1Q6HA

Crystal structure of a truncated form of fkpa from escherichia coli
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
210
structure length
210
Chain Sequence
AFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase fkpA
publication title Structural and functional studies of FkpA from Escherichia coli, a cis/trans peptidyl-prolyl isomerase with chaperone activity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 69
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2003-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF01346 FKBP_N Domain amino terminal to FKBP-type peptidyl-prolyl isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.460 Mainly Alpha Orthogonal Bundle Helix Hairpins Peptidyl-prolyl cis-trans isomerase, FKBP-type, N-terminal domain 1q6hA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1q6hA02
4JFMA 1U79A 3LUOA 1J4RA 1NSGA 3O5MA 3WH0A 3H9RB 4LAYA 3IK8A 2ZQUA 5DIVA 2PV3A 2MPHA 4U84A 3UI5A 3UQIA 3UQAA 1ROUA 1BKFA 2PV2A 4IQCA 2PBCA 4U86A 1Y0OA 1TCOC 3TCZA 1FKSA 1QPLA 1ZCNA 2KE0A 2K8IA 3O5JA 2M1IA 3PA7A 4DH0A 4G2PA 3ODKA 2KFWA 5DIUA 3O5FA 2VCDA 5GPGA 2XP5A 4TW8A 1HXVA 4J4NA 4TW7A 2FKEA 1FAPA 2KI3A 1EQ3A 5HW6A 5HW8A 1A7XA 2ZR4A 3O5OA 1Q1CA 1JNTA 1D6OA 3O5LA 2ZQTA 3KCEA 3VAWA 2Y78A 3UI6A 4DROA 2PV1A 1ZK6A 4ODNA 2XPAA 4W9PA 2F2DA 3FAPA 3B09A 2ZQVA 4W9QA 2ITKA 4DRMA 5J6EA 4FAPA 2XP7A 4BF8A 2MLZA 5HKGA 3IHZA 1KT1A 2MF9A 4FN2A 4ODMA 4QIBA 3KABA 4ODPA 2LGOA 5HWCA 4ODOA 1YATA 2FAPA 4MGVA 4DIPA 2PPPA 4DRIA 4DZ2A 1L1PA 1Q6UA 1KT0A 2L2SA 5B8IC 3KZ7A 2D9FA 1NMWA 3KACA 3RFWA 2F21A 2UZ5A 5D75A 3NRKA 4ODKA 3CGMA 3MDYB 2DG4A 4TX0A 3O5IA 1FKIA 3O5QA 2ZQSA 3CGNA 2OFNA 1Q6IA 1W26A 1YW5A 1FKHA 2MLXA 3TDBA 2LPVA 3EY6A 5HWBA 1B6CA 3GPKA 4IQ2A 5I98A 4J4OA 2JZVA 1FKGA 4DZ3A 1T11A 4R0XA 4DRPA 3I6CA 2RUQA 4MSPA 1D7JA 3O5GA 1ROTA 3PRDA 4JFKA 2RQSA 3UF8A 1QZ2A 4DRHA 3UQBA 2LKNA 3KADA 2IF4A 2MNTA 2XP8A 4N19A 2ZR6A 3UI4A 2N87A 1JNSA 3O5RA 3TC5A 5HTGA 1FD9A 3IKGA 3KAHA 5HUAA 1FKJA 2Q5AA 4G50A 3O5DA 1R9HA 1FKLA 1P5QA 1FJDA 5BXJA 1JVWA 3IKDA 1N1AA 2RSEA 1J6YA 1J4IA 5HT1A 4U85A 1D7IA 4O2TA 1EYMA 4DRQA 3KAGA 4TNSA 4C02B 4TYOA 1FKRA 2DG9A 3O5PA 1FKKA 4JFIA 3O5KA 1F8AB 1FKTA 3JXVA 1PBKA 4GIVA 1FKBA 3RGCA 2MLYA 1C9HA 2XP4A 1BL4A 1M5YA 1J4HA 2RUCA 4JFJA 2XPBA 4LAVA 2XP6A 4ODQA 4QT3A 1FKFA 4TW6A 4DRKA 1F40A 3PRBA 2M08A 4JFLA 1PINA 2KGJA 2XP9A 3NTPA 3O5EA 4JYSA 4DT4A 2RUDA 2PPOA 3JYJA 4NNRA 4LAXA 3JYMA 1Q6HA 1D7HA 2ZR5A 1NMVA 4ITZA 1FKDA 3KAIA 4IPXA 4LAWA 5DITA 4ODLA 2AWGA 3OOBA 2RURA 1QPFA 4GGQA 5HW7A 2F4EA 2VN1A 4W9OA 2LJ4A 4ODRA 2DG3A 2KO7A 3NI6A 4DRJA 3B7XA 2PPNA 2XP3A 3KAFA 2M2AA 4DRNA 2KR7A 4QT2A
chains in the Genus database with same CATH superfamily
2JS3A 1XUQA 2HP8A 3N2KA 2WLLB 3SPGA 4LGXA 4UFZA 2PV3A 5JQGA 1ZLZA 1SKVA 1ZBCA 1U97A 1XL4A 3CRAA 2NLJC 1W9PA 2PBCA 2E74B 1FKAO 4JI5O 3W7SA 1AP5A 2AXTZ 4JYCA 1M90W 3OAAG 2Y78A 1AILA 5LMUO 1W1PA 3FYEB 4JI6B 1H2GA 2XP7A 1NVPB 2QSAA 3RYHB 1KQSU 3AROA 4I55B 1R3LC 5DO2A 1Q6UA 1BS3A 3OMIB 4J10A 5D75A 3OMNB 2FB5A 1KYOF 4ZPWR 1MOFA 3HKBB 2Y0IA 4LP8A 4KR0B 5LYJA 4HNAA 4JI4O 3WL0A 1P7GA 3CHXA 1K97A 1Z5WA 2JJ1G 1BQ0A 1H8EG 4CC5A 2LKNA 1YF2A 2XP8A 2ZR6A 4I50B 1DK1A 3CCVV 4KL1A 5TISZ 1FFTB 2E5LB 5IWAO 1HJXA 1N1AA 1EBOA 2DJVA 1S5JA 5HT1A 3LNNA 1G4YB 4O2TA 3JD2A 2WLZA 1FKRA 3RVYA 4S3JA 3JASB 1E6RA 3RGCA 1M5YA 1J4HA 1UPGA 4ODQA 2W0FC 5KMGB 2EX3A 2R9AA 1X6NA 4OX9B 3HKDA 1VQ9V 3ZCCA 5JJEB 3L9DA 2OWOA 4CH4A 3LNMB 4ICGA 4NXMO 1P4RA 4GX1A 2VN1A 1XHGA 1GN6A 4MTVA 3E8BA 4KFMA 3EIPA 2X6AA 3FB7C 5CN0A 2DE0X 4TV9B 3VQYA 2V7QG 2A3QA 4U7NA 2QWOB 4NB5A 3ABLB 2IU0A 2P06A 4GX2A 2L35A 4J41A 1K9TA 4QGPA 4O4HB 2Z3YA 3BVOA 1SETA 3SPHA 3OEEG 1OZ0A 3O5LA 5JH7B 2WLLA 4JZGA 4LH6A 5FPOA 3A0BZ 1W1VA 2KQXA 3CMAV 3OA5A 1B6QA 1Q5OA 2UXDB 5HKGA 4CH3A 4ODPA 3K58A 3WQVA 2P6JA 2H3OA 4DV0O 2WSSG 2HJFC 4Z2KA 3LDDA 4X1KB 2ZCEA 1UJWB 4LFBB 4RAIA 4B08A 1EN4A 4I55A 4BWAA 4GX0A 2AZ0A 1VQPV 4QJFB 3VBBA 1VIBA 1XNQO 5KUKA 1V54C 3SYOA 2MNTA 2PTMA 3D3QA 1WLEA 1V55B 1YI2V 1FKJA 3HKBA 1GN2A 4GT1A 2DQ0A 1P84F 3NR7A 5LHIA 1L8DA 4JI3B 5J2UA 1R1BA 4DR3O 3O9OA 1SQBH 3A0HZ 5H5NA 4DV5O 3KAGA 2ZD9A 1F8AB 4JI2O 3FYIB 1GO3F 1WP8A 3E8GA 5LA6B 3FB8C 3DGEA 4AILC 1M57C 4FLTA 1FKFA 1VQ6V 3AQUA 2O57A 2B1IA 5L3EA 4ZHQB 3AG2B 4EB6B 1N0JA 4NKGB 2Y4UA 3JASA 3RYFA 1HNZB 1NH2B 1AVMA 4ODRA 2DG3A 4FPPA 2Q0AA 5D5QA 2WLNA 3CRQA 5KMGA 4E4EA 2ZDIC 5JJJB 3CC4V 5IYCO 4ZKIA 5DIVA 1E6ZA 4U84A 3LSUA 5K1PA 3AS0A 3JAMN 5B5EZ 1IVSA 4X9QA 1KB9F 1XHZA 1FAPA 4TT3G 2JJ2G 5HW6A 1J5EB 3B8NA 4K8ZA 3KCEA 2HVJC 3HPLC 1ZK6A 1QLNA 4ODNA 1AI6A 1ZBWA 2F2DA 3JALB 1IDSA 2F93B 4BF8A 1IZ3A 3ASNC 1I94O 2WLIB 2YIAA 4ODOA 5HFMA 1IX9A 3E35A 1R3IC 5JH7A 3HB3B 4NTXA 2AZ2A 3I56V 2BTQA 2Q69A 1HW7A 3RFWA 3L72H 4H37A 3MHSC 2K9PA 4G28B 2M6YA 3CCUV 1DLBA 1JR9A 4B3TO 2QEXV 2P4VA 2XTAA 4DV1B 2UU9B 3GPKA 2JEUA 2Q7EA 4UUJC 4D7TA 1NT2B 1ROTA 4DRHA 1FFXB 2GV9A 2C2AA 4X1KA 4HBOA 4JZ2A 4PA3A 3WIJA 5LL6Y 2X6BA 3ZN1A 3JSNA 3BA8A 1S5HC 4FM2A 1NI8A 3BFRA 4X20B 2ETNA 3ARXA 2AGAA 2YXLA 3ARPA 1I08A 1QLEB 3ARUA 4UDMA 2RQ6A 4GKKO 4TYOA 1O9GA 4F6RA 3T1HB 1THZA 2WA3A 1XMQO 4X62B 4QZVB 4H13B 1MG1A 4ZI7B 3PN1A 2V4DA 4JYSA 3O5EA 1YJ9V 1NZ6A 5B1NA 1WNOA 1XMOB 3QG5A 1FKDA 2D2CB 2UXCB 3STZC 2YBUA 2K1EA 1XOUA 2NR5A 4I9WA 1IBKO 4DV3B 4DV6O 4LF7O 2ZE5A 1ORQC 4DRNA 3AG4B 3ABTA 1Q86W 1QR9A 4LFCO 3SGIA 3WH0A 4LF8O 5LMNO 3WFVA 4DW0A 2ZQUA 4DR2B 4RUFA 2PV2A 1FKSA 1HNWB 5KHKA 5DIUA 4BAYA 4Z2IA 1Q8IA 3E89A 2CGOA 1J95A 3RBZA 5IYDO 5EZYB 1WA8B 3CCJV 1I5XA 3JSLA 2BSKB 5EBWC 3JARB 2XUMA 1JNDA 4DRMA 3OR7C 4ZS6A 3ABUA 2A79B 4I5SA 1YTFB 3W7WA 1LQ0A 2DT3A 4LFAO 3B8SA 2P22C 2Y69B 2LQTA 4DV2B 2HHHB 3R66A 3EVKA 3G71V 4CH5A 1VARA 1FYJA 4TQDA 1UFIA 4LF4B 3SYCA 1HKIA 2GTAA 2YIBD 3JALA 1O6IA 2DG4A 3PR9A 3L70H 3WG7B 1E1QG 2DSUA 2WLIA 2WA4A 3P30A 3G6LA 1PNMA 4GKJO 4DV7O 3O5GA 2UXBO 2IF4A 3EFFK 5IJ9B 3K08A 3UI4A 3BRCA 1VP7A 3J7AU 2R9RB 3CXCU 3JD3A 5F2VO 4XDJA 4EKWA 5CB4B 1NVPD 1LG2A 1AI4A 4G50A 3O5DA 1BT8A 1FAFA 2ZT9B 3F5WC 3CX5F 1DGSA 4DR4B 4EFEA 3BCCH 1OCRC 4DV4B 1FFXA 3A8TA 4GCZA 4BIZA 5B1AB 5KUMA 3FD9A 4X20A 5B1BC 3ZEDA 2RUCA 4LAVA 1IBMB 2PUSA 4Z2LA 3ICXA 1OCZC 3TCUA 1N4CA 5DM6V 1NTZH 3LDEA 1SQXH 2F4VB 1EZJA 2RURA 5JWPA 2ODMA 3OTOO 1YZBA 2QKCA 3B77A 4ZPTR 1N36B 3QTCA 1OCCB 3B7XA 3ARZA 2KR7A 2F1MA 2LO1A 3W7XA 4UVAA 1WN7A 5DEZA 4PI2A 1N32B 1I0HA 1YHQV 1PL0A 4TQFA 5KLVH 1HNXB 1BKFA 1G8MA 4U86A 3GVMA 3JAWA 4DWSB 1R73A 4IGGA 2K8IA 3ABMC 3C3SA 4FLVA 1H38A 3ZHQA 1FXKB 1K73W 1NKDA 2EZOA 4P30A 2JRIA 1VF6C 3FAPA 4DR6O 1OWQA 1KKCA 4IYHA 3SPJA 2MLZA 3RW0A 3W4RA 2OIEA 3RYCB 2FAPA 5KHIA 4DZ2A 1JX9A 3FB6C 3KACA 4MVOA 2ZE8A 5EZYA 1WA8A 3NRKA 3JARA 3MDYB 3JYCA 5L3CA 3ZHUA 1FKIA 3SJQC 4WK9A 3HKCB 3TDBA 3H1LH 1JPXA 2R72A 1KP3A 3UCSC 1PPJH 4X64O 2JS5A 1WAZA 1KKDA 4DR1O 3W7TA 4LF6B 4X66O 5HUAA 2JIZG 1TAEA 3ASOC 2VWKA 1GM9A 2UXNA 1S77D 2O9OA 2OTJV 2NNUA 4JTAB 5KHGA 5IJ9A 4LF5O 3O5PA 1B3QA 3B4SA 4BR6A 4B3RB 1BHBA 2Q6AA 1FKBA 5CB4A 3E22B 1C9HA 1BL4A 3UM7A 2EJRA 4TW6A 3F7YC 5JCOA 2DYRC 4JFLA 5EIBC 1NTMH 2KG7A 2FTKA 3OOBA 2DT1A 5HW7A 1QPFA 1NU1H 1VEWA 3HKDB 2DSZA 2O92A 5GTHZ 3KAFA 3K04A 2YBTA 2UUBO 4TWKA 1J4RA 3O5MA 1KBHA 3H9RB 4JYYA 5EBMC 3WQWA 4B3MO 4Q20A 2G41A 4UCUA 4JI7B 1RM1C 1VQ7V 2KFWA 1QVGU 1N33B 4JAUA 4J4NA 4YHHB 1XHXA 3BAAA 4WFEA 4RQFA 1Q1CA 1N34O 1IURA 4PA4A 4K8XA 2GHYA 5L3GA 4B7EA 3TJTA 4BIOA 1Z2GA 2ITKA 3AS3A 1W1TA 5HBFA 4FLUA 3KABA 4DW1A 1ZWIC 4FFBA 4WIWA 1FXKA 3CEIA 4YY3O 3LUTB 2XT9A 1KT0A 1FS0G 5EBLC 5KA5A 2DSVA 2DWDC 4ODKA 2QE7G 4L87A 1H2NA 1Q6IA 2MLXA 5H6QA 1FKHA 1CXZB 5CA1B 3RYCA 1P7BA 5C8YB 4DRPA 1TVKB 1BQZA 1R3JC 4FLZA 4AQYB 3UF8A 1LUWA 4PA9A 4LH7A 2QR4A 2Y48A 2G38A 4DRXB 1D5AA 3HKCA 1WAWA 3ZMZA 3ZHTA 3MAQA 1LG1A 4J11A 1FFQA 4NYKA 1ZL1A 3H1IH 5BY1A 4KP4A 3SYAA 1N0NA 5L3DA 3CHCA 2Q73A 1IBLO 3SJAC 2L6LA 1M1KW 1Q3EA 2UUAB 3ZRWB 4F6EA 4DUYB 2UUCB 2EILC 2UXCO 4JFIA 3BY6A 2N74A 5J2UB 1MZEA 1ZX3A 4DYLA 1V54B 5LP6C 4WFFA 2PYLA 2E75B 3B40A 2EULA 5C93A 3DSQA 1TUBA 5KX5B 3CB2A 1ZTEA 1CEZA 1FFRA 3TC5A 5DITA 2RMKB 3D3IA 3U10A 4N21A 4YIOA 4HARA 1FJGO 3ARWA 3E22A 4DRJA 3B9EA 2CTQA 4J9ZB 2V1DA 1K92A 2HVKC 2X7RB 1VQMV 2Z5UA 1K33A 3RYFB 3CP1A 3M99B 3UI5A 2R9IA 5IE9A 2EIMC 1M57B 2ZXWC 1YITV 1EDQA 3RT3C 2ZM6O 5IJ0B 1CPYA 5DEDA 4TW7A 3K57A 4NXNB 3WD1A 1A32A 5HW8A 1A7XA 3VAWA 4RWUA 1GPFA 4HZ3A 4MVUA 4LF4O 3UI6A 2P67A 1VF8A 4TUYB 2QGNA 4W4LA 3RYIB 3WB1A 5B66Z 3QVNA 4PD4F 1KT1A 5BR8O 4GUNA 4B3SB 1E6PA 3G80A 2PPPA 3CHEA 2L2SA 4R50A 2AOSA 2UZ5A 3ZN0A 5DF0A 3K3WA 4KUMA 2EJ7A 1CTNA 2BTQB 1XBLA 4UCSA 1FKGA 4DZ3A 5LGUA 1FXHA 3QO7A 3UKMA 4MSPA 3PRDA 2ZR3A 3ASNB 3GB7C 1Q81W 3U11A 2B1GA 2HJDA 4PA6A 4MTXA 4JYAO 1JNSA 3DTUB 1FD9A 4GYCB 1YTFD 2Q5AA 5CA1A 2E3CA 5C8YA 1R6KA 1TVKA 1K4DC 4DO2A 4DRQA 5JVDB 2F4VO 2IJIA 2VQEB 4WBNB 4DRXA 1W2BU 4KHPO 1FKTA 3UT5A 2LJ2A 4W5UA 1GKFA 5L3FA 2XP4A 4YIPA 2VQFO 4D6TH 1NJIW 4K35A 3H9VA 4DT4A 4JI0B 4FFKA 2PPOA 2IUZA 3K06A 3AG1C 4F6RB 1VF7A 4O4IB 2UXXA 1NMVA 2ZR5A 3ZRWA 4PDLA 1RD6A 1K7DA 2GDSA 5LBQA 1E9LA 4DUZO 3U0ZA 1AB3A 2CE4A 4DR7B 1DF5A 1SQGA 1XNRB 1DF4A 1PNKA 2AHZA 2QWPB 1WPBA 3FB5C 5IYBO 5KX5A 2WAMA 3GWOA 3P3NA 1GTOA 1OJHA 2MPHA 2AHYA 1R6NA 1OV9A 1Q43A 1TCOC 1AJQA 2HR3A 1ZCNA 2M1IA 2XAJA 4UV8A 3CHDA 1JVMA 2Q68A 2R70A 3IGAC 1M4UA 4ASUG 2ZR4A 4LWSA 4DR5B 3RMEA 3T2MA 1M56C 2PYJA 4JI1O 1HKKA 5IJ0A 3WD2A 2EIJC 2QA4V 4J7ZA 1TGOA 1Y76B 4JV5B 4EEQA 4TUYA 2QM4A 4PELA 3ALGA 2ZDIA 5KAFZ 3SJCC 1VF5B 4DWSD 5FNVA 2GBOA 3RYIA 1PD3A 1ITXA 3A0RA 2P5OA 3ARQA 5HWBA 5IYZB 2YEVB 1T11A 2RUQA 3CRCA 1NTKH 5EC2C 2PGGA 3UQ8A 4L8JA 4I7ZB 3AS2A 3IKGA 1SQFA 3WB2A 1SQVH 1E44A 4IIJB 3T1YO 4JI8O 5A2QN 4F4LA 3N27A 1ZSPA 3APQA 4CH6A 3H01A 1UR9A 3K9AA 1XRVA 3WD3A 2BCCH 3O5KA 4BIUA 3P32A 4EFBA 4ML4A 1JMKC 1DTOA 1LNQA 2XP6A 1YJNV 1SQQH 2Q7HA 2XAFA 1PINA 3TXSA 2QM7A 3CCMV 3JYJA 4FLYA 4K0KB 5JVDA 4Z2GA 5LHHA 4IPXA 4X65B 1P49A 4WBNA 3ZMUA 3ZS8C 4W9OA 2JGDB 1OCRB 3OUSA 2LJ4A 4MW3A 5EC1C 2M2AA 2QKSA 4YHHO 4QT2A 2CTPA 3DC5A 4MS2A 4L3NA 2DYSC 3X2QC 4JI5B 1AJPA 4O4IA 3K5MA 5B1BB 4P9PA 4H44B 3MD0A 4FIPC 1NWTA 1OCZB 3KCYA 2JGUA 2W6JG 2PI6A 4PTMA 5LMUB 3O5FA 4I0XB 4TW8A 1MSDA 4RO2A 3APOA 2YSUB 3JAWB 2FMLA 2B31A 3HR0A 2RJZA 1XI1A 4TV8B 3BMBA 3F5TA 1YIJV 3LSQA 3OM3B 1HKJA 1GAXA 3WB0A 1SF9A 1LJYA 1MSWD 4FLXA 4WJXA 4JF3A 1X6LA 4CZZA 4JI6O 2FL4A 1F4MA 4JI4B 3B9AA 3ABMB 1EIBA 4PJ0Z 1XEQA 2Y0PA 1L0NH 3IFXA 4TX0A 2PY5A 2ZQSA 2CK3G 1ZBVA 1TFVA 2WWWA 5BXZA 5CA0B 1SERA 1Y76A 4JFKA 5IY5C 1QZ2A 3UQBA 2ADQB 5IWAB 2HEPA 3CH9A 3KADA 3CRRA 3QO8A 3ARYA 1G6UA 1COWG 3KAHA 4J7KA 3SDLA 1S3JA 4U7OA 1K4CC 3AK1A 2WLMA 4NZCA 1FPOA 5IYZA 3OT7A 1XILA 2ZIMA 2YEVA 2RCVA 1D7IA 1AJNA 5B3SC 3OW2U 4J7JA 3JCZA 3K0DA 2DG9A 1EFRG 2E5LO 4L72B 3KCXA 2XAGA 4X1YB 1VMGA 4IIJA 4PDRA 4NXMB 3PRBA 2WLKA 3G6EV 2EINC 4Q22A 1Y74A 3C90A 2RUDA 1SRYA 3ASOB 3K9SA 1MA1A 1HDJA 3H1HH 4GGQA 1NS1A 4OX9O 1K34A 1H2KA 2KG7B 4YJ3B 3HKEA 5GPRA 1OCOC 4CS2A 3WD0A 4AY1A 3KZIZ 3RN4A 1TUEB 1QU7A 2EIKC 4JFMA 3LUOA 3AEIA 3KG2A 1HWYA 1YDXA 3IK8A 4MAVA 3ZBHA 3PRAA 1VQ5V 4IQCA 3RM4A 2DYRB 2CH7B 3K5OA 1QPLA 2JGDA 4QE9A 4P9OA 4YXWG 3ODKA 1NR7A 1HXVA 4B3SO 4OGQB 1W9VA 1H8HG 4ABMA 4B7KA 1BL8A 3BA9A 2PV1A 3ETQA 3VQVA 1LR1A 1D2KA 3FXYA 3AG3C 4W9QA 4Z1VA 1URFA 1GM7A 4DV0B 3EXAA 1M93A 4QIBA 3Q4HA 4I0XA 1VQKV 1VQNV 4DRIA 3DXRB 1PP9H 2A9HA 2UXDO 2OYQA 2QWQB 1RM1B 4TV8A 4UB6Z 1O9HA 1XNQB 4FFBB 3CGMA 4MSWC 3IJ4A 4LNUA 4FM1A 2OFNA 1HJWA 1YW5A 4DWSA 2A0LA 3EY6A 5I98A 3FFQA 2Q8VA 3B2EE 3AK2A 5LHGA 1D7JA 4LFBO 4LC1A 3QF7A 2BE3A 3CJHB 3OEHG 4H33A 5E1AC 2CGNA 2VQEO 5D5PA 2ZINA 1YSCA 1OGBA 3O5RA 4DV5B 4J9YB 1SS3A 1MNGA 3SR2C 1US6A 3QOKA 1NH6A 2G8ZA 1VF6A 5CA0A 4JI2B 1J4IA 3N2GB 1X4TA 1JQ0A 4PDMA 1AR5A 1JOYA 1SESA 4JI3O 1XREA 1GOIA 1XNRO 2XPBA 4URIA 1VQ8V 1PKXA 1GK9A 3CMEV 1Q7YW 4NNRA 2AWGA 2XASA 3VOUA 1SZTA 1ZB5A 1SR0A 4X1YA 1TUBB 3ABKC 1K9MW 4MVRA 3L71H 1B04A 2EILB 4R8CA 2ESCA 1U79A 2RNBA 1NSGA 1HNZO 4ZOLB 3OUFA 3QNEA 4P8WA 1PNLA 3A2FA 5LP6B 2HKOA 1ZU8A 1Y0OA 3AS1A 3PA7A 4YJ3A 2E76B 2BTOA 4CS4A 5EK0A 3S3WA 1W0KG 1ZUQA 2H94A 3RGBA 1I94B 4FVMA 4DROA 1ZBKA 5B1AC 4LCUC 4XAKA 2CH7A 2AW9A 1J5EO 4MTOA 3CD6V 3BHPA 3UO3A 2EIMB 1GN4A 4MVMA 2ZXWB 1YATA 5LOVB 3RWRD 1IXMA 2IW5A 4B3TB 1FXVA 3AK3A 2F21A 5KHJA 2ATKC 1HJVA 3O5IA 2WM0A 3O5QA 2ZE6A 1Y67A 2LGQA 2YICA 2LPVA 1MZFA 3K03A 1B6CA 4IT4A 4U3JB 2IJJA 2B5UB 2A3EA 3DXRA 3SPIA 3ARTA 2VRZA 1NH2D 2RQSA 2YXHA 5H9CA 2GUZB 3D36C 1Q82W 1HP8A 4DV1O 2UU9O 4DWSC 3CCSV 2IU3A 3NXSA 2DQ3A 4GKKB 1FKLA 4HAMA 1J6YA 2DW4A 1SQPH 3WKZA 1XMQB 4U3FH 4Z1MG 4FM0A 3CJHA 4BW9A 5FPRA 5J9PC 5H6RA 1ENVA 4MNMA 4OPAA 2YDEA 4DRKA 1QBZA 3TETA 1F40A 3FKSG 4O4LB 2M08A 2XAQA 3CCLV 3N2GA 4O2BB 4PI0A 1L0LH 1IBKB 2YXYA 4DV6B 3JYMA 3UT5B 3T1HO 4LF7B 1SA0B 3KAIA 4LFCB 4DXWA 4X62O 1IX5A 2XOKG 5LGTA 4LF8B 5LMNB 1W9UA 4IYIA 2OCCC 4OXSA 2A3BA 1XMOO 2PPNA 3BXWA 1BZKA 4GLXA 1K3EA 3CC2V 2QM8A 4QE7A 2FDMA 4P8VA 4J42A 3OGCC 3B9DA 3UQAA 4DV3O 4KXRA 2CTRA 1JJ2U 1YEWA 2IM9A 2M7WA 4NTWA 3O5JA 4G2PA 3AG1B 4QIWF 1S76D 2EBOA 3T1CA 1UR8A 4H0LB 4DR2O 2KI3A 4O4JB 4R6ZA 4UB8Z 1JNTA 4ZOLA 3JATB 4LFAB 1MMMA 4MVSA 1W59A 1HNWO 1Y6XA 5LP6A 4YJ2A 2ZR2A 3B09A 3CC7V 2IJKA 5J6EA 4FAPA 1OGGA 4WFGA 1W0JG 3IHZA 4ODMA 5HWCA 4LWSB 2DMXA 4MGVA 1AP6A 1BMFG 3IAYA 4XDLA 3CRMA 3K5LA 1X59A 2FYUH 2VS0A 4GKJB 4DV7B 1WJZA 4DV2O 2Q9LA 4DK1A 1F51A 2HHHO 2UXBB 3CGNA 3FX7A 5CA3A 3GWKC 3D8CA 2RDCA 2ITDC 3CSXA 4FMTA 4IQ2A 1AR4A 1M56B 2KB1A 2JZVA 2QTSA 3OE7G 5LOVA 3I6CA 2EIJB 1QHTA 5FNVB 4KQZA 3UO2A 3RM9A 1D2DA 1GH6A 4IHJA 1QR8A 5BMVB 1XL6A 4UVBA 4R7CA 4X89A 4U3JA 2B5UA 2F23A 3OMAB 3BABA 3ARRA 1ZAUA 2QTOA 1QNMA 2GUZA 1B06A 1KD1W 3ETGA 1WPXA 4DR4O 3R65A 5E79Z 4DV4O 2N05A 2Q7GA 4QT3A 3QO5A 3OTOB 3CHFA 3THOA 3MHHC 2ADPA 5DECA 3SPCA 2DWEC 4LAXA 2KSDA 1F23A 1IBMO 4UXNA 2IJHA 2XP3A 2YIBA 1ZL8B 4O4LA 1PV0A 2F95B 4O2BA 1N36O 1SA0A 1QQCA 2X0LA 3TCZA 1BGYH 1BE3H 2ZE7A 1N32O 2XP5A 4DR6B 1HNXO 3O5OA 3RYHA 1D6OA 2ZQTA 2XNDG 1OHHG 2LW1A 3ZHSA 4JTDB 1S5LZ 5JH8A 5GONB 2LP7A 2DYSB 1Z5VA 3X2QB 4ZIBA 3ZRVA 1AR1B 2QKAA 4LF9B 2RN9A 4O4JA 1KFWA 3H1JH 4Q6GA 2OCHA 1L1PA 2F66C 3JATA 4MPKA 4MTFA 1H0IA 2D9FA 2YS8A 1S0VA 3MDSA 2XHBA 2DN9A 4X64B 5EIBD 2CAZC 3E83A 1GMGA 4UCTA 2LFRA 1YJWV 4DR1B 2FKXA 2F43G 2JVDA 4WFHA 4I50A 4UV9A 4J4OA 2KKWA 4X66B 1WNSA 2IH1C 1WP7A 1RPOA 3JD4A 1IXBA 1JNEA 3ALFA 4PHZA 4WFAV 4JASA 2B9ZA 5CBHA 4I4TB 4LF5B 1R9HA 3ZIAG 5LXTB 1AI7A 2H8PC 4LF6O 1AROP 2OT5A 4GX5A 1N8RW 4RQEA 1YCIA 5AG2A 1K8AW 4PA7A 1H2SB 5BMVA 3ZX6A 4PDVA 3CS5A 3JCUZ 3EHBB 3L74H 4MVZA 4ZBMA 5IY5B 4X1IB 2PZSA 4R5EA 1XQ8A 3ZRSA 1GM8A 3ABLC 4WKAA 4B3RO 2QDOA 4TV9A 5ITZB 2UUBB 1CP9A 2WLHA 4E2LA 3K79A 1GUVA 1I7FA 4HBEA 2KO7A 1Y74B 5B3SB 1JA8A 2YC0A 5KAIZ 2XAHA 4B3MB 1H2LA 1D5NA 2ZNJA 3L73H 4O4HA 1RPRA 2N04A 1KU9A 2QJ1A 4DK0A 3UQIA 3HKEB 4J80A 1QCEA 3BPZA 3GTYX 1EZVH 2EINB 3OTFA 1N34B 3CCRV 1HR0B 3PJSK 2JDIG 3ML0A 3CPWU 1ZL8A 1H0GA 5GPGA 3CXHF 2DPEA 5GQBA 1JCHB 4FZ1A 5GTIZ 3C3TA 3S3XA 4JI7O 3J80N 1OCOB 2W0XA 2YIDA 3ZMVA 4W9PA 1N33O 2OLHA 1RFYA 4YY3B 2EIKB 4CBCA 1R6TA 4JTCB 5DN6G 1PM9A 1QVFU 4FZ0A 4Z2HA 3B8MA 2PN0A 2CDYA 1EN5A 1V55C 3AG7A 3RFRA 2WK2A 4DIPA 1VQLV 2HG5C 2PF4E 5B8IC 1E15A 3O65A 1NMWA 3DC6A 2QWRB 1M9NA 3Q4HB 1JFFB 2Q4PA 5GONA 1W26A 2YUAA 2X6CA 5CBGA 4X65O 3FAVB 3OD4A 2A3CA 2Y4TA 3RM8A 3AG3B 4R0XA 3M8AA 4O2AB 3RVZA 3K0GA 4LNUB 2A7WA 4NR1A 5IT9N 1T5EA 3IC9A 4IL6Z 2NN4A 1IBLB 1HKMA 1MABG 3VQXA 5K1XA 3G6BA 4AQYO 3AG2C 2YI9A 4MVQA 3BEHA 5L3BA 1R3KC 1XDCA 4HYOA 5LA6A 2A3AA 2OTLV 4NTYA 4C02B 1H2MA 4BW5A 4ZHQA 1KC8W 4I4TA 2ZKOA 5FL7G 4EB6A 1RP3B 4XBFA 3CZ8A 5LXTA 2VWJA 3T4DA 2P90A 4Q7NA 4QPKA 3P3PA 2UUAO 4DUYO 2UUCO 2HFEC 1FJGB 1W1YA 1EN6A 2Q5ZA 4K3AA 2KGJA 3ZHRA 1Q6HA 4LAWA 2ZIOA 3ETEA 4ODLA 2DT0A 1I5YA 2PI5A 5J2TB 2HLDG 2OIGA 4X1IA 1NWUA 5GW7A 3CE2A 1K5QA 2ZM6B 4FLWA 4Z2JA 4LAYA 1K5SA 5ITZA 4WKHA 1EM1A 4DH0A 4JAVA 2KE0A 1LL7A 1EQ3A 2FKEA 3TK1A 3JD1A 4PV1B 1VQOV 5BR8B 1KP2A 3I55V 1ROPA 4TSFG 3ABKB 4X8AA 3SYPA 2ZQVA 3FY1A 1YVWA 2CTWA 2GTSA 4NXNO 5H2FZ 4LBEC 4CC6A 2Q0OC 2YI8A 5CBFA 3CCEV 4FN2A 1KMIZ 2LW7A 2QWNB 2LGOA 4MNJA 2P7TC 3H1KH 2A06H 1E1RG 1JCHA 3E86A 1VQ4V 3ETDA 1EHNA 3CYOA 5EYPB 2DSWA 1L1FA 4W4KA 4C7UA 2LGWA 5JJNB 3JAKB 1QLEC 2BOCC 2Q67A 1NR1A 3K59A 4IT6A 4JYAB 3ZMSA 1NWSA 3W7UA 2ITCC 2LFSA 4JAAA 3VQWA 4I9QA 5CMUA 3ZJZA 3L75H 4UCOA 5KA6A 4N19A 1JFFA 1G1XB 4UCRA 4UCVA 2IH3C 4QPJA 1Y66A 3T4ZA 3FAVA 2PI4A 4JPRA 4IT5A 1P5QA 1FJDA 4P2ZA 1JVWA 5BZBA 4KHPB 4AHCA 3J81N 1E6NA 4FK5C 4O2AA 3I5DA 1EYMA 2VQFB 3WU2Z 4TNSA 4WF9V 4ZI7A 1U96A 2W6IG 3AG4C 2EZPA 1NQTA 5LGNA 1RSOB 4OPHA 3SJBC 1WB0A 3JXVA 1PBKA 2BOBC 4FJCC 1NBMG 4NSBA 3LDCA 5FLXN 4JFJA 3ARVA 3ZRXA 4DUZB 3G4SV 2CUGA 3NTPA 2XP9A 4DR3B 3N2KB 1M5IA 2MK3A 3E8HA 1D7HA 4ITZA 5JQGB 2ZQMA 3WL1A 3NI6A 4JI0O 3E2EA 3E8FA 2WLYA 3TGUH 4MW8A 1GN3A 4DR7O 5A9GA 5IDJA 4LR3A 2Y69C 3OR6C 1ROUA 4XDKA 4ZPVR 5J2TA 4G2KA 2ARHA 3GU0A 3OGIB 2VCDA 3G67A 2BSKA 4JI1B 4P8XA 4LF9O 3STLC 4CS3A 3M7MX 4A5UB 3WG7C 1TA8A 3CWBH 1WB7A 1KUQA 2OCCB 5KHHA 4AI8A 4MT8A 1BCCH 2XPAA 4X88A 4WCEV 1SZXA 4HBNA 2MF9A 5LYJB 3WD4A 4HNAB 4DR5O 2IBZH 4MTGA 4YJ2B 2MW2B 4S3KA 3ZHVA 4MNKA 1BHAA 2WLJA 2Z0AA 3KZ7A 3CCQV 4G27B 2D3OW 5JCOC 4P8UA 1V9PA 3IC7A 1SYTA 1Q90D 4Z2WA 4RUEA 2ILMA 4JV5O 1Y4MA 3SYQA 2ZNIA 4WFBV 1S72V 2GSMB 4JGSA 5EYPA 1F4NA 2DT2A 1AI5A 3T1YB 4JI8B 2N87A 1SC5B 4D7SA 3K5NA 1JJOA 3JAKA 3KKYA 4TOIA 3ARSA 5HTGA 4GZRB 1F7YA 5B1OA 3ZMTA 5BXJA 3IKDA 5HFLA 2RSEA 3JD0A 1BSMA 2JK5C 4IHJB 1YXBA 4U85A 1OCCC 4QNHB 1WB8A 1FKKA 4GIVA 1PL4A 1LL4A 2MLYA 2P4KA 4WKFA 1LL6A 1NWRA 2WPDG 4N23A 1GRJA 3F7VC 3LSSA 4JYBA 2DOSA 3G6MA 3OFNG 4NVPA 1KECA 1RSOA 1FXKC 4UVCA 2F4EA 3TXQA 1HR0O 4MNLA 1E79G 4K0KO 3D36A 1LUVA 2JEXA 2QF8A
chains in the Genus database with same CATH topology
4L3NA 4LGXA 5DEZA 2PV3A 1ZBCA 1BKFA 1W9PA 1NWTA 2PBCA 4U86A 3TCZA 4DWSB 2K8IA 2PI6A 4PTMA 3O5FA 2XP5A 4TW8A 3O5OA 1D6OA 2ZQTA 2B31A 2Y78A 1W1PA 4QT2A 3FAPA 1OWQA 5JH8A 1HKJA 2XP7A 2MLZA 1LJYA 3AROA 4WJXA 1X6LA 3W4RA 1KFWA 2FAPA 4DZ2A 1L1PA 5DO2A 1Q6UA 4MPKA 1H0IA 2D9FA 3KACA 3B9AA 5D75A 1EIBA 3NRKA 3MDYB 4TX0A 1FKIA 4WK9A 4ZPWR 2ZQSA 1ZBVA 4KR0B 3TDBA 1TFVA 4J4OA 3WL0A 4JFKA 1JNEA 1QZ2A 3UQBA 2LKNA 3ALFA 3CH9A 3KADA 2XP8A 2ZR6A 3ARYA 5HUAA 3KAHA 1R9HA 4NZCA 1HJXA 1N1AA 2O9OA 5HT1A 1D7IA 4O2TA 2WLZA 1FKRA 2DG9A 3O5PA 4L72B 4S3JA 1E6RA 1FKBA 3RGCA 1C9HA 4R5EA 1BL4A 1M5YA 1J4HA 4ODQA 4TW6A 1X6NA 3PRBA 4JFLA 4WKAA 4Q22A 2RUDA 3OOBA 2DT1A 4GGQA 1QPFA 5HW7A 1GUVA 2VN1A 1XHGA 4MTVA 4HBEA 2DSZA 2O92A 2KO7A 3WD0A 5GPRA 3KAFA 2YBTA 4JFMA 3LUOA 1J4RA 3O5MA 3H9RB 3IK8A 4MAVA 3UQIA 3PRAA 3WQWA 4IQCA 3RM4A 1QPLA 1K9TA 2G41A 3ODKA 2KFWA 5GPGA 1H0GA 1HXVA 2DPEA 4J4NA 1W9VA 5GQBA 3O5LA 1Q1CA 2PV1A 1W1VA 4W9PA 1D2KA 2OLHA 3OA5A 3FXYA 4W9QA 2ITKA 3AS3A 5HKGA 1W1TA 5HBFA 4QIBA 3KABA 4ODPA 4WIWA 4Z2HA 2WK2A 3WQVA 4DIPA 4DRIA 1KT0A 2DSVA 5B8IC 1E15A 1NMWA 4ODKA 3CGMA 4Z2KA 2OFNA 1Q6IA 1W26A 1HJWA 1FKHA 1YW5A 2MLXA 4DWSA 3EY6A 2A3CA 5I98A 3RM8A 4R0XA 4DRPA 1D7JA 3UF8A 2MNTA 1OGBA 3O5RA 1WAWA 1FKJA 1HKMA 1LG1A 1FFQA 1ZL1A 1NH6A 3QOKA 2G8ZA 1J4IA 3CHCA 2A3AA 3KAGA 4C02B 4JFIA 1F8AB 1GOIA 3CZ8A 2XPBA 1FKFA 4Q7NA 3AQUA 4URIA 1W1YA 2KGJA 4NNRA 1Q6HA 1FFRA 3TC5A 4LAWA 5DITA 4ODLA 2AWGA 2DT0A 1ZB5A 4HARA 3ARWA 1SR0A 4ODRA 2DG3A 4DRJA 1NWUA 3B9EA 2ESCA 4Z2JA 1U79A 1NSGA 4LAYA 4P8WA 5DIVA 3UI5A 1E6ZA 4U84A 3AS0A 1ZU8A 4WKHA 1EDQA 1Y0OA 4DH0A 3AS1A 2KE0A 3PA7A 1LL7A 1EQ3A 4TW7A 2FKEA 1FAPA 3WD1A 5HW6A 5HW8A 1A7XA 3VAWA 3KCEA 1GPFA 3UI6A 4DROA 1VF8A 1ZBKA 1ZK6A 4ODNA 4XAKA 1ZBWA 2F2DA 2ZQVA 3FY1A 4BF8A 4FN2A 1KT1A 2LGOA 4MNJA 4ODOA 1YATA 1E6PA 2PPPA 1EHNA 3CHEA 2L2SA 2AOSA 3RFWA 2F21A 2UZ5A 5DF0A 2DSWA 1HJVA 3O5IA 2WM0A 3O5QA 1CTNA 4IT6A 2LPVA 4IT4A 1B6CA 3GPKA 1NWSA 2A3EA 1FKGA 4DZ3A 3ARTA 4MSPA 1ROTA 3PRDA 2RQSA 4DRHA 4N19A 4DWSC 4HBOA 3WIJA 1JNSA 1FD9A 2Q5AA 1FKLA 3ARXA 1P5QA 1FJDA 1JVWA 1J6YA 3ARPA 1E6NA 3WKZA 3ARUA 1EYMA 4DRQA 4TNSA 4TYOA 4MNMA 1WB0A 1FKTA 3JXVA 1PBKA 4NSBA 4W5UA 2XP4A 4JFJA 3ARVA 4DRKA 4QZVB 1F40A 2M08A 3NTPA 2XP9A 3O5EA 4JYSA 4DT4A 2PPOA 2IUZA 1WNOA 3JYMA 1D7HA 2ZR5A 1NMVA 4ITZA 1FKDA 3KAIA 1RD6A 2YBUA 1E9LA 1IX5A 1W9UA 3WL1A 3NI6A 2A3BA 2PPNA 2WLYA 4DRNA 3BXWA 3WH0A 4P8VA 2FDMA 2ZQUA 2MPHA 3B9DA 3UQAA 1ROUA 2PV2A 4ZPVR 1TCOC 1FKSA 1ZCNA 3O5JA 2M1IA 4G2PA 5DIUA 4Z2IA 2VCDA 3CHDA 1UR8A 4P8XA 2KI3A 2ZR4A 1JNTA 3RMEA 2XPAA 1HKKA 3B09A 1JNDA 4DRMA 3WD2A 4FAPA 5J6EA 4ZS6A 1OGGA 1LQ0A 3IHZA 2MF9A 4ODMA 2DT3A 3WD4A 3B8SA 5HWCA 4MGVA 4S3KA 4MNKA 3KZ7A 1HKIA 4P8UA 3ALGA 1O6IA 2DG4A 1SYTA 4DWSD 3PR9A 1ITXA 3CGNA 3ARQA 2DSUA 5HWBA 4IQ2A 3G6LA 2JZVA 1T11A 3I6CA 2RUQA 3O5GA 4KQZA 2DT2A 3RM9A 2IF4A 3UI4A 2N87A 3ARSA 5HTGA 3IKGA 3AS2A 1LG2A 4G50A 3O5DA 5BXJA 3IKDA 2RSEA 4U85A 3ARRA 1XRVA 1UR9A 3WD3A 1FKKA 3O5KA 4GIVA 4ML4A 1LL4A 2MLYA 4WKFA 1LL6A 1NWRA 2RUCA 4LAVA 2XP6A 4QT3A 3CHFA 4Z2LA 1PINA 3G6MA 3JYJA 4LAXA 4Z2GA 4IPXA 2RURA 2F4EA 4ZPTR 4W9OA 2LJ4A 4MNLA 3B7XA 3ARZA 2XP3A 2M2AA 2KR7A 4AY1A 2QF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JFM A;  1U79 A;  3LUO A;  1J4R A;  1NSG A;  3O5M A;  3WH0 A;  3H9R B;  4LAY A;  3IK8 A;  2ZQU A;  5DIV A;  2PV3 A;  2MPH A;  4U84 A;  3UI5 A;  3UQI A;  3UQA A;  1ROU A;  1BKF A;  2PV2 A;  4IQC A;  2PBC A;  4U86 A;  1Y0O A;  1TCO C;  3TCZ A;  1FKS A;  1QPL A;  1ZCN A;  2KE0 A;  2K8I A;  3O5J A;  2M1I A;  3PA7 A;  4DH0 A;  4G2P A;  3ODK A;  2KFW A;  5DIU A;  3O5F A;  2VCD A;  5GPG A;  2XP5 A;  4TW8 A;  1HXV A;  4J4N A;  4TW7 A;  2FKE A;  1FAP A;  2KI3 A;  1EQ3 A;  5HW6 A;  5HW8 A;  1A7X A;  2ZR4 A;  3O5O A;  1Q1C A;  1JNT A;  1D6O A;  3O5L A;  2ZQT A;  3KCE A;  3VAW A;  2Y78 A;  3UI6 A;  4DRO A;  2PV1 A;  1ZK6 A;  4ODN A;  2XPA A;  4W9P A;  2F2D A;  3FAP A;  3B09 A;  2ZQV A;  4W9Q A;  2ITK A;  4DRM A;  5J6E A;  4FAP A;  2XP7 A;  4BF8 A;  2MLZ A;  5HKG A;  3IHZ A;  1KT1 A;  2MF9 A;  4FN2 A;  4ODM A;  4QIB A;  3KAB A;  4ODP A;  2LGO A;  5HWC A;  4ODO A;  1YAT A;  2FAP A;  4MGV A;  4DIP A;  2PPP A;  4DRI A;  4DZ2 A;  1L1P A;  1Q6U A;  1KT0 A;  2L2S A;  5B8I C;  3KZ7 A;  2D9F A;  1NMW A;  3KAC A;  3RFW A;  2F21 A;  2UZ5 A;  5D75 A;  3NRK A;  4ODK A;  3CGM A;  3MDY B;  2DG4 A;  4TX0 A;  3O5I A;  1FKI A;  3O5Q A;  2ZQS A;  3CGN A;  2OFN A;  1Q6I A;  1W26 A;  1YW5 A;  1FKH A;  2MLX A;  3TDB A;  2LPV A;  3EY6 A;  5HWB A;  1B6C A;  3GPK A;  4IQ2 A;  5I98 A;  4J4O A;  2JZV A;  1FKG A;  4DZ3 A;  1T11 A;  4R0X A;  4DRP A;  3I6C A;  2RUQ A;  4MSP A;  1D7J A;  3O5G A;  1ROT A;  3PRD A;  4JFK A;  2RQS A;  3UF8 A;  1QZ2 A;  4DRH A;  3UQB A;  2LKN A;  3KAD A;  2IF4 A;  2MNT A;  2XP8 A;  4N19 A;  2ZR6 A;  3UI4 A;  2N87 A;  1JNS A;  3O5R A;  3TC5 A;  5HTG A;  1FD9 A;  3IKG A;  3KAH A;  5HUA A;  1FKJ A;  2Q5A A;  4G50 A;  3O5D A;  1R9H A;  1FKL A;  1P5Q A;  1FJD A;  5BXJ A;  1JVW A;  3IKD A;  1N1A A;  2RSE A;  1J6Y A;  1J4I A;  5HT1 A;  4U85 A;  1D7I A;  4O2T A;  1EYM A;  4DRQ A;  3KAG A;  4TNS A;  4C02 B;  4TYO A;  1FKR A;  2DG9 A;  3O5P A;  1FKK A;  4JFI A;  3O5K A;  1F8A B;  1FKT A;  3JXV A;  1PBK A;  4GIV A;  1FKB A;  3RGC A;  2MLY A;  1C9H A;  2XP4 A;  1BL4 A;  1M5Y A;  1J4H A;  2RUC A;  4JFJ A;  2XPB A;  4LAV A;  2XP6 A;  4ODQ A;  4QT3 A;  1FKF A;  4TW6 A;  4DRK A;  1F40 A;  3PRB A;  2M08 A;  4JFL A;  1PIN A;  2KGJ A;  2XP9 A;  3NTP A;  3O5E A;  4JYS A;  4DT4 A;  2RUD A;  2PPO A;  3JYJ A;  4NNR A;  4LAX A;  3JYM A;  1Q6H A;  1D7H A;  2ZR5 A;  1NMV A;  4ITZ A;  1FKD A;  3KAI A;  4IPX A;  4LAW A;  5DIT A;  4ODL A;  2AWG A;  3OOB A;  2RUR A;  1QPF A;  4GGQ A;  5HW7 A;  2F4E A;  2VN1 A;  4W9O A;  2LJ4 A;  4ODR A;  2DG3 A;  2KO7 A;  3NI6 A;  4DRJ A;  3B7X A;  2PPN A;  2XP3 A;  3KAF A;  2M2A A;  4DRN A;  2KR7 A;  4QT2 A; 
#chains in the Genus database with same CATH topology
 2JS3 A;  1XUQ A;  2HP8 A;  3N2K A;  2WLL B;  3SPG A;  4LGX A;  4UFZ A;  2PV3 A;  5JQG A;  1ZLZ A;  1SKV A;  1ZBC A;  1U97 A;  1XL4 A;  3CRA A;  2NLJ C;  1W9P A;  2PBC A;  2E74 B;  1FKA O;  4JI5 O;  3W7S A;  1AP5 A;  2AXT Z;  4JYC A;  1M90 W;  3OAA G;  2Y78 A;  1AIL A;  5LMU O;  1W1P A;  3FYE B;  4JI6 B;  1H2G A;  2XP7 A;  1NVP B;  2QSA A;  3RYH B;  1KQS U;  3ARO A;  4I55 B;  1R3L C;  5DO2 A;  1Q6U A;  1BS3 A;  3OMI B;  4J10 A;  5D75 A;  3OMN B;  2FB5 A;  1KYO F;  4ZPW R;  1MOF A;  3HKB B;  2Y0I A;  4LP8 A;  4KR0 B;  5LYJ A;  4HNA A;  4JI4 O;  3WL0 A;  1P7G A;  3CHX A;  1K97 A;  1Z5W A;  2JJ1 G;  1BQ0 A;  1H8E G;  4CC5 A;  2LKN A;  1YF2 A;  2XP8 A;  2ZR6 A;  4I50 B;  1DK1 A;  3CCV V;  4KL1 A;  5TIS Z;  1FFT B;  2E5L B;  5IWA O;  1HJX A;  1N1A A;  1EBO A;  2DJV A;  1S5J A;  5HT1 A;  3LNN A;  1G4Y B;  4O2T A;  3JD2 A;  2WLZ A;  1FKR A;  3RVY A;  4S3J A;  3JAS B;  1E6R A;  3RGC A;  1M5Y A;  1J4H A;  1UPG A;  4ODQ A;  2W0F C;  5KMG B;  2EX3 A;  2R9A A;  1X6N A;  4OX9 B;  3HKD A;  1VQ9 V;  3ZCC A;  5JJE B;  3L9D A;  2OWO A;  4CH4 A;  3LNM B;  4ICG A;  4NXM O;  1P4R A;  4GX1 A;  2VN1 A;  1XHG A;  1GN6 A;  4MTV A;  3E8B A;  4KFM A;  3EIP A;  2X6A A;  3FB7 C;  5CN0 A;  2DE0 X;  4TV9 B;  3VQY A;  2V7Q G;  2A3Q A;  4U7N A;  2QWO B;  4NB5 A;  3ABL B;  2IU0 A;  2P06 A;  4GX2 A;  2L35 A;  4J41 A;  1K9T A;  4QGP A;  4O4H B;  2Z3Y A;  3BVO A;  1SET A;  3SPH A;  3OEE G;  1OZ0 A;  3O5L A;  5JH7 B;  2WLL A;  4JZG A;  4LH6 A;  5FPO A;  3A0B Z;  1W1V A;  2KQX A;  3CMA V;  3OA5 A;  1B6Q A;  1Q5O A;  2UXD B;  5HKG A;  4CH3 A;  4ODP A;  3K58 A;  3WQV A;  2P6J A;  2H3O A;  4DV0 O;  2WSS G;  2HJF C;  4Z2K A;  3LDD A;  4X1K B;  2ZCE A;  1UJW B;  4LFB B;  4RAI A;  4B08 A;  1EN4 A;  4I55 A;  4BWA A;  4GX0 A;  2AZ0 A;  1VQP V;  4QJF B;  3VBB A;  1VIB A;  1XNQ O;  5KUK A;  1V54 C;  3SYO A;  2MNT A;  2PTM A;  3D3Q A;  1WLE A;  1V55 B;  1YI2 V;  1FKJ A;  3HKB A;  1GN2 A;  4GT1 A;  2DQ0 A;  1P84 F;  3NR7 A;  5LHI A;  1L8D A;  4JI3 B;  5J2U A;  1R1B A;  4DR3 O;  3O9O A;  1SQB H;  3A0H Z;  5H5N A;  4DV5 O;  3KAG A;  2ZD9 A;  1F8A B;  4JI2 O;  3FYI B;  1GO3 F;  1WP8 A;  3E8G A;  5LA6 B;  3FB8 C;  3DGE A;  4AIL C;  1M57 C;  4FLT A;  1FKF A;  1VQ6 V;  3AQU A;  2O57 A;  2B1I A;  5L3E A;  4ZHQ B;  3AG2 B;  4EB6 B;  1N0J A;  4NKG B;  2Y4U A;  3JAS A;  3RYF A;  1HNZ B;  1NH2 B;  1AVM A;  4ODR A;  2DG3 A;  4FPP A;  2Q0A A;  5D5Q A;  2WLN A;  3CRQ A;  5KMG A;  4E4E A;  2ZDI C;  5JJJ B;  3CC4 V;  5IYC O;  4ZKI A;  5DIV A;  1E6Z A;  4U84 A;  3LSU A;  5K1P A;  3AS0 A;  3JAM N;  5B5E Z;  1IVS A;  4X9Q A;  1KB9 F;  1XHZ A;  1FAP A;  4TT3 G;  2JJ2 G;  5HW6 A;  1J5E B;  3B8N A;  4K8Z A;  3KCE A;  2HVJ C;  3HPL C;  1ZK6 A;  1QLN A;  4ODN A;  1AI6 A;  1ZBW A;  2F2D A;  3JAL B;  1IDS A;  2F93 B;  4BF8 A;  1IZ3 A;  3ASN C;  1I94 O;  2WLI B;  2YIA A;  4ODO A;  5HFM A;  1IX9 A;  3E35 A;  1R3I C;  5JH7 A;  3HB3 B;  4NTX A;  2AZ2 A;  3I56 V;  2BTQ A;  2Q69 A;  1HW7 A;  3RFW A;  3L72 H;  4H37 A;  3MHS C;  2K9P A;  4G28 B;  2M6Y A;  3CCU V;  1DLB A;  1JR9 A;  4B3T O;  2QEX V;  2P4V A;  2XTA A;  4DV1 B;  2UU9 B;  3GPK A;  2JEU A;  2Q7E A;  4UUJ C;  4D7T A;  1NT2 B;  1ROT A;  4DRH A;  1FFX B;  2GV9 A;  2C2A A;  4X1K A;  4HBO A;  4JZ2 A;  4PA3 A;  3WIJ A;  5LL6 Y;  2X6B A;  3ZN1 A;  3JSN A;  3BA8 A;  1S5H C;  4FM2 A;  1NI8 A;  3BFR A;  4X20 B;  2ETN A;  3ARX A;  2AGA A;  2YXL A;  3ARP A;  1I08 A;  1QLE B;  3ARU A;  4UDM A;  2RQ6 A;  4GKK O;  4TYO A;  1O9G A;  4F6R A;  3T1H B;  1THZ A;  2WA3 A;  1XMQ O;  4X62 B;  4QZV B;  4H13 B;  1MG1 A;  4ZI7 B;  3PN1 A;  2V4D A;  4JYS A;  3O5E A;  1YJ9 V;  1NZ6 A;  5B1N A;  1WNO A;  1XMO B;  3QG5 A;  1FKD A;  2D2C B;  2UXC B;  3STZ C;  2YBU A;  2K1E A;  1XOU A;  2NR5 A;  4I9W A;  1IBK O;  4DV3 B;  4DV6 O;  4LF7 O;  2ZE5 A;  1ORQ C;  4DRN A;  3AG4 B;  3ABT A;  1Q86 W;  1QR9 A;  4LFC O;  3SGI A;  3WH0 A;  4LF8 O;  5LMN O;  3WFV A;  4DW0 A;  2ZQU A;  4DR2 B;  4RUF A;  2PV2 A;  1FKS A;  1HNW B;  5KHK A;  5DIU A;  4BAY A;  4Z2I A;  1Q8I A;  3E89 A;  2CGO A;  1J95 A;  3RBZ A;  5IYD O;  5EZY B;  1WA8 B;  3CCJ V;  1I5X A;  3JSL A;  2BSK B;  5EBW C;  3JAR B;  2XUM A;  1JND A;  4DRM A;  3OR7 C;  4ZS6 A;  3ABU A;  2A79 B;  4I5S A;  1YTF B;  3W7W A;  1LQ0 A;  2DT3 A;  4LFA O;  3B8S A;  2P22 C;  2Y69 B;  2LQT A;  4DV2 B;  2HHH B;  3R66 A;  3EVK A;  3G71 V;  4CH5 A;  1VAR A;  1FYJ A;  4TQD A;  1UFI A;  4LF4 B;  3SYC A;  1HKI A;  2GTA A;  2YIB D;  3JAL A;  1O6I A;  2DG4 A;  3PR9 A;  3L70 H;  3WG7 B;  1E1Q G;  2DSU A;  2WLI A;  2WA4 A;  3P30 A;  3G6L A;  1PNM A;  4GKJ O;  4DV7 O;  3O5G A;  2UXB O;  2IF4 A;  3EFF K;  5IJ9 B;  3K08 A;  3UI4 A;  3BRC A;  1VP7 A;  3J7A U;  2R9R B;  3CXC U;  3JD3 A;  5F2V O;  4XDJ A;  4EKW A;  5CB4 B;  1NVP D;  1LG2 A;  1AI4 A;  4G50 A;  3O5D A;  1BT8 A;  1FAF A;  2ZT9 B;  3F5W C;  3CX5 F;  1DGS A;  4DR4 B;  4EFE A;  3BCC H;  1OCR C;  4DV4 B;  1FFX A;  3A8T A;  4GCZ A;  4BIZ A;  5B1A B;  5KUM A;  3FD9 A;  4X20 A;  5B1B C;  3ZED A;  2RUC A;  4LAV A;  1IBM B;  2PUS A;  4Z2L A;  3ICX A;  1OCZ C;  3TCU A;  1N4C A;  5DM6 V;  1NTZ H;  3LDE A;  1SQX H;  2F4V B;  1EZJ A;  2RUR A;  5JWP A;  2ODM A;  3OTO O;  1YZB A;  2QKC A;  3B77 A;  4ZPT R;  1N36 B;  3QTC A;  1OCC B;  3B7X A;  3ARZ A;  2KR7 A;  2F1M A;  2LO1 A;  3W7X A;  4UVA A;  1WN7 A;  5DEZ A;  4PI2 A;  1N32 B;  1I0H A;  1YHQ V;  1PL0 A;  4TQF A;  5KLV H;  1HNX B;  1BKF A;  1G8M A;  4U86 A;  3GVM A;  3JAW A;  4DWS B;  1R73 A;  4IGG A;  2K8I A;  3ABM C;  3C3S A;  4FLV A;  1H38 A;  3ZHQ A;  1FXK B;  1K73 W;  1NKD A;  2EZO A;  4P30 A;  2JRI A;  1VF6 C;  3FAP A;  4DR6 O;  1OWQ A;  1KKC A;  4IYH A;  3SPJ A;  2MLZ A;  3RW0 A;  3W4R A;  2OIE A;  3RYC B;  2FAP A;  5KHI A;  4DZ2 A;  1JX9 A;  3FB6 C;  3KAC A;  4MVO A;  2ZE8 A;  5EZY A;  1WA8 A;  3NRK A;  3JAR A;  3MDY B;  3JYC A;  5L3C A;  3ZHU A;  1FKI A;  3SJQ C;  4WK9 A;  3HKC B;  3TDB A;  3H1L H;  1JPX A;  2R72 A;  1KP3 A;  3UCS C;  1PPJ H;  4X64 O;  2JS5 A;  1WAZ A;  1KKD A;  4DR1 O;  3W7T A;  4LF6 B;  4X66 O;  5HUA A;  2JIZ G;  1TAE A;  3ASO C;  2VWK A;  1GM9 A;  2UXN A;  1S77 D;  2O9O A;  2OTJ V;  2NNU A;  4JTA B;  5KHG A;  5IJ9 A;  4LF5 O;  3O5P A;  1B3Q A;  3B4S A;  4BR6 A;  4B3R B;  1BHB A;  2Q6A A;  1FKB A;  5CB4 A;  3E22 B;  1C9H A;  1BL4 A;  3UM7 A;  2EJR A;  4TW6 A;  3F7Y C;  5JCO A;  2DYR C;  4JFL A;  5EIB C;  1NTM H;  2KG7 A;  2FTK A;  3OOB A;  2DT1 A;  5HW7 A;  1QPF A;  1NU1 H;  1VEW A;  3HKD B;  2DSZ A;  2O92 A;  5GTH Z;  3KAF A;  3K04 A;  2YBT A;  2UUB O;  4TWK A;  1J4R A;  3O5M A;  1KBH A;  3H9R B;  4JYY A;  5EBM C;  3WQW A;  4B3M O;  4Q20 A;  2G41 A;  4UCU A;  4JI7 B;  1RM1 C;  1VQ7 V;  2KFW A;  1QVG U;  1N33 B;  4JAU A;  4J4N A;  4YHH B;  1XHX A;  3BAA A;  4WFE A;  4RQF A;  1Q1C A;  1N34 O;  1IUR A;  4PA4 A;  4K8X A;  2GHY A;  5L3G A;  4B7E A;  3TJT A;  4BIO A;  1Z2G A;  2ITK A;  3AS3 A;  1W1T A;  5HBF A;  4FLU A;  3KAB A;  4DW1 A;  1ZWI C;  4FFB A;  4WIW A;  1FXK A;  3CEI A;  4YY3 O;  3LUT B;  2XT9 A;  1KT0 A;  1FS0 G;  5EBL C;  5KA5 A;  2DSV A;  2DWD C;  4ODK A;  2QE7 G;  4L87 A;  1H2N A;  1Q6I A;  2MLX A;  5H6Q A;  1FKH A;  1CXZ B;  5CA1 B;  3RYC A;  1P7B A;  5C8Y B;  4DRP A;  1TVK B;  1BQZ A;  1R3J C;  4FLZ A;  4AQY B;  3UF8 A;  1LUW A;  4PA9 A;  4LH7 A;  2QR4 A;  2Y48 A;  2G38 A;  4DRX B;  1D5A A;  3HKC A;  1WAW A;  3ZMZ A;  3ZHT A;  3MAQ A;  1LG1 A;  4J11 A;  1FFQ A;  4NYK A;  1ZL1 A;  3H1I H;  5BY1 A;  4KP4 A;  3SYA A;  1N0N A;  5L3D A;  3CHC A;  2Q73 A;  1IBL O;  3SJA C;  2L6L A;  1M1K W;  1Q3E A;  2UUA B;  3ZRW B;  4F6E A;  4DUY B;  2UUC B;  2EIL C;  2UXC O;  4JFI A;  3BY6 A;  2N74 A;  5J2U B;  1MZE A;  1ZX3 A;  4DYL A;  1V54 B;  5LP6 C;  4WFF A;  2PYL A;  2E75 B;  3B40 A;  2EUL A;  5C93 A;  3DSQ A;  1TUB A;  5KX5 B;  3CB2 A;  1ZTE A;  1CEZ A;  1FFR A;  3TC5 A;  5DIT A;  2RMK B;  3D3I A;  3U10 A;  4N21 A;  4YIO A;  4HAR A;  1FJG O;  3ARW A;  3E22 A;  4DRJ A;  3B9E A;  2CTQ A;  4J9Z B;  2V1D A;  1K92 A;  2HVK C;  2X7R B;  1VQM V;  2Z5U A;  1K33 A;  3RYF B;  3CP1 A;  3M99 B;  3UI5 A;  2R9I A;  5IE9 A;  2EIM C;  1M57 B;  2ZXW C;  1YIT V;  1EDQ A;  3RT3 C;  2ZM6 O;  5IJ0 B;  1CPY A;  5DED A;  4TW7 A;  3K57 A;  4NXN B;  3WD1 A;  1A32 A;  5HW8 A;  1A7X A;  3VAW A;  4RWU A;  1GPF A;  4HZ3 A;  4MVU A;  4LF4 O;  3UI6 A;  2P67 A;  1VF8 A;  4TUY B;  2QGN A;  4W4L A;  3RYI B;  3WB1 A;  5B66 Z;  3QVN A;  4PD4 F;  1KT1 A;  5BR8 O;  4GUN A;  4B3S B;  1E6P A;  3G80 A;  2PPP A;  3CHE A;  2L2S A;  4R50 A;  2AOS A;  2UZ5 A;  3ZN0 A;  5DF0 A;  3K3W A;  4KUM A;  2EJ7 A;  1CTN A;  2BTQ B;  1XBL A;  4UCS A;  1FKG A;  4DZ3 A;  5LGU A;  1FXH A;  3QO7 A;  3UKM A;  4MSP A;  3PRD A;  2ZR3 A;  3ASN B;  3GB7 C;  1Q81 W;  3U11 A;  2B1G A;  2HJD A;  4PA6 A;  4MTX A;  4JYA O;  1JNS A;  3DTU B;  1FD9 A;  4GYC B;  1YTF D;  2Q5A A;  5CA1 A;  2E3C A;  5C8Y A;  1R6K A;  1TVK A;  1K4D C;  4DO2 A;  4DRQ A;  5JVD B;  2F4V O;  2IJI A;  2VQE B;  4WBN B;  4DRX A;  1W2B U;  4KHP O;  1FKT A;  3UT5 A;  2LJ2 A;  4W5U A;  1GKF A;  5L3F A;  2XP4 A;  4YIP A;  2VQF O;  4D6T H;  1NJI W;  4K35 A;  3H9V A;  4DT4 A;  4JI0 B;  4FFK A;  2PPO A;  2IUZ A;  3K06 A;  3AG1 C;  4F6R B;  1VF7 A;  4O4I B;  2UXX A;  1NMV A;  2ZR5 A;  3ZRW A;  4PDL A;  1RD6 A;  1K7D A;  2GDS A;  5LBQ A;  1E9L A;  4DUZ O;  3U0Z A;  1AB3 A;  2CE4 A;  4DR7 B;  1DF5 A;  1SQG A;  1XNR B;  1DF4 A;  1PNK A;  2AHZ A;  2QWP B;  1WPB A;  3FB5 C;  5IYB O;  5KX5 A;  2WAM A;  3GWO A;  3P3N A;  1GTO A;  1OJH A;  2MPH A;  2AHY A;  1R6N A;  1OV9 A;  1Q43 A;  1TCO C;  1AJQ A;  2HR3 A;  1ZCN A;  2M1I A;  2XAJ A;  4UV8 A;  3CHD A;  1JVM A;  2Q68 A;  2R70 A;  3IGA C;  1M4U A;  4ASU G;  2ZR4 A;  4LWS A;  4DR5 B;  3RME A;  3T2M A;  1M56 C;  2PYJ A;  4JI1 O;  1HKK A;  5IJ0 A;  3WD2 A;  2EIJ C;  2QA4 V;  4J7Z A;  1TGO A;  1Y76 B;  4JV5 B;  4EEQ A;  4TUY A;  2QM4 A;  4PEL A;  3ALG A;  2ZDI A;  5KAF Z;  3SJC C;  1VF5 B;  4DWS D;  5FNV A;  2GBO A;  3RYI A;  1PD3 A;  1ITX A;  3A0R A;  2P5O A;  3ARQ A;  5HWB A;  5IYZ B;  2YEV B;  1T11 A;  2RUQ A;  3CRC A;  1NTK H;  5EC2 C;  2PGG A;  3UQ8 A;  4L8J A;  4I7Z B;  3AS2 A;  3IKG A;  1SQF A;  3WB2 A;  1SQV H;  1E44 A;  4IIJ B;  3T1Y O;  4JI8 O;  5A2Q N;  4F4L A;  3N27 A;  1ZSP A;  3APQ A;  4CH6 A;  3H01 A;  1UR9 A;  3K9A A;  1XRV A;  3WD3 A;  2BCC H;  3O5K A;  4BIU A;  3P32 A;  4EFB A;  4ML4 A;  1JMK C;  1DTO A;  1LNQ A;  2XP6 A;  1YJN V;  1SQQ H;  2Q7H A;  2XAF A;  1PIN A;  3TXS A;  2QM7 A;  3CCM V;  3JYJ A;  4FLY A;  4K0K B;  5JVD A;  4Z2G A;  5LHH A;  4IPX A;  4X65 B;  1P49 A;  4WBN A;  3ZMU A;  3ZS8 C;  4W9O A;  2JGD B;  1OCR B;  3OUS A;  2LJ4 A;  4MW3 A;  5EC1 C;  2M2A A;  2QKS A;  4YHH O;  4QT2 A;  2CTP A;  3DC5 A;  4MS2 A;  4L3N A;  2DYS C;  3X2Q C;  4JI5 B;  1AJP A;  4O4I A;  3K5M A;  5B1B B;  4P9P A;  4H44 B;  3MD0 A;  4FIP C;  1NWT A;  1OCZ B;  3KCY A;  2JGU A;  2W6J G;  2PI6 A;  4PTM A;  5LMU B;  3O5F A;  4I0X B;  4TW8 A;  1MSD A;  4RO2 A;  3APO A;  2YSU B;  3JAW B;  2FML A;  2B31 A;  3HR0 A;  2RJZ A;  1XI1 A;  4TV8 B;  3BMB A;  3F5T A;  1YIJ V;  3LSQ A;  3OM3 B;  1HKJ A;  1GAX A;  3WB0 A;  1SF9 A;  1LJY A;  1MSW D;  4FLX A;  4WJX A;  4JF3 A;  1X6L A;  4CZZ A;  4JI6 O;  2FL4 A;  1F4M A;  4JI4 B;  3B9A A;  3ABM B;  1EIB A;  4PJ0 Z;  1XEQ A;  2Y0P A;  1L0N H;  3IFX A;  4TX0 A;  2PY5 A;  2ZQS A;  2CK3 G;  1ZBV A;  1TFV A;  2WWW A;  5BXZ A;  5CA0 B;  1SER A;  1Y76 A;  4JFK A;  5IY5 C;  1QZ2 A;  3UQB A;  2ADQ B;  5IWA B;  2HEP A;  3CH9 A;  3KAD A;  3CRR A;  3QO8 A;  3ARY A;  1G6U A;  1COW G;  3KAH A;  4J7K A;  3SDL A;  1S3J A;  4U7O A;  1K4C C;  3AK1 A;  2WLM A;  4NZC A;  1FPO A;  5IYZ A;  3OT7 A;  1XIL A;  2ZIM A;  2YEV A;  2RCV A;  1D7I A;  1AJN A;  5B3S C;  3OW2 U;  4J7J A;  3JCZ A;  3K0D A;  2DG9 A;  1EFR G;  2E5L O;  4L72 B;  3KCX A;  2XAG A;  4X1Y B;  1VMG A;  4IIJ A;  4PDR A;  4NXM B;  3PRB A;  2WLK A;  3G6E V;  2EIN C;  4Q22 A;  1Y74 A;  3C90 A;  2RUD A;  1SRY A;  3ASO B;  3K9S A;  1MA1 A;  1HDJ A;  3H1H H;  4GGQ A;  1NS1 A;  4OX9 O;  1K34 A;  1H2K A;  2KG7 B;  4YJ3 B;  3HKE A;  5GPR A;  1OCO C;  4CS2 A;  3WD0 A;  4AY1 A;  3KZI Z;  3RN4 A;  1TUE B;  1QU7 A;  2EIK C;  4JFM A;  3LUO A;  3AEI A;  3KG2 A;  1HWY A;  1YDX A;  3IK8 A;  4MAV A;  3ZBH A;  3PRA A;  1VQ5 V;  4IQC A;  3RM4 A;  2DYR B;  2CH7 B;  3K5O A;  1QPL A;  2JGD A;  4QE9 A;  4P9O A;  4YXW G;  3ODK A;  1NR7 A;  1HXV A;  4B3S O;  4OGQ B;  1W9V A;  1H8H G;  4ABM A;  4B7K A;  1BL8 A;  3BA9 A;  2PV1 A;  3ETQ A;  3VQV A;  1LR1 A;  1D2K A;  3FXY A;  3AG3 C;  4W9Q A;  4Z1V A;  1URF A;  1GM7 A;  4DV0 B;  3EXA A;  1M93 A;  4QIB A;  3Q4H A;  4I0X A;  1VQK V;  1VQN V;  4DRI A;  3DXR B;  1PP9 H;  2A9H A;  2UXD O;  2OYQ A;  2QWQ B;  1RM1 B;  4TV8 A;  4UB6 Z;  1O9H A;  1XNQ B;  4FFB B;  3CGM A;  4MSW C;  3IJ4 A;  4LNU A;  4FM1 A;  2OFN A;  1HJW A;  1YW5 A;  4DWS A;  2A0L A;  3EY6 A;  5I98 A;  3FFQ A;  2Q8V A;  3B2E E;  3AK2 A;  5LHG A;  1D7J A;  4LFB O;  4LC1 A;  3QF7 A;  2BE3 A;  3CJH B;  3OEH G;  4H33 A;  5E1A C;  2CGN A;  2VQE O;  5D5P A;  2ZIN A;  1YSC A;  1OGB A;  3O5R A;  4DV5 B;  4J9Y B;  1SS3 A;  1MNG A;  3SR2 C;  1US6 A;  3QOK A;  1NH6 A;  2G8Z A;  1VF6 A;  5CA0 A;  4JI2 B;  1J4I A;  3N2G B;  1X4T A;  1JQ0 A;  4PDM A;  1AR5 A;  1JOY A;  1SES A;  4JI3 O;  1XRE A;  1GOI A;  1XNR O;  2XPB A;  4URI A;  1VQ8 V;  1PKX A;  1GK9 A;  3CME V;  1Q7Y W;  4NNR A;  2AWG A;  2XAS A;  3VOU A;  1SZT A;  1ZB5 A;  1SR0 A;  4X1Y A;  1TUB B;  3ABK C;  1K9M W;  4MVR A;  3L71 H;  1B04 A;  2EIL B;  4R8C A;  2ESC A;  1U79 A;  2RNB A;  1NSG A;  1HNZ O;  4ZOL B;  3OUF A;  3QNE A;  4P8W A;  1PNL A;  3A2F A;  5LP6 B;  2HKO A;  1ZU8 A;  1Y0O A;  3AS1 A;  3PA7 A;  4YJ3 A;  2E76 B;  2BTO A;  4CS4 A;  5EK0 A;  3S3W A;  1W0K G;  1ZUQ A;  2H94 A;  3RGB A;  1I94 B;  4FVM A;  4DRO A;  1ZBK A;  5B1A C;  4LCU C;  4XAK A;  2CH7 A;  2AW9 A;  1J5E O;  4MTO A;  3CD6 V;  3BHP A;  3UO3 A;  2EIM B;  1GN4 A;  4MVM A;  2ZXW B;  1YAT A;  5LOV B;  3RWR D;  1IXM A;  2IW5 A;  4B3T B;  1FXV A;  3AK3 A;  2F21 A;  5KHJ A;  2ATK C;  1HJV A;  3O5I A;  2WM0 A;  3O5Q A;  2ZE6 A;  1Y67 A;  2LGQ A;  2YIC A;  2LPV A;  1MZF A;  3K03 A;  1B6C A;  4IT4 A;  4U3J B;  2IJJ A;  2B5U B;  2A3E A;  3DXR A;  3SPI A;  3ART A;  2VRZ A;  1NH2 D;  2RQS A;  2YXH A;  5H9C A;  2GUZ B;  3D36 C;  1Q82 W;  1HP8 A;  4DV1 O;  2UU9 O;  4DWS C;  3CCS V;  2IU3 A;  3NXS A;  2DQ3 A;  4GKK B;  1FKL A;  4HAM A;  1J6Y A;  2DW4 A;  1SQP H;  3WKZ A;  1XMQ B;  4U3F H;  4Z1M G;  4FM0 A;  3CJH A;  4BW9 A;  5FPR A;  5J9P C;  5H6R A;  1ENV A;  4MNM A;  4OPA A;  2YDE A;  4DRK A;  1QBZ A;  3TET A;  1F40 A;  3FKS G;  4O4L B;  2M08 A;  2XAQ A;  3CCL V;  3N2G A;  4O2B B;  4PI0 A;  1L0L H;  1IBK B;  2YXY A;  4DV6 B;  3JYM A;  3UT5 B;  3T1H O;  4LF7 B;  1SA0 B;  3KAI A;  4LFC B;  4DXW A;  4X62 O;  1IX5 A;  2XOK G;  5LGT A;  4LF8 B;  5LMN B;  1W9U A;  4IYI A;  2OCC C;  4OXS A;  2A3B A;  1XMO O;  2PPN A;  3BXW A;  1BZK A;  4GLX A;  1K3E A;  3CC2 V;  2QM8 A;  4QE7 A;  2FDM A;  4P8V A;  4J42 A;  3OGC C;  3B9D A;  3UQA A;  4DV3 O;  4KXR A;  2CTR A;  1JJ2 U;  1YEW A;  2IM9 A;  2M7W A;  4NTW A;  3O5J A;  4G2P A;  3AG1 B;  4QIW F;  1S76 D;  2EBO A;  3T1C A;  1UR8 A;  4H0L B;  4DR2 O;  2KI3 A;  4O4J B;  4R6Z A;  4UB8 Z;  1JNT A;  4ZOL A;  3JAT B;  4LFA B;  1MMM A;  4MVS A;  1W59 A;  1HNW O;  1Y6X A;  5LP6 A;  4YJ2 A;  2ZR2 A;  3B09 A;  3CC7 V;  2IJK A;  5J6E A;  4FAP A;  1OGG A;  4WFG A;  1W0J G;  3IHZ A;  4ODM A;  5HWC A;  4LWS B;  2DMX A;  4MGV A;  1AP6 A;  1BMF G;  3IAY A;  4XDL A;  3CRM A;  3K5L A;  1X59 A;  2FYU H;  2VS0 A;  4GKJ B;  4DV7 B;  1WJZ A;  4DV2 O;  2Q9L A;  4DK1 A;  1F51 A;  2HHH O;  2UXB B;  3CGN A;  3FX7 A;  5CA3 A;  3GWK C;  3D8C A;  2RDC A;  2ITD C;  3CSX A;  4FMT A;  4IQ2 A;  1AR4 A;  1M56 B;  2KB1 A;  2JZV A;  2QTS A;  3OE7 G;  5LOV A;  3I6C A;  2EIJ B;  1QHT A;  5FNV B;  4KQZ A;  3UO2 A;  3RM9 A;  1D2D A;  1GH6 A;  4IHJ A;  1QR8 A;  5BMV B;  1XL6 A;  4UVB A;  4R7C A;  4X89 A;  4U3J A;  2B5U A;  2F23 A;  3OMA B;  3BAB A;  3ARR A;  1ZAU A;  2QTO A;  1QNM A;  2GUZ A;  1B06 A;  1KD1 W;  3ETG A;  1WPX A;  4DR4 O;  3R65 A;  5E79 Z;  4DV4 O;  2N05 A;  2Q7G A;  4QT3 A;  3QO5 A;  3OTO B;  3CHF A;  3THO A;  3MHH C;  2ADP A;  5DEC A;  3SPC A;  2DWE C;  4LAX A;  2KSD A;  1F23 A;  1IBM O;  4UXN A;  2IJH A;  2XP3 A;  2YIB A;  1ZL8 B;  4O4L A;  1PV0 A;  2F95 B;  4O2B A;  1N36 O;  1SA0 A;  1QQC A;  2X0L A;  3TCZ A;  1BGY H;  1BE3 H;  2ZE7 A;  1N32 O;  2XP5 A;  4DR6 B;  1HNX O;  3O5O A;  3RYH A;  1D6O A;  2ZQT A;  2XND G;  1OHH G;  2LW1 A;  3ZHS A;  4JTD B;  1S5L Z;  5JH8 A;  5GON B;  2LP7 A;  2DYS B;  1Z5V A;  3X2Q B;  4ZIB A;  3ZRV A;  1AR1 B;  2QKA A;  4LF9 B;  2RN9 A;  4O4J A;  1KFW A;  3H1J H;  4Q6G A;  2OCH A;  1L1P A;  2F66 C;  3JAT A;  4MPK A;  4MTF A;  1H0I A;  2D9F A;  2YS8 A;  1S0V A;  3MDS A;  2XHB A;  2DN9 A;  4X64 B;  5EIB D;  2CAZ C;  3E83 A;  1GMG A;  4UCT A;  2LFR A;  1YJW V;  4DR1 B;  2FKX A;  2F43 G;  2JVD A;  4WFH A;  4I50 A;  4UV9 A;  4J4O A;  2KKW A;  4X66 B;  1WNS A;  2IH1 C;  1WP7 A;  1RPO A;  3JD4 A;  1IXB A;  1JNE A;  3ALF A;  4PHZ A;  4WFA V;  4JAS A;  2B9Z A;  5CBH A;  4I4T B;  4LF5 B;  1R9H A;  3ZIA G;  5LXT B;  1AI7 A;  2H8P C;  4LF6 O;  1ARO P;  2OT5 A;  4GX5 A;  1N8R W;  4RQE A;  1YCI A;  5AG2 A;  1K8A W;  4PA7 A;  1H2S B;  5BMV A;  3ZX6 A;  4PDV A;  3CS5 A;  3JCU Z;  3EHB B;  3L74 H;  4MVZ A;  4ZBM A;  5IY5 B;  4X1I B;  2PZS A;  4R5E A;  1XQ8 A;  3ZRS A;  1GM8 A;  3ABL C;  4WKA A;  4B3R O;  2QDO A;  4TV9 A;  5ITZ B;  2UUB B;  1CP9 A;  2WLH A;  4E2L A;  3K79 A;  1GUV A;  1I7F A;  4HBE A;  2KO7 A;  1Y74 B;  5B3S B;  1JA8 A;  2YC0 A;  5KAI Z;  2XAH A;  4B3M B;  1H2L A;  1D5N A;  2ZNJ A;  3L73 H;  4O4H A;  1RPR A;  2N04 A;  1KU9 A;  2QJ1 A;  4DK0 A;  3UQI A;  3HKE B;  4J80 A;  1QCE A;  3BPZ A;  3GTY X;  1EZV H;  2EIN B;  3OTF A;  1N34 B;  3CCR V;  1HR0 B;  3PJS K;  2JDI G;  3ML0 A;  3CPW U;  1ZL8 A;  1H0G A;  5GPG A;  3CXH F;  2DPE A;  5GQB A;  1JCH B;  4FZ1 A;  5GTI Z;  3C3T A;  3S3X A;  4JI7 O;  3J80 N;  1OCO B;  2W0X A;  2YID A;  3ZMV A;  4W9P A;  1N33 O;  2OLH A;  1RFY A;  4YY3 B;  2EIK B;  4CBC A;  1R6T A;  4JTC B;  5DN6 G;  1PM9 A;  1QVF U;  4FZ0 A;  4Z2H A;  3B8M A;  2PN0 A;  2CDY A;  1EN5 A;  1V55 C;  3AG7 A;  3RFR A;  2WK2 A;  4DIP A;  1VQL V;  2HG5 C;  2PF4 E;  5B8I C;  1E15 A;  3O65 A;  1NMW A;  3DC6 A;  2QWR B;  1M9N A;  3Q4H B;  1JFF B;  2Q4P A;  5GON A;  1W26 A;  2YUA A;  2X6C A;  5CBG A;  4X65 O;  3FAV B;  3OD4 A;  2A3C A;  2Y4T A;  3RM8 A;  3AG3 B;  4R0X A;  3M8A A;  4O2A B;  3RVZ A;  3K0G A;  4LNU B;  2A7W A;  4NR1 A;  5IT9 N;  1T5E A;  3IC9 A;  4IL6 Z;  2NN4 A;  1IBL B;  1HKM A;  1MAB G;  3VQX A;  5K1X A;  3G6B A;  4AQY O;  3AG2 C;  2YI9 A;  4MVQ A;  3BEH A;  5L3B A;  1R3K C;  1XDC A;  4HYO A;  5LA6 A;  2A3A A;  2OTL V;  4NTY A;  4C02 B;  1H2M A;  4BW5 A;  4ZHQ A;  1KC8 W;  4I4T A;  2ZKO A;  5FL7 G;  4EB6 A;  1RP3 B;  4XBF A;  3CZ8 A;  5LXT A;  2VWJ A;  3T4D A;  2P90 A;  4Q7N A;  4QPK A;  3P3P A;  2UUA O;  4DUY O;  2UUC O;  2HFE C;  1FJG B;  1W1Y A;  1EN6 A;  2Q5Z A;  4K3A A;  2KGJ A;  3ZHR A;  1Q6H A;  4LAW A;  2ZIO A;  3ETE A;  4ODL A;  2DT0 A;  1I5Y A;  2PI5 A;  5J2T B;  2HLD G;  2OIG A;  4X1I A;  1NWU A;  5GW7 A;  3CE2 A;  1K5Q A;  2ZM6 B;  4FLW A;  4Z2J A;  4LAY A;  1K5S A;  5ITZ A;  4WKH A;  1EM1 A;  4DH0 A;  4JAV A;  2KE0 A;  1LL7 A;  1EQ3 A;  2FKE A;  3TK1 A;  3JD1 A;  4PV1 B;  1VQO V;  5BR8 B;  1KP2 A;  3I55 V;  1ROP A;  4TSF G;  3ABK B;  4X8A A;  3SYP A;  2ZQV A;  3FY1 A;  1YVW A;  2CTW A;  2GTS A;  4NXN O;  5H2F Z;  4LBE C;  4CC6 A;  2Q0O C;  2YI8 A;  5CBF A;  3CCE V;  4FN2 A;  1KMI Z;  2LW7 A;  2QWN B;  2LGO A;  4MNJ A;  2P7T C;  3H1K H;  2A06 H;  1E1R G;  1JCH A;  3E86 A;  1VQ4 V;  3ETD A;  1EHN A;  3CYO A;  5EYP B;  2DSW A;  1L1F A;  4W4K A;  4C7U A;  2LGW A;  5JJN B;  3JAK B;  1QLE C;  2BOC C;  2Q67 A;  1NR1 A;  3K59 A;  4IT6 A;  4JYA B;  3ZMS A;  1NWS A;  3W7U A;  2ITC C;  2LFS A;  4JAA A;  3VQW A;  4I9Q A;  5CMU A;  3ZJZ A;  3L75 H;  4UCO A;  5KA6 A;  4N19 A;  1JFF A;  1G1X B;  4UCR A;  4UCV A;  2IH3 C;  4QPJ A;  1Y66 A;  3T4Z A;  3FAV A;  2PI4 A;  4JPR A;  4IT5 A;  1P5Q A;  1FJD A;  4P2Z A;  1JVW A;  5BZB A;  4KHP B;  4AHC A;  3J81 N;  1E6N A;  4FK5 C;  4O2A A;  3I5D A;  1EYM A;  2VQF B;  3WU2 Z;  4TNS A;  4WF9 V;  4ZI7 A;  1U96 A;  2W6I G;  3AG4 C;  2EZP A;  1NQT A;  5LGN A;  1RSO B;  4OPH A;  3SJB C;  1WB0 A;  3JXV A;  1PBK A;  2BOB C;  4FJC C;  1NBM G;  4NSB A;  3LDC A;  5FLX N;  4JFJ A;  3ARV A;  3ZRX A;  4DUZ B;  3G4S V;  2CUG A;  3NTP A;  2XP9 A;  4DR3 B;  3N2K B;  1M5I A;  2MK3 A;  3E8H A;  1D7H A;  4ITZ A;  5JQG B;  2ZQM A;  3WL1 A;  3NI6 A;  4JI0 O;  3E2E A;  3E8F A;  2WLY A;  3TGU H;  4MW8 A;  1GN3 A;  4DR7 O;  5A9G A;  5IDJ A;  4LR3 A;  2Y69 C;  3OR6 C;  1ROU A;  4XDK A;  4ZPV R;  5J2T A;  4G2K A;  2ARH A;  3GU0 A;  3OGI B;  2VCD A;  3G67 A;  2BSK A;  4JI1 B;  4P8X A;  4LF9 O;  3STL C;  4CS3 A;  3M7M X;  4A5U B;  3WG7 C;  1TA8 A;  3CWB H;  1WB7 A;  1KUQ A;  2OCC B;  5KHH A;  4AI8 A;  4MT8 A;  1BCC H;  2XPA A;  4X88 A;  4WCE V;  1SZX A;  4HBN A;  2MF9 A;  5LYJ B;  3WD4 A;  4HNA B;  4DR5 O;  2IBZ H;  4MTG A;  4YJ2 B;  2MW2 B;  4S3K A;  3ZHV A;  4MNK A;  1BHA A;  2WLJ A;  2Z0A A;  3KZ7 A;  3CCQ V;  4G27 B;  2D3O W;  5JCO C;  4P8U A;  1V9P A;  3IC7 A;  1SYT A;  1Q90 D;  4Z2W A;  4RUE A;  2ILM A;  4JV5 O;  1Y4M A;  3SYQ A;  2ZNI A;  4WFB V;  1S72 V;  2GSM B;  4JGS A;  5EYP A;  1F4N A;  2DT2 A;  1AI5 A;  3T1Y B;  4JI8 B;  2N87 A;  1SC5 B;  4D7S A;  3K5N A;  1JJO A;  3JAK A;  3KKY A;  4TOI A;  3ARS A;  5HTG A;  4GZR B;  1F7Y A;  5B1O A;  3ZMT A;  5BXJ A;  3IKD A;  5HFL A;  2RSE A;  3JD0 A;  1BSM A;  2JK5 C;  4IHJ B;  1YXB A;  4U85 A;  1OCC C;  4QNH B;  1WB8 A;  1FKK A;  4GIV A;  1PL4 A;  1LL4 A;  2MLY A;  2P4K A;  4WKF A;  1LL6 A;  1NWR A;  2WPD G;  4N23 A;  1GRJ A;  3F7V C;  3LSS A;  4JYB A;  2DOS A;  3G6M A;  3OFN G;  4NVP A;  1KEC A;  1RSO A;  1FXK C;  4UVC A;  2F4E A;  3TXQ A;  1HR0 O;  4MNL A;  1E79 G;  4K0K O;  3D36 A;  1LUV A;  2JEX A;  2QF8 A; 
#chains in the Genus database with same CATH homology
 4L3N A;  4LGX A;  5DEZ A;  2PV3 A;  1ZBC A;  1BKF A;  1W9P A;  1NWT A;  2PBC A;  4U86 A;  3TCZ A;  4DWS B;  2K8I A;  2PI6 A;  4PTM A;  3O5F A;  2XP5 A;  4TW8 A;  3O5O A;  1D6O A;  2ZQT A;  2B31 A;  2Y78 A;  1W1P A;  4QT2 A;  3FAP A;  1OWQ A;  5JH8 A;  1HKJ A;  2XP7 A;  2MLZ A;  1LJY A;  3ARO A;  4WJX A;  1X6L A;  3W4R A;  1KFW A;  2FAP A;  4DZ2 A;  1L1P A;  5DO2 A;  1Q6U A;  4MPK A;  1H0I A;  2D9F A;  3KAC A;  3B9A A;  5D75 A;  1EIB A;  3NRK A;  3MDY B;  4TX0 A;  1FKI A;  4WK9 A;  4ZPW R;  2ZQS A;  1ZBV A;  4KR0 B;  3TDB A;  1TFV A;  4J4O A;  3WL0 A;  4JFK A;  1JNE A;  1QZ2 A;  3UQB A;  2LKN A;  3ALF A;  3CH9 A;  3KAD A;  2XP8 A;  2ZR6 A;  3ARY A;  5HUA A;  3KAH A;  1R9H A;  4NZC A;  1HJX A;  1N1A A;  2O9O A;  5HT1 A;  1D7I A;  4O2T A;  2WLZ A;  1FKR A;  2DG9 A;  3O5P A;  4L72 B;  4S3J A;  1E6R A;  1FKB A;  3RGC A;  1C9H A;  4R5E A;  1BL4 A;  1M5Y A;  1J4H A;  4ODQ A;  4TW6 A;  1X6N A;  3PRB A;  4JFL A;  4WKA A;  4Q22 A;  2RUD A;  3OOB A;  2DT1 A;  4GGQ A;  1QPF A;  5HW7 A;  1GUV A;  2VN1 A;  1XHG A;  4MTV A;  4HBE A;  2DSZ A;  2O92 A;  2KO7 A;  3WD0 A;  5GPR A;  3KAF A;  2YBT A;  4JFM A;  3LUO A;  1J4R A;  3O5M A;  3H9R B;  3IK8 A;  4MAV A;  3UQI A;  3PRA A;  3WQW A;  4IQC A;  3RM4 A;  1QPL A;  1K9T A;  2G41 A;  3ODK A;  2KFW A;  5GPG A;  1H0G A;  1HXV A;  2DPE A;  4J4N A;  1W9V A;  5GQB A;  3O5L A;  1Q1C A;  2PV1 A;  1W1V A;  4W9P A;  1D2K A;  2OLH A;  3OA5 A;  3FXY A;  4W9Q A;  2ITK A;  3AS3 A;  5HKG A;  1W1T A;  5HBF A;  4QIB A;  3KAB A;  4ODP A;  4WIW A;  4Z2H A;  2WK2 A;  3WQV A;  4DIP A;  4DRI A;  1KT0 A;  2DSV A;  5B8I C;  1E15 A;  1NMW A;  4ODK A;  3CGM A;  4Z2K A;  2OFN A;  1Q6I A;  1W26 A;  1HJW A;  1FKH A;  1YW5 A;  2MLX A;  4DWS A;  3EY6 A;  2A3C A;  5I98 A;  3RM8 A;  4R0X A;  4DRP A;  1D7J A;  3UF8 A;  2MNT A;  1OGB A;  3O5R A;  1WAW A;  1FKJ A;  1HKM A;  1LG1 A;  1FFQ A;  1ZL1 A;  1NH6 A;  3QOK A;  2G8Z A;  1J4I A;  3CHC A;  2A3A A;  3KAG A;  4C02 B;  4JFI A;  1F8A B;  1GOI A;  3CZ8 A;  2XPB A;  1FKF A;  4Q7N A;  3AQU A;  4URI A;  1W1Y A;  2KGJ A;  4NNR A;  1Q6H A;  1FFR A;  3TC5 A;  4LAW A;  5DIT A;  4ODL A;  2AWG A;  2DT0 A;  1ZB5 A;  4HAR A;  3ARW A;  1SR0 A;  4ODR A;  2DG3 A;  4DRJ A;  1NWU A;  3B9E A;  2ESC A;  4Z2J A;  1U79 A;  1NSG A;  4LAY A;  4P8W A;  5DIV A;  3UI5 A;  1E6Z A;  4U84 A;  3AS0 A;  1ZU8 A;  4WKH A;  1EDQ A;  1Y0O A;  4DH0 A;  3AS1 A;  2KE0 A;  3PA7 A;  1LL7 A;  1EQ3 A;  4TW7 A;  2FKE A;  1FAP A;  3WD1 A;  5HW6 A;  5HW8 A;  1A7X A;  3VAW A;  3KCE A;  1GPF A;  3UI6 A;  4DRO A;  1VF8 A;  1ZBK A;  1ZK6 A;  4ODN A;  4XAK A;  1ZBW A;  2F2D A;  2ZQV A;  3FY1 A;  4BF8 A;  4FN2 A;  1KT1 A;  2LGO A;  4MNJ A;  4ODO A;  1YAT A;  1E6P A;  2PPP A;  1EHN A;  3CHE A;  2L2S A;  2AOS A;  3RFW A;  2F21 A;  2UZ5 A;  5DF0 A;  2DSW A;  1HJV A;  3O5I A;  2WM0 A;  3O5Q A;  1CTN A;  4IT6 A;  2LPV A;  4IT4 A;  1B6C A;  3GPK A;  1NWS A;  2A3E A;  1FKG A;  4DZ3 A;  3ART A;  4MSP A;  1ROT A;  3PRD A;  2RQS A;  4DRH A;  4N19 A;  4DWS C;  4HBO A;  3WIJ A;  1JNS A;  1FD9 A;  2Q5A A;  1FKL A;  3ARX A;  1P5Q A;  1FJD A;  1JVW A;  1J6Y A;  3ARP A;  1E6N A;  3WKZ A;  3ARU A;  1EYM A;  4DRQ A;  4TNS A;  4TYO A;  4MNM A;  1WB0 A;  1FKT A;  3JXV A;  1PBK A;  4NSB A;  4W5U A;  2XP4 A;  4JFJ A;  3ARV A;  4DRK A;  4QZV B;  1F40 A;  2M08 A;  3NTP A;  2XP9 A;  3O5E A;  4JYS A;  4DT4 A;  2PPO A;  2IUZ A;  1WNO A;  3JYM A;  1D7H A;  2ZR5 A;  1NMV A;  4ITZ A;  1FKD A;  3KAI A;  1RD6 A;  2YBU A;  1E9L A;  1IX5 A;  1W9U A;  3WL1 A;  3NI6 A;  2A3B A;  2PPN A;  2WLY A;  4DRN A;  3BXW A;  3WH0 A;  4P8V A;  2FDM A;  2ZQU A;  2MPH A;  3B9D A;  3UQA A;  1ROU A;  2PV2 A;  4ZPV R;  1TCO C;  1FKS A;  1ZCN A;  3O5J A;  2M1I A;  4G2P A;  5DIU A;  4Z2I A;  2VCD A;  3CHD A;  1UR8 A;  4P8X A;  2KI3 A;  2ZR4 A;  1JNT A;  3RME A;  2XPA A;  1HKK A;  3B09 A;  1JND A;  4DRM A;  3WD2 A;  4FAP A;  5J6E A;  4ZS6 A;  1OGG A;  1LQ0 A;  3IHZ A;  2MF9 A;  4ODM A;  2DT3 A;  3WD4 A;  3B8S A;  5HWC A;  4MGV A;  4S3K A;  4MNK A;  3KZ7 A;  1HKI A;  4P8U A;  3ALG A;  1O6I A;  2DG4 A;  1SYT A;  4DWS D;  3PR9 A;  1ITX A;  3CGN A;  3ARQ A;  2DSU A;  5HWB A;  4IQ2 A;  3G6L A;  2JZV A;  1T11 A;  3I6C A;  2RUQ A;  3O5G A;  4KQZ A;  2DT2 A;  3RM9 A;  2IF4 A;  3UI4 A;  2N87 A;  3ARS A;  5HTG A;  3IKG A;  3AS2 A;  1LG2 A;  4G50 A;  3O5D A;  5BXJ A;  3IKD A;  2RSE A;  4U85 A;  3ARR A;  1XRV A;  1UR9 A;  3WD3 A;  1FKK A;  3O5K A;  4GIV A;  4ML4 A;  1LL4 A;  2MLY A;  4WKF A;  1LL6 A;  1NWR A;  2RUC A;  4LAV A;  2XP6 A;  4QT3 A;  3CHF A;  4Z2L A;  1PIN A;  3G6M A;  3JYJ A;  4LAX A;  4Z2G A;  4IPX A;  2RUR A;  2F4E A;  4ZPT R;  4W9O A;  2LJ4 A;  4MNL A;  3B7X A;  3ARZ A;  2XP3 A;  2M2A A;  2KR7 A;  4AY1 A;  2QF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...