1Q6HA

Crystal structure of a truncated form of fkpa from escherichia coli
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
210
structure length
210
Chain Sequence
AFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase fkpA
publication title Structural and functional studies of FkpA from Escherichia coli, a cis/trans peptidyl-prolyl isomerase with chaperone activity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 69
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2003-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF01346 FKBP_N Domain amino terminal to FKBP-type peptidyl-prolyl isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.460 Mainly Alpha Orthogonal Bundle Helix Hairpins Peptidyl-prolyl cis-trans isomerase, FKBP-type, N-terminal domain 1q6hA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1q6hA02
1D7HA 2PBCA 3GPKA 5J6EA 5I98A 4NNRA 1Q6IA 1P5QA 4ODRA 1D7IA 2Y78A 3KADA 1U79A 1ROUA 3IHZA 4G50A 5HUAA 1PINA 1FKLA 3IKGA 2FKEA 4R0XA 1TCOC 1J4HA 2RUCA 1FKSA 4DIPA 1NMVA 4ODNA 1D7JA 2K8IA 1ZCNA 3KAIA 4GGQA 4ODKA 1L1PA 1HXVA 1JVWA 2ZQUA 2F21A 1ZK6A 2RUQA 1FKRA 3ODKA 2MLZA 1EYMA 3TCZA 2PPPA 3JYJA 4O2TA 2RURA 3TDBA 4DRHA 2AWGA 3H9RB 1QZ2A 3MDYB 2KI3A 4JFKA 4ODQA 3TC5A 1W26A 2MLXA 2XP5A 5HKGA 2OFNA 2XP9A 1FAPA 2ZR4A 3O5MA 3O5QA 1FKIA 2M08A 4G2PA 4JFJA 3O5EA 2ZR6A 4GIVA 1QPFA 3KAFA 3O5RA 4TX0A 3RGCA 5HW6A 2DG9A 2MF9A 2MPHA 2PPNA 4LAWA 5B8IC 3NI6A 5HT1A 4DH0A 4TW6A 1JNSA 3OOBA 2M1IA 2ZQVA 5D75A 3B09A 4J4OA 5HW7A 2XP3A 4IQ2A 1KT1A 1FKJA 2KE0A 2XP6A 3I6CA 4FN2A 3KAHA 1FKHA 1FKGA 4IPXA 2ZR5A 1T11A 4DRNA 4J4NA 3O5GA 4LAYA 2DG4A 1NSGA 2DG3A 4ITZA 1Q1CA 5HWBA 3JYMA 3O5KA 5HTGA 3UQAA 4DRJA 2KO7A 1M5YA 3IK8A 2RUDA 2XP7A 4DZ3A 1FJDA 3O5FA 4U86A 3KACA 1N1AA 2MNTA 4DT4A 2MLYA 4U84A 2Q5AA 3RFWA 2IF4A 4TNSA 3UI6A 4W9OA 1YATA 2F4EA 1FKDA 1FKFA 4ODOA 4ODPA 4DRMA 5DIUA 3KAGA 1NMWA 2PV1A 4U85A 5GPGA 1C9HA 2LKNA 1J4RA 1PBKA 3PA7A 2LGOA 2RQSA 1KT0A 4C02B 3O5JA 3PRDA 1FKBA 2XP8A 2LJ4A 3KABA 3NRKA 2ITKA 3O5OA 4LAVA 1J6YA 3UQBA 2KGJA 3UQIA 1QPLA 4MGVA 1Y0OA 4W9PA 2FAPA 2LPVA 2D9FA 5DITA 3WH0A 1FKTA 1ROTA 1YW5A 2M2AA 2ZQSA 4JFLA 4MSPA 3FAPA 1Q6HA 1J4IA 4JFMA 4ODMA 3LUOA 4QT3A 4DRKA 2XPAA 4TW8A 2KR7A 4IQCA 4ODLA 2VN1A 5BXJA 2PV2A 3VAWA 2UZ5A 2JZVA 3O5LA 5HWCA 3O5PA 2L2SA 1R9HA 3IKDA 2XPBA 5DIVA 4W9QA 3UF8A 3PRBA 1A7XA 2N87A 3CGNA 4QIBA 1FD9A 3O5DA 3UI5A 4TYOA 2PPOA 3B7XA 4QT2A 4FAPA 3CGMA 4DRIA 4BF8A 3O5IA 2PV3A 4JFIA 3KZ7A 2XP4A 3JXVA 4LAXA 3EY6A 1EQ3A 1Q6UA 1BKFA 1B6CA 4JYSA 1BL4A 4TW7A 2ZQTA 1FKKA 4DRQA 4DZ2A 4N19A 5HW8A 2VCDA 1JNTA 3KCEA 4DRPA 3UI4A 2RSEA 1F8AB 1F40A 4DROA 1D6OA 3NTPA 2F2DA 2KFWA
chains in the Genus database with same CATH superfamily
4HBOA 1W59A 1RSOA 1MZFA 2FMLA 4PA6A 3ML0A 2OT5A 4LH7A 1NJIW 1OCOC 2QJ1A 5IJ9B 3IKGA 1W1PA 2JGUA 5L3DA 2YXHA 4WKAA 3LDDA 1L0LH 1FKSA 1D7JA 1NU1H 3DC6A 4JI0O 5KHKA 4DUZO 1KECA 2PUSA 4KXRA 3ARUA 2IU0A 3RYFB 1AR5A 3JYJA 2NN4A 2QM7A 3CJHA 2OWOA 5GPRA 4JI3B 3MD0A 2MLXA 3G6LA 1P7BA 2YUAA 3RM9A 2A9HA 3ZHSA 3K06A 1NVPD 1R3IC 3ZMZA 4RAIA 3CPWU 2DYRB 3IC9A 2ZE5A 2RN9A 5EZYA 4DR6B 3WB1A 4LF5O 2EZOA 3LNMB 2ETNA 1K9MW 1K3EA 3IFXA 1A32A 5EK0A 2A3AA 2XP6A 1PV0A 4UCOA 1R1BA 2CTRA 3SJQC 3SYPA 1XMOB 1IURA 4WFGA 1UJWB 3CX5F 4X8AA 1XMQB 1IBMB 4IHJA 5HWBA 1I94O 1M5YA 2WLMA 1MG1A 2XP7A 5K1XA 2P5OA 3CZ8A 1FJDA 3O5FA 4L8JA 1JA8A 3B4SA 3CH9A 4CS2A 2ODMA 5LHGA 1V55C 1AROP 4ODPA 1OCCB 4UFZA 4PDVA 3ZCCA 4BIOA 1J4RA 1OCZC 4DUYB 2ZIMA 4JV5B 4DYLA 3G6EV 1NZ6A 1Q8IA 3RGBA 5IT9N 4KL1A 3ARZA 1FKTA 1KUQA 4GX2A 5IJ9A 1XRVA 2QE7G 4FM0A 1JJOA 2LW1A 4TUYB 1YTFD 2L2SA 2ZR3A 4DR3B 1AI6A 1BL8A 1M5IA 1LUWA 3ABKC 3CWBH 3RYFA 3CGNA 3D36C 3STZC 2AW9A 2OIGA 3CCVV 5LMUB 2IJIA 1ZUQA 3EFFK 2B1GA 2DQ0A 3ZRWB 1KYOF 4X66O 2EBOA 2WLJA 1Q6IA 1KP2A 2UXNA 5J6EA 1K34A 2A3EA 4OGQB 2QA4V 1KC8W 2XAHA 3W7XA 4WF9V 4JI5O 4X9QA 1HXVA 1SERA 3PR9A 1XL6A 4LFAB 1E6RA 2Q9LA 2BTQB 4NXNB 2ZNJA 3AG1B 4GKKB 2HJFC 3CXHF 1NH6A 1NWUA 3TC5A 3BA9A 2HVJC 2LJ2A 3OGCC 3CHXA 2F43G 4R8CA 1QVFU 1GN3A 3K3WA 4R7CA 4WFAV 1SS3A 3GB7C 4FJCC 4PHZA 4Z2WA 5BMVB 4B3TB 4HBNA 3JD3A 2WLZA 1O9GA 4LNUB 2EJ7A 1GM7A 1THZA 3CYOA 2WSSG 2YS8A 3LNNA 2DJVA 1GO3F 1E1QG 4TT3G 3BEHA 3A0HZ 4NTYA 4DV6O 1Q43A 3K59A 1M90W 1N32B 1PNKA 3ALGA 3CEIA 2Z5UA 2UUBO 1F51A 5J9PC 3U11A 1HKMA 5FPRA 1RFYA 2CTPA 4G27B 1LUVA 3UQAA 4O4HB 1UFIA 2V1DA 2D3OW 3ARYA 4ZPWR 4Q22A 4JTDB 1R3KC 4TNSA 5KHHA 4YY3O 2Y0IA 3CMEV 1AI5A 4JYAB 4BAYA 4DR4B 4B7EA 1R6TA 1JOYA 1ZBCA 2LKNA 1P84F 3ZRWA 3AG3C 4DO2A 1CXZB 1QHTA 3VQYA 1FS0G 4W9PA 2FAPA 4ZI7B 1Q82W 1E6PA 1YZBA 4TQDA 4ZHQB 3FB8C 2UZ5A 4CC6A 4LF4O 4WJXA 4FLVA 4KQZA 1M93A 1VQMV 1VQ9V 2BTQA 3W7SA 3P3PA 2QEXV 3DGEA 2AHYA 4LAXA 5CN0A 1KQSU 1J5EB 3HKDB 2VCDA 3SPIA 3T4ZA 3JD2A 3UI4A 3OMIB 1VQOV 3APQA 4MPKA 1D7HA 1JMKC 2UXBB 1D7IA 2Y78A 4B3SO 2DMXA 2OIEA 5B3SC 2XT9A 1Q81W 2MK3A 1VQKV 1WP7A 1Y76A 4O4HA 4IL6Z 4LFCB 1W26A 1VF5B 1HNZO 2KKWA 2QWPB 4DV3O 4H33A 3FX7A 4JFJA 1P49A 4MVOA 2MF9A 2MPHA 4RQEA 4MTXA 4EFBA 3RWRD 2P4KA 1WB8A 4JZ2A 3AG4C 3CD6V 3OEEG 5JH7A 4ZI7A 4E2LA 4DV7B 1H2MA 1VQ5V 1GMGA 1WA8B 3PJSK 4ZHQA 2EIKC 2QF8A 1NR7A 3Q4HA 4EKWA 1N4CA 1PNMA 1NVPB 3ZRXA 3VOUA 2GTSA 2MNTA 4JGSA 1OV9A 2QKAA 3T1YB 2YXLA 2JDIG 3CRQA 2WLNA 5L3EA 3HKDA 5DIUA 4GCZA 2LGOA 2CH7B 4X62O 1SZTA 1QPLA 3CRMA 1QLEC 1H2GA 3T4DA 4FZ1A 3GWOA 2PI4A 3F5WC 3LUOA 1XQ8A 4DXWA 1HP8A 1VQPV 1BCCH 2XPBA 2X6CA 2Q67A 4Z1MG 4FAPA 3TXQA 1EZVH 1SR0A 5DF0A 4KFMA 4X20A 2HFEC 1Q6UA 4NXMB 4P9PA 1NT2B 5JQGA 5IE9A 4P8XA 4E4EA 1K4CC 3UT5B 3HKCA 2WA4A 1K8AW 1YTFB 5IYCO 3WU2Z 3ETGA 1GM9A 3OFNG 2HVKC 2FKEA 5EBMC 1TCOC 1IZ3A 3RM8A 5DEDA 2EINB 1WPXA 4UVAA 2E5LO 2F21A 2ZE7A 2VWKA 1ZK6A 1WA8A 3C3SA 3RVYA 4ZPVR 4GZRB 1Z2GA 1BE3H 3H1LH 1JJ2U 5IYZB 4LP8A 3E89A 1WNSA 2JK5C 5FLXN 1IBLB 3HKEB 4MTFA 1HR0O 3B8MA 4G2PA 4BWAA 2YEVB 4GIVA 1K9TA 3WL1A 3ZN0A 5CBHA 2EULA 2MW2B 4GX0A 4MS2A 4AHCA 3J81N 4U3JA 4I9WA 2CH7A 2PTMA 5HW7A 3WD4A 1JCHB 3G4SV 1S5LZ 1NWRA 1LNQA 1NSGA 3OTFA 1X59A 3BXWA 2DSZA 3OAAG 4X1IB 2B1IA 4DZ3A 4MVRA 1M1KW 4UCVA 5IDJA 3CHDA 4DT4A 2F95B 2CTWA 1LQ0A 3R65A 2F1MA 4N23A 1HKIA 1I94B 4DV0B 4JAAA 3HB3B 1AVMA 2PV1A 5LL6Y 3FAVB 4C02B 1SQQH 1DK1A 1S5HC 3NRKA 3SJCC 1BHBA 2QWOB 4UB8Z 2HKOA 3L72H 2OCCB 1IXBA 1NWSA 3K9AA 1W9UA 2ZR2A 3J80N 2XPAA 3CC2V 5KUMA 3E2EA 1N8RW 2UU9B 2YC0A 1OWQA 1R9HA 3BRCA 4P9OA 4X64B 1VF8A 4LF6O 1Q86W 3O5DA 1Q3EA 5IYZA 3W7UA 4MW3A 2Q0AA 4DV5B 2NNUA 2PI5A 1SQFA 1AJPA 3OM3B 4UCRA 4D6TH 2Z3YA 1BSMA 2YEVA 4DRPA 2R70A 3QF7A 3FYIB 3VQXA 1U96A 1D6OA 3N2GB 1XL4A 4TQFA 5B5EZ 2WK2A 1FXKB 5AG2A 3TCUA 1JCHA 1ZL8A 4H13B 3LSSA 4K3AA 5KX5B 3FB6C 3CRAA 3RW0A 3UM7A 2XOKG 4DK1A 2Q6AA 4X1IA 2X0LA 3VBBA 2HLDG 4Q7NA 3WIJA 4UCSA 4UV8A 3F7VC 2YDEA 2UXXA 2WLIB 2GHYA 4QNHB 1H2NA 4W5UA 1HNXB 4PDLA 4WFHA 4DH0A 2UUAO 3H1KH 2ZQVA 1WAZA 4BIZA 3FXYA 3JD1A 3I6CA 5DO2A 4DV2B 3M7MX 4MW8A 1R6NA 2ZR5A 3CCQV 3ZRSA 1YDXA 1VF6C 2A79B 4LC1A 3RT3C 1SZXA 1YIJV 4S3KA 3JYMA 3WD0A 4YJ2B 1IXMA 4JI2O 4FIPC 4DV6B 4QGPA 2RJZA 4LF7B 3ZEDA 1PNLA 4U7NA 3CCMV 1AR1B 2B31A 2UUBB 4J42A 1W9VA 1GH6A 3J7AU 1N34O 2CDYA 2OCHA 4UVCA 5K1PA 3BY6A 5GPGA 2R9RB 1C9HA 3DC5A 4B3RB 1N36B 1PKXA 2Q5ZA 3N2GA 1JVMA 4JI7O 1Y0OA 2KQXA 4J9ZB 1H0GA 5JVDB 4GKJB 5KA5A 5IJ0A 4Q20A 1Y67A 3LUTB 4W4KA 3MHHC 5DIVA 2LFRA 1NTZH 2H3OA 3JAKB 4FPPA 5KX5A 4LBEC 3ARRA 1XEQA 3JALB 2XAGA 4ZBMA 4DR2O 4JFIA 3X2QC 1FXKC 4J9YB 4QJFB 3OE7G 4Z1VA 4LF4B 2QR4A 1XOUA 1FKKA 1VQ8V 1G1XB 1VQ4V 3NXSA 1F4NA 5BXZA 3CRRA 3CC4V 1GOIA 4EB6A 2RSEA 2WLIA 1SQBH 1BZKA 3WL0A 1N33B 5GQBA 2DT0A 3E8BA 3MAQA 1OGGA 4ML4A 4WBNA 4DWSD 1V55B 1AJQA 5HUAA 5KLVH 1BMFG 4MNLA 1VQLV 5BR8O 1K97A 4JI8B 1VQ6V 1OCZB 1NWTA 5H6RA 2RUQA 4FLUA 3ODKA 3JASA 1GKFA 3A0BZ 1ZBWA 1HJWA 1PM9A 2IBZH 3MDSA 2GBOA 1XILA 3OMAB 1FAPA 2FKXA 3ABKB 1SESA 4K0KO 3QO5A 1FJGO 1OCRC 3MHSC 2R9IA 1M57C 3OOBA 4ASUG 3OW2U 1Y74A 2XUMA 4DV4O 4FN2A 2GUZB 4DW1A 4IPXA 5JVDA 1SQVH 3JCZA 3K5MA 3ZBHA 3JAKA 3AEIA 4BIUA 1ZAUA 3ZS8C 4YHHB 3JALA 4U84A 4I7ZB 2LFSA 3I56V 5B1BB 4NYKA 1I0HA 1YF2A 4AI8A 2HHHO 2X6AA 5DITA 3WH0A 2IJHA 2M2AA 4MSPA 2CK3G 1HNWO 4DRKA 5CB4A 3FB5C 4LR3A 1LG2A 3S3WA 1W1YA 3OR6C 1F23A 3ARTA 2B5UB 2YIBD 5CBGA 1FFQA 2XAQA 3RM4A 3U0ZA 2Q7HA 3JSNA 5IYBO 2QKSA 1BQ0A 1H0IA 1IDSA 4TW7A 3UCSC 2ZCEA 1LL6A 2KSDA 4DROA 4DR1O 1EN6A 3D36A 1HJXA 4EFEA 1XHZA 3JAWB 5JH8A 3E22B 2X7RB 2Q73A 2F4VO 4I50B 5LGTA 2ZE8A 3KAIA 1K4DC 3AG3B 2ZQUA 1XUQA 2GUZA 1EYMA 3K5NA 3GTYX 2OTJV 2VQEO 2ZM6O 3KKYA 5EBWC 1IBKB 2GTAA 4ODQA 3HR0A 4LFBO 1PL0A 2E76B 2XP9A 2M08A 1ZLZA 1WJZA 1U97A 4MNKA 3N27A 1ZX3A 1TAEA 1ROPA 1JNDA 1V54B 3OTOO 5GTIZ 1FFTB 1HWYA 5HT1A 4PV1B 1GRJA 5J2UB 3LSUA 1D5NA 5B1BC 4HARA 3AK1A 5DEZA 3DXRB 3RN4A 1S72V 4ITZA 3RFRA 2X6BA 3ZMUA 3K79A 3IK8A 5EC1C 4HNAB 5KAIZ 2R72A 1E9LA 4LF8O 2H8PC 5C8YB 2B5UA 1YCIA 4NZCA 5B3SB 3KACA 4U86A 2AZ0A 2IM9A 4W9OA 2F4EA 5C93A 2ZDIC 3FYEB 1FKFA 2WWWA 1WB0A 4I0XB 3CHEA 1NTKH 3DTUB 2H94A 2ZQMA 3CHCA 2RQSA 1KT0A 3GU0A 2YIAA 2ITKA 3QTCA 2UUCO 2LPVA 3TETA 4WKHA 4TUYA 3E22A 3FAPA 3ZMSA 4JI1B 1KKDA 2VN1A 4I50A 5CA1B 1XNRB 2FDMA 4JASA 3AG4B 2R9AA 4MTOA 5FL7G 1OZ0A 4QT2A 1WP8A 4HBEA 4BF8A 4FFBB 4FZ0A 1S0VA 2PV3A 1NH2D 2A3CA 2EIKB 3OEHG 2F23A 4R6ZA 3ASNC 1RP3B 1IVSA 1MA1A 3CB2A 3L73H 2UXCO 2VQFB 3QO7A 4K8XA 2PBCA 3FY1A 4NNRA 5D5QA 4AQYO 4JAVA 3KG2A 2P22C 1PINA 5J2UA 4ODNA 1H2LA 2DQ3A 2Y4TA 3AS2A 4JYBA 1P4RA 4D7TA 2MLZA 1V54C 2LP7A 1WPBA 2JJ2G 1M4UA 3DXRA 4O2TA 1QLEB 4MVQA 1S5JA 2CE4A 1H2SB 4NVPA 4OX9O 2A0LA 3WB0A 2P67A 4DK0A 4GUNA 5GTHZ 1EN5A 1G8MA 5C8YA 3L74H 5BMVA 5HKGA 2YIDA 2JJ1G 4LNUA 5L3CA 5H2FZ 5H5NA 2HG5C 1EBOA 3K5LA 4MVMA 4NB5A 4XAKA 3HPLC 5IYDO 4P8VA 3ABLB 3B9AA 1SRYA 2O92A 4QPJA 1FXHA 1YI2V 2M1IA 3LSQA 3B09A 3L9DA 2WPDG 4RQFA 1H8EG 4IQ2A 4L3NA 2VS0A 1AR4A 1XI1A 1TUBB 5E79Z 1M9NA 1LR1A 5CA1A 4LAYA 2YI8A 4MSWC 5KHGA 5LYJB 2QM8A 4NTWA 2ZKOA 1E6NA 2EX3A 4FFBA 2A7WA 5JWPA 2IW5A 3GVMA 4KHPB 1LL7A 4GLXA 4JI2B 1CPYA 1ZTEA 2BSKB 1XREA 5IWAB 1W1VA 3KABA 4LAVA 3EHBB 1VIBA 3ZHRA 4YIOA 4CH4A 1BQZA 1N34B 2ZQSA 5TISZ 3W7TA 3RYCB 4JFMA 3L75H 1US6A 2KR7A 4ODLA 4F6RB 4DW0A 3AS3A 4WIWA 5LOVB 1D2KA 2JS5A 4JI7B 1AI7A 2IU3A 3UF8A 4JI3O 3KCXA 4QIBA 4B3MB 4CH6A 1W0JG 2LGQA 2Y4UA 5F2VO 4TV8B 1KBHA 3G67A 1YITV 2XHBA 3H01A 4JYSA 3LDEA 2DSUA 4DZ2A 4N19A 2JS3A 1LL4A 1L1FA 3NTPA 3UQBA 3O5QA 4ICGA 1PL4A 4YXWG 1W0KG 1XMOO 1ROUA 1Y4MA 1FKLA 3KZIZ 1I7FA 4DV1B 1XMQO 1IBMO 1ZCNA 5LMNB 4DWSC 5LP6C 1L1PA 1JVWA 1TUBA 4J11A 2PPPA 4I4TB 3CCSV 3ABLC 3WQWA 3G6BA 5LYJA 1QLNA 2Y69C 4JFKA 4MNMA 3O9OA 1FKIA 3L71H 3D3QA 4ABMA 3JYCA 4DUYO 4LF9B 5EBLC 4JV5O 1UR8A 4DR7B 4KUMA 3DSQA 2EZPA 2PPNA 3WD2A 2DE0X 2JEXA 3A0RA 3EXAA 2IH1C 4K0KB 5KUKA 3RYCA 5L3GA 3ETQA 4DR3O 3T2MA 1S3JA 2BOBC 1FJGB 3CHFA 4GYCB 1URFA 4F6RA 2HJDA 1OJHA 4PD4F 1WAWA 4PA9A 5LOVA 2P6JA 3K5OA 4DUZB 4JI0B 3U10A 2P90A 3E8FA 3QOKA 3ARXA 5CA0B 1BHAA 2QWQB 1K7DA 5LMUO 3EIPA 2IJKA 3SJBC 5BY1A 2IF4A 4TV8A 3BAAA 4G28B 1FKDA 2BE3A 5DN6G 2O9OA 4Z2GA 4PJ0Z 2XP8A 1SQPH 4CBCA 4OPAA 2DN9A 5HWCA 1H8HG 4CS4A 4LF5B 1VMGA 4DRXB 4R50A 1EIBA 2BTOA 3ZJZA 4LFAO 4TSFG 4J7KA 1SF9A 4NXNO 2HHHB 2YXYA 4I4TA 3QVNA 1OHHG 4F4LA 1SA0B 1GM8A 1SQGA 4B3TO 4WK9A 5B66Z 1EQ3A 1SYTA 3SYCA 3TK1A 3UT5A 4WFFA 5HW8A 3KCEA 3ETDA 4G2KA 2FYUH 2RDCA 4IIJB 1P5QA 1N32O 4H37A 4PI2A 2ZIOA 1M56C 3JARB 1N0JA 2ZE6A 2RQ6A 4U3FH 2ESCA 4DR1B 4LCUC 5GONB 1L8DA 2EIMC 3UKMA 1EM1A 2Q68A 1VQNV 4DRHA 5KHJA 4GX1A 3HKEA 3H9RB 2PYLA 2LO1A 2NR5A 5CA0A 4I55B 2YBUA 4JYAO 4R5EA 4DR4O 2DT2A 1RM1B 1XHXA 2Q0OC 4Q6GA 4JYYA 2DG9A 2M7WA 2YICA 4JTAB 3X2QB 4LAWA 3UO3A 4ZS6A 4X66B 1GTOA 2QKCA 4XDJA 2XP3A 1QCEA 2AXTZ 2QDOA 3IGAC 1FPOA 2HP8A 4DRXA 3SPGA 1KD1W 1T11A 1EFRG 4FVMA 3O5GA 1TFVA 4JI5B 4X1YB 1N0NA 1I5YA 2DYSC 2A3BA 2ADQB 1VF6A 3FAVA 1DF4A 3ZHQA 2CGOA 2UXBO 4I9QA 3CCUV 3WQVA 3JSLA 1Z5WA 3BCCH 3AROA 1FKBA 2VWJA 2A3QA 1B04A 3PN1A 1I08A 5B1AB 1IX5A 3K08A 3S3XA 1ROTA 3AK3A 5LHHA 4ODMA 3H1IH 3QG5A 1UR9A 1P7GA 1OCRB 1NQTA 1D5AA 4FK5C 5GONA 1M57B 5B1OA 3B2EE 4W9QA 1MSWD 3G6MA 3AG2C 3PRBA 1A7XA 4MAVA 2PPOA 1ORQC 4DRIA 2K9PA 4QE9A 1SQXH 3BA8A 3OA5A 4JZGA 3JATB 4GX5A 4I55A 1F4MA 4HZ3A 4OPHA 5JJJB 3E8GA 4DR5O 3K58A 2KB1A 4UXNA 1GN2A 2AZ2A 3KCYA 1HKKA 4YY3B 1X4TA 1FXKA 4DV7O 3R66A 1FYJA 3ETEA 3RVZA 4NR1A 1RSOB 4R0XA 1RM1C 3ARQA 3CE2A 4PDMA 3IC7A 1FKRA 4JI4O 1TVKB 2ARHA 4EEQA 4AQYB 2FL4A 4L87A 4JI6O 3G71V 1EHNA 3RYIB 3T1YO 3CJHB 4BR6A 3RBZA 2CUGA 2VRZA 1KMIZ 1PP9H 2AOSA 3KAFA 3O5RA 1Q7YW 4MTGA 3OD4A 4OX9B 2EILC 3K9SA 4UUJC 3VQWA 4CH5A 3K04A 1PD3A 1ZWIC 4P8UA 3T1HO 4B3SB 4TWKA 1FKHA 4YJ2A 4L72B 3SYOA 2OLHA 4FM2A 2DG3A 5HTGA 1IX9A 4PTMA 2RMKB 1S76D 2P06A 2IUZA 5B1AC 4NXMO 2DOSA 4WFBV 1N1AA 2MLYA 1DF5A 2W0XA 3G80A 1MMMA 3JATA 1HNZB 2QGNA 2EJRA 1YXBA 4DV3B 1E44A 1NMWA 4U85A 4NTXA 1PBKA 2LJ4A 1BS3A 5HFLA 2KGJA 2DWEC 2D9FA 1YW5A 3B9EA 4QT3A 2FTKA 3AS0A 3W7WA 2QM4A 3ZX6A 4P2ZA 1HDJA 2G41A 1TVKA 2IH3C 3M99B 1IBLO 4QE7A 2QTOA 3RYIA 2PYJA 1BKFA 1B6CA 3ALFA 1J95A 4A5UB 4RUFA 1VP7A 3F5TA 1F8AB 2GSMB 5HBFA 2F2DA 1K5SA 5EIBD 4CZZA 3O65A 1X6LA 4UV9A 2EIJC 4X62B 5LBQA 2UXDO 2WLKA 4GGQA 4ODKA 2G8ZA 1JFFB 3TCZA 3SYQA 4K35A 2QSAA 3BABA 2DSVA 1MZEA 1XBLA 4X1KB 4TV9B 3ZN1A 4DV0O 1QU7A 2LW7A 3ICXA 2F66C 2ZR6A 3RGCA 3K0GA 2NLJC 1L0NH 4IT5A 3ASNB 3K57A 4HYOA 4J4OA 3IJ4A 2UU9O 2DT1A 2OYQA 4UDMA 3JAMN 4ZIBA 1XNQO 4IT4A 5CA3A 2Q7GA 1JPXA 4X64O 4FLTA 2E5LB 3A2FA 2V4DA 2ITCC 5GW7A 3CRCA 4JYCA 4DRJA 3ASOB 3BVOA 4DV5O 3WD3A 2E3CA 3RMEA 4TOIA 2Q69A 3SPHA 2ITDC 1Y66A 5D5PA 4XBFA 4HAMA 1RPRA 4H44B 3UQ8A 1HR0B 4ODOA 3FKSG 2CTQA 3PA7A 3O5JA 1DLBA 5DM6V 2HR3A 3OR7C 5IY5B 1S77D 1Q5OA 1J4IA 2JRIA 2ZDIA 4TW8A 1FXVA 3FFQA 4WKFA 3VAWA 2PZSA 1YSCA 2JZVA 3O5LA 3O5PA 4D7SA 1JFFA 2XASA 1GPFA 2E74B 3H1HH 2WLLB 2DYRC 3BFRA 4FMTA 5A9GA 1T5EA 4X1KA 4TV9A 3JCUZ 3OT7A 4O4LB 1MNGA 2ZQTA 1W2BU 1HNXO 4AY1A 4PA3A 1FFXB 2RNBA 3JAWA 3ARWA 3ZMVA 1AP6A 2LGWA 5I98A 1WLEA 4O2BB 4B7KA 5KHIA 4DV2O 4QIWF 5LGNA 2FB5A 1DTOA 2YSUB 3FB7C 1NMVA 5LGUA 4O2AB 3SPJA 3ABMB 3C90A 2GDSA 3CP1A 3ZHUA 4LF7O 1OCCC 2Z0AA 1JNEA 2KI3A 5JJNB 3AS1A 1KKCA 4LF6B 1Y76B 1B3QA 1KP3A 3BMBA 4CS3A 2WAMA 1H2KA 3D8CA 1CTNA 2ZXWB 3BPZA 5KA6A 4PA7A 5LA6B 3TGUH 4B3RO 1HW7A 4FLZA 1N36O 4X65O 1ZBKA 2XAJA 3ASOC 1G6UA 1QBZA 1GAXA 4LH6A 5KMGB 3CC7V 3NI6A 3N2KB 1CEZA 2ZNIA 3APOA 2KG7B 2N74A 4GKJO 3CMAV 3ZRVA 2ATKC 1FKJA 4FLWA 2PGGA 4JPRA 5FNVB 2Q4PA 1FKGA 4ZOLB 5JH7B 4HNAA 4J4NA 5ITZB 1K92A 3THOA 2DG4A 3O5KA 4UVBA 4JF3A 2Y48A 5EYPB 5IY5C 4MVUA 2CAZC 2V7QG 3E35A 3Q4HB 1Z5VA 1FAFA 4DWSB 5LP6B 2WLLA 1QVGU 4UCTA 3ZMTA 2Q5AA 3RFWA 3QNEA 4I0XA 4P30A 1K5QA 4I5SA 4O4LA 1YATA 4Z2LA 1N33O 1VEWA 4DRMA 3SDLA 2Y69B 1FFXA 1OGBA 1CP9A 1D2DA 3O5OA 1J6YA 4IT6A 1R3LC 4JI8O 5H6QA 1RPOA 4O2BA 4O4JB 3NR7A 4RWUA 1Q6HA 2UUAB 3AG1C 1SC5B 4BW5A 2PV2A 4PDRA 2W0FC 4O2AA 3I55V 2DPEA 2DWDC 3UI5A 2JEUA 5BZBA 3CCLV 2CGNA 4QPKA 2ILMA 1HKJA 3K03A 1BL4A 4Z2KA 4X20B 3SGIA 3ABMC 5LA6A 1UPGA 5CMUA 4MNJA 4IYIA 1HJVA 1NS1A 5JQGB 2KFWA 2BOCC 3H9VA 3GPKA 5LXTB 5KMGA 4LWSB 3B8SA 1AJNA 3N2KA 3KADA 1U79A 4DR5B 4G50A 3HKCB 2KG7A 2DSWA 3RYHB 1YHQV 2RUCA 1J4HA 2ZXWC 4IYHA 5LHIA 5FNVA 1K33A 4X88A 4UB6Z 4ZOLA 1NKDA 1JR9A 5ITZA 3B40A 2XAFA 4YHHO 3M8AA 2AWGA 2IJJA 5EYPA 1COWG 3MDYB 4P8WA 4DR6O 1YVWA 2XP5A 4MVSA 4DWSA 5LP6A 4JI4B 2N04A 4DR2B 1YEWA 1GN6A 4JI6B 5HFMA 1QPFA 4TX0A 5HW6A 2PI6A 4FLXA 1ITXA 1G4YB 5B8IC 1EZJA 1GK9A 4FLYA 4J7JA 2ADPA 1JNSA 4UCUA 4U3JB 1R73A 3SYAA 1KT1A 3SPCA 4O4JA 4H0LB 3KAHA 4U7OA 4MVZA 2WLHA 5BR8B 1EDQA 4JAUA 2QWNB 1AB3A 3ZIAG 2PN0A 1NR1A 1M56B 3T1HB 1NTMH 2LQTA 2EIMB 4S3JA 4LGXA 2L6LA 3UI6A 2BSKA 3I5DA 4PELA 1MABG 3TXSA 4RUEA 3WKZA 3CCEV 3OGIB 4FM1A 3GWKC 3P3NA 5LXTA 4LWSA 2B9ZA 2W6IG 4QZVB 3ARPA 3RYHA 5BXJA 1QR8A 1E79G 3E8HA 4DV4B 2QWRB 4N21A 3F7YC 1IBKO 1SKVA 3B7XA 3EVKA 1KB9F 2XP4A 4CH3A 1FFRA 3BHPA 4B08A 2XTAA 3P30A 4DRQA 1YJ9V 3CSXA 1VF7A 1JNTA 4Z2HA 2M6YA 1ZL1A 2DYSB 1W1TA 2PF4E 4ODRA 2YIBA 2F93B 3STLC 5EIBC 4YIPA 4GKKO 4DIPA 1HNWB 1SETA 1TUEB 3ZHVA 1ZL8B 2RURA 3TDBA 1R3JC 4ZPTR 1YJNV 4FFKA 5B1NA 4Z2JA 5L3BA 2UXDB 1O9HA 3D3IA 5JCOA 4O4IB 4J7ZA 2ZR4A 4AILC 5H9CA 3AG2B 2HEPA 4MT8A 3B9DA 3JD4A 2JGDB 3CXCU 4GT1A 3K0DA 1O6IA 3E86A 4OXSA 5JCOC 2RCVA 2ZINA 4JI1O 1NH2B 2GV9A 1XNRO 1JX9A 2KE0A 2BCCH 2P4VA 3H1JH 3TJTA 3L70H 3WFVA 2F4VB 4K8ZA 3ABUA 1XHGA 1R6KA 2KO7A 2RUDA 4KP4A 4PA4A 2VQEB 4C7UA 2ZM6B 2JVDA 5DECA 2W6JG 1XNQB 1MSDA 3ABTA 2QTSA 4LFBB 5A2QN 1E6ZA 3C3TA 2VQFO 4MTVA 3OMNB 1KU9A 1RD6A 1B6QA 3VQVA 1AILA 1LG1A 3KAGA 2EINC 3B77A 1ZBVA 4YJ3B 3UO2A 3OTOB 3LDCA 4JFLA 1QQCA 5JJEB 3A8TA 4NKGB 4IQCA 3HKBB 3AG7A 3E83A 4JTCB 2EILB 2Y0PA 3CS5A 3CCJV 2K1EA 1ZB5A 1ZSPA 3IKDA 5IJ0B 1J5EO 1SA0A 1E15A 1EN4A 1LJYA 2N87A 1FD9A 4TYOA 1E1RG 3ARSA 3CGMA 1V9PA 3O5IA 1TA8A 2P7TC 3KZ7A 4Z2IA 3SJAC 3JXVA 4LF8B 2A06H 3EY6A 4O4IA 1AI4A 4J10A 2YBTA 1VQ7V 3P32A 1H38A 1K73W 1X6NA 4IIJA 3WG7B 3OUSA 1KFWA 1DGSA 1Q90D 2JGDA 2YI9A 4EB6B 3B8NA 3JARA 5CBFA 3IHZA 2ZT9B 3WB2A 4XDKA 4LFCO 4X89A 2WLYA 2UUCB 4WBNB 1GUVA 2K8IA 2DT3A 1XDCA 1ENVA 2G38A 5J2TB 4IGGA 3JASB 5KAFZ 5FPOA 1QZ2A 1PPJH 1FKAO 4KR0B 1F7YA 1OCOB 4KHPO 2OFNA 3W4RA 3O5MA 4CC5A 2O57A 2D2CB 1Y6XA 3FD9A 4PI0A 1ZU8A 3O5EA 2AGAA 5IWAO 2OCCC 1VARA 2C2AA 4J80A 1QR9A 4ZKIA 2UXCB 4TW6A 4YJ3A 2JIZG 5D75A 2PY5A 1TGOA 1QNMA 1WNOA 4X65B 2L35A 3AQUA 3HKBA 4X1YA 1Y74B 4URIA 4B3MO 1WB7A 4NSBA 1B06A 1Q1CA 2EIJB 1WN7A 1GN4A 1BT8A 2E75B 3JD0A 4W4LA 2XNDG 1YJWV 1NBMG 4RO2A 4BW9A 4WCEV 3CCRV 5EZYB 1I5XA 3ZHTA 1NI8A 2OTLV 3PRDA 2Q8VA 4DV1O 5L3FA 3UQIA 4MGVA 2AHZA 4J41A 5LMNO 2WA3A 3T1CA 3SR2C 2DW4A 1JQ0A 1W9PA 3WG7C 4IHJB 2ZD9A 3AK2A 1BGYH 2N05A 5CB4B 4F6EA 3WD1A 1AP5A 2WM0A 3ARVA 2Q7EA 5J2TA 4WFEA 3OUFA 4LF9O 4DR7O 3IAYA 5EC2C 3QO8A 1MOFA 5E1AC 1F40A 4XDLA 3PRAA 4DRNA
chains in the Genus database with same CATH topology
4HBOA 5I98A 2WK2A 1ROUA 1FKLA 3IKGA 1W1PA 4WKAA 1FKSA 1NMVA 1D7JA 1ZCNA 4DWSC 1L1PA 1JVWA 3ARUA 2PPPA 3JYJA 3WQWA 1JNEA 2KI3A 4JFKA 5GPRA 4MNMA 2MLXA 3AS1A 3G6LA 4Q7NA 3RM9A 1FKIA 1CTNA 3WIJA 1UR8A 1ZBKA 4W5UA 2PPNA 3WD2A 3NI6A 4DH0A 2ZQVA 2A3AA 3FXYA 1FKJA 2XP6A 3I6CA 5DO2A 1FKGA 2ZR5A 3CHFA 4J4NA 5HWBA 2DG4A 4S3KA 1WAWA 3JYMA 3O5KA 3WD0A 1M5YA 3QOKA 2XP7A 3ARXA 3CZ8A 1FJDA 3O5FA 4DWSB 2B31A 2Q5AA 3RFWA 1W9VA 2IF4A 3CH9A 1YATA 1FKDA 4Z2LA 4ODPA 4DRMA 5GPGA 1C9HA 1J4RA 1OGBA 2O9OA 4Z2GA 2XP8A 3O5OA 1J6YA 4IT6A 3ARZA 5HWCA 1Y0OA 1FKTA 1Q6HA 1H0GA 1EIBA 1XRVA 2PV2A 2L2SA 2DPEA 5DIVA 3CGNA 3UI5A 3ARRA 4JFIA 4WK9A 1EQ3A 1SYTA 1HKJA 1BL4A 4Z2KA 1FKKA 3PRAA 5HW8A 3KCEA 1GOIA 2RSEA 4MNJA 1HJVA 3WL0A 2KFWA 1Q6IA 3GPKA 2DT0A 1OGGA 5GQBA 5J6EA 2A3EA 1P5QA 3B8SA 4ML4A 3KADA 1U79A 4DWSD 4G50A 5HUAA 2DSWA 4MNLA 2RUCA 1J4HA 2ESCA 1NWTA 1HXVA 3PR9A 2RUQA 3ODKA 1E6RA 1ZBWA 1HJWA 4DRHA 2AWGA 1NH6A 1NWUA 3H9RB 3MDYB 3TC5A 4P8WA 2XP5A 2YBUA 4DWSA 1FAPA 4R5EA 2DT2A 2WLZA 1QPFA 4TX0A 5HW6A 2DG9A 2PI6A 1ITXA 4LAWA 5B8IC 4ZS6A 1JNSA 3OOBA 2XP3A 1KT1A 3ALGA 4FN2A 3KAHA 4IPXA 1T11A 1HKMA 3O5GA 1TFVA 1EDQA 3UQAA 3ARYA 4ZPWR 4Q22A 4U84A 2A3BA 4S3JA 4LGXA 4TNSA 3UI6A 3WKZA 2LKNA 1ZBCA 3WQVA 3AROA 1FKBA 4W9PA 2FAPA 5DITA 3WH0A 1IX5A 1ROTA 2M2AA 4MSPA 4ODMA 1E6PA 4DRKA 4QZVB 3ARPA 1UR9A 5BXJA 2UZ5A 1LG2A 1W1YA 4WJXA 4W9QA 3G6MA 3ARTA 3PRBA 1A7XA 4KQZA 4MAVA 2PPOA 1FFQA 3B7XA 4DRIA 3RM4A 3OA5A 2XP4A 4LAXA 1FFRA 1H0IA 4TW7A 4DRQA 2VCDA 1JNTA 4Z2HA 1LL6A 3UI4A 4MPKA 4DROA 1ZL1A 1HKKA 1HJXA 1W1TA 1D7HA 4ODRA 1D7IA 2Y78A 5JH8A 4R0XA 4DIPA 3ARQA 3KAIA 2ZQUA 1FKRA 1EYMA 3TDBA 2RURA 4ZPTR 4Z2JA 1EHNA 4ODQA 1W26A 2XP9A 2ZR4A 2M08A 2AOSA 4JFJA 4MNKA 3KAFA 3O5RA 1JNDA 2MF9A 2MPHA 3B9DA 1O6IA 5HT1A 4P8UA 2KE0A 1FKHA 4HARA 4L72B 5DEZA 2QF8A 2OLHA 4ITZA 2DG3A 1XHGA 5HTGA 2KO7A 3IK8A 2RUDA 4PTMA 1E9LA 2IUZA 4NZCA 4U86A 3KACA 1N1AA 2MNTA 2MLYA 4W9OA 2F4EA 1E6ZA 4MTVA 1FKFA 1WB0A 5DIUA 1RD6A 3CHEA 3KAGA 1NMWA 1LG1A 4U85A 1PBKA 3CHCA 2LGOA 2RQSA 1KT0A 1ZBVA 2LJ4A 2ITKA 2KGJA 1QPLA 2LPVA 2D9FA 1YW5A 3B9EA 4JFLA 4WKHA 4QT3A 3FAPA 3AS0A 3LUOA 4IQCA 2VN1A 1ZB5A 2G41A 2FDMA 3IKDA 2XPBA 1E15A 1LJYA 2N87A 1FD9A 4TYOA 4QT2A 3ARSA 3CGMA 4FAPA 4HBEA 4BF8A 1SR0A 3O5IA 2PV3A 2A3CA 5DF0A 3KZ7A 4Z2IA 3JXVA 3EY6A 1Q6UA 1BKFA 1B6CA 3ALFA 2YBTA 1X6NA 4P8XA 1F8AB 1KFWA 5HBFA 2F2DA 2PBCA 3FY1A 4NNRA 1X6LA 3IHZA 1PINA 2FKEA 1TCOC 2WLYA 3RM8A 4ODNA 1GUVA 2K8IA 4GGQA 4ODKA 2G8ZA 3AS2A 2DT3A 2F21A 1ZK6A 2MLZA 3TCZA 4O2TA 4ZPVR 2DSVA 1QZ2A 4KR0B 5HKGA 2OFNA 3W4RA 3O5MA 4G2PA 1ZU8A 3O5EA 1K9TA 2ZR6A 4GIVA 3WL1A 3RGCA 4XAKA 4P8VA 3B9AA 2O92A 4TW6A 2M1IA 5D75A 3B09A 4J4OA 5HW7A 4IQ2A 3WD4A 4L3NA 1WNOA 2DT1A 1NWRA 4IT4A 3AQUA 4URIA 4LAYA 4NSBA 1NSGA 1Q1CA 3BXWA 4DRJA 2DSZA 4DZ3A 3WD3A 1E6NA 3RMEA 3CHDA 4DT4A 1LQ0A 1HKIA 1LL7A 4ODOA 2PV1A 3PA7A 4C02B 3O5JA 1W1VA 3KABA 3PRDA 4LAVA 3NRKA 3UQBA 3UQIA 4MGVA 2ZQSA 4JFMA 1J4IA 1NWSA 1W9UA 2XPAA 2KR7A 4TW8A 4ODLA 4WKFA 1W9PA 3VAWA 2JZVA 3O5LA 3AS3A 3O5PA 1OWQA 4WIWA 1R9HA 1D2KA 3WD1A 1GPFA 3UF8A 2WM0A 1VF8A 3ARVA 3O5DA 4QIBA 4JYSA 2ZQTA 2DSUA 4DZ2A 4AY1A 4N19A 1LL4A 4DRPA 3ARWA 1F40A 1D6OA 3NTPA 4DRNA 3O5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D7H A;  2PBC A;  3GPK A;  5J6E A;  5I98 A;  4NNR A;  1Q6I A;  1P5Q A;  4ODR A;  1D7I A;  2Y78 A;  3KAD A;  1U79 A;  1ROU A;  3IHZ A;  4G50 A;  5HUA A;  1PIN A;  1FKL A;  3IKG A;  2FKE A;  4R0X A;  1TCO C;  1J4H A;  2RUC A;  1FKS A;  4DIP A;  1NMV A;  4ODN A;  1D7J A;  2K8I A;  1ZCN A;  3KAI A;  4GGQ A;  4ODK A;  1L1P A;  1HXV A;  1JVW A;  2ZQU A;  2F21 A;  1ZK6 A;  2RUQ A;  1FKR A;  3ODK A;  2MLZ A;  1EYM A;  3TCZ A;  2PPP A;  3JYJ A;  4O2T A;  2RUR A;  3TDB A;  4DRH A;  2AWG A;  3H9R B;  1QZ2 A;  3MDY B;  2KI3 A;  4JFK A;  4ODQ A;  3TC5 A;  1W26 A;  2MLX A;  2XP5 A;  5HKG A;  2OFN A;  2XP9 A;  1FAP A;  2ZR4 A;  3O5M A;  3O5Q A;  1FKI A;  2M08 A;  4G2P A;  4JFJ A;  3O5E A;  2ZR6 A;  4GIV A;  1QPF A;  3KAF A;  3O5R A;  4TX0 A;  3RGC A;  5HW6 A;  2DG9 A;  2MF9 A;  2MPH A;  2PPN A;  4LAW A;  5B8I C;  3NI6 A;  5HT1 A;  4DH0 A;  4TW6 A;  1JNS A;  3OOB A;  2M1I A;  2ZQV A;  5D75 A;  3B09 A;  4J4O A;  5HW7 A;  2XP3 A;  4IQ2 A;  1KT1 A;  1FKJ A;  2KE0 A;  2XP6 A;  3I6C A;  4FN2 A;  3KAH A;  1FKH A;  1FKG A;  4IPX A;  2ZR5 A;  1T11 A;  4DRN A;  4J4N A;  3O5G A;  4LAY A;  2DG4 A;  1NSG A;  2DG3 A;  4ITZ A;  1Q1C A;  5HWB A;  3JYM A;  3O5K A;  5HTG A;  3UQA A;  4DRJ A;  2KO7 A;  1M5Y A;  3IK8 A;  2RUD A;  2XP7 A;  4DZ3 A;  1FJD A;  3O5F A;  4U86 A;  3KAC A;  1N1A A;  2MNT A;  4DT4 A;  2MLY A;  4U84 A;  2Q5A A;  3RFW A;  2IF4 A;  4TNS A;  3UI6 A;  4W9O A;  1YAT A;  2F4E A;  1FKD A;  1FKF A;  4ODO A;  4ODP A;  4DRM A;  5DIU A;  3KAG A;  1NMW A;  2PV1 A;  4U85 A;  5GPG A;  1C9H A;  2LKN A;  1J4R A;  1PBK A;  3PA7 A;  2LGO A;  2RQS A;  1KT0 A;  4C02 B;  3O5J A;  3PRD A;  1FKB A;  2XP8 A;  2LJ4 A;  3KAB A;  3NRK A;  2ITK A;  3O5O A;  4LAV A;  1J6Y A;  3UQB A;  2KGJ A;  3UQI A;  1QPL A;  4MGV A;  1Y0O A;  4W9P A;  2FAP A;  2LPV A;  2D9F A;  5DIT A;  3WH0 A;  1FKT A;  1ROT A;  1YW5 A;  2M2A A;  2ZQS A;  4JFL A;  4MSP A;  3FAP A;  1Q6H A;  1J4I A;  4JFM A;  4ODM A;  3LUO A;  4QT3 A;  4DRK A;  2XPA A;  4TW8 A;  2KR7 A;  4IQC A;  4ODL A;  2VN1 A;  5BXJ A;  2PV2 A;  3VAW A;  2UZ5 A;  2JZV A;  3O5L A;  5HWC A;  3O5P A;  2L2S A;  1R9H A;  3IKD A;  2XPB A;  5DIV A;  4W9Q A;  3UF8 A;  3PRB A;  1A7X A;  2N87 A;  3CGN A;  4QIB A;  1FD9 A;  3O5D A;  3UI5 A;  4TYO A;  2PPO A;  3B7X A;  4QT2 A;  4FAP A;  3CGM A;  4DRI A;  4BF8 A;  3O5I A;  2PV3 A;  4JFI A;  3KZ7 A;  2XP4 A;  3JXV A;  4LAX A;  3EY6 A;  1EQ3 A;  1Q6U A;  1BKF A;  1B6C A;  4JYS A;  1BL4 A;  4TW7 A;  2ZQT A;  1FKK A;  4DRQ A;  4DZ2 A;  4N19 A;  5HW8 A;  2VCD A;  1JNT A;  3KCE A;  4DRP A;  3UI4 A;  2RSE A;  1F8A B;  1F40 A;  4DRO A;  1D6O A;  3NTP A;  2F2D A;  2KFW A; 
#chains in the Genus database with same CATH topology
 4HBO A;  1W59 A;  1RSO A;  1MZF A;  2FML A;  4PA6 A;  3ML0 A;  2OT5 A;  4LH7 A;  1NJI W;  1OCO C;  2QJ1 A;  5IJ9 B;  3IKG A;  1W1P A;  2JGU A;  5L3D A;  2YXH A;  4WKA A;  3LDD A;  1L0L H;  1FKS A;  1D7J A;  1NU1 H;  3DC6 A;  4JI0 O;  5KHK A;  4DUZ O;  1KEC A;  2PUS A;  4KXR A;  3ARU A;  2IU0 A;  3RYF B;  1AR5 A;  3JYJ A;  2NN4 A;  2QM7 A;  3CJH A;  2OWO A;  5GPR A;  4JI3 B;  3MD0 A;  2MLX A;  3G6L A;  1P7B A;  2YUA A;  3RM9 A;  2A9H A;  3ZHS A;  3K06 A;  1NVP D;  1R3I C;  3ZMZ A;  4RAI A;  3CPW U;  2DYR B;  3IC9 A;  2ZE5 A;  2RN9 A;  5EZY A;  4DR6 B;  3WB1 A;  4LF5 O;  2EZO A;  3LNM B;  2ETN A;  1K9M W;  1K3E A;  3IFX A;  1A32 A;  5EK0 A;  2A3A A;  2XP6 A;  1PV0 A;  4UCO A;  1R1B A;  2CTR A;  3SJQ C;  3SYP A;  1XMO B;  1IUR A;  4WFG A;  1UJW B;  3CX5 F;  4X8A A;  1XMQ B;  1IBM B;  4IHJ A;  5HWB A;  1I94 O;  1M5Y A;  2WLM A;  1MG1 A;  2XP7 A;  5K1X A;  2P5O A;  3CZ8 A;  1FJD A;  3O5F A;  4L8J A;  1JA8 A;  3B4S A;  3CH9 A;  4CS2 A;  2ODM A;  5LHG A;  1V55 C;  1ARO P;  4ODP A;  1OCC B;  4UFZ A;  4PDV A;  3ZCC A;  4BIO A;  1J4R A;  1OCZ C;  4DUY B;  2ZIM A;  4JV5 B;  4DYL A;  3G6E V;  1NZ6 A;  1Q8I A;  3RGB A;  5IT9 N;  4KL1 A;  3ARZ A;  1FKT A;  1KUQ A;  4GX2 A;  5IJ9 A;  1XRV A;  2QE7 G;  4FM0 A;  1JJO A;  2LW1 A;  4TUY B;  1YTF D;  2L2S A;  2ZR3 A;  4DR3 B;  1AI6 A;  1BL8 A;  1M5I A;  1LUW A;  3ABK C;  3CWB H;  3RYF A;  3CGN A;  3D36 C;  3STZ C;  2AW9 A;  2OIG A;  3CCV V;  5LMU B;  2IJI A;  1ZUQ A;  3EFF K;  2B1G A;  2DQ0 A;  3ZRW B;  1KYO F;  4X66 O;  2EBO A;  2WLJ A;  1Q6I A;  1KP2 A;  2UXN A;  5J6E A;  1K34 A;  2A3E A;  4OGQ B;  2QA4 V;  1KC8 W;  2XAH A;  3W7X A;  4WF9 V;  4JI5 O;  4X9Q A;  1HXV A;  1SER A;  3PR9 A;  1XL6 A;  4LFA B;  1E6R A;  2Q9L A;  2BTQ B;  4NXN B;  2ZNJ A;  3AG1 B;  4GKK B;  2HJF C;  3CXH F;  1NH6 A;  1NWU A;  3TC5 A;  3BA9 A;  2HVJ C;  2LJ2 A;  3OGC C;  3CHX A;  2F43 G;  4R8C A;  1QVF U;  1GN3 A;  3K3W A;  4R7C A;  4WFA V;  1SS3 A;  3GB7 C;  4FJC C;  4PHZ A;  4Z2W A;  5BMV B;  4B3T B;  4HBN A;  3JD3 A;  2WLZ A;  1O9G A;  4LNU B;  2EJ7 A;  1GM7 A;  1THZ A;  3CYO A;  2WSS G;  2YS8 A;  3LNN A;  2DJV A;  1GO3 F;  1E1Q G;  4TT3 G;  3BEH A;  3A0H Z;  4NTY A;  4DV6 O;  1Q43 A;  3K59 A;  1M90 W;  1N32 B;  1PNK A;  3ALG A;  3CEI A;  2Z5U A;  2UUB O;  1F51 A;  5J9P C;  3U11 A;  1HKM A;  5FPR A;  1RFY A;  2CTP A;  4G27 B;  1LUV A;  3UQA A;  4O4H B;  1UFI A;  2V1D A;  2D3O W;  3ARY A;  4ZPW R;  4Q22 A;  4JTD B;  1R3K C;  4TNS A;  5KHH A;  4YY3 O;  2Y0I A;  3CME V;  1AI5 A;  4JYA B;  4BAY A;  4DR4 B;  4B7E A;  1R6T A;  1JOY A;  1ZBC A;  2LKN A;  1P84 F;  3ZRW A;  3AG3 C;  4DO2 A;  1CXZ B;  1QHT A;  3VQY A;  1FS0 G;  4W9P A;  2FAP A;  4ZI7 B;  1Q82 W;  1E6P A;  1YZB A;  4TQD A;  4ZHQ B;  3FB8 C;  2UZ5 A;  4CC6 A;  4LF4 O;  4WJX A;  4FLV A;  4KQZ A;  1M93 A;  1VQM V;  1VQ9 V;  2BTQ A;  3W7S A;  3P3P A;  2QEX V;  3DGE A;  2AHY A;  4LAX A;  5CN0 A;  1KQS U;  1J5E B;  3HKD B;  2VCD A;  3SPI A;  3T4Z A;  3JD2 A;  3UI4 A;  3OMI B;  1VQO V;  3APQ A;  4MPK A;  1D7H A;  1JMK C;  2UXB B;  1D7I A;  2Y78 A;  4B3S O;  2DMX A;  2OIE A;  5B3S C;  2XT9 A;  1Q81 W;  2MK3 A;  1VQK V;  1WP7 A;  1Y76 A;  4O4H A;  4IL6 Z;  4LFC B;  1W26 A;  1VF5 B;  1HNZ O;  2KKW A;  2QWP B;  4DV3 O;  4H33 A;  3FX7 A;  4JFJ A;  1P49 A;  4MVO A;  2MF9 A;  2MPH A;  4RQE A;  4MTX A;  4EFB A;  3RWR D;  2P4K A;  1WB8 A;  4JZ2 A;  3AG4 C;  3CD6 V;  3OEE G;  5JH7 A;  4ZI7 A;  4E2L A;  4DV7 B;  1H2M A;  1VQ5 V;  1GMG A;  1WA8 B;  3PJS K;  4ZHQ A;  2EIK C;  2QF8 A;  1NR7 A;  3Q4H A;  4EKW A;  1N4C A;  1PNM A;  1NVP B;  3ZRX A;  3VOU A;  2GTS A;  2MNT A;  4JGS A;  1OV9 A;  2QKA A;  3T1Y B;  2YXL A;  2JDI G;  3CRQ A;  2WLN A;  5L3E A;  3HKD A;  5DIU A;  4GCZ A;  2LGO A;  2CH7 B;  4X62 O;  1SZT A;  1QPL A;  3CRM A;  1QLE C;  1H2G A;  3T4D A;  4FZ1 A;  3GWO A;  2PI4 A;  3F5W C;  3LUO A;  1XQ8 A;  4DXW A;  1HP8 A;  1VQP V;  1BCC H;  2XPB A;  2X6C A;  2Q67 A;  4Z1M G;  4FAP A;  3TXQ A;  1EZV H;  1SR0 A;  5DF0 A;  4KFM A;  4X20 A;  2HFE C;  1Q6U A;  4NXM B;  4P9P A;  1NT2 B;  5JQG A;  5IE9 A;  4P8X A;  4E4E A;  1K4C C;  3UT5 B;  3HKC A;  2WA4 A;  1K8A W;  1YTF B;  5IYC O;  3WU2 Z;  3ETG A;  1GM9 A;  3OFN G;  2HVK C;  2FKE A;  5EBM C;  1TCO C;  1IZ3 A;  3RM8 A;  5DED A;  2EIN B;  1WPX A;  4UVA A;  2E5L O;  2F21 A;  2ZE7 A;  2VWK A;  1ZK6 A;  1WA8 A;  3C3S A;  3RVY A;  4ZPV R;  4GZR B;  1Z2G A;  1BE3 H;  3H1L H;  1JJ2 U;  5IYZ B;  4LP8 A;  3E89 A;  1WNS A;  2JK5 C;  5FLX N;  1IBL B;  3HKE B;  4MTF A;  1HR0 O;  3B8M A;  4G2P A;  4BWA A;  2YEV B;  4GIV A;  1K9T A;  3WL1 A;  3ZN0 A;  5CBH A;  2EUL A;  2MW2 B;  4GX0 A;  4MS2 A;  4AHC A;  3J81 N;  4U3J A;  4I9W A;  2CH7 A;  2PTM A;  5HW7 A;  3WD4 A;  1JCH B;  3G4S V;  1S5L Z;  1NWR A;  1LNQ A;  1NSG A;  3OTF A;  1X59 A;  3BXW A;  2DSZ A;  3OAA G;  4X1I B;  2B1I A;  4DZ3 A;  4MVR A;  1M1K W;  4UCV A;  5IDJ A;  3CHD A;  4DT4 A;  2F95 B;  2CTW A;  1LQ0 A;  3R65 A;  2F1M A;  4N23 A;  1HKI A;  1I94 B;  4DV0 B;  4JAA A;  3HB3 B;  1AVM A;  2PV1 A;  5LL6 Y;  3FAV B;  4C02 B;  1SQQ H;  1DK1 A;  1S5H C;  3NRK A;  3SJC C;  1BHB A;  2QWO B;  4UB8 Z;  2HKO A;  3L72 H;  2OCC B;  1IXB A;  1NWS A;  3K9A A;  1W9U A;  2ZR2 A;  3J80 N;  2XPA A;  3CC2 V;  5KUM A;  3E2E A;  1N8R W;  2UU9 B;  2YC0 A;  1OWQ A;  1R9H A;  3BRC A;  4P9O A;  4X64 B;  1VF8 A;  4LF6 O;  1Q86 W;  3O5D A;  1Q3E A;  5IYZ A;  3W7U A;  4MW3 A;  2Q0A A;  4DV5 B;  2NNU A;  2PI5 A;  1SQF A;  1AJP A;  3OM3 B;  4UCR A;  4D6T H;  2Z3Y A;  1BSM A;  2YEV A;  4DRP A;  2R70 A;  3QF7 A;  3FYI B;  3VQX A;  1U96 A;  1D6O A;  3N2G B;  1XL4 A;  4TQF A;  5B5E Z;  2WK2 A;  1FXK B;  5AG2 A;  3TCU A;  1JCH A;  1ZL8 A;  4H13 B;  3LSS A;  4K3A A;  5KX5 B;  3FB6 C;  3CRA A;  3RW0 A;  3UM7 A;  2XOK G;  4DK1 A;  2Q6A A;  4X1I A;  2X0L A;  3VBB A;  2HLD G;  4Q7N A;  3WIJ A;  4UCS A;  4UV8 A;  3F7V C;  2YDE A;  2UXX A;  2WLI B;  2GHY A;  4QNH B;  1H2N A;  4W5U A;  1HNX B;  4PDL A;  4WFH A;  4DH0 A;  2UUA O;  3H1K H;  2ZQV A;  1WAZ A;  4BIZ A;  3FXY A;  3JD1 A;  3I6C A;  5DO2 A;  4DV2 B;  3M7M X;  4MW8 A;  1R6N A;  2ZR5 A;  3CCQ V;  3ZRS A;  1YDX A;  1VF6 C;  2A79 B;  4LC1 A;  3RT3 C;  1SZX A;  1YIJ V;  4S3K A;  3JYM A;  3WD0 A;  4YJ2 B;  1IXM A;  4JI2 O;  4FIP C;  4DV6 B;  4QGP A;  2RJZ A;  4LF7 B;  3ZED A;  1PNL A;  4U7N A;  3CCM V;  1AR1 B;  2B31 A;  2UUB B;  4J42 A;  1W9V A;  1GH6 A;  3J7A U;  1N34 O;  2CDY A;  2OCH A;  4UVC A;  5K1P A;  3BY6 A;  5GPG A;  2R9R B;  1C9H A;  3DC5 A;  4B3R B;  1N36 B;  1PKX A;  2Q5Z A;  3N2G A;  1JVM A;  4JI7 O;  1Y0O A;  2KQX A;  4J9Z B;  1H0G A;  5JVD B;  4GKJ B;  5KA5 A;  5IJ0 A;  4Q20 A;  1Y67 A;  3LUT B;  4W4K A;  3MHH C;  5DIV A;  2LFR A;  1NTZ H;  2H3O A;  3JAK B;  4FPP A;  5KX5 A;  4LBE C;  3ARR A;  1XEQ A;  3JAL B;  2XAG A;  4ZBM A;  4DR2 O;  4JFI A;  3X2Q C;  1FXK C;  4J9Y B;  4QJF B;  3OE7 G;  4Z1V A;  4LF4 B;  2QR4 A;  1XOU A;  1FKK A;  1VQ8 V;  1G1X B;  1VQ4 V;  3NXS A;  1F4N A;  5BXZ A;  3CRR A;  3CC4 V;  1GOI A;  4EB6 A;  2RSE A;  2WLI A;  1SQB H;  1BZK A;  3WL0 A;  1N33 B;  5GQB A;  2DT0 A;  3E8B A;  3MAQ A;  1OGG A;  4ML4 A;  4WBN A;  4DWS D;  1V55 B;  1AJQ A;  5HUA A;  5KLV H;  1BMF G;  4MNL A;  1VQL V;  5BR8 O;  1K97 A;  4JI8 B;  1VQ6 V;  1OCZ B;  1NWT A;  5H6R A;  2RUQ A;  4FLU A;  3ODK A;  3JAS A;  1GKF A;  3A0B Z;  1ZBW A;  1HJW A;  1PM9 A;  2IBZ H;  3MDS A;  2GBO A;  1XIL A;  3OMA B;  1FAP A;  2FKX A;  3ABK B;  1SES A;  4K0K O;  3QO5 A;  1FJG O;  1OCR C;  3MHS C;  2R9I A;  1M57 C;  3OOB A;  4ASU G;  3OW2 U;  1Y74 A;  2XUM A;  4DV4 O;  4FN2 A;  2GUZ B;  4DW1 A;  4IPX A;  5JVD A;  1SQV H;  3JCZ A;  3K5M A;  3ZBH A;  3JAK A;  3AEI A;  4BIU A;  1ZAU A;  3ZS8 C;  4YHH B;  3JAL A;  4U84 A;  4I7Z B;  2LFS A;  3I56 V;  5B1B B;  4NYK A;  1I0H A;  1YF2 A;  4AI8 A;  2HHH O;  2X6A A;  5DIT A;  3WH0 A;  2IJH A;  2M2A A;  4MSP A;  2CK3 G;  1HNW O;  4DRK A;  5CB4 A;  3FB5 C;  4LR3 A;  1LG2 A;  3S3W A;  1W1Y A;  3OR6 C;  1F23 A;  3ART A;  2B5U B;  2YIB D;  5CBG A;  1FFQ A;  2XAQ A;  3RM4 A;  3U0Z A;  2Q7H A;  3JSN A;  5IYB O;  2QKS A;  1BQ0 A;  1H0I A;  1IDS A;  4TW7 A;  3UCS C;  2ZCE A;  1LL6 A;  2KSD A;  4DRO A;  4DR1 O;  1EN6 A;  3D36 A;  1HJX A;  4EFE A;  1XHZ A;  3JAW B;  5JH8 A;  3E22 B;  2X7R B;  2Q73 A;  2F4V O;  4I50 B;  5LGT A;  2ZE8 A;  3KAI A;  1K4D C;  3AG3 B;  2ZQU A;  1XUQ A;  2GUZ A;  1EYM A;  3K5N A;  3GTY X;  2OTJ V;  2VQE O;  2ZM6 O;  3KKY A;  5EBW C;  1IBK B;  2GTA A;  4ODQ A;  3HR0 A;  4LFB O;  1PL0 A;  2E76 B;  2XP9 A;  2M08 A;  1ZLZ A;  1WJZ A;  1U97 A;  4MNK A;  3N27 A;  1ZX3 A;  1TAE A;  1ROP A;  1JND A;  1V54 B;  3OTO O;  5GTI Z;  1FFT B;  1HWY A;  5HT1 A;  4PV1 B;  1GRJ A;  5J2U B;  3LSU A;  1D5N A;  5B1B C;  4HAR A;  3AK1 A;  5DEZ A;  3DXR B;  3RN4 A;  1S72 V;  4ITZ A;  3RFR A;  2X6B A;  3ZMU A;  3K79 A;  3IK8 A;  5EC1 C;  4HNA B;  5KAI Z;  2R72 A;  1E9L A;  4LF8 O;  2H8P C;  5C8Y B;  2B5U A;  1YCI A;  4NZC A;  5B3S B;  3KAC A;  4U86 A;  2AZ0 A;  2IM9 A;  4W9O A;  2F4E A;  5C93 A;  2ZDI C;  3FYE B;  1FKF A;  2WWW A;  1WB0 A;  4I0X B;  3CHE A;  1NTK H;  3DTU B;  2H94 A;  2ZQM A;  3CHC A;  2RQS A;  1KT0 A;  3GU0 A;  2YIA A;  2ITK A;  3QTC A;  2UUC O;  2LPV A;  3TET A;  4WKH A;  4TUY A;  3E22 A;  3FAP A;  3ZMS A;  4JI1 B;  1KKD A;  2VN1 A;  4I50 A;  5CA1 B;  1XNR B;  2FDM A;  4JAS A;  3AG4 B;  2R9A A;  4MTO A;  5FL7 G;  1OZ0 A;  4QT2 A;  1WP8 A;  4HBE A;  4BF8 A;  4FFB B;  4FZ0 A;  1S0V A;  2PV3 A;  1NH2 D;  2A3C A;  2EIK B;  3OEH G;  2F23 A;  4R6Z A;  3ASN C;  1RP3 B;  1IVS A;  1MA1 A;  3CB2 A;  3L73 H;  2UXC O;  2VQF B;  3QO7 A;  4K8X A;  2PBC A;  3FY1 A;  4NNR A;  5D5Q A;  4AQY O;  4JAV A;  3KG2 A;  2P22 C;  1PIN A;  5J2U A;  4ODN A;  1H2L A;  2DQ3 A;  2Y4T A;  3AS2 A;  4JYB A;  1P4R A;  4D7T A;  2MLZ A;  1V54 C;  2LP7 A;  1WPB A;  2JJ2 G;  1M4U A;  3DXR A;  4O2T A;  1QLE B;  4MVQ A;  1S5J A;  2CE4 A;  1H2S B;  4NVP A;  4OX9 O;  2A0L A;  3WB0 A;  2P67 A;  4DK0 A;  4GUN A;  5GTH Z;  1EN5 A;  1G8M A;  5C8Y A;  3L74 H;  5BMV A;  5HKG A;  2YID A;  2JJ1 G;  4LNU A;  5L3C A;  5H2F Z;  5H5N A;  2HG5 C;  1EBO A;  3K5L A;  4MVM A;  4NB5 A;  4XAK A;  3HPL C;  5IYD O;  4P8V A;  3ABL B;  3B9A A;  1SRY A;  2O92 A;  4QPJ A;  1FXH A;  1YI2 V;  2M1I A;  3LSQ A;  3B09 A;  3L9D A;  2WPD G;  4RQF A;  1H8E G;  4IQ2 A;  4L3N A;  2VS0 A;  1AR4 A;  1XI1 A;  1TUB B;  5E79 Z;  1M9N A;  1LR1 A;  5CA1 A;  4LAY A;  2YI8 A;  4MSW C;  5KHG A;  5LYJ B;  2QM8 A;  4NTW A;  2ZKO A;  1E6N A;  2EX3 A;  4FFB A;  2A7W A;  5JWP A;  2IW5 A;  3GVM A;  4KHP B;  1LL7 A;  4GLX A;  4JI2 B;  1CPY A;  1ZTE A;  2BSK B;  1XRE A;  5IWA B;  1W1V A;  3KAB A;  4LAV A;  3EHB B;  1VIB A;  3ZHR A;  4YIO A;  4CH4 A;  1BQZ A;  1N34 B;  2ZQS A;  5TIS Z;  3W7T A;  3RYC B;  4JFM A;  3L75 H;  1US6 A;  2KR7 A;  4ODL A;  4F6R B;  4DW0 A;  3AS3 A;  4WIW A;  5LOV B;  1D2K A;  2JS5 A;  4JI7 B;  1AI7 A;  2IU3 A;  3UF8 A;  4JI3 O;  3KCX A;  4QIB A;  4B3M B;  4CH6 A;  1W0J G;  2LGQ A;  2Y4U A;  5F2V O;  4TV8 B;  1KBH A;  3G67 A;  1YIT V;  2XHB A;  3H01 A;  4JYS A;  3LDE A;  2DSU A;  4DZ2 A;  4N19 A;  2JS3 A;  1LL4 A;  1L1F A;  3NTP A;  3UQB A;  3O5Q A;  4ICG A;  1PL4 A;  4YXW G;  1W0K G;  1XMO O;  1ROU A;  1Y4M A;  1FKL A;  3KZI Z;  1I7F A;  4DV1 B;  1XMQ O;  1IBM O;  1ZCN A;  5LMN B;  4DWS C;  5LP6 C;  1L1P A;  1JVW A;  1TUB A;  4J11 A;  2PPP A;  4I4T B;  3CCS V;  3ABL C;  3WQW A;  3G6B A;  5LYJ A;  1QLN A;  2Y69 C;  4JFK A;  4MNM A;  3O9O A;  1FKI A;  3L71 H;  3D3Q A;  4ABM A;  3JYC A;  4DUY O;  4LF9 B;  5EBL C;  4JV5 O;  1UR8 A;  4DR7 B;  4KUM A;  3DSQ A;  2EZP A;  2PPN A;  3WD2 A;  2DE0 X;  2JEX A;  3A0R A;  3EXA A;  2IH1 C;  4K0K B;  5KUK A;  3RYC A;  5L3G A;  3ETQ A;  4DR3 O;  3T2M A;  1S3J A;  2BOB C;  1FJG B;  3CHF A;  4GYC B;  1URF A;  4F6R A;  2HJD A;  1OJH A;  4PD4 F;  1WAW A;  4PA9 A;  5LOV A;  2P6J A;  3K5O A;  4DUZ B;  4JI0 B;  3U10 A;  2P90 A;  3E8F A;  3QOK A;  3ARX A;  5CA0 B;  1BHA A;  2QWQ B;  1K7D A;  5LMU O;  3EIP A;  2IJK A;  3SJB C;  5BY1 A;  2IF4 A;  4TV8 A;  3BAA A;  4G28 B;  1FKD A;  2BE3 A;  5DN6 G;  2O9O A;  4Z2G A;  4PJ0 Z;  2XP8 A;  1SQP H;  4CBC A;  4OPA A;  2DN9 A;  5HWC A;  1H8H G;  4CS4 A;  4LF5 B;  1VMG A;  4DRX B;  4R50 A;  1EIB A;  2BTO A;  3ZJZ A;  4LFA O;  4TSF G;  4J7K A;  1SF9 A;  4NXN O;  2HHH B;  2YXY A;  4I4T A;  3QVN A;  1OHH G;  4F4L A;  1SA0 B;  1GM8 A;  1SQG A;  4B3T O;  4WK9 A;  5B66 Z;  1EQ3 A;  1SYT A;  3SYC A;  3TK1 A;  3UT5 A;  4WFF A;  5HW8 A;  3KCE A;  3ETD A;  4G2K A;  2FYU H;  2RDC A;  4IIJ B;  1P5Q A;  1N32 O;  4H37 A;  4PI2 A;  2ZIO A;  1M56 C;  3JAR B;  1N0J A;  2ZE6 A;  2RQ6 A;  4U3F H;  2ESC A;  4DR1 B;  4LCU C;  5GON B;  1L8D A;  2EIM C;  3UKM A;  1EM1 A;  2Q68 A;  1VQN V;  4DRH A;  5KHJ A;  4GX1 A;  3HKE A;  3H9R B;  2PYL A;  2LO1 A;  2NR5 A;  5CA0 A;  4I55 B;  2YBU A;  4JYA O;  4R5E A;  4DR4 O;  2DT2 A;  1RM1 B;  1XHX A;  2Q0O C;  4Q6G A;  4JYY A;  2DG9 A;  2M7W A;  2YIC A;  4JTA B;  3X2Q B;  4LAW A;  3UO3 A;  4ZS6 A;  4X66 B;  1GTO A;  2QKC A;  4XDJ A;  2XP3 A;  1QCE A;  2AXT Z;  2QDO A;  3IGA C;  1FPO A;  2HP8 A;  4DRX A;  3SPG A;  1KD1 W;  1T11 A;  1EFR G;  4FVM A;  3O5G A;  1TFV A;  4JI5 B;  4X1Y B;  1N0N A;  1I5Y A;  2DYS C;  2A3B A;  2ADQ B;  1VF6 A;  3FAV A;  1DF4 A;  3ZHQ A;  2CGO A;  2UXB O;  4I9Q A;  3CCU V;  3WQV A;  3JSL A;  1Z5W A;  3BCC H;  3ARO A;  1FKB A;  2VWJ A;  2A3Q A;  1B04 A;  3PN1 A;  1I08 A;  5B1A B;  1IX5 A;  3K08 A;  3S3X A;  1ROT A;  3AK3 A;  5LHH A;  4ODM A;  3H1I H;  3QG5 A;  1UR9 A;  1P7G A;  1OCR B;  1NQT A;  1D5A A;  4FK5 C;  5GON A;  1M57 B;  5B1O A;  3B2E E;  4W9Q A;  1MSW D;  3G6M A;  3AG2 C;  3PRB A;  1A7X A;  4MAV A;  2PPO A;  1ORQ C;  4DRI A;  2K9P A;  4QE9 A;  1SQX H;  3BA8 A;  3OA5 A;  4JZG A;  3JAT B;  4GX5 A;  4I55 A;  1F4M A;  4HZ3 A;  4OPH A;  5JJJ B;  3E8G A;  4DR5 O;  3K58 A;  2KB1 A;  4UXN A;  1GN2 A;  2AZ2 A;  3KCY A;  1HKK A;  4YY3 B;  1X4T A;  1FXK A;  4DV7 O;  3R66 A;  1FYJ A;  3ETE A;  3RVZ A;  4NR1 A;  1RSO B;  4R0X A;  1RM1 C;  3ARQ A;  3CE2 A;  4PDM A;  3IC7 A;  1FKR A;  4JI4 O;  1TVK B;  2ARH A;  4EEQ A;  4AQY B;  2FL4 A;  4L87 A;  4JI6 O;  3G71 V;  1EHN A;  3RYI B;  3T1Y O;  3CJH B;  4BR6 A;  3RBZ A;  2CUG A;  2VRZ A;  1KMI Z;  1PP9 H;  2AOS A;  3KAF A;  3O5R A;  1Q7Y W;  4MTG A;  3OD4 A;  4OX9 B;  2EIL C;  3K9S A;  4UUJ C;  3VQW A;  4CH5 A;  3K04 A;  1PD3 A;  1ZWI C;  4P8U A;  3T1H O;  4B3S B;  4TWK A;  1FKH A;  4YJ2 A;  4L72 B;  3SYO A;  2OLH A;  4FM2 A;  2DG3 A;  5HTG A;  1IX9 A;  4PTM A;  2RMK B;  1S76 D;  2P06 A;  2IUZ A;  5B1A C;  4NXM O;  2DOS A;  4WFB V;  1N1A A;  2MLY A;  1DF5 A;  2W0X A;  3G80 A;  1MMM A;  3JAT A;  1HNZ B;  2QGN A;  2EJR A;  1YXB A;  4DV3 B;  1E44 A;  1NMW A;  4U85 A;  4NTX A;  1PBK A;  2LJ4 A;  1BS3 A;  5HFL A;  2KGJ A;  2DWE C;  2D9F A;  1YW5 A;  3B9E A;  4QT3 A;  2FTK A;  3AS0 A;  3W7W A;  2QM4 A;  3ZX6 A;  4P2Z A;  1HDJ A;  2G41 A;  1TVK A;  2IH3 C;  3M99 B;  1IBL O;  4QE7 A;  2QTO A;  3RYI A;  2PYJ A;  1BKF A;  1B6C A;  3ALF A;  1J95 A;  4A5U B;  4RUF A;  1VP7 A;  3F5T A;  1F8A B;  2GSM B;  5HBF A;  2F2D A;  1K5S A;  5EIB D;  4CZZ A;  3O65 A;  1X6L A;  4UV9 A;  2EIJ C;  4X62 B;  5LBQ A;  2UXD O;  2WLK A;  4GGQ A;  4ODK A;  2G8Z A;  1JFF B;  3TCZ A;  3SYQ A;  4K35 A;  2QSA A;  3BAB A;  2DSV A;  1MZE A;  1XBL A;  4X1K B;  4TV9 B;  3ZN1 A;  4DV0 O;  1QU7 A;  2LW7 A;  3ICX A;  2F66 C;  2ZR6 A;  3RGC A;  3K0G A;  2NLJ C;  1L0N H;  4IT5 A;  3ASN B;  3K57 A;  4HYO A;  4J4O A;  3IJ4 A;  2UU9 O;  2DT1 A;  2OYQ A;  4UDM A;  3JAM N;  4ZIB A;  1XNQ O;  4IT4 A;  5CA3 A;  2Q7G A;  1JPX A;  4X64 O;  4FLT A;  2E5L B;  3A2F A;  2V4D A;  2ITC C;  5GW7 A;  3CRC A;  4JYC A;  4DRJ A;  3ASO B;  3BVO A;  4DV5 O;  3WD3 A;  2E3C A;  3RME A;  4TOI A;  2Q69 A;  3SPH A;  2ITD C;  1Y66 A;  5D5P A;  4XBF A;  4HAM A;  1RPR A;  4H44 B;  3UQ8 A;  1HR0 B;  4ODO A;  3FKS G;  2CTQ A;  3PA7 A;  3O5J A;  1DLB A;  5DM6 V;  2HR3 A;  3OR7 C;  5IY5 B;  1S77 D;  1Q5O A;  1J4I A;  2JRI A;  2ZDI A;  4TW8 A;  1FXV A;  3FFQ A;  4WKF A;  3VAW A;  2PZS A;  1YSC A;  2JZV A;  3O5L A;  3O5P A;  4D7S A;  1JFF A;  2XAS A;  1GPF A;  2E74 B;  3H1H H;  2WLL B;  2DYR C;  3BFR A;  4FMT A;  5A9G A;  1T5E A;  4X1K A;  4TV9 A;  3JCU Z;  3OT7 A;  4O4L B;  1MNG A;  2ZQT A;  1W2B U;  1HNX O;  4AY1 A;  4PA3 A;  1FFX B;  2RNB A;  3JAW A;  3ARW A;  3ZMV A;  1AP6 A;  2LGW A;  5I98 A;  1WLE A;  4O2B B;  4B7K A;  5KHI A;  4DV2 O;  4QIW F;  5LGN A;  2FB5 A;  1DTO A;  2YSU B;  3FB7 C;  1NMV A;  5LGU A;  4O2A B;  3SPJ A;  3ABM B;  3C90 A;  2GDS A;  3CP1 A;  3ZHU A;  4LF7 O;  1OCC C;  2Z0A A;  1JNE A;  2KI3 A;  5JJN B;  3AS1 A;  1KKC A;  4LF6 B;  1Y76 B;  1B3Q A;  1KP3 A;  3BMB A;  4CS3 A;  2WAM A;  1H2K A;  3D8C A;  1CTN A;  2ZXW B;  3BPZ A;  5KA6 A;  4PA7 A;  5LA6 B;  3TGU H;  4B3R O;  1HW7 A;  4FLZ A;  1N36 O;  4X65 O;  1ZBK A;  2XAJ A;  3ASO C;  1G6U A;  1QBZ A;  1GAX A;  4LH6 A;  5KMG B;  3CC7 V;  3NI6 A;  3N2K B;  1CEZ A;  2ZNI A;  3APO A;  2KG7 B;  2N74 A;  4GKJ O;  3CMA V;  3ZRV A;  2ATK C;  1FKJ A;  4FLW A;  2PGG A;  4JPR A;  5FNV B;  2Q4P A;  1FKG A;  4ZOL B;  5JH7 B;  4HNA A;  4J4N A;  5ITZ B;  1K92 A;  3THO A;  2DG4 A;  3O5K A;  4UVB A;  4JF3 A;  2Y48 A;  5EYP B;  5IY5 C;  4MVU A;  2CAZ C;  2V7Q G;  3E35 A;  3Q4H B;  1Z5V A;  1FAF A;  4DWS B;  5LP6 B;  2WLL A;  1QVG U;  4UCT A;  3ZMT A;  2Q5A A;  3RFW A;  3QNE A;  4I0X A;  4P30 A;  1K5Q A;  4I5S A;  4O4L A;  1YAT A;  4Z2L A;  1N33 O;  1VEW A;  4DRM A;  3SDL A;  2Y69 B;  1FFX A;  1OGB A;  1CP9 A;  1D2D A;  3O5O A;  1J6Y A;  4IT6 A;  1R3L C;  4JI8 O;  5H6Q A;  1RPO A;  4O2B A;  4O4J B;  3NR7 A;  4RWU A;  1Q6H A;  2UUA B;  3AG1 C;  1SC5 B;  4BW5 A;  2PV2 A;  4PDR A;  2W0F C;  4O2A A;  3I55 V;  2DPE A;  2DWD C;  3UI5 A;  2JEU A;  5BZB A;  3CCL V;  2CGN A;  4QPK A;  2ILM A;  1HKJ A;  3K03 A;  1BL4 A;  4Z2K A;  4X20 B;  3SGI A;  3ABM C;  5LA6 A;  1UPG A;  5CMU A;  4MNJ A;  4IYI A;  1HJV A;  1NS1 A;  5JQG B;  2KFW A;  2BOC C;  3H9V A;  3GPK A;  5LXT B;  5KMG A;  4LWS B;  3B8S A;  1AJN A;  3N2K A;  3KAD A;  1U79 A;  4DR5 B;  4G50 A;  3HKC B;  2KG7 A;  2DSW A;  3RYH B;  1YHQ V;  2RUC A;  1J4H A;  2ZXW C;  4IYH A;  5LHI A;  5FNV A;  1K33 A;  4X88 A;  4UB6 Z;  4ZOL A;  1NKD A;  1JR9 A;  5ITZ A;  3B40 A;  2XAF A;  4YHH O;  3M8A A;  2AWG A;  2IJJ A;  5EYP A;  1COW G;  3MDY B;  4P8W A;  4DR6 O;  1YVW A;  2XP5 A;  4MVS A;  4DWS A;  5LP6 A;  4JI4 B;  2N04 A;  4DR2 B;  1YEW A;  1GN6 A;  4JI6 B;  5HFM A;  1QPF A;  4TX0 A;  5HW6 A;  2PI6 A;  4FLX A;  1ITX A;  1G4Y B;  5B8I C;  1EZJ A;  1GK9 A;  4FLY A;  4J7J A;  2ADP A;  1JNS A;  4UCU A;  4U3J B;  1R73 A;  3SYA A;  1KT1 A;  3SPC A;  4O4J A;  4H0L B;  3KAH A;  4U7O A;  4MVZ A;  2WLH A;  5BR8 B;  1EDQ A;  4JAU A;  2QWN B;  1AB3 A;  3ZIA G;  2PN0 A;  1NR1 A;  1M56 B;  3T1H B;  1NTM H;  2LQT A;  2EIM B;  4S3J A;  4LGX A;  2L6L A;  3UI6 A;  2BSK A;  3I5D A;  4PEL A;  1MAB G;  3TXS A;  4RUE A;  3WKZ A;  3CCE V;  3OGI B;  4FM1 A;  3GWK C;  3P3N A;  5LXT A;  4LWS A;  2B9Z A;  2W6I G;  4QZV B;  3ARP A;  3RYH A;  5BXJ A;  1QR8 A;  1E79 G;  3E8H A;  4DV4 B;  2QWR B;  4N21 A;  3F7Y C;  1IBK O;  1SKV A;  3B7X A;  3EVK A;  1KB9 F;  2XP4 A;  4CH3 A;  1FFR A;  3BHP A;  4B08 A;  2XTA A;  3P30 A;  4DRQ A;  1YJ9 V;  3CSX A;  1VF7 A;  1JNT A;  4Z2H A;  2M6Y A;  1ZL1 A;  2DYS B;  1W1T A;  2PF4 E;  4ODR A;  2YIB A;  2F93 B;  3STL C;  5EIB C;  4YIP A;  4GKK O;  4DIP A;  1HNW B;  1SET A;  1TUE B;  3ZHV A;  1ZL8 B;  2RUR A;  3TDB A;  1R3J C;  4ZPT R;  1YJN V;  4FFK A;  5B1N A;  4Z2J A;  5L3B A;  2UXD B;  1O9H A;  3D3I A;  5JCO A;  4O4I B;  4J7Z A;  2ZR4 A;  4AIL C;  5H9C A;  3AG2 B;  2HEP A;  4MT8 A;  3B9D A;  3JD4 A;  2JGD B;  3CXC U;  4GT1 A;  3K0D A;  1O6I A;  3E86 A;  4OXS A;  5JCO C;  2RCV A;  2ZIN A;  4JI1 O;  1NH2 B;  2GV9 A;  1XNR O;  1JX9 A;  2KE0 A;  2BCC H;  2P4V A;  3H1J H;  3TJT A;  3L70 H;  3WFV A;  2F4V B;  4K8Z A;  3ABU A;  1XHG A;  1R6K A;  2KO7 A;  2RUD A;  4KP4 A;  4PA4 A;  2VQE B;  4C7U A;  2ZM6 B;  2JVD A;  5DEC A;  2W6J G;  1XNQ B;  1MSD A;  3ABT A;  2QTS A;  4LFB B;  5A2Q N;  1E6Z A;  3C3T A;  2VQF O;  4MTV A;  3OMN B;  1KU9 A;  1RD6 A;  1B6Q A;  3VQV A;  1AIL A;  1LG1 A;  3KAG A;  2EIN C;  3B77 A;  1ZBV A;  4YJ3 B;  3UO2 A;  3OTO B;  3LDC A;  4JFL A;  1QQC A;  5JJE B;  3A8T A;  4NKG B;  4IQC A;  3HKB B;  3AG7 A;  3E83 A;  4JTC B;  2EIL B;  2Y0P A;  3CS5 A;  3CCJ V;  2K1E A;  1ZB5 A;  1ZSP A;  3IKD A;  5IJ0 B;  1J5E O;  1SA0 A;  1E15 A;  1EN4 A;  1LJY A;  2N87 A;  1FD9 A;  4TYO A;  1E1R G;  3ARS A;  3CGM A;  1V9P A;  3O5I A;  1TA8 A;  2P7T C;  3KZ7 A;  4Z2I A;  3SJA C;  3JXV A;  4LF8 B;  2A06 H;  3EY6 A;  4O4I A;  1AI4 A;  4J10 A;  2YBT A;  1VQ7 V;  3P32 A;  1H38 A;  1K73 W;  1X6N A;  4IIJ A;  3WG7 B;  3OUS A;  1KFW A;  1DGS A;  1Q90 D;  2JGD A;  2YI9 A;  4EB6 B;  3B8N A;  3JAR A;  5CBF A;  3IHZ A;  2ZT9 B;  3WB2 A;  4XDK A;  4LFC O;  4X89 A;  2WLY A;  2UUC B;  4WBN B;  1GUV A;  2K8I A;  2DT3 A;  1XDC A;  1ENV A;  2G38 A;  5J2T B;  4IGG A;  3JAS B;  5KAF Z;  5FPO A;  1QZ2 A;  1PPJ H;  1FKA O;  4KR0 B;  1F7Y A;  1OCO B;  4KHP O;  2OFN A;  3W4R A;  3O5M A;  4CC5 A;  2O57 A;  2D2C B;  1Y6X A;  3FD9 A;  4PI0 A;  1ZU8 A;  3O5E A;  2AGA A;  5IWA O;  2OCC C;  1VAR A;  2C2A A;  4J80 A;  1QR9 A;  4ZKI A;  2UXC B;  4TW6 A;  4YJ3 A;  2JIZ G;  5D75 A;  2PY5 A;  1TGO A;  1QNM A;  1WNO A;  4X65 B;  2L35 A;  3AQU A;  3HKB A;  4X1Y A;  1Y74 B;  4URI A;  4B3M O;  1WB7 A;  4NSB A;  1B06 A;  1Q1C A;  2EIJ B;  1WN7 A;  1GN4 A;  1BT8 A;  2E75 B;  3JD0 A;  4W4L A;  2XND G;  1YJW V;  1NBM G;  4RO2 A;  4BW9 A;  4WCE V;  3CCR V;  5EZY B;  1I5X A;  3ZHT A;  1NI8 A;  2OTL V;  3PRD A;  2Q8V A;  4DV1 O;  5L3F A;  3UQI A;  4MGV A;  2AHZ A;  4J41 A;  5LMN O;  2WA3 A;  3T1C A;  3SR2 C;  2DW4 A;  1JQ0 A;  1W9P A;  3WG7 C;  4IHJ B;  2ZD9 A;  3AK2 A;  1BGY H;  2N05 A;  5CB4 B;  4F6E A;  3WD1 A;  1AP5 A;  2WM0 A;  3ARV A;  2Q7E A;  5J2T A;  4WFE A;  3OUF A;  4LF9 O;  4DR7 O;  3IAY A;  5EC2 C;  3QO8 A;  1MOF A;  5E1A C;  1F40 A;  4XDL A;  3PRA A;  4DRN A; 
#chains in the Genus database with same CATH homology
 4HBO A;  5I98 A;  2WK2 A;  1ROU A;  1FKL A;  3IKG A;  1W1P A;  4WKA A;  1FKS A;  1NMV A;  1D7J A;  1ZCN A;  4DWS C;  1L1P A;  1JVW A;  3ARU A;  2PPP A;  3JYJ A;  3WQW A;  1JNE A;  2KI3 A;  4JFK A;  5GPR A;  4MNM A;  2MLX A;  3AS1 A;  3G6L A;  4Q7N A;  3RM9 A;  1FKI A;  1CTN A;  3WIJ A;  1UR8 A;  1ZBK A;  4W5U A;  2PPN A;  3WD2 A;  3NI6 A;  4DH0 A;  2ZQV A;  2A3A A;  3FXY A;  1FKJ A;  2XP6 A;  3I6C A;  5DO2 A;  1FKG A;  2ZR5 A;  3CHF A;  4J4N A;  5HWB A;  2DG4 A;  4S3K A;  1WAW A;  3JYM A;  3O5K A;  3WD0 A;  1M5Y A;  3QOK A;  2XP7 A;  3ARX A;  3CZ8 A;  1FJD A;  3O5F A;  4DWS B;  2B31 A;  2Q5A A;  3RFW A;  1W9V A;  2IF4 A;  3CH9 A;  1YAT A;  1FKD A;  4Z2L A;  4ODP A;  4DRM A;  5GPG A;  1C9H A;  1J4R A;  1OGB A;  2O9O A;  4Z2G A;  2XP8 A;  3O5O A;  1J6Y A;  4IT6 A;  3ARZ A;  5HWC A;  1Y0O A;  1FKT A;  1Q6H A;  1H0G A;  1EIB A;  1XRV A;  2PV2 A;  2L2S A;  2DPE A;  5DIV A;  3CGN A;  3UI5 A;  3ARR A;  4JFI A;  4WK9 A;  1EQ3 A;  1SYT A;  1HKJ A;  1BL4 A;  4Z2K A;  1FKK A;  3PRA A;  5HW8 A;  3KCE A;  1GOI A;  2RSE A;  4MNJ A;  1HJV A;  3WL0 A;  2KFW A;  1Q6I A;  3GPK A;  2DT0 A;  1OGG A;  5GQB A;  5J6E A;  2A3E A;  1P5Q A;  3B8S A;  4ML4 A;  3KAD A;  1U79 A;  4DWS D;  4G50 A;  5HUA A;  2DSW A;  4MNL A;  2RUC A;  1J4H A;  2ESC A;  1NWT A;  1HXV A;  3PR9 A;  2RUQ A;  3ODK A;  1E6R A;  1ZBW A;  1HJW A;  4DRH A;  2AWG A;  1NH6 A;  1NWU A;  3H9R B;  3MDY B;  3TC5 A;  4P8W A;  2XP5 A;  2YBU A;  4DWS A;  1FAP A;  4R5E A;  2DT2 A;  2WLZ A;  1QPF A;  4TX0 A;  5HW6 A;  2DG9 A;  2PI6 A;  1ITX A;  4LAW A;  5B8I C;  4ZS6 A;  1JNS A;  3OOB A;  2XP3 A;  1KT1 A;  3ALG A;  4FN2 A;  3KAH A;  4IPX A;  1T11 A;  1HKM A;  3O5G A;  1TFV A;  1EDQ A;  3UQA A;  3ARY A;  4ZPW R;  4Q22 A;  4U84 A;  2A3B A;  4S3J A;  4LGX A;  4TNS A;  3UI6 A;  3WKZ A;  2LKN A;  1ZBC A;  3WQV A;  3ARO A;  1FKB A;  4W9P A;  2FAP A;  5DIT A;  3WH0 A;  1IX5 A;  1ROT A;  2M2A A;  4MSP A;  4ODM A;  1E6P A;  4DRK A;  4QZV B;  3ARP A;  1UR9 A;  5BXJ A;  2UZ5 A;  1LG2 A;  1W1Y A;  4WJX A;  4W9Q A;  3G6M A;  3ART A;  3PRB A;  1A7X A;  4KQZ A;  4MAV A;  2PPO A;  1FFQ A;  3B7X A;  4DRI A;  3RM4 A;  3OA5 A;  2XP4 A;  4LAX A;  1FFR A;  1H0I A;  4TW7 A;  4DRQ A;  2VCD A;  1JNT A;  4Z2H A;  1LL6 A;  3UI4 A;  4MPK A;  4DRO A;  1ZL1 A;  1HKK A;  1HJX A;  1W1T A;  1D7H A;  4ODR A;  1D7I A;  2Y78 A;  5JH8 A;  4R0X A;  4DIP A;  3ARQ A;  3KAI A;  2ZQU A;  1FKR A;  1EYM A;  3TDB A;  2RUR A;  4ZPT R;  4Z2J A;  1EHN A;  4ODQ A;  1W26 A;  2XP9 A;  2ZR4 A;  2M08 A;  2AOS A;  4JFJ A;  4MNK A;  3KAF A;  3O5R A;  1JND A;  2MF9 A;  2MPH A;  3B9D A;  1O6I A;  5HT1 A;  4P8U A;  2KE0 A;  1FKH A;  4HAR A;  4L72 B;  5DEZ A;  2QF8 A;  2OLH A;  4ITZ A;  2DG3 A;  1XHG A;  5HTG A;  2KO7 A;  3IK8 A;  2RUD A;  4PTM A;  1E9L A;  2IUZ A;  4NZC A;  4U86 A;  3KAC A;  1N1A A;  2MNT A;  2MLY A;  4W9O A;  2F4E A;  1E6Z A;  4MTV A;  1FKF A;  1WB0 A;  5DIU A;  1RD6 A;  3CHE A;  3KAG A;  1NMW A;  1LG1 A;  4U85 A;  1PBK A;  3CHC A;  2LGO A;  2RQS A;  1KT0 A;  1ZBV A;  2LJ4 A;  2ITK A;  2KGJ A;  1QPL A;  2LPV A;  2D9F A;  1YW5 A;  3B9E A;  4JFL A;  4WKH A;  4QT3 A;  3FAP A;  3AS0 A;  3LUO A;  4IQC A;  2VN1 A;  1ZB5 A;  2G41 A;  2FDM A;  3IKD A;  2XPB A;  1E15 A;  1LJY A;  2N87 A;  1FD9 A;  4TYO A;  4QT2 A;  3ARS A;  3CGM A;  4FAP A;  4HBE A;  4BF8 A;  1SR0 A;  3O5I A;  2PV3 A;  2A3C A;  5DF0 A;  3KZ7 A;  4Z2I A;  3JXV A;  3EY6 A;  1Q6U A;  1BKF A;  1B6C A;  3ALF A;  2YBT A;  1X6N A;  4P8X A;  1F8A B;  1KFW A;  5HBF A;  2F2D A;  2PBC A;  3FY1 A;  4NNR A;  1X6L A;  3IHZ A;  1PIN A;  2FKE A;  1TCO C;  2WLY A;  3RM8 A;  4ODN A;  1GUV A;  2K8I A;  4GGQ A;  4ODK A;  2G8Z A;  3AS2 A;  2DT3 A;  2F21 A;  1ZK6 A;  2MLZ A;  3TCZ A;  4O2T A;  4ZPV R;  2DSV A;  1QZ2 A;  4KR0 B;  5HKG A;  2OFN A;  3W4R A;  3O5M A;  4G2P A;  1ZU8 A;  3O5E A;  1K9T A;  2ZR6 A;  4GIV A;  3WL1 A;  3RGC A;  4XAK A;  4P8V A;  3B9A A;  2O92 A;  4TW6 A;  2M1I A;  5D75 A;  3B09 A;  4J4O A;  5HW7 A;  4IQ2 A;  3WD4 A;  4L3N A;  1WNO A;  2DT1 A;  1NWR A;  4IT4 A;  3AQU A;  4URI A;  4LAY A;  4NSB A;  1NSG A;  1Q1C A;  3BXW A;  4DRJ A;  2DSZ A;  4DZ3 A;  3WD3 A;  1E6N A;  3RME A;  3CHD A;  4DT4 A;  1LQ0 A;  1HKI A;  1LL7 A;  4ODO A;  2PV1 A;  3PA7 A;  4C02 B;  3O5J A;  1W1V A;  3KAB A;  3PRD A;  4LAV A;  3NRK A;  3UQB A;  3UQI A;  4MGV A;  2ZQS A;  4JFM A;  1J4I A;  1NWS A;  1W9U A;  2XPA A;  2KR7 A;  4TW8 A;  4ODL A;  4WKF A;  1W9P A;  3VAW A;  2JZV A;  3O5L A;  3AS3 A;  3O5P A;  1OWQ A;  4WIW A;  1R9H A;  1D2K A;  3WD1 A;  1GPF A;  3UF8 A;  2WM0 A;  1VF8 A;  3ARV A;  3O5D A;  4QIB A;  4JYS A;  2ZQT A;  2DSU A;  4DZ2 A;  4AY1 A;  4N19 A;  1LL4 A;  4DRP A;  3ARW A;  1F40 A;  1D6O A;  3NTP A;  4DRN A;  3O5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...