 1V6YA 1QNOA 1V3MA 2WVSA 1JZ8A 1US2A 4J3SA 1GQKA 4GINA 3AS1A 1PZ3A 3LPGA 2WYSA 1H4PA 1JXJA 4OIFA 3II1A 1E4NA 4MTVA 1V0KA 3I3BA 4W87A 1ZB5A 1OD0A 1WZAA 3W25A 4H04A 3BAYA 1UR1A 1JIBA 2PF0A 3VDCA 2XVNA 4CCEA 1GCYA 1NOWA 3OB8A 2YA1A 1V08A 4RE4A 2WC4A 1UA3A 5E0FA 3W37A 4YHEA 3VNZA 3UG5A 5A6LA 1XD1A 3LMYA 4D6FA 3J7HA 3AYSA 4W5UA 1C92A 3GH4A 3G6MA 2J7GA 1VAHA 3THDA 2CERA 2EPKX 1XCXA 3ARZA 3TTQA 2CBIA 2GJXB 1ZL1A 4DUVA 3WNKA 3KWXA 1XC6A 1UD3A 3OLDA 5AYBA 2BXZA 4H7VA 2J8GA 1CTNA 4LPCA 2CEQA 3WFLA 4EE9A 4Z2GA 1B9ZA 1Q6FA 2JF6A 2CPUA 2VRJA 3UETA 3F5LA 2XJ7A 5AC5A 3MO4A 4H8UA 3NDYA 3WDQA 5C8BB 3CO4A 1OGSA 3GXFA 3VTRA 4P7LA 2FHBA 3AMDA 3GXIA 2XG9A 1JD9A 2OWXA 4CU7A 1LLOA 3ECQA 5CSUA 1LL6A 4Z2IA 5D8WA 3MV11 3ZO9A 3GDBA 4KH2A 5D9NA 2J78A 1B2YA 3E1F1 3WNMA 4QDMA 3A4AA 1AVAA 3D5HA 4PUDA 3WD4A 2E9MA 1C7TA 1I75A 2RGLA 4R27A 4W88A 2Z1KA 2J4GA 4Z2JA 2CIPA 3CH9A 5HNNA 2DEPA 1JNEA 2UY5A 1JYVA 4L4OA 5C70A 4CN6A 2WVVA 3ZJ8A 2YDQA 1F4AA 2XHYA 4MPKA 1ISZA 2AMGA 1OB0A 4X9YA 1JF6A 3G6LA 2ZXQA 1XSKA 2A3HA 1W1VA 5I6SA 1ZBCA 4K68A 3OBAA 1BYDA 1CDGA 2ZUSA 1NWTA 1O7AA 2A3EA 2JEPA 2WANA 1E0XA 5DF0A 2XFRA 5D9MA 5A6BD 4AZ6A 4HA4A 4AZHA 2DT0A 2JE8A 1GZJA 3NCOA 1ISWA 5A6JA 1BHGA 3ZR5A 1C8QA 3QHMA 1CBGA 3W27A 3VIMA 3RPMA 2F61A 1MW1A 1IT0A 5DT5A 2VI0A 1CGWA 1R8LA 2PBGA 4FLSA 5HBFA 1QI0A 3I3EA 2D22A 1QHOA 4W7VA 3UCQA 1XHGA 4TVDA 3WF1A 5F7UA 1HN1A 1CXIA 3IAPA 2CETA 4BQ5A 4JFSA 2ZUWA 3M46A 5CLTA 3WH6A 3W81A 2EPNA 3BAIA 1J0YA 1QI2A 3HJEA 3VD7A 3LPPA 4D1IA 2O9OA 2XSBA 1HKJA 2JALA 5TD4A 1BF2A 4C7FA 2VZUA 2CBJA 4ZEPA 1GW1A 3UG4A 2OYMA 3SIMA 4F79A 2D1ZA 2DH3A 4GI9A 4V28A 5M17A 3WELA 1FP8A 3SURA 3IJ9A 1MW3A 4UQDA 1OIFA 2CHOA 4UOJA 2VNCA 1R7AA 1P6WA 6TAAA 1MQRA 1XV8A 2BVYA 3SCPA 1XRVA 3ALFA 1W1PA 4UQAA 4JAWA 2WCGA 3OIHA 3BCFA 2ZIDA 3WNNA 3ARTA 1V0NA 1C3FA 3VGEA 3CIVA 1HJWA 4L4PA 2YA2A 1PJ9A 1CGUA 1NOUA 1JYXA 3CMJA 4MB4A 3OGRA 1E15A 1E3XA 5E70A 3OLEA 3ARYA 5CXPA 1UD5A 2OSYA 3PZIA 2BFGA 5BYWA 3VOCA 4XZBA 2AAAA 2OLHA 3EDEA 1W3KA 1XH1A 4U5KA 4XX6A 3CZGA 4AZBA 2YDSA 1GNXA 2ZUTA 1EHNA 1VENA 2BVTA 2XM2A 3AS3A 4HMCA 3NYDA 3VUPA 4TXEA 4HPHA 3NSMA 3MMDA 4ZXOA 2WLZA 2WMKA 1UR9A 5DFAA 1CLXA 4FLQA 1X6LA 2NW0A 2YOCA 2A3BA 2D20A 3SUVA 5A2CA 3UR8A 4E8CA 5A94A 4HPGA 3PZ9A 1CXHA 4JL2A 1KCKA 3VVGA 4WLCA 1SR0A 1NOFA 4A3YA 5BXSA 1W3JA 2BY0A 3THCA 2WZEA 3VM5A 3OA5A 3FNDA 1CECA 1UWTA 3DYMA 3WH8A 3POCA 3CPUA 1PX4A 1FA2A 1RD6A 1TZ7A 1IZKA 4HP5A 1E6ZA 3WL0A 1MW2A 3K1DA 2X05A 4JCLA 3KL0A 1EO5A 2W62A 3TA9A 5BXTA 5JUVA 2VQTA 2J8FA 2QMJA 3EYPA 4CN4A 4CKQA 3PTMA 1GHRA 3WQ5A 4F8XA 4AZGA 2PWEA 3HN3A 4JCMA 5A6SA 1B3VA 1H1NA 4UZUA 4DUXA 3VIFA 1W1YA 2WB5A 2ZWZA 4KGLA 4B9YA 2X09A 1UH4A 1JZ6A 5A69A 3B9EA 1VBRA 1NH6A 5EFFA 2DSUA 1CYGA 3FXYA 2EPLX 3VDAA 3MANA 4BS0A 3NDZA 2XVKA 1KXVA 5CGTA 5GQBA 2ESCA 2J7EA 2F8QA 1HL8A 1LWHA 3AQUA 3L4XA 3AS2A 1V3IA 4TVCA 1HJSA 1ZS2A 1SFSA 3DHUA 3AYRA 5JIWA 1DWFM 4E4PA 2NSXA 4IPLA 2VX7A 2CBVA 1PPIA 1NM9A 4TOQA 1S46A 3OGSA 3A3HA 1AMYA 4AD1A 4AC1X 1G5AA 4M81A 1FFQA 3QOKA 4MJ2A 1UKTA 4MNMA 3WFZA 3RM4A 4AWEA 2BHYA 3W28A 3IK2A 1EA9C 1GHSA 1UKPA 1NWUA 3VU2A 1RP9A 2W67A 1E3ZA 2WCAA 1GJWA 3U5YA 5EFDA 1JAEA 1MWOA 1WZMA 1K9DA 3L4TA 2G3NA 1V02E 1W9DM 4TUFA 1UD6A 2ZX5A 1E40A 3CUFA 3S6TA 2VMFA 1R85A 2J7CA 4HMEA 1XGZA 3WMSA 2J75A 1JDCA 1XYFA 3PZMA 2DIJA 3MU7A 4D6JA 1JDAA 4UZSA 1E6PA 5GNYA 3N15A 3VX1A 2JIWA 3WMBA 5FCZA 1KXQA 4BQ3A 1OGGA 3L4YA 3ZJ7A 2JFEX 3GYCA 4WJXA 5LYRA 3BMWA 5E6YA 3FW6A 3ZSTA 4AIEA 1JNDA 4JL1A 2VR5A 5BXPA 5E9AA 5E09A 4QP0A 1QBBA 4UQ9A 2GDVA 7TAAA 4JFTA 1VIWA 3QOMA 5LA1A 3OG2A 1EQCA 3WDPP 3HMCA 2VVSA 2VCAA 5IDIA 1D7FA 1TVPA 3VIGA 4ATLA 1CXFA 3O9NA 2YL8A 4ZXLA 5GPRA 4Q22A 1EOMA 1OM0A 1MW0A 4E2OA 4CD4A 1HX0A 1RPKA 3UG3A 3SCNA 4PTVA 2VRKA 2C8NA 3EDFA 3ZOAA 4AW7A 2X1IA 2GUYA 2JEQA 1Q6DA 1GOQA 4FLRA 1PIGA 1HT6A 1U33A 1ITCA
chains in the Genus database with same CATH superfamily
2XZ7A 1L0PA 3GG8A 3FV9A 3LCFA 1HNYA 3GD6A 4LVFA 2D23A 3IIOA 1H61A 3QKEA 4O17A 2ZUUA 1ZK6A 4PEEA 2DGAA 4IX2A 1GKPA 4DB7A 3FIGA 2P3EA 4TW8A 1U79A 4O50A 3A9IA 5HWNA 2PV3A 4M82A 3CQHA 4QJ4B 4KWSA 5G5IA 4H2HA 1UWUA 3BG3A 1U1JA 1JRBA 4EK7A 4PTMA 5HPCA 1Y0OA 3ARRA 3QV7A 4JYEA 4K7YA 1W1A1 5E9XA 2P50A 3GTNA 1Q6IA 3QQ0A 2RDUA 1XLJA 4BA0A 4L64A 3WH5A 5A8NA 1Y8BA 3LLDA 4MJZA 3FAXA 1SGJA 1WKDA 4NHVA 3SCWA 3LNPA 1YQ2A 8CGTA 1W56A 3WK3A 2KZHA 2NT1A 1VFFA 1RJQA 1UWIA 4QEHA 2F6KA 2W92A 4ECLA 4R34A 4B5SA 1P1MA 1PTGA 2FH6A 2DVTA 4IPJA 3AO0A 2VTFA 3DFPA 2XGZA 4GYKA 3LPFA 2PP3A 4MY8A 1I8JA 3DKLA 4L4LA 2BTMA 2CZDA 4PTWA 4LY4A 3PB2A 4UQCA 3UWUA 4G7EB 1JFXA 5D2YA 5H6HA 4XIMA 1IV8A 1A4LA 4R7JA 2DZPA 3WF2A 2XIQA 4A8RA 1SW3A 4LQ1A 4RE0A 2UY3A 1R7OA 2D0HA 4X9SA 1OJXA 1TFVA 2O7QA 3TIMA 3ORWA 3F4NA 2GPTA 1WQ5A 1KFEA 2EPHA 1J18A 4M6UA 5A6BA 1ZP3A 2JKAA 3E6EA 3BCDA 5BXRA 4QT3A 2D3NA 3TWAA 2G41A 3PP7A 4IM4A 5BRPA 1OINA 4IGNA 4CQDA 4QE4A 1Q2RA 1DIEA 3DDMA 4AYSA 4DUOA 3G3MA 4YHGA 2YGYA 4BFAA 1P5BA 3T0DA 2HV5A 3RLHA 4JBRA 5BNKA 2PZNA 4RZBA 2VM8A 2I7GA 1F7BA 1KCLA 1ME9A 1PTDA 4LX4A 3MCOA 1VHCA 2PPGA 3TKFA 6ALDA 1YBQA 2C71A 3ABQA 1SW7A 3CZJA 1E9ZB 3WDJA 4UBPC 4GZJA 1AW1A 4P5UA 3KDNA 3KBVA 3MMWA 2QJIA 1J10A 1WAWA 3LGEA 2J9XA 2Y4SA 4P8UA 4AF0A 2BODX 3UG8A 3G1DA 4PCTA 1TJ2A 3QF0A 2V0TA 4HZ7A 1EGMA 4ACYA 1PX3A 4RNFA 3M7WA 4XUYA 4QDWA 5I0DA 3O6AA 5JVLA 3U2CA 4XB3A 4YN5A 3EX4A 1FOBA 1CPUA 3N2OA 3C86A 2WVVB 1J0ZA 3QM3A 1Z9AA 4G8TA 2YCJA 3BMVA 1YE4A 4NI8A 2ZVIA 3E38A 4GOAA 4GI4A 3O5RA 1E6RA 3GHTA 4W8BA 3V75A 3HO8A 4U86A 2WMJA 4ODPA 4PTXA 5HMEA 4FI4A 2VR4A 4L1WA 1TWZA 1W1TA 3PUEA 4ATDA 4C6QA 1DJXA 2X42A 3I4EA 2ZBTA 4MM1A 4CD8A 2FTYA 3LNMA 4H6RA 4YVPA 3VKJA 1DP0A 2ISDA 3BLOA 3H2AA 4KRTA 5LNUA 2HK0A 4ICCX 4B5TA 2IPWA 4K3ZA 3DBPA 2VZOA 4G2DA 1W9BM 1OT2A 4JTCA 3W6LA 4WY0B 1GORA 3M0ZA 1WA3A 3GU1A 1UW9A 1J79A 4MNKA 3SUUA 3EOOA 4DF1A 1QNPA 3GG7A 1B90A 1KGUA 3QR3A 4MY9A 4YTUA 3G18A 3GAYA 3KEHA 4XTDA 3S3GA 2D2OA 1NP0A 1EDGA 1LLZA 3LU2A 3ATZA 5HTGA 3I4KA 2GK1A 2PODA 1JDDA 1J01A 1Z48A 4BQ4A 1A80A 4C1NB 3UERA 5D2XA 2QCHA 2FTPA 5IBXC 3GH5A 1GOKA 4JOMA 2F2HA 3UZ5A 2W5FA 3WD2A 4TTUA 2LPVA 1DVJA 4W8AA 4ZOEA 1EHAA 3O5IA 4EXBA 4PMZA 1Q6LA 4MADA 2D2HA 4LGXA 1J6PA 1MXGA 4M29A 1T5AA 3MUCA 1DIDA 4ZENA 4LAWA 4ZO8A 4KCVA 3AZRA 3U6WA 3E3HA 4K1WA 1ZZMA 2E3ZA 2EBNA 3H26A 2CZFA 5HWMA 4N2YA 4I7VA 3DC0A 2GVJA 2QAFA 2M08A 2E40A 2CXGA 3QHNA 5T9CE 4BF9A 1J0HA 4LF1A 4M24A 1GQIA 3L67A 3LA4A 4C7GA 1Z7AA 2YYUA 3L66A 2ZWYA 2JF7A 1RA5A 2A3AA 1WKFA 3WFAA 4KEVA 1UWQA 2ZRZA 3AIRA 4HJWA 5DQPA 3PPHA 3ZFHA 4CCZA 1E0WA 1GQLA 3SSZA 3RAOA 4O12A 5C2XA 1JUEA 1B30A 1ISVA 1V3KA 1Q13A 3G1YA 3A4JA 5REQA 1PXGA 3KCJA 1PYFA 2Y7EA 4JEQA 1V3HA 1C93A 4QIBA 4RZ4A 2PTXA 3GXDA 4DZ2A 1V8EA 1M53A 1QXLA 3ZT5A 1B3ZA 1RBLA 3H23A 1GEHA 3AJXA 3T6CA 1PX8A 4PMVA 3I7QA 1D7HA 2GJPA 1F07A 5LIYX 3TN6A 1JCTA 4DAIA 1O5XA 3QGAC 2QIIA 3W26A 3CHEA 4NZ1A 3NQBA 2PD9A 2VWSA 1TO3A 1Q6EA 4M7TA 3V36A 4DZHA 3V5FA 4Q4OA 3MZ2A 1GJPA 1S2TA 3KXQA 4P8WA 3VIJA 5D2TA 1HJUA 4GY1A 1R2TA 3MMUA 4I9TA 3NZRA 1H09A 3URQA 4CUCA 3MB9A 4P7QA 3P84A 3R1ZA 4WX2A 1MZHA 1M7XA 1OC6A 1PAMA 4D71A 4HA0A 1EEXA 5FIPA 2BY3A 3VGBA 1H2JA 4MKVA 2O9PA 1F9CA 2FIQA 3WJXA 4L7ZA 4AX6A 1V79A 3WUGA 3HGSA 3HQ1A 4KBXA 3CQKA 3ID7A 3GTYX 4TV5A 3V7PA 3CQJA 1QR7A 4OUIA 3FYOA 5EMMA 3HPAA 3THUA 4WK9A 3VNLA 3CZKA 1F61A 2FFIA 2HTMA 4MG4A 3DIPA 3PG8A 4AVOA 3BURA 3POHA 4IG2B 1E5JA 3WYZA 1MDRA 4W5ZA 5C5YA 3SGGA 2XFFA 1HJVA 1JXKA 5LXEA 1KBKA 3WLKX 3H7VA 2CU0A 4H9YA 4CNNA 1M7OA 1W9XA 2R1KA 3HM7A 4DNMA 1P0KA 3I10A 1RZMA 1LL7A 3W01A 4PFMA 2HDJA 3E9AA 4U5IA 4KCWA 3OOBA 4G9PA 1ZAJA 2E6YA 2X2YA 3BAWA 3NL5A 4ZTXA 3BGAA 4EKJA 4K8EA 7ODCA 4IPNB 1J5SA 4O8AA 1W2PA 1PZ2A 1UUOA 1E6NA 1V02A 5LKYA 4YWIA 4LBRA 3H4GA 4MFDA 3WLQA 2IUZA 3LBOA 3BARA 1H11A 4DRPA 3IKDA 4FXRA 1RLDA 2EG6A 2VXNA 1UKSA 2PDMA 1ITXA 3UNTA 3D46A 3N04A 4MSPA 3L2LA 2OWWA 1BLIA 2AQVA 4PMRA 1DEDA 4ODQA 3KZ7A 4HSNA 5IFPA 4HTYA 3GG1A 4PMYA 3NJ3A 1FKLA 3TC7A 2X2GA 3QH2A 3BW2A 5HUPA 3WH7A 3VD5A 3TMQA 4K39A 4H9XA 4JTKA 4CCDA 3I6RA 4ORMA 5AC7A 5FAGA 3CGTA 3NPXA 4UMBA 1AD4A 2E4TA 2OLAA 2WVTA 5CH9A 4JYDA 1YEYA 1LT7A 5CC6A 2BP1A 1DTUA 5EMUA 2ZQUA 2RUCA 3MDUA 4N9BA 3KWSA 1AH4A 3L23A 2QCDB 3UESA 4PN2A 4AYGA 2IKIA 3T0TA 2GUUA 2D69A 4H9VA 3E0IA 1Q6HA 1K9TA 1BL4A 3MV01 2Y2WA 1Q7MA 3F03K 3C4UA 4ODNA 1W31A 3C8NA 4GIRA 3S9ZA 5C55A 1MXDA 1BWLA 1GOMA 4OU1A 4KF1A 3KE0A 2WWCA 4TV6A 1R3RA 1ZJIA 3VE9A 1EPVA 1QNSA 1DORA 1BTCA 3DI1A 5A2AA 1TV5A 4GCAA 4IFOA 5CJMA 5C0QA 3UXDA 3KTXA 1UZDA 3AALA 2DT1A 1C8VA 4DELA 3O6CA 1PCKA 1EOKA 4MB5A 1NAL1 4O1FA 4W84A 2QCGA 2DDXA 4EXQA 1EJ7L 4XBJA 3WEZA 1RJPA 1UOKA 3CEUA 1RCXB 3KAFA 3OQEA 3GXTA 1V6VA 4UTUA 4IIEA 3RHGA 5I02A 1XLAA 3IUIA 2XWDA 3EWDA 1C91A 1OFDA 4IGMA 3AIQA 3SW6A 4UOZA 2VFHA 3W7IA 4OT7A 3HZ3A 2X41A 4MKSA 1B6CA 2GJNA 4CGTA 2TSYA 3WQVA 2AL2A 5U7SA 2YBUA 2JK2A 5HNTA 4JQ2A 1E4MM 4FN2A 3MSDA 3VC5A 4RNHA 1S5TA 4WIWA 3BXWA 1SYTA 4E6MA 3GH7A 4Z42C 4JTFA 2VX6A 4PYSA 4WD0A 3RR1A 4Q8UA 4PCNA 4AZ7A 1S39A 1W2VA 4M3PA 2WV8A 1EO7A 2PCEA 4PTNA 2PTZA 1DWGM 1AG1O 3SUSA 4ZCWA 3TAKA 2YXOA 3UXAA 3STFA 3P93A 3AXXA 1TPVA 3TFXA 4TW7A 1XM3A 4Y9MA 4J3VA 1L6FA 2CHRA 5LHEA 2YL6A 3KS5A 3FKRA 3QFWA 4F9JA 3RX3A 5E5CA 3MVTA 1J6OA 4W86A 5FEPA 3VZZA 3MHGA 1A0EA 4IMDA 2JGYA 4GQGA 5AC4A 1YXYA 3QZ6A 3NWRA 3NL3A 2FGLA 4AX7A 3NQMA 5JBFA 1I2OA 3FYPA 1QO5A 4DWSC 1XYCA 3B9DA 2Q8ZA 5FL0A 4NIRA 3FAPA 1AJ2A 3JUGA 3N19B 5AYYA 1LRNA 4WCJA 3SCSA 4QZVB 3NOYA 2G3FA 2E6AA 1Q85A 1MRAA 1W3NA 2KO7A 3GR4A 2WHLA 4HHMA 3OZOA 4S3JA 3GHUA 5D09A 5CZKA 1OFBA 3N6HA 1P48A 1KKRA 2E1DA 3FVDA 1R9ZA 3CQIA 4O0KA 3PNZA 5H8PA 2OO6A 2PGRA 2BVDA 4JKKA 4JIEA 4DWSB 5A6KA 5I24A 3N2TA 3F7JA 3GG0A 2QGYA 4ZBCA 1BFNA 4FS9A 1PCWA 1PEZA 4ITZA 2PV1A 3MP3A 1HZYA 4LUSA 3CJPA 2NUWA 4EP8C 5GNXA 1E0TA 5L9FA 3BLPX 1NVMA 4R3UA 2BLEA 2W63A 4IISA 3MA8A 1ODUA 4H6EA 2VC6A 3E5PA 1E9IA 4RJEA 3WEOA 4H7ZA 1LQAA 3BJTA 3LENA 2FVLA 2P76A 3AYVA 1R46A 1Q6QA 3VMNA 1M65A 1QTWA 1QPKA 4RDVA 4UFMA 3LPOA 5D2WA 1NY1A 3T4WA 1XG3A 2FPVA 3BAJA 1QW9A 3FYYA 2PMQA 3SEPA 4U10A 1V3JA 4GXPA 3VKKA 1N55A 4KKXA 3MUY1 3SY8A 4IQEA 1FUYA 3PZTA 5I09A 1KV5A 4LYRA 1ALDA 2CWXA 2PAJA 1EZ2A 4PBEA 3NSXA 5IM51 2QVNA 3V16A 3VNKA 3W85A 4GG9A 2ON3A 2V2CA 4NF7A 4JKMA 3UR5A 3CHDA 4NT0A 4ZS6A 3WF4A 1VF8A 2BXYA 4A6GA 2WM0A 1GYMA 3SY1A 2BGSA 4Y9OA 3RDKA 1UD8A 1J0IA 1MDLA 1UZHA 3P14A 2XM1A 4DYEA 3DG7A 4US5A 1F3EA 1C29A 4GH3A 1E6SM 3BUVA 1RQHA 2OWCA 1D9EA 3UT0A 1CXEA 4H01A 1OBAA 5C9ZA 1PB0A 1XLIA 4QTGA 2CLPA 4URIA 2PDJA 3BLDA 4ES4A 2ALRA 1P0NA 4DRJA 1ESWA 4JTRA 4JQ1A 4DXXA 2E28A 3O6YX 1S5NA 3HPZA 4HZ6A 3IGXA 1JG9A 2HISA 2QCNA 2O7SA 2XVPA 3D47A 5JH8A 5EKYA 4RE2A 3LCGA 1DWAM 3TCEA 2QV5A 2XYLA 4EX4A 3M0VA 3HF3A 5DEZA 3P6LA 3RF9A 3BPWA 3H2CA 1KM4A 5JH2A 4DY1A 4QG8A 1E44A 1TIMA 1QNRA 4Z2LA 1YPXA 1F5ZA 4H3DA 4PR4A 1JI1A 5EGRA 3M47A 4WVXA 1V5XA 1IXNA 3FEQA 3FXGA 4HPXA 1W26A 3W4RA 5FJOA 3NQ7A 1VEOA 1E4LA 1IF2A 4JS3A 1A0CA 3FX4A 1PWLA 4LU0A 2DUZA 2OCZA 3B0VC 2CYGA 3RU8X 1F73A 3EX6A 2OYLA 2CESA 3VD4A 2WSKA 4ALDA 4XISA 1ZAIA 3U9IA 3BZJA 3AIBA 1TREA 1J9YA 2Y6ZA 3ONBA 1YKWA 3IVSA 5CPLA 3TONA 2X16A 4IMGA 1K6AA 3BH4A 2ZQTA 1U2YA 1ZBVA 1I2PA 5G1YA 3N1AA 4AD0A 2RURA 4AIUA 3V0UA 4KW2A 4PB5A 1ZFJA 4O57A 4KCUA 4HOXA 3GVQA 4IMFA 3FEMA 2WNZA 1A5SA 4W89A 3KRBA 4FXFA 3ZLHA 3DYPA 5T9BG 1WZKA 1GOWA 4GISA 3PPCA 4AZ5A 3W00A 3GZAA 2DJLA 3LK6A 1V93A 3E0WA 2UY2A 2XFWA 3ZJ6A 3DFNA 3ARQA 4MJ4A 1XWYA 1XXXA 4D6DA 3CUJA 3VAWA 3SRKA 3ZR4A 3P5ZA 2C0AA 1ROTA 3I7SA 1UH3A 4F0RA 3P8IA 3O5FA 1O4UA 3AUJA 1MUMA 2B0MA 1OGBA 1DPMA 3PC0A 1TUFA 1CXKA 3M7SA 2WZHA 6XIAA 2AGKA 1EP1A 4C6CA 3SZ8A 1FKBA 2WC7A 4EPDC 1JCHB 1V3MA 2WVSA 2Z7GA 1US2A 4J3SA 1I45A 4M0XA 4E2VA 3GHSA 3WK2A 4QM1A 5FF0A 4IT4A 3L5MA 1EP2A 1JXJA 1RVGA 3LXBA 3KAIA 4OIFA 1E4NA 1P0BA 4GZ7A 1OD0A 3W25A 3BAYA 1L8PA 1JIBA 3IIZA 2PF0A 4GIEA 3VDCA 2XVNA 3IJLA 4J5NA 3LTYA 1W1ZA 4XZMX 4CCEA 2F84A 1N8WA 1N8FA 1NOWA 3NURA 1FAPA 2WJFA 3VNZA 3PWAA 1XF0A 3L9CA 3LV5A 4D6FA 3AYSA 4US6A 5SWUA 2F4EA 4TW6A 2H9AA 4XTIA 3GH4A 3V0TA 2J7GA 2F2DA 3AWOA 3O5GA 3P67A 2GJXB 4IIBA 4HNUA 1XC6A 3W1TA 3MPGA 1DJHA 1JNTA 2BXZA 4H7VA 4L4MA 3CB8A 3T81A 1FWGC 4LPCA 4MVAA 1FWSA 3TC3A 3UBPC 1MRQA 4S2CA 1OVDA 2GWGA 3UETA 5AC5A 4IXXA 3N3MA 3T55A 3NDYA 3W7OA 2PZ0A 4A2SA 3TEVA 3W2MA 2ALDA 3LSCA 1OGSA 4P7LA 3P8JA 4IF2A 1QPQA 4B91A 1JD9A 3BV4A 4FNQA 2DG9A 2DZTA 3W1XA 2OX4A 4OWGA 4FXSA 4ZFCA 5CSUA 2A2IA 1LL6A 5D8WA 4DBSA 4EWJA 4DPPA 2QPXA 5AHIA 1B2YA 1OQFA 3VKDA 3QYQA 3WNMA 5AYXA 1JJKA 1AVAA 3D5HA 5TQLA 3WD4A 4R85A 2TPSA 5HNNA 1IX5A 4LUYA 5DCEA 1JNEA 2KGJA 4V1YA 3S9IA 3QLLA 2MNTA 3EB2A 3W7KA 1DE6A 3MI2A 3C3UA 3QC3A 4IT6A 2WVVA 3VZXA 1EYMA 2YDQA 1ISZA 4WR3A 1XX1A 1OB0A 1P6BA 4MKNA 4HVXA 4LCRA 1ONEA 2PP0A 5GJMA 3SADA 1LUCA 1O7AA 1UJPA 7REQB 3W2UA 4H7CA 4S3EA 3CL7A 3TJLA 3C0SA 4HA4A 3QFEA 2JE8A 3HV8A 5AZ0A 3BTNA 4JPGA 1ISWA 4HKPA 5A6JA 3H4XA 4HCDA 3A12A 2VWTA 1MW1A 4IUOA 1G69A 2HPIA 2PE4A 4AAJA 2VI0A 3LXAA 1A50A 3OOQA 4FOUA 3DAQA 3R89A 3EIPA 1LLWA 1XDLA 3B8TA 1TTIA 2G97A 1OFQA 1CXIA 3O5QA 1ZCCA 5G1MA 4DN1A 4Z1DA 1O5KA 3MY9A 3M46A 5CLTA 3NL2A 2NLIA 3WH6A 4WY0A 1K3UA 1LP6A 4Q8NA 4IQLA 3LPPA 2O9OA 3T1GA 1ZCNA 4BJHA 1HKJA 4PUNA 3UNDA 2CBJA 4HARA 1GW1A 3IGHX 3H24A 4Q4MA 2D1ZA 2DH3A 5M17A 4V28A 3NXFA 1OIFA 4M1BA 3TN4A 1N8IA 4JQAA 2XISA 3IVUA 4IIFA 1H62A 1BF6A 2ZZ7A 1Q6OA 2DZWA 1V0NA 1C3FA 5C9RA 1TCDA 1CGUA 3ABZA 4QX4A 4A35A 3PJXA 1E1CA 1E15A 3DFQA 3R10A 4NZ5A 4ERGA 1K77A 4YWSA 3IJDA 3LV6A 3TFCA 3PZIA 2BFGA 4LV9A 1I2RA 1LRQA 4RDWA 3VOCA 4AHOA 4ENLA 1G67A 1XYMA 3T8LA 4F48A 3EDEA 4GUFA 1XH1A 4F4RA 2F6XA 3IJQA 3NQ2A 4AZBA 1SO3A 5H8MA 4YLWA 2WQDA 1VENA 3LZ5A 3AS3A 2BMBA 2HXTA 3NYDA 2OOFA 1W5QA 1UR9A 1IR2A 1CLXA 2ZA3A 2YOCA 5CPNA 2NUYA 1TWSA 1DYSA 3SUVA 5A2CA 3UR8A 3TDFA 1NIUA 4RV3A 3PZ9A 1R6WA 3KABA 2JKPA 5CKSA 5EMJA 1H1ZA 1L2QA 3H9RB 1CXHA 4DX3A 2PSNA 3VVGA 5HW7A 4A3YA 3QXBA 2BY0A 3THCA 4XAPA 2H8ZA 3AXKA 3WH8A 4DT4A 2OELA 2YCKX 2C1GA 3FDGA 1A5BA 1RD6A 1TZ7A 1IZKA 4LSBA 3WL0A 4ZPWR 2P8CA 2NQLA 3S2JA 2X05A 1LROA 2EG7A 3RO6A 1ME8A 4LRTA 3NI6A 3E49A 4S3AA 2XP8A 1GHRA 2VEIA 3WQ5A 1PKNA 5I3HA 3TLQA 5LIKX 2G96A 2WSRA 4UWMA 3VNDA 3P5YA 3EXSA 4KGLA 4B9YA 2FZNA 1HQTA 4YTRA 3RLVA 5A69A 3U2EA 3B4UA 4IPXA 2MUCA 4UTTC 4L5ZA 2XP4A 2EPLX 4H00A 2ACSA 4QDPA 1KM2A 4GXWA 3CWNA 2JZVA 3BLLA 1VPYA 2J7EA 5D04C 4S3DA 5DANA 5T26A 5J5RA 1ZHAA 1A53A 1Q66A 3GNDA 3AQUA 1LRTA 1HJSA 1TZZA 3DHUA 1K8CA 4DRKA 1D8CA 2QJJA 4OBTA 3UI4A 4O10A 4LW7A 4IG2A 4TOQA 1XW8A 4B5XA 1G6CA 3L0KA 2BOGX 1G5AA 1FWNA 2C14A 2OR2A 1QWGA 3PBYA 3NGJA 4BEQA 2PPOA 2HMCA 2FMOA 2IMRA 1GHSA 1UKPA 4O15A 4FNTA 1RP9A 2PDYA 1E3ZA 3B05A 3KHDA 1J5TA 5EFDA 3PAOA 1WZMA 3UPBA 1Q2SA 3MDWA 3GX9A 3DG3A 4MYXA 3N2CA 2G3NA 2QGHA 3O5DA 1W9DM 1UD6A 2ZX5A 1SQ7A 3N2BA 3CUFA 3S6TA 5H2ZA 1D8WA 2PDUA 1DJNA 4GH1A 5KETA 2NVAA 1JDCA 2HVNA 4GYPC 2NXIA 2DIJA 3LMZA 1DQXA 2QS8A 4QG6A 4UZSA 2INEA 2P5NA 3R8GA 2DW7A 2VFFA 3OVRA 4BQ3A 4A2RA 3L4YA 1NSJA 2ZTJA 4H9TA 2X1UA 1SPQA 1ITUA 2YB4A 1QAPA 2X30A 3O16A 2BOEX 3KVKA 4QP0A 4HHLA 1QBBA 4UQ9A 7TAAA 2CLEA 3WDPP 1R2RA 2VCAA 5IDIA 1X7FA 4HBOA 3VIGA 1XLEA 3UJFA 4XO6A 2F21A 1QU4A 1H7XA 2J88A 3OG3A 4E2OA 1FKWA 1EA0A 2HQAA 4H8NA 5D38A 4UR7A 3VNMA 3ZOAA 1XIMA 4FXJA 4HNCA 3OZYA 3TSMA 1PIGA 2HE5A 4L6DA 1U33A 1TV3A 1JCJA 5G2HA 5FEXA 5HDRA 2WMFA 3TYDA 1VZWA 4PMDA 2OSXA 1GOIA 4ZQCA 4DJDC 3FHQA 2ZUVA 5DBUA 4KEUA 4L61A 5ABFB 1F74A 2WMIA 1ECEA 3CUXA 1QDSA 3SQMA 5HANA 1E1EA 2WJDA 2PGWA 2ZKMX 1DQUA 3EXRA 3C5QA 1BYBA 2PU1A 1WDQA 1KCZA 1F6KA 3EMQA 1JGMA 3LRMA 3R94A 1B3YA 2YSWA 3Q4DA 2DT3A 3L12A 1F6PA 2Z00A 4IP7A 2ZQSA 3TW6A 1DXEA 4KIRA 3EDKA 3EB4A 1Q6CA 1V7YA 3M0XA 3M0MA 4O1DA 2WK2A 2GGHA 1PZ1A 4J2PA 2VJXA 1Q7ZA 4O11A 4XSMA 1QVBA 3D6NA 4E3TA 3COTA 1HGYA 1U30A 1FWIC 4Q6JA 3U48A 1G1YA 2PF8A 1M7JA 5FJJA 2ICSA 4Z1AA 1WXJA 3M41A 1K9EA 3ITGA 4HSHA 4UFHA 3RLGA 2MLZA 3IK4A 1QI4A 3B03A 3TTYA 2QW5A 3H55A 2ISWA 4TNSA 5J5DA 1LM1A 4UC5A 3U2ZA 1J12A 3HU7A 4LALA 4PMOA 4H8HA 4EIVA 1VYRA 4CD7A 3EAUA 1T96A 1KM5A 3T0AA 4UIOA 2WZIA 4MWAA 3NEHA 3H4WA 2UY4A 2RGMA 3LCWA 4JY8A 1TTJA 2WW5A 1WP6A 1B5TA 1GVFA 1O5QA 3S5YA 4GUJA 1OYBA 4Y8EA 1ZNNA 4TU1A 4BI7A 1GT8A 2J47A 2W66A 3WNOA 3T42A 2YW4A 3UGRA 4DO6A 2WNWA 3O1NA 4DZAA 4QR6A 1XIDA 2C15A 1LTDA 3KTSA 3S1UA 4MWAD 5M3WA 4J1OA 1JR1A 3S5OA 3UZZA 2V3DA 4LNYA 1KR0A 1PIIA 2VCDA 1OYAA 3UYCA 4A4AA 2V30A 5K2ZA 1JCMP 3CPRA 1E0UA 4M8UA 4XZNX 3AIWA 2YZRA 4K8HA 5A8MA 2D3LA 1H0GA 3WIJA 4OZOA 2J25A 1DKWA 3W0KA 4XKYB 2ZUNA 1XQKA 2DP3A 4BCEA 3ITXA 3H22A 4GKTA 2QIWA 1UBSA 1OC5A 2FZ9A 3LHYA 3K8LA 2BHUA 1HJQA 4F40A 1EJSC 2W61A 4TX8A 4YVXA 4DF2A 1OHLA 4ZSTA 4UTJA 1ONRA 3O7UA 3QSRA 5BWFA 2P4VA 2QQ6A 3C2EA 3ABRA 3I68A 1ML1A 3N6QA 1GPFA 1A3WA 1CT5A 4DWSA 3KZSA 5CBIA 1WDWA 3EGJA 1Y5XA 1QI3A 3I6EA 3CLMA 1LDCA 5GPGA 3ABSA 1DQWA 4C6JA 4B16A 2VR2A 3PPFA 1LYXA 5XINA 1TE6A 4U2YA 4GIVA 1Q5MA 3NG3A 4JDYA 2DSVA 2XN0A 2WWDA 1ODZA 4I7WA 3FDKA 4NZCA 3Q67A 1T0OA 4DWSD 5CSRA 2XH0A 2QVHA 1JEZA 2E9LA 2O9RA 2WKGA 3KBJA 3KOXA 2G50A 3C2RA 3C6CA 4AISA 7XIMA 1M68A 1DV7A 4A8LA 1IEWA 4AF0B 2ZQ0A 3V5CA 4JN8A 1TTPA 4W7WA 2RAGA 1IWAA 3KUMA 4FHAA 2PBOA 4D6GA 2DZUA 2ZC1A 4XD5A 3A4XA 3RJYA 1VH7A 4GQ0A 4H8VA 3N9SA 1EL3A 1D2KA 4C02B 1A7XA 2VX4A 4C7DA 3LM7A 3ATYA 3MZNA 1EFZA 3OLGA 2LLEA 4YYCA 1JPHA 3AHZA 3HG5A 8RUCA 1KR1A 1VFHA 3W6MA 2ANUA 2OKOA 1XLLA 2XN2A 4HK7A 4M5PA 3AI0A 3OBKA 1ZJHA 2WMGA 5IHSA 3W88A 4C6LA 1RK5A 1TQJA 3GW0A 3PTQA 3BSGA 3CEPA 5ECUA 1NELA 3R2GA 3VIKA 2ATMA 5E6ZA 2NVDA 4TX6A 1HKIA 3DH7A 3W9ZA 1NMVA 4HMNA 2YCLA 4QT2A 1GVOA 2Z2BA 4MSSA 5EA9A 1WO2A 3WBEA 1KXHA 2BNJA 3W53A 3A6OA 5D33A 4UTWA 3LHVA 3HG2A 3O2LA 1L6SA 4IMEA 1X98A 2BXVA 4UMAA 1EJTC 4O4VA 5EMYA 1TG7A 4Q8QA 2K8IA 3A9BA 4UXDA 3JW7A 3SSJA 2FH8A 5M5DA 1V6XA 2EEXA 2V3GA 3F5KA 4QQ3A 1Q3NA 4PCSA 6REQB 1JFHA 1XFBA 2IXVA 5AFDA 4FEZA 3W24A 1P1XA 2GK1B 1LBLA 1WDPA 3W1MA 1GQJA 3GVRA 1A3HA 1F8IA 4YPJA 4P7OA 1L2UA 4G6CA 4DYJA 2G8ZA 3TK7A 1U22A 3EOUA 2RFGA 2KE0A 2PCQA 4UFKA 4JFIA 2EKGA 4DF0A 4JQ4A 4G50A 1N82A 4GKLA 3SCTA 1ZP4A 4JTHA 3VGDA 5BWAA 1BXNA 2WCSA 3GE7A 3UWWA 5JBDA 3S1VA 3AXMA 4O4WA 3ITYA 4XKMA 4WDXA 3IGUA 4ZQMA 2A3CA 2E09A 4DO5A 4RUBA 1RH9A 1B1YA 5CZTA 4LYKA 1E1FA 3RXZA 1CZ1A 4O8RA 1U5JA 5CG7A 1FKRA 4ML9A 4R7WA 1KFWA 4ZQNA 1MVYA 4U31A 1T8QA 5DMLA 1JCXA 5EMKA 3VIIA 1TELA 3ZM8A 3CS2A 4OHQA 3SGZA 1PKMA 2UZ9A 4ZR8A 4C65A 1ME7A 3TVAA 4ZFMA 5BOOA 2WXDM 2Y8KA 3RK8A 1VCGA 5REQB 1XRSA 3IRDA 3W7GA 1M01A 3N11A 3CUGA 3G5EA 1E5NA 1WCGA 4MNLA 4LH8A 4V33A 1IXQA 1C8XA 5HK4A 4JNYA 5HNUA 2FB2A 2TAAA 3HFYA 3NQFA 4JFMA 1UR8A 2NQJA 1XJBA 5I3JA 3RU6A 1XGDA 3OJGA 4AMAA 2XWEA 2AKMA 1TPC1 1QMLA 5F2GA 3VPLA 4S3FA 4DRNA 3ZLFA 3L21A 2TYSA 1I1XA 1FCVA 3W7EA 3KCEA 1UR0A 3UXIA 4PE8A 2GGJA 2PLJA 1XH2A 3CUZA 4O52A 1A0DA 3O3RA 4J27A 4ZGYA 3WLLA 1EB3A 3VUSA 4XVEA 4RXGA 5CJNA 2NT0A 1Q1CA 4M19A 4D9PA 3FKKA 4AHPA 3N6JA 4C60A 1NFPA 3TC5A 1UC5A 2GJRA 3HFTA 4U2ZA 1JZ7A 2E1WA 3QW3A 1YX1A 1V3LA 4UR9A 1QK0A 3MUAA 4O28A 3B8VA 2V82A 5C7HA 2EG8A 4MGVA 4GBDA 4WY0F 2W79A 3H2MA 2ZXDA 3WDRA 4IT1A 1M04A 1T99A 2OGYA 3ES8A 3W7NA 2YBTA 3KOYA 1H5YA 1ZJBA 3LB0A 1K7XA 4TIMA 4PUKA 1P0DA 4POCA 1VCVA 1VJSA 2Q8XA 1PDYA 4P7RA 2B7QA 3BANA 4HYRA 1UJQA 4HA1A 3L2IA 4HA3A 3WLMA 1BKHA 2PU0A 1BSLA 3N9KA 3B8DA 4Q7NA 4IGHA 4WQ6A 4FPSA 3QGKC 1IXOA 2ZUMA 3IEBA 3O0FA 2XP5A 4FO4A 4IFRA 4XAZA 4L6HA 2ZX9A 3JU2A 2RSEA 4LAZA 1DBTA 3P62A 3N2XA 4AVFA 3GC2A 2GUBA 4PUJA 3G1RA 3GTXA 1ZBWA 3KZPA 1D7IA 2W0UA 1TRIA 1AW5A 1O1HA 4MWAE 4E8DA 5DCBA 5KITA 1JUBA 1FCUA 1CENA 4JQ3A 4NAEB 3PZQA 2VGBA 3FY1A 3ELFA 3PHAA 3MP4A 4UUIA 3QY6A 3BAXA 4AD2A 2V38A 4QRNA 3G2GA 4BY3A 5FSEC 3M16A 1P7TA 4GVIA 5DCDA 3VO0A 5BRBA 3QQ1A 1GONA 1JAKA 5FJPA 3XISA 3ARSA 1V6TA 3QLDA 5DT7A 3RUBL 1IZJA 1BVWA 3F4VA 3M5XA 4EF9A 2YB1A 4QJ3B 4LNCA 2Z29A 3AROA 1TKKA 1NQ6A 5D30A 1FKHA 2RH9A 2W3ZA 3V4BA 4XVDA 2NQ5A 3WDHA 2XU2A 3BQ6A 3TCZA 1K9FA 2B7OA 1EIXA 1HXJA 4IQCA 2RHGA 3WMCA 4H9UA 4NNBA 4PRRA 1XSJA 2D24A 4M80A 3MKCA 1S1RA 1R38A 4MAZA 3N4FA 3PJTA 3TXZA 3VIOA 2ZA1A 1GVYA 4IIGA 2C91A 4HMDA 2GLKA 5XIAA 1WDRA 4UOQA 1W91A 3WQOA 1TPUA 1PL9A 3M5VA 1QOXA 4FNRA 2VUNA 2B31A 2ZR5A 3VOFA 3T78A 4LVGA 4KCTA 1CGTA 5AC8A 3GDTA 2BASA 2YLAA 1PKLA 2P88A 4GI8A 5CQ1A 4UTLA 2GGGA 1OSEA 4RZ5A 4L9YA 3LN3A 1OF6A 4DI8A 2W4XA 5CAKA 1CB2A 2C79A 3O6DA 4XV0A 3TP4A 3SECA 3C0LA 4H41A 1AMKA 3BOFA 1UQZA 2V5CA 4DEFA 1DJZA 4IIDA 2X1TA 3WF3A 2YL9A 1K8XA 1Y5VA 4JTEA 4JD4A 4PUEA 1AFSA 1HP4A 4NNRA 3GYEA 3B8SA 4HOZA 2Y24A 4J28A 2DVXA 3DFYA 3RLUA 2VN1A 5I78A 4WF7A 1S2CA 4JTUA 2VEGA 2CLKA 2YJQA 3PZNA 4D2JA 1VIZA 4PUWA 4GGQA 3THAA 5AC6A 1XLHA 1QPOA 4C6OA 3B7XA 1PS9A 4JFUA 1EBGA 1RP8A 1EX5A 1MUCA 2DUXA 2ADAA 1EDTA 4GD0A 2E5BA 3Q58A 4BF7A 5IOBA 1W9PA 2ZADA 4QITA 4D8ZA 1IWBA 2AL2B 2ISVA 1NTHA 3TOPA 2J8TA 2OPJA 3SY5A 1GJUA 4FR6A 2IQ0A 4HNTA 2FJKA 4O0ZA 1XYBA 2I5QA 3VINA 4JICA 4Q6XA 3U3HA 4JDBA 5FOOA 2QLYA 1W5NA 3BSHA 5DXXA 3KL5A 3W2JA 4TO8A 4A29A 2ABAA 5HA7A 3KS6A 3CTLA 3WQWA 4Y90A 2E8YA 1P43A 1AZ1A 1O6IA 1V03A 3VCCA 1FH8A 2YKKA 2CLMA 2WAGA 4K36A 4ROPA 3H21A 3LCIA 3NAVA 2OGJA 1GOOA 1KGXA 3IVTA 1JPIA 1SJCA 3UPWA 4PCFA 1LL4A 4A21A 5A95A 4JN6A 2ZX8A 4HD5A 4C6MA 1R9XA 2XPKA 3VM7A 3EKZA 3KL3A 3EWWA 3BCJA 1R3VA 4FX6M 1E9LA 4GNKB 1LZOA 4O1EA 1R3QA 1VPXA 4HTBA 1UB3A 2V5DA 4Y7EA 4MLJA 3KADA 3OODA 5I3IA 2XVLA 3W22A 1ZPTA 3NGFA 4WXZA 3VDHA 3NQCA 3VNJA 1TR9A 3B8UA 4KFNA 4Z08A 4KT2A 2I5IA 2J62A 3EBVA 3WBXA 2GQ9A 2GOKA 3O5EA 1UASA 4A05A 3V18A 2R8WA 3P80A 1AH3A 5HULA 1XL9A 1SW0A 4PULA 1EXBA 3KBWA 4N9CA 3SCQA 3D3AA 1BEUA 4ACZA 3KP1A 4IP5A 1QT1A 2Y89A 4DROA 3MI3A 3T2OA 2ZZ1A 3WDIA 3NQAA 2E8ZA 3MSGA 4HZMA 1MFUA 5HJXA 1H3GA 3PR9A 1O1ZA 4ZTYA 1QPNA 3UP8A 3LUOA 3S6OA 4PBGA 2F23A 1KC7A 3NZGA 3M0KA 4U84A 1XLMA 1B9BA 8A3HA 4JHOA 3IPWA 4A3HA 1BG9A 1KFLA 1RD5A 3AMLA 4WJ8A 3WD1A 2KR7A 4JIRA 2IKHA 1MYRA 1IIHA 2NSOA 5G4WA 3CHFA 3TYBA 2J7FA 3KBMA 3MUIA 3NDOA 2ZRWA 2V67A 4UFIA 3BOXA 3M5ZA 3C0QA 4GUHA 1Z42A 4REQA 2QJNA 1FVPA 2NQHA 3P2VA 1EWDA 2Q6ZA 5CEWA 1R3WA 2P8BA 1TA3B 4JFWA 4YVVA 1UR2A 5I00A 3WJZA 4D72A 4EPBC 4D6HA 1YATA 1D6OA 3B97A 1TJPA 1B31A 1REQA 1NWSA 1GK8A 4OVXA 3OQ8A 5ABEA 3QMRA 1QNVA 1LJYA 2XIMA 2WBGA 4V2XA 3P0XA 2CW6A 2JGQA 2DSKA 2HK1A 4GYPA 2C3ZA 2ZYFA 4L65A 2YX0A 4XAFA 1WX0A 4B9ZA 2FZMA 3KX6A 5D4YA 4AD4A 2Z28A 4QLJA 1EGVA 4EVZA 5G4EA 3TROA 2YDAA 2HCVA 2HEJA 2O9TA 1T7LA 4GZIA 3KRSA 2RQSA 3OZMA 3UGVA 4EOUA 4GX8A 4NSBA 3NA8A 3I65A 4CN1A 3AOFA 4WZHA 4X63A 3NQEA 1DJGA 3U8GA 2I1OA 3BV7A 2QF7A 4CCCA 1UR4A 5FJRA 4X60A 3KOZA 2A7RA 1R3YA 1IEQA 7A3HA 4XSLA 1B4KA 1QI5A 3PZVA 5EYWA 1CIUA 3EOLA 3CAVA 1JCYA 5FF7A 5EY5A 1L9WA 1SUXA 5ABFA 3AS0A 3NM1A 1I0DA 4JY9A 4F2TA 1VBUA 3CASA 2FHFA 3KAOA 4H19A 4AEEA 4DBWA 2NXGA 2PC8A 4RK8A 4YCOA 3GXMA 3F2CA 1DXIA 2Y1HA 2QF8A 2X8RA 1PO9A 1EBHA 2J7DA 1P4CA 2V5JA 4I9JA 3WENA 1LORA 5CG0A 1KM1A 3WG6A 2G95A 1FCQA 2IXUA 3RMJA 4M6VA 1SZRA 2J13A 3BGJA 1IR1A 5IHRA 1QZ2A 3L68A 4PEKA 2OJPA 1PZ0A 1XINA 1U1HA 3PM6A 3DC8A 1HJXA 2L2SA 3UI6A 3VCRA 1NEYA 1K02A 3BC9A 1QW8A 3KP0A 2WMHA 3FSUA 4LEFA 1GQNA 1IEXA 4TQTA 4J4KA 3SN1A 4L9ZA 5A3HA 1MNSA 5C2CA 1GPWA 4M6PA 4DJDD 2GVEA 4RPPA 2J27A 4C5ZA 3M0LA 2PDQA 3OVGA 4ZOBA 1MXSA 3CB3A 3MKVA 3F4CA 1EEPA 3AS1A 4NAFA 4V15A 1YXDA 1TMHA 2WYSA 1FD9A 3M9YA 3I3BA 4OV9A 1MI3A 1VFTA 4PFHA 1WZAA 2FAPA 4H04A 2G4JA 3B04A 3WH0A 4K37A 1QO2A 3UJSA 2YA1A 4I9MA 1V08A 2ZZ4A 3W7QA 2WC4A 5E0FA 2BWGA 3GWQA 3VE7A 1C9DA 3LERA 4XD4A 2DZSA 2V63A 3J7HA 1VS1A 4R33A 4W5UA 2JBMA 1W5PA 3OVQA 2Z2AA 1KW1A 1VAHA 4JFJA 4XIAA 3THDA 9XIMA 2B5UB 2H6RA 1BTMA 2QUVA 3P60A 4GYJA 1FDYA 4DUVA 3RFWA 1K1DA 3CHVA 3QEZA 4Q8MA 3QJAA 1BWVA 3E74A 2J8GA 1CTNA 1KT0A 4FF7A 4Z2GA 2RUSA 3OTRA 2CPUA 3BMXA 4DBDA 4YS1A 4ZA0A 3WDQA 4CQ8A 5B7ZA 5C54A 1MEHA 3VTRA 1R5YA 1Y65A 3BQ5A 1TV7A 3PRAA 1LLOA 3ECQA 3CV1A 1RQEA 3MV11 4KH2A 4XBSA 2TRSA 3FVMA 2J78A 4N02A 3SB0A 2Y5SA 3DCPA 4XKYA 1AZ2A 2E9MA 1C7TA 1GVRA 1I75A 2RGLA 4W88A 4ODLA 4Z2JA 4JYSA 3TYCA 2VGFA 3DFSA 2CIPA 1EF3A 3CH9A 2VEKA 3CO8A 1TWWA 2UY5A 2H9AB 1JYVA 2POZA 4I5RA 4ZB0A 3UR2A 4L4OA 2OZ3A 1F4AA 4MPKA 1JF6A 3B0YA 3G6LA 3GTIA 2WQPA 2ZXQA 3GKAA 1XSKA 2A3HA 1W1VA 5I6SA 1ZBCA 4K68A 3OBAA 1BYDA 1V7AA 3HMJG 1NWTA 1OCBA 2V8ZA 2XFRA 5D9MA 5A6BD 4AZ6A 1EJRC 2ACQA 4JIHA 3TNBA 5EPDA 3EA3A 3ZR5A 4XAYA 2PTYA 1NMWA 3EPOA 1A4MA 3W27A 3VIMA 1UMYA 1W1IE 1K4GA 1Z44A 2X40A 1IT0A 3UU0A 5DT5A 3V35A 3VA8A 3W70A 4NX0A 2WZTA 1I6NA 5AECA 2E5DA 4TVDA 4RPQA 5M2FX 3WJYA 5RUBA 3I6CA 3DEQA 3S4TA 3QTGA 2W27A 4BQ5A 2DZAA 3KACA 3HJEA 3QBUA 4HBKA 3N29A 3GVVA 3OBEA 3Q37A 2JALA 4ZOCA 2OXNA 1I2QA 1BF2A 3M0JA 4JN7A 3VK5A 1RY0A 2J6VA 3SIMA 4F79A 2PS2A 4L6OA 3PA7A 3WELA 4I5UA 3KVJA 2V81A 4UQDA 5LIXX 2CHOA 2QCMA 1LUCB 3L5AA 3PPGA 4C1KA 2XIJA 4DWDA 4KIEA 1OF8A 6TAAA 3CAQA 2BVYA 1XRVA 4JAWA 2DFAA 3QVQA 3O0KA 3LTSA 5LGXA 3OIHA 3BCFA 3E0VA 1WDDA 2CLFA 4O18A 3GQYA 4PUMA 2ZIDA 3C61A 3WNNA 3CIVA 1HJWA 4QEEA 2YA2A 1PJ9A 2XPBA 3CMJA 2WPBA 1TSIA 1YADA 4MB4A 4K1GA 1E3XA 4EAYA 3ARYA 2VYOA 1A5LC 4LCQA 4NP7A 4C5YA 1P5QA 2Y8UA 4PTDA 2R94A 1FXQA 1BQGA 1KRAC 2P3ZA 2J66A 2FPYA 4XZBA 2I56A 2IPFA 3S5ZA 2ZZ2A 5HMDA 2J24A 4CQ9A 6REQA 3TOYA 4BF8A 1GNXA 4RKAA 2EAWA 1RUSA 2XM2A 2F7FA 3USBA 2ITKA 1O68A 1XRTA 2WLZA 3DI0A 4HCHA 3GXPA 1FQ0A 1ZY9A 5DFAA 3PG9A 2PEVA 2NW0A 1TX2A 4AQLA 2A3BA 2D20A 4RLIA 4Q33A 4E8CA 3CYJA 5A94A 3ANYA 1UUMA 1ITQA 3XINA 3GVWA 2Y63A 2HWGA 4JL2A 1SR0A 1H50A 3UY7A 5BXSA 2WZEA 1RA0A 3UPMA 1ZAHA 4DXKA 1HO1A 3POCA 3W7MA 1E1CB 5JXQA 1VLIA 3MTWA 4DIPA 3K1DA 4O13A 4OGZA 4Q8VA 3OW1A 3EWBX 2FMNA 2W62A 3IKGA 5JUVA 3TQKA 1A3XA 3O07A 1PWMA 4CN4A 2BVWA 3PTMA 4G2PA 3EOSA 4JCMA 2PWEA 6TIMA 2WB5A 1G4TA 3W7JA 4RNJA 1VR6A 2A5HA 1KM0A 3TZNA 5EFFA 4BS0A 3VDAA 2FFCA 3JYJA 3PWIA 3W07A 1KXVA 2YBVA 2PN0A 4Q4PA 2ESCA 1A5CA 4F2UA 2F8QA 3MP5A 1TB3A 1QOPA 3G1AA 2HS6A 3GRIA 5F4XA 2ACUA 4LAYA 4JX6A 3STCA 3TJ4A 4E4PA 3UF9A 2ZC8A 2GJLA 1PPIA 4IQJA 5TAOA 3WJSA 1S46A 3OGSA 4JTAA 5K3VA 2J9ZA 1VYSX 2QT3A 1OCJA 3MSYA 4DJFC 4AD1A 3E2QA 2ZZ5A 1B4EA 2PDNA 2BHYA 2PDBA 2Q5AA 3IK2A 5T91A 1HXVA 1YDYA 1NWUA 3VU2A 3AU6A 4KQZA 1YTKA 2W67A 3IIPA 5J04A 5LNSA 3G3DA 2VD9A 3U5YA 1JCNA 3FGCA 2O4MA 3HTWA 1S2WA 2PDCA 3L4TA 3ITTA 3DERA 3R6IA 4TUFA 2INFA 2VMFA 1FJDA 3PSVA 1R85A 1XGZA 3REQA 1FWHC 1KT1A 3QQWA 4B5WA 5HW6A 1TPEA 4QROA 3O15A 2HRWA 3Q45A 4HHHA 1E6PA 3V1HA 3N15A 1KLYA 3IARA 3VX1A 4IGSA 1KD0A 5FCZA 3JR2A 4L56A 3ZJ7A 2JFEX 3N4EA 4N4QA 1XCFA 4GGHA 5BXJA 5C6MA 4JL1A 2VDGA 2R9RA 3NTPA 1W1B1 3H7RA 1VIWA 4J2MA 7PTDA 3TCSA 4ONVA 1RXOB 1QRQA 1XIBA 2C1HA 4J3ZA 1B3OA 1CXFA 4ZXLA 5GPRA 4Q22A 5E1QA 1GZGA 3VKCA 3GTHA 1OM0A 1MW0A 4MHBA 1HX0A 5CC5A 3SCNA 4PTVA 3LBCA 4AW7A 2X1IA 2JEQA 4F0KA 2DJXA 1RR2A 4RNIA 4AIBA 3SI9A 2ASHA 2YCEA 3BK0A 1PBGA 2XIBA 1SFTA 4NAEA 1MO0A 2HPMA 1QHZA 2PDFA 2VZTA 2QDEA 3FJ6A 4NJKA 5A8OA 2ZXBA 3T9PA 3UZYA 5HMSA 3WQCA 3S5NA 1WPCA 4MLRA 3S8HA 4CNSA 4HIBA 5BZAA 2OZ8A 2X1RA 3ZMRA 3BLKA 1VBHA 4GPNA 3GIYA 4IPPA 4C6KA 3NZ1A 3N2MA 2WHJA 1AL8A 6ENLA 3BO9A 4LVAA 1RCOB 1RBOB 3VXGA 3LQLA 1Z8AA 4ZB5A 1AL7A 1LBMA 4C6IA 3ARVA 4LFYA 3T2QA 4O16A 3VGGA 5BOEA 2I16A 2A7PA 3KDOA 2D2JA 3KBSA 2CHNA 2F6UA 3MJMA 2Y7GA 3BL3A 3LCXA 4ZQOA 2VC9A 1Z32X 3AMGA 4PA8A 4UQEA 5D05A 3C56A 1A47A 3WLTA 1H60A 1OYCA 3UZJA 4ASTA 3A22A 3ZVHB 4P8VA 2UBPC 2ZRXA 3B9NA 4UCFA 2Z25A 4NILA 4BK9A 3CWHA 4MF4A 2R6OA 1X8FA 4LYPA 4HK5A 2RKXA 4XG1A 1AODA 2WMIB 3CIXA 3AUOA 3A23A 4BKNA 1VC4A 2XP9A 1BYAA 5D75A 4OOUA 3OP2A 3S0CA 3W2LA 2WNNA 1UWSA 3ZJKA 3F2DA 1SM9A 2WKJA 1US3A 4GA8A 4AUBA 1WXZA 1K7FA 5TNVA 1UMLA 1KA9F 2XZ9A 1H7NA 1G4SA 3NO3A 4RX0A 1F6YA 4XD6A 4TTGA 2GVYA 2EULA 4IOTA 4UDMA 4CQBA 5HJYA 1IE7C 3CBWA 2OEKA 1JL8A 3R8HA 4LAUA 3MUZ1 1A5UA 3H2NA 1M5YA 4JX5A 2YZ5A 4IXHA 2DZXA 3PTKA 3CQ0A 3VNIA 5CLWA 4D8LA 1CXLA 3UWQA 2QJMA 4MWAC 4Z2KA 3EWYA 3KFTA 5FEZA 3WQ4A 1AW2A 4ATWA 4TMCA 1V6WA 4O19A 3R0UA 2WPGA 2PUZA 4FIRA 4GWEA 3T08A 1VP5A 5BRQA 1C7SA 3F4WA 1XIGA 1V77A 3CPGA 2H3BA 3EX1A 4RL3A 4NJHA 1GRJA 3VABA 3VAVA 4LC6A 5KINA 3HGRA 1FH9A 2Z27A 3W1LA 4NZJA 2PPNA 4MWAB 2OLSA 3N12A 3DFTA 5A6TC 4RW5A 5FI8A 5A8GA 3GFXA 3RJXA 3W7CA 2VC7A 3E02A 4U33A 3A4WA 1OFOA 3C52A 3P82A 4HZ8A 1MUWA 5HXMA 3OVPA 3PVFA 4CQCA 2VQUA 3L2MA 2VO5A 2PBCA 2CWNA 1JQVA 4LXFA 1IEVA 1NDYA 4LUTA 4JHMA 2OQLA 4DRIA 2I9EA 4WKFA 3KVMA 2D2GA 1ONWA 9CGTA 1C9WA 2VENA 1VYPX 3MUXA 3VD3A 2WOQA 4PBFA 4GX9A 1D3HA 3M64A 4I8DA 1S2AA 2FB3A 4IICA 4F0LA 1GKRA 3Q94A 3C8FA 3WBAA 5G2IA 1QNQA 1LOQA 3WLSA 4OKDA 1RY8A 2LGOA 5GNZA 1M41A 2F9RA 2C6QA 4DO7A 3JVAA 3N17A 2RJHA 4PMXA 3WUFA 4FA3A 3LOTA 1LG2A 2YIHA 3ITOA 1TV8A 3LGDA 3SBFA 1OK4A 4UTKA 2REQA 5EBAA 5KZDA 3DZ1A 4FNPA 4RZ6A 3TA6A 2A0NA 5I06A 2AQOA 4JR5A 4H1ZA 1EYEA 2IPGA 4PRTA 3DGBA 4HQVA 4E5TA 3AWNA 1I9CB 3PBGA 3U2OA 1X97A 3KRZA 4A8IA 3M07A 4FZIA 5H91A 3RN6A 5LNVA 8XIAA 1FFRA 4K7VA 5AOUA 4GNJA 3ITLA 3W74A 2ZE0A 4W85A 4HJFA 3UWVA 3DENA 4CU6A 4K38A 2QAPA 5A2BA 1VFUA 2PWUA 3HGOA 1FWEC 2Z6IA 4D6EA 1M03A 3ES7A 4DZ5A 4QSFA 3NZPA 1WYIA 3BE7A 2Q3RA 2PC4A 2Z4GA 2DG4A 1UZ1A 1WOAA 3GBDA 1TA3A 4AC7C 2YR1A 2CCRA 4KEZA 1GWJA 3TE9A 1KFKA 1OEPA 2P0OA 3FLUA 5IXEA 2P1FA 3LLFA 3E2SA 3LHUA 3W38A 2MANA 4R9OA 4UTWC 3SCOA 3HV9A 2ZCGA 5IFTA 1M5WA 1VD6A 2FQIA 3OZPA 4WOZA 1CGVA 1H7RA 3S46A 2INZA 1XYAA 2A6NA 2XSAA 3E0LA 2YXGA 2V3FA 4CNTA 4PRWA 1T41A 3AIVA 5KZMA 1TPDA 2E0PA 3OYXA 4BEUA 3CLWA 3PZOA 3DFHA 1KRCC 2MPHA 3W2NA 4UNIA 2VL4A 2YCLB 1NFGA 2C0HA 4AZIA 4O1AA 1TJ1A 1OFAA 1I2NA 4XZ9A 3WLIA 1IGWA 3P7YA 3WF0A 1ZENA 1HF6A 3WNPA 1X6NA 3LM3A 1LBFA 2V69A 1UD2A 2VVNA 1HG3A 1B57A 2ZRYA 3W7LA 1B0IA 2A1YA 3QGVA 3M0YA 4OJYA 3S6DA 2CZVA 2MF9A 1H1YA 2WSPA 2J79A 1K4HA 4US5D 1FHUA 4C6NA 3PULA 3GNPA 5EMLA 4DUWA 1FWRA 4L1XA 1CGYA 2FJUB 2Y7DA 3LGGA 5B8IC 3L4ZA 3HG3A 3AAMA 4YCPA 3B06A 4Q32A 3W7DA 3MSRA 5K9DA 4I6KA 1GGOA 3AMKA 3ZR6A 3E96A 3RRAA 1KTBA 4EPKA 4ZB2A 3EDDA 5AKQA 4HU3A 5E93A 3S2LA 1KGWA 1EJUC 3K5XA 3UQNA 1VCFA 3MVIA 4DIAA 2VGIA 3WUEA 2BG5A 2OTDA 1NSGA 1L8NA 1JNSA 1V0MA 1KTNA 1E56A 5XIMA 2VP8A 2PURA 2B7PA 4PMNA 3T4CA 4D6IA 3N13A 4HU0A 5LA2A 3WNLA 2DPEA 3WL1A 1YLVA 1BSIA 4H6QA 2CC0A 1LT8A 2AL1A 2PDIA 2DW6A 2FGBA 2C1IA 1KB3A 3MDYB 4IFKB 1TRDA 5CPMA 1IHIA 3IIXA 2CITA 3VZYA 1GW9A 5A1AA 3GB6A 4Z0JA 1GVIA 3LS9A 2EJ1A 3NO1A 3NUKA 1DHPA 3W1PA 3ZYZA 3JZEA 1EQPA 5FF4A 1ROUA 2CKSA 4KFPA 3UJEA 3NPWA 4N6FA 4E4FA 5LIWX 1PINA 3RCNA 3H2OA 4ZSUA 3RIKA 2FKPA 1QBAA 3UYIA 6XIMA 3WQGA 4JNMA 3EKGA 4EXAA 1LOSA 3VKAA 1MSSA 1XPGA 3G1SA 3WLNA 4LB4A 3SM0A 3GY1A 3R58A 1SO6A 3AZTA 4OQVA 3VFCA 4LUIA 1E70M 4HNNA 3O5PA 4AXKA 1LF1A 5HR7A 5JH1A 5KTLA 4GO9A 1PV8A 2E9BA 2MNRA 4M56A 1M7PA 5DRCA 2J7HA 3MKKA 1VHNA 3CYVA 1TJRA 1R3SA 2Y88A 1D7JA 3PF3A 2V5BA 4G56A 4QE5A 4JIQA 2D0GA 3L7RA 3GK0A 4QAWA 4S23A 3W6YA 5F2IA 1XR2A 3MHFA 3W73A 3W7PA 1MEIA 4XQ6A 3G77A 1EIBA 1UCWA 3G1VA 2ONEA 5D9OA 5KSWA 2A3LA 3EWXA 1OABA 4Q8WA 5DMNA 3W2KA 3NVTA 1H0IA 1MQPA 3OLIA 5MKGA 1LQ0A 5AB3A 4ODOA 4U3AA 3OIXA 2FVKA 4NJJA 3CAKA 3QW4B 5A6MA 1TPH1 3TU9A 4GC3A 5H8UA 1GZ1A 2WJZA 4JTIA 2J74A 1IGSA 3CZEA 5BOFA 1XCWA 1ZTVA 5AHNA 4MGGA 5HOSA 2N87A 2ZQVA 2WSQA 3GDKA 1AK5A 3ERPA 1AQFA 4AEOA 2Z1VA 2ZVRA 1KFJA 3GFYA 3QTPA 2J77A 4UTIA 2CLOA 1UQYA 3CK5A 1E4IA 1K70A 2ZICA 3GHRA 4LJ3A 4KRUA 2OO0A 1BG4A 3RM9A 1W9UA 2ZOXA 1R87A 3TYEA 3IUHA 1BKSA 3RYSA 3FHAA 2DH2A 3SFKA 5F1VA 2OYKA 1UD4A 5I2UA 1JPMA 4O2TA 1SZGA 4Q8TA 4MZYA 3TTSA 1Z6KA 3N14A 2I9UA 4OTKA 5J8LA 2DU2A 1OADA 5FJIA 3UWYA 2OT1A 1PYMA 4GQQA 1JDFA 1HW6A 3T0CA 5KMYA 3EZ4A 5LNRA 4KS0A 2C7FA 3B0UX 1VKFA 1PUDA 2BY2A 1NQKA 3O5JA 3UVAA 4ZO7A 1XISA 1VEMA 2Y5EA 4X3ZA 5CZSA 4CLMA 4JTLA 1YPFA 1JYNA 3RO8A 1IT8A 3EX2A 3GNOA 4BZYA 2Q8LA 1XIJA 4PUUA 1XRFA 4UR8A 1P7TB 5DY3A 1Q65A 2ISFA 3ISIX 4V27A 1W3TA 2XGBA 2EXOA 3T2PA 4DRSA 3LSBA 3L0NA 3WEMA 2EGZA 4MYAA