1Q6HA

Crystal structure of a truncated form of fkpa from escherichia coli
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
210
structure length
210
Chain Sequence
AFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional studies of FkpA from Escherichia coli, a cis/trans peptidyl-prolyl isomerase with chaperone activity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase fkpA
total genus 69
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2003-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF01346 FKBP_N Domain amino terminal to FKBP-type peptidyl-prolyl isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.460 Mainly Alpha Orthogonal Bundle Helix Hairpins Peptidyl-prolyl cis-trans isomerase, FKBP-type, N-terminal domain 1q6hA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1q6hA02
1JVWA 5HWBA 2RURA 4TYOA 3PRDA 4DRJA 4DRNA 2M08A 2OFNA 3I6CA 3O5LA 3RFWA 5J6EA 4U84A 2KO7A 1D7JA 2RUCA 3ODKA 4FAPA 3NI6A 2ZQSA 3UI6A 5HKGA 3O5JA 4IQCA 2DG4A 1Y0OA 1ZCNA 4ODLA 2VCDA 2ZR4A 2K8IA 2ZQVA 4ODOA 1F8AB 2PPOA 5HW8A 2PPNA 1NMVA 4N19A 1QPLA 4BF8A 5HW7A 4U85A 1P5QA 2MPHA 5I98A 4ODQA 1D7IA 1FKBA 2FKEA 5HW6A 3OOBA 3O5PA 4DRHA 5DIUA 1HXVA 4ITZA 2RUQA 3VAWA 2LGOA 4DRIA 1PINA 1R9HA 4DIPA 2PV1A 2D9FA 3O5DA 3KADA 2MLZA 1FKFA 2IF4A 3O5MA 3PRBA 1J4RA 2LJ4A 1JNSA 2ZR6A 1D6OA 1QZ2A 3KZ7A 3MDYB 1J6YA 3KAFA 5D75A 3TC5A 4ODPA 4J4OA 2DG9A 1FKRA 1L1PA 1ZK6A 2XP7A 3KAHA 3O5RA 1FKTA 4TNSA 2KFWA 1FKGA 4QIBA 1T11A 5HTGA 3KCEA 1FAPA 4G2PA 3WH0A 1BL4A 2KR7A 4O2TA 5HUAA 2XPAA 1A7XA 2PV3A 2F21A 1KT1A 4JFKA 3O5KA 3KABA 2MLXA 4IPXA 3PA7A 1J4HA 4TW8A 1J4IA 2XP3A 3JXVA 4JFJA 3UI4A 3KACA 1FKLA 2KI3A 2RUDA 3IHZA 4LAVA 1Q6HA 1PBKA 4QT2A 4QT3A 2FAPA 4GIVA 2LKNA 2LPVA 1QPFA 4DROA 1FKDA 1FKIA 2AWGA 4MSPA 2RQSA 1D7HA 2ZQUA 2XP5A 1W26A 3CGMA 1FKKA 1YW5A 2Y78A 3O5GA 4NNRA 4JFMA 3TDBA 4GGQA 2XP8A 1KT0A 4DRQA 4W9OA 1EYMA 2PPPA 1ROUA 4TW7A 2L2SA 3H9RB 4JFLA 5DITA 4G50A 3KAIA 3UI5A 4DZ3A 3B7XA 1EQ3A 1FKSA 1TCOC 2VN1A 1BKFA 3KAGA 1YATA 4FN2A 2KGJA 2MLYA 3UQIA 1N1AA 3FAPA 3NRKA 2DG3A 4ODKA 3UF8A 1NMWA 3EY6A 3LUOA 1FJDA 4C02B 3JYJA 1Q6IA 1FKHA 3RGCA 3UQBA 3B09A 2MF9A 4IQ2A 1F40A 4ODMA 1U79A 1M5YA 1FKJA 1Q1CA 4ODRA 2MNTA 3GPKA 3UQAA 2UZ5A 2KE0A 4R0XA 2F2DA 3IKDA 3IKGA 2F4EA 2PV2A 4J4NA 2N87A 2XPBA 4DT4A 5BXJA 1B6CA 2M2AA 3O5QA 2JZVA 4LAYA 2RSEA 5B8IC 4DH0A 4U86A 5HT1A 4LAXA 2PBCA 4TX0A 4W9PA 4DZ2A 2ZQTA 4DRKA 3JYMA 3IK8A 2XP6A 3O5FA 3NTPA 1C9HA 2XP9A 3CGNA 1NSGA 2ZR5A 3O5IA 4MGVA 4TW6A 5GPGA 4JFIA 2Q5AA 3TCZA 4JYSA 2ITKA 5HWCA 1JNTA 1ROTA 3O5EA 4W9QA 4DRMA 4ODNA 3O5OA 1FD9A 4LAWA 4DRPA 5DIVA 2M1IA 2XP4A 1Q6UA
chains in the Genus database with same CATH superfamily
3CCVV 3H1HH 1PNKA 2AW9A 3RYFB 2KO7A 1OGBA 4MAVA 1F8AB 2CAZC 3CC4V 5IJ9B 1EZJA 3O5PA 1HXVA 1N34B 1OCZC 4NYKA 2QA4V 2D9FA 3ASNB 1I5XA 3PRBA 1ROPA 2ZE7A 1Y74A 5FL7G 3CE2A 4J4OA 2YSUB 4ZHQB 4DUZB 3OTOO 1QLNA 4J7ZA 3FB7C 2DSZA 1E9LA 3WQVA 4X1KA 4O2TA 5KHKA 2ZIOA 1G1XB 2XPAA 2YI8A 3CRAA 1J4HA 1H8EG 3L9DA 5B1OA 3KACA 2H3OA 5TISZ 4X1IB 1SA0A 3O9OA 4LBEC 4CS4A 4DK1A 4GIVA 3K58A 3T1YO 1K34A 4UCSA 1T5EA 3GVMA 4NXMB 2R70A 1FKDA 3FFQA 2ZR2A 3ABUA 4X8AA 5KLVH 4JFMA 2XP8A 4B3TO 4RUEA 1TGOA 3E86A 3T1YB 5IT9N 5JVDA 4RUFA 1HNXO 3F7VC 1YATA 2WK2A 4LFBO 3H1JH 2QKAA 4B7KA 3RGCA 1M4UA 4LWSB 2UXCO 4FLXA 4ODMA 3FY1A 5KX5B 1VMGA 3APQA 1M56B 3QOKA 4X1IA 4MTXA 4CS3A 4U86A 2D2CB 1Q5OA 2CDYA 1Y76A 2Q67A 1DTOA 3HPLC 5EYPB 3WG7C 4DV6B 5HWCA 1PM9A 3OR7C 3WL1A 3OUFA 4MVMA 4MTOA 2FKXA 1E6ZA 3CCEV 3O5LA 2FYUH 4U84A 1W1YA 2AOSA 2UUCB 4JI6B 1YTFD 4F6RB 2ZDIC 1AILA 1N32O 2VCDA 4DV1B 4YJ2A 1QPLA 2EILB 2VRZA 3ASOB 1NVPB 3M8AA 2X6BA 1J5EO 3CMEV 3RYIB 4FM0A 4G27B 2X0LA 2LFRA 4I55A 5HW6A 3G6LA 1SQBH 2PF4E 3UT5B 4XDJA 2H8PC 3HR0A 4LFAB 1BSMA 4YIPA 3ARZA 2UUCO 2BCCH 2JGDA 2JS3A 2YIDA 1KB9F 3D36C 3I5DA 4JI7B 1VARA 4JYYA 4PA9A 4YY3B 4JAUA 1YJNV 2QR4A 1M9NA 3KAHA 5JH7B 4I9WA 4G2PA 3OMNB 4LFAO 3SPGA 1URFA 1OJHA 4HZ3A 4IIJB 2F21A 1NT2B 1L8DA 3K5NA 2JK5C 3ABKC 5KHHA 4GX2A 1FKLA 5CA0A 2KI3A 1SQGA 5KA6A 5BMVA 5J2TA 2UXDB 1LUVA 1SQXH 2IH1C 3CPWU 4TV8A 1J95A 3RYCA 4DROA 1NTZH 3AG4B 3E8BA 1JJ2U 3NXSA 4DR6O 1FJGB 4JAVA 5CN0A 2UUBO 1XBLA 2ZNIA 1EYMA 5IY5B 3X2QB 4DV4O 3P3PA 1FKSA 1NR1A 2R9IA 3R66A 3ASNC 4PD4F 1HJWA 3STZC 2W0XA 5L3CA 2ITCC 3UQBA 4MVZA 2PN0A 4RAIA 5IWAO 2UUBB 3H9VA 4WFEA 2W6JG 3BABA 4QZVB 5CA0B 4R0XA 4FLTA 2X7RB 1S0VA 2A3CA 4MW3A 2RQ6A 4NTYA 4QE7A 3ZHVA 3ABLB 3LDCA 4JV5O 3WFVA 5FPRA 3ZRWB 5ITZA 4X65O 1VQ8V 1SQFA 2GTSA 2ZE5A 4P9PA 3JATA 1OCCC 4HBNA 1YJ9V 2OTJV 4MNKA 2ILMA 4DRXB 5DF0A 3LUTB 3BXWA 2ZR4A 1X6LA 1JNEA 4Z2WA 1YDXA 4MVQA 4IYIA 1P5QA 3H01A 3FB8C 2W0FC 4LF5O 3SPHA 2LJ2A 3CCRV 3VOUA 2V4DA 1Z5VA 4Z1MG 5LGNA 4L3NA 3BAAA 3KAFA 4BAYA 4R6ZA 4ODPA 1QCEA 3RYIA 2DPEA 5DO2A 1FKTA 3WH0A 4DUYO 2Q5ZA 1RPRA 2FMLA 3BEHA 5LGUA 1S5JA 3CCJV 3QO8A 4LGXA 4TQDA 1M57B 2QM7A 2FB5A 2RUDA 5L3FA 4I50B 2LGWA 1GH6A 1QU7A 1FFRA 4FLZA 3T4DA 3SYAA 5EC2C 2DJVA 4ZPWR 1D7HA 1SQVH 1M5IA 1XL6A 5LP6C 4GLXA 3FXYA 4NNRA 4I55B 2KG7B 2HLDG 4TW7A 2XOKG 5C93A 3CCQV 2P4KA 3KAIA 5EZYA 2VN1A 5JH8A 2XASA 3FYEB 1KFWA 4ODKA 2OTLV 2V7QG 1R3KC 2EINB 5LHIA 1Q82W 3B8SA 2DSUA 1M5YA 4IHJB 3ZCCA 2EBOA 1NWTA 5LHHA 3JAKB 1KD1W 3GPKA 2PYJA 2ZKOA 2CK3G 4HBEA 2LO1A 1H38A 2RDCA 4JI4O 1Q86W 2P4VA 4QGPA 4P8UA 5HT1A 4OX9O 3CGNA 2HVJC 3OR6C 3T4ZA 3ABKB 2CE4A 4B3SO 4NXNO 5H6QA 2EZPA 1FKAO 3T1CA 3O5EA 2M1IA 5IYBO 1BHAA 3M7MX 3K0GA 3ETEA 3RYCB 4BW5A 4DR1B 1B3QA 3CD6V 3A0HZ 5EZYB 4TV9A 2DG4A 3HKDB 5IJ9A 1XNRB 1N4CA 1NH2D 1YIJV 3JD3A 3K0DA 1NU1H 3P32A 2RUQA 4NXMO 2CUGA 2K1EA 1AR1B 4FMTA 3S3XA 4DR4O 5EIBC 5JVDB 5LOVB 2Q68A 4ZKIA 2LJ4A 4GCZA 2RNBA 1LL6A 4UDMA 1E15A 1LL4A 1L1PA 2F1MA 2GBOA 1HP8A 2Y4UA 2GUZA 4ICGA 4CBCA 3RFRA 4NB5A 5LMNO 3ABLC 5CBGA 1WJZA 1W9PA 2B5UA 4DR5B 4TT3G 4TW8A 2WA4A 4BIZA 1J4IA 1GOIA 2F43G 1WB0A 1OCRB 2DYSC 4LF7O 4EB6A 3BVOA 1O6IA 3CRCA 4LF9B 3PR9A 4X20A 2LGQA 5KMGB 1R73A 2LPVA 1ENVA 1HJVA 1M56C 3TGUH 1AVMA 4XDLA 1Y67A 4LNUB 1H2SB 2A3EA 1I94B 2XAHA 3CWBH 1RM1C 3A0BZ 3THOA 4LF9O 2GUZB 2QJ1A 3P30A 3D3QA 3H1KH 3CC7V 4FN2A 1ZLZA 3WD2A 1N1AA 3NRKA 3UF8A 3HKBA 2UU9B 1FJDA 2AGAA 2AZ2A 1Q90D 1FKJA 3CXHF 1WB8A 4GX0A 3AG7A 1XHXA 3IC7A 2M2AA 3L72H 4YY3O 2ESCA 1B06A 4PA3A 4WIWA 1XMOO 4FVMA 3TXSA 3FD9A 4TW6A 2VWJA 2HFEC 4DR2O 3CHFA 2JJ2G 4E4EA 2Q5AA 3AS1A 3TCZA 4LNUA 3CCMV 2HJFC 3MDSA 4PV1B 4N23A 3K04A 3O65A 5BR8B 3HKCB 4DRNA 2OFNA 3I6CA 1XMOB 3ZHTA 1VF5B 4FAPA 4PA7A 1ZCNA 4RO2A 3AROA 4TOIA 3OGIB 1IZ3A 2QTOA 1K5SA 1N8RW 3SJQC 4MVUA 1RSOB 4DV7O 1GTOA 2OCCC 2XNDG 1M90W 3ETDA 1FFTB 2A3BA 1HWYA 2BSKB 4B3RB 4WKAA 3JAMN 4MSWC 2E75B 3J80N 1EBOA 1SKVA 2QTSA 4I0XB 1N34O 5GQBA 4DV7B 4Z2IA 1GUVA 1T11A 3KCEA 1ZWIC 4U3JA 4D7TA 1RM1B 5FLXN 1PNLA 5IWAB 1QLEC 2R72A 1E6PA 3SYPA 2MLXA 2V1DA 4L87A 4WBNB 3RN4A 3UI4A 1JA8A 4FM1A 3SYQA 3OTOB 1YITV 3GTYX 4URIA 3ZN1A 1XMQO 3AK1A 3UKMA 1Z5WA 1F51A 3UQ8A 1KMIZ 4X65B 4KR0B 1Q81W 2HHHB 3CX5F 2ZR3A 1D2KA 1MSDA 1LG2A 1V54C 3E22A 5JJNB 1KKDA 3G80A 3ZHQA 1NS1A 1EQ3A 3DC5A 3EXAA 4MW8A 4UFZA 3CHCA 1ZBVA 1FKHA 1HDJA 1DGSA 3B09A 1QNMA 5LBQA 1AJQA 1HR0B 1AI7A 4XBFA 4CH3A 4U7OA 4IIJA 2WLMA 5BXJA 3OMIB 3J81N 4JF3A 2BOCC 5GONA 5KUKA 5B1BB 4DRXA 4O4IB 2ZQTA 1KECA 1F4MA 4LH7A 4HARA 3A8TA 4JYBA 1TVKB 1RD6A 3CHEA 1KQSU 2EIKB 4F4LA 2C2AA 1BMFG 3AS3A 3I56V 3O5JA 1VF7A 2KQXA 1XL4A 3EHBB 4GZRB 4H44B 1IBMO 2IJKA 4AI8A 3JSNA 4DR7B 2DWEC 2YBTA 3CXCU 4DRHA 5EIBD 1KUQA 4KP4A 4HNAB 3IFXA 1H2KA 4NSBA 1P49A 5EBMC 2OWOA 1AI4A 3CCLV 3ZHUA 4O4LA 5HFMA 3ZMVA 1IX5A 2F4VB 3SPCA 1W0KG 2ZXWC 4K35A 2DT1A 4O4JA 4X1KB 2QEXV 1N36O 2KFWA 3TK1A 4ZHQA 1BL4A 2JS5A 1SC5B 3JD1A 1G4YB 5IYZB 5DEDA 2BTQA 1AB3A 1H0GA 1JX9A 1ZL1A 3ARRA 4CH4A 3F7YC 2NNUA 3EVKA 3L70H 3ABMB 1X6NA 1MMMA 3OMAB 1GRJA 2Q0OC 2VS0A 2WLHA 2H94A 3Q4HA 4HNAA 5LA6A 2IU0A 2VQFB 3CH9A 3ABTA 2IBZH 1Q43A 4JI8B 2W6IG 1H0IA 1HNZO 1VQ6V 4DR1O 4WJXA 2DT3A 2JIZG 1VQNV 5H5NA 1IVSA 4LF4O 3K03A 3ALGA 3JYCA 2VQFO 4J42A 2UXNA 4JI8O 2P7TC 4PDVA 1K9MW 1GK9A 2MF9A 4ZIBA 1K9TA 4JPRA 2QKSA 4DV3B 1U79A 1AR5A 2P90A 3K06A 2MNTA 1OCOB 5GONB 3RW0A 2F4EA 4LF4B 2Z3YA 4TUYB 4TX0A 4PI2A 5GTHZ 3JYMA 4ZI7B 4MTVA 1PPJH 4JYSA 2HVKC 1JNTA 1KYOF 4HAMA 3WD0A 5DIVA 5B1AB 2NLJC 2Y69B 3L73H 5HWBA 4QPJA 1O9GA 1EN6A 4KHPO 3CHDA 4YJ3A 4FK5C 3F5TA 3WB0A 3C3SA 4I9QA 4ODOA 3E8HA 4Z2JA 4O4LB 4BF8A 4G2KA 3KKYA 3RYHA 1HNWB 1D2DA 1R3IC 3X2QC 4JI1B 3A2FA 1KC8W 3JCZA 4BW9A 5AG2A 3ZS8C 1V9PA 2YUAA 1D6OA 1QZ2A 3HKBB 1S5LZ 2F93B 4O2AA 2DG9A 4DWSB 2XP7A 3BPZA 1P7GA 2GHYA 3H1LH 5HTGA 2YBUA 1Q7YW 2UU9O 5HUAA 3SR2C 4W4KA 2F23A 5LMUO 3O5KA 3FKSG 1DF5A 3C90A 4DWSD 2PTMA 4C7UA 1W1TA 1CPYA 4LCUC 4LR3A 2NR5A 5DN6G 4JI5B 3HB3B 1WP8A 1ZBKA 3RVZA 4ZOLB 5A2QN 4X20B 3LSSA 4P2ZA 3UCSC 2DYRC 4MSPA 1JFFA 2B1IA 4Z2HA 2FDMA 1BT8A 3DXRA 1VF6C 4HYOA 3R65A 1K92A 2YEVA 5EC1C 2JVDA 1QLEB 5DM6V 4CC5A 1ZB5A 3JALB 3T2MA 1NBMG 3G4SV 1FXKA 4WKFA 2NN4A 1Q6IA 2PUSA 2XT9A 5CBFA 2JEUA 3JASA 4I4TB 1F40A 5LGTA 3W7WA 2EIJC 3CS5A 3K08A 3RGBA 2UZ5A 3AG4C 1SRYA 2F2DA 3JSLA 2UXBO 2XPBA 1B6CA 3SPIA 5CB4A 2PBCA 4X1YA 4JI2B 3QVNA 1R3JC 1ZL8A 5LXTA 3KCXA 1NSGA 5B3SC 3O5IA 4J10A 2ITKA 3IAYA 4DRPA 1PP9H 2IJJA 4EKWA 2PGGA 3BA9A 1SETA 1QHTA 3CSXA 4D6TH 5J6EA 1RPOA 3T1HO 4QE9A 4JI2O 1NR7A 3FX7A 4N21A 4FLWA 1S3JA 4IQCA 2KKWA 1GM9A 1WP7A 1WPBA 2PPOA 5HW8A 3U10A 4K8XA 4B3MB 5I98A 1XMQB 5LL6Y 2YIAA 4ITZA 2ETNA 2HG5C 5KMGA 1Z2GA 1PINA 3WD4A 3UO2A 5K1XA 4J11A 2XAGA 4QPKA 1BCCH 1A32A 3N2KA 3O5MA 3WB2A 1OCCB 3MDYB 2G38A 1FKRA 4ASUG 2WWWA 1CTNA 2QE7G 4AQYB 2Y0IA 1FAPA 2WA3A 1F4NA 4PTMA 4UV8A 1FAFA 3WL0A 3ZN0A 4GT1A 2UXCB 3UO3A 3FYIB 4JZ2A 1K8AW 5CB4B 4X1YB 3ZJZA 3QG5A 3ZIAG 3RYFA 1L0NH 4H33A 4I50A 1HJXA 2LKNA 2Q73A 3ZMZA 3VQYA 3JALA 3OW2U 1QBZA 1GN2A 1E6NA 3ASOC 2GDSA 3QTCA 4F6RA 3GU0A 3B77A 2CTQA 1GN6A 4GX5A 1MSWD 4BIUA 3PN1A 2ZE8A 3TJTA 3K3WA 1I5YA 1X4TA 3UI5A 2PZSA 1FXKB 1N32B 1Y6XA 1BKFA 1JFFB 4FM2A 3EY6A 1SZTA 4C02B 4IHJA 3CC2V 3WQWA 5EK0A 5F2VO 2Q6AA 1I94O 1Q1CA 1XREA 1GMGA 4YHHO 3JAKA 1JCHA 2ZQMA 2L6LA 3U0ZA 1VQOV 1K3EA 4FZ0A 2F4VO 2QM8A 1IBLO 1U96A 2OYQA 1C9HA 3LDEA 1JJOA 4F6EA 1VQ7V 4JYCA 1FD9A 4LH6A 4UCTA 2FTKA 2DYSB 4ABMA 1VIBA 5BY1A 1OWQA 2RURA 1BS3A 1VF6A 2DQ0A 2Y4TA 3W7XA 1MZFA 3RM9A 1IBLB 2RUCA 1RFYA 2ZQSA 4KUMA 4DO2A 4K3AA 2ZQVA 1OCOC 2K8IA 1I0HA 3N27A 1NZ6A 1IX9A 1JPXA 1Q8IA 4MNLA 4ODQA 2UUAB 4MS2A 2Q8VA 3OOBA 3SJBC 2L35A 2XUMA 3K5LA 5BR8O 4PDRA 4ML4A 4CZZA 5JH7A 1ZTEA 1IDSA 1P4RA 4AILC 5L3DA 1HNZB 1DK1A 2QWPB 2ZR6A 2IJIA 2RCVA 1FS0G 5IYZA 3IC9A 4U7NA 3TC5A 2CH7B 2UUAO 2E5LB 1L1FA 3SYCA 4QIBA 3OEEG 4UVAA 5B1BC 3BRCA 1YXBA 3BHPA 4FLUA 4DV3O 4WFBV 2BOBC 1UPGA 4DK0A 1OCZB 2G8ZA 4G28B 5IE9A 1WNOA 2E5LO 4QT2A 2XTAA 4FFKA 2ZINA 1YJWV 4R50A 2B5UB 1E6RA 2AHZA 5EYPA 1ZU8A 1PL4A 3AEIA 2CTPA 2Q7EA 4DRQA 3K57A 4NVPA 1LNQA 5DITA 4DW0A 3K5OA 3B7XA 4ZS6A 2IH3C 2HHHO 2DN9A 1HNWO 3TCUA 3ZRWA 4JI1O 4UXNA 4LF5B 4EEQA 4ODRA 1IXMA 1H2GA 4PELA 4TWKA 3QO5A 4RQFA 3CRRA 3OGCC 4AHCA 4J80A 5JJEB 3IK8A 5IY5C 3IJ4A 2LW7A 3K79A 4JFIA 5LP6A 4QIWF 4W9QA 4DUYB 1IXBA 3HKCA 4NKGB 5J9PC 3ZBHA 1JVWA 4WCEV 5LMUB 3CYOA 4TUYA 1YTFB 3SGIA 3ARVA 3UI6A 3E35A 1Y0OA 3K9SA 2ZIMA 3CJHB 1K4DC 1BQ0A 3ARWA 1FKBA 1US6A 1F23A 3MD0A 3ZHSA 4DWSA 5C8YA 2LP7A 1QQCA 2HKOA 4GKJB 3VAWA 4IT4A 2JEXA 5IJ0B 1CXZB 2WSSG 1JNDA 4K8ZA 4FJCC 2IF4A 5GPRA 1TAEA 5KUMA 5BZBA 4J7JA 1W9UA 1JNSA 3AG2C 2RN9A 1XI1A 4PDMA 5L3EA 1IURA 2VQEB 4DR7O 4LWSA 3ZRSA 4UB8Z 1R3LC 4LFCB 2QSAA 5JQGB 2G41A 2F95B 4J9ZB 2HP8A 3FB5C 2ZM6O 4PDLA 3KABA 2ODMA 1MNGA 1SESA 3P3NA 1FFXB 3WKZA 4YJ2B 4DYLA 4KXRA 1GM7A 3ZHRA 4I0XA 4J9YB 1N36B 3E2EA 1R6KA 3SYOA 4LFCO 4PHZA 2EIKC 3HKEB 3AK3A 4B3SB 4ZI7A 5E79Z 1FKIA 2Q69A 2WLIB 3TXQA 3O5GA 1RSOA 3WD1A 4W9OA 3H1IH 1M93A 1Q3EA 3ALFA 4DZ3A 5J2UB 4DUZO 2MLYA 1PKXA 1W2BU 4B3MO 1E1RG 2QKCA 5LOVA 4MVSA 1GKFA 4KL1A 1FFXA 4NZCA 4JI3B 4O4HA 2HEPA 4H13B 3IKDA 4X66B 2DSVA 2DW4A 4LAYA 5CA1B 3AG1B 4Q7NA 4WF9V 4R5EA 3L75H 4TV9B 5GPGA 2OCCB 4O2BA 2ADPA 1L0LH 4H0LB 1K97A 3OUSA 4ODNA 3JD4A 4WFFA 4S3KA 1CP9A 3L74H 1NH2B 2Y0PA 4B3TB 1AI6A 3HKDA 3LSQA 2DYRB 3K59A 1QR8A 1YSCA 3WU2Z 1HKMA 2PPNA 1G6UA 4LFBB 1JMKC 2X6AA 1XHZA 3AQUA 2LGOA 3ETQA 1HKIA 1JCHB 3QF7A 3O5DA 4B7EA 1NJIW 5J2UA 3NR7A 2MLZA 2QF8A 5L3BA 2JDIG 1QVGU 3ARXA 4JTDB 4O4JB 4IYHA 1TA8A 4JASA 3OFNG 4EB6B 1FKGA 1K33A 3OM3B 1A7XA 2PV3A 1FXHA 5KHIA 4IPXA 1FXKC 4FLYA 4JYAO 4JI6O 4OPAA 3QNEA 5KX5A 3B9EA 4R7CA 1NVPD 1P7BA 3WB1A 3S3WA 1ZBWA 2ZE6A 4DR2B 2GV9A 3L71H 1W59A 1VP7A 2AWGA 2WAMA 2RQSA 1MABG 5D5PA 1U97A 2HJDA 2ZD9A 4EFBA 2Y78A 5C8YB 2OIGA 1NQTA 2YS8A 3ML0A 3GB7C 2Y48A 2ARHA 5K1PA 4X88A 1KP3A 1K73W 2WLNA 2F66C 2QWNB 4G50A 3EIPA 2DWDC 1B6QA 3E89A 2RMKB 4L72B 1SF9A 1OCRC 3G6BA 3ZMUA 1F7YA 1AI5A 4JTCB 3WIJA 4YXWG 3UQAA 1LR1A 5LHGA 4UCVA 4QJFB 5IJ0A 5B8IC 1UFIA 4B3RO 5FNVA 2UXDO 1XUQA 4BR6A 2XP6A 1XEQA 3RM4A 3B9DA 3CCSV 3E8GA 1H8HG 5J2TB 2DQ3A 3DXRB 3DTUB 4K0KB 3DC6A 1BHBA 3ZEDA 1TUBA 2B31A 3W7UA 2UXBB 4DRJA 4OXSA 5JJJB 2M08A 3UM7A 1UJWB 4LF6O 1Y66A 2CGOA 2A79B 5HW7A 2ZDIA 1SZXA 1GN3A 2P22C 1VQ9V 1S77D 3JASB 4PI0A 1V54B 2FKEA 1R1BA 1B04A 3JATB 5DIUA 1SQPH 4HBOA 3ZMTA 1AR4A 2P5OA 4CH6A 2ATKC 5IYDO 4Q22A 1WA8A 1J4RA 2YXHA 2YI9A 1J6YA 3ARUA 1XNQB 4JV5B 2A7WA 4U3JB 1D5NA 1TVKA 1ZBCA 2OLHA 4X62O 3CEIA 1GM8A 4FIPC 4MTFA 2RJZA 2PI4A 1FYJA 1ITXA 3B8MA 1AP6A 3AG1C 1H2NA 1OV9A 3SPJA 4OGQB 1I08A 1EZVH 3OD4A 1VQKV 2BSKA 3MHHC 3STLC 3ZRXA 4GX1A 2KSDA 1XOUA 2HR3A 3ICXA 1R6TA 4AQYO 2YEVB 2ZM6B 2E74B 3KG2A 2FAPA 4Q6GA 2BTOA 2XAQA 4YJ3B 4DWSC 1OHHG 2QWRB 3MHSC 4IT5A 3AK2A 1YW5A 4H37A 2PPPA 2L2SA 2KG7A 3E22B 2EZOA 1JVMA 2P06A 3JCUZ 1V55B 1JQ0A 2YICA 2E76B 4FPPA 2Q4PA 1YEWA 3CCUV 1TCOC 4DV0O 4NR1A 1K4CC 1LUWA 1MG1A 2BE3A 2QM4A 1NMWA 2D3OW 3FAPA 2LQTA 3RBZA 3LUOA 3AS2A 4O2AB 1Y76B 1ZAUA 3ARYA 1JR9A 2A0LA 1KU9A 1VF8A 1EDQA 2KB1A 4BWAA 3VQWA 2PY5A 4LF8O 1JOYA 4GUNA 3IKGA 3DGEA 4X89A 3O5QA 1M1KW 4MTGA 1EN5A 5KA5A 3LSUA 3VQXA 4P8WA 3FAVB 2Q0AA 3CJHA 4MNJA 1SA0B 3OA5A 2XP4A 4YHHB 4LC1A 3AG2B 4MPKA 1XILA 1D7JA 3Q4HB 5HKGA 4I7ZB 4KQZA 3MAQA 1EIBA 1NMVA 4N19A 4P8VA 3ETGA 1GN4A 1VQ5V 1KBHA 3K5MA 3C3TA 4D7SA 1PV0A 3N2KB 2WLZA 5A9GA 3OAAG 4ZPTR 1SR0A 4UVBA 4OX9B 5BXZA 3PRAA 5D75A 1H2LA 2EIMB 1VQMV 1RP3B 1ZL8B 5LXTB 2K9PA 3J7AU 1E44A 4UB6Z 4WFGA 1GPFA 4ZPVR 1WA8B 3W7SA 2CGNA 4JI3O 1V55C 1VQPV 1KP2A 4X66O 3JXVA 2YIBD 5LYJB 1N33O 2BTQB 1Q6HA 1YHQV 1W1VA 1PL0A 4UCOA 1NWSA 1BGYH 3M99B 1QPFA 4O4IA 1HNXB 1VEWA 3BMBA 4Q20A 3K9AA 2ZXWB 3OTFA 5EBWC 4J7KA 1HW7A 4MNMA 1I7FA 3CGMA 1FKKA 3TDBA 1N33B 1IBKO 3JD0A 1KT0A 3D3IA 1YI2V 2O92A 4UVCA 1S76D 2QWQB 4GYCB 4JFLA 2VWKA 2JRIA 2IW5A 4WFAV 2KGJA 1Y4MA 1ZX3A 5H9CA 3JYJA 2JGUA 5LMNB 2QGNA 4IL6Z 4DR5O 3ZMSA 3JD2A 1TFVA 3ARQA 1YCIA 1XDCA 1WN7A 3G67A 2PV2A 3D8CA 3B9AA 3JAWB 3N2GB 2JZVA 2AHYA 3RMEA 4DH0A 4LAXA 4DZ2A 1BE3H 3E83A 5CMUA 3RT3C 4JTAB 2XP9A 2ZT9B 5JCOA 5B66Z 3ARPA 2IJHA 5CA3A 3FAVA 4R8CA 1J5EB 4WBNA 5HFLA 2YDEA 1HKJA 1Q6UA 3ZX6A 2EINC 3B8NA 1S5HC 2XAFA 2OCHA 5IDJA 4NTXA 5KAFZ 4JYAB 4JI7O 4MT8A 2EX3A 4ODLA 3JARB 3RYHB 1N0JA 3WD3A 3RVYA 4U85A 1NWRA 3QO7A 1W1PA 2N05A 3LNNA 3KCYA 2PI5A 1PNMA 2PV1A 4DV5B 2A3QA 5GW7A 4WFHA 2IU3A 2MW2B 2X6CA 1FKFA 4GKKB 4O4HB 3KZ7A 4AY1A 1EM1A 2N74A 4DR3O 2EIJB 4L8JA 2YXLA 1ZK6A 3G6MA 3O5RA 4TNSA 4UCUA 3PJSK 1YF2A 5FPOA 2CTWA 1HKKA 4DV5O 2M7WA 1N0NA 3CP1A 1KT1A 2A06H 1Y74B 3BY6A 1EHNA 5B3SB 1FJGO 4I5SA 2EULA 5KHGA 2VQEO 2ITDC 4IGGA 4RQEA 4MVRA 4UCRA 4LAVA 1PBKA 2OT5A 3BCCH 5B1AC 4DV4B 4U3FH 4XDKA 3APOA 1AJNA 1COWG 5DECA 3U11A 3ZRVA 4WK9A 3ARSA 4EFEA 1XQ8A 1SYTA 1W9VA 1WNSA 1W26A 1NTMH 2CTRA 3CHXA 1X59A 1ROUA 1K7DA 2IUZA 3T1HB 2WLYA 4UV9A 4LF6B 2AZ0A 2YXYA 1YVWA 2ZCEA 3UT5A 3G6EV 2LFSA 4TSFG 2OIEA 2KE0A 1TUBB 3OE7G 1FFQA 2EIMC 4DT4A 4LP8A 5HBFA 3VQVA 1MZEA 4DRKA 1EFRG 3LNMB 1XNQO 2PYLA 1WAZA 3RWRD 4DXWA 4S3JA 5KAIZ 1M57C 2CH7A 5B1NA 1NH6A 4X62B 3ABMC 2DOSA 1YZBA 5GTIZ 4DRMA 1LG1A 4XAKA 2WLKA 1BQZA 4TYOA 2PI6A 2Z5UA 1XRVA 3OEHG 5EBLC 5LP6B 2Q7HA 1VQLV 4CH5A 2MPHA 1GAXA 1DF4A 5CBHA 1D7IA 2Q7GA 2O9OA 2GTAA 2DMXA 3G71V 4DRIA 4DIPA 4TQFA 1NTKH 1HR0O 5JWPA 1XHGA 3TETA 4FZ1A 2A3AA 3ARTA 2EJ7A 2E3CA 2DSWA 3W4RA 4PA6A 4DV0B 3FB6C 5IYCO 4DV6O 4Z2GA 1WB7A 2KR7A 1BL8A 2EILC 2JGDB 4OPHA 4DV2O 4JFKA 2AXTZ 2FL4A 1QR9A 4I4TA 1P84F 2Z0AA 4LF8B 4P9OA 2XP3A 4JFJA 3E8FA 4DV1O 3CRQA 4PA4A 3IHZA 5LA6B 1DLBA 1IBMB 3AS0A 2IM9A 1E1QG 1K5QA 4DV2B 1OGGA 4TV8B 2ZQUA 4X9QA 2XP5A 4WKHA 4E2LA 2M6YA 4JGSA 2P67A 2QWOB 3HKEA 1D5AA 1R6NA 2P6JA 2QDOA 3UQIA 4JI4B 3CMAV 2WM0A 4P30A 2Y69C 2XHBA 4BIOA 3GWOA 3SJCC 4NXNB 1TUEB 2ADQB 1OZ0A 5LYJA 1G8MA 1H2MA 4JAAA 1KKCA 3CB2A 2N04A 3O5FA 3RM8A 4MGVA 4CS2A 3B2EE 3KZIZ 4KFMA 1XNRO 1O9HA 3EFFK 2R9AA 3O5OA 4DR6B 3F5WC 2GSMB 1EN4A 5H2FZ 3BFRA 5JQGA 1SERA 5B5EZ 4FLVA 3PRDA 5DEZA 5CA1A 3RFWA 5H6RA 4DR4B 3ODKA 3NI6A 4B08A 3BA8A 1FXVA 4UUJC 4K0KO 1PD3A 4DW1A 1GO3F 1UR9A 1R9HA 1MA1A 3CRMA 4W4LA 1QVFU 3A0RA 1VQ4V 1CEZA 3KADA 2XAJA 4JI0B 2WLIA 4P8XA 1IBKB 1ORQC 4ZBMA 1ZSPA 4MVOA 2WPDG 5D5QA 1NWUA 4FFBA 1THZA 3OT7A 4YIOA 2B9ZA 4LF7B 1S72V 1LQ0A 1FPOA 1ZUQA 4QNHB 4Z1VA 4Z2LA 1W0JG 3W7TA 4X64B 5ITZB 4JI0O 5E1AC 1WLEA 2UXXA 2B1GA 4KHPB 3PA7A 3WG7B 2WLJA 3JARA 1E79G 4J41A 4A5UB 3SDLA 1WAWA 3B40A 2YIBA 3AG3B 1LJYA 4QT3A 4X64O 3SJAC 3B4SA 2R9RB 2MK3A 1AJPA 2WLLA 2DT2A 3DSQA 3I55V 1NKDA 1UR8A 1NI8A 4O2BB 2O57A 4IT6A 2A9HA 2EJRA 1AROP 2Q9LA 4FFBB 5KHJA 4GGQA 1MOFA 3GWKC 3CZ8A 3H9RB 4ZOLA 4RWUA 3KAGA 4CC6A 1WPXA 3VBBA 2DG3A 4Z2KA 2ZNJA 4IQ2A 4JZGA 4GKJO 5JCOC 4W5UA 3JAWA 3N2GA 2YC0A 5BMVB 4J4NA 1BZKA 3LDDA 2N87A 3D36A 4PJ0Z 2RSEA 4GKKO 2JJ1G 4W9PA 1SQQH 4JI5O 4NTWA 2DE0X 2WLLB 4DR3B 1SS3A 5L3GA 3NTPA 5FNVB 2ZR5A 1ROTA 3IGAC 4LAWA 1LL7A 2LW1A 3AG3C 2DT0A 1AP5A
chains in the Genus database with same CATH topology
1OWQA 2RURA 4MPKA 4DRNA 2OFNA 3I6CA 3RM9A 2KO7A 1OGBA 1D7JA 2RUCA 4FAPA 5HKGA 2ZQSA 1ZCNA 2ZQVA 3AROA 2K8IA 4MAVA 4KQZA 1F8AB 1EIBA 4P8VA 1NMVA 4N19A 4MNLA 4ODQA 3OOBA 3O5PA 1HXVA 4ML4A 2D9FA 2WLZA 4ZPTR 1SR0A 3PRBA 2A3BA 2ZR6A 3PRAA 5D75A 3TC5A 4WKAA 4J4OA 5GQBA 4Z2IA 2DSZA 1E9LA 4QIBA 1GUVA 1T11A 3KCEA 3WQVA 4O2TA 2XPAA 4ZPVR 1GPFA 1E6PA 2MLXA 1J4HA 2G8ZA 3JXVA 3UI4A 1WNOA 3KACA 1Q6HA 4QT2A 4GIVA 4URIA 1W1VA 1NWSA 1QPFA 4KR0B 1FKDA 1E6RA 4MNMA 1D2KA 3CGMA 1ZU8A 1FKKA 1LG2A 3TDBA 4JFMA 2XP8A 1KT0A 4DRQA 2O92A 5DITA 4JFLA 3B7XA 1EQ3A 1YATA 4ZS6A 2KGJA 2WK2A 3CHCA 1ZBVA 3JYJA 1FKHA 3RGCA 3B09A 4ODMA 3FY1A 4ODRA 1TFVA 3ARQA 3QOKA 2PV2A 5BXJA 3B9AA 2JZVA 3RMEA 4DH0A 4U86A 4LAXA 4DZ2A 2ZQTA 3IK8A 2XP9A 3ARPA 4JFIA 4HARA 5HWCA 4W9QA 3WL1A 1RD6A 3CHEA 1HKJA 1Q6UA 1JVWA 1E6ZA 3O5LA 3AS3A 4U84A 1W1YA 2AOSA 3ARVA 3UI6A 3O5JA 1Y0OA 4ODLA 2VCDA 1QPLA 3WD3A 4U85A 3ARWA 2YBTA 1FKBA 1NWRA 5HW6A 1W1PA 4DRHA 4DWSA 3G6LA 3VAWA 4IT4A 4NSBA 2PV1A 1JNDA 3ARZA 1FKFA 5GPRA 2IF4A 1W9UA 1JNSA 1IX5A 3KZ7A 4AY1A 1ZK6A 2DT1A 3G6MA 3KAHA 3O5RA 4TNSA 2KFWA 1HKKA 2G41A 4G2PA 1BL4A 2F21A 1KT1A 3KABA 1EHNA 1H0GA 1ZL1A 3WKZA 3ARRA 1X6NA 1FKLA 2KI3A 4LAVA 1PBKA 3CH9A 4WK9A 1FKIA 4DROA 3ARSA 1SYTA 1W9VA 1W26A 3O5GA 1H0IA 3WD1A 4WJXA 2DT3A 1EYMA 4W9OA 1ROUA 2IUZA 2WLYA 3ALFA 4DZ3A 1FKSA 3ALGA 2MLYA 1HJWA 3UQBA 2MF9A 1K9TA 1U79A 4NZCA 4QZVB 2MNTA 2KE0A 4R0XA 3IKDA 1FFQA 2F4EA 4DT4A 2A3CA 2DSVA 4LAYA 5HBFA 4TX0A 4DRKA 4Q7NA 3JYMA 4MTVA 4S3JA 4R5EA 5GPGA 1NH6A 4JYSA 1JNTA 4DRMA 3WD0A 4ODNA 1LG1A 4XAKA 5DIVA 4S3KA 5HWBA 4TYOA 4MNKA 2PI6A 3CHDA 5DF0A 3BXWA 1XRVA 4ODOA 2ZR4A 1HKMA 1X6LA 1JNEA 4Z2JA 2PPNA 4BF8A 1P5QA 2MPHA 1D7IA 2O9OA 3AQUA 4DRIA 2LGOA 4DIPA 1HKIA 3O5DA 2MLZA 2QF8A 1XHGA 3ARXA 1D6OA 1QZ2A 4L3NA 3KAFA 2A3AA 3ARTA 4ODPA 2DG9A 4DWSB 2DSWA 2XP7A 3W4RA 2DPEA 5DO2A 4Z2GA 1FKTA 1FKGA 5HTGA 2YBUA 3WH0A 2KR7A 5HUAA 1A7XA 2PV3A 4JFKA 4LGXA 3O5KA 4IPXA 4DWSD 2XP3A 1W1TA 4JFJA 2RUDA 3IHZA 3B9EA 3AS0A 1ZBKA 1ZBWA 1FFRA 2AWGA 4MSPA 1OGGA 2RQSA 4ZPWR 4Z2HA 1D7HA 2FDMA 2ZQUA 2XP5A 3FXYA 4WKHA 4NNRA 2Y78A 4TW7A 4G50A 3KAIA 2VN1A 1ZB5A 3UQIA 5JH8A 1KFWA 2WM0A 4L72B 4ODKA 4WKFA 1Q6IA 3B8SA 1F40A 2DSUA 1M5YA 1NWTA 3WIJA 3GPKA 3UQAA 2UZ5A 2F2DA 2XPBA 4HBEA 1B6CA 5B8IC 5HT1A 4P8UA 2PBCA 2XP6A 3O5FA 3RM8A 3CGNA 3O5IA 3B9DA 1NSGA 4MGVA 3RM4A 2ITKA 3O5EA 4DRPA 3O5OA 2M1IA 2B31A 4DRJA 3PRDA 5DEZA 5J6EA 2M08A 3RFWA 3ODKA 3NI6A 4IQCA 2DG4A 2PPOA 5HW8A 5HW7A 5I98A 2FKEA 1UR9A 5DIUA 4ITZA 2RUQA 1PINA 1R9HA 4HBOA 3WD4A 3KADA 4P8XA 3O5MA 4Q22A 1J4RA 2LJ4A 1LL6A 1J6YA 3MDYB 1NWUA 1E15A 1LL4A 3ARUA 1FKRA 1L1PA 1CTNA 1ZBCA 2OLHA 1LQ0A 4Z2LA 1FAPA 1ITXA 4PTMA 3WL0A 1W9PA 3PA7A 4TW8A 1J4IA 1GOIA 1WB0A 1O6IA 1WAWA 1LJYA 2FAPA 4QT3A 3PR9A 1HJXA 2LKNA 2LPVA 1HJVA 4DWSC 2DT2A 1UR8A 1E6NA 4IT6A 1YW5A 2A3EA 4GGQA 2PPPA 2L2SA 3CZ8A 3H9RB 3UI5A 1TCOC 1BKFA 4FN2A 3KAGA 3WD2A 1N1AA 3FAPA 3NRKA 2DG3A 4Z2KA 3UF8A 1NMWA 3EY6A 3LUOA 1FJDA 4C02B 3AS2A 3WQWA 3ARYA 4IQ2A 1VF8A 1FKJA 1EDQA 4W5UA 1Q1CA 3IKGA 4J4NA 2N87A 2M2AA 3O5QA 2RSEA 2ESCA 4W9PA 4WIWA 4P8WA 3NTPA 1C9HA 4TW6A 2ZR5A 3CHFA 2Q5AA 2DT0A 3AS1A 3TCZA 4MNJA 1ROTA 1FD9A 4LAWA 1LL7A 3OA5A 2XP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JVW A;  5HWB A;  2RUR A;  4TYO A;  3PRD A;  4DRJ A;  4DRN A;  2M08 A;  2OFN A;  3I6C A;  3O5L A;  3RFW A;  5J6E A;  4U84 A;  2KO7 A;  1D7J A;  2RUC A;  3ODK A;  4FAP A;  3NI6 A;  2ZQS A;  3UI6 A;  5HKG A;  3O5J A;  4IQC A;  2DG4 A;  1Y0O A;  1ZCN A;  4ODL A;  2VCD A;  2ZR4 A;  2K8I A;  2ZQV A;  4ODO A;  1F8A B;  2PPO A;  5HW8 A;  2PPN A;  1NMV A;  4N19 A;  1QPL A;  4BF8 A;  5HW7 A;  4U85 A;  1P5Q A;  2MPH A;  5I98 A;  4ODQ A;  1D7I A;  1FKB A;  2FKE A;  5HW6 A;  3OOB A;  3O5P A;  4DRH A;  5DIU A;  1HXV A;  4ITZ A;  2RUQ A;  3VAW A;  2LGO A;  4DRI A;  1PIN A;  1R9H A;  4DIP A;  2PV1 A;  2D9F A;  3O5D A;  3KAD A;  2MLZ A;  1FKF A;  2IF4 A;  3O5M A;  3PRB A;  1J4R A;  2LJ4 A;  1JNS A;  2ZR6 A;  1D6O A;  1QZ2 A;  3KZ7 A;  3MDY B;  1J6Y A;  3KAF A;  5D75 A;  3TC5 A;  4ODP A;  4J4O A;  2DG9 A;  1FKR A;  1L1P A;  1ZK6 A;  2XP7 A;  3KAH A;  3O5R A;  1FKT A;  4TNS A;  2KFW A;  1FKG A;  4QIB A;  1T11 A;  5HTG A;  3KCE A;  1FAP A;  4G2P A;  3WH0 A;  1BL4 A;  2KR7 A;  4O2T A;  5HUA A;  2XPA A;  1A7X A;  2PV3 A;  2F21 A;  1KT1 A;  4JFK A;  3O5K A;  3KAB A;  2MLX A;  4IPX A;  3PA7 A;  1J4H A;  4TW8 A;  1J4I A;  2XP3 A;  3JXV A;  4JFJ A;  3UI4 A;  3KAC A;  1FKL A;  2KI3 A;  2RUD A;  3IHZ A;  4LAV A;  1Q6H A;  1PBK A;  4QT2 A;  4QT3 A;  2FAP A;  4GIV A;  2LKN A;  2LPV A;  1QPF A;  4DRO A;  1FKD A;  1FKI A;  2AWG A;  4MSP A;  2RQS A;  1D7H A;  2ZQU A;  2XP5 A;  1W26 A;  3CGM A;  1FKK A;  1YW5 A;  2Y78 A;  3O5G A;  4NNR A;  4JFM A;  3TDB A;  4GGQ A;  2XP8 A;  1KT0 A;  4DRQ A;  4W9O A;  1EYM A;  2PPP A;  1ROU A;  4TW7 A;  2L2S A;  3H9R B;  4JFL A;  5DIT A;  4G50 A;  3KAI A;  3UI5 A;  4DZ3 A;  3B7X A;  1EQ3 A;  1FKS A;  1TCO C;  2VN1 A;  1BKF A;  3KAG A;  1YAT A;  4FN2 A;  2KGJ A;  2MLY A;  3UQI A;  1N1A A;  3FAP A;  3NRK A;  2DG3 A;  4ODK A;  3UF8 A;  1NMW A;  3EY6 A;  3LUO A;  1FJD A;  4C02 B;  3JYJ A;  1Q6I A;  1FKH A;  3RGC A;  3UQB A;  3B09 A;  2MF9 A;  4IQ2 A;  1F40 A;  4ODM A;  1U79 A;  1M5Y A;  1FKJ A;  1Q1C A;  4ODR A;  2MNT A;  3GPK A;  3UQA A;  2UZ5 A;  2KE0 A;  4R0X A;  2F2D A;  3IKD A;  3IKG A;  2F4E A;  2PV2 A;  4J4N A;  2N87 A;  2XPB A;  4DT4 A;  5BXJ A;  1B6C A;  2M2A A;  3O5Q A;  2JZV A;  4LAY A;  2RSE A;  5B8I C;  4DH0 A;  4U86 A;  5HT1 A;  4LAX A;  2PBC A;  4TX0 A;  4W9P A;  4DZ2 A;  2ZQT A;  4DRK A;  3JYM A;  3IK8 A;  2XP6 A;  3O5F A;  3NTP A;  1C9H A;  2XP9 A;  3CGN A;  1NSG A;  2ZR5 A;  3O5I A;  4MGV A;  4TW6 A;  5GPG A;  4JFI A;  2Q5A A;  3TCZ A;  4JYS A;  2ITK A;  5HWC A;  1JNT A;  1ROT A;  3O5E A;  4W9Q A;  4DRM A;  4ODN A;  3O5O A;  1FD9 A;  4LAW A;  4DRP A;  5DIV A;  2M1I A;  2XP4 A;  1Q6U A; 
#chains in the Genus database with same CATH topology
 3CCV V;  3H1H H;  1PNK A;  2AW9 A;  3RYF B;  2KO7 A;  1OGB A;  4MAV A;  1F8A B;  2CAZ C;  3CC4 V;  5IJ9 B;  1EZJ A;  3O5P A;  1HXV A;  1N34 B;  1OCZ C;  4NYK A;  2QA4 V;  2D9F A;  3ASN B;  1I5X A;  3PRB A;  1ROP A;  2ZE7 A;  1Y74 A;  5FL7 G;  3CE2 A;  4J4O A;  2YSU B;  4ZHQ B;  4DUZ B;  3OTO O;  1QLN A;  4J7Z A;  3FB7 C;  2DSZ A;  1E9L A;  3WQV A;  4X1K A;  4O2T A;  5KHK A;  2ZIO A;  1G1X B;  2XPA A;  2YI8 A;  3CRA A;  1J4H A;  1H8E G;  3L9D A;  5B1O A;  3KAC A;  2H3O A;  5TIS Z;  4X1I B;  1SA0 A;  3O9O A;  4LBE C;  4CS4 A;  4DK1 A;  4GIV A;  3K58 A;  3T1Y O;  1K34 A;  4UCS A;  1T5E A;  3GVM A;  4NXM B;  2R70 A;  1FKD A;  3FFQ A;  2ZR2 A;  3ABU A;  4X8A A;  5KLV H;  4JFM A;  2XP8 A;  4B3T O;  4RUE A;  1TGO A;  3E86 A;  3T1Y B;  5IT9 N;  5JVD A;  4RUF A;  1HNX O;  3F7V C;  1YAT A;  2WK2 A;  4LFB O;  3H1J H;  2QKA A;  4B7K A;  3RGC A;  1M4U A;  4LWS B;  2UXC O;  4FLX A;  4ODM A;  3FY1 A;  5KX5 B;  1VMG A;  3APQ A;  1M56 B;  3QOK A;  4X1I A;  4MTX A;  4CS3 A;  4U86 A;  2D2C B;  1Q5O A;  2CDY A;  1Y76 A;  2Q67 A;  1DTO A;  3HPL C;  5EYP B;  3WG7 C;  4DV6 B;  5HWC A;  1PM9 A;  3OR7 C;  3WL1 A;  3OUF A;  4MVM A;  4MTO A;  2FKX A;  1E6Z A;  3CCE V;  3O5L A;  2FYU H;  4U84 A;  1W1Y A;  2AOS A;  2UUC B;  4JI6 B;  1YTF D;  4F6R B;  2ZDI C;  1AIL A;  1N32 O;  2VCD A;  4DV1 B;  4YJ2 A;  1QPL A;  2EIL B;  2VRZ A;  3ASO B;  1NVP B;  3M8A A;  2X6B A;  1J5E O;  3CME V;  3RYI B;  4FM0 A;  4G27 B;  2X0L A;  2LFR A;  4I55 A;  5HW6 A;  3G6L A;  1SQB H;  2PF4 E;  3UT5 B;  4XDJ A;  2H8P C;  3HR0 A;  4LFA B;  1BSM A;  4YIP A;  3ARZ A;  2UUC O;  2BCC H;  2JGD A;  2JS3 A;  2YID A;  1KB9 F;  3D36 C;  3I5D A;  4JI7 B;  1VAR A;  4JYY A;  4PA9 A;  4YY3 B;  4JAU A;  1YJN V;  2QR4 A;  1M9N A;  3KAH A;  5JH7 B;  4I9W A;  4G2P A;  3OMN B;  4LFA O;  3SPG A;  1URF A;  1OJH A;  4HZ3 A;  4IIJ B;  2F21 A;  1NT2 B;  1L8D A;  3K5N A;  2JK5 C;  3ABK C;  5KHH A;  4GX2 A;  1FKL A;  5CA0 A;  2KI3 A;  1SQG A;  5KA6 A;  5BMV A;  5J2T A;  2UXD B;  1LUV A;  1SQX H;  2IH1 C;  3CPW U;  4TV8 A;  1J95 A;  3RYC A;  4DRO A;  1NTZ H;  3AG4 B;  3E8B A;  1JJ2 U;  3NXS A;  4DR6 O;  1FJG B;  4JAV A;  5CN0 A;  2UUB O;  1XBL A;  2ZNI A;  1EYM A;  5IY5 B;  3X2Q B;  4DV4 O;  3P3P A;  1FKS A;  1NR1 A;  2R9I A;  3R66 A;  3ASN C;  4PD4 F;  1HJW A;  3STZ C;  2W0X A;  5L3C A;  2ITC C;  3UQB A;  4MVZ A;  2PN0 A;  4RAI A;  5IWA O;  2UUB B;  3H9V A;  4WFE A;  2W6J G;  3BAB A;  4QZV B;  5CA0 B;  4R0X A;  4FLT A;  2X7R B;  1S0V A;  2A3C A;  4MW3 A;  2RQ6 A;  4NTY A;  4QE7 A;  3ZHV A;  3ABL B;  3LDC A;  4JV5 O;  3WFV A;  5FPR A;  3ZRW B;  5ITZ A;  4X65 O;  1VQ8 V;  1SQF A;  2GTS A;  2ZE5 A;  4P9P A;  3JAT A;  1OCC C;  4HBN A;  1YJ9 V;  2OTJ V;  4MNK A;  2ILM A;  4DRX B;  5DF0 A;  3LUT B;  3BXW A;  2ZR4 A;  1X6L A;  1JNE A;  4Z2W A;  1YDX A;  4MVQ A;  4IYI A;  1P5Q A;  3H01 A;  3FB8 C;  2W0F C;  4LF5 O;  3SPH A;  2LJ2 A;  3CCR V;  3VOU A;  2V4D A;  1Z5V A;  4Z1M G;  5LGN A;  4L3N A;  3BAA A;  3KAF A;  4BAY A;  4R6Z A;  4ODP A;  1QCE A;  3RYI A;  2DPE A;  5DO2 A;  1FKT A;  3WH0 A;  4DUY O;  2Q5Z A;  1RPR A;  2FML A;  3BEH A;  5LGU A;  1S5J A;  3CCJ V;  3QO8 A;  4LGX A;  4TQD A;  1M57 B;  2QM7 A;  2FB5 A;  2RUD A;  5L3F A;  4I50 B;  2LGW A;  1GH6 A;  1QU7 A;  1FFR A;  4FLZ A;  3T4D A;  3SYA A;  5EC2 C;  2DJV A;  4ZPW R;  1D7H A;  1SQV H;  1M5I A;  1XL6 A;  5LP6 C;  4GLX A;  3FXY A;  4NNR A;  4I55 B;  2KG7 B;  2HLD G;  4TW7 A;  2XOK G;  5C93 A;  3CCQ V;  2P4K A;  3KAI A;  5EZY A;  2VN1 A;  5JH8 A;  2XAS A;  3FYE B;  1KFW A;  4ODK A;  2OTL V;  2V7Q G;  1R3K C;  2EIN B;  5LHI A;  1Q82 W;  3B8S A;  2DSU A;  1M5Y A;  4IHJ B;  3ZCC A;  2EBO A;  1NWT A;  5LHH A;  3JAK B;  1KD1 W;  3GPK A;  2PYJ A;  2ZKO A;  2CK3 G;  4HBE A;  2LO1 A;  1H38 A;  2RDC A;  4JI4 O;  1Q86 W;  2P4V A;  4QGP A;  4P8U A;  5HT1 A;  4OX9 O;  3CGN A;  2HVJ C;  3OR6 C;  3T4Z A;  3ABK B;  2CE4 A;  4B3S O;  4NXN O;  5H6Q A;  2EZP A;  1FKA O;  3T1C A;  3O5E A;  2M1I A;  5IYB O;  1BHA A;  3M7M X;  3K0G A;  3ETE A;  3RYC B;  4BW5 A;  4DR1 B;  1B3Q A;  3CD6 V;  3A0H Z;  5EZY B;  4TV9 A;  2DG4 A;  3HKD B;  5IJ9 A;  1XNR B;  1N4C A;  1NH2 D;  1YIJ V;  3JD3 A;  3K0D A;  1NU1 H;  3P32 A;  2RUQ A;  4NXM O;  2CUG A;  2K1E A;  1AR1 B;  4FMT A;  3S3X A;  4DR4 O;  5EIB C;  5JVD B;  5LOV B;  2Q68 A;  4ZKI A;  2LJ4 A;  4GCZ A;  2RNB A;  1LL6 A;  4UDM A;  1E15 A;  1LL4 A;  1L1P A;  2F1M A;  2GBO A;  1HP8 A;  2Y4U A;  2GUZ A;  4ICG A;  4CBC A;  3RFR A;  4NB5 A;  5LMN O;  3ABL C;  5CBG A;  1WJZ A;  1W9P A;  2B5U A;  4DR5 B;  4TT3 G;  4TW8 A;  2WA4 A;  4BIZ A;  1J4I A;  1GOI A;  2F43 G;  1WB0 A;  1OCR B;  2DYS C;  4LF7 O;  4EB6 A;  3BVO A;  1O6I A;  3CRC A;  4LF9 B;  3PR9 A;  4X20 A;  2LGQ A;  5KMG B;  1R73 A;  2LPV A;  1ENV A;  1HJV A;  1M56 C;  3TGU H;  1AVM A;  4XDL A;  1Y67 A;  4LNU B;  1H2S B;  2A3E A;  1I94 B;  2XAH A;  3CWB H;  1RM1 C;  3A0B Z;  3THO A;  4LF9 O;  2GUZ B;  2QJ1 A;  3P30 A;  3D3Q A;  3H1K H;  3CC7 V;  4FN2 A;  1ZLZ A;  3WD2 A;  1N1A A;  3NRK A;  3UF8 A;  3HKB A;  2UU9 B;  1FJD A;  2AGA A;  2AZ2 A;  1Q90 D;  1FKJ A;  3CXH F;  1WB8 A;  4GX0 A;  3AG7 A;  1XHX A;  3IC7 A;  2M2A A;  3L72 H;  4YY3 O;  2ESC A;  1B06 A;  4PA3 A;  4WIW A;  1XMO O;  4FVM A;  3TXS A;  3FD9 A;  4TW6 A;  2VWJ A;  2HFE C;  4DR2 O;  3CHF A;  2JJ2 G;  4E4E A;  2Q5A A;  3AS1 A;  3TCZ A;  4LNU A;  3CCM V;  2HJF C;  3MDS A;  4PV1 B;  4N23 A;  3K04 A;  3O65 A;  5BR8 B;  3HKC B;  4DRN A;  2OFN A;  3I6C A;  1XMO B;  3ZHT A;  1VF5 B;  4FAP A;  4PA7 A;  1ZCN A;  4RO2 A;  3ARO A;  4TOI A;  3OGI B;  1IZ3 A;  2QTO A;  1K5S A;  1N8R W;  3SJQ C;  4MVU A;  1RSO B;  4DV7 O;  1GTO A;  2OCC C;  2XND G;  1M90 W;  3ETD A;  1FFT B;  2A3B A;  1HWY A;  2BSK B;  4B3R B;  4WKA A;  3JAM N;  4MSW C;  2E75 B;  3J80 N;  1EBO A;  1SKV A;  2QTS A;  4I0X B;  1N34 O;  5GQB A;  4DV7 B;  4Z2I A;  1GUV A;  1T11 A;  3KCE A;  1ZWI C;  4U3J A;  4D7T A;  1RM1 B;  5FLX N;  1PNL A;  5IWA B;  1QLE C;  2R72 A;  1E6P A;  3SYP A;  2MLX A;  2V1D A;  4L87 A;  4WBN B;  3RN4 A;  3UI4 A;  1JA8 A;  4FM1 A;  3SYQ A;  3OTO B;  1YIT V;  3GTY X;  4URI A;  3ZN1 A;  1XMQ O;  3AK1 A;  3UKM A;  1Z5W A;  1F51 A;  3UQ8 A;  1KMI Z;  4X65 B;  4KR0 B;  1Q81 W;  2HHH B;  3CX5 F;  2ZR3 A;  1D2K A;  1MSD A;  1LG2 A;  1V54 C;  3E22 A;  5JJN B;  1KKD A;  3G80 A;  3ZHQ A;  1NS1 A;  1EQ3 A;  3DC5 A;  3EXA A;  4MW8 A;  4UFZ A;  3CHC A;  1ZBV A;  1FKH A;  1HDJ A;  1DGS A;  3B09 A;  1QNM A;  5LBQ A;  1AJQ A;  1HR0 B;  1AI7 A;  4XBF A;  4CH3 A;  4U7O A;  4IIJ A;  2WLM A;  5BXJ A;  3OMI B;  3J81 N;  4JF3 A;  2BOC C;  5GON A;  5KUK A;  5B1B B;  4DRX A;  4O4I B;  2ZQT A;  1KEC A;  1F4M A;  4LH7 A;  4HAR A;  3A8T A;  4JYB A;  1TVK B;  1RD6 A;  3CHE A;  1KQS U;  2EIK B;  4F4L A;  2C2A A;  1BMF G;  3AS3 A;  3I56 V;  3O5J A;  1VF7 A;  2KQX A;  1XL4 A;  3EHB B;  4GZR B;  4H44 B;  1IBM O;  2IJK A;  4AI8 A;  3JSN A;  4DR7 B;  2DWE C;  2YBT A;  3CXC U;  4DRH A;  5EIB D;  1KUQ A;  4KP4 A;  4HNA B;  3IFX A;  1H2K A;  4NSB A;  1P49 A;  5EBM C;  2OWO A;  1AI4 A;  3CCL V;  3ZHU A;  4O4L A;  5HFM A;  3ZMV A;  1IX5 A;  2F4V B;  3SPC A;  1W0K G;  2ZXW C;  4K35 A;  2DT1 A;  4O4J A;  4X1K B;  2QEX V;  1N36 O;  2KFW A;  3TK1 A;  4ZHQ A;  1BL4 A;  2JS5 A;  1SC5 B;  3JD1 A;  1G4Y B;  5IYZ B;  5DED A;  2BTQ A;  1AB3 A;  1H0G A;  1JX9 A;  1ZL1 A;  3ARR A;  4CH4 A;  3F7Y C;  2NNU A;  3EVK A;  3L70 H;  3ABM B;  1X6N A;  1MMM A;  3OMA B;  1GRJ A;  2Q0O C;  2VS0 A;  2WLH A;  2H94 A;  3Q4H A;  4HNA A;  5LA6 A;  2IU0 A;  2VQF B;  3CH9 A;  3ABT A;  2IBZ H;  1Q43 A;  4JI8 B;  2W6I G;  1H0I A;  1HNZ O;  1VQ6 V;  4DR1 O;  4WJX A;  2DT3 A;  2JIZ G;  1VQN V;  5H5N A;  1IVS A;  4LF4 O;  3K03 A;  3ALG A;  3JYC A;  2VQF O;  4J42 A;  2UXN A;  4JI8 O;  2P7T C;  4PDV A;  1K9M W;  1GK9 A;  2MF9 A;  4ZIB A;  1K9T A;  4JPR A;  2QKS A;  4DV3 B;  1U79 A;  1AR5 A;  2P90 A;  3K06 A;  2MNT A;  1OCO B;  5GON B;  3RW0 A;  2F4E A;  4LF4 B;  2Z3Y A;  4TUY B;  4TX0 A;  4PI2 A;  5GTH Z;  3JYM A;  4ZI7 B;  4MTV A;  1PPJ H;  4JYS A;  2HVK C;  1JNT A;  1KYO F;  4HAM A;  3WD0 A;  5DIV A;  5B1A B;  2NLJ C;  2Y69 B;  3L73 H;  5HWB A;  4QPJ A;  1O9G A;  1EN6 A;  4KHP O;  3CHD A;  4YJ3 A;  4FK5 C;  3F5T A;  3WB0 A;  3C3S A;  4I9Q A;  4ODO A;  3E8H A;  4Z2J A;  4O4L B;  4BF8 A;  4G2K A;  3KKY A;  3RYH A;  1HNW B;  1D2D A;  1R3I C;  3X2Q C;  4JI1 B;  3A2F A;  1KC8 W;  3JCZ A;  4BW9 A;  5AG2 A;  3ZS8 C;  1V9P A;  2YUA A;  1D6O A;  1QZ2 A;  3HKB B;  1S5L Z;  2F93 B;  4O2A A;  2DG9 A;  4DWS B;  2XP7 A;  3BPZ A;  1P7G A;  2GHY A;  3H1L H;  5HTG A;  2YBU A;  1Q7Y W;  2UU9 O;  5HUA A;  3SR2 C;  4W4K A;  2F23 A;  5LMU O;  3O5K A;  3FKS G;  1DF5 A;  3C90 A;  4DWS D;  2PTM A;  4C7U A;  1W1T A;  1CPY A;  4LCU C;  4LR3 A;  2NR5 A;  5DN6 G;  4JI5 B;  3HB3 B;  1WP8 A;  1ZBK A;  3RVZ A;  4ZOL B;  5A2Q N;  4X20 B;  3LSS A;  4P2Z A;  3UCS C;  2DYR C;  4MSP A;  1JFF A;  2B1I A;  4Z2H A;  2FDM A;  1BT8 A;  3DXR A;  1VF6 C;  4HYO A;  3R65 A;  1K92 A;  2YEV A;  5EC1 C;  2JVD A;  1QLE B;  5DM6 V;  4CC5 A;  1ZB5 A;  3JAL B;  3T2M A;  1NBM G;  3G4S V;  1FXK A;  4WKF A;  2NN4 A;  1Q6I A;  2PUS A;  2XT9 A;  5CBF A;  2JEU A;  3JAS A;  4I4T B;  1F40 A;  5LGT A;  3W7W A;  2EIJ C;  3CS5 A;  3K08 A;  3RGB A;  2UZ5 A;  3AG4 C;  1SRY A;  2F2D A;  3JSL A;  2UXB O;  2XPB A;  1B6C A;  3SPI A;  5CB4 A;  2PBC A;  4X1Y A;  4JI2 B;  3QVN A;  1R3J C;  1ZL8 A;  5LXT A;  3KCX A;  1NSG A;  5B3S C;  3O5I A;  4J10 A;  2ITK A;  3IAY A;  4DRP A;  1PP9 H;  2IJJ A;  4EKW A;  2PGG A;  3BA9 A;  1SET A;  1QHT A;  3CSX A;  4D6T H;  5J6E A;  1RPO A;  3T1H O;  4QE9 A;  4JI2 O;  1NR7 A;  3FX7 A;  4N21 A;  4FLW A;  1S3J A;  4IQC A;  2KKW A;  1GM9 A;  1WP7 A;  1WPB A;  2PPO A;  5HW8 A;  3U10 A;  4K8X A;  4B3M B;  5I98 A;  1XMQ B;  5LL6 Y;  2YIA A;  4ITZ A;  2ETN A;  2HG5 C;  5KMG A;  1Z2G A;  1PIN A;  3WD4 A;  3UO2 A;  5K1X A;  4J11 A;  2XAG A;  4QPK A;  1BCC H;  1A32 A;  3N2K A;  3O5M A;  3WB2 A;  1OCC B;  3MDY B;  2G38 A;  1FKR A;  4ASU G;  2WWW A;  1CTN A;  2QE7 G;  4AQY B;  2Y0I A;  1FAP A;  2WA3 A;  1F4N A;  4PTM A;  4UV8 A;  1FAF A;  3WL0 A;  3ZN0 A;  4GT1 A;  2UXC B;  3UO3 A;  3FYI B;  4JZ2 A;  1K8A W;  5CB4 B;  4X1Y B;  3ZJZ A;  3QG5 A;  3ZIA G;  3RYF A;  1L0N H;  4H33 A;  4I50 A;  1HJX A;  2LKN A;  2Q73 A;  3ZMZ A;  3VQY A;  3JAL A;  3OW2 U;  1QBZ A;  1GN2 A;  1E6N A;  3ASO C;  2GDS A;  3QTC A;  4F6R A;  3GU0 A;  3B77 A;  2CTQ A;  1GN6 A;  4GX5 A;  1MSW D;  4BIU A;  3PN1 A;  2ZE8 A;  3TJT A;  3K3W A;  1I5Y A;  1X4T A;  3UI5 A;  2PZS A;  1FXK B;  1N32 B;  1Y6X A;  1BKF A;  1JFF B;  4FM2 A;  3EY6 A;  1SZT A;  4C02 B;  4IHJ A;  3CC2 V;  3WQW A;  5EK0 A;  5F2V O;  2Q6A A;  1I94 O;  1Q1C A;  1XRE A;  1GMG A;  4YHH O;  3JAK A;  1JCH A;  2ZQM A;  2L6L A;  3U0Z A;  1VQO V;  1K3E A;  4FZ0 A;  2F4V O;  2QM8 A;  1IBL O;  1U96 A;  2OYQ A;  1C9H A;  3LDE A;  1JJO A;  4F6E A;  1VQ7 V;  4JYC A;  1FD9 A;  4LH6 A;  4UCT A;  2FTK A;  2DYS B;  4ABM A;  1VIB A;  5BY1 A;  1OWQ A;  2RUR A;  1BS3 A;  1VF6 A;  2DQ0 A;  2Y4T A;  3W7X A;  1MZF A;  3RM9 A;  1IBL B;  2RUC A;  1RFY A;  2ZQS A;  4KUM A;  4DO2 A;  4K3A A;  2ZQV A;  1OCO C;  2K8I A;  1I0H A;  3N27 A;  1NZ6 A;  1IX9 A;  1JPX A;  1Q8I A;  4MNL A;  4ODQ A;  2UUA B;  4MS2 A;  2Q8V A;  3OOB A;  3SJB C;  2L35 A;  2XUM A;  3K5L A;  5BR8 O;  4PDR A;  4ML4 A;  4CZZ A;  5JH7 A;  1ZTE A;  1IDS A;  1P4R A;  4AIL C;  5L3D A;  1HNZ B;  1DK1 A;  2QWP B;  2ZR6 A;  2IJI A;  2RCV A;  1FS0 G;  5IYZ A;  3IC9 A;  4U7N A;  3TC5 A;  2CH7 B;  2UUA O;  2E5L B;  1L1F A;  3SYC A;  4QIB A;  3OEE G;  4UVA A;  5B1B C;  3BRC A;  1YXB A;  3BHP A;  4FLU A;  4DV3 O;  4WFB V;  2BOB C;  1UPG A;  4DK0 A;  1OCZ B;  2G8Z A;  4G28 B;  5IE9 A;  1WNO A;  2E5L O;  4QT2 A;  2XTA A;  4FFK A;  2ZIN A;  1YJW V;  4R50 A;  2B5U B;  1E6R A;  2AHZ A;  5EYP A;  1ZU8 A;  1PL4 A;  3AEI A;  2CTP A;  2Q7E A;  4DRQ A;  3K57 A;  4NVP A;  1LNQ A;  5DIT A;  4DW0 A;  3K5O A;  3B7X A;  4ZS6 A;  2IH3 C;  2HHH O;  2DN9 A;  1HNW O;  3TCU A;  3ZRW A;  4JI1 O;  4UXN A;  4LF5 B;  4EEQ A;  4ODR A;  1IXM A;  1H2G A;  4PEL A;  4TWK A;  3QO5 A;  4RQF A;  3CRR A;  3OGC C;  4AHC A;  4J80 A;  5JJE B;  3IK8 A;  5IY5 C;  3IJ4 A;  2LW7 A;  3K79 A;  4JFI A;  5LP6 A;  4QIW F;  4W9Q A;  4DUY B;  1IXB A;  3HKC A;  4NKG B;  5J9P C;  3ZBH A;  1JVW A;  4WCE V;  5LMU B;  3CYO A;  4TUY A;  1YTF B;  3SGI A;  3ARV A;  3UI6 A;  3E35 A;  1Y0O A;  3K9S A;  2ZIM A;  3CJH B;  1K4D C;  1BQ0 A;  3ARW A;  1FKB A;  1US6 A;  1F23 A;  3MD0 A;  3ZHS A;  4DWS A;  5C8Y A;  2LP7 A;  1QQC A;  2HKO A;  4GKJ B;  3VAW A;  4IT4 A;  2JEX A;  5IJ0 B;  1CXZ B;  2WSS G;  1JND A;  4K8Z A;  4FJC C;  2IF4 A;  5GPR A;  1TAE A;  5KUM A;  5BZB A;  4J7J A;  1W9U A;  1JNS A;  3AG2 C;  2RN9 A;  1XI1 A;  4PDM A;  5L3E A;  1IUR A;  2VQE B;  4DR7 O;  4LWS A;  3ZRS A;  4UB8 Z;  1R3L C;  4LFC B;  2QSA A;  5JQG B;  2G41 A;  2F95 B;  4J9Z B;  2HP8 A;  3FB5 C;  2ZM6 O;  4PDL A;  3KAB A;  2ODM A;  1MNG A;  1SES A;  3P3N A;  1FFX B;  3WKZ A;  4YJ2 B;  4DYL A;  4KXR A;  1GM7 A;  3ZHR A;  4I0X A;  4J9Y B;  1N36 B;  3E2E A;  1R6K A;  3SYO A;  4LFC O;  4PHZ A;  2EIK C;  3HKE B;  3AK3 A;  4B3S B;  4ZI7 A;  5E79 Z;  1FKI A;  2Q69 A;  2WLI B;  3TXQ A;  3O5G A;  1RSO A;  3WD1 A;  4W9O A;  3H1I H;  1M93 A;  1Q3E A;  3ALF A;  4DZ3 A;  5J2U B;  4DUZ O;  2MLY A;  1PKX A;  1W2B U;  4B3M O;  1E1R G;  2QKC A;  5LOV A;  4MVS A;  1GKF A;  4KL1 A;  1FFX A;  4NZC A;  4JI3 B;  4O4H A;  2HEP A;  4H13 B;  3IKD A;  4X66 B;  2DSV A;  2DW4 A;  4LAY A;  5CA1 B;  3AG1 B;  4Q7N A;  4WF9 V;  4R5E A;  3L75 H;  4TV9 B;  5GPG A;  2OCC B;  4O2B A;  2ADP A;  1L0L H;  4H0L B;  1K97 A;  3OUS A;  4ODN A;  3JD4 A;  4WFF A;  4S3K A;  1CP9 A;  3L74 H;  1NH2 B;  2Y0P A;  4B3T B;  1AI6 A;  3HKD A;  3LSQ A;  2DYR B;  3K59 A;  1QR8 A;  1YSC A;  3WU2 Z;  1HKM A;  2PPN A;  1G6U A;  4LFB B;  1JMK C;  2X6A A;  1XHZ A;  3AQU A;  2LGO A;  3ETQ A;  1HKI A;  1JCH B;  3QF7 A;  3O5D A;  4B7E A;  1NJI W;  5J2U A;  3NR7 A;  2MLZ A;  2QF8 A;  5L3B A;  2JDI G;  1QVG U;  3ARX A;  4JTD B;  4O4J B;  4IYH A;  1TA8 A;  4JAS A;  3OFN G;  4EB6 B;  1FKG A;  1K33 A;  3OM3 B;  1A7X A;  2PV3 A;  1FXH A;  5KHI A;  4IPX A;  1FXK C;  4FLY A;  4JYA O;  4JI6 O;  4OPA A;  3QNE A;  5KX5 A;  3B9E A;  4R7C A;  1NVP D;  1P7B A;  3WB1 A;  3S3W A;  1ZBW A;  2ZE6 A;  4DR2 B;  2GV9 A;  3L71 H;  1W59 A;  1VP7 A;  2AWG A;  2WAM A;  2RQS A;  1MAB G;  5D5P A;  1U97 A;  2HJD A;  2ZD9 A;  4EFB A;  2Y78 A;  5C8Y B;  2OIG A;  1NQT A;  2YS8 A;  3ML0 A;  3GB7 C;  2Y48 A;  2ARH A;  5K1P A;  4X88 A;  1KP3 A;  1K73 W;  2WLN A;  2F66 C;  2QWN B;  4G50 A;  3EIP A;  2DWD C;  1B6Q A;  3E89 A;  2RMK B;  4L72 B;  1SF9 A;  1OCR C;  3G6B A;  3ZMU A;  1F7Y A;  1AI5 A;  4JTC B;  3WIJ A;  4YXW G;  3UQA A;  1LR1 A;  5LHG A;  4UCV A;  4QJF B;  5IJ0 A;  5B8I C;  1UFI A;  4B3R O;  5FNV A;  2UXD O;  1XUQ A;  4BR6 A;  2XP6 A;  1XEQ A;  3RM4 A;  3B9D A;  3CCS V;  3E8G A;  1H8H G;  5J2T B;  2DQ3 A;  3DXR B;  3DTU B;  4K0K B;  3DC6 A;  1BHB A;  3ZED A;  1TUB A;  2B31 A;  3W7U A;  2UXB B;  4DRJ A;  4OXS A;  5JJJ B;  2M08 A;  3UM7 A;  1UJW B;  4LF6 O;  1Y66 A;  2CGO A;  2A79 B;  5HW7 A;  2ZDI A;  1SZX A;  1GN3 A;  2P22 C;  1VQ9 V;  1S77 D;  3JAS B;  4PI0 A;  1V54 B;  2FKE A;  1R1B A;  1B04 A;  3JAT B;  5DIU A;  1SQP H;  4HBO A;  3ZMT A;  1AR4 A;  2P5O A;  4CH6 A;  2ATK C;  5IYD O;  4Q22 A;  1WA8 A;  1J4R A;  2YXH A;  2YI9 A;  1J6Y A;  3ARU A;  1XNQ B;  4JV5 B;  2A7W A;  4U3J B;  1D5N A;  1TVK A;  1ZBC A;  2OLH A;  4X62 O;  3CEI A;  1GM8 A;  4FIP C;  4MTF A;  2RJZ A;  2PI4 A;  1FYJ A;  1ITX A;  3B8M A;  1AP6 A;  3AG1 C;  1H2N A;  1OV9 A;  3SPJ A;  4OGQ B;  1I08 A;  1EZV H;  3OD4 A;  1VQK V;  2BSK A;  3MHH C;  3STL C;  3ZRX A;  4GX1 A;  2KSD A;  1XOU A;  2HR3 A;  3ICX A;  1R6T A;  4AQY O;  2YEV B;  2ZM6 B;  2E74 B;  3KG2 A;  2FAP A;  4Q6G A;  2BTO A;  2XAQ A;  4YJ3 B;  4DWS C;  1OHH G;  2QWR B;  3MHS C;  4IT5 A;  3AK2 A;  1YW5 A;  4H37 A;  2PPP A;  2L2S A;  2KG7 A;  3E22 B;  2EZO A;  1JVM A;  2P06 A;  3JCU Z;  1V55 B;  1JQ0 A;  2YIC A;  2E76 B;  4FPP A;  2Q4P A;  1YEW A;  3CCU V;  1TCO C;  4DV0 O;  4NR1 A;  1K4C C;  1LUW A;  1MG1 A;  2BE3 A;  2QM4 A;  1NMW A;  2D3O W;  3FAP A;  2LQT A;  3RBZ A;  3LUO A;  3AS2 A;  4O2A B;  1Y76 B;  1ZAU A;  3ARY A;  1JR9 A;  2A0L A;  1KU9 A;  1VF8 A;  1EDQ A;  2KB1 A;  4BWA A;  3VQW A;  2PY5 A;  4LF8 O;  1JOY A;  4GUN A;  3IKG A;  3DGE A;  4X89 A;  3O5Q A;  1M1K W;  4MTG A;  1EN5 A;  5KA5 A;  3LSU A;  3VQX A;  4P8W A;  3FAV B;  2Q0A A;  3CJH A;  4MNJ A;  1SA0 B;  3OA5 A;  2XP4 A;  4YHH B;  4LC1 A;  3AG2 B;  4MPK A;  1XIL A;  1D7J A;  3Q4H B;  5HKG A;  4I7Z B;  4KQZ A;  3MAQ A;  1EIB A;  1NMV A;  4N19 A;  4P8V A;  3ETG A;  1GN4 A;  1VQ5 V;  1KBH A;  3K5M A;  3C3T A;  4D7S A;  1PV0 A;  3N2K B;  2WLZ A;  5A9G A;  3OAA G;  4ZPT R;  1SR0 A;  4UVB A;  4OX9 B;  5BXZ A;  3PRA A;  5D75 A;  1H2L A;  2EIM B;  1VQM V;  1RP3 B;  1ZL8 B;  5LXT B;  2K9P A;  3J7A U;  1E44 A;  4UB6 Z;  4WFG A;  1GPF A;  4ZPV R;  1WA8 B;  3W7S A;  2CGN A;  4JI3 O;  1V55 C;  1VQP V;  1KP2 A;  4X66 O;  3JXV A;  2YIB D;  5LYJ B;  1N33 O;  2BTQ B;  1Q6H A;  1YHQ V;  1W1V A;  1PL0 A;  4UCO A;  1NWS A;  1BGY H;  3M99 B;  1QPF A;  4O4I A;  1HNX B;  1VEW A;  3BMB A;  4Q20 A;  3K9A A;  2ZXW B;  3OTF A;  5EBW C;  4J7K A;  1HW7 A;  4MNM A;  1I7F A;  3CGM A;  1FKK A;  3TDB A;  1N33 B;  1IBK O;  3JD0 A;  1KT0 A;  3D3I A;  1YI2 V;  2O92 A;  4UVC A;  1S76 D;  2QWQ B;  4GYC B;  4JFL A;  2VWK A;  2JRI A;  2IW5 A;  4WFA V;  2KGJ A;  1Y4M A;  1ZX3 A;  5H9C A;  3JYJ A;  2JGU A;  5LMN B;  2QGN A;  4IL6 Z;  4DR5 O;  3ZMS A;  3JD2 A;  1TFV A;  3ARQ A;  1YCI A;  1XDC A;  1WN7 A;  3G67 A;  2PV2 A;  3D8C A;  3B9A A;  3JAW B;  3N2G B;  2JZV A;  2AHY A;  3RME A;  4DH0 A;  4LAX A;  4DZ2 A;  1BE3 H;  3E83 A;  5CMU A;  3RT3 C;  4JTA B;  2XP9 A;  2ZT9 B;  5JCO A;  5B66 Z;  3ARP A;  2IJH A;  5CA3 A;  3FAV A;  4R8C A;  1J5E B;  4WBN A;  5HFL A;  2YDE A;  1HKJ A;  1Q6U A;  3ZX6 A;  2EIN C;  3B8N A;  1S5H C;  2XAF A;  2OCH A;  5IDJ A;  4NTX A;  5KAF Z;  4JYA B;  4JI7 O;  4MT8 A;  2EX3 A;  4ODL A;  3JAR B;  3RYH B;  1N0J A;  3WD3 A;  3RVY A;  4U85 A;  1NWR A;  3QO7 A;  1W1P A;  2N05 A;  3LNN A;  3KCY A;  2PI5 A;  1PNM A;  2PV1 A;  4DV5 B;  2A3Q A;  5GW7 A;  4WFH A;  2IU3 A;  2MW2 B;  2X6C A;  1FKF A;  4GKK B;  4O4H B;  3KZ7 A;  4AY1 A;  1EM1 A;  2N74 A;  4DR3 O;  2EIJ B;  4L8J A;  2YXL A;  1ZK6 A;  3G6M A;  3O5R A;  4TNS A;  4UCU A;  3PJS K;  1YF2 A;  5FPO A;  2CTW A;  1HKK A;  4DV5 O;  2M7W A;  1N0N A;  3CP1 A;  1KT1 A;  2A06 H;  1Y74 B;  3BY6 A;  1EHN A;  5B3S B;  1FJG O;  4I5S A;  2EUL A;  5KHG A;  2VQE O;  2ITD C;  4IGG A;  4RQE A;  4MVR A;  4UCR A;  4LAV A;  1PBK A;  2OT5 A;  3BCC H;  5B1A C;  4DV4 B;  4U3F H;  4XDK A;  3APO A;  1AJN A;  1COW G;  5DEC A;  3U11 A;  3ZRV A;  4WK9 A;  3ARS A;  4EFE A;  1XQ8 A;  1SYT A;  1W9V A;  1WNS A;  1W26 A;  1NTM H;  2CTR A;  3CHX A;  1X59 A;  1ROU A;  1K7D A;  2IUZ A;  3T1H B;  2WLY A;  4UV9 A;  4LF6 B;  2AZ0 A;  2YXY A;  1YVW A;  2ZCE A;  3UT5 A;  3G6E V;  2LFS A;  4TSF G;  2OIE A;  2KE0 A;  1TUB B;  3OE7 G;  1FFQ A;  2EIM C;  4DT4 A;  4LP8 A;  5HBF A;  3VQV A;  1MZE A;  4DRK A;  1EFR G;  3LNM B;  1XNQ O;  2PYL A;  1WAZ A;  3RWR D;  4DXW A;  4S3J A;  5KAI Z;  1M57 C;  2CH7 A;  5B1N A;  1NH6 A;  4X62 B;  3ABM C;  2DOS A;  1YZB A;  5GTI Z;  4DRM A;  1LG1 A;  4XAK A;  2WLK A;  1BQZ A;  4TYO A;  2PI6 A;  2Z5U A;  1XRV A;  3OEH G;  5EBL C;  5LP6 B;  2Q7H A;  1VQL V;  4CH5 A;  2MPH A;  1GAX A;  1DF4 A;  5CBH A;  1D7I A;  2Q7G A;  2O9O A;  2GTA A;  2DMX A;  3G71 V;  4DRI A;  4DIP A;  4TQF A;  1NTK H;  1HR0 O;  5JWP A;  1XHG A;  3TET A;  4FZ1 A;  2A3A A;  3ART A;  2EJ7 A;  2E3C A;  2DSW A;  3W4R A;  4PA6 A;  4DV0 B;  3FB6 C;  5IYC O;  4DV6 O;  4Z2G A;  1WB7 A;  2KR7 A;  1BL8 A;  2EIL C;  2JGD B;  4OPH A;  4DV2 O;  4JFK A;  2AXT Z;  2FL4 A;  1QR9 A;  4I4T A;  1P84 F;  2Z0A A;  4LF8 B;  4P9O A;  2XP3 A;  4JFJ A;  3E8F A;  4DV1 O;  3CRQ A;  4PA4 A;  3IHZ A;  5LA6 B;  1DLB A;  1IBM B;  3AS0 A;  2IM9 A;  1E1Q G;  1K5Q A;  4DV2 B;  1OGG A;  4TV8 B;  2ZQU A;  4X9Q A;  2XP5 A;  4WKH A;  4E2L A;  2M6Y A;  4JGS A;  2P67 A;  2QWO B;  3HKE A;  1D5A A;  1R6N A;  2P6J A;  2QDO A;  3UQI A;  4JI4 B;  3CMA V;  2WM0 A;  4P30 A;  2Y69 C;  2XHB A;  4BIO A;  3GWO A;  3SJC C;  4NXN B;  1TUE B;  2ADQ B;  1OZ0 A;  5LYJ A;  1G8M A;  1H2M A;  4JAA A;  1KKC A;  3CB2 A;  2N04 A;  3O5F A;  3RM8 A;  4MGV A;  4CS2 A;  3B2E E;  3KZI Z;  4KFM A;  1XNR O;  1O9H A;  3EFF K;  2R9A A;  3O5O A;  4DR6 B;  3F5W C;  2GSM B;  1EN4 A;  5H2F Z;  3BFR A;  5JQG A;  1SER A;  5B5E Z;  4FLV A;  3PRD A;  5DEZ A;  5CA1 A;  3RFW A;  5H6R A;  4DR4 B;  3ODK A;  3NI6 A;  4B08 A;  3BA8 A;  1FXV A;  4UUJ C;  4K0K O;  1PD3 A;  4DW1 A;  1GO3 F;  1UR9 A;  1R9H A;  1MA1 A;  3CRM A;  4W4L A;  1QVF U;  3A0R A;  1VQ4 V;  1CEZ A;  3KAD A;  2XAJ A;  4JI0 B;  2WLI A;  4P8X A;  1IBK B;  1ORQ C;  4ZBM A;  1ZSP A;  4MVO A;  2WPD G;  5D5Q A;  1NWU A;  4FFB A;  1THZ A;  3OT7 A;  4YIO A;  2B9Z A;  4LF7 B;  1S72 V;  1LQ0 A;  1FPO A;  1ZUQ A;  4QNH B;  4Z1V A;  4Z2L A;  1W0J G;  3W7T A;  4X64 B;  5ITZ B;  4JI0 O;  5E1A C;  1WLE A;  2UXX A;  2B1G A;  4KHP B;  3PA7 A;  3WG7 B;  2WLJ A;  3JAR A;  1E79 G;  4J41 A;  4A5U B;  3SDL A;  1WAW A;  3B40 A;  2YIB A;  3AG3 B;  1LJY A;  4QT3 A;  4X64 O;  3SJA C;  3B4S A;  2R9R B;  2MK3 A;  1AJP A;  2WLL A;  2DT2 A;  3DSQ A;  3I55 V;  1NKD A;  1UR8 A;  1NI8 A;  4O2B B;  2O57 A;  4IT6 A;  2A9H A;  2EJR A;  1ARO P;  2Q9L A;  4FFB B;  5KHJ A;  4GGQ A;  1MOF A;  3GWK C;  3CZ8 A;  3H9R B;  4ZOL A;  4RWU A;  3KAG A;  4CC6 A;  1WPX A;  3VBB A;  2DG3 A;  4Z2K A;  2ZNJ A;  4IQ2 A;  4JZG A;  4GKJ O;  5JCO C;  4W5U A;  3JAW A;  3N2G A;  2YC0 A;  5BMV B;  4J4N A;  1BZK A;  3LDD A;  2N87 A;  3D36 A;  4PJ0 Z;  2RSE A;  4GKK O;  2JJ1 G;  4W9P A;  1SQQ H;  4JI5 O;  4NTW A;  2DE0 X;  2WLL B;  4DR3 B;  1SS3 A;  5L3G A;  3NTP A;  5FNV B;  2ZR5 A;  1ROT A;  3IGA C;  4LAW A;  1LL7 A;  2LW1 A;  3AG3 C;  2DT0 A;  1AP5 A; 
#chains in the Genus database with same CATH homology
 1OWQ A;  2RUR A;  4MPK A;  4DRN A;  2OFN A;  3I6C A;  3RM9 A;  2KO7 A;  1OGB A;  1D7J A;  2RUC A;  4FAP A;  5HKG A;  2ZQS A;  1ZCN A;  2ZQV A;  3ARO A;  2K8I A;  4MAV A;  4KQZ A;  1F8A B;  1EIB A;  4P8V A;  1NMV A;  4N19 A;  4MNL A;  4ODQ A;  3OOB A;  3O5P A;  1HXV A;  4ML4 A;  2D9F A;  2WLZ A;  4ZPT R;  1SR0 A;  3PRB A;  2A3B A;  2ZR6 A;  3PRA A;  5D75 A;  3TC5 A;  4WKA A;  4J4O A;  5GQB A;  4Z2I A;  2DSZ A;  1E9L A;  4QIB A;  1GUV A;  1T11 A;  3KCE A;  3WQV A;  4O2T A;  2XPA A;  4ZPV R;  1GPF A;  1E6P A;  2MLX A;  1J4H A;  2G8Z A;  3JXV A;  3UI4 A;  1WNO A;  3KAC A;  1Q6H A;  4QT2 A;  4GIV A;  4URI A;  1W1V A;  1NWS A;  1QPF A;  4KR0 B;  1FKD A;  1E6R A;  4MNM A;  1D2K A;  3CGM A;  1ZU8 A;  1FKK A;  1LG2 A;  3TDB A;  4JFM A;  2XP8 A;  1KT0 A;  4DRQ A;  2O92 A;  5DIT A;  4JFL A;  3B7X A;  1EQ3 A;  1YAT A;  4ZS6 A;  2KGJ A;  2WK2 A;  3CHC A;  1ZBV A;  3JYJ A;  1FKH A;  3RGC A;  3B09 A;  4ODM A;  3FY1 A;  4ODR A;  1TFV A;  3ARQ A;  3QOK A;  2PV2 A;  5BXJ A;  3B9A A;  2JZV A;  3RME A;  4DH0 A;  4U86 A;  4LAX A;  4DZ2 A;  2ZQT A;  3IK8 A;  2XP9 A;  3ARP A;  4JFI A;  4HAR A;  5HWC A;  4W9Q A;  3WL1 A;  1RD6 A;  3CHE A;  1HKJ A;  1Q6U A;  1JVW A;  1E6Z A;  3O5L A;  3AS3 A;  4U84 A;  1W1Y A;  2AOS A;  3ARV A;  3UI6 A;  3O5J A;  1Y0O A;  4ODL A;  2VCD A;  1QPL A;  3WD3 A;  4U85 A;  3ARW A;  2YBT A;  1FKB A;  1NWR A;  5HW6 A;  1W1P A;  4DRH A;  4DWS A;  3G6L A;  3VAW A;  4IT4 A;  4NSB A;  2PV1 A;  1JND A;  3ARZ A;  1FKF A;  5GPR A;  2IF4 A;  1W9U A;  1JNS A;  1IX5 A;  3KZ7 A;  4AY1 A;  1ZK6 A;  2DT1 A;  3G6M A;  3KAH A;  3O5R A;  4TNS A;  2KFW A;  1HKK A;  2G41 A;  4G2P A;  1BL4 A;  2F21 A;  1KT1 A;  3KAB A;  1EHN A;  1H0G A;  1ZL1 A;  3WKZ A;  3ARR A;  1X6N A;  1FKL A;  2KI3 A;  4LAV A;  1PBK A;  3CH9 A;  4WK9 A;  1FKI A;  4DRO A;  3ARS A;  1SYT A;  1W9V A;  1W26 A;  3O5G A;  1H0I A;  3WD1 A;  4WJX A;  2DT3 A;  1EYM A;  4W9O A;  1ROU A;  2IUZ A;  2WLY A;  3ALF A;  4DZ3 A;  1FKS A;  3ALG A;  2MLY A;  1HJW A;  3UQB A;  2MF9 A;  1K9T A;  1U79 A;  4NZC A;  4QZV B;  2MNT A;  2KE0 A;  4R0X A;  3IKD A;  1FFQ A;  2F4E A;  4DT4 A;  2A3C A;  2DSV A;  4LAY A;  5HBF A;  4TX0 A;  4DRK A;  4Q7N A;  3JYM A;  4MTV A;  4S3J A;  4R5E A;  5GPG A;  1NH6 A;  4JYS A;  1JNT A;  4DRM A;  3WD0 A;  4ODN A;  1LG1 A;  4XAK A;  5DIV A;  4S3K A;  5HWB A;  4TYO A;  4MNK A;  2PI6 A;  3CHD A;  5DF0 A;  3BXW A;  1XRV A;  4ODO A;  2ZR4 A;  1HKM A;  1X6L A;  1JNE A;  4Z2J A;  2PPN A;  4BF8 A;  1P5Q A;  2MPH A;  1D7I A;  2O9O A;  3AQU A;  4DRI A;  2LGO A;  4DIP A;  1HKI A;  3O5D A;  2MLZ A;  2QF8 A;  1XHG A;  3ARX A;  1D6O A;  1QZ2 A;  4L3N A;  3KAF A;  2A3A A;  3ART A;  4ODP A;  2DG9 A;  4DWS B;  2DSW A;  2XP7 A;  3W4R A;  2DPE A;  5DO2 A;  4Z2G A;  1FKT A;  1FKG A;  5HTG A;  2YBU A;  3WH0 A;  2KR7 A;  5HUA A;  1A7X A;  2PV3 A;  4JFK A;  4LGX A;  3O5K A;  4IPX A;  4DWS D;  2XP3 A;  1W1T A;  4JFJ A;  2RUD A;  3IHZ A;  3B9E A;  3AS0 A;  1ZBK A;  1ZBW A;  1FFR A;  2AWG A;  4MSP A;  1OGG A;  2RQS A;  4ZPW R;  4Z2H A;  1D7H A;  2FDM A;  2ZQU A;  2XP5 A;  3FXY A;  4WKH A;  4NNR A;  2Y78 A;  4TW7 A;  4G50 A;  3KAI A;  2VN1 A;  1ZB5 A;  3UQI A;  5JH8 A;  1KFW A;  2WM0 A;  4L72 B;  4ODK A;  4WKF A;  1Q6I A;  3B8S A;  1F40 A;  2DSU A;  1M5Y A;  1NWT A;  3WIJ A;  3GPK A;  3UQA A;  2UZ5 A;  2F2D A;  2XPB A;  4HBE A;  1B6C A;  5B8I C;  5HT1 A;  4P8U A;  2PBC A;  2XP6 A;  3O5F A;  3RM8 A;  3CGN A;  3O5I A;  3B9D A;  1NSG A;  4MGV A;  3RM4 A;  2ITK A;  3O5E A;  4DRP A;  3O5O A;  2M1I A;  2B31 A;  4DRJ A;  3PRD A;  5DEZ A;  5J6E A;  2M08 A;  3RFW A;  3ODK A;  3NI6 A;  4IQC A;  2DG4 A;  2PPO A;  5HW8 A;  5HW7 A;  5I98 A;  2FKE A;  1UR9 A;  5DIU A;  4ITZ A;  2RUQ A;  1PIN A;  1R9H A;  4HBO A;  3WD4 A;  3KAD A;  4P8X A;  3O5M A;  4Q22 A;  1J4R A;  2LJ4 A;  1LL6 A;  1J6Y A;  3MDY B;  1NWU A;  1E15 A;  1LL4 A;  3ARU A;  1FKR A;  1L1P A;  1CTN A;  1ZBC A;  2OLH A;  1LQ0 A;  4Z2L A;  1FAP A;  1ITX A;  4PTM A;  3WL0 A;  1W9P A;  3PA7 A;  4TW8 A;  1J4I A;  1GOI A;  1WB0 A;  1O6I A;  1WAW A;  1LJY A;  2FAP A;  4QT3 A;  3PR9 A;  1HJX A;  2LKN A;  2LPV A;  1HJV A;  4DWS C;  2DT2 A;  1UR8 A;  1E6N A;  4IT6 A;  1YW5 A;  2A3E A;  4GGQ A;  2PPP A;  2L2S A;  3CZ8 A;  3H9R B;  3UI5 A;  1TCO C;  1BKF A;  4FN2 A;  3KAG A;  3WD2 A;  1N1A A;  3FAP A;  3NRK A;  2DG3 A;  4Z2K A;  3UF8 A;  1NMW A;  3EY6 A;  3LUO A;  1FJD A;  4C02 B;  3AS2 A;  3WQW A;  3ARY A;  4IQ2 A;  1VF8 A;  1FKJ A;  1EDQ A;  4W5U A;  1Q1C A;  3IKG A;  4J4N A;  2N87 A;  2M2A A;  3O5Q A;  2RSE A;  2ESC A;  4W9P A;  4WIW A;  4P8W A;  3NTP A;  1C9H A;  4TW6 A;  2ZR5 A;  3CHF A;  2Q5A A;  2DT0 A;  3AS1 A;  3TCZ A;  4MNJ A;  1ROT A;  1FD9 A;  4LAW A;  1LL7 A;  3OA5 A;  2XP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...