1Q6HA

Crystal structure of a truncated form of fkpa from escherichia coli
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
210
structure length
210
Chain Sequence
AFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase fkpA
publication title Structural and functional studies of FkpA from Escherichia coli, a cis/trans peptidyl-prolyl isomerase with chaperone activity.
pubmed doi rcsb
source organism Escherichia coli
total genus 69
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2003-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF01346 FKBP_N Domain amino terminal to FKBP-type peptidyl-prolyl isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.460 Mainly Alpha Orthogonal Bundle Helix Hairpins Peptidyl-prolyl cis-trans isomerase, FKBP-type, N-terminal domain 1q6hA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1q6hA02
1BKFA 1C9HA 1FKTA 2DG3A 2PV1A 3KZ7A 1Q1CA 1D7JA 2N87A 2M1IA 2LJ4A 2ZR5A 1U79A 1PBKA 2RUQA 3NRKA 3O5OA 1B6CA 4LAYA 1D7HA 2RUCA 4FN2A 4W9OA 3TDBA 5HW7A 2MLYA 5HWCA 1N1AA 1HXVA 3B09A 2DG4A 3O5LA 2PV3A 1BL4A 1Q6HA 4NNRA 2XPBA 4ODPA 1PINA 3UQIA 2ZQSA 1J4HA 1FKFA 1FKGA 1KT0A 2MLZA 4JFMA 3TCZA 2M08A 4TW7A 3O5FA 4O2TA 2RURA 4ODRA 2XPAA 3O5KA 2L2SA 3GPKA 3O5DA 4MSPA 1FKRA 3IHZA 4G50A 4ODOA 1YATA 5DIVA 5HWBA 3H9RB 1JNSA 3IK8A 3KADA 3O5EA 2JZVA 3O5GA 4QT3A 3O5IA 4DRQA 1Q6IA 3O5QA 3RGCA 3KAFA 5HUAA 2UZ5A 1W26A 3B7XA 4N19A 1ZCNA 5B8IC 5HW8A 2F4EA 4DH0A 1ROTA 3KAGA 4GIVA 1Y0OA 1J6YA 1FJDA 4IPXA 2F21A 5HTGA 4DROA 1M5YA 3CGMA 3MDYB 4DRNA 3O5PA 3RFWA 1ROUA 4TYOA 1FAPA 3JXVA 2M2AA 2RQSA 3CGNA 2KFWA 2MPHA 2D9FA 1TCOC 3LUOA 4DIPA 1A7XA 5GPGA 1D6OA 3OOBA 2PBCA 4LAVA 3TC5A 4MGVA 4JFKA 4ODLA 2VN1A 2KE0A 3FAPA 1Q6UA 2FAPA 2XP6A 3NTPA 1R9HA 2RUDA 2DG9A 3JYMA 1FKJA 4DRMA 2ZQVA 4DZ3A 4TW6A 1NMVA 4IQ2A 1EYMA 3JYJA 1QZ2A 4DRIA 4ITZA 4ODNA 4TW8A 1EQ3A 5HW6A 1QPFA 1D7IA 1FD9A 2KO7A 2LKNA 4JFIA 4ODMA 2ZQTA 3UI6A 1FKLA 4DT4A 3UI4A 1F40A 1ZK6A 2XP5A 1FKHA 5D75A 3PRDA 4W9QA 4U85A 4R0XA 4GGQA 1FKDA 1FKSA 4ODQA 4DRJA 5BXJA 4QT2A 1NSGA 1T11A 2Y78A 4ODKA 3I6CA 2MLXA 2XP7A 2KGJA 4J4OA 3WH0A 2KI3A 2RSEA 2XP3A 2LGOA 5HKGA 3KAHA 2ZR6A 4LAXA 1JNTA 2ITKA 4TNSA 3UQAA 4TX0A 3PRBA 4QIBA 4C02B 3UI5A 1JVWA 2XP8A 3EY6A 3KACA 2PV2A 2ZQUA 4DRPA 4JYSA 4FAPA 5HT1A 2ZR4A 4DRKA 2K8IA 4IQCA 1P5QA 1FKKA 2IF4A 3IKGA 4G2PA 5DITA 2FKEA 1FKBA 1J4RA 1QPLA 4U86A 4BF8A 3IKDA 2XP4A 1FKIA 1YW5A 4U84A 2MNTA 2MF9A 3UF8A 3KAIA 3KCEA 2XP9A 3ODKA 4LAWA 1NMWA 2PPNA 5DIUA 5J6EA 3O5RA 1KT1A 3VAWA 1L1PA 1F8AB 4DRHA 2LPVA 2VCDA 1J4IA 4JFLA 3O5JA 2KR7A 4W9PA 4JFJA 3UQBA 3KABA 2AWGA 2OFNA 2Q5AA 2F2DA 3PA7A 4J4NA 4DZ2A 3NI6A 2PPPA 5I98A 3O5MA 2PPOA
chains in the Genus database with same CATH superfamily
3KZ7A 3RYIA 2E5LB 2P6JA 2LJ4A 1I94O 3ABLC 4IL6Z 2HG5C 3HKEA 1Q6HA 3L72H 3DXRA 3H1KH 4TOIA 4BWAA 1N36B 1HDJA 5CA0A 3IC7A 2EJ7A 1Q90D 3M99B 3AQUA 3K9SA 2ESCA 1KU9A 1Q82W 1ITXA 2V7QG 3RGCA 4GYCB 3NXSA 4X65O 3SPIA 1GN4A 1HNXO 3KAGA 5J2UB 4NKGB 1M5YA 1RPRA 4FLXA 4I9QA 3L9DA 5LYJB 3BHPA 5IYCO 4DV0B 4RWUA 3AEIA 3ARZA 2M2AA 3CC7V 1LUVA 3B4SA 3RYHB 1E6PA 4LAVA 4U3JA 5LGTA 3FD9A 2A3QA 3F7VC 4B3SO 4TUYB 3NTPA 4YIPA 1G4YB 2Z0AA 1ROPA 2QWQB 1EN6A 2BTQB 1W0KG 3A0BZ 4ODNA 2YBUA 3K5OA 3SJQC 4JI1O 1D7IA 5BR8O 2LKNA 5BMVA 3DSQA 4X1YB 4X66O 1GUVA 4LFAO 1M93A 3Q4HB 1FKSA 2OCCC 1OGBA 2F4VO 3ARUA 1R3JC 4O2AB 4PDLA 2JS3A 3OMIB 2Z5UA 3A0HZ 2C2AA 2HHHB 1AJPA 1JMKC 4NSBA 4C02B 1YVWA 1QCEA 3WG7B 1I08A 1X6LA 1W59A 4DRKA 1P5QA 1FKKA 4UB6Z 2Q8VA 3JAWA 4DW0A 4DUZO 3T1HB 4F6RB 4G27B 5KX5A 5E79Z 3THOA 2OT5A 2LPVA 2DOSA 4QPKA 4S3JA 4I55B 1TA8A 1OHHG 1S76D 4I50B 3NI6A 3FX7A 1WB7A 4IHJB 3HB3B 3HPLC 2UU9O 3ICXA 4Z1MG 2MLYA 1FAFA 3WFVA 3T1YB 1VARA 4CS4A 3JARA 2H3OA 2G41A 3ABKC 3E22A 2QA4V 1K4CC 2ODMA 4PELA 2UXBO 3BAAA 4N21A 5DIVA 3PR9A 2OLHA 5JQGB 1EIBA 5TISZ 4DUYO 3OEEG 2A3CA 4N19A 5B1AC 1ZCNA 4DH0A 3OTOB 1EZVH 1WAWA 1MABG 4WBNB 2BE3A 3H1HH 4DR7B 1PL4A 3AG7A 3BA9A 3FFQA 5DEZA 5IJ0A 5CB4B 3RM4A 2CGNA 4X20B 3AK2A 5EYPB 3VBBA 5LOVB 4MTFA 1OGGA 2PZSA 2WPDG 3BMBA 4ZHQA 1ZB5A 4MT8A 5IYZB 3JYMA 3ZX6A 3QO5A 3B9EA 2YC0A 2QWNB 1FD9A 1XL4A 3D3QA 1HKJA 1OCZB 2ZQTA 3UI6A 4DT4A 1JQ0A 5D75A 1NWSA 2VQEO 3GWOA 3OR6C 2Y48A 4YY3B 3CMEV 1NSGA 1NVPD 1HKIA 3B9AA 2M6YA 4BIOA 1XRVA 4LF4B 3ARWA 1MA1A 5DN6G 1CTNA 5LYJA 4RQFA 4DRPA 3ALFA 1M57B 4JYSA 3OR7C 1VF8A 2PGGA 1YZBA 2FDMA 1B6QA 3K0DA 1NQTA 1XQ8A 2IW5A 1SERA 2RDCA 4TUYA 4UFZA 2XP9A 4IT6A 3VAWA 3T4DA 3CCVV 3ZMTA 2PF4E 4I0XB 3ARTA 4X8AA 1IXMA 3N2GB 2EZOA 3SR2C 1N32O 3K5LA 3C90A 4QE7A 2QTSA 1C9HA 2PV1A 2LO1A 1JNSA 4LAYA 2QM4A 2IH3C 2DG4A 1R3LC 4FLUA 1MZEA 1N36O 5JH7A 1ZLZA 2QE7G 3AK3A 1KKCA 1BCCH 4JPRA 4PDRA 3UT5B 1YATA 2GTSA 3E8FA 3K06A 3JAKB 3IK8A 3CMAV 3ARXA 2ZDIA 2YIBA 4NVPA 4UV9A 4EKWA 4MVSA 5FNVB 5HTGA 3W4RA 2XASA 1TUBA 1SQGA 3HKBB 3SYOA 4LF7B 4DV0O 5IJ9B 4ICGA 4AY1A 2EIMC 3OGCC 2EULA 1TCOC 1I5YA 4I55A 5FL7G 2EX3A 1TGOA 3BA8A 1B04A 5KAFZ 1JOYA 1EN5A 3HR0A 2XP6A 4LF5B 3CCEV 1FKJA 3CH9A 5EBMC 3KCXA 5KHJA 1FXKB 4IQ2A 1W9PA 1EYMA 2A79B 3ABTA 4JI0B 3RT3C 5HW6A 2FL4A 4ODMA 1NBMG 2JDIG 3CEIA 1WB8A 2DT0A 4K8ZA 1FKLA 4DV4B 3W7WA 2H94A 1JFFB 1LL6A 5JJEB 1YJ9V 1Z2GA 5EBLC 4LGXA 1EM1A 5CBHA 4ODKA 5DM6V 1GMGA 4PJ0Z 2OTLV 5HKGA 4HBEA 1QNMA 4Q22A 2B1GA 1JNTA 4FAPA 1XEQA 4X20A 2CTWA 3E8HA 1WJZA 5EYPA 1FKBA 5LOVA 1I7FA 2IJIA 4U84A 3W7TA 3RWRD 2Y4UA 2ZXWB 3AROA 5J6EA 1IXBA 4LH6A 4J7ZA 4HYOA 2KR7A 4MTOA 1F4NA 5DF0A 2EILB 3U0ZA 2YXLA 4CBCA 2F43G 3OT7A 4ZI7B 1XNQB 4DZ2A 2DG3A 2DN9A 2W0XA 2HR3A 2RUQA 3NRKA 3JALB 5J9PC 4CC6A 3T1YO 4DWSD 3WB1A 1Y76A 1BL4A 2JRIA 2QKCA 1PINA 1NTMH 3GVMA 4GKJB 1XMOO 2CTQA 1BL8A 2G8ZA 1NR7A 4G50A 1HWYA 2ITDC 5C8YA 2JZVA 3C3SA 2UZ5A 3OTOO 3AG3B 2WLJA 2DT3A 3FXYA 3SGIA 2X6CA 1FJDA 4HBOA 3ARYA 3P32A 1QVGU 4XDLA 4K0KO 1X6NA 3LUOA 5GPGA 1E1RG 2WLMA 2ZDIC 1XBLA 3N2GA 3P3PA 1V55B 1SS3A 2HJDA 3B8MA 2Q69A 4UUJC 4DRXA 4DV2O 1Q81W 5KHIA 2RUDA 1EBOA 2AXTZ 2ZQVA 4ZBMA 1YI2V 3SYCA 1UR9A 4TQDA 3QF7A 5JCOA 3RM8A 1MNGA 1EZJA 1ZX3A 2WAMA 3JASA 3ALGA 3UT5A 3VQVA 5KMGB 3JAKA 4NZCA 4YY3O 1NWUA 4TV8B 2DWDC 4J4OA 2EIKB 3N2KB 4KXRA 3K9AA 3OMNB 2MK3A 1HNZB 5L3FA 2VRZA 3KACA 4Q7NA 3OMAB 4IQCA 3IKGA 4UXNA 1K92A 3LDCA 2UUAB 2DMXA 4LP8A 4DW1A 2PI5A 3D36A 3CRCA 1AR4A 1ZL8B 1PL0A 2VQFB 4JFJA 4W9PA 1AJNA 4TSFG 5DEDA 3B8SA 1E15A 4J4NA 3LSSA 5HW7A 1IX5A 2H8PC 1E79G 4ZOLA 1JFFA 2DJVA 1KC8W 3B09A 3CRMA 3UQIA 1J4HA 1DF5A 2DSVA 3RVZA 2LFRA 2E3CA 1K4DC 2HLDG 2RURA 4UCTA 4MW3A 2M7WA 1GM9A 1S5LZ 1KB9F 5L3BA 4X88A 4R8CA 1WN7A 3OFNG 1JJ2U 1FFXB 1PNKA 2WLIB 5D5QA 2JVDA 3B7XA 1AI4A 1TVKB 2PI4A 2IH1C 4LF7O 3SJBC 4NXMO 3BVOA 3RW0A 1JCHA 3BEHA 2Q7EA 1SC5B 2EINC 3CGNA 4WFAV 5H9CA 1OCOC 1BZKA 1QLEB 4WKAA 3WD3A 4DIPA 5LL6Y 2PBCA 5EBWC 4ZI7A 3CWBH 1FFTB 4K35A 3QO7A 2Q9LA 1Q6UA 4LF5O 1XMQB 3JD4A 5B3SC 3J7AU 5KLVH 3MHSC 3JALA 3K5NA 4DRMA 2XAHA 4X64B 2XT9A 2DYRC 1M90W 4O2BA 4D6TH 3CC2V 3ETGA 2YXYA 4FPPA 4HBNA 5DECA 2ZCEA 4AQYB 4FVMA 3SPJA 4PA9A 4X1KA 2RQ6A 1QR9A 2ZE6A 1YDXA 2Q68A 5JCOC 1SRYA 3FB7C 3IAYA 1JVWA 2QKAA 2P5OA 3B2EE 1S3JA 3G6EV 1RFYA 1DTOA 3EHBB 4LF8B 3QOKA 2VS0A 4DK0A 1O9HA 2ZD9A 2UUBO 1NMWA 1KT1A 4LCUC 2O92A 4JAAA 4X1IB 1JNEA 4MNKA 2ZR2A 3ASOC 3K57A 2HKOA 1XNQO 1MSWD 2CH7B 2KG7B 2ILMA 1UPGA 5JH8A 4QPJA 1O9GA 1DGSA 2IBZH 2AHYA 2Z3YA 3D36C 3ZRWB 4Z2IA 4TWKA 2ZQSA 5L3DA 3G6BA 5BZBA 2ZNJA 5IDJA 1WNSA 2A3EA 4PD4F 1XHZA 3O5DA 4JAUA 2QDOA 1FKRA 2WLZA 1AR1B 3IHZA 3CHDA 4ZPVR 4MVUA 1Q7YW 3O5GA 3O5IA 1HJWA 5EIBC 1CPYA 2LFSA 2Y0IA 1B3QA 1IBMO 2GSMB 5HW8A 4DWSB 3WQWA 3WD4A 3MAQA 4C7UA 3CRQA 3CGMA 1L8DA 5IWAB 4DV3O 3O5PA 4G28B 2IJKA 3UM7A 4TYOA 1N33O 4LR3A 1PPJH 4DV5B 3OUFA 3SPCA 3GWKC 4BIUA 3CXHF 3RYFA 2ZINA 1MZFA 1D2DA 2KE0A 4WJXA 4EFEA 1U97A 3ETEA 4JI2B 3C3TA 4FFBA 2UXCO 1GM8A 3VQYA 2UXXA 5LP6C 4LF6B 1M56C 3CCUV 3CRRA 1P7GA 4Q6GA 1J95A 4B3RB 3CRAA 1F23A 2ZT9B 2XUMA 2IU3A 2P4KA 2XTAA 2OTJV 3JD2A 2Q6AA 3M7MX 1FFXA 4HZ3A 3ZBHA 2WLIA 1RSOB 3CZ8A 2MLXA 2XP7A 2KI3A 2ITCC 4Z2WA 4HAMA 2XP3A 4L8JA 5B1BC 3ZMVA 1IBLO 2JEXA 1EDQA 1LUWA 4JYAB 3X2QB 1JVMA 4BF8A 1G6UA 2WWWA 4Z2LA 4JTAB 1ZU8A 1R6KA 3ZHTA 4JYYA 2DYSC 1UJWB 3WQVA 1XILA 2Q5AA 3ABMB 2F2DA 1KQSU 2JGDA 2FB5A 5L3EA 3AS1A 2ATKC 5LMUB 1E6ZA 5GONA 4MNMA 1R6TA 2R9AA 5H2FZ 1U79A 1AB3A 3TDBA 4YJ3B 1HXVA 1SZTA 5LA6B 2Q4PA 2FMLA 4GT1A 3ASNC 4ZPWR 1K3EA 1VQ7V 2LGWA 4CH3A 1M4UA 4DV6B 2B9ZA 1AI7A 4LWSA 1K97A 1NTZH 4MVMA 2F95B 4I7ZB 4J7JA 1NT2B 2UUCB 2AGAA 2P90A 1JNDA 1NH2D 1NH6A 2K9PA 3UO2A 2YIAA 3ML0A 2E76B 2HVJC 4MVZA 1E9LA 4JI8B 4DR6O 4B3TB 2NNUA 4X1IA 2ZIMA 1H2SB 3ZRSA 4BW9A 4X62B 2LW1A 2MPHA 3ZN0A 2P22C 1L1FA 1IBKO 4GKKB 4ABMA 2CH7A 1RM1B 2KG7A 4GUNA 4MVQA 3ZS8C 2HEPA 1XMQO 3ARQA 3H1LH 2LW7A 1SQXH 2ZQMA 3ZRWA 4X64O 4TW6A 4JYCA 3AG1C 2MW2B 4TW8A 2DQ3A 2WLLB 1THZA 1YITV 4JFIA 3TCUA 4Z2HA 5J2TA 5KHKA 4AQYO 2FKXA 1LL4A 3CJHA 1XNRO 2A3BA 4IIJA 4FM0A 4ODQA 5LHIA 1N34B 3E8BA 2AHZA 3AG4C 4LFBB 3N27A 3I6CA 3JD0A 4JAVA 3U11A 4NB5A 4UCVA 2PN0A 1W9UA 2A7WA 1VQOV 1AP6A 2EIJB 3K79A 2NR5A 2K8IA 2QF8A 2RJZA 2IF4A 3FAVB 4FLYA 1OCCB 4J10A 3SJCC 5IY5B 4U86A 1FKIA 2IJJA 4MW8A 4K8XA 3O5RA 4JI7O 3CD6V 1HR0O 1KBHA 1Z5WA 2VCDA 4Z2JA 4IYHA 1EHNA 5LHHA 3KG2A 2VWJA 5J2UA 1OCRB 1FXHA 1WPXA 4L3NA 2L35A 1BSMA 2QGNA 3RYHA 1RSOA 1KUQA 4NNRA 5HFLA 1XUQA 1J5EB 4TV9B 4P9OA 3UCSC 5K1XA 3OEHG 3LDDA 1US6A 4RQEA 4FFKA 2ZKOA 2YDEA 3AG2C 1X4TA 1HNWB 2BTQA 3O5EA 2NN4A 5A2QN 1W26A 3L70H 4X1YA 4UCOA 1NKDA 2Y69C 1V54B 2E5LO 2PYLA 1S0VA 4WFBV 5IWAO 1BQZA 3GU0A 4O4JB 4OGQB 3H1JH 3Q4HA 2BSKB 4KHPB 3QNEA 2UXDB 2AW9A 3BY6A 4P30A 4JI4B 3CHCA 1H2GA 4KR0B 4DV5O 4O2AA 1D6OA 1W1VA 2IUZA 2ADPA 4RUEA 4YHHB 4MGVA 4ODLA 1H0IA 2VN1A 2QWOB 1BGYH 2IJHA 1OWQA 2DG9A 1NMVA 2YSUB 3I55V 5LA6A 1KD1W 1H2KA 1Q86W 4DR1B 4F6RA 3H1IH 5BY1A 3UI4A 1ZBWA 4FK5C 4U7OA 5GTHZ 4ZS6A 4KUMA 1HJXA 5CN0A 3EVKA 5JVDB 1PM9A 4JTCB 4UB8Z 1K8AW 2PI6A 2X0LA 4DV1B 5H6QA 4GX1A 1WP7A 4DV7B 2N74A 4I50A 1M5IA 4WF9V 4IHJA 1KYOF 3OAAG 3FB5C 2RCVA 4O4IB 4TNSA 4TX0A 5B1NA 4QIBA 2OCHA 3UQ8A 4E2LA 4MSWC 4G2PA 2ZE5A 4MTXA 1KP2A 1SA0B 3CX5F 3ZMUA 2WA3A 4YXWG 2DSUA 3ODKA 3R66A 3KCYA 5JQGA 3CCRV 3OE7G 4DR3B 4UV8A 4GX5A 3TJTA 2XNDG 1Y67A 4OPHA 1AVMA 2WLLA 1K73W 4DR4B 4WBNA 3PA7A 2HHHO 1QU7A 2Y4TA 2YICA 5LMUO 4JV5B 4JTDB 2PPOA 1Q8IA 1UFIA 3IFXA 4YJ2B 1WLEA 2F1MA 5CB4A 4NXNB 1D7JA 2M1IA 4QGPA 1ENVA 5HWCA 2YEVB 2G38A 5IYDO 3T1HO 4ODPA 3CP1A 4DV6O 4TT3G 1KT0A 4HNAB 4P9PA 4JFMA 2M08A 3CCMV 4O2TA 4S3KA 4UVCA 4MSPA 4FJCC 5IYZA 2UUCO 2F93B 1GAXA 1KP3A 1W0JG 3G6LA 2QR4A 3ABLB 4OX9B 3FAVA 2WSSG 4JI8O 1H2MA 4B3TO 4CS2A 4OPAA 3L75H 3P30A 4DR2B 3RM9A 4FMTA 4X62O 4CS3A 5ITZB 3B77A 1E6RA 4WFHA 2D9FA 1A7XA 2R70A 1H38A 4GKKO 3LUTB 1NH2B 3CE2A 5KHHA 2Y0PA 2ZE8A 1K5SA 5BXZA 2DW4A 1QBZA 2N04A 3SPHA 1WNOA 4L87A 3A0RA 2Q5ZA 4DR7O 4EEQA 4NTWA 2XP5A 4I0XA 3WG7C 3HKCB 3CXCU 3TGUH 3QTCA 3EFFK 3G6MA 3BCCH 4LFBO 3RYCB 1N0NA 3WH0A 1X59A 1YCIA 4PI0A 1VIBA 4XBFA 1XHGA 1PKXA 3BRCA 3CSXA 3MHHC 2AOSA 1DLBA 3ZHSA 3WIJA 1SF9A 2BSKA 2ITKA 4EFBA 1GKFA 4Z1VA 2IM9A 3CB2A 2OCCB 1BHBA 1VQNV 3P3NA 2PPNA 4MVRA 5A9GA 3CCJV 4CC5A 1F8AB 2LQTA 2LGQA 3JAMN 2K1EA 4LF4O 1P49A 2R72A 5FNVA 4D7SA 2GV9A 4X65B 3HKBA 2B31A 5I98A 2GTAA 1GOIA 3O5MA 1FKTA 5IJ9A 1MMMA 1R3IC 3K59A 5JVDA 2JS5A 1YF2A 2XPBA 1J5EO 2RN9A 1NVPB 1LQ0A 4TW7A 3G67A 4ODRA 3I56V 3E86A 1SQVH 3GPKA 4JI3B 4B3SB 4ODOA 3J81N 1FXKA 3O9OA 5CA1B 3F5TA 4UCRA 4DRQA 1GN3A 3IGAC 1PV0A 1N8RW 2ARHA 2P7TC 3FY1A 1YIJV 1UR8A 1SA0A 4WKFA 1ZUQA 4JI1B 3ABKB 2A0LA 4X66B 3RFWA 5AG2A 4JI4O 5EC1C 4J7KA 4PV1B 3RYIB 5JJNB 2YIBD 3T2MA 4LF9B 3WD2A 2WA4A 3HKDB 3TC5A 2F4VB 1OCZC 4JFKA 4URIA 1VF5B 2EJRA 3W7SA 1LNQA 4QE9A 4DO2A 1KKDA 4U3FH 1N0JA 2YEVA 1VQPV 4QIWF 4JZ2A 3JYJA 5KUMA 1HJVA 2KO7A 4HNAA 3ETDA 1S72V 4F6EA 4MS2A 1Y66A 4LFCB 4DUZB 2PYJA 4W9QA 1M57C 1H0GA 2XAQA 2V4DA 3I5DA 5B5EZ 2WLKA 3CYOA 3STLC 3DC6A 4G2KA 4JI6B 1NU1H 4W4KA 3ARSA 4H37A 1HKMA 2HFEC 2UU9B 4JI0O 5ITZA 5DITA 1RP3B 3A8TA 3K3WA 4FIPC 4B08A 4JI5B 4DV4O 2ZE7A 5BMVB 4GLXA 5DIUA 3KCEA 4EB6B 4WFFA 3L73H 5H5NA 1J4IA 3T1CA 2JJ1G 4DR4O 4NTXA 2AZ0A 3TK1A 1LR1A 2DWEC 2OWOA 1NR1A 2GHYA 3LNNA 1AJQA 1BKFA 2JK5C 4JZGA 4B7KA 4R7CA 3WD0A 1BT8A 4NTYA 2QM8A 3AS2A 1AI6A 3HKCA 1B6CA 1WPBA 1QQCA 1IVSA 3FYIB 3PN1A 4LNUB 1S5HC 1LG1A 4P8UA 4JASA 1E6NA 4PA6A 5LMNB 3JYCA 5B66Z 2DQ0A 3JAWB 1L0NH 1Q43A 4NR1A 3ZHVA 5KX5B 3ZMZA 4MNLA 4OX9O 3QO8A 3K0GA 1YSCA 1T5EA 1IZ3A 5B8IC 4MVOA 1VQ4V 1NZ6A 1SESA 2X6AA 1F4MA 4DROA 4DR2O 2BCCH 5KMGA 2IU0A 4WIWA 1Y74B 1FXKC 1HW7A 4QJFB 4TV8A 4UCSA 2KFWA 2VQEB 4GKJO 3T4ZA 3N2KA 5EZYB 2NLJC 2Q7HA 5CBFA 1FJGB 1E44A 4W4LA 1PD3A 4IYIA 3E22B 2FAPA 1H8HG 1Y6XA 3OM3B 2KB1A 5B1OA 2CTPA 2EIMB 5LXTB 1EQ3A 3SJAC 1NWRA 3J80N 4GX2A 3TXSA 4WFGA 2E74B 1ZK6A 1EN4A 1VQ5V 1ZL8A 4RO2A 3VQXA 1T11A 2KKWA 1MOFA 1Q3EA 4J41A 3TETA 2LGOA 2ZXWC 1F51A 4ZHQB 4E4EA 2RNBA 2WM0A 2ZR4A 1VQKV 1PNLA 2EILC 5C93A 4P8XA 3LSQA 3HKDA 3ARRA 1K9TA 1TUEB 1YTFD 3SDLA 5KAIZ 1PNMA 1JR9A 3KAIA 1V9PA 1GN6A 1COWG 4F4LA 1N4CA 4I4TB 1TVKA 4OXSA 1HNZO 1VQ9V 3CS5A 5F2VO 2FYUH 4L72B 5HT1A 4JYBA 1Q1CA 4W9OA 1D7HA 1AI5A 3ZJZA 2QEXV 1Y4MA 4PA3A 4LBEC 3AG3C 2B1IA 2UUAO 3WB0A 1HKKA 1FKGA 4R5EA 2XPAA 3O5KA 4JI3O 5EIBD 2VQFO 3KADA 4QT3A 3ZHQA 3O5QA 1VF7A 1V55C 2F4EA 4XDKA 3ZRVA 5FPOA 1GO3F 2YI8A 3B8NA 3W7XA 4EB6A 4R50A 1R1BA 5E1AC 3BXWA 3JD3A 3JXVA 3ZCCA 3L71H 4LF9O 1SR0A 2L6LA 1IDSA 1QLNA 5JH7B 3FAPA 3EIPA 3PJSK 4U7NA 3LSUA 1SZXA 1R9HA 3OW2U 2PY5A 1R73A 4QNHB 2W6IG 4LNUA 3ZIAG 1VQMV 1XI1A 4DRIA 4LH7A 2EIKC 1YJWV 1VQ8V 4LFCO 5LHGA 3E35A 5KHGA 2AZ2A 1TUBB 4Z2KA 3DC5A 3CC4V 2HJFC 4UDMA 4AILC 4JI6O 3DGEA 3R65A 3BPZA 4BAYA 3CCSV 1AP5A 1BQ0A 4CZZA 1D2KA 1W1PA 2ADQB 1ZAUA 2Q7GA 4LAXA 4WK9A 1NS1A 2PTMA 3G4SV 1Y74A 1OZ0A 2GDSA 4FZ0A 2QTOA 3NR7A 1TFVA 3UKMA 2BOCC 1QPLA 5EZYA 4JI5O 2A3AA 2YIDA 2HP8A 2MF9A 2D2CB 4PDMA 2EZPA 3S3XA 3CCLV 1XMOB 1SQQH 3AS3A 3STZC 2R9IA 4IT4A 2V1DA 1TAEA 1NI8A 4J9ZB 5LXTA 4DWSA 2OFNA 2DSWA 2PUSA 1SQPH 4X89A 3U10A 2ZNIA 2F66C 2PPPA 5KA6A 4B3MB 1YHQV 3UQBA 2OIGA 2WK2A 3RGBA 4K0KB 4LF8O 3CHXA 5LMNO 1K7DA 1GN2A 2Q0OC 4RUFA 2JIZG 2Q0AA 4A5UB 3O5FA 5HBFA 2JJ2G 1LG2A 4JGSA 1RPOA 4N23A 1PP9H 4DV2B 1QLEC 3KAFA 4ASUG 4ML4A 1SETA 1MSDA 1W2BU 1BE3H 2CTRA 3S3WA 4IPXA 1XDCA 3MDSA 1ROUA 3KZIZ 4I4TA 1U96A 1Y76B 5D5PA 1FJGO 3WU2Z 2ZM6B 1M1KW 3RN4A 3OD4A 4FLVA 3UO3A 1YJNV 1BHAA 5C8YB 2P4VA 2EINB 4KP4A 4ITZA 4O4LB 1OCOB 1QPFA 1RD6A 1XHXA 1K5QA 4DYLA 1L0LH 2CK3G 1FKHA 4FLZA 4U85A 4R0XA 5B3SB 1FKDA 5GTIZ 3ARVA 3E89A 2FTKA 1Q5OA 2DYRB 1GRJA 1K34A 1SQFA 3E8GA 3RFRA 4BIZA 4JI2O 2RSEA 1IX9A 4FLTA 4D7TA 1WA8B 1WP8A 3FB8C 3RMEA 4YJ3A 3OTFA 3UI5A 4DRXB 4LF6O 1F7YA 1ZWIC 2FKEA 4B3RO 1H2LA 2KSDA 1YW5A 1NTKH 4JF3A 2N05A 3AK1A 4DK1A 4UVAA 2WLNA 3JASB 1R3KC 3M8AA 4RAIA 3IC9A 4JFLA 2F23A 2D3OW 1A32A 2P67A 3KABA 5KUKA 3AS0A 4KQZA 2O9OA 5JJJB 1BS3A 1YTFB 4NXMB 4JYAO 4CH4A 3O5LA 2PV3A 1FYJA 1SYTA 3GB7C 4DWSC 3FKSG 5LGUA 1FKFA 3D8CA 2KQXA 1CP9A 1OJHA 3ASOB 3O65A 2MLZA 2HVKC 3QG5A 3RBZA 2DT1A 4MPKA 5CA3A 3D3IA 5HWBA 1XREA 5H6RA 1Q6IA 4KFMA 4LC1A 2O57A 1VEWA 3G80A 4WKHA 1D5AA 3ZRXA 4KL1A 4GIVA 1Y0OA 2YUAA 1VQLV 3MDYB 4DRNA 3CPWU 4ZOLB 3SYAA 4ZIBA 1IURA 3E83A 3WL0A 2RQSA 3ABUA 2QJ1A 4Q20A 1JPXA 1GTOA 1FFRA 1VP7A 1KFWA 2YS8A 1NWTA 3BFRA 3K04A 3MD0A 4PA7A 4DZ3A 3K03A 2A06H 3ARPA 4IT5A 4AHCA 2X7RB 2A9HA 3K58A 4YIOA 4H0LB 2B5UB 3JSLA 3ZHRA 3H01A 2UUBB 4DRJA 4QT2A 1JCHB 1NJIW 3X2QC 4DR5B 4GCZA 5LP6B 1M56B 1M9NA 2GUZB 3KAHA 3QVNA 3OA5A 3UQAA 2DE0X 3PRBA 1W1TA 4R6ZA 2YI9A 5IE9A 4TV9A 3ABMC 4J42A 4O2BB 2MNTA 4LAWA 1QVFU 4TQFA 5B1BB 1N34O 3O5JA 4J80A 2XAFA 4XAKA 4X1KB 1ZBVA 4O4LA 4H33A 4PI2A 2AWGA 1IBMB 4O4JA 4B3MO 1QR8A 1VMGA 1WB0A 1GK9A 2XAGA 4B7EA 4FLWA 2N87A 2ZR5A 5HFMA 1P84F 4DV3B 1I94B 4FN2A 1N1AA 5FPRA 4ZKIA 2X6BA 3JATB 3ZMSA 5EK0A 3CCQV 1N33B 1VQ6V 2DYSB 1B06A 3FB6C 2CAZC 5GW7A 1WA8A 2WLHA 4X9QA 1E1QG 2EBOA 3SYQA 3IJ4A 5L3GA 1AR5A 3G71V 3H9RB 1AROP 2UXCB 3WB2A 4ZPTR 3ASNB 2ETNA 1RM1C 3WL1A 3F7YC 2VWKA 2ZR3A 1HNXB 3K5MA 2F21A 1ZBCA 1FFQA 1ZSPA 5FLXN 3BABA 5EC2C 3B9DA 2LP7A 1FAPA 2DSZA 5DO2A 2JGUA 4O4HB 4O4IA 3OGIB 2ZM6O 2OIEA 3VOUA 4WFEA 1HNWO 5GQBA 4WCEV 1FS0G 1IBLB 4NYKA 4GZRB 1ZTEA 1WAZA 2QKSA 2JEUA 4H44B 1XL6A 5BR8B 3DTUB 4KHPO 2UXDO 4Z2GA 2EIJC 1JJOA 4LFAB 2CDYA 3KKYA 3PRDA 1D5NA 2XAJA 4H13B 4GGQA 1ORQC 3HKEB 5CMUA 4YHHO 2UXNA 3LNMB 2OYQA 5B1AB 1OCCC 3AG1B 2KGJA 3DXRB 5IY5C 5JWPA 3GTYX 1G1XB 1VF6A 1CXZB 4YJ2A 5CA0B 3RYFB 2ZR6A 4MTGA 3VQWA 4P8VA 4FFBB 1K33A 2XP8A 3EY6A 2ZQUA 1YXBA 1GM7A 2Q73A 2Q67A 4DR1O 2DPEA 3JD1A 2CE4A 1J4RA 3AG4B 1W9VA 1OCRC 4QZVB 3IKDA 2XP4A 4AI8A 1GH6A 3E2EA 4DV1O 4DRHA 1FKAO 4DV7O 4I9WA 4DXWA 3JCZA 4U3JB 3APOA 1H8EG 1QHTA 1L1PA 1GPFA 2B5UA 1URFA 3TXQA 4DR6B 5LBQA 1PBKA 2QM7A 3O5OA 2RUCA 2XHBA 5K1PA 5LP6A 1ZBKA 2QWRB 1V54C 3TCZA 2LJ2A 4FM2A 2GUZA 1IBKB 1R6NA 5GPRA 1P7BA 2W6JG 4DR3O 2L2SA 2UXBB 3A2FA 1I5XA 5CBGA 4J9YB 5HUAA 1DK1A 4DUYB 1K9MW 2ZIOA 1KECA 4JV5O 1ROTA 3CHEA 4PTMA 1YEWA 1LL7A 1I0HA 1J6YA 4NXNO 3H9VA 2JGDB 3SYPA 3B40A 1KMIZ 2BTOA 3JCUZ 2GBOA 3OUSA 5GONB 1XNRB 5IT9N 3PRAA 2W0FC 4MAVA 3AG2B 4P2ZA 4UCUA 3RYCA 4FM1A 4CH5A 2QSAA 3OOBA 1JX9A 2BOBC 4W5UA 3CHFA 1SKVA 1FPOA 4LWSB 2Y69B 3ZHUA 3LDEA 1OV9A 4I5SA 4IGGA 1MG1A 3JATA 1QZ2A 5IYBO 1SQBH 2RMKB 3RVYA 1BMFG 4J11A 3JSNA 2YXHA 4PDVA 1F40A 1P4RA 4XDJA 4BR6A 2WLYA 4MTVA 3SPGA 3K08A 4UVBA 4PHZA 3FYEB 4P8WA 5BXJA 1LJYA 3F5WC 4JI7B 4DR5O 1HR0B 1H2NA 2Y78A 3JARB 3L74H 2DT2A 2XOKG 1HP8A 2QWPB 4GX0A 1EFRG 5LGNA 4BW5A 4HARA 1XOUA 3ETQA 2PV2A 1S77D 1DF4A 4CH6A 3ZEDA 4O4HA 2R9RB 1Z5VA 3WKZA 1ZL1A 1VF6C 3WD1A 3UF8A 5J2TB 3EXAA 1AILA 5CA1A 3CJHB 1FXVA 4FZ1A 1O6IA 3APQA 2E75B 5IJ0B 4IIJB 1G8MA 4PA4A 5L3CA 4MNJA 1W1YA 3ZN1A 1CEZA 2CGOA 3W7UA 2CUGA 2P06A 4K3AA 1JA8A 5KA5A 1N32B 2YBTA 1S5JA
chains in the Genus database with same CATH topology
3KZ7A 1D7JA 2M1IA 2LJ4A 3UQBA 5HWCA 2WK2A 3B09A 1Q6HA 4ODPA 3UQIA 1J4HA 2DSVA 1KT0A 4JFMA 2M08A 3O5FA 4O2TA 4S3KA 5HBFA 2RURA 1LG2A 4MSPA 3AQUA 2ESCA 1ITXA 3G6LA 3RGCA 3KAFA 3B7XA 4ML4A 3KAGA 4IPXA 1M5YA 1ROUA 3RM9A 3ARZA 2M2AA 1E6RA 3CGNA 2D9FA 4DIPA 3WD3A 1A7XA 4WKAA 1E6PA 2PBCA 4LAVA 1Q6UA 3NTPA 4DRMA 1WNOA 4ITZA 4ODNA 2YBUA 1QPFA 1D7IA 2LKNA 1RD6A 1GUVA 2XP5A 1FKHA 4U85A 4R0XA 1FKDA 1FKSA 3ARVA 1OGBA 3G6MA 3WH0A 3ARUA 1XHGA 2RSEA 2AOSA 3WIJA 2ITKA 3RMEA 4NSBA 4C02B 3UI5A 1JVWA 1X6LA 4DRKA 1P5QA 1FKKA 2FKEA 3QOKA 1YW5A 1NMWA 2PPNA 1KT1A 2O92A 1F8AB 2LPVA 4JFLA 1JNEA 4S3JA 3KABA 4MNKA 3AS0A 4KQZA 3NI6A 2O9OA 2B31A 5I98A 5JH8A 3O5MA 1GOIA 1FKTA 2MLYA 3O5LA 2PV3A 4Z2IA 1SYTA 2XPBA 4DWSC 2G41A 2ZQSA 1FKFA 2MLZA 1LQ0A 4TW7A 2A3EA 4ODRA 2DT1A 4MPKA 3O5DA 3GPKA 1FKRA 2WLZA 3IHZA 4ODOA 3CHDA 4ZPVR 5DIVA 3PR9A 5HWBA 2OLHA 3O5GA 4DRQA 3O5IA 1Q6IA 1HJWA 1EIBA 2A3CA 3FY1A 4N19A 1ZCNA 4WKHA 5HW8A 4DH0A 4DWSB 1UR8A 4GIVA 4WKFA 3WQWA 1WAWA 3WD4A 1Y0OA 3CGMA 3MDYB 4DRNA 3O5PA 3RFWA 5DEZA 4TYOA 3RM4A 3WL0A 2RQSA 3WD2A 3TC5A 1FFRA 1OGGA 4JFKA 2KE0A 4URIA 1KFWA 4WJXA 1NWTA 1ZB5A 3JYMA 4DZ3A 3B9EA 3ARPA 3JYJA 1HJVA 1FD9A 2KO7A 1HKJA 2ZQTA 3UI6A 4DT4A 5D75A 4W9QA 1NWSA 1H0GA 4DRJA 4QT2A 1NSGA 1HKIA 3B9AA 3CZ8A 2MLXA 2XP7A 1XRVA 2KI3A 3ARWA 2XP3A 3KAHA 3ARSA 1CTNA 3OA5A 1HKMA 3UQAA 3PRBA 1W1TA 4DRPA 1EDQA 3ALFA 4JYSA 1VF8A 5DITA 2FDMA 4BF8A 2MNTA 4LAWA 3KCEA 2XP9A 5DIUA 4IT6A 3VAWA 4Z2LA 1J4IA 3ARTA 3O5JA 1ZU8A 4XAKA 1ZBVA 3WQVA 2AWGA 2Q5AA 2F2DA 3AS1A 1BKFA 1C9HA 1E6ZA 2PV1A 4MNMA 1WB0A 2N87A 2ZR5A 3WD0A 1U79A 3AS2A 4LAYA 1JNSA 1B6CA 3TDBA 4FN2A 5HW7A 1HXVA 1N1AA 2DG4A 1LG1A 4ZPWR 4P8UA 1E6NA 1YATA 3H9RB 3IK8A 1JNDA 4MNLA 1NH6A 3ARXA 4ZPTR 5B8IC 3WL1A 1E9LA 2F21A 5HTGA 1ZBCA 1FFQA 3W4RA 4DROA 3B9DA 4WIWA 1FAPA 4AY1A 2DSZA 2KFWA 2MPHA 1TCOC 5DO2A 2FAPA 2XP6A 3ARQA 5GQBA 1FKJA 3CH9A 4TW6A 4IQ2A 1W9PA 1EYMA 4TW8A 1NWRA 1EQ3A 5HW6A 4ODMA 4JFIA 4Z2HA 2DT0A 1IX5A 1FKLA 1LL4A 4Z2GA 1ZK6A 2A3BA 3PRDA 1LL6A 4GGQA 4ODQA 4LGXA 1T11A 4ODKA 3I6CA 2KGJA 1W9UA 5HKGA 2LGOA 4HBEA 4Q22A 2ZR6A 1JNTA 4P8VA 2XP8A 3EY6A 4FAPA 2WM0A 2ZQUA 2ZR4A 2K8IA 2QF8A 2IF4A 2DPEA 4P8XA 1FKBA 1J4RA 3ARRA 1K9TA 1W9VA 4QZVB 4U86A 3IKDA 2XP4A 1FKIA 4U84A 3KAIA 3AROA 5J6EA 3O5RA 4DRHA 2VCDA 4Z2JA 2KR7A 1EHNA 5DF0A 4DZ2A 4L72B 1L1PA 5HT1A 1GPFA 2DG3A 4L3NA 1Q1CA 2RUQA 1PBKA 3NRKA 3O5OA 4W9OA 1D7HA 2RUCA 4DWSD 1BL4A 4NNRA 1PINA 1ZBKA 1HKKA 1FKGA 3TCZA 5GPRA 4R5EA 2XPAA 3O5KA 2L2SA 2G8ZA 4G50A 3KADA 3O5EA 2JZVA 4QT3A 3O5QA 5HUAA 2UZ5A 1W26A 2F4EA 4PTMA 3CHEA 1ROTA 2DT3A 3FXYA 1LL7A 1J6YA 1FJDA 4HBOA 3ARYA 3PRAA 4MAVA 3BXWA 3JXVA 3CHCA 4KR0B 1X6NA 3LUOA 5GPGA 1D6OA 1W1VA 3OOBA 2IUZA 1SR0A 4W5UA 4MGVA 3CHFA 4ODLA 1H0IA 2VN1A 3FAPA 1R9HA 2RUDA 1OWQA 2DG9A 2ZQVA 1NMVA 1QZ2A 4DRIA 1UR9A 3RM8A 3UI4A 1F40A 1ZBWA 2WLYA 4MTVA 3ALGA 4ZS6A 4Z2KA 1HJXA 4P8WA 4NZCA 5BXJA 1LJYA 1NWUA 2PI6A 2Y78A 4J4OA 2DT2A 1D2KA 1W1PA 4LAXA 4TNSA 4TX0A 4WK9A 4QIBA 4HARA 3KACA 4Q7NA 2PV2A 1TFVA 4IQCA 3IKGA 4G2PA 1QPLA 2A3AA 3WKZA 1ZL1A 2MF9A 2DSUA 3WD1A 3UF8A 3ODKA 1O6IA 3AS3A 4IT4A 4MNJA 1W1YA 4W9PA 4JFJA 4DWSA 2OFNA 2DSWA 3PA7A 3B8SA 1E15A 4J4NA 2PPPA 2YBTA 2PPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BKF A;  1C9H A;  1FKT A;  2DG3 A;  2PV1 A;  3KZ7 A;  1Q1C A;  1D7J A;  2N87 A;  2M1I A;  2LJ4 A;  2ZR5 A;  1U79 A;  1PBK A;  2RUQ A;  3NRK A;  3O5O A;  1B6C A;  4LAY A;  1D7H A;  2RUC A;  4FN2 A;  4W9O A;  3TDB A;  5HW7 A;  2MLY A;  5HWC A;  1N1A A;  1HXV A;  3B09 A;  2DG4 A;  3O5L A;  2PV3 A;  1BL4 A;  1Q6H A;  4NNR A;  2XPB A;  4ODP A;  1PIN A;  3UQI A;  2ZQS A;  1J4H A;  1FKF A;  1FKG A;  1KT0 A;  2MLZ A;  4JFM A;  3TCZ A;  2M08 A;  4TW7 A;  3O5F A;  4O2T A;  2RUR A;  4ODR A;  2XPA A;  3O5K A;  2L2S A;  3GPK A;  3O5D A;  4MSP A;  1FKR A;  3IHZ A;  4G50 A;  4ODO A;  1YAT A;  5DIV A;  5HWB A;  3H9R B;  1JNS A;  3IK8 A;  3KAD A;  3O5E A;  2JZV A;  3O5G A;  4QT3 A;  3O5I A;  4DRQ A;  1Q6I A;  3O5Q A;  3RGC A;  3KAF A;  5HUA A;  2UZ5 A;  1W26 A;  3B7X A;  4N19 A;  1ZCN A;  5B8I C;  5HW8 A;  2F4E A;  4DH0 A;  1ROT A;  3KAG A;  4GIV A;  1Y0O A;  1J6Y A;  1FJD A;  4IPX A;  2F21 A;  5HTG A;  4DRO A;  1M5Y A;  3CGM A;  3MDY B;  4DRN A;  3O5P A;  3RFW A;  1ROU A;  4TYO A;  1FAP A;  3JXV A;  2M2A A;  2RQS A;  3CGN A;  2KFW A;  2MPH A;  2D9F A;  1TCO C;  3LUO A;  4DIP A;  1A7X A;  5GPG A;  1D6O A;  3OOB A;  2PBC A;  4LAV A;  3TC5 A;  4MGV A;  4JFK A;  4ODL A;  2VN1 A;  2KE0 A;  3FAP A;  1Q6U A;  2FAP A;  2XP6 A;  3NTP A;  1R9H A;  2RUD A;  2DG9 A;  3JYM A;  1FKJ A;  4DRM A;  2ZQV A;  4DZ3 A;  4TW6 A;  1NMV A;  4IQ2 A;  1EYM A;  3JYJ A;  1QZ2 A;  4DRI A;  4ITZ A;  4ODN A;  4TW8 A;  1EQ3 A;  5HW6 A;  1QPF A;  1D7I A;  1FD9 A;  2KO7 A;  2LKN A;  4JFI A;  4ODM A;  2ZQT A;  3UI6 A;  1FKL A;  4DT4 A;  3UI4 A;  1F40 A;  1ZK6 A;  2XP5 A;  1FKH A;  5D75 A;  3PRD A;  4W9Q A;  4U85 A;  4R0X A;  4GGQ A;  1FKD A;  1FKS A;  4ODQ A;  4DRJ A;  5BXJ A;  4QT2 A;  1NSG A;  1T11 A;  2Y78 A;  4ODK A;  3I6C A;  2MLX A;  2XP7 A;  2KGJ A;  4J4O A;  3WH0 A;  2KI3 A;  2RSE A;  2XP3 A;  2LGO A;  5HKG A;  3KAH A;  2ZR6 A;  4LAX A;  1JNT A;  2ITK A;  4TNS A;  3UQA A;  4TX0 A;  3PRB A;  4QIB A;  4C02 B;  3UI5 A;  1JVW A;  2XP8 A;  3EY6 A;  3KAC A;  2PV2 A;  2ZQU A;  4DRP A;  4JYS A;  4FAP A;  5HT1 A;  2ZR4 A;  4DRK A;  2K8I A;  4IQC A;  1P5Q A;  1FKK A;  2IF4 A;  3IKG A;  4G2P A;  5DIT A;  2FKE A;  1FKB A;  1J4R A;  1QPL A;  4U86 A;  4BF8 A;  3IKD A;  2XP4 A;  1FKI A;  1YW5 A;  4U84 A;  2MNT A;  2MF9 A;  3UF8 A;  3KAI A;  3KCE A;  2XP9 A;  3ODK A;  4LAW A;  1NMW A;  2PPN A;  5DIU A;  5J6E A;  3O5R A;  1KT1 A;  3VAW A;  1L1P A;  1F8A B;  4DRH A;  2LPV A;  2VCD A;  1J4I A;  4JFL A;  3O5J A;  2KR7 A;  4W9P A;  4JFJ A;  3UQB A;  3KAB A;  2AWG A;  2OFN A;  2Q5A A;  2F2D A;  3PA7 A;  4J4N A;  4DZ2 A;  3NI6 A;  2PPP A;  5I98 A;  3O5M A;  2PPO A; 
#chains in the Genus database with same CATH topology
 3KZ7 A;  3RYI A;  2E5L B;  2P6J A;  2LJ4 A;  1I94 O;  3ABL C;  4IL6 Z;  2HG5 C;  3HKE A;  1Q6H A;  3L72 H;  3DXR A;  3H1K H;  4TOI A;  4BWA A;  1N36 B;  1HDJ A;  5CA0 A;  3IC7 A;  2EJ7 A;  1Q90 D;  3M99 B;  3AQU A;  3K9S A;  2ESC A;  1KU9 A;  1Q82 W;  1ITX A;  2V7Q G;  3RGC A;  4GYC B;  3NXS A;  4X65 O;  3SPI A;  1GN4 A;  1HNX O;  3KAG A;  5J2U B;  4NKG B;  1M5Y A;  1RPR A;  4FLX A;  4I9Q A;  3L9D A;  5LYJ B;  3BHP A;  5IYC O;  4DV0 B;  4RWU A;  3AEI A;  3ARZ A;  2M2A A;  3CC7 V;  1LUV A;  3B4S A;  3RYH B;  1E6P A;  4LAV A;  4U3J A;  5LGT A;  3FD9 A;  2A3Q A;  3F7V C;  4B3S O;  4TUY B;  3NTP A;  4YIP A;  1G4Y B;  2Z0A A;  1ROP A;  2QWQ B;  1EN6 A;  2BTQ B;  1W0K G;  3A0B Z;  4ODN A;  2YBU A;  3K5O A;  3SJQ C;  4JI1 O;  1D7I A;  5BR8 O;  2LKN A;  5BMV A;  3DSQ A;  4X1Y B;  4X66 O;  1GUV A;  4LFA O;  1M93 A;  3Q4H B;  1FKS A;  2OCC C;  1OGB A;  2F4V O;  3ARU A;  1R3J C;  4O2A B;  4PDL A;  2JS3 A;  3OMI B;  2Z5U A;  3A0H Z;  2C2A A;  2HHH B;  1AJP A;  1JMK C;  4NSB A;  4C02 B;  1YVW A;  1QCE A;  3WG7 B;  1I08 A;  1X6L A;  1W59 A;  4DRK A;  1P5Q A;  1FKK A;  4UB6 Z;  2Q8V A;  3JAW A;  4DW0 A;  4DUZ O;  3T1H B;  4F6R B;  4G27 B;  5KX5 A;  5E79 Z;  3THO A;  2OT5 A;  2LPV A;  2DOS A;  4QPK A;  4S3J A;  4I55 B;  1TA8 A;  1OHH G;  1S76 D;  4I50 B;  3NI6 A;  3FX7 A;  1WB7 A;  4IHJ B;  3HB3 B;  3HPL C;  2UU9 O;  3ICX A;  4Z1M G;  2MLY A;  1FAF A;  3WFV A;  3T1Y B;  1VAR A;  4CS4 A;  3JAR A;  2H3O A;  2G41 A;  3ABK C;  3E22 A;  2QA4 V;  1K4C C;  2ODM A;  4PEL A;  2UXB O;  3BAA A;  4N21 A;  5DIV A;  3PR9 A;  2OLH A;  5JQG B;  1EIB A;  5TIS Z;  4DUY O;  3OEE G;  2A3C A;  4N19 A;  5B1A C;  1ZCN A;  4DH0 A;  3OTO B;  1EZV H;  1WAW A;  1MAB G;  4WBN B;  2BE3 A;  3H1H H;  4DR7 B;  1PL4 A;  3AG7 A;  3BA9 A;  3FFQ A;  5DEZ A;  5IJ0 A;  5CB4 B;  3RM4 A;  2CGN A;  4X20 B;  3AK2 A;  5EYP B;  3VBB A;  5LOV B;  4MTF A;  1OGG A;  2PZS A;  2WPD G;  3BMB A;  4ZHQ A;  1ZB5 A;  4MT8 A;  5IYZ B;  3JYM A;  3ZX6 A;  3QO5 A;  3B9E A;  2YC0 A;  2QWN B;  1FD9 A;  1XL4 A;  3D3Q A;  1HKJ A;  1OCZ B;  2ZQT A;  3UI6 A;  4DT4 A;  1JQ0 A;  5D75 A;  1NWS A;  2VQE O;  3GWO A;  3OR6 C;  2Y48 A;  4YY3 B;  3CME V;  1NSG A;  1NVP D;  1HKI A;  3B9A A;  2M6Y A;  4BIO A;  1XRV A;  4LF4 B;  3ARW A;  1MA1 A;  5DN6 G;  1CTN A;  5LYJ A;  4RQF A;  4DRP A;  3ALF A;  1M57 B;  4JYS A;  3OR7 C;  1VF8 A;  2PGG A;  1YZB A;  2FDM A;  1B6Q A;  3K0D A;  1NQT A;  1XQ8 A;  2IW5 A;  1SER A;  2RDC A;  4TUY A;  4UFZ A;  2XP9 A;  4IT6 A;  3VAW A;  3T4D A;  3CCV V;  3ZMT A;  2PF4 E;  4I0X B;  3ART A;  4X8A A;  1IXM A;  3N2G B;  2EZO A;  3SR2 C;  1N32 O;  3K5L A;  3C90 A;  4QE7 A;  2QTS A;  1C9H A;  2PV1 A;  2LO1 A;  1JNS A;  4LAY A;  2QM4 A;  2IH3 C;  2DG4 A;  1R3L C;  4FLU A;  1MZE A;  1N36 O;  5JH7 A;  1ZLZ A;  2QE7 G;  3AK3 A;  1KKC A;  1BCC H;  4JPR A;  4PDR A;  3UT5 B;  1YAT A;  2GTS A;  3E8F A;  3K06 A;  3JAK B;  3IK8 A;  3CMA V;  3ARX A;  2ZDI A;  2YIB A;  4NVP A;  4UV9 A;  4EKW A;  4MVS A;  5FNV B;  5HTG A;  3W4R A;  2XAS A;  1TUB A;  1SQG A;  3HKB B;  3SYO A;  4LF7 B;  4DV0 O;  5IJ9 B;  4ICG A;  4AY1 A;  2EIM C;  3OGC C;  2EUL A;  1TCO C;  1I5Y A;  4I55 A;  5FL7 G;  2EX3 A;  1TGO A;  3BA8 A;  1B04 A;  5KAF Z;  1JOY A;  1EN5 A;  3HR0 A;  2XP6 A;  4LF5 B;  3CCE V;  1FKJ A;  3CH9 A;  5EBM C;  3KCX A;  5KHJ A;  1FXK B;  4IQ2 A;  1W9P A;  1EYM A;  2A79 B;  3ABT A;  4JI0 B;  3RT3 C;  5HW6 A;  2FL4 A;  4ODM A;  1NBM G;  2JDI G;  3CEI A;  1WB8 A;  2DT0 A;  4K8Z A;  1FKL A;  4DV4 B;  3W7W A;  2H94 A;  1JFF B;  1LL6 A;  5JJE B;  1YJ9 V;  1Z2G A;  5EBL C;  4LGX A;  1EM1 A;  5CBH A;  4ODK A;  5DM6 V;  1GMG A;  4PJ0 Z;  2OTL V;  5HKG A;  4HBE A;  1QNM A;  4Q22 A;  2B1G A;  1JNT A;  4FAP A;  1XEQ A;  4X20 A;  2CTW A;  3E8H A;  1WJZ A;  5EYP A;  1FKB A;  5LOV A;  1I7F A;  2IJI A;  4U84 A;  3W7T A;  3RWR D;  2Y4U A;  2ZXW B;  3ARO A;  5J6E A;  1IXB A;  4LH6 A;  4J7Z A;  4HYO A;  2KR7 A;  4MTO A;  1F4N A;  5DF0 A;  2EIL B;  3U0Z A;  2YXL A;  4CBC A;  2F43 G;  3OT7 A;  4ZI7 B;  1XNQ B;  4DZ2 A;  2DG3 A;  2DN9 A;  2W0X A;  2HR3 A;  2RUQ A;  3NRK A;  3JAL B;  5J9P C;  4CC6 A;  3T1Y O;  4DWS D;  3WB1 A;  1Y76 A;  1BL4 A;  2JRI A;  2QKC A;  1PIN A;  1NTM H;  3GVM A;  4GKJ B;  1XMO O;  2CTQ A;  1BL8 A;  2G8Z A;  1NR7 A;  4G50 A;  1HWY A;  2ITD C;  5C8Y A;  2JZV A;  3C3S A;  2UZ5 A;  3OTO O;  3AG3 B;  2WLJ A;  2DT3 A;  3FXY A;  3SGI A;  2X6C A;  1FJD A;  4HBO A;  3ARY A;  3P32 A;  1QVG U;  4XDL A;  4K0K O;  1X6N A;  3LUO A;  5GPG A;  1E1R G;  2WLM A;  2ZDI C;  1XBL A;  3N2G A;  3P3P A;  1V55 B;  1SS3 A;  2HJD A;  3B8M A;  2Q69 A;  4UUJ C;  4DRX A;  4DV2 O;  1Q81 W;  5KHI A;  2RUD A;  1EBO A;  2AXT Z;  2ZQV A;  4ZBM A;  1YI2 V;  3SYC A;  1UR9 A;  4TQD A;  3QF7 A;  5JCO A;  3RM8 A;  1MNG A;  1EZJ A;  1ZX3 A;  2WAM A;  3JAS A;  3ALG A;  3UT5 A;  3VQV A;  5KMG B;  3JAK A;  4NZC A;  4YY3 O;  1NWU A;  4TV8 B;  2DWD C;  4J4O A;  2EIK B;  3N2K B;  4KXR A;  3K9A A;  3OMN B;  2MK3 A;  1HNZ B;  5L3F A;  2VRZ A;  3KAC A;  4Q7N A;  3OMA B;  4IQC A;  3IKG A;  4UXN A;  1K92 A;  3LDC A;  2UUA B;  2DMX A;  4LP8 A;  4DW1 A;  2PI5 A;  3D36 A;  3CRC A;  1AR4 A;  1ZL8 B;  1PL0 A;  2VQF B;  4JFJ A;  4W9P A;  1AJN A;  4TSF G;  5DED A;  3B8S A;  1E15 A;  4J4N A;  3LSS A;  5HW7 A;  1IX5 A;  2H8P C;  1E79 G;  4ZOL A;  1JFF A;  2DJV A;  1KC8 W;  3B09 A;  3CRM A;  3UQI A;  1J4H A;  1DF5 A;  2DSV A;  3RVZ A;  2LFR A;  2E3C A;  1K4D C;  2HLD G;  2RUR A;  4UCT A;  4MW3 A;  2M7W A;  1GM9 A;  1S5L Z;  1KB9 F;  5L3B A;  4X88 A;  4R8C A;  1WN7 A;  3OFN G;  1JJ2 U;  1FFX B;  1PNK A;  2WLI B;  5D5Q A;  2JVD A;  3B7X A;  1AI4 A;  1TVK B;  2PI4 A;  2IH1 C;  4LF7 O;  3SJB C;  4NXM O;  3BVO A;  3RW0 A;  1JCH A;  3BEH A;  2Q7E A;  1SC5 B;  2EIN C;  3CGN A;  4WFA V;  5H9C A;  1OCO C;  1BZK A;  1QLE B;  4WKA A;  3WD3 A;  4DIP A;  5LL6 Y;  2PBC A;  5EBW C;  4ZI7 A;  3CWB H;  1FFT B;  4K35 A;  3QO7 A;  2Q9L A;  1Q6U A;  4LF5 O;  1XMQ B;  3JD4 A;  5B3S C;  3J7A U;  5KLV H;  3MHS C;  3JAL A;  3K5N A;  4DRM A;  2XAH A;  4X64 B;  2XT9 A;  2DYR C;  1M90 W;  4O2B A;  4D6T H;  3CC2 V;  3ETG A;  2YXY A;  4FPP A;  4HBN A;  5DEC A;  2ZCE A;  4AQY B;  4FVM A;  3SPJ A;  4PA9 A;  4X1K A;  2RQ6 A;  1QR9 A;  2ZE6 A;  1YDX A;  2Q68 A;  5JCO C;  1SRY A;  3FB7 C;  3IAY A;  1JVW A;  2QKA A;  2P5O A;  3B2E E;  1S3J A;  3G6E V;  1RFY A;  1DTO A;  3EHB B;  4LF8 B;  3QOK A;  2VS0 A;  4DK0 A;  1O9H A;  2ZD9 A;  2UUB O;  1NMW A;  1KT1 A;  4LCU C;  2O92 A;  4JAA A;  4X1I B;  1JNE A;  4MNK A;  2ZR2 A;  3ASO C;  3K57 A;  2HKO A;  1XNQ O;  1MSW D;  2CH7 B;  2KG7 B;  2ILM A;  1UPG A;  5JH8 A;  4QPJ A;  1O9G A;  1DGS A;  2IBZ H;  2AHY A;  2Z3Y A;  3D36 C;  3ZRW B;  4Z2I A;  4TWK A;  2ZQS A;  5L3D A;  3G6B A;  5BZB A;  2ZNJ A;  5IDJ A;  1WNS A;  2A3E A;  4PD4 F;  1XHZ A;  3O5D A;  4JAU A;  2QDO A;  1FKR A;  2WLZ A;  1AR1 B;  3IHZ A;  3CHD A;  4ZPV R;  4MVU A;  1Q7Y W;  3O5G A;  3O5I A;  1HJW A;  5EIB C;  1CPY A;  2LFS A;  2Y0I A;  1B3Q A;  1IBM O;  2GSM B;  5HW8 A;  4DWS B;  3WQW A;  3WD4 A;  3MAQ A;  4C7U A;  3CRQ A;  3CGM A;  1L8D A;  5IWA B;  4DV3 O;  3O5P A;  4G28 B;  2IJK A;  3UM7 A;  4TYO A;  1N33 O;  4LR3 A;  1PPJ H;  4DV5 B;  3OUF A;  3SPC A;  3GWK C;  4BIU A;  3CXH F;  3RYF A;  2ZIN A;  1MZF A;  1D2D A;  2KE0 A;  4WJX A;  4EFE A;  1U97 A;  3ETE A;  4JI2 B;  3C3T A;  4FFB A;  2UXC O;  1GM8 A;  3VQY A;  2UXX A;  5LP6 C;  4LF6 B;  1M56 C;  3CCU V;  3CRR A;  1P7G A;  4Q6G A;  1J95 A;  4B3R B;  3CRA A;  1F23 A;  2ZT9 B;  2XUM A;  2IU3 A;  2P4K A;  2XTA A;  2OTJ V;  3JD2 A;  2Q6A A;  3M7M X;  1FFX A;  4HZ3 A;  3ZBH A;  2WLI A;  1RSO B;  3CZ8 A;  2MLX A;  2XP7 A;  2KI3 A;  2ITC C;  4Z2W A;  4HAM A;  2XP3 A;  4L8J A;  5B1B C;  3ZMV A;  1IBL O;  2JEX A;  1EDQ A;  1LUW A;  4JYA B;  3X2Q B;  1JVM A;  4BF8 A;  1G6U A;  2WWW A;  4Z2L A;  4JTA B;  1ZU8 A;  1R6K A;  3ZHT A;  4JYY A;  2DYS C;  1UJW B;  3WQV A;  1XIL A;  2Q5A A;  3ABM B;  2F2D A;  1KQS U;  2JGD A;  2FB5 A;  5L3E A;  3AS1 A;  2ATK C;  5LMU B;  1E6Z A;  5GON A;  4MNM A;  1R6T A;  2R9A A;  5H2F Z;  1U79 A;  1AB3 A;  3TDB A;  4YJ3 B;  1HXV A;  1SZT A;  5LA6 B;  2Q4P A;  2FML A;  4GT1 A;  3ASN C;  4ZPW R;  1K3E A;  1VQ7 V;  2LGW A;  4CH3 A;  1M4U A;  4DV6 B;  2B9Z A;  1AI7 A;  4LWS A;  1K97 A;  1NTZ H;  4MVM A;  2F95 B;  4I7Z B;  4J7J A;  1NT2 B;  2UUC B;  2AGA A;  2P90 A;  1JND A;  1NH2 D;  1NH6 A;  2K9P A;  3UO2 A;  2YIA A;  3ML0 A;  2E76 B;  2HVJ C;  4MVZ A;  1E9L A;  4JI8 B;  4DR6 O;  4B3T B;  2NNU A;  4X1I A;  2ZIM A;  1H2S B;  3ZRS A;  4BW9 A;  4X62 B;  2LW1 A;  2MPH A;  3ZN0 A;  2P22 C;  1L1F A;  1IBK O;  4GKK B;  4ABM A;  2CH7 A;  1RM1 B;  2KG7 A;  4GUN A;  4MVQ A;  3ZS8 C;  2HEP A;  1XMQ O;  3ARQ A;  3H1L H;  2LW7 A;  1SQX H;  2ZQM A;  3ZRW A;  4X64 O;  4TW6 A;  4JYC A;  3AG1 C;  2MW2 B;  4TW8 A;  2DQ3 A;  2WLL B;  1THZ A;  1YIT V;  4JFI A;  3TCU A;  4Z2H A;  5J2T A;  5KHK A;  4AQY O;  2FKX A;  1LL4 A;  3CJH A;  1XNR O;  2A3B A;  4IIJ A;  4FM0 A;  4ODQ A;  5LHI A;  1N34 B;  3E8B A;  2AHZ A;  3AG4 C;  4LFB B;  3N27 A;  3I6C A;  3JD0 A;  4JAV A;  3U11 A;  4NB5 A;  4UCV A;  2PN0 A;  1W9U A;  2A7W A;  1VQO V;  1AP6 A;  2EIJ B;  3K79 A;  2NR5 A;  2K8I A;  2QF8 A;  2RJZ A;  2IF4 A;  3FAV B;  4FLY A;  1OCC B;  4J10 A;  3SJC C;  5IY5 B;  4U86 A;  1FKI A;  2IJJ A;  4MW8 A;  4K8X A;  3O5R A;  4JI7 O;  3CD6 V;  1HR0 O;  1KBH A;  1Z5W A;  2VCD A;  4Z2J A;  4IYH A;  1EHN A;  5LHH A;  3KG2 A;  2VWJ A;  5J2U A;  1OCR B;  1FXH A;  1WPX A;  4L3N A;  2L35 A;  1BSM A;  2QGN A;  3RYH A;  1RSO A;  1KUQ A;  4NNR A;  5HFL A;  1XUQ A;  1J5E B;  4TV9 B;  4P9O A;  3UCS C;  5K1X A;  3OEH G;  3LDD A;  1US6 A;  4RQE A;  4FFK A;  2ZKO A;  2YDE A;  3AG2 C;  1X4T A;  1HNW B;  2BTQ A;  3O5E A;  2NN4 A;  5A2Q N;  1W26 A;  3L70 H;  4X1Y A;  4UCO A;  1NKD A;  2Y69 C;  1V54 B;  2E5L O;  2PYL A;  1S0V A;  4WFB V;  5IWA O;  1BQZ A;  3GU0 A;  4O4J B;  4OGQ B;  3H1J H;  3Q4H A;  2BSK B;  4KHP B;  3QNE A;  2UXD B;  2AW9 A;  3BY6 A;  4P30 A;  4JI4 B;  3CHC A;  1H2G A;  4KR0 B;  4DV5 O;  4O2A A;  1D6O A;  1W1V A;  2IUZ A;  2ADP A;  4RUE A;  4YHH B;  4MGV A;  4ODL A;  1H0I A;  2VN1 A;  2QWO B;  1BGY H;  2IJH A;  1OWQ A;  2DG9 A;  1NMV A;  2YSU B;  3I55 V;  5LA6 A;  1KD1 W;  1H2K A;  1Q86 W;  4DR1 B;  4F6R A;  3H1I H;  5BY1 A;  3UI4 A;  1ZBW A;  4FK5 C;  4U7O A;  5GTH Z;  4ZS6 A;  4KUM A;  1HJX A;  5CN0 A;  3EVK A;  5JVD B;  1PM9 A;  4JTC B;  4UB8 Z;  1K8A W;  2PI6 A;  2X0L A;  4DV1 B;  5H6Q A;  4GX1 A;  1WP7 A;  4DV7 B;  2N74 A;  4I50 A;  1M5I A;  4WF9 V;  4IHJ A;  1KYO F;  3OAA G;  3FB5 C;  2RCV A;  4O4I B;  4TNS A;  4TX0 A;  5B1N A;  4QIB A;  2OCH A;  3UQ8 A;  4E2L A;  4MSW C;  4G2P A;  2ZE5 A;  4MTX A;  1KP2 A;  1SA0 B;  3CX5 F;  3ZMU A;  2WA3 A;  4YXW G;  2DSU A;  3ODK A;  3R66 A;  3KCY A;  5JQG A;  3CCR V;  3OE7 G;  4DR3 B;  4UV8 A;  4GX5 A;  3TJT A;  2XND G;  1Y67 A;  4OPH A;  1AVM A;  2WLL A;  1K73 W;  4DR4 B;  4WBN A;  3PA7 A;  2HHH O;  1QU7 A;  2Y4T A;  2YIC A;  5LMU O;  4JV5 B;  4JTD B;  2PPO A;  1Q8I A;  1UFI A;  3IFX A;  4YJ2 B;  1WLE A;  2F1M A;  5CB4 A;  4NXN B;  1D7J A;  2M1I A;  4QGP A;  1ENV A;  5HWC A;  2YEV B;  2G38 A;  5IYD O;  3T1H O;  4ODP A;  3CP1 A;  4DV6 O;  4TT3 G;  1KT0 A;  4HNA B;  4P9P A;  4JFM A;  2M08 A;  3CCM V;  4O2T A;  4S3K A;  4UVC A;  4MSP A;  4FJC C;  5IYZ A;  2UUC O;  2F93 B;  1GAX A;  1KP3 A;  1W0J G;  3G6L A;  2QR4 A;  3ABL B;  4OX9 B;  3FAV A;  2WSS G;  4JI8 O;  1H2M A;  4B3T O;  4CS2 A;  4OPA A;  3L75 H;  3P30 A;  4DR2 B;  3RM9 A;  4FMT A;  4X62 O;  4CS3 A;  5ITZ B;  3B77 A;  1E6R A;  4WFH A;  2D9F A;  1A7X A;  2R70 A;  1H38 A;  4GKK O;  3LUT B;  1NH2 B;  3CE2 A;  5KHH A;  2Y0P A;  2ZE8 A;  1K5S A;  5BXZ A;  2DW4 A;  1QBZ A;  2N04 A;  3SPH A;  1WNO A;  4L87 A;  3A0R A;  2Q5Z A;  4DR7 O;  4EEQ A;  4NTW A;  2XP5 A;  4I0X A;  3WG7 C;  3HKC B;  3CXC U;  3TGU H;  3QTC A;  3EFF K;  3G6M A;  3BCC H;  4LFB O;  3RYC B;  1N0N A;  3WH0 A;  1X59 A;  1YCI A;  4PI0 A;  1VIB A;  4XBF A;  1XHG A;  1PKX A;  3BRC A;  3CSX A;  3MHH C;  2AOS A;  1DLB A;  3ZHS A;  3WIJ A;  1SF9 A;  2BSK A;  2ITK A;  4EFB A;  1GKF A;  4Z1V A;  2IM9 A;  3CB2 A;  2OCC B;  1BHB A;  1VQN V;  3P3N A;  2PPN A;  4MVR A;  5A9G A;  3CCJ V;  4CC5 A;  1F8A B;  2LQT A;  2LGQ A;  3JAM N;  2K1E A;  4LF4 O;  1P49 A;  2R72 A;  5FNV A;  4D7S A;  2GV9 A;  4X65 B;  3HKB A;  2B31 A;  5I98 A;  2GTA A;  1GOI A;  3O5M A;  1FKT A;  5IJ9 A;  1MMM A;  1R3I C;  3K59 A;  5JVD A;  2JS5 A;  1YF2 A;  2XPB A;  1J5E O;  2RN9 A;  1NVP B;  1LQ0 A;  4TW7 A;  3G67 A;  4ODR A;  3I56 V;  3E86 A;  1SQV H;  3GPK A;  4JI3 B;  4B3S B;  4ODO A;  3J81 N;  1FXK A;  3O9O A;  5CA1 B;  3F5T A;  4UCR A;  4DRQ A;  1GN3 A;  3IGA C;  1PV0 A;  1N8R W;  2ARH A;  2P7T C;  3FY1 A;  1YIJ V;  1UR8 A;  1SA0 A;  4WKF A;  1ZUQ A;  4JI1 B;  3ABK B;  2A0L A;  4X66 B;  3RFW A;  5AG2 A;  4JI4 O;  5EC1 C;  4J7K A;  4PV1 B;  3RYI B;  5JJN B;  2YIB D;  3T2M A;  4LF9 B;  3WD2 A;  2WA4 A;  3HKD B;  3TC5 A;  2F4V B;  1OCZ C;  4JFK A;  4URI A;  1VF5 B;  2EJR A;  3W7S A;  1LNQ A;  4QE9 A;  4DO2 A;  1KKD A;  4U3F H;  1N0J A;  2YEV A;  1VQP V;  4QIW F;  4JZ2 A;  3JYJ A;  5KUM A;  1HJV A;  2KO7 A;  4HNA A;  3ETD A;  1S72 V;  4F6E A;  4MS2 A;  1Y66 A;  4LFC B;  4DUZ B;  2PYJ A;  4W9Q A;  1M57 C;  1H0G A;  2XAQ A;  2V4D A;  3I5D A;  5B5E Z;  2WLK A;  3CYO A;  3STL C;  3DC6 A;  4G2K A;  4JI6 B;  1NU1 H;  4W4K A;  3ARS A;  4H37 A;  1HKM A;  2HFE C;  2UU9 B;  4JI0 O;  5ITZ A;  5DIT A;  1RP3 B;  3A8T A;  3K3W A;  4FIP C;  4B08 A;  4JI5 B;  4DV4 O;  2ZE7 A;  5BMV B;  4GLX A;  5DIU A;  3KCE A;  4EB6 B;  4WFF A;  3L73 H;  5H5N A;  1J4I A;  3T1C A;  2JJ1 G;  4DR4 O;  4NTX A;  2AZ0 A;  3TK1 A;  1LR1 A;  2DWE C;  2OWO A;  1NR1 A;  2GHY A;  3LNN A;  1AJQ A;  1BKF A;  2JK5 C;  4JZG A;  4B7K A;  4R7C A;  3WD0 A;  1BT8 A;  4NTY A;  2QM8 A;  3AS2 A;  1AI6 A;  3HKC A;  1B6C A;  1WPB A;  1QQC A;  1IVS A;  3FYI B;  3PN1 A;  4LNU B;  1S5H C;  1LG1 A;  4P8U A;  4JAS A;  1E6N A;  4PA6 A;  5LMN B;  3JYC A;  5B66 Z;  2DQ0 A;  3JAW B;  1L0N H;  1Q43 A;  4NR1 A;  3ZHV A;  5KX5 B;  3ZMZ A;  4MNL A;  4OX9 O;  3QO8 A;  3K0G A;  1YSC A;  1T5E A;  1IZ3 A;  5B8I C;  4MVO A;  1VQ4 V;  1NZ6 A;  1SES A;  2X6A A;  1F4M A;  4DRO A;  4DR2 O;  2BCC H;  5KMG A;  2IU0 A;  4WIW A;  1Y74 B;  1FXK C;  1HW7 A;  4QJF B;  4TV8 A;  4UCS A;  2KFW A;  2VQE B;  4GKJ O;  3T4Z A;  3N2K A;  5EZY B;  2NLJ C;  2Q7H A;  5CBF A;  1FJG B;  1E44 A;  4W4L A;  1PD3 A;  4IYI A;  3E22 B;  2FAP A;  1H8H G;  1Y6X A;  3OM3 B;  2KB1 A;  5B1O A;  2CTP A;  2EIM B;  5LXT B;  1EQ3 A;  3SJA C;  1NWR A;  3J80 N;  4GX2 A;  3TXS A;  4WFG A;  2E74 B;  1ZK6 A;  1EN4 A;  1VQ5 V;  1ZL8 A;  4RO2 A;  3VQX A;  1T11 A;  2KKW A;  1MOF A;  1Q3E A;  4J41 A;  3TET A;  2LGO A;  2ZXW C;  1F51 A;  4ZHQ B;  4E4E A;  2RNB A;  2WM0 A;  2ZR4 A;  1VQK V;  1PNL A;  2EIL C;  5C93 A;  4P8X A;  3LSQ A;  3HKD A;  3ARR A;  1K9T A;  1TUE B;  1YTF D;  3SDL A;  5KAI Z;  1PNM A;  1JR9 A;  3KAI A;  1V9P A;  1GN6 A;  1COW G;  4F4L A;  1N4C A;  4I4T B;  1TVK A;  4OXS A;  1HNZ O;  1VQ9 V;  3CS5 A;  5F2V O;  2FYU H;  4L72 B;  5HT1 A;  4JYB A;  1Q1C A;  4W9O A;  1D7H A;  1AI5 A;  3ZJZ A;  2QEX V;  1Y4M A;  4PA3 A;  4LBE C;  3AG3 C;  2B1I A;  2UUA O;  3WB0 A;  1HKK A;  1FKG A;  4R5E A;  2XPA A;  3O5K A;  4JI3 O;  5EIB D;  2VQF O;  3KAD A;  4QT3 A;  3ZHQ A;  3O5Q A;  1VF7 A;  1V55 C;  2F4E A;  4XDK A;  3ZRV A;  5FPO A;  1GO3 F;  2YI8 A;  3B8N A;  3W7X A;  4EB6 A;  4R50 A;  1R1B A;  5E1A C;  3BXW A;  3JD3 A;  3JXV A;  3ZCC A;  3L71 H;  4LF9 O;  1SR0 A;  2L6L A;  1IDS A;  1QLN A;  5JH7 B;  3FAP A;  3EIP A;  3PJS K;  4U7N A;  3LSU A;  1SZX A;  1R9H A;  3OW2 U;  2PY5 A;  1R73 A;  4QNH B;  2W6I G;  4LNU A;  3ZIA G;  1VQM V;  1XI1 A;  4DRI A;  4LH7 A;  2EIK C;  1YJW V;  1VQ8 V;  4LFC O;  5LHG A;  3E35 A;  5KHG A;  2AZ2 A;  1TUB B;  4Z2K A;  3DC5 A;  3CC4 V;  2HJF C;  4UDM A;  4AIL C;  4JI6 O;  3DGE A;  3R65 A;  3BPZ A;  4BAY A;  3CCS V;  1AP5 A;  1BQ0 A;  4CZZ A;  1D2K A;  1W1P A;  2ADQ B;  1ZAU A;  2Q7G A;  4LAX A;  4WK9 A;  1NS1 A;  2PTM A;  3G4S V;  1Y74 A;  1OZ0 A;  2GDS A;  4FZ0 A;  2QTO A;  3NR7 A;  1TFV A;  3UKM A;  2BOC C;  1QPL A;  5EZY A;  4JI5 O;  2A3A A;  2YID A;  2HP8 A;  2MF9 A;  2D2C B;  4PDM A;  2EZP A;  3S3X A;  3CCL V;  1XMO B;  1SQQ H;  3AS3 A;  3STZ C;  2R9I A;  4IT4 A;  2V1D A;  1TAE A;  1NI8 A;  4J9Z B;  5LXT A;  4DWS A;  2OFN A;  2DSW A;  2PUS A;  1SQP H;  4X89 A;  3U10 A;  2ZNI A;  2F66 C;  2PPP A;  5KA6 A;  4B3M B;  1YHQ V;  3UQB A;  2OIG A;  2WK2 A;  3RGB A;  4K0K B;  4LF8 O;  3CHX A;  5LMN O;  1K7D A;  1GN2 A;  2Q0O C;  4RUF A;  2JIZ G;  2Q0A A;  4A5U B;  3O5F A;  5HBF A;  2JJ2 G;  1LG2 A;  4JGS A;  1RPO A;  4N23 A;  1PP9 H;  4DV2 B;  1QLE C;  3KAF A;  4ASU G;  4ML4 A;  1SET A;  1MSD A;  1W2B U;  1BE3 H;  2CTR A;  3S3W A;  4IPX A;  1XDC A;  3MDS A;  1ROU A;  3KZI Z;  4I4T A;  1U96 A;  1Y76 B;  5D5P A;  1FJG O;  3WU2 Z;  2ZM6 B;  1M1K W;  3RN4 A;  3OD4 A;  4FLV A;  3UO3 A;  1YJN V;  1BHA A;  5C8Y B;  2P4V A;  2EIN B;  4KP4 A;  4ITZ A;  4O4L B;  1OCO B;  1QPF A;  1RD6 A;  1XHX A;  1K5Q A;  4DYL A;  1L0L H;  2CK3 G;  1FKH A;  4FLZ A;  4U85 A;  4R0X A;  5B3S B;  1FKD A;  5GTI Z;  3ARV A;  3E89 A;  2FTK A;  1Q5O A;  2DYR B;  1GRJ A;  1K34 A;  1SQF A;  3E8G A;  3RFR A;  4BIZ A;  4JI2 O;  2RSE A;  1IX9 A;  4FLT A;  4D7T A;  1WA8 B;  1WP8 A;  3FB8 C;  3RME A;  4YJ3 A;  3OTF A;  3UI5 A;  4DRX B;  4LF6 O;  1F7Y A;  1ZWI C;  2FKE A;  4B3R O;  1H2L A;  2KSD A;  1YW5 A;  1NTK H;  4JF3 A;  2N05 A;  3AK1 A;  4DK1 A;  4UVA A;  2WLN A;  3JAS B;  1R3K C;  3M8A A;  4RAI A;  3IC9 A;  4JFL A;  2F23 A;  2D3O W;  1A32 A;  2P67 A;  3KAB A;  5KUK A;  3AS0 A;  4KQZ A;  2O9O A;  5JJJ B;  1BS3 A;  1YTF B;  4NXM B;  4JYA O;  4CH4 A;  3O5L A;  2PV3 A;  1FYJ A;  1SYT A;  3GB7 C;  4DWS C;  3FKS G;  5LGU A;  1FKF A;  3D8C A;  2KQX A;  1CP9 A;  1OJH A;  3ASO B;  3O65 A;  2MLZ A;  2HVK C;  3QG5 A;  3RBZ A;  2DT1 A;  4MPK A;  5CA3 A;  3D3I A;  5HWB A;  1XRE A;  5H6R A;  1Q6I A;  4KFM A;  4LC1 A;  2O57 A;  1VEW A;  3G80 A;  4WKH A;  1D5A A;  3ZRX A;  4KL1 A;  4GIV A;  1Y0O A;  2YUA A;  1VQL V;  3MDY B;  4DRN A;  3CPW U;  4ZOL B;  3SYA A;  4ZIB A;  1IUR A;  3E83 A;  3WL0 A;  2RQS A;  3ABU A;  2QJ1 A;  4Q20 A;  1JPX A;  1GTO A;  1FFR A;  1VP7 A;  1KFW A;  2YS8 A;  1NWT A;  3BFR A;  3K04 A;  3MD0 A;  4PA7 A;  4DZ3 A;  3K03 A;  2A06 H;  3ARP A;  4IT5 A;  4AHC A;  2X7R B;  2A9H A;  3K58 A;  4YIO A;  4H0L B;  2B5U B;  3JSL A;  3ZHR A;  3H01 A;  2UUB B;  4DRJ A;  4QT2 A;  1JCH B;  1NJI W;  3X2Q C;  4DR5 B;  4GCZ A;  5LP6 B;  1M56 B;  1M9N A;  2GUZ B;  3KAH A;  3QVN A;  3OA5 A;  3UQA A;  2DE0 X;  3PRB A;  1W1T A;  4R6Z A;  2YI9 A;  5IE9 A;  4TV9 A;  3ABM C;  4J42 A;  4O2B B;  2MNT A;  4LAW A;  1QVF U;  4TQF A;  5B1B B;  1N34 O;  3O5J A;  4J80 A;  2XAF A;  4XAK A;  4X1K B;  1ZBV A;  4O4L A;  4H33 A;  4PI2 A;  2AWG A;  1IBM B;  4O4J A;  4B3M O;  1QR8 A;  1VMG A;  1WB0 A;  1GK9 A;  2XAG A;  4B7E A;  4FLW A;  2N87 A;  2ZR5 A;  5HFM A;  1P84 F;  4DV3 B;  1I94 B;  4FN2 A;  1N1A A;  5FPR A;  4ZKI A;  2X6B A;  3JAT B;  3ZMS A;  5EK0 A;  3CCQ V;  1N33 B;  1VQ6 V;  2DYS B;  1B06 A;  3FB6 C;  2CAZ C;  5GW7 A;  1WA8 A;  2WLH A;  4X9Q A;  1E1Q G;  2EBO A;  3SYQ A;  3IJ4 A;  5L3G A;  1AR5 A;  3G71 V;  3H9R B;  1ARO P;  2UXC B;  3WB2 A;  4ZPT R;  3ASN B;  2ETN A;  1RM1 C;  3WL1 A;  3F7Y C;  2VWK A;  2ZR3 A;  1HNX B;  3K5M A;  2F21 A;  1ZBC A;  1FFQ A;  1ZSP A;  5FLX N;  3BAB A;  5EC2 C;  3B9D A;  2LP7 A;  1FAP A;  2DSZ A;  5DO2 A;  2JGU A;  4O4H B;  4O4I A;  3OGI B;  2ZM6 O;  2OIE A;  3VOU A;  4WFE A;  1HNW O;  5GQB A;  4WCE V;  1FS0 G;  1IBL B;  4NYK A;  4GZR B;  1ZTE A;  1WAZ A;  2QKS A;  2JEU A;  4H44 B;  1XL6 A;  5BR8 B;  3DTU B;  4KHP O;  2UXD O;  4Z2G A;  2EIJ C;  1JJO A;  4LFA B;  2CDY A;  3KKY A;  3PRD A;  1D5N A;  2XAJ A;  4H13 B;  4GGQ A;  1ORQ C;  3HKE B;  5CMU A;  4YHH O;  2UXN A;  3LNM B;  2OYQ A;  5B1A B;  1OCC C;  3AG1 B;  2KGJ A;  3DXR B;  5IY5 C;  5JWP A;  3GTY X;  1G1X B;  1VF6 A;  1CXZ B;  4YJ2 A;  5CA0 B;  3RYF B;  2ZR6 A;  4MTG A;  3VQW A;  4P8V A;  4FFB B;  1K33 A;  2XP8 A;  3EY6 A;  2ZQU A;  1YXB A;  1GM7 A;  2Q73 A;  2Q67 A;  4DR1 O;  2DPE A;  3JD1 A;  2CE4 A;  1J4R A;  3AG4 B;  1W9V A;  1OCR C;  4QZV B;  3IKD A;  2XP4 A;  4AI8 A;  1GH6 A;  3E2E A;  4DV1 O;  4DRH A;  1FKA O;  4DV7 O;  4I9W A;  4DXW A;  3JCZ A;  4U3J B;  3APO A;  1H8E G;  1QHT A;  1L1P A;  1GPF A;  2B5U A;  1URF A;  3TXQ A;  4DR6 B;  5LBQ A;  1PBK A;  2QM7 A;  3O5O A;  2RUC A;  2XHB A;  5K1P A;  5LP6 A;  1ZBK A;  2QWR B;  1V54 C;  3TCZ A;  2LJ2 A;  4FM2 A;  2GUZ A;  1IBK B;  1R6N A;  5GPR A;  1P7B A;  2W6J G;  4DR3 O;  2L2S A;  2UXB B;  3A2F A;  1I5X A;  5CBG A;  4J9Y B;  5HUA A;  1DK1 A;  4DUY B;  1K9M W;  2ZIO A;  1KEC A;  4JV5 O;  1ROT A;  3CHE A;  4PTM A;  1YEW A;  1LL7 A;  1I0H A;  1J6Y A;  4NXN O;  3H9V A;  2JGD B;  3SYP A;  3B40 A;  1KMI Z;  2BTO A;  3JCU Z;  2GBO A;  3OUS A;  5GON B;  1XNR B;  5IT9 N;  3PRA A;  2W0F C;  4MAV A;  3AG2 B;  4P2Z A;  4UCU A;  3RYC A;  4FM1 A;  4CH5 A;  2QSA A;  3OOB A;  1JX9 A;  2BOB C;  4W5U A;  3CHF A;  1SKV A;  1FPO A;  4LWS B;  2Y69 B;  3ZHU A;  3LDE A;  1OV9 A;  4I5S A;  4IGG A;  1MG1 A;  3JAT A;  1QZ2 A;  5IYB O;  1SQB H;  2RMK B;  3RVY A;  1BMF G;  4J11 A;  3JSN A;  2YXH A;  4PDV A;  1F40 A;  1P4R A;  4XDJ A;  4BR6 A;  2WLY A;  4MTV A;  3SPG A;  3K08 A;  4UVB A;  4PHZ A;  3FYE B;  4P8W A;  5BXJ A;  1LJY A;  3F5W C;  4JI7 B;  4DR5 O;  1HR0 B;  1H2N A;  2Y78 A;  3JAR B;  3L74 H;  2DT2 A;  2XOK G;  1HP8 A;  2QWP B;  4GX0 A;  1EFR G;  5LGN A;  4BW5 A;  4HAR A;  1XOU A;  3ETQ A;  2PV2 A;  1S77 D;  1DF4 A;  4CH6 A;  3ZED A;  4O4H A;  2R9R B;  1Z5V A;  3WKZ A;  1ZL1 A;  1VF6 C;  3WD1 A;  3UF8 A;  5J2T B;  3EXA A;  1AIL A;  5CA1 A;  3CJH B;  1FXV A;  4FZ1 A;  1O6I A;  3APQ A;  2E75 B;  5IJ0 B;  4IIJ B;  1G8M A;  4PA4 A;  5L3C A;  4MNJ A;  1W1Y A;  3ZN1 A;  1CEZ A;  2CGO A;  3W7U A;  2CUG A;  2P06 A;  4K3A A;  1JA8 A;  5KA5 A;  1N32 B;  2YBT A;  1S5J A; 
#chains in the Genus database with same CATH homology
 3KZ7 A;  1D7J A;  2M1I A;  2LJ4 A;  3UQB A;  5HWC A;  2WK2 A;  3B09 A;  1Q6H A;  4ODP A;  3UQI A;  1J4H A;  2DSV A;  1KT0 A;  4JFM A;  2M08 A;  3O5F A;  4O2T A;  4S3K A;  5HBF A;  2RUR A;  1LG2 A;  4MSP A;  3AQU A;  2ESC A;  1ITX A;  3G6L A;  3RGC A;  3KAF A;  3B7X A;  4ML4 A;  3KAG A;  4IPX A;  1M5Y A;  1ROU A;  3RM9 A;  3ARZ A;  2M2A A;  1E6R A;  3CGN A;  2D9F A;  4DIP A;  3WD3 A;  1A7X A;  4WKA A;  1E6P A;  2PBC A;  4LAV A;  1Q6U A;  3NTP A;  4DRM A;  1WNO A;  4ITZ A;  4ODN A;  2YBU A;  1QPF A;  1D7I A;  2LKN A;  1RD6 A;  1GUV A;  2XP5 A;  1FKH A;  4U85 A;  4R0X A;  1FKD A;  1FKS A;  3ARV A;  1OGB A;  3G6M A;  3WH0 A;  3ARU A;  1XHG A;  2RSE A;  2AOS A;  3WIJ A;  2ITK A;  3RME A;  4NSB A;  4C02 B;  3UI5 A;  1JVW A;  1X6L A;  4DRK A;  1P5Q A;  1FKK A;  2FKE A;  3QOK A;  1YW5 A;  1NMW A;  2PPN A;  1KT1 A;  2O92 A;  1F8A B;  2LPV A;  4JFL A;  1JNE A;  4S3J A;  3KAB A;  4MNK A;  3AS0 A;  4KQZ A;  3NI6 A;  2O9O A;  2B31 A;  5I98 A;  5JH8 A;  3O5M A;  1GOI A;  1FKT A;  2MLY A;  3O5L A;  2PV3 A;  4Z2I A;  1SYT A;  2XPB A;  4DWS C;  2G41 A;  2ZQS A;  1FKF A;  2MLZ A;  1LQ0 A;  4TW7 A;  2A3E A;  4ODR A;  2DT1 A;  4MPK A;  3O5D A;  3GPK A;  1FKR A;  2WLZ A;  3IHZ A;  4ODO A;  3CHD A;  4ZPV R;  5DIV A;  3PR9 A;  5HWB A;  2OLH A;  3O5G A;  4DRQ A;  3O5I A;  1Q6I A;  1HJW A;  1EIB A;  2A3C A;  3FY1 A;  4N19 A;  1ZCN A;  4WKH A;  5HW8 A;  4DH0 A;  4DWS B;  1UR8 A;  4GIV A;  4WKF A;  3WQW A;  1WAW A;  3WD4 A;  1Y0O A;  3CGM A;  3MDY B;  4DRN A;  3O5P A;  3RFW A;  5DEZ A;  4TYO A;  3RM4 A;  3WL0 A;  2RQS A;  3WD2 A;  3TC5 A;  1FFR A;  1OGG A;  4JFK A;  2KE0 A;  4URI A;  1KFW A;  4WJX A;  1NWT A;  1ZB5 A;  3JYM A;  4DZ3 A;  3B9E A;  3ARP A;  3JYJ A;  1HJV A;  1FD9 A;  2KO7 A;  1HKJ A;  2ZQT A;  3UI6 A;  4DT4 A;  5D75 A;  4W9Q A;  1NWS A;  1H0G A;  4DRJ A;  4QT2 A;  1NSG A;  1HKI A;  3B9A A;  3CZ8 A;  2MLX A;  2XP7 A;  1XRV A;  2KI3 A;  3ARW A;  2XP3 A;  3KAH A;  3ARS A;  1CTN A;  3OA5 A;  1HKM A;  3UQA A;  3PRB A;  1W1T A;  4DRP A;  1EDQ A;  3ALF A;  4JYS A;  1VF8 A;  5DIT A;  2FDM A;  4BF8 A;  2MNT A;  4LAW A;  3KCE A;  2XP9 A;  5DIU A;  4IT6 A;  3VAW A;  4Z2L A;  1J4I A;  3ART A;  3O5J A;  1ZU8 A;  4XAK A;  1ZBV A;  3WQV A;  2AWG A;  2Q5A A;  2F2D A;  3AS1 A;  1BKF A;  1C9H A;  1E6Z A;  2PV1 A;  4MNM A;  1WB0 A;  2N87 A;  2ZR5 A;  3WD0 A;  1U79 A;  3AS2 A;  4LAY A;  1JNS A;  1B6C A;  3TDB A;  4FN2 A;  5HW7 A;  1HXV A;  1N1A A;  2DG4 A;  1LG1 A;  4ZPW R;  4P8U A;  1E6N A;  1YAT A;  3H9R B;  3IK8 A;  1JND A;  4MNL A;  1NH6 A;  3ARX A;  4ZPT R;  5B8I C;  3WL1 A;  1E9L A;  2F21 A;  5HTG A;  1ZBC A;  1FFQ A;  3W4R A;  4DRO A;  3B9D A;  4WIW A;  1FAP A;  4AY1 A;  2DSZ A;  2KFW A;  2MPH A;  1TCO C;  5DO2 A;  2FAP A;  2XP6 A;  3ARQ A;  5GQB A;  1FKJ A;  3CH9 A;  4TW6 A;  4IQ2 A;  1W9P A;  1EYM A;  4TW8 A;  1NWR A;  1EQ3 A;  5HW6 A;  4ODM A;  4JFI A;  4Z2H A;  2DT0 A;  1IX5 A;  1FKL A;  1LL4 A;  4Z2G A;  1ZK6 A;  2A3B A;  3PRD A;  1LL6 A;  4GGQ A;  4ODQ A;  4LGX A;  1T11 A;  4ODK A;  3I6C A;  2KGJ A;  1W9U A;  5HKG A;  2LGO A;  4HBE A;  4Q22 A;  2ZR6 A;  1JNT A;  4P8V A;  2XP8 A;  3EY6 A;  4FAP A;  2WM0 A;  2ZQU A;  2ZR4 A;  2K8I A;  2QF8 A;  2IF4 A;  2DPE A;  4P8X A;  1FKB A;  1J4R A;  3ARR A;  1K9T A;  1W9V A;  4QZV B;  4U86 A;  3IKD A;  2XP4 A;  1FKI A;  4U84 A;  3KAI A;  3ARO A;  5J6E A;  3O5R A;  4DRH A;  2VCD A;  4Z2J A;  2KR7 A;  1EHN A;  5DF0 A;  4DZ2 A;  4L72 B;  1L1P A;  5HT1 A;  1GPF A;  2DG3 A;  4L3N A;  1Q1C A;  2RUQ A;  1PBK A;  3NRK A;  3O5O A;  4W9O A;  1D7H A;  2RUC A;  4DWS D;  1BL4 A;  4NNR A;  1PIN A;  1ZBK A;  1HKK A;  1FKG A;  3TCZ A;  5GPR A;  4R5E A;  2XPA A;  3O5K A;  2L2S A;  2G8Z A;  4G50 A;  3KAD A;  3O5E A;  2JZV A;  4QT3 A;  3O5Q A;  5HUA A;  2UZ5 A;  1W26 A;  2F4E A;  4PTM A;  3CHE A;  1ROT A;  2DT3 A;  3FXY A;  1LL7 A;  1J6Y A;  1FJD A;  4HBO A;  3ARY A;  3PRA A;  4MAV A;  3BXW A;  3JXV A;  3CHC A;  4KR0 B;  1X6N A;  3LUO A;  5GPG A;  1D6O A;  1W1V A;  3OOB A;  2IUZ A;  1SR0 A;  4W5U A;  4MGV A;  3CHF A;  4ODL A;  1H0I A;  2VN1 A;  3FAP A;  1R9H A;  2RUD A;  1OWQ A;  2DG9 A;  2ZQV A;  1NMV A;  1QZ2 A;  4DRI A;  1UR9 A;  3RM8 A;  3UI4 A;  1F40 A;  1ZBW A;  2WLY A;  4MTV A;  3ALG A;  4ZS6 A;  4Z2K A;  1HJX A;  4P8W A;  4NZC A;  5BXJ A;  1LJY A;  1NWU A;  2PI6 A;  2Y78 A;  4J4O A;  2DT2 A;  1D2K A;  1W1P A;  4LAX A;  4TNS A;  4TX0 A;  4WK9 A;  4QIB A;  4HAR A;  3KAC A;  4Q7N A;  2PV2 A;  1TFV A;  4IQC A;  3IKG A;  4G2P A;  1QPL A;  2A3A A;  3WKZ A;  1ZL1 A;  2MF9 A;  2DSU A;  3WD1 A;  3UF8 A;  3ODK A;  1O6I A;  3AS3 A;  4IT4 A;  4MNJ A;  1W1Y A;  4W9P A;  4JFJ A;  4DWS A;  2OFN A;  2DSW A;  3PA7 A;  3B8S A;  1E15 A;  4J4N A;  2PPP A;  2YBT A;  2PPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...