1Q6HA

Crystal structure of a truncated form of fkpa from escherichia coli
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
210
structure length
210
Chain Sequence
b'AFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase fkpA
publication title Structural and functional studies of FkpA from Escherichia coli, a cis/trans peptidyl-prolyl isomerase with chaperone activity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 69
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2003-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF01346 FKBP_N Domain amino terminal to FKBP-type peptidyl-prolyl isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.460 Mainly Alpha Orthogonal Bundle Helix Hairpins Peptidyl-prolyl cis-trans isomerase, FKBP-type, N-terminal domain 1q6hA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1q6hA02
1L1PA 1QZ2A 4ODNA 4FAPA 3IHZA 4O2TA 2IF4A 3KAHA 1F40A 2ZR5A 1M5YA 3O5GA 4ODPA 1Q1CA 1FJDA 1J4HA 4ODOA 3OOBA 3UF8A 1D6OA 3O5KA 1FD9A 5HWBA 2M1IA 1FKGA 4DRIA 3PRBA 3FAPA 1BL4A 2KO7A 3MDYB 4U84A 2MPHA 4LAXA 2Q5AA 4ODKA 4MSPA 1FKSA 4TX0A 1N1AA 2F21A 1EYMA 2PPPA 1FKKA 3NI6A 3JYMA 1EQ3A 4J4OA 2D9FA 3WH0A 3O5QA 5HWCA 2XPBA 2KR7A 1QPLA 3GPKA 5HKGA 5GPGA 5HTGA 4W9OA 1P5QA 5HT1A 4BF8A 2K8IA 2MF9A 4DT4A 3PRDA 1HXVA 3UQBA 1Q6HA 4R0XA 4QT2A 5BXJA 5HW7A 1PBKA 4W9PA 1ROUA 2N87A 3UQIA 2PPOA 1FKRA 5DIVA 4ODQA 1Y0OA 1Q6UA 4DRPA 3RFWA 4TNSA 5HW6A 1NMWA 2RUQA 1FKBA 5DIUA 4C02B 2Y78A 3VAWA 3KCEA 3ODKA 4TW7A 1FKDA 4DH0A 2XP4A 4DRJA 3KZ7A 4DROA 1T11A 2FAPA 4DRHA 1J4RA 1D7HA 1NSGA 4J4NA 1J4IA 2ZR6A 3O5EA 3KAGA 2KI3A 1YW5A 3JYJA 3KABA 3O5RA 5DITA 1B6CA 2RUCA 1FKJA 2JZVA 1F8AB 2LPVA 3UQAA 1Q6IA 4DRNA 2XP8A 1KT1A 2MLXA 4FN2A 2LJ4A 2KE0A 1D7JA 3O5IA 2XP5A 2ZQUA 3JXVA 4U86A 2LGOA 4ODRA 4ODMA 1NMVA 4JFKA 4DRQA 4GGQA 4G50A 4QIBA 2RURA 2VCDA 3KADA 3O5PA 4IQ2A 4MGVA 3B7XA 1D7IA 1FKIA 1FKHA 1FKTA 1FKLA 2PV2A 2RQSA 2OFNA 2ZR4A 3O5FA 4U85A 3PA7A 1BKFA 2FKEA 4LAWA 4N19A 4NNRA 3KAFA 4TW6A 4W9QA 1YATA 3O5MA 4TYOA 5HW8A 1QPFA 5HUAA 1ZK6A 4JFLA 4ODLA 2PV3A 4JYSA 2PPNA 3TDBA 5B8IC 3IKGA 1KT0A 2PV1A 1FKFA 3NRKA 1FAPA 4JFMA 5D75A 1ZCNA 3UI6A 2ITKA 1TCOC 4DZ2A 3O5JA 4GIVA 3O5LA 2DG4A 2DG9A 4QT3A 3I6CA 2UZ5A 2XP9A 4TW8A 2L2SA 2ZQVA 3O5DA 3IKDA 3H9RB 3KACA 2AWGA 5J6EA 2VN1A 3UI5A 1ROTA 4JFIA 4JFJA 4IQCA 1PINA 3UI4A 4DZ3A 1A7XA 3O5OA 2ZQTA 1R9HA 2DG3A 2M2AA 3CGNA 2MNTA 3EY6A 2F2DA 2KGJA 2M08A 2PBCA 2RUDA 3B09A 3TCZA 4LAVA 1U79A 3KAIA 3IK8A 3RGCA 4DRKA 2XP7A 2MLZA 3NTPA 2RSEA 1JNTA 4DIPA 2XP6A 2LKNA 4LAYA 4IPXA 1W26A 2XPAA 1C9HA 3CGMA 4G2PA 3TC5A 2KFWA 3LUOA 2ZQSA 5I98A 1J6YA 1JNSA 2F4EA 4ITZA 2MLYA 1JVWA 2XP3A 4DRMA
chains in the Genus database with same CATH superfamily
1N0NA 3K3WA 3CS5A 3F7YC 2ADQB 5HBFA 4LF5B 4O4LA 3VQWA 3CMEV 3Q4HB 3T1HO 2ZXWB 4CC5A 4FFBB 4PHZA 3ZMTA 4DR2B 3HPLC 1W59A 3LSQA 1OCZC 3JSNA 4MSPA 3WL0A 1VP7A 3JYMA 2CTPA 1SQXH 1URFA 1X59A 2EULA 1ZL8A 4H13B 2KKWA 2OIEA 2ZR2A 1F4MA 4R8CA 3WG7C 2AHZA 2HJFC 4L72B 5LP6C 3ZN0A 2EIJC 3M7MX 1E1RG 5EK0A 5IYCO 4ZI7B 2BE3A 4DK1A 4DWSA 1R6NA 3SYCA 3RW0A 2X0LA 3SJCC 4HNAB 4O4IA 1LUVA 2ETNA 4TW7A 3AG4B 1ENVA 5C8YA 2XP4A 2MK3A 3K04A 4JI6B 2GHYA 4JTAB 3CHEA 3G80A 4EB6B 5B1AC 3G6EV 3AS3A 4FN2A 2Z3YA 4YY3O 3QO8A 1D7JA 1FXKC 3JXVA 1KKCA 2RQ6A 4ODRA 3CMAV 1M90W 1GN3A 4NVPA 1CTNA 2V1DA 1S5HC 2DJVA 3ZMVA 4LF6B 4IIJB 1WN7A 1FKTA 1E79G 1ZB5A 4B3TB 5IY5C 4LAWA 1OCOC 1W0JG 5CA1A 2ITDC 5KAIZ 1IX5A 4F6RB 2PV1A 3LNMB 3QVNA 5EZYB 5B1BC 4YHHO 2IJHA 4FM0A 1FFTB 1BMFG 4PJ0Z 2EJ7A 4TW8A 1GMGA 2CUGA 1AJQA 2E5LO 4DV5O 1NTMH 4DR1O 3QOKA 4UXNA 2E3CA 1BSMA 1Q43A 2O9OA 4HZ3A 5LGTA 3HR0A 4UCUA 4H37A 4DRKA 1SQVH 2NNUA 5ITZA 3JAKB 4ZPTR 2LKNA 5L3EA 4JI7B 1DF4A 2CGOA 4H33A 1CEZA 4FM1A 3SJAC 4MNJA 1IXBA 4ODNA 2WPDG 3ETQA 2WK2A 4UV8A 3NXSA 4XDKA 1ZBKA 1CPYA 4J11A 3AEIA 1Q1CA 4DR7O 4IL6Z 4LF5O 1HP8A 2W0XA 2VQFO 3K08A 4C7UA 5L3CA 3BFRA 1YHQV 4P8XA 3ARPA 5JH7A 4Z2KA 2OIGA 5KUKA 4W9OA 1NTKH 2EZOA 5HT1A 3W7TA 1NI8A 4ASUG 4FLZA 4BAYA 2YUAA 2JGDB 1LL7A 2F23A 2OCCB 2QGNA 3CRCA 3HKBA 1TUBB 1FYJA 1LL4A 1ZU8A 1T5EA 3UT5A 2JGUA 4LP8A 3FD9A 3OEHG 4JV5B 4O2AA 3J7AU 1LL6A 4GKJB 2LFRA 1K33A 3FYEB 3K5LA 4CS2A 1AI4A 4JI1B 3L9DA 1OJHA 4WIWA 4D7SA 1YZBA 1XL6A 3OR7C 1IXMA 3QNEA 1B6QA 4TSFG 1FKIA 3IGAC 3KZIZ 4UB8Z 3PA7A 2NLJC 3KCYA 4O4JA 2QF8A 4GX1A 4IT4A 2CAZC 4DV3O 4JYSA 4ODLA 3TDBA 1WNSA 2ITKA 1Y76A 2YI8A 1VQKV 1JFFB 1SKVA 5GW7A 2Y0IA 4DV6B 1AI7A 4P8UA 1MSDA 1HNZB 3WB2A 4LNUA 1ROTA 4JFJA 3ARWA 1L0NH 1WB0A 3ZHQA 1HJVA 2DT3A 1WJZA 4D7TA 1YF2A 4DUYO 2MNTA 2M08A 1N32B 1P49A 1EN6A 1P7GA 3B09A 4LAVA 2ZE5A 3K5MA 5IYZA 4WCEV 2UXBO 1OHHG 5KMGB 1LNQA 1HDJA 1K4DC 4ZHQB 3CHXA 3SPJA 4JI7O 1O6IA 1NWRA 1JJOA 4WBNA 3ARZA 3E35A 2D2CB 4BWAA 2QWNB 4FLTA 1SQFA 1UFIA 5LP6A 1WAZA 4ODOA 2HHHO 4Z2WA 4X89A 4TOIA 5KLVH 2W0FC 4U84A 2PYLA 2DN9A 2UXCB 2LJ2A 4TX0A 2F21A 3W7UA 1E15A 2PPPA 2W6JG 1G4YB 1NJIW 5EBMC 1QHTA 2G38A 2ZE6A 4R7CA 3UQBA 5GONB 4DUZO 4I7ZB 4W9PA 2Q6AA 3RYIA 2DT0A 3ABKC 4Q22A 3WD0A 5GTIZ 1NMWA 5LGNA 1BS3A 2ATKC 2Y4TA 4PA6A 1EZVH 4PV1B 5LBQA 3KZ7A 5J9PC 2F43G 2F66C 1XNRO 2QA4V 3AS0A 5LA6B 1Y74A 4MNLA 2YC0A 4FLVA 3K57A 4DV0B 4O4HB 4LBEC 1BQ0A 2H3OA 4UVCA 3CB2A 4FLWA 2AZ0A 2DOSA 1W9PA 4JFKA 4GGQA 1GH6A 3CCMV 2KQXA 2FTKA 5KHKA 2UUBO 2VS0A 3JALA 1ZAUA 5JCOC 3H01A 1QPFA 4E2LA 3RYFB 4AQYO 4JI5O 1ZK6A 1KT0A 1W1TA 3B4SA 3W7XA 3ETGA 4LGXA 1NT2B 2GTSA 3UKMA 2ZQVA 1D5AA 2DSUA 2QWRB 5BMVB 5DEZA 2JJ1G 1S3JA 2WA3A 2JVDA 3OTOB 2Q9LA 3CGNA 5KHJA 1KB9F 1PM9A 1MZFA 1VF7A 2PBCA 1NR1A 4JYAO 1QLEC 3F5WC 4GYCB 4Z2GA 5B5EZ 4S3KA 2ZQMA 3RVYA 4GKKB 4IHJB 4X66O 1SESA 4X1YA 2ARHA 1Q5OA 3H1LH 4OPHA 5H6QA 1XHXA 2FYUH 1BL8A 5CB4A 3KG2A 5DECA 3T1YB 1NKDA 2Q7HA 3F7VC 1FJGO 4TV9A 1QCEA 4O2BA 1M5IA 2GSMB 3L72H 1FKSA 1F7YA 4LH7A 1EYMA 1JQ0A 2EIKC 1RM1B 5HKGA 5HTGA 4TUYB 1H2SB 3BCCH 4K0KB 1P5QA 2K8IA 5LMUO 2YXHA 5CA3A 1H0IA 5LOVA 3UQIA 2PPOA 1ORQC 3WU2Z 4B3SO 3ZJZA 1XUQA 1GAXA 3Q4HA 4HBNA 5H6RA 1S72V 4DRJA 4URIA 2UXDB 1R3IC 3KABA 2JZVA 4FM2A 1VQOV 2MLXA 4BW9A 1VF6A 3MD0A 2ZCEA 4JI0B 3BRCA 5JH8A 3D3QA 1KKDA 3JD2A 4HNAA 1V55C 4W9QA 3CX5F 2F1MA 4JI8B 1BT8A 5JVDB 4RO2A 2FMLA 2PPNA 3CHFA 3TJTA 1VQ7V 4ZPVR 2X6CA 2MW2B 3I5DA 1M57B 3VBBA 2B1GA 4EB6A 3PRAA 1SZTA 2XP9A 3O5DA 1MABG 5LHIA 1XMOO 1N33B 4RQEA 1BHBA 2VN1A 1WAWA 1E6PA 1J5EO 4LF7B 5BXZA 3N2GB 4DV4B 4GT1A 3EIPA 3BA8A 4IIJA 3IK8A 2PF4E 5BR8B 2RSEA 5IJ9B 4DIPA 4WF9V 3VQVA 1W26A 1VQ6V 3M99B 1JNSA 4H0LB 5EZYA 5EBLC 1MG1A 2XAQA 2HJDA 3H1HH 4NXNB 1TVKB 2WLHA 5J2UA 3IHZA 1IBLO 2YBUA 1SC5B 2EIJB 2QE7G 4OXSA 1WP8A 2LO1A 1VARA 4DV2O 3ABMB 2BCCH 3F5TA 4GX2A 4JI4B 1VQ9V 1OGBA 3LDDA 4JAUA 4MVRA 2KG7A 1GM9A 5B66Z 2HVKC 4NTXA 1L1FA 3JAKA 2GV9A 4I4TA 3ABTA 4UDMA 3CXCU 4KHPO 2UXXA 3IJ4A 4JF3A 3UM7A 4CH6A 1S77D 4Q20A 3RYCB 5IWAO 1JNDA 3ZHVA 2BOCC 4MT8A 3UCSC 5D5PA 1VQLV 3ZIAG 1FXKB 1SERA 3B9AA 1IX9A 3T1HB 2RUQA 2Y78A 1VMGA 3AG3C 3EXAA 3CCLV 1Q86W 4FZ1A 3G71V 1EM1A 3KCXA 4NXMO 3AG2C 1HJWA 4JYBA 3HKCA 1XL4A 3I55V 2O92A 1R73A 4X65O 2VWJA 1Q6IA 5KA6A 3STZC 1OCCC 1K9MW 2XT9A 3OTFA 2R72A 2PYJA 1W1PA 2JGDA 1Q90D 1OV9A 1QU7A 2RN9A 1TUBA 2ZDIA 2FKEA 1G6UA 4W4KA 4TYOA 1ZSPA 4MTOA 2PI5A 4X1IB 2DW4A 3STLC 1G8MA 2YI9A 4YY3B 3K58A 5H9CA 3D36C 1XQ8A 1W0KG 2OWOA 2DWEC 4ABMA 1HJXA 1MA1A 4AILC 5HFLA 1Q3EA 3FB7C 3CRQA 3O5OA 1R9HA 2M2AA 4F4LA 2IUZA 1KP2A 3P30A 2AOSA 1SS3A 2Y0PA 3WD4A 4IYIA 1JMKC 3A0RA 1BZKA 5LL6Y 4LAYA 3JAWB 4YHHB 3DC6A 3FX7A 4CH3A 2P5OA 5JWPA 1JNEA 2PN0A 2E5LB 4DV5B 4O2TA 2VQEO 2Z0AA 4DR1B 1NH6A 1M5YA 1UR8A 1YTFB 1E6NA 3CEIA 1LQ0A 4L3NA 4U7OA 3BVOA 3HKDA 1HNWO 3AS2A 4YJ2B 2YEVB 2D3OW 4DW0A 4JAAA 1R1BA 1P7BA 4JYYA 4Z1MG 2EILC 5CBHA 2HKOA 2IM9A 3B77A 5KMGA 3JD1A 4L8JA 4ZHQA 2EINC 5GQBA 2BTQB 2XAHA 2WLJA 4DR7B 1O9GA 1PV0A 2FKXA 2LW7A 3OMIB 4UVAA 2VQFB 2YIBA 4KUMA 5EIBC 2Q0AA 2Q7GA 4WKFA 1VF5B 2FAPA 3SPCA 1D7HA 4MS2A 2WSSG 1MSWD 4UCOA 3D8CA 4GUNA 1KC8W 2DMXA 2LPVA 4X20B 2ITCC 1COWG 1QR8A 1ZTEA 1KT1A 4ZIBA 3RN4A 4J9YB 4I50B 5GONA 2P67A 2HG5C 4HYOA 2YDEA 2QDOA 3ABMC 3K79A 2QM7A 4ZOLB 1LJYA 4IQ2A 1F23A 4MGVA 3B7XA 1D7IA 1SRYA 3O5FA 4Q6GA 2DWDC 1JX9A 3O5MA 1E6RA 5JQGA 3FAVB 2YIBD 2IU3A 1G1XB 5LA6A 3RYHB 2GDSA 1YVWA 3JARB 3GVMA 3MHSC 4O4HA 3I6CA 3AQUA 2CTRA 2L2SA 3B9DA 4LFCO 1J95A 4CH4A 1NVPB 4B3MO 1EN5A 2DPEA 3ZHSA 2AW9A 4MVQA 1H2LA 3ARVA 2ZNIA 4MTGA 2ZQTA 4DR5O 4QNHB 2F2DA 1LG1A 1K4CC 1UR9A 1D5NA 4DV3B 4DWSD 2Y4UA 3RYFA 2XPAA 2QR4A 1R6KA 5I98A 4UCRA 3LSUA 1K9TA 3DXRA 3CH9A 3BXWA 3CPWU 2FB5A 4CZZA 1OZ0A 3JASA 5IE9A 4KXRA 2XOKG 1F40A 3JYCA 3CCVV 2WLKA 2X6AA 5BMVA 4DUYB 1FD9A 3ABKB 1FS0G 1SETA 1F4NA 3ARQA 3G6LA 3E8GA 3MDYB 3KKYA 4AHCA 1M4UA 1EQ3A 2UXBB 2KR7A 3T1CA 1E9LA 3W7WA 1M9NA 1NWSA 4WFEA 4QPJA 2RMKB 1KYOF 5BXJA 4QT2A 1R3LC 4X64O 1YIJV 3OGCC 4IHJA 4F6EA 1ROUA 2XHBA 1W9UA 4S3JA 1Q6UA 2HHHB 2PI6A 3DSQA 3VAWA 1WP7A 2P6JA 2W6IG 3B40A 1R3JC 2ILMA 4OPAA 1SQBH 5CA0B 1GN6A 4DW1A 1ZX3A 4X1KA 3M8AA 4DRNA 4TUYA 1AJNA 4DUZB 1KBHA 4PDLA 3CP1A 2YXLA 1YCIA 4DRQA 1K5SA 3NR7A 2R70A 2AZ2A 1VQ5V 2QWQB 3GTYX 2Q73A 4CH5A 3KAFA 1IVSA 1XNRB 5GPRA 5HUAA 4XDJA 4K3AA 3E89A 1FKFA 1QLEB 2FL4A 4DR4B 3J80N 4DZ2A 3O5JA 2JIZG 4LR3A 4JTDB 5IDJA 3THOA 4L87A 2AWGA 4MSWC 5B1OA 4MTVA 4FPPA 1R3KC 5DM6V 5KUMA 5EYPB 1XI1A 3K9SA 3ZHRA 3DTUB 2WLZA 2BSKB 1A7XA 3P32A 1H2MA 2UUBB 4UCSA 5IJ0B 2HR3A 1JCHB 1FPOA 3JD3A 2Q5ZA 4J41A 5LYJA 2HLDG 3ASNC 2A0LA 2JJ2G 4JI5B 3ZEDA 4AQYB 2LP7A 3PN1A 1S76D 4KR0B 5JVDA 3QTCA 1XBLA 1C9HA 2JEXA 5EC1C 2EIKB 4J42A 1DGSA 3ARXA 1SF9A 3ZMZA 1F51A 1NQTA 3O5GA 2F95B 3G6MA 1FXHA 3TXSA 3CCJV 4J7ZA 3N2GA 3RMEA 3W4RA 4RQFA 1BL4A 4JYAB 2UUAO 3ZRWB 5HWCA 1W1VA 1QPLA 3GPKA 5GPGA 2N74A 2O57A 3K9AA 4WFGA 4B08A 4X66B 1K8AW 2MF9A 3WD1A 3B8SA 4RUFA 2RCVA 1IBKO 3AK2A 1TVKA 3DC5A 5HW6A 3VQXA 1EIBA 2A79B 1Y66A 4PD4F 1RD6A 1L8DA 4I9WA 3WIJA 3ZRXA 1FJGB 1VQ8V 1IBMO 2L35A 3OEEG 1AILA 2HP8A 1V55B 2B5UB 1H8EG 3N2KB 2ZE7A 5LMUB 3AG7A 1DTOA 4DRXB 2A06H 1U97A 3RGBA 3H1KH 4O4LB 4B3SB 1XDCA 1HKKA 2LGOA 3RYCA 1RSOB 4JZGA 1YEWA 3ARRA 4G50A 2HVJC 4I55B 1FXKA 1K3EA 2ZD9A 5KHHA 4U85A 1GOIA 1WB8A 4MVMA 4R50A 3OFNG 2UUCB 1KU9A 2DYSC 5LMNO 3UO2A 5DO2A 3A0HZ 1X4TA 3O9OA 4NYKA 4EEQA 4X62B 1N36O 4DR4O 4X8AA 4Z2HA 3H9RB 4ML4A 4JFIA 3LDEA 2DSVA 2ZE8A 1AR1B 1E44A 4ZPWR 2RUDA 4B7EA 1N34O 3TCZA 1QR9A 2Z5UA 4UB6Z 3ZX6A 3OR6C 2XP6A 3ML0A 3QO5A 1PKXA 4X1IA 1RP3B 4YIPA 4GX0A 3SYOA 4DYLA 1XMOB 3AROA 1FXVA 3LSSA 1I5XA 4MVOA 1VEWA 1EDQA 3KAHA 1J5EB 2Y48A 4DR3O 1V9PA 4MVZA 1SA0B 2YSUB 1NR7A 1P4RA 4W5UA 3SYQA 5CA1B 3BEHA 2DYRC 3AG3B 4ODKA 1NBMG 3AG2B 1FKKA 4PA9A 1NH2B 4I9QA 3JAWA 3ARSA 3SPGA 5CMUA 2CTWA 3K0GA 3FB8C 5KHGA 1IBLB 3T4DA 2IJJA 2N87A 4ODQA 1OCCB 4YJ3B 1NZ6A 4DV2B 3EFFK 2G41A 3KCEA 1RFYA 3MDSA 4DRHA 1HR0O 4LFAO 4YJ2A 1VQ4V 2KI3A 3JYJA 2OYQA 2YEVA 1BHAA 2XTAA 1SQQH 4CC6A 3UQAA 1Y67A 4KHPB 4OGQB 5IWAB 3CZ8A 1Z5VA 3ZHTA 2ZINA 2YBTA 4P30A 2BTQA 2EIMC 3WD2A 4NXMB 3B9EA 3VQYA 3AK3A 3BABA 2OFNA 3RM8A 1OWQA 4FFBA 5JH7B 3OE7G 2PV3A 4PA3A 1YTFD 3IAYA 4J7KA 4X65B 2UUCO 1ZCNA 3GU0A 5D75A 3UI6A 3E86A 2NN4A 3O5LA 4GX5A 5JJNB 3CD6V 1PL4A 1V54B 4MTXA 4X62O 4DV7O 1ZL1A 3K03A 2WLNA 1PD3A 4I50A 2FDMA 4ZI7A 4E4EA 4WJXA 4J80A 2XUMA 3P3PA 2LFSA 2DT1A 3TETA 2QSAA 1IZ3A 5JJEB 1JNTA 1XILA 1B04A 4KL1A 2PTMA 3WL1A 3CCQV 2WLYA 2E74B 1WA8B 1XRVA 4ITZA 3ALFA 3JSLA 3RYHA 2XP3A 2PZSA 3JARA 2EILB 2DSWA 4FAPA 4GLXA 4N21A 1H2NA 1IURA 2ZR5A 1YJ9V 4IYHA 2EINB 3OOBA 3O5KA 4MPKA 2Q8VA 4JAVA 4O4JB 4NTWA 1LG2A 2A3CA 1DF5A 4EFEA 3CRRA 5K1XA 3X2QC 3CSXA 1Y76B 1Q7YW 4F6RA 1QQCA 1Q6HA 2VQEB 4MW8A 1FKRA 3SJQC 3J81N 1AP6A 1TUEB 2X7RB 4WK9A 2DT2A 4TNSA 2IU0A 1FKBA 3K59A 1AROP 2HFEC 5A9GA 1PP9H 1HNWB 2A3QA 3G4SV 4J7JA 2ZM6O 1XHZA 1NVPD 1NSGA 1AR4A 4JTCB 3E22B 2NR5A 1PNLA 4P9PA 4DXWA 4IT6A 4WBNB 2P90A 2E75B 2LJ4A 4UVBA 4JI3O 4U86A 1QNMA 2XAJA 2ZT9B 4BIZA 1RPOA 4K35A 4LF4O 2GUZB 4TQFA 2A3EA 4JYCA 3FXYA 2V7QG 1W2BU 2H94A 4G2KA 3SYAA 3IFXA 1DK1A 2WA4A 3E8BA 5IYDO 3K5NA 2OLHA 5JCOA 2F4VO 5CA0A 4CBCA 1AB3A 1MZEA 4WFAV 5CBFA 2YICA 2DQ0A 4LF8O 3LNNA 4WFFA 3CXHF 1Y74B 1UJWB 1YSCA 4UCVA 5EC2C 1GRJA 4DR6O 3CHCA 2PGGA 1SQPH 1JVWA 3JATB 1SYTA 4LFCB 4B3MB 1I5YA 4LF9O 2YIAA 1X6NA 2DSZA 2N04A 4DR5B 2AGAA 4JZ2A 5EYPA 1D6OA 4JI2O 3APOA 5IJ0A 2EJRA 1KFWA 1I08A 5CBGA 3OT7A 2QM8A 2QKAA 1JCHA 4LH6A 1AJPA 4X9QA 1PL0A 3OW2U 5B1NA 2XPBA 1K5QA 4BF8A 1V54C 3OUFA 1N8RW 4DT4A 4PDVA 4MNMA 1H38A 1JFFA 5KHIA 1BCCH 1CP9A 4IT5A 2OT5A 4QE7A 3LUTB 1XNQO 1TAEA 4MTFA 4XAKA 3L75H 4DH0A 2ESCA 2WLLB 2Q68A 4QZVB 4LWSB 4TQDA 5FNVB 3WB0A 1ZBVA 1VIBA 1MNGA 5LOVB 3O5RA 5DITA 1YI2V 5FPOA 2RUCA 4X64B 2XP8A 3ZS8C 5D5QA 2XP5A 3BMBA 2V4DA 1R6TA 2RDCA 1JOYA 1BE3H 1ZBWA 1SZXA 1K92A 3RT3C 4UV9A 5TISZ 1BKFA 3ABUA 1YATA 1HWYA 4HAMA 3ZRSA 3JAMN 2IH1C 4U3JB 5L3BA 3ASNB 4PELA 1BQZA 3N2KA 2B9ZA 2LW1A 3APQA 1M93A 2UZ5A 2PUSA 3A2FA 4LCUC 1NTZH 4YXWG 3S3WA 3AK1A 3FYIB 2ZIMA 3L70H 4DRXA 5GTHZ 4TV8B 2GTAA 2JDIG 1N4CA 1HKIA 2K9PA 5LXTB 1RSOA 4I55A 1Q81W 3EY6A 2CH7B 4HBEA 4X88A 5IYBO 2VRZA 3BHPA 4QE9A 2CTQA 3R65A 4OX9O 3ZHUA 4G2PA 2UU9O 3TC5A 1KD1W 2AXTZ 2F4EA 1ZBCA 1LUWA 1EHNA 2YXYA 3E83A 4EKWA 4MNKA 2PY5A 1VQPV 5HWBA 2ZNJA 3A0BZ 4I0XB 4QGPA 1HNXO 3ASOC 2ZIOA 1FFQA 3NI6A 4P8VA 2R9RB 4FK5C 1M56C 4DO2A 3PJSK 4R6ZA 4B3RO 3CRAA 3R66A 4RUEA 2VWKA 1ITXA 2IJIA 3GWOA 3LDCA 2WLIB 4BIOA 4A5UB 4U3FH 1SA0A 2QTSA 2Y69C 3CJHB 3P3NA 2UUAB 2ZR6A 3KAGA 1WPBA 1B6CA 3CRMA 1RPRA 2ADPA 1FKJA 2DYSB 5J2UB 4JGSA 5A2QN 1XHGA 1SR0A 1IBKB 2CK3G 5BY1A 4DV1O 1XMQO 3ARUA 4W4LA 1QBZA 3FFQA 1I94O 5J2TB 4PDMA 3RBZA 4YJ3A 5DEDA 3CYOA 1NWUA 3C90A 5DF0A 3W7SA 1FKLA 2RQSA 1IBMB 2KG7B 4NNRA 4N19A 3ARTA 3C3TA 2RJZA 3TK1A 4I4TB 1D2KA 3ZCCA 1YJWV 1KECA 5KX5B 2A3AA 4RWUA 1BGYH 1FFXB 1NU1H 1W1YA 3EVKA 1TCOC 2QTOA 3BPZA 3AG1B 4UCTA 4J9ZB 2KSDA 4PI2A 1VQNV 3WD3A 4WFBV 1NH2D 3S3XA 3ALGA 3CCRV 3ZMUA 3D36A 5F2VO 3OUSA 3FB5C 1D2DA 1HKMA 3HKEB 3HKCB 2WM0A 4PA7A 1FKAO 3H9VA 4DR2O 5LMNB 5LGUA 2DYRB 4PDRA 2QKCA 3ABLB 3A8TA 3CGMA 3EHBB 3U10A 4BIUA 1N36B 3FY1A 2CDYA 1N0JA 4DRMA 1GK9A 1ZUQA 1H2KA 1QZ2A 2JS3A 4JPRA 4ODPA 2M6YA 1J4HA 4U7NA 2P7TC 3ETDA 1E1QG 3SGIA 1FKGA 1N34B 3OD4A 1CXZB 1ZLZA 4GCZA 3RM4A 1OCRC 4TT3G 5FPRA 2L6LA 3B2EE 2D9FA 4JI6O 3O5QA 3H1IH 3CC4V 3CCUV 2ZKOA 5IT9N 3UO3A 3PRDA 2UXNA 1WA8A 4R0XA 1DLBA 4KQZA 1QVFU 4KFMA 1TFVA 4FLUA 1US6A 1Y0OA 4DR3B 2ZXWC 3RFWA 4FVMA 1I0HA 3ZMSA 1KQSU 5B3SB 2A7WA 2EIMB 4LF6O 1S0VA 2A3BA 3WKZA 2B1IA 2DE0X 4B3TO 2R9IA 1JA8A 4J4NA 3O5EA 4QJFB 4QIWF 1VF6C 4MAVA 4FJCC 5IJ9A 4LFBB 2A9HA 4K8XA 3H1JH 1E6ZA 3BY6A 1EFRG 2ZQUA 4WKHA 4WKAA 3AG4C 2VCDA 3HKDB 1IDSA 4PI0A 4Q7NA 1HR0B 4B7KA 4LFAB 2G8ZA 5HW8A 4N23A 1NS1A 5B8IC 4JFMA 2C2AA 3E22A 4AI8A 2F93B 1GKFA 2WWWA 5EIBD 3JD4A 1OGGA 3UI5A 1JVMA 2YIDA 1ZWIC 3UI4A 3AS1A 2GUZA 3PR9A 4CS3A 2XP7A 3ZRVA 3G6BA 1ZL8B 2CE4A 3X2QB 1NWTA 1K7DA 3OAAG 2IH3C 4DV7B 2P22C 3CC7V 3JCZA 4DWSB 5E1AC 1EZJA 2QEXV 2K1EA 1FJDA 1K34A 4O4IB 3ZN1A 1FFRA 4G28B 2M1IA 5C8YB 1GO3F 5JQGB 3B8NA 2MPHA 4LAXA 2Q5AA 1Z2GA 4FIPC 2B31A 5KA5A 4JV5O 3WH0A 3SPHA 3AG1C 5FLXN 4GKJO 4RAIA 4ICGA 2KB1A 3FB6C 3JATA 4NR1A 3E8FA 3E2EA 5DIVA 2N05A 1FAFA 4JI1O 2GBOA 4FFKA 3SDLA 3BAAA 5H5NA 2M7WA 5E79Z 3IC9A 3WB1A 4YIOA 4CS4A 2RNBA 1H0GA 4ZS6A 3QF7A 3ABLC 1J4IA 1YW5A 3DXRB 3L73H 2AHYA 3JASB 2IJKA 4LFBO 1M1KW 4DV6O 5K1PA 3L71H 2OCCC 4XDLA 3TXQA 1HNZO 4Z2JA 1NMVA 3GB7C 2ZDIC 3T2MA 4HARA 3OA5A 4BR6A 4J10A 2PV2A 4P8WA 1AI6A 2ZM6B 1PNKA 2JRIA 1N32O 5ITZB 4TW6A 2WLLA 2Q4PA 4LWSA 5HFMA 3IKGA 5FNVA 5DN6G 1FAPA 1SQGA 3WFVA 4GIVA 4LC1A 5LHHA 2DG4A 2DG9A 4ZBMA 4JI3B 3BA9A 3IKDA 1L0LH 1WPXA 1YITV 4GZRB 4LF4B 2Q67A 3L74H 3IC7A 3OGIB 4IQCA 1PINA 5B3SC 1GM8A 1GUVA 1KP3A 4TWKA 2Q7EA 1W9VA 3SPIA 1JJ2U 4QPKA 1U79A 2UXCO 5KAFZ 2E76B 1JR9A 4X1KB 4U3JA 2F4VB 3LUOA 2ZQSA 3MAQA 3O65A 4KP4A 4X20A 1L1PA 2BTOA 3T4ZA 1K73W 4LF8B 2EX3A 2PI4A 4TV8A 3HKBB 5LHGA 4K8ZA 2P4VA 4FZ0A 4PA4A 3UT5B 5LXTA 2WAMA 3FAPA 4ZOLA 2KO7A 4NKGB 2CH7A 1ROPA 1VF8A 4O2AB 1N1AA 2XNDG 4DR6B 4J4OA 3FAVA 1A32A 3RM9A 1Y4MA 4DV0O 1HXVA 3E8HA 5HW7A 1PBKA 2P06A 4LF9B 4NZCA 4DRPA 1O9HA 5DIUA 4JI2B 3U0ZA 2WLMA 1QVGU 5LYJB 3ODKA 1FKDA 4UFZA 1GTOA 1Q82W 4I0XA 4WFHA 3CWBH 3ARYA 5AG2A 3TCUA 2QWPB 1Q8IA 1THZA 1EN4A 1XREA 3MHHC 1EBOA 3CC2V 4DWSC 3ETEA 4LNUB 3TGUH 4Z2IA 4PTMA 3CE2A 2EZPA 4ODMA 1XEQA 1XNQB 2WLIA 3OTOO 4R5EA 1UPGA 1FKHA 4FLYA 3CHDA 3CJHA 1KUQA 4JFLA 5IYZB 1TA8A 2ZR3A 1OCZB 5FL7G 3FKSG 3K0DA 3C3SA 1S5LZ 2Q69A 1HW7A 4MVUA 2OTJV 2YS8A 4GKKO 4Z1VA 3WG7B 5J6EA 5LP6B 1B06A 1B3QA 2P4KA 1AR5A 4DZ3A 3T1YO 1AVMA 2DG3A 5J2TA 1X6LA 2KGJA 2H8PC 1VQMV 3RGCA 2MLZA 3NTPA 3ASOB 4NB5A 1WB7A 2QJ1A 2LQTA 5KX5A 1FFXA 2KFWA 4I5SA 1M56B 3ICXA 4K0KO 2MLYA 1MMMA 2DQ3A 5B1AB 3RYIB 4D6TH 3ZBHA 4H44B 5H2FZ 2IF4A 2JEUA 2LGQA 3UF8A 5JJJB 1Z5WA 1P84F 2Q0OC 4DRIA 3PRBA 2JS5A 2R9AA 3HKEA 3OM3B 3B8MA 5IY5B 3OMAB 2Y69B 1OCOB 3DGEA 1AI5A 4OX9B 2UXDO 2QKSA 2UU9B 4EFBA 4XBFA 4ZKIA 1K97A 4MVSA 3K5OA 5B1BB 4JASA 4HBOA 1S5JA 2XAFA 1GN2A 5EBWC 1JPXA 1PNMA 2LGWA 4JI0O 3CCSV 4C02B 3JALB 3RWRD 3SJBC 4G27B 3GWKC 5BZBA 1HNXB 2HEPA 4FMTA 2BSKA 3JD0A 1AP5A 4DROA 1GM7A 1T11A 1RM1C 4Z2LA 4MW3A 1J4RA 4AY1A 2IW5A 5L3FA 3SYPA 4JI8O 4BW5A 1F8AB 2XAGA 2OTLV 4B3RB 3JCUZ 5L3GA 3U11A 2KE0A 2IBZH 1Y6XA 3O5IA 4IGGA 1LR1A 4NSBA 3N27A 3CCEV 2CGNA 1N33O 4P9OA 1WLEA 1GPFA 4P2ZA 4QIBA 2RURA 3KADA 3O5PA 1XOUA 4LF7O 4DV4O 2ZR4A 4FLXA 1MOFA 2BOBC 3K06A 5CN0A 3WQVA 1PPJH 2OCHA 5BR8O 3NRKA 3HB3B 3RFRA 3QO7A 3ZRWA 3I56V 1H8HG 3OMNB 3D3IA 4DK0A 1YJNV 4X1YB 4QT3A 1U96A 2X6BA 3G67A 1I7FA 3SR2C 3QG5A 2QM4A 3WQWA 3KACA 5L3DA 4NXNO 4DV1B 1XMQB 5CB4B 1YDXA 2XASA 1I94B 3RVZA 4NTYA 3UQ8A 2ODMA 4TV9B 1GN4A 4O2BB 4JI4O 5C93A 3KAIA 3VOUA 1KMIZ 1M57C 4UUJC 4IPXA 1H2GA 1HKJA 2EBOA 1YXBA 2JK5C 1OCRB 1J6YA 1QLNA 2B5UA 1TGOA 2QWOB 1WNOA
chains in the Genus database with same CATH topology
1QZ2A 3IHZA 5HBFA 3KAHA 1EDQA 2YBUA 4ODPA 1J4HA 1FKGA 4W5UA 1OGBA 4ODKA 3RM4A 4MSPA 3WL0A 1FKKA 3JYMA 2D9FA 3O5QA 3PRDA 3ARSA 4L72B 4R0XA 4KQZA 1TFVA 2N87A 1JNDA 4ODQA 1Y0OA 3RFWA 4DWSA 3B9AA 2RUQA 2G41A 2Y78A 3KCEA 4TW7A 2A3BA 2XP4A 3WKZA 4DRHA 1HJWA 4J4NA 3O5EA 2KI3A 3JYJA 4MAVA 2O92A 3CHEA 3UQAA 1Q6IA 3AS3A 1E6ZA 4FN2A 3CZ8A 1D7JA 2ZQUA 3JXVA 4ODRA 4WKHA 2YBTA 1CTNA 1W1PA 4WKAA 2VCDA 3WD2A 3B9EA 1FKTA 4Q7NA 1ZB5A 2OFNA 3RM8A 4LAWA 2FKEA 1OWQA 2G8ZA 5HW8A 4TYOA 2PV3A 5B8IC 1IX5A 2PV1A 4JFMA 5D75A 1ZCNA 3UI6A 3O5LA 4TW8A 1ZL1A 1OGGA 3UI5A 1HJXA 2FDMA 3QOKA 3UI4A 3O5OA 3AS1A 1R9HA 2M2AA 4WJXA 2IUZA 3PR9A 2O9OA 2DT1A 2AOSA 3WD4A 4DRKA 2XP7A 1JNTA 4ZPTR 2LKNA 4LAYA 3WL1A 1NWTA 2WLYA 1XRVA 4ITZA 3ALFA 1JNEA 2XP3A 4MNJA 2DSWA 4ODNA 4FAPA 4O2TA 2WK2A 4DWSB 1NH6A 1UR8A 1M5YA 1ZBKA 2ZR5A 1Q1CA 1FJDA 1E6NA 1FFRA 3OOBA 3O5KA 4MPKA 1LQ0A 4L3NA 2M1IA 1LG2A 2A3CA 2MPHA 4LAXA 2Q5AA 3AS2A 2B31A 4P8XA 3ARPA 3WH0A 4Z2KA 4W9OA 5HT1A 1Q6HA 1FKRA 5DIVA 5GQBA 1LL7A 4WK9A 2DT2A 4TNSA 1FKBA 1LL4A 1ZU8A 4WKFA 1H0GA 4ZS6A 2FAPA 1D7HA 1NSGA 1J4IA 1YW5A 1LL6A 2LPVA 4IT6A 1KT1A 2LJ4A 4U86A 4Z2JA 1NMVA 4WIWA 4HARA 1LJYA 4IQ2A 3OA5A 4MGVA 2A3EA 1D7IA 3B7XA 1FKIA 3FXYA 3O5FA 2PV2A 4P8WA 3PA7A 2QF8A 4TW6A 3O5MA 1E6RA 4IT4A 4ODLA 3TDBA 4JYSA 3IKGA 1FAPA 2OLHA 2ITKA 4GIVA 2DG4A 2DG9A 3I6CA 3AQUA 2L2SA 3IKDA 4P8UA 3B9DA 2DPEA 1ROTA 4JFJA 3ARWA 1WB0A 4IQCA 1HJVA 1PINA 2DT3A 3ARVA 2ZQTA 1GUVA 2MNTA 2F2DA 1LG1A 2M08A 1UR9A 1W9VA 3B09A 4LAVA 1U79A 4DWSD 2XPAA 3CHCA 3LUOA 2ZQSA 5I98A 1JVWA 1K9TA 3CH9A 1O6IA 3BXWA 1NWRA 1SYTA 1L1PA 3ARZA 1F40A 1X6NA 2DSZA 4ODOA 1D6OA 1FD9A 3FAPA 1KFWA 3ARQA 3G6LA 2KO7A 3MDYB 4U84A 1VF8A 4TX0A 1N1AA 2F21A 2PPPA 1E15A 1EQ3A 4J4OA 2XPBA 2KR7A 1E9LA 3RM9A 1NWSA 4BF8A 4DT4A 1HXVA 3UQBA 4MNMA 5BXJA 4QT2A 5HW7A 1PBKA 4W9PA 1ROUA 1W9UA 4S3JA 4NZCA 1Q6UA 4DRPA 2DT0A 4Q22A 3WD0A 2PI6A 1NMWA 5DIUA 3VAWA 3ODKA 4XAKA 1FKDA 4DH0A 2ESCA 3KZ7A 4QZVB 1ZBVA 3AS0A 3O5RA 5DITA 4MNLA 2RUCA 3ARYA 4DRNA 2XP8A 4DWSC 2XP5A 4Z2IA 4PTMA 4ODMA 1W9PA 4JFKA 4DRQA 4GGQA 1ZBWA 4R5EA 1FKHA 1BKFA 3CHDA 3KAFA 5GPRA 1YATA 5HUAA 1QPFA 1ZK6A 4JFLA 1KT0A 1FKFA 1W1TA 4DZ2A 3O5JA 4LGXA 2UZ5A 2ZQVA 2DSUA 2AWGA 5J6EA 4MTVA 1HKIA 5DEZA 2WLZA 4DZ3A 1A7XA 2DG3A 3CGNA 1X6LA 3EY6A 2KGJA 4HBEA 2PBCA 3RGCA 2MLZA 3NTPA 4KR0B 4Z2GA 1C9HA 4G2PA 4S3KA 3TC5A 2KFWA 2F4EA 2MLYA 3ARXA 1ZBCA 2IF4A 3O5GA 1EHNA 3G6MA 4MNKA 3UF8A 5HWBA 4DRIA 3RMEA 3PRBA 3W4RA 1BL4A 1FKSA 1EYMA 1FFQA 3NI6A 4P8VA 5HWCA 1W1VA 5HKGA 5HTGA 1QPLA 3GPKA 5GPGA 1P5QA 2K8IA 2MF9A 1H0IA 3WD1A 3B8SA 4HBOA 1ITXA 3UQIA 2PPOA 5HW6A 1EIBA 4C02B 1RD6A 3WIJA 4DRJA 4DROA 1T11A 4Z2LA 1J4RA 4URIA 4AY1A 2ZR6A 3KAGA 3KABA 1B6CA 1FKJA 2JZVA 1F8AB 2MLXA 1XHGA 2KE0A 1SR0A 3O5IA 4NSBA 1HKKA 2LGOA 3ARUA 1GPFA 5JH8A 3ARRA 4G50A 4QIBA 2RURA 3KADA 3O5PA 1NWUA 5DF0A 4U85A 1FKLA 2RQSA 2ZR4A 1GOIA 4NNRA 4N19A 4W9QA 3ARTA 1D2KA 2A3AA 3WQVA 2PPNA 3CHFA 1W1YA 3NRKA 5DO2A 4ZPVR 1TCOC 4QT3A 3PRAA 2XP9A 3O5DA 4Z2HA 3H9RB 3WQWA 3KACA 4ML4A 2VN1A 4JFIA 2DSVA 3WD3A 1WAWA 1E6PA 3ALGA 1HKMA 4ZPWR 2WM0A 2RUDA 3TCZA 3KAIA 3IK8A 2RSEA 4DIPA 2XP6A 4IPXA 1HKJA 1W26A 3CGMA 1J6YA 1JNSA 3FY1A 4DRMA 1WNOA 3AROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L1P A;  1QZ2 A;  4ODN A;  4FAP A;  3IHZ A;  4O2T A;  2IF4 A;  3KAH A;  1F40 A;  2ZR5 A;  1M5Y A;  3O5G A;  4ODP A;  1Q1C A;  1FJD A;  1J4H A;  4ODO A;  3OOB A;  3UF8 A;  1D6O A;  3O5K A;  1FD9 A;  5HWB A;  2M1I A;  1FKG A;  4DRI A;  3PRB A;  3FAP A;  1BL4 A;  2KO7 A;  3MDY B;  4U84 A;  2MPH A;  4LAX A;  2Q5A A;  4ODK A;  4MSP A;  1FKS A;  4TX0 A;  1N1A A;  2F21 A;  1EYM A;  2PPP A;  1FKK A;  3NI6 A;  3JYM A;  1EQ3 A;  4J4O A;  2D9F A;  3WH0 A;  3O5Q A;  5HWC A;  2XPB A;  2KR7 A;  1QPL A;  3GPK A;  5HKG A;  5GPG A;  5HTG A;  4W9O A;  1P5Q A;  5HT1 A;  4BF8 A;  2K8I A;  2MF9 A;  4DT4 A;  3PRD A;  1HXV A;  3UQB A;  1Q6H A;  4R0X A;  4QT2 A;  5BXJ A;  5HW7 A;  1PBK A;  4W9P A;  1ROU A;  2N87 A;  3UQI A;  2PPO A;  1FKR A;  5DIV A;  4ODQ A;  1Y0O A;  1Q6U A;  4DRP A;  3RFW A;  4TNS A;  5HW6 A;  1NMW A;  2RUQ A;  1FKB A;  5DIU A;  4C02 B;  2Y78 A;  3VAW A;  3KCE A;  3ODK A;  4TW7 A;  1FKD A;  4DH0 A;  2XP4 A;  4DRJ A;  3KZ7 A;  4DRO A;  1T11 A;  2FAP A;  4DRH A;  1J4R A;  1D7H A;  1NSG A;  4J4N A;  1J4I A;  2ZR6 A;  3O5E A;  3KAG A;  2KI3 A;  1YW5 A;  3JYJ A;  3KAB A;  3O5R A;  5DIT A;  1B6C A;  2RUC A;  1FKJ A;  2JZV A;  1F8A B;  2LPV A;  3UQA A;  1Q6I A;  4DRN A;  2XP8 A;  1KT1 A;  2MLX A;  4FN2 A;  2LJ4 A;  2KE0 A;  1D7J A;  3O5I A;  2XP5 A;  2ZQU A;  3JXV A;  4U86 A;  2LGO A;  4ODR A;  4ODM A;  1NMV A;  4JFK A;  4DRQ A;  4GGQ A;  4G50 A;  4QIB A;  2RUR A;  2VCD A;  3KAD A;  3O5P A;  4IQ2 A;  4MGV A;  3B7X A;  1D7I A;  1FKI A;  1FKH A;  1FKT A;  1FKL A;  2PV2 A;  2RQS A;  2OFN A;  2ZR4 A;  3O5F A;  4U85 A;  3PA7 A;  1BKF A;  2FKE A;  4LAW A;  4N19 A;  4NNR A;  3KAF A;  4TW6 A;  4W9Q A;  1YAT A;  3O5M A;  4TYO A;  5HW8 A;  1QPF A;  5HUA A;  1ZK6 A;  4JFL A;  4ODL A;  2PV3 A;  4JYS A;  2PPN A;  3TDB A;  5B8I C;  3IKG A;  1KT0 A;  2PV1 A;  1FKF A;  3NRK A;  1FAP A;  4JFM A;  5D75 A;  1ZCN A;  3UI6 A;  2ITK A;  1TCO C;  4DZ2 A;  3O5J A;  4GIV A;  3O5L A;  2DG4 A;  2DG9 A;  4QT3 A;  3I6C A;  2UZ5 A;  2XP9 A;  4TW8 A;  2L2S A;  2ZQV A;  3O5D A;  3IKD A;  3H9R B;  3KAC A;  2AWG A;  5J6E A;  2VN1 A;  3UI5 A;  1ROT A;  4JFI A;  4JFJ A;  4IQC A;  1PIN A;  3UI4 A;  4DZ3 A;  1A7X A;  3O5O A;  2ZQT A;  1R9H A;  2DG3 A;  2M2A A;  3CGN A;  2MNT A;  3EY6 A;  2F2D A;  2KGJ A;  2M08 A;  2PBC A;  2RUD A;  3B09 A;  3TCZ A;  4LAV A;  1U79 A;  3KAI A;  3IK8 A;  3RGC A;  4DRK A;  2XP7 A;  2MLZ A;  3NTP A;  2RSE A;  1JNT A;  4DIP A;  2XP6 A;  2LKN A;  4LAY A;  4IPX A;  1W26 A;  2XPA A;  1C9H A;  3CGM A;  4G2P A;  3TC5 A;  2KFW A;  3LUO A;  2ZQS A;  5I98 A;  1J6Y A;  1JNS A;  2F4E A;  4ITZ A;  2MLY A;  1JVW A;  2XP3 A;  4DRM A; 
#chains in the Genus database with same CATH topology
 1N0N A;  3K3W A;  3CS5 A;  3F7Y C;  2ADQ B;  5HBF A;  4LF5 B;  4O4L A;  3VQW A;  3CME V;  3Q4H B;  3T1H O;  2ZXW B;  4CC5 A;  4FFB B;  4PHZ A;  3ZMT A;  4DR2 B;  3HPL C;  1W59 A;  3LSQ A;  1OCZ C;  3JSN A;  4MSP A;  3WL0 A;  1VP7 A;  3JYM A;  2CTP A;  1SQX H;  1URF A;  1X59 A;  2EUL A;  1ZL8 A;  4H13 B;  2KKW A;  2OIE A;  2ZR2 A;  1F4M A;  4R8C A;  3WG7 C;  2AHZ A;  2HJF C;  4L72 B;  5LP6 C;  3ZN0 A;  2EIJ C;  3M7M X;  1E1R G;  5EK0 A;  5IYC O;  4ZI7 B;  2BE3 A;  4DK1 A;  4DWS A;  1R6N A;  3SYC A;  3RW0 A;  2X0L A;  3SJC C;  4HNA B;  4O4I A;  1LUV A;  2ETN A;  4TW7 A;  3AG4 B;  1ENV A;  5C8Y A;  2XP4 A;  2MK3 A;  3K04 A;  4JI6 B;  2GHY A;  4JTA B;  3CHE A;  3G80 A;  4EB6 B;  5B1A C;  3G6E V;  3AS3 A;  4FN2 A;  2Z3Y A;  4YY3 O;  3QO8 A;  1D7J A;  1FXK C;  3JXV A;  1KKC A;  2RQ6 A;  4ODR A;  3CMA V;  1M90 W;  1GN3 A;  4NVP A;  1CTN A;  2V1D A;  1S5H C;  2DJV A;  3ZMV A;  4LF6 B;  4IIJ B;  1WN7 A;  1FKT A;  1E79 G;  1ZB5 A;  4B3T B;  5IY5 C;  4LAW A;  1OCO C;  1W0J G;  5CA1 A;  2ITD C;  5KAI Z;  1IX5 A;  4F6R B;  2PV1 A;  3LNM B;  3QVN A;  5EZY B;  5B1B C;  4YHH O;  2IJH A;  4FM0 A;  1FFT B;  1BMF G;  4PJ0 Z;  2EJ7 A;  4TW8 A;  1GMG A;  2CUG A;  1AJQ A;  2E5L O;  4DV5 O;  1NTM H;  4DR1 O;  3QOK A;  4UXN A;  2E3C A;  1BSM A;  1Q43 A;  2O9O A;  4HZ3 A;  5LGT A;  3HR0 A;  4UCU A;  4H37 A;  4DRK A;  1SQV H;  2NNU A;  5ITZ A;  3JAK B;  4ZPT R;  2LKN A;  5L3E A;  4JI7 B;  1DF4 A;  2CGO A;  4H33 A;  1CEZ A;  4FM1 A;  3SJA C;  4MNJ A;  1IXB A;  4ODN A;  2WPD G;  3ETQ A;  2WK2 A;  4UV8 A;  3NXS A;  4XDK A;  1ZBK A;  1CPY A;  4J11 A;  3AEI A;  1Q1C A;  4DR7 O;  4IL6 Z;  4LF5 O;  1HP8 A;  2W0X A;  2VQF O;  3K08 A;  4C7U A;  5L3C A;  3BFR A;  1YHQ V;  4P8X A;  3ARP A;  5JH7 A;  4Z2K A;  2OIG A;  5KUK A;  4W9O A;  1NTK H;  2EZO A;  5HT1 A;  3W7T A;  1NI8 A;  4ASU G;  4FLZ A;  4BAY A;  2YUA A;  2JGD B;  1LL7 A;  2F23 A;  2OCC B;  2QGN A;  3CRC A;  3HKB A;  1TUB B;  1FYJ A;  1LL4 A;  1ZU8 A;  1T5E A;  3UT5 A;  2JGU A;  4LP8 A;  3FD9 A;  3OEH G;  4JV5 B;  4O2A A;  3J7A U;  1LL6 A;  4GKJ B;  2LFR A;  1K33 A;  3FYE B;  3K5L A;  4CS2 A;  1AI4 A;  4JI1 B;  3L9D A;  1OJH A;  4WIW A;  4D7S A;  1YZB A;  1XL6 A;  3OR7 C;  1IXM A;  3QNE A;  1B6Q A;  4TSF G;  1FKI A;  3IGA C;  3KZI Z;  4UB8 Z;  3PA7 A;  2NLJ C;  3KCY A;  4O4J A;  2QF8 A;  4GX1 A;  4IT4 A;  2CAZ C;  4DV3 O;  4JYS A;  4ODL A;  3TDB A;  1WNS A;  2ITK A;  1Y76 A;  2YI8 A;  1VQK V;  1JFF B;  1SKV A;  5GW7 A;  2Y0I A;  4DV6 B;  1AI7 A;  4P8U A;  1MSD A;  1HNZ B;  3WB2 A;  4LNU A;  1ROT A;  4JFJ A;  3ARW A;  1L0N H;  1WB0 A;  3ZHQ A;  1HJV A;  2DT3 A;  1WJZ A;  4D7T A;  1YF2 A;  4DUY O;  2MNT A;  2M08 A;  1N32 B;  1P49 A;  1EN6 A;  1P7G A;  3B09 A;  4LAV A;  2ZE5 A;  3K5M A;  5IYZ A;  4WCE V;  2UXB O;  1OHH G;  5KMG B;  1LNQ A;  1HDJ A;  1K4D C;  4ZHQ B;  3CHX A;  3SPJ A;  4JI7 O;  1O6I A;  1NWR A;  1JJO A;  4WBN A;  3ARZ A;  3E35 A;  2D2C B;  4BWA A;  2QWN B;  4FLT A;  1SQF A;  1UFI A;  5LP6 A;  1WAZ A;  4ODO A;  2HHH O;  4Z2W A;  4X89 A;  4TOI A;  5KLV H;  2W0F C;  4U84 A;  2PYL A;  2DN9 A;  2UXC B;  2LJ2 A;  4TX0 A;  2F21 A;  3W7U A;  1E15 A;  2PPP A;  2W6J G;  1G4Y B;  1NJI W;  5EBM C;  1QHT A;  2G38 A;  2ZE6 A;  4R7C A;  3UQB A;  5GON B;  4DUZ O;  4I7Z B;  4W9P A;  2Q6A A;  3RYI A;  2DT0 A;  3ABK C;  4Q22 A;  3WD0 A;  5GTI Z;  1NMW A;  5LGN A;  1BS3 A;  2ATK C;  2Y4T A;  4PA6 A;  1EZV H;  4PV1 B;  5LBQ A;  3KZ7 A;  5J9P C;  2F43 G;  2F66 C;  1XNR O;  2QA4 V;  3AS0 A;  5LA6 B;  1Y74 A;  4MNL A;  2YC0 A;  4FLV A;  3K57 A;  4DV0 B;  4O4H B;  4LBE C;  1BQ0 A;  2H3O A;  4UVC A;  3CB2 A;  4FLW A;  2AZ0 A;  2DOS A;  1W9P A;  4JFK A;  4GGQ A;  1GH6 A;  3CCM V;  2KQX A;  2FTK A;  5KHK A;  2UUB O;  2VS0 A;  3JAL A;  1ZAU A;  5JCO C;  3H01 A;  1QPF A;  4E2L A;  3RYF B;  4AQY O;  4JI5 O;  1ZK6 A;  1KT0 A;  1W1T A;  3B4S A;  3W7X A;  3ETG A;  4LGX A;  1NT2 B;  2GTS A;  3UKM A;  2ZQV A;  1D5A A;  2DSU A;  2QWR B;  5BMV B;  5DEZ A;  2JJ1 G;  1S3J A;  2WA3 A;  2JVD A;  3OTO B;  2Q9L A;  3CGN A;  5KHJ A;  1KB9 F;  1PM9 A;  1MZF A;  1VF7 A;  2PBC A;  1NR1 A;  4JYA O;  1QLE C;  3F5W C;  4GYC B;  4Z2G A;  5B5E Z;  4S3K A;  2ZQM A;  3RVY A;  4GKK B;  4IHJ B;  4X66 O;  1SES A;  4X1Y A;  2ARH A;  1Q5O A;  3H1L H;  4OPH A;  5H6Q A;  1XHX A;  2FYU H;  1BL8 A;  5CB4 A;  3KG2 A;  5DEC A;  3T1Y B;  1NKD A;  2Q7H A;  3F7V C;  1FJG O;  4TV9 A;  1QCE A;  4O2B A;  1M5I A;  2GSM B;  3L72 H;  1FKS A;  1F7Y A;  4LH7 A;  1EYM A;  1JQ0 A;  2EIK C;  1RM1 B;  5HKG A;  5HTG A;  4TUY B;  1H2S B;  3BCC H;  4K0K B;  1P5Q A;  2K8I A;  5LMU O;  2YXH A;  5CA3 A;  1H0I A;  5LOV A;  3UQI A;  2PPO A;  1ORQ C;  3WU2 Z;  4B3S O;  3ZJZ A;  1XUQ A;  1GAX A;  3Q4H A;  4HBN A;  5H6R A;  1S72 V;  4DRJ A;  4URI A;  2UXD B;  1R3I C;  3KAB A;  2JZV A;  4FM2 A;  1VQO V;  2MLX A;  4BW9 A;  1VF6 A;  3MD0 A;  2ZCE A;  4JI0 B;  3BRC A;  5JH8 A;  3D3Q A;  1KKD A;  3JD2 A;  4HNA A;  1V55 C;  4W9Q A;  3CX5 F;  2F1M A;  4JI8 B;  1BT8 A;  5JVD B;  4RO2 A;  2FML A;  2PPN A;  3CHF A;  3TJT A;  1VQ7 V;  4ZPV R;  2X6C A;  2MW2 B;  3I5D A;  1M57 B;  3VBB A;  2B1G A;  4EB6 A;  3PRA A;  1SZT A;  2XP9 A;  3O5D A;  1MAB G;  5LHI A;  1XMO O;  1N33 B;  4RQE A;  1BHB A;  2VN1 A;  1WAW A;  1E6P A;  1J5E O;  4LF7 B;  5BXZ A;  3N2G B;  4DV4 B;  4GT1 A;  3EIP A;  3BA8 A;  4IIJ A;  3IK8 A;  2PF4 E;  5BR8 B;  2RSE A;  5IJ9 B;  4DIP A;  4WF9 V;  3VQV A;  1W26 A;  1VQ6 V;  3M99 B;  1JNS A;  4H0L B;  5EZY A;  5EBL C;  1MG1 A;  2XAQ A;  2HJD A;  3H1H H;  4NXN B;  1TVK B;  2WLH A;  5J2U A;  3IHZ A;  1IBL O;  2YBU A;  1SC5 B;  2EIJ B;  2QE7 G;  4OXS A;  1WP8 A;  2LO1 A;  1VAR A;  4DV2 O;  3ABM B;  2BCC H;  3F5T A;  4GX2 A;  4JI4 B;  1VQ9 V;  1OGB A;  3LDD A;  4JAU A;  4MVR A;  2KG7 A;  1GM9 A;  5B66 Z;  2HVK C;  4NTX A;  1L1F A;  3JAK A;  2GV9 A;  4I4T A;  3ABT A;  4UDM A;  3CXC U;  4KHP O;  2UXX A;  3IJ4 A;  4JF3 A;  3UM7 A;  4CH6 A;  1S77 D;  4Q20 A;  3RYC B;  5IWA O;  1JND A;  3ZHV A;  2BOC C;  4MT8 A;  3UCS C;  5D5P A;  1VQL V;  3ZIA G;  1FXK B;  1SER A;  3B9A A;  1IX9 A;  3T1H B;  2RUQ A;  2Y78 A;  1VMG A;  3AG3 C;  3EXA A;  3CCL V;  1Q86 W;  4FZ1 A;  3G71 V;  1EM1 A;  3KCX A;  4NXM O;  3AG2 C;  1HJW A;  4JYB A;  3HKC A;  1XL4 A;  3I55 V;  2O92 A;  1R73 A;  4X65 O;  2VWJ A;  1Q6I A;  5KA6 A;  3STZ C;  1OCC C;  1K9M W;  2XT9 A;  3OTF A;  2R72 A;  2PYJ A;  1W1P A;  2JGD A;  1Q90 D;  1OV9 A;  1QU7 A;  2RN9 A;  1TUB A;  2ZDI A;  2FKE A;  1G6U A;  4W4K A;  4TYO A;  1ZSP A;  4MTO A;  2PI5 A;  4X1I B;  2DW4 A;  3STL C;  1G8M A;  2YI9 A;  4YY3 B;  3K58 A;  5H9C A;  3D36 C;  1XQ8 A;  1W0K G;  2OWO A;  2DWE C;  4ABM A;  1HJX A;  1MA1 A;  4AIL C;  5HFL A;  1Q3E A;  3FB7 C;  3CRQ A;  3O5O A;  1R9H A;  2M2A A;  4F4L A;  2IUZ A;  1KP2 A;  3P30 A;  2AOS A;  1SS3 A;  2Y0P A;  3WD4 A;  4IYI A;  1JMK C;  3A0R A;  1BZK A;  5LL6 Y;  4LAY A;  3JAW B;  4YHH B;  3DC6 A;  3FX7 A;  4CH3 A;  2P5O A;  5JWP A;  1JNE A;  2PN0 A;  2E5L B;  4DV5 B;  4O2T A;  2VQE O;  2Z0A A;  4DR1 B;  1NH6 A;  1M5Y A;  1UR8 A;  1YTF B;  1E6N A;  3CEI A;  1LQ0 A;  4L3N A;  4U7O A;  3BVO A;  3HKD A;  1HNW O;  3AS2 A;  4YJ2 B;  2YEV B;  2D3O W;  4DW0 A;  4JAA A;  1R1B A;  1P7B A;  4JYY A;  4Z1M G;  2EIL C;  5CBH A;  2HKO A;  2IM9 A;  3B77 A;  5KMG A;  3JD1 A;  4L8J A;  4ZHQ A;  2EIN C;  5GQB A;  2BTQ B;  2XAH A;  2WLJ A;  4DR7 B;  1O9G A;  1PV0 A;  2FKX A;  2LW7 A;  3OMI B;  4UVA A;  2VQF B;  2YIB A;  4KUM A;  5EIB C;  2Q0A A;  2Q7G A;  4WKF A;  1VF5 B;  2FAP A;  3SPC A;  1D7H A;  4MS2 A;  2WSS G;  1MSW D;  4UCO A;  3D8C A;  4GUN A;  1KC8 W;  2DMX A;  2LPV A;  4X20 B;  2ITC C;  1COW G;  1QR8 A;  1ZTE A;  1KT1 A;  4ZIB A;  3RN4 A;  4J9Y B;  4I50 B;  5GON A;  2P67 A;  2HG5 C;  4HYO A;  2YDE A;  2QDO A;  3ABM C;  3K79 A;  2QM7 A;  4ZOL B;  1LJY A;  4IQ2 A;  1F23 A;  4MGV A;  3B7X A;  1D7I A;  1SRY A;  3O5F A;  4Q6G A;  2DWD C;  1JX9 A;  3O5M A;  1E6R A;  5JQG A;  3FAV B;  2YIB D;  2IU3 A;  1G1X B;  5LA6 A;  3RYH B;  2GDS A;  1YVW A;  3JAR B;  3GVM A;  3MHS C;  4O4H A;  3I6C A;  3AQU A;  2CTR A;  2L2S A;  3B9D A;  4LFC O;  1J95 A;  4CH4 A;  1NVP B;  4B3M O;  1EN5 A;  2DPE A;  3ZHS A;  2AW9 A;  4MVQ A;  1H2L A;  3ARV A;  2ZNI A;  4MTG A;  2ZQT A;  4DR5 O;  4QNH B;  2F2D A;  1LG1 A;  1K4C C;  1UR9 A;  1D5N A;  4DV3 B;  4DWS D;  2Y4U A;  3RYF A;  2XPA A;  2QR4 A;  1R6K A;  5I98 A;  4UCR A;  3LSU A;  1K9T A;  3DXR A;  3CH9 A;  3BXW A;  3CPW U;  2FB5 A;  4CZZ A;  1OZ0 A;  3JAS A;  5IE9 A;  4KXR A;  2XOK G;  1F40 A;  3JYC A;  3CCV V;  2WLK A;  2X6A A;  5BMV A;  4DUY B;  1FD9 A;  3ABK B;  1FS0 G;  1SET A;  1F4N A;  3ARQ A;  3G6L A;  3E8G A;  3MDY B;  3KKY A;  4AHC A;  1M4U A;  1EQ3 A;  2UXB B;  2KR7 A;  3T1C A;  1E9L A;  3W7W A;  1M9N A;  1NWS A;  4WFE A;  4QPJ A;  2RMK B;  1KYO F;  5BXJ A;  4QT2 A;  1R3L C;  4X64 O;  1YIJ V;  3OGC C;  4IHJ A;  4F6E A;  1ROU A;  2XHB A;  1W9U A;  4S3J A;  1Q6U A;  2HHH B;  2PI6 A;  3DSQ A;  3VAW A;  1WP7 A;  2P6J A;  2W6I G;  3B40 A;  1R3J C;  2ILM A;  4OPA A;  1SQB H;  5CA0 B;  1GN6 A;  4DW1 A;  1ZX3 A;  4X1K A;  3M8A A;  4DRN A;  4TUY A;  1AJN A;  4DUZ B;  1KBH A;  4PDL A;  3CP1 A;  2YXL A;  1YCI A;  4DRQ A;  1K5S A;  3NR7 A;  2R70 A;  2AZ2 A;  1VQ5 V;  2QWQ B;  3GTY X;  2Q73 A;  4CH5 A;  3KAF A;  1IVS A;  1XNR B;  5GPR A;  5HUA A;  4XDJ A;  4K3A A;  3E89 A;  1FKF A;  1QLE B;  2FL4 A;  4DR4 B;  3J80 N;  4DZ2 A;  3O5J A;  2JIZ G;  4LR3 A;  4JTD B;  5IDJ A;  3THO A;  4L87 A;  2AWG A;  4MSW C;  5B1O A;  4MTV A;  4FPP A;  1R3K C;  5DM6 V;  5KUM A;  5EYP B;  1XI1 A;  3K9S A;  3ZHR A;  3DTU B;  2WLZ A;  2BSK B;  1A7X A;  3P32 A;  1H2M A;  2UUB B;  4UCS A;  5IJ0 B;  2HR3 A;  1JCH B;  1FPO A;  3JD3 A;  2Q5Z A;  4J41 A;  5LYJ A;  2HLD G;  3ASN C;  2A0L A;  2JJ2 G;  4JI5 B;  3ZED A;  4AQY B;  2LP7 A;  3PN1 A;  1S76 D;  4KR0 B;  5JVD A;  3QTC A;  1XBL A;  1C9H A;  2JEX A;  5EC1 C;  2EIK B;  4J42 A;  1DGS A;  3ARX A;  1SF9 A;  3ZMZ A;  1F51 A;  1NQT A;  3O5G A;  2F95 B;  3G6M A;  1FXH A;  3TXS A;  3CCJ V;  4J7Z A;  3N2G A;  3RME A;  3W4R A;  4RQF A;  1BL4 A;  4JYA B;  2UUA O;  3ZRW B;  5HWC A;  1W1V A;  1QPL A;  3GPK A;  5GPG A;  2N74 A;  2O57 A;  3K9A A;  4WFG A;  4B08 A;  4X66 B;  1K8A W;  2MF9 A;  3WD1 A;  3B8S A;  4RUF A;  2RCV A;  1IBK O;  3AK2 A;  1TVK A;  3DC5 A;  5HW6 A;  3VQX A;  1EIB A;  2A79 B;  1Y66 A;  4PD4 F;  1RD6 A;  1L8D A;  4I9W A;  3WIJ A;  3ZRX A;  1FJG B;  1VQ8 V;  1IBM O;  2L35 A;  3OEE G;  1AIL A;  2HP8 A;  1V55 B;  2B5U B;  1H8E G;  3N2K B;  2ZE7 A;  5LMU B;  3AG7 A;  1DTO A;  4DRX B;  2A06 H;  1U97 A;  3RGB A;  3H1K H;  4O4L B;  4B3S B;  1XDC A;  1HKK A;  2LGO A;  3RYC A;  1RSO B;  4JZG A;  1YEW A;  3ARR A;  4G50 A;  2HVJ C;  4I55 B;  1FXK A;  1K3E A;  2ZD9 A;  5KHH A;  4U85 A;  1GOI A;  1WB8 A;  4MVM A;  4R50 A;  3OFN G;  2UUC B;  1KU9 A;  2DYS C;  5LMN O;  3UO2 A;  5DO2 A;  3A0H Z;  1X4T A;  3O9O A;  4NYK A;  4EEQ A;  4X62 B;  1N36 O;  4DR4 O;  4X8A A;  4Z2H A;  3H9R B;  4ML4 A;  4JFI A;  3LDE A;  2DSV A;  2ZE8 A;  1AR1 B;  1E44 A;  4ZPW R;  2RUD A;  4B7E A;  1N34 O;  3TCZ A;  1QR9 A;  2Z5U A;  4UB6 Z;  3ZX6 A;  3OR6 C;  2XP6 A;  3ML0 A;  3QO5 A;  1PKX A;  4X1I A;  1RP3 B;  4YIP A;  4GX0 A;  3SYO A;  4DYL A;  1XMO B;  3ARO A;  1FXV A;  3LSS A;  1I5X A;  4MVO A;  1VEW A;  1EDQ A;  3KAH A;  1J5E B;  2Y48 A;  4DR3 O;  1V9P A;  4MVZ A;  1SA0 B;  2YSU B;  1NR7 A;  1P4R A;  4W5U A;  3SYQ A;  5CA1 B;  3BEH A;  2DYR C;  3AG3 B;  4ODK A;  1NBM G;  3AG2 B;  1FKK A;  4PA9 A;  1NH2 B;  4I9Q A;  3JAW A;  3ARS A;  3SPG A;  5CMU A;  2CTW A;  3K0G A;  3FB8 C;  5KHG A;  1IBL B;  3T4D A;  2IJJ A;  2N87 A;  4ODQ A;  1OCC B;  4YJ3 B;  1NZ6 A;  4DV2 B;  3EFF K;  2G41 A;  3KCE A;  1RFY A;  3MDS A;  4DRH A;  1HR0 O;  4LFA O;  4YJ2 A;  1VQ4 V;  2KI3 A;  3JYJ A;  2OYQ A;  2YEV A;  1BHA A;  2XTA A;  1SQQ H;  4CC6 A;  3UQA A;  1Y67 A;  4KHP B;  4OGQ B;  5IWA B;  3CZ8 A;  1Z5V A;  3ZHT A;  2ZIN A;  2YBT A;  4P30 A;  2BTQ A;  2EIM C;  3WD2 A;  4NXM B;  3B9E A;  3VQY A;  3AK3 A;  3BAB A;  2OFN A;  3RM8 A;  1OWQ A;  4FFB A;  5JH7 B;  3OE7 G;  2PV3 A;  4PA3 A;  1YTF D;  3IAY A;  4J7K A;  4X65 B;  2UUC O;  1ZCN A;  3GU0 A;  5D75 A;  3UI6 A;  3E86 A;  2NN4 A;  3O5L A;  4GX5 A;  5JJN B;  3CD6 V;  1PL4 A;  1V54 B;  4MTX A;  4X62 O;  4DV7 O;  1ZL1 A;  3K03 A;  2WLN A;  1PD3 A;  4I50 A;  2FDM A;  4ZI7 A;  4E4E A;  4WJX A;  4J80 A;  2XUM A;  3P3P A;  2LFS A;  2DT1 A;  3TET A;  2QSA A;  1IZ3 A;  5JJE B;  1JNT A;  1XIL A;  1B04 A;  4KL1 A;  2PTM A;  3WL1 A;  3CCQ V;  2WLY A;  2E74 B;  1WA8 B;  1XRV A;  4ITZ A;  3ALF A;  3JSL A;  3RYH A;  2XP3 A;  2PZS A;  3JAR A;  2EIL B;  2DSW A;  4FAP A;  4GLX A;  4N21 A;  1H2N A;  1IUR A;  2ZR5 A;  1YJ9 V;  4IYH A;  2EIN B;  3OOB A;  3O5K A;  4MPK A;  2Q8V A;  4JAV A;  4O4J B;  4NTW A;  1LG2 A;  2A3C A;  1DF5 A;  4EFE A;  3CRR A;  5K1X A;  3X2Q C;  3CSX A;  1Y76 B;  1Q7Y W;  4F6R A;  1QQC A;  1Q6H A;  2VQE B;  4MW8 A;  1FKR A;  3SJQ C;  3J81 N;  1AP6 A;  1TUE B;  2X7R B;  4WK9 A;  2DT2 A;  4TNS A;  2IU0 A;  1FKB A;  3K59 A;  1ARO P;  2HFE C;  5A9G A;  1PP9 H;  1HNW B;  2A3Q A;  3G4S V;  4J7J A;  2ZM6 O;  1XHZ A;  1NVP D;  1NSG A;  1AR4 A;  4JTC B;  3E22 B;  2NR5 A;  1PNL A;  4P9P A;  4DXW A;  4IT6 A;  4WBN B;  2P90 A;  2E75 B;  2LJ4 A;  4UVB A;  4JI3 O;  4U86 A;  1QNM A;  2XAJ A;  2ZT9 B;  4BIZ A;  1RPO A;  4K35 A;  4LF4 O;  2GUZ B;  4TQF A;  2A3E A;  4JYC A;  3FXY A;  2V7Q G;  1W2B U;  2H94 A;  4G2K A;  3SYA A;  3IFX A;  1DK1 A;  2WA4 A;  3E8B A;  5IYD O;  3K5N A;  2OLH A;  5JCO A;  2F4V O;  5CA0 A;  4CBC A;  1AB3 A;  1MZE A;  4WFA V;  5CBF A;  2YIC A;  2DQ0 A;  4LF8 O;  3LNN A;  4WFF A;  3CXH F;  1Y74 B;  1UJW B;  1YSC A;  4UCV A;  5EC2 C;  1GRJ A;  4DR6 O;  3CHC A;  2PGG A;  1SQP H;  1JVW A;  3JAT B;  1SYT A;  4LFC B;  4B3M B;  1I5Y A;  4LF9 O;  2YIA A;  1X6N A;  2DSZ A;  2N04 A;  4DR5 B;  2AGA A;  4JZ2 A;  5EYP A;  1D6O A;  4JI2 O;  3APO A;  5IJ0 A;  2EJR A;  1KFW A;  1I08 A;  5CBG A;  3OT7 A;  2QM8 A;  2QKA A;  1JCH A;  4LH6 A;  1AJP A;  4X9Q A;  1PL0 A;  3OW2 U;  5B1N A;  2XPB A;  1K5Q A;  4BF8 A;  1V54 C;  3OUF A;  1N8R W;  4DT4 A;  4PDV A;  4MNM A;  1H38 A;  1JFF A;  5KHI A;  1BCC H;  1CP9 A;  4IT5 A;  2OT5 A;  4QE7 A;  3LUT B;  1XNQ O;  1TAE A;  4MTF A;  4XAK A;  3L75 H;  4DH0 A;  2ESC A;  2WLL B;  2Q68 A;  4QZV B;  4LWS B;  4TQD A;  5FNV B;  3WB0 A;  1ZBV A;  1VIB A;  1MNG A;  5LOV B;  3O5R A;  5DIT A;  1YI2 V;  5FPO A;  2RUC A;  4X64 B;  2XP8 A;  3ZS8 C;  5D5Q A;  2XP5 A;  3BMB A;  2V4D A;  1R6T A;  2RDC A;  1JOY A;  1BE3 H;  1ZBW A;  1SZX A;  1K92 A;  3RT3 C;  4UV9 A;  5TIS Z;  1BKF A;  3ABU A;  1YAT A;  1HWY A;  4HAM A;  3ZRS A;  3JAM N;  2IH1 C;  4U3J B;  5L3B A;  3ASN B;  4PEL A;  1BQZ A;  3N2K A;  2B9Z A;  2LW1 A;  3APQ A;  1M93 A;  2UZ5 A;  2PUS A;  3A2F A;  4LCU C;  1NTZ H;  4YXW G;  3S3W A;  3AK1 A;  3FYI B;  2ZIM A;  3L70 H;  4DRX A;  5GTH Z;  4TV8 B;  2GTA A;  2JDI G;  1N4C A;  1HKI A;  2K9P A;  5LXT B;  1RSO A;  4I55 A;  1Q81 W;  3EY6 A;  2CH7 B;  4HBE A;  4X88 A;  5IYB O;  2VRZ A;  3BHP A;  4QE9 A;  2CTQ A;  3R65 A;  4OX9 O;  3ZHU A;  4G2P A;  2UU9 O;  3TC5 A;  1KD1 W;  2AXT Z;  2F4E A;  1ZBC A;  1LUW A;  1EHN A;  2YXY A;  3E83 A;  4EKW A;  4MNK A;  2PY5 A;  1VQP V;  5HWB A;  2ZNJ A;  3A0B Z;  4I0X B;  4QGP A;  1HNX O;  3ASO C;  2ZIO A;  1FFQ A;  3NI6 A;  4P8V A;  2R9R B;  4FK5 C;  1M56 C;  4DO2 A;  3PJS K;  4R6Z A;  4B3R O;  3CRA A;  3R66 A;  4RUE A;  2VWK A;  1ITX A;  2IJI A;  3GWO A;  3LDC A;  2WLI B;  4BIO A;  4A5U B;  4U3F H;  1SA0 A;  2QTS A;  2Y69 C;  3CJH B;  3P3N A;  2UUA B;  2ZR6 A;  3KAG A;  1WPB A;  1B6C A;  3CRM A;  1RPR A;  2ADP A;  1FKJ A;  2DYS B;  5J2U B;  4JGS A;  5A2Q N;  1XHG A;  1SR0 A;  1IBK B;  2CK3 G;  5BY1 A;  4DV1 O;  1XMQ O;  3ARU A;  4W4L A;  1QBZ A;  3FFQ A;  1I94 O;  5J2T B;  4PDM A;  3RBZ A;  4YJ3 A;  5DED A;  3CYO A;  1NWU A;  3C90 A;  5DF0 A;  3W7S A;  1FKL A;  2RQS A;  1IBM B;  2KG7 B;  4NNR A;  4N19 A;  3ART A;  3C3T A;  2RJZ A;  3TK1 A;  4I4T B;  1D2K A;  3ZCC A;  1YJW V;  1KEC A;  5KX5 B;  2A3A A;  4RWU A;  1BGY H;  1FFX B;  1NU1 H;  1W1Y A;  3EVK A;  1TCO C;  2QTO A;  3BPZ A;  3AG1 B;  4UCT A;  4J9Z B;  2KSD A;  4PI2 A;  1VQN V;  3WD3 A;  4WFB V;  1NH2 D;  3S3X A;  3ALG A;  3CCR V;  3ZMU A;  3D36 A;  5F2V O;  3OUS A;  3FB5 C;  1D2D A;  1HKM A;  3HKE B;  3HKC B;  2WM0 A;  4PA7 A;  1FKA O;  3H9V A;  4DR2 O;  5LMN B;  5LGU A;  2DYR B;  4PDR A;  2QKC A;  3ABL B;  3A8T A;  3CGM A;  3EHB B;  3U10 A;  4BIU A;  1N36 B;  3FY1 A;  2CDY A;  1N0J A;  4DRM A;  1GK9 A;  1ZUQ A;  1H2K A;  1QZ2 A;  2JS3 A;  4JPR A;  4ODP A;  2M6Y A;  1J4H A;  4U7N A;  2P7T C;  3ETD A;  1E1Q G;  3SGI A;  1FKG A;  1N34 B;  3OD4 A;  1CXZ B;  1ZLZ A;  4GCZ A;  3RM4 A;  1OCR C;  4TT3 G;  5FPR A;  2L6L A;  3B2E E;  2D9F A;  4JI6 O;  3O5Q A;  3H1I H;  3CC4 V;  3CCU V;  2ZKO A;  5IT9 N;  3UO3 A;  3PRD A;  2UXN A;  1WA8 A;  4R0X A;  1DLB A;  4KQZ A;  1QVF U;  4KFM A;  1TFV A;  4FLU A;  1US6 A;  1Y0O A;  4DR3 B;  2ZXW C;  3RFW A;  4FVM A;  1I0H A;  3ZMS A;  1KQS U;  5B3S B;  2A7W A;  2EIM B;  4LF6 O;  1S0V A;  2A3B A;  3WKZ A;  2B1I A;  2DE0 X;  4B3T O;  2R9I A;  1JA8 A;  4J4N A;  3O5E A;  4QJF B;  4QIW F;  1VF6 C;  4MAV A;  4FJC C;  5IJ9 A;  4LFB B;  2A9H A;  4K8X A;  3H1J H;  1E6Z A;  3BY6 A;  1EFR G;  2ZQU A;  4WKH A;  4WKA A;  3AG4 C;  2VCD A;  3HKD B;  1IDS A;  4PI0 A;  4Q7N A;  1HR0 B;  4B7K A;  4LFA B;  2G8Z A;  5HW8 A;  4N23 A;  1NS1 A;  5B8I C;  4JFM A;  2C2A A;  3E22 A;  4AI8 A;  2F93 B;  1GKF A;  2WWW A;  5EIB D;  3JD4 A;  1OGG A;  3UI5 A;  1JVM A;  2YID A;  1ZWI C;  3UI4 A;  3AS1 A;  2GUZ A;  3PR9 A;  4CS3 A;  2XP7 A;  3ZRV A;  3G6B A;  1ZL8 B;  2CE4 A;  3X2Q B;  1NWT A;  1K7D A;  3OAA G;  2IH3 C;  4DV7 B;  2P22 C;  3CC7 V;  3JCZ A;  4DWS B;  5E1A C;  1EZJ A;  2QEX V;  2K1E A;  1FJD A;  1K34 A;  4O4I B;  3ZN1 A;  1FFR A;  4G28 B;  2M1I A;  5C8Y B;  1GO3 F;  5JQG B;  3B8N A;  2MPH A;  4LAX A;  2Q5A A;  1Z2G A;  4FIP C;  2B31 A;  5KA5 A;  4JV5 O;  3WH0 A;  3SPH A;  3AG1 C;  5FLX N;  4GKJ O;  4RAI A;  4ICG A;  2KB1 A;  3FB6 C;  3JAT A;  4NR1 A;  3E8F A;  3E2E A;  5DIV A;  2N05 A;  1FAF A;  4JI1 O;  2GBO A;  4FFK A;  3SDL A;  3BAA A;  5H5N A;  2M7W A;  5E79 Z;  3IC9 A;  3WB1 A;  4YIO A;  4CS4 A;  2RNB A;  1H0G A;  4ZS6 A;  3QF7 A;  3ABL C;  1J4I A;  1YW5 A;  3DXR B;  3L73 H;  2AHY A;  3JAS B;  2IJK A;  4LFB O;  1M1K W;  4DV6 O;  5K1P A;  3L71 H;  2OCC C;  4XDL A;  3TXQ A;  1HNZ O;  4Z2J A;  1NMV A;  3GB7 C;  2ZDI C;  3T2M A;  4HAR A;  3OA5 A;  4BR6 A;  4J10 A;  2PV2 A;  4P8W A;  1AI6 A;  2ZM6 B;  1PNK A;  2JRI A;  1N32 O;  5ITZ B;  4TW6 A;  2WLL A;  2Q4P A;  4LWS A;  5HFM A;  3IKG A;  5FNV A;  5DN6 G;  1FAP A;  1SQG A;  3WFV A;  4GIV A;  4LC1 A;  5LHH A;  2DG4 A;  2DG9 A;  4ZBM A;  4JI3 B;  3BA9 A;  3IKD A;  1L0L H;  1WPX A;  1YIT V;  4GZR B;  4LF4 B;  2Q67 A;  3L74 H;  3IC7 A;  3OGI B;  4IQC A;  1PIN A;  5B3S C;  1GM8 A;  1GUV A;  1KP3 A;  4TWK A;  2Q7E A;  1W9V A;  3SPI A;  1JJ2 U;  4QPK A;  1U79 A;  2UXC O;  5KAF Z;  2E76 B;  1JR9 A;  4X1K B;  4U3J A;  2F4V B;  3LUO A;  2ZQS A;  3MAQ A;  3O65 A;  4KP4 A;  4X20 A;  1L1P A;  2BTO A;  3T4Z A;  1K73 W;  4LF8 B;  2EX3 A;  2PI4 A;  4TV8 A;  3HKB B;  5LHG A;  4K8Z A;  2P4V A;  4FZ0 A;  4PA4 A;  3UT5 B;  5LXT A;  2WAM A;  3FAP A;  4ZOL A;  2KO7 A;  4NKG B;  2CH7 A;  1ROP A;  1VF8 A;  4O2A B;  1N1A A;  2XND G;  4DR6 B;  4J4O A;  3FAV A;  1A32 A;  3RM9 A;  1Y4M A;  4DV0 O;  1HXV A;  3E8H A;  5HW7 A;  1PBK A;  2P06 A;  4LF9 B;  4NZC A;  4DRP A;  1O9H A;  5DIU A;  4JI2 B;  3U0Z A;  2WLM A;  1QVG U;  5LYJ B;  3ODK A;  1FKD A;  4UFZ A;  1GTO A;  1Q82 W;  4I0X A;  4WFH A;  3CWB H;  3ARY A;  5AG2 A;  3TCU A;  2QWP B;  1Q8I A;  1THZ A;  1EN4 A;  1XRE A;  3MHH C;  1EBO A;  3CC2 V;  4DWS C;  3ETE A;  4LNU B;  3TGU H;  4Z2I A;  4PTM A;  3CE2 A;  2EZP A;  4ODM A;  1XEQ A;  1XNQ B;  2WLI A;  3OTO O;  4R5E A;  1UPG A;  1FKH A;  4FLY A;  3CHD A;  3CJH A;  1KUQ A;  4JFL A;  5IYZ B;  1TA8 A;  2ZR3 A;  1OCZ B;  5FL7 G;  3FKS G;  3K0D A;  3C3S A;  1S5L Z;  2Q69 A;  1HW7 A;  4MVU A;  2OTJ V;  2YS8 A;  4GKK O;  4Z1V A;  3WG7 B;  5J6E A;  5LP6 B;  1B06 A;  1B3Q A;  2P4K A;  1AR5 A;  4DZ3 A;  3T1Y O;  1AVM A;  2DG3 A;  5J2T A;  1X6L A;  2KGJ A;  2H8P C;  1VQM V;  3RGC A;  2MLZ A;  3NTP A;  3ASO B;  4NB5 A;  1WB7 A;  2QJ1 A;  2LQT A;  5KX5 A;  1FFX A;  2KFW A;  4I5S A;  1M56 B;  3ICX A;  4K0K O;  2MLY A;  1MMM A;  2DQ3 A;  5B1A B;  3RYI B;  4D6T H;  3ZBH A;  4H44 B;  5H2F Z;  2IF4 A;  2JEU A;  2LGQ A;  3UF8 A;  5JJJ B;  1Z5W A;  1P84 F;  2Q0O C;  4DRI A;  3PRB A;  2JS5 A;  2R9A A;  3HKE A;  3OM3 B;  3B8M A;  5IY5 B;  3OMA B;  2Y69 B;  1OCO B;  3DGE A;  1AI5 A;  4OX9 B;  2UXD O;  2QKS A;  2UU9 B;  4EFB A;  4XBF A;  4ZKI A;  1K97 A;  4MVS A;  3K5O A;  5B1B B;  4JAS A;  4HBO A;  1S5J A;  2XAF A;  1GN2 A;  5EBW C;  1JPX A;  1PNM A;  2LGW A;  4JI0 O;  3CCS V;  4C02 B;  3JAL B;  3RWR D;  3SJB C;  4G27 B;  3GWK C;  5BZB A;  1HNX B;  2HEP A;  4FMT A;  2BSK A;  3JD0 A;  1AP5 A;  4DRO A;  1GM7 A;  1T11 A;  1RM1 C;  4Z2L A;  4MW3 A;  1J4R A;  4AY1 A;  2IW5 A;  5L3F A;  3SYP A;  4JI8 O;  4BW5 A;  1F8A B;  2XAG A;  2OTL V;  4B3R B;  3JCU Z;  5L3G A;  3U11 A;  2KE0 A;  2IBZ H;  1Y6X A;  3O5I A;  4IGG A;  1LR1 A;  4NSB A;  3N27 A;  3CCE V;  2CGN A;  1N33 O;  4P9O A;  1WLE A;  1GPF A;  4P2Z A;  4QIB A;  2RUR A;  3KAD A;  3O5P A;  1XOU A;  4LF7 O;  4DV4 O;  2ZR4 A;  4FLX A;  1MOF A;  2BOB C;  3K06 A;  5CN0 A;  3WQV A;  1PPJ H;  2OCH A;  5BR8 O;  3NRK A;  3HB3 B;  3RFR A;  3QO7 A;  3ZRW A;  3I56 V;  1H8H G;  3OMN B;  3D3I A;  4DK0 A;  1YJN V;  4X1Y B;  4QT3 A;  1U96 A;  2X6B A;  3G67 A;  1I7F A;  3SR2 C;  3QG5 A;  2QM4 A;  3WQW A;  3KAC A;  5L3D A;  4NXN O;  4DV1 B;  1XMQ B;  5CB4 B;  1YDX A;  2XAS A;  1I94 B;  3RVZ A;  4NTY A;  3UQ8 A;  2ODM A;  4TV9 B;  1GN4 A;  4O2B B;  4JI4 O;  5C93 A;  3KAI A;  3VOU A;  1KMI Z;  1M57 C;  4UUJ C;  4IPX A;  1H2G A;  1HKJ A;  2EBO A;  1YXB A;  2JK5 C;  1OCR B;  1J6Y A;  1QLN A;  2B5U A;  1TGO A;  2QWO B;  1WNO A; 
#chains in the Genus database with same CATH homology
 1QZ2 A;  3IHZ A;  5HBF A;  3KAH A;  1EDQ A;  2YBU A;  4ODP A;  1J4H A;  1FKG A;  4W5U A;  1OGB A;  4ODK A;  3RM4 A;  4MSP A;  3WL0 A;  1FKK A;  3JYM A;  2D9F A;  3O5Q A;  3PRD A;  3ARS A;  4L72 B;  4R0X A;  4KQZ A;  1TFV A;  2N87 A;  1JND A;  4ODQ A;  1Y0O A;  3RFW A;  4DWS A;  3B9A A;  2RUQ A;  2G41 A;  2Y78 A;  3KCE A;  4TW7 A;  2A3B A;  2XP4 A;  3WKZ A;  4DRH A;  1HJW A;  4J4N A;  3O5E A;  2KI3 A;  3JYJ A;  4MAV A;  2O92 A;  3CHE A;  3UQA A;  1Q6I A;  3AS3 A;  1E6Z A;  4FN2 A;  3CZ8 A;  1D7J A;  2ZQU A;  3JXV A;  4ODR A;  4WKH A;  2YBT A;  1CTN A;  1W1P A;  4WKA A;  2VCD A;  3WD2 A;  3B9E A;  1FKT A;  4Q7N A;  1ZB5 A;  2OFN A;  3RM8 A;  4LAW A;  2FKE A;  1OWQ A;  2G8Z A;  5HW8 A;  4TYO A;  2PV3 A;  5B8I C;  1IX5 A;  2PV1 A;  4JFM A;  5D75 A;  1ZCN A;  3UI6 A;  3O5L A;  4TW8 A;  1ZL1 A;  1OGG A;  3UI5 A;  1HJX A;  2FDM A;  3QOK A;  3UI4 A;  3O5O A;  3AS1 A;  1R9H A;  2M2A A;  4WJX A;  2IUZ A;  3PR9 A;  2O9O A;  2DT1 A;  2AOS A;  3WD4 A;  4DRK A;  2XP7 A;  1JNT A;  4ZPT R;  2LKN A;  4LAY A;  3WL1 A;  1NWT A;  2WLY A;  1XRV A;  4ITZ A;  3ALF A;  1JNE A;  2XP3 A;  4MNJ A;  2DSW A;  4ODN A;  4FAP A;  4O2T A;  2WK2 A;  4DWS B;  1NH6 A;  1UR8 A;  1M5Y A;  1ZBK A;  2ZR5 A;  1Q1C A;  1FJD A;  1E6N A;  1FFR A;  3OOB A;  3O5K A;  4MPK A;  1LQ0 A;  4L3N A;  2M1I A;  1LG2 A;  2A3C A;  2MPH A;  4LAX A;  2Q5A A;  3AS2 A;  2B31 A;  4P8X A;  3ARP A;  3WH0 A;  4Z2K A;  4W9O A;  5HT1 A;  1Q6H A;  1FKR A;  5DIV A;  5GQB A;  1LL7 A;  4WK9 A;  2DT2 A;  4TNS A;  1FKB A;  1LL4 A;  1ZU8 A;  4WKF A;  1H0G A;  4ZS6 A;  2FAP A;  1D7H A;  1NSG A;  1J4I A;  1YW5 A;  1LL6 A;  2LPV A;  4IT6 A;  1KT1 A;  2LJ4 A;  4U86 A;  4Z2J A;  1NMV A;  4WIW A;  4HAR A;  1LJY A;  4IQ2 A;  3OA5 A;  4MGV A;  2A3E A;  1D7I A;  3B7X A;  1FKI A;  3FXY A;  3O5F A;  2PV2 A;  4P8W A;  3PA7 A;  2QF8 A;  4TW6 A;  3O5M A;  1E6R A;  4IT4 A;  4ODL A;  3TDB A;  4JYS A;  3IKG A;  1FAP A;  2OLH A;  2ITK A;  4GIV A;  2DG4 A;  2DG9 A;  3I6C A;  3AQU A;  2L2S A;  3IKD A;  4P8U A;  3B9D A;  2DPE A;  1ROT A;  4JFJ A;  3ARW A;  1WB0 A;  4IQC A;  1HJV A;  1PIN A;  2DT3 A;  3ARV A;  2ZQT A;  1GUV A;  2MNT A;  2F2D A;  1LG1 A;  2M08 A;  1UR9 A;  1W9V A;  3B09 A;  4LAV A;  1U79 A;  4DWS D;  2XPA A;  3CHC A;  3LUO A;  2ZQS A;  5I98 A;  1JVW A;  1K9T A;  3CH9 A;  1O6I A;  3BXW A;  1NWR A;  1SYT A;  1L1P A;  3ARZ A;  1F40 A;  1X6N A;  2DSZ A;  4ODO A;  1D6O A;  1FD9 A;  3FAP A;  1KFW A;  3ARQ A;  3G6L A;  2KO7 A;  3MDY B;  4U84 A;  1VF8 A;  4TX0 A;  1N1A A;  2F21 A;  2PPP A;  1E15 A;  1EQ3 A;  4J4O A;  2XPB A;  2KR7 A;  1E9L A;  3RM9 A;  1NWS A;  4BF8 A;  4DT4 A;  1HXV A;  3UQB A;  4MNM A;  5BXJ A;  4QT2 A;  5HW7 A;  1PBK A;  4W9P A;  1ROU A;  1W9U A;  4S3J A;  4NZC A;  1Q6U A;  4DRP A;  2DT0 A;  4Q22 A;  3WD0 A;  2PI6 A;  1NMW A;  5DIU A;  3VAW A;  3ODK A;  4XAK A;  1FKD A;  4DH0 A;  2ESC A;  3KZ7 A;  4QZV B;  1ZBV A;  3AS0 A;  3O5R A;  5DIT A;  4MNL A;  2RUC A;  3ARY A;  4DRN A;  2XP8 A;  4DWS C;  2XP5 A;  4Z2I A;  4PTM A;  4ODM A;  1W9P A;  4JFK A;  4DRQ A;  4GGQ A;  1ZBW A;  4R5E A;  1FKH A;  1BKF A;  3CHD A;  3KAF A;  5GPR A;  1YAT A;  5HUA A;  1QPF A;  1ZK6 A;  4JFL A;  1KT0 A;  1FKF A;  1W1T A;  4DZ2 A;  3O5J A;  4LGX A;  2UZ5 A;  2ZQV A;  2DSU A;  2AWG A;  5J6E A;  4MTV A;  1HKI A;  5DEZ A;  2WLZ A;  4DZ3 A;  1A7X A;  2DG3 A;  3CGN A;  1X6L A;  3EY6 A;  2KGJ A;  4HBE A;  2PBC A;  3RGC A;  2MLZ A;  3NTP A;  4KR0 B;  4Z2G A;  1C9H A;  4G2P A;  4S3K A;  3TC5 A;  2KFW A;  2F4E A;  2MLY A;  3ARX A;  1ZBC A;  2IF4 A;  3O5G A;  1EHN A;  3G6M A;  4MNK A;  3UF8 A;  5HWB A;  4DRI A;  3RME A;  3PRB A;  3W4R A;  1BL4 A;  1FKS A;  1EYM A;  1FFQ A;  3NI6 A;  4P8V A;  5HWC A;  1W1V A;  5HKG A;  5HTG A;  1QPL A;  3GPK A;  5GPG A;  1P5Q A;  2K8I A;  2MF9 A;  1H0I A;  3WD1 A;  3B8S A;  4HBO A;  1ITX A;  3UQI A;  2PPO A;  5HW6 A;  1EIB A;  4C02 B;  1RD6 A;  3WIJ A;  4DRJ A;  4DRO A;  1T11 A;  4Z2L A;  1J4R A;  4URI A;  4AY1 A;  2ZR6 A;  3KAG A;  3KAB A;  1B6C A;  1FKJ A;  2JZV A;  1F8A B;  2MLX A;  1XHG A;  2KE0 A;  1SR0 A;  3O5I A;  4NSB A;  1HKK A;  2LGO A;  3ARU A;  1GPF A;  5JH8 A;  3ARR A;  4G50 A;  4QIB A;  2RUR A;  3KAD A;  3O5P A;  1NWU A;  5DF0 A;  4U85 A;  1FKL A;  2RQS A;  2ZR4 A;  1GOI A;  4NNR A;  4N19 A;  4W9Q A;  3ART A;  1D2K A;  2A3A A;  3WQV A;  2PPN A;  3CHF A;  1W1Y A;  3NRK A;  5DO2 A;  4ZPV R;  1TCO C;  4QT3 A;  3PRA A;  2XP9 A;  3O5D A;  4Z2H A;  3H9R B;  3WQW A;  3KAC A;  4ML4 A;  2VN1 A;  4JFI A;  2DSV A;  3WD3 A;  1WAW A;  1E6P A;  3ALG A;  1HKM A;  4ZPW R;  2WM0 A;  2RUD A;  3TCZ A;  3KAI A;  3IK8 A;  2RSE A;  4DIP A;  2XP6 A;  4IPX A;  1HKJ A;  1W26 A;  3CGM A;  1J6Y A;  1JNS A;  3FY1 A;  4DRM A;  1WNO A;  3ARO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...