1Q6HA

Crystal structure of a truncated form of fkpa from escherichia coli
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
210
structure length
210
Chain Sequence
AFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional studies of FkpA from Escherichia coli, a cis/trans peptidyl-prolyl isomerase with chaperone activity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase fkpA
total genus 69
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2003-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF01346 FKBP_N Domain amino terminal to FKBP-type peptidyl-prolyl isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.460 Mainly Alpha Orthogonal Bundle Helix Hairpins Peptidyl-prolyl cis-trans isomerase, FKBP-type, N-terminal domain 1q6hA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1q6hA02
2RUQA 3IK8A 2MLZA 3O5IA 5HW6A 2LPVA 4TW7A 4J4NA 1F8AB 5I98A 2MF9A 4DROA 3PRBA 4W9PA 1FKJA 4JFJA 1J4RA 4DRNA 3O5EA 1BKFA 3IKDA 3O5PA 4TW6A 4DRHA 4FN2A 4JFLA 2ZR5A 3O5QA 5DIUA 3UI4A 3UQIA 4FAPA 1PBKA 3KAHA 1FD9A 1P5QA 4DRPA 3H9RB 1ZK6A 4DIPA 2ZQSA 2PPPA 4W9QA 1D7HA 2LGOA 3JXVA 4QIBA 5BXJA 2XP6A 4BF8A 4DH0A 2XP5A 3UQBA 2XP4A 3OOBA 4W9OA 2XPAA 2RSEA 1ROUA 1Y0OA 1QZ2A 1M5YA 2ZQUA 5J6EA 1J4HA 2M2AA 1Q6HA 2DG9A 2MLXA 3KZ7A 3RFWA 2ZQTA 4DRKA 1FKSA 2XP8A 2JZVA 3KCEA 1FAPA 5HWCA 5B8IC 2KO7A 3O5FA 5HTGA 3PRDA 2MLYA 5HUAA 1B6CA 3O5JA 1JNTA 4IPXA 2ZQVA 4G2PA 1FJDA 2PPNA 5D75A 2ITKA 1FKTA 1L1PA 1R9HA 4G50A 4MSPA 4QT3A 4JFMA 2DG3A 4N19A 3KABA 2F21A 4LAWA 2UZ5A 1YATA 1FKLA 4QT2A 2RURA 4DRQA 1TCOC 2IF4A 2RUDA 4ITZA 5DITA 3TC5A 3I6CA 4DZ2A 2LJ4A 1C9HA 2OFNA 3KACA 3KAFA 3O5KA 3O5RA 3PA7A 4JYSA 3UF8A 4DT4A 4DZ3A 2D9FA 2KE0A 4U85A 4IQCA 3VAWA 1D7JA 2PV1A 1F40A 1KT0A 3NRKA 3O5MA 1PINA 1T11A 1Q1CA 3KAIA 3O5OA 3TCZA 1BL4A 5HW7A 4DRMA 1HXVA 3WH0A 2LKNA 5HKGA 1EYMA 2ZR6A 1FKIA 3FAPA 4O2TA 4LAVA 1FKBA 4ODNA 4ODLA 1YW5A 2FAPA 1U79A 2MNTA 2MPHA 2L2SA 2PV2A 3KADA 4JFIA 1J4IA 2PPOA 3IHZA 1FKGA 3NTPA 3TDBA 1QPFA 3O5LA 1ROTA 5HT1A 2PV3A 2XP7A 5HWBA 2XPBA 4TYOA 3ODKA 4ODQA 4IQ2A 4ODKA 2Q5AA 2KR7A 3UI6A 2PBCA 1ZCNA 3GPKA 1A7XA 3KAGA 3O5GA 4TW8A 4TNSA 4C02B 3O5DA 4JFKA 4DRJA 2KGJA 1FKFA 2Y78A 2F2DA 2ZR4A 4NNRA 4U86A 4U84A 3CGMA 1N1AA 1Q6IA 2VN1A 4LAXA 1NMVA 4DRIA 2AWGA 3UQAA 2K8IA 2FKEA 3JYMA 3NI6A 3IKGA 4ODPA 1FKHA 1W26A 2KI3A 1J6YA 1FKRA 2RUCA 5GPGA 1FKKA 5HW8A 1JNSA 1Q6UA 4LAYA 3CGNA 4J4OA 1EQ3A 1JVWA 2DG4A 3MDYB 1D6OA 4ODMA 4R0XA 5DIVA 1KT1A 1NSGA 3UI5A 3LUOA 2XP9A 1QPLA 2N87A 3B09A 2XP3A 2VCDA 3EY6A 4ODRA 2KFWA 4GIVA 2M08A 3B7XA 1NMWA 4MGVA 1D7IA 3RGCA 4GGQA 1FKDA 4ODOA 4TX0A 2F4EA 2RQSA 2M1IA 3JYJA
chains in the Genus database with same CATH superfamily
2RUQA 1VQPV 3SJBC 4TW7A 5I98A 3ZMVA 2WLIA 2KSDA 3ARWA 2OIEA 2BTQA 1MZEA 2ATKC 3OMIB 4JI2B 3EIPA 2XNDG 5JH8A 2QDOA 3PJSK 3CX5F 2UXNA 1BE3H 1HNXO 1YCIA 1ZK6A 4XAKA 1HWYA 2GUZA 2WLJA 3JXVA 1YI2V 2OIGA 4ZHQB 4DH0A 2OTJV 3OTOB 4R5EA 2HR3A 1Q86W 1Y74B 1J95A 2DT1A 1UPGA 3CHFA 4O4JB 1VQ8V 2DN9A 2DE0X 1B6CA 1GK9A 1PL0A 2B1IA 2WM0A 3ABUA 3M99B 4B3SB 4DV5O 4FLYA 4LF5B 1OV9A 3FD9A 3SJAC 1IBLO 4YXWG 4QT3A 1FYJA 4HAMA 5FNVB 1KECA 3BAAA 1HR0B 1KP2A 3ZJZA 1XMOB 4DZ3A 3ARYA 3NRKA 3TK1A 3K9AA 1UR8A 2PZSA 2CDYA 5B1AB 2V1DA 1D5NA 4F6EA 2FAPA 3SPGA 4PA9A 4IYHA 4KQZA 2PPOA 4DV5B 1XHXA 1M4UA 1QQCA 4B3RB 3KAGA 1BMFG 2ZXWB 5L3CA 4DV6B 5BR8O 3OAAG 1TVKA 1RM1C 4P8XA 1ZU8A 2X7RB 4HZ3A 1BT8A 2OCCB 4JYYA 3ABTA 4ODPA 3HKBA 5BZBA 3RYFA 1TUEB 2WLYA 3IAYA 1I5XA 1WB7A 2Q4PA 5HW8A 3CXHF 4LAYA 4IL6Z 3HKCA 4ODMA 1FXKB 1KT1A 3OR6C 5FPOA 5LHHA 4B3TB 5BY1A 2QWQB 1IBKB 4NKGB 4JZ2A 1PP9H 2P22C 3T1YB 3X2QB 4FLTA 4I0XA 2RQSA 3IK8A 1K7DA 1MOFA 1Y74A 3BABA 4ABMA 5KMGA 1IBKO 1F7YA 3AS3A 3ARRA 5DM6V 4O2BA 3O5QA 3C90A 1G1XB 3QO8A 4NB5A 4DRPA 2R70A 1P49A 2F1MA 2XUMA 1EZVH 3GWKC 3IC9A 3WU2Z 1I5YA 4AQYB 4PI2A 2EBOA 1GM7A 1Z5VA 2CH7B 4LH7A 1RSOA 2FDMA 2FKXA 3AEIA 3G4SV 1IDSA 3STLC 1W9PA 4LFCO 2B31A 2YEVA 1FAPA 3CSXA 3ABKB 2LP7A 1AJNA 4WKAA 1VIBA 3RT3C 2PPNA 1B3QA 2JGUA 4DRXB 3K57A 3SPCA 2JVDA 2YI9A 5LGTA 2X6BA 2F21A 3CZ8A 4Z2WA 4J41A 2IF4A 1FAFA 4BAYA 4IT5A 3AG3C 2Q67A 1PM9A 2WLNA 2D9FA 2WAMA 2YEVB 1PD3A 2N04A 3SPHA 1YEWA 3CRCA 4RQFA 1YW5A 3CJHA 1KYOF 4WCEV 4TV8B 3KADA 2UU9B 5JWPA 5IYDO 1ZWIC 1GN2A 4X1IA 3ABLB 1QPFA 1XL4A 5IYZA 1B04A 4FIPC 2HHHB 2YDEA 2QJ1A 4FFBA 2PI6A 1AR5A 2Y78A 1Q3EA 4IHJA 2VN1A 2QTOA 4LF9O 2FKEA 5GTIZ 1NKDA 4O4LA 4FZ0A 2ZT9B 5ITZB 2ZM6B 2UXDB 1AI6A 1EFRG 1WLEA 2YBTA 2QWPB 2UUBB 3ASOB 1XEQA 1H2MA 2ZDIA 3SDLA 3AG4C 4O2AA 4QPJA 4GCZA 4WKHA 1NR7A 3WD1A 2M1IA 1ZL8B 4PJ0Z 1YJNV 3JYJA 1AI5A 4WFHA 3MHSC 3WFVA 3THOA 1E6RA 1FXHA 2PI5A 2E5LB 1N33O 2WLMA 3JSNA 3ZS8C 2F66C 3K5NA 1K4DC 4UCVA 1UFIA 2PPPA 5LMNO 2DOSA 5B5EZ 2UXDO 2PTMA 3OFNG 2QKCA 1YJWV 1ZBCA 2WLHA 2XPAA 3B8NA 1NWTA 1S72V 5J6EA 3HPLC 2HJDA 2M2AA 2B9ZA 2WK2A 2ZQTA 2IJHA 1FKSA 5LBQA 2EULA 4HARA 4LFBB 3ZRWA 1GN3A 2CE4A 1NI8A 4TWKA 1EN5A 5LMUO 3RN4A 2AW9A 3H1JH 2O92A 1WB0A 3JD4A 4LAWA 4D6TH 2ODMA 2DSWA 1I94O 2RURA 1GKFA 2F23A 1EM1A 3K06A 1Y66A 3BEHA 2UUBO 2PV1A 1HXVA 2KKWA 2F43G 4GZRB 1YSCA 2ZKOA 4FLXA 2Z0AA 2FL4A 4JI0O 1HDJA 2LW1A 4KP4A 5CA1A 5LMUB 3IHZA 3RGBA 2VQEO 3FAVA 2E76B 4DWSD 1T5EA 4JPRA 1M1KW 4U7OA 4L8JA 1K92A 3TXQA 1P4RA 1EIBA 4DR7B 4LR3A 3RFRA 4TV9A 3F5WC 3BCCH 3ETDA 3NXSA 4DRIA 3L72H 3OT7A 1ZL1A 4UCUA 1SQFA 2QGNA 2X6AA 5JJEB 1XNRO 4DR6B 2Q7HA 5KHHA 1LUWA 5LMNB 1TAEA 2N74A 2IJJA 1X4TA 5IJ0B 2ZDIC 1X59A 4PI0A 3FY1A 5DIVA 3STZC 2A3QA 3UQ8A 2AZ2A 1YIJV 3EY6A 2H94A 3SJCC 1I0HA 2M6YA 3P32A 2BCCH 4ODOA 4I5SA 3B8MA 3WL1A 2IH3C 1ZUQA 3OEEG 2L35A 4DROA 4DV7B 3VOUA 2QTSA 4PDMA 4JYBA 1BKFA 4DRHA 3EXAA 4JFLA 4FAPA 1NH6A 1NWUA 5IY5C 1W1PA 4DWSB 3LSQA 4LGXA 4DR3B 2LGOA 4W5UA 2ZM6O 4LC1A 5LL6Y 1AR1B 4UDMA 2XP4A 4FLZA 1N0JA 4QNHB 2DSVA 3EHBB 4YHHB 2CK3G 3T4DA 4FK5C 2M7WA 1AR4A 1WB8A 4KUMA 2HHHO 1HJXA 1SA0B 2F4VO 2IBZH 3ABKC 4CH3A 4G2PA 1JFFB 4CS4A 4HBEA 3AG1B 1CEZA 2YICA 2UXCO 3HKDA 4QGPA 4ITZA 2RUDA 4BR6A 3RM4A 2KQXA 5LXTA 3PA7A 2D2CB 3QO5A 3L75H 3GB7C 4R50A 2NR5A 1HNWB 2PF4E 4BIOA 1K5QA 3LDEA 4MTFA 1R73A 1EN6A 2MNTA 5CA1B 3QNEA 2H8PC 1P7BA 2YXLA 5H9CA 4B08A 3WKZA 4QZVB 3ZEDA 1L8DA 1WP7A 3PRAA 3CHEA 3UI6A 4PDRA 4ZS6A 4NXNB 5D5PA 4I7ZB 3ZHSA 3ARQA 4YHHO 1IVSA 4H13B 3ZMSA 4QE9A 4H37A 3BVOA 2JGDB 1LUVA 5KHGA 3RYHA 1XMQO 1K34A 2RUCA 3ZHTA 5IDJA 1RFYA 3ARXA 1CPYA 2EJ7A 3FB7C 4I50B 3RYHB 3I55V 1MSWD 1JVWA 2W0XA 5BMVB 1XMOO 2A0LA 2VCDA 3MAQA 4EFEA 4O4HB 4DW0A 4I4TB 4A5UB 2IUZA 4RAIA 2Y4TA 4TQDA 1KMIZ 4JFJA 4L3NA 3O5IA 4D7TA 2ADPA 3SYAA 4C7UA 4TW6A 2OT5A 5DIUA 2A3EA 3B9DA 1PBKA 4EB6A 3E22A 3N2KB 1FD9A 4E2LA 2GTSA 4I55A 3E89A 1XMQB 3OOBA 3RWRD 3AG2B 1AP5A 4W4KA 5LP6A 3E2EA 4LBEC 4MW3A 3SYQA 4XBFA 2VWKA 1PPJH 2ESCA 4ZPWR 3W4RA 3G6EV 3ETGA 4B3RO 2E75B 1BSMA 3O5JA 4UFZA 1FJDA 1VF8A 4PD4F 2ITKA 3IC7A 1R9HA 4WBNB 1Y6XA 4GX5A 2ZD9A 1YATA 1ITXA 3LNNA 2ETNA 4JYSA 1WAZA 1QBZA 5LP6B 3O5OA 5KHJA 4Z1VA 5HKGA 3UKMA 1U96A 3RVYA 4MPKA 4J11A 2LGQA 4IIJA 4F6RA 1XNRB 1Q8IA 2RNBA 3MDSA 5GW7A 1COWG 4P8VA 4DR2B 1XBLA 4LF4O 1ZCNA 3CRAA 1R6TA 4TNSA 1ZSPA 2MW2B 4P8WA 4U86A 2VQEB 3QF7A 2OCCC 3UT5A 3ARSA 1HJWA 4LAXA 2P06A 2WPDG 1E1QG 4FLWA 4DRXA 3H01A 4TT3G 2CTWA 2DT0A 4JTCB 3J7AU 4X20A 1XL6A 3LDCA 4I50A 1NSGA 3EVKA 1QPLA 1I94B 1N34O 2QKSA 1VEWA 3H1HH 2LQTA 3TXSA 4R7CA 3WL0A 4TV9B 1I7FA 1QR9A 3WD4A 3JAMN 3QO7A 4Z2HA 4J4NA 2O57A 2HEPA 3CHXA 1FKJA 1R1BA 1MABG 2UUCB 3JARB 3AROA 2NNUA 4UCSA 3ALGA 3FYIB 4DR4B 1SQGA 4UVCA 2RSEA 1VQ4V 3N2GA 2Q69A 3ZN1A 3K79A 1HNZO 2QWRB 3OUFA 5EZYA 1VF7A 1S76D 1H0GA 1XRVA 1X6NA 2QM7A 1FXKA 5HTGA 2L6LA 1OCOC 2UXBO 1E6NA 1WJZA 5H6RA 4D7SA 1M5IA 4LP8A 3CC7V 3ZRWB 4CS2A 3QG5A 1S5JA 1VF5B 3TCUA 4DW1A 2DT3A 3AG1C 4WFFA 1W2BU 3ALFA 4DV1O 3CRRA 1BHAA 4PDVA 1SQQH 3JD1A 5GTHZ 1HKJA 1D7JA 5F2VO 4NXMB 1KT0A 3OW2U 1W0JG 4DV2B 3CCJV 1Y67A 3JAWB 4AY1A 1IURA 3OMNB 2MPHA 1ZLZA 4HYOA 1F4MA 3ARPA 3VQXA 2YXHA 2YIBD 4N23A 2IJKA 1DGSA 1XQ8A 2C2AA 2XP7A 4J7ZA 2GSMB 4JYCA 2G38A 3CMEV 5TISZ 3Q4HB 2ZE8A 1XNQO 2EINC 3CCUV 1K73W 4NTXA 2DWDC 4Z2KA 3ZHUA 1UJWB 1Q6IA 5FNVA 3M8AA 2AWGA 1ZBVA 3NI6A 1BS3A 5A2QN 2V7QG 3JCUZ 4WIWA 5GPGA 1NTKH 2HVKC 3CCLV 2CUGA 5GQBA 3ASOC 1CXZB 3ZMUA 5KUMA 4X62B 3K08A 3CCEV 3CCSV 3A2FA 3JAKA 3JARA 3ARTA 1AILA 2VS0A 2KG7B 3D3QA 1FFRA 1SETA 5L3EA 2LPVA 3ARZA 2MF9A 2GV9A 2QSAA 2XOKG 3KKYA 1XREA 3IKDA 3UI4A 1SC5B 1AI7A 4JI3O 3HR0A 5IJ0A 5EYPB 4PDLA 2AHZA 3E22B 5L3BA 2XAJA 1DK1A 1V9PA 4Z1MG 4CC5A 1OWQA 1VARA 4UV9A 4JI1O 3UM7A 4WK9A 5KHKA 3CYOA 5LYJB 1TGOA 4X1KA 4Z2LA 1NWRA 5DN6G 5BR8B 2JZVA 4DV6O 1M57B 4LCUC 3CE2A 4LF4B 3K58A 4DR1B 2MLYA 3SPIA 3UT5B 4UB8Z 1QVGU 2ZIOA 1SYTA 3T1YO 3ABLC 4P30A 2KG7A 1SQPH 4MNKA 3ML0A 2EJRA 1GTOA 4I9WA 1OCCB 4JGSA 3UF8A 5DO2A 1V55C 4DXWA 2Z5UA 3FFQA 1Z2GA 1H2LA 2X6CA 4YIPA 5HW7A 4F6RB 4PTMA 2A7WA 4LAVA 1FKBA 4QPKA 2Q5ZA 1IXBA 3JCZA 2PV2A 1KUQA 2GBOA 3HKCB 1LL4A 4OX9O 5IYBO 4MTOA 1O9HA 1R3LC 2E3CA 1OZ0A 2KR7A 2BE3A 4Q20A 4TW8A 1S3JA 3RW0A 4JFKA 3U10A 1MZFA 5CMUA 3C3SA 4URIA 1KB9F 4UXNA 1SR0A 2CGNA 2P90A 4H0LB 4DK0A 5IWAO 4JI8O 1BQZA 2DJVA 2X0LA 2DMXA 5EIBC 1HNXB 2RMKB 2AOSA 1EQ3A 3P30A 3L71H 5HFLA 3KG2A 4EEQA 3WB2A 1TUBA 2RN9A 3B09A 4NTYA 3TETA 3L9DA 5DEZA 1TUBB 1NMWA 3S3XA 1GRJA 1ZL8A 2CTQA 1YVWA 3C3TA 1NU1H 3L74H 2P6JA 1AJPA 2LJ2A 4B3SO 4WFBV 4FLUA 4DR1O 2XHBA 3G6LA 2ITCC 1N32B 1V54B 2WLZA 1QLEC 4YJ2B 4DWSC 2BSKA 4WFEA 2Y0PA 1XILA 4TV8A 5IWAB 1KKDA 3E8GA 3QVNA 4MVUA 5HFMA 4WKFA 2G41A 2DG9A 4X65B 3RFWA 3KCEA 2HP8A 5EIBD 4JTAB 2P67A 3CEIA 2V4DA 5HUAA 2JS3A 1ZBWA 2MK3A 1J5EB 3CHDA 3CJHB 1K97A 3ETEA 1IBMB 2EIJB 3ETQA 4UV8A 3JD2A 1JA8A 3CMAV 1TCOC 4UCRA 2OFNA 3KAFA 4X62O 2AXTZ 3B9AA 1P7GA 4X20B 1ZB5A 1F40A 3B77A 3A0BZ 2FYUH 3O5MA 2JEUA 1W1YA 3T4ZA 2YIDA 3D36C 1HR0O 1KFWA 5J2UB 1K8AW 3KZIZ 1IBLB 5J2UA 2L2SA 4GKKO 1W1TA 5LXTB 3ZRVA 4B3MB 5DEDA 1NTZH 5L3DA 3BPZA 4WFAV 4B7EA 4JV5B 2R9RB 1E6ZA 1FKFA 3JAKB 2GTAA 2N05A 2HG5C 1H2KA 3MD0A 1SA0A 4MSWC 2CH7A 4IGGA 5JQGA 1FKHA 3QOKA 1FFQA 1U97A 3B4SA 1FKRA 5CBGA 4DR3O 1D2KA 2OTLV 2Q9LA 2YIAA 2K9PA 2ZNIA 4J4OA 3JASB 3UO3A 3K5OA 4FVMA 3WD2A 4YY3B 1SZTA 4X8AA 1QVFU 2FB5A 1SERA 3K5LA 2WSSG 1F23A 4OPAA 3RGCA 2RCVA 4DV3B 4GGQA 3ABMB 1FKDA 1H2NA 2A3BA 3G80A 2CGOA 4YJ3A 4UVAA 5JH7A 4YJ2A 1ZTEA 3CC2V 4DRNA 4E4EA 3W7XA 3OUSA 4RQEA 1LR1A 3SGIA 1XHGA 3KCXA 3RVZA 4ZKIA 1G4YB 4JI1B 2DYRB 3R65A 1KBHA 4W9QA 2XP6A 2ZINA 3APQA 3UQBA 4U3JA 1TA8A 3DXRB 2ZQUA 2A3AA 3AQUA 1J4HA 5IJ9A 4K0KB 4JI4B 1N33B 4YIOA 4LF8O 4S3KA 1QCEA 5JCOC 1M56B 1JNTA 2Y4UA 4IPXA 1D5AA 5FL7G 1YTFD 4QIWF 1NVPD 3ZRXA 4DV3O 1OCZC 2WA4A 3J81N 2UZ5A 2DQ3A 1NQTA 2DWEC 2W0FC 3N2GB 4DZ2A 5JJNB 4CC6A 2WLLA 1FJGB 5KHIA 1SZXA 2VQFO 4YY3O 5B3SB 1VQLV 4IHJB 3VAWA 5EBMC 1VQOV 1WPXA 2Y0IA 4ODLA 2ZNJA 1JX9A 4ZHQA 5JJJB 5C93A 1FKGA 3NTPA 3WB1A 5CB4A 2DSZA 2AZ0A 1N36B 1XNQB 4JV5O 1LJYA 4ASUG 1A7XA 5E79Z 4J7KA 1N36O 2YIBA 1H2SB 5H5NA 4U84A 3VQWA 1H8EG 2F95B 5BXZA 1E6PA 4OXSA 1K5SA 3H1KH 4DR4O 4DO2A 2GUZB 1FKKA 4MTXA 1YTFB 3WQWA 1O9GA 3E8FA 3T1HO 2PI4A 2VQFB 4R0XA 5EK0A 5JVDA 5LYJA 3OMAB 3UI5A 1O6IA 1JVMA 3L73H 4TSFG 5KA6A 3FXYA 4MGVA 1EN4A 4PHZA 2R72A 2JRIA 4BW5A 2F4EA 1Q81W 3ASNC 3OEHG 4ML4A 2MLZA 1JFFA 3J80N 1A32A 1RSOB 4LF8B 3BA8A 4FM2A 3APOA 3DXRA 4TUYA 2D3OW 5EC2C 1J4RA 2ZR5A 3UQIA 1YF2A 1KKCA 3CWBH 1JMKC 4QIBA 2XAHA 5B1BB 4PA3A 4UB6Z 5CA3A 3LSUA 5IYCO 5JH7B 1M5YA 4MW8A 1R3JC 4J7JA 4PELA 2K1EA 2MLXA 1THZA 1N32O 5HWCA 1OCOB 4IYIA 4HBNA 1N4CA 5EBWC 2YS8A 3PN1A 1E1RG 2DG3A 2YBUA 4BIZA 4EKWA 3G6BA 1SS3A 3CXCU 1C9HA 4X88A 1OGGA 3Q4HA 4WFGA 2NLJC 3F5TA 4TQFA 4X64B 1YHQV 4JI5B 2DYSC 4PA4A 1SQXH 1IZ3A 4JAAA 3KAIA 3B2EE 1JOYA 1WNSA 2UUAO 4PA7A 1JCHA 3B40A 2XT9A 2JEXA 4EB6B 5J9PC 1D2DA 4MNMA 3IJ4A 3JAWA 4Q7NA 4MVSA 3MHHC 1DLBA 4NXNO 4ODQA 4IQ2A 2PBCA 2F93B 1GM9A 3FB6C 2ZR4A 4K0KO 4L87A 4KHPO 2DSUA 1BCCH 3UQAA 1R6KA 1E9LA 1ZX3A 2W6IG 3ZMZA 1ZAUA 1K9TA 2DW4A 4FM1A 4AQYO 1Q6UA 4J9YB 5L3FA 1HNWO 2ZE7A 3MDYB 1PNKA 5KLVH 4MVQA 1DF4A 4JYAB 3DGEA 4I4TA 3R66A 2XP9A 3LUOA 1I08A 4O4HA 3UO2A 3OM3B 4J10A 1ZBKA 5J2TA 4GUNA 3OGCC 4ZPVR 3EFFK 1EHNA 1GOIA 2A9HA 3U11A 3ZN0A 4DK1A 1QNMA 2JGDA 3O5EA 1Y4MA 2IW5A 4JASA 3QTCA 1WAWA 1KC8W 4OPHA 2ADQB 2BSKB 3BY6A 2WA3A 3DSQA 3JYCA 1OHHG 4P2ZA 3BA9A 1GO3F 3WIJA 2HKOA 2R9AA 4X1YB 2XAGA 3K0GA 1G8MA 1URFA 2ZIMA 4KHPB 1JNDA 3PR9A 4G27B 3VQVA 2ITDC 3WG7B 4G28B 5HBFA 1PKXA 3O5FA 3FX7A 4B3MO 4U7NA 1NVPB 1K3EA 3K59A 3T2MA 2OLHA 2EZOA 4PA6A 4MSPA 2LFRA 3CCMV 2Q7GA 4DRQA 1W0KG 1HKIA 2LJ4A 3O5RA 1R3KC 5CBHA 4DT4A 2QA4V 4DV4O 4FZ1A 4JI5O 1LL7A 4ZI7A 4P9OA 1W59A 1JCHB 3TCZA 1BL4A 4DWSA 1LG1A 2LKNA 1PNLA 3H1IH 1FKIA 3FAPA 2PN0A 4DR6O 1IBMO 5B66Z 4FFKA 4JFIA 4UVBA 2EIKB 1NT2B 2DT2A 3F7YC 3H9VA 3B9EA 1K9MW 1R6NA 2CTPA 4MTVA 1W9VA 4NSBA 3O5GA 1AP6A 2RJZA 5H6QA 2Z3YA 1F51A 1IX9A 4X65O 4U3FH 1B6QA 4DUYO 4QJFB 1Y76A 1SQVH 4LF7B 1CTNA 1IX5A 5JQGB 3JYMA 4O4IB 2KI3A 1F4NA 1M93A 4X9QA 5LHIA 4MNLA 3GVMA 1K33A 4WJXA 4NR1A 1US6A 2A79B 3BRCA 2P7TC 1OGBA 1PV0A 3CRMA 4DV7O 2KFWA 2EINB 4MVZA 5B1OA 3W7UA 1NWSA 4TX0A 4X66O 2EILC 5L3GA 2ARHA 4TUYB 3WQVA 2QM8A 3FAVB 4TOIA 1JQ0A 2WLIB 3G67A 4LFBO 1F8AB 3RM8A 3PRBA 3ZRSA 2VRZA 3ZIAG 4JYAO 1ORQC 3JATB 1QLEB 2Q7EA 1NS1A 4MVOA 3OD4A 1Q7YW 4KL1A 1M9NA 2IU3A 1Q5OA 4JAVA 3K3WA 2QWNB 2GDSA 1VF6C 3HB3B 5B1BC 2P5OA 4JI7O 5EC1C 1DTOA 1JJ2U 1OCCC 3CPWU 4EFBA 1Y0OA 4DV0O 4GX0A 4MAVA 1WA8A 4JI3B 1Q43A 1FFTB 5KX5A 1KD1W 4O2BB 3D3IA 5KMGB 1RD6A 1BHBA 1LG2A 5JCOA 1HKKA 5CBFA 5D75A 1FPOA 3CHCA 4I0XB 4JFMA 2B5UA 2EIJC 4JI6B 4DUZO 3E86A 2RDCA 5DITA 1GH6A 3I6CA 3RBZA 3O5KA 3CH9A 1EZJA 4K8ZA 1RP3B 4Z2IA 2PYLA 4U85A 2JK5C 2DYSB 3BHPA 1PINA 1XI1A 3K03A 5CA0A 3WH0A 1M57C 2VWJA 1B06A 2OYQA 3FYEB 3D36A 3RYIB 1U79A 4Z2GA 4AILC 3HKBB 1SRYA 4GX1A 2YUAA 5LOVA 5LA6B 2Y69C 3LDDA 3SYOA 4B7KA 1WP8A 4NVPA 1J4IA 3D8CA 1BQ0A 1R3IC 4NTWA 2ZE6A 2PV3A 1P84F 2DQ0A 3JD3A 4DR7O 2EZPA 2JDIG 1V55B 3BMBA 4WF9V 2LO1A 4DV0B 1WNOA 1N1AA 4KFMA 3LNMB 1NR1A 3TJTA 1FXVA 3I56V 4BIUA 3T1CA 5ITZA 4IT6A 1M90W 2O9OA 1JNEA 4AHCA 2E74B 5LA6A 5H2FZ 1N8RW 1D6OA 1RPOA 2EIMB 1G6UA 1HKMA 2GHYA 4LF6O 5CA0B 2M08A 5CN0A 1RM1B 2XAFA 3IGAC 4ZOLB 4X66B 2QR4A 2H3OA 5C8YA 4PV1B 2PY5A 4LF6B 4XDLA 4Z2JA 4O4LB 1YZBA 1HP8A 3W7WA 5FPRA 3CB2A 2DYRC 5GONA 5BXJA 1D7HA 4W4LA 4S3JA 1VQMV 1E79G 2ZCEA 1AVMA 3UCSC 2A3CA 1SKVA 3X2QC 4K35A 1QLNA 5J2TB 1OCRB 4CH6A 1ENVA 3CCQV 3JALA 2YC0A 1SQBH 2XP8A 3JSLA 3AS2A 2IH1C 3WG7C 2ZR2A 2E5LO 1BZKA 5D5QA 3PRDA 1V54C 4XDJA 1KQSU 3CP1A 3SYPA 1VQ5V 1L1PA 1OCZB 2Q68A 1VMGA 2HVJC 3HKEA 4I9QA 3FB5C 4AI8A 3KABA 2Q8VA 1K4CC 3TC5A 1HJVA 4LNUA 3NR7A 3KACA 2YXYA 1VQ6V 4HNAA 3U0ZA 4MNJA 4ZPTR 4DYLA 4X1KB 1NH2B 2Y48A 1EYMA 1MMMA 4MS2A 1TFVA 1XOUA 3F7VC 1YJ9V 1GN4A 4DUZB 4JI6O 2PYJA 4CH5A 1J5EO 2G8ZA 2EIKC 4CZZA 4DUYB 4TYOA 3ZCCA 3O65A 4JF3A 3JD0A 3GPKA 3AG3B 2KGJA 1Z5WA 4FM0A 3ICXA 3ABMC 5C8YB 2UU9O 4GKKB 3AG7A 2FMLA 3H1LH 1GN6A 4BWAA 1AI4A 5GPRA 4J42A 1NJIW 2WWWA 4GYCB 4DV4B 3AK3A 2N87A 4XDKA 2JIZG 1Y76B 3WD3A 1D7IA 4MVMA 2JJ2G 1BGYH 1QHTA 5IE9A 2BTOA 2OWOA 4X89A 4IT4A 3FB8C 2HFEC 3O5PA 5AG2A 2QF8A 3K9SA 3FKSG 1AB3A 5LHGA 4I55B 1LL6A 4LWSA 2IJIA 4UCTA 1VQ9V 4GLXA 3AK1A 2ZQSA 2XTAA 2ZR3A 3ZHVA 3N2KA 5LOVB 4L72B 3AG4B 2UXXA 3KCYA 1L1FA 4RO2A 4W9OA 3AS0A 4O2AB 4Q22A 2BOCC 3LSSA 4GKJO 3DC6A 4LF7O 4X1YA 2NN4A 4RUEA 4DRKA 2CAZC 4H33A 4JI2O 3BFRA 2YSUB 5EZYB 5B8IC 5DECA 3SR2C 2ZQVA 4O4JA 4MT8A 3RYIA 4MTGA 4QT2A 1GM8A 3ZX6A 2UUAB 5B1NA 1EBOA 2A06H 4FFBB 5KX5B 1RPRA 4IQCA 3G6MA 1NBMG 1WA8B 3A8TA 3RYCB 1Q82W 4JI8B 1FS0G 4MVRA 4K8XA 4KXRA 2QWOB 2ILMA 1W1VA 4R8CA 1M56C 2QKAA 1FKAO 4UUJC 4NZCA 5HT1A 3I5DA 2DPEA 3GU0A 4ODKA 4C02B 1GPFA 3A0HZ 5B3SC 3ZHRA 2F2DA 2WLLB 1N0NA 1YXBA 4J9ZB 3ASNB 2RQ6A 4GKJB 1NMVA 3OTFA 3CRQA 1VQ7V 3IKGA 3OTOO 1W26A 3OA5A 1J6YA 1BL8A 4X64O 1H2GA 3RM9A 3CS5A 3JATA 1UR9A 2JS5A 5EYPA 1VQNV 3B7XA 4LWSB 4LF5O 1YITV 4IIJB 1W9UA 5HW6A 4KR0B 4JAUA 1JR9A 1GMGA 1DF5A 2OCHA 1S5HC 4K3AA 1PL4A 2ZE5A 4FN2A 5K1PA 2W6JG 3H9RB 3SJQC 4NYKA 1OJHA 3ZBHA 3E35A 1MNGA 1ROUA 1GAXA 1FFXB 1OCRC 2CTRA 2IM9A 1H38A 4ZOLA 1Q6HA 4RUFA 4JTDB 3WD0A 1EDQA 1XDCA 2BOBC 2ZQMA 2QM4A 2PGGA 1WPBA 2XASA 4ZBMA 3RYFB 2P4VA 3W7TA 1IXMA 2LGWA 4OX9B 1FKTA 4QE7A 4G50A 2R9IA 1L0LH 4FLVA 3S3WA 3CCRV 1TVKB 2LW7A 1SF9A 2QE7G 1KU9A 3VQYA 4ZI7B 4GX2A 2PUSA 4RWUA 4NXMO 3T1HB 3O9OA 2KE0A 3ARVA 1ROPA 4HBOA 1Q1CA 1FJGO 4DRMA 5B1AC 1H8HG 1XUQA 2ZR6A 3SPJA 4ODNA 5KA5A 3LUTB 4LFAB 3DC5A 3P3PA 3K0DA 3TDBA 1L0NH 3O5LA 5A9GA 4DR5O 4LNUB 2F4VB 1E44A 2AHYA 2UXBB 2Q5AA 2ZXWC 3VBBA 1JPXA 4BW9A 3RMEA 2QEXV 4JI4O 4DR5B 3SYCA 2YI8A 3CGMA 5K1XA 1E15A 4P9PA 4CBCA 4P8UA 4JI0B 4H44B 1Q90D 2FTKA 3M7MX 3B8SA 1KP3A 3JALB 5CB4B 2B5UB 3CGNA 3RYCA 4LH6A 1YDXA 1FXKC 5BMVA 2UUCO 2DG4A 1S77D 2HJFC 5E1AC 1MG1A 4JZGA 4FMTA 4DV1B 2EX3A 2P4KA 2XP3A 4ODRA 5GONB 1H0IA 1LNQA 5FLXN 1PNMA 3OR7C 3AG2C 5KAFZ 4GIVA 3N27A 1WN7A 1MSDA 3WB0A 4W9PA 1CP9A 4GT1A 4LFCB 1AROP 2BTQB 2IU0A 2Q0AA 3KAHA 1P5QA 5IY5B 4OGQB 4DIPA 2KB1A 3E83A 4BF8A 4JI7B 2XP5A 1VP7A 1VQKV 4LF9B 5KUKA 1VF6A 2Q73A 3A0RA 4Q6GA 3ZMTA 3CC4V 1QZ2A 1SESA 1S0VA 3KZ7A 5LP6C 3GTYX 1AJQA 3E8BA 2HLDG 3OGIB 2KO7A 2Q0OC 1XHZA 1HW7A 1QU7A 3L70H 4CS3A 1GUVA 3HKDB 4G2KA 5IT9N 4N21A 4LFAO 1X6LA 4N19A 3P3NA 1FKLA 1N34B 5IJ9B 5LGUA 4DV2O 4YJ3B 2B1GA 2JJ1G 4O4IA 4B3TO 3K04A 1NZ6A 3GWOA 1LQ0A 1NH2D 3ARUA 4U3JB 3ZHQA 3AK2A 1T11A 4ZIBA 1QR8A 4O2TA 3IFXA 5LGNA 3BXWA 3K5MA 4FPPA 2Y69B 5DF0A 4R6ZA 5IYZB 3DTUB 4ICGA 1S5LZ 1ROTA 1FFXA 4X1IB 1NTMH 5HWBA 2XPBA 3ODKA 4WBNA 4CH4A 4F4LA 3O5DA 4DR2O 4DRJA 1JJOA 4NNRA 3CCVV 1HNZB 3AS1A 2EILB 2XAQA 2K8IA 2Q6AA 2AGAA 3OE7G 4J80A 3JASA 1MA1A 1JNSA 2WLKA 5EBLC 5JVDB 5KAIZ 3G71V 4FJCC 2EIMC 4HNAB 2LFSA 3W7SA 3TGUH 4UCOA 3CD6V 3E8HA 2UXCB 3HKEB
chains in the Genus database with same CATH topology
2RUQA 2A3BA 4L3NA 3O5IA 4TW7A 5I98A 3ARWA 4Z2JA 4DRNA 4TW6A 5JH8A 5DIUA 2A3EA 3B9DA 1PBKA 1XHGA 1FD9A 1ZK6A 4XAKA 4W9QA 1D7HA 4S3JA 3JXVA 5BXJA 2XP6A 4DH0A 2A3CA 4R5EA 3UQBA 3OOBA 2ZQUA 2A3AA 3AQUA 1J4HA 2XP8A 3AS2A 2DT1A 2ESCA 4ZPWR 3W4RA 3CHFA 3PRDA 4S3KA 1B6CA 3O5JA 1JNTA 4IPXA 1FJDA 1VF8A 2WM0A 2ITKA 1L1PA 1R9HA 4QT3A 3KABA 2UZ5A 1YATA 1ITXA 4DZ2A 3TC5A 1HJVA 3KACA 4JYSA 4DZ3A 3ARYA 3VAWA 4MNJA 4ZPTR 3NRKA 3O5OA 1UR8A 5HKGA 1EYMA 1TFVA 4MPKA 4ODLA 2FAPA 2G8ZA 4KQZA 2PPOA 1FKGA 3NTPA 2DSZA 4P8VA 4TYOA 1LJYA 3KAGA 1ZCNA 3GPKA 1A7XA 4TNSA 2KGJA 4P8XA 1ZU8A 4P8WA 4U86A 4U84A 3ARSA 1HJWA 4LAXA 1E6PA 4ODPA 2WLYA 1FKKA 5HW8A 2DT0A 5GPRA 4LAYA 3WQWA 4ODMA 4R0XA 1KT1A 1NSGA 3UI5A 1O6IA 1QPLA 2N87A 3FXYA 3WD3A 4MGVA 1D7IA 3WL0A 2F4EA 2RQSA 3WD4A 4ML4A 3IK8A 2MLZA 4Z2HA 4IT4A 4J4NA 3AS3A 1FKJA 3ARRA 1J4RA 3O5PA 2QF8A 2ZR5A 3O5QA 3UQIA 4DRPA 1LL6A 2ZQSA 3AROA 4QIBA 3ALGA 4L72B 4W9OA 3AS0A 4Q22A 2FDMA 2RSEA 1M5YA 1W9PA 4DRKA 1XRVA 1H0GA 2MLXA 1X6NA 2B31A 1FAPA 5HWCA 5B8IC 5HTGA 1E6NA 2ZQVA 4WKAA 2PPNA 2DT3A 2DG3A 2YBUA 2F21A 4QT2A 3ALFA 3CZ8A 2IF4A 1C9HA 1OGGA 1HKJA 2D9FA 4IQCA 1D7JA 3G6MA 1KT0A 3KAIA 4MNMA 1W1VA 1YW5A 4AY1A 2MPHA 4Q7NA 3KADA 3ARPA 4NZCA 1QPFA 5HT1A 2XP7A 2DPEA 4ODQA 4IQ2A 4ODKA 2PBCA 2PI6A 4C02B 1GPFA 2Y78A 2F2DA 2ZR4A 2DSUA 4Z2KA 1Q6IA 2VN1A 1NMVA 2AWGA 1ZBVA 3UQAA 2FKEA 3NI6A 1E9LA 3IKGA 1W26A 3OA5A 1J6YA 4WIWA 5GPGA 1K9TA 1Q6UA 2YBTA 5GQBA 3MDYB 3RM9A 1UR9A 3LUOA 2XP9A 3ARTA 1ZBKA 3B7XA 4WKHA 4ZPVR 3WD1A 2M1IA 3JYJA 1EHNA 1W9UA 5HW6A 1GOIA 1FFRA 2LPVA 3ARZA 4KR0B 2MF9A 1E6RA 3O5EA 3IKDA 4FN2A 3UI4A 1WAWA 3H9RB 2PPPA 1ZBCA 1OWQA 3WIJA 2XPAA 1NWTA 1ROUA 4WK9A 5J6EA 1JNDA 3PR9A 2M2AA 4Z2LA 1Q6HA 2WK2A 2ZQTA 1FKSA 1NWRA 3WD0A 2JZVA 1EDQA 5HBFA 3O5FA 4HARA 2MLYA 2OLHA 1FKTA 1SYTA 4G50A 2O92A 4MSPA 1WB0A 4MNKA 4LAWA 2DSWA 2RURA 4DRQA 1HKIA 2LJ4A 3O5RA 3UF8A 4DT4A 5DO2A 2KE0A 3ARVA 2PV1A 4HBOA 1LL7A 5HW7A 1Q1CA 1HXVA 3TCZA 1BL4A 4DRMA 4DWSA 1LG1A 2LKNA 2ZR6A 1FKIA 4PTMA 3FAPA 4ODNA 4LAVA 1FKBA 2PV2A 1LL4A 4JFIA 3IHZA 2DT2A 3TDBA 3B9EA 3O5LA 4MTVA 4DWSD 1W9VA 2Q5AA 2KR7A 1EIBA 3O5GA 4NSBA 3RMEA 4TW8A 4JFKA 3CGMA 1E15A 4URIA 1CTNA 1IX5A 4DRIA 1SR0A 1ZL1A 4P8UA 3JYMA 3B8SA 2KI3A 4MNLA 3CGNA 2AOSA 4WJXA 1EQ3A 3FY1A 2DG4A 5DIVA 1OGBA 2XP3A 3B09A 3EY6A 4ODRA 2KFWA 1H0IA 5DEZA 1NMWA 1NWSA 4ODOA 4TX0A 4GIVA 3WL1A 3WQVA 1F8AB 3RM8A 4DROA 3G6LA 3PRBA 4W9PA 1BKFA 4DRHA 2WLZA 4JFLA 4FAPA 1NH6A 1NWUA 4DWSC 1W1PA 3KAHA 1P5QA 4DWSB 4DIPA 4LGXA 2LGOA 4W5UA 4BF8A 2XP5A 2XP4A 2DSVA 1Y0OA 1QZ2A 4MAVA 4WKFA 2G41A 2DG9A 3KZ7A 3RFWA 3KCEA 2KO7A 1HJXA 5HUAA 1RD6A 4G2PA 1LG2A 1GUVA 1HKKA 1ZBWA 4HBEA 5D75A 3CHCA 3CHDA 1X6LA 4JFMA 4N19A 1FKLA 1TCOC 2RUDA 4ITZA 5DITA 3I6CA 3RM4A 2OFNA 1LQ0A 3KAFA 3O5KA 3PA7A 3CH9A 3ARUA 3B9AA 4Z2IA 4U85A 1ZB5A 1F40A 3O5MA 1PINA 1T11A 1W1YA 3WH0A 4O2TA 1KFWA 4Z2GA 1U79A 2MNTA 3BXWA 2L2SA 5DF0A 1J4IA 1W1TA 3WKZA 4QZVB 1ROTA 2PV3A 5HWBA 2XPBA 3ODKA 3PRAA 3UI6A 3CHEA 4ZS6A 3O5DA 1E6ZA 4DRJA 1FKFA 4NNRA 3ARQA 3AS1A 1WNOA 1N1AA 2K8IA 1FKHA 3QOKA 1FFQA 1FKRA 2RUCA 1D2KA 1JNSA 4IT6A 3ARXA 2O9OA 1JNEA 4J4OA 1JVWA 3WD2A 1D6OA 1HKMA 2VCDA 2M08A 3RGCA 4GGQA 1FKDA 2IUZA 4JFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RUQ A;  3IK8 A;  2MLZ A;  3O5I A;  5HW6 A;  2LPV A;  4TW7 A;  4J4N A;  1F8A B;  5I98 A;  2MF9 A;  4DRO A;  3PRB A;  4W9P A;  1FKJ A;  4JFJ A;  1J4R A;  4DRN A;  3O5E A;  1BKF A;  3IKD A;  3O5P A;  4TW6 A;  4DRH A;  4FN2 A;  4JFL A;  2ZR5 A;  3O5Q A;  5DIU A;  3UI4 A;  3UQI A;  4FAP A;  1PBK A;  3KAH A;  1FD9 A;  1P5Q A;  4DRP A;  3H9R B;  1ZK6 A;  4DIP A;  2ZQS A;  2PPP A;  4W9Q A;  1D7H A;  2LGO A;  3JXV A;  4QIB A;  5BXJ A;  2XP6 A;  4BF8 A;  4DH0 A;  2XP5 A;  3UQB A;  2XP4 A;  3OOB A;  4W9O A;  2XPA A;  2RSE A;  1ROU A;  1Y0O A;  1QZ2 A;  1M5Y A;  2ZQU A;  5J6E A;  1J4H A;  2M2A A;  1Q6H A;  2DG9 A;  2MLX A;  3KZ7 A;  3RFW A;  2ZQT A;  4DRK A;  1FKS A;  2XP8 A;  2JZV A;  3KCE A;  1FAP A;  5HWC A;  5B8I C;  2KO7 A;  3O5F A;  5HTG A;  3PRD A;  2MLY A;  5HUA A;  1B6C A;  3O5J A;  1JNT A;  4IPX A;  2ZQV A;  4G2P A;  1FJD A;  2PPN A;  5D75 A;  2ITK A;  1FKT A;  1L1P A;  1R9H A;  4G50 A;  4MSP A;  4QT3 A;  4JFM A;  2DG3 A;  4N19 A;  3KAB A;  2F21 A;  4LAW A;  2UZ5 A;  1YAT A;  1FKL A;  4QT2 A;  2RUR A;  4DRQ A;  1TCO C;  2IF4 A;  2RUD A;  4ITZ A;  5DIT A;  3TC5 A;  3I6C A;  4DZ2 A;  2LJ4 A;  1C9H A;  2OFN A;  3KAC A;  3KAF A;  3O5K A;  3O5R A;  3PA7 A;  4JYS A;  3UF8 A;  4DT4 A;  4DZ3 A;  2D9F A;  2KE0 A;  4U85 A;  4IQC A;  3VAW A;  1D7J A;  2PV1 A;  1F40 A;  1KT0 A;  3NRK A;  3O5M A;  1PIN A;  1T11 A;  1Q1C A;  3KAI A;  3O5O A;  3TCZ A;  1BL4 A;  5HW7 A;  4DRM A;  1HXV A;  3WH0 A;  2LKN A;  5HKG A;  1EYM A;  2ZR6 A;  1FKI A;  3FAP A;  4O2T A;  4LAV A;  1FKB A;  4ODN A;  4ODL A;  1YW5 A;  2FAP A;  1U79 A;  2MNT A;  2MPH A;  2L2S A;  2PV2 A;  3KAD A;  4JFI A;  1J4I A;  2PPO A;  3IHZ A;  1FKG A;  3NTP A;  3TDB A;  1QPF A;  3O5L A;  1ROT A;  5HT1 A;  2PV3 A;  2XP7 A;  5HWB A;  2XPB A;  4TYO A;  3ODK A;  4ODQ A;  4IQ2 A;  4ODK A;  2Q5A A;  2KR7 A;  3UI6 A;  2PBC A;  1ZCN A;  3GPK A;  1A7X A;  3KAG A;  3O5G A;  4TW8 A;  4TNS A;  4C02 B;  3O5D A;  4JFK A;  4DRJ A;  2KGJ A;  1FKF A;  2Y78 A;  2F2D A;  2ZR4 A;  4NNR A;  4U86 A;  4U84 A;  3CGM A;  1N1A A;  1Q6I A;  2VN1 A;  4LAX A;  1NMV A;  4DRI A;  2AWG A;  3UQA A;  2K8I A;  2FKE A;  3JYM A;  3NI6 A;  3IKG A;  4ODP A;  1FKH A;  1W26 A;  2KI3 A;  1J6Y A;  1FKR A;  2RUC A;  5GPG A;  1FKK A;  5HW8 A;  1JNS A;  1Q6U A;  4LAY A;  3CGN A;  4J4O A;  1EQ3 A;  1JVW A;  2DG4 A;  3MDY B;  1D6O A;  4ODM A;  4R0X A;  5DIV A;  1KT1 A;  1NSG A;  3UI5 A;  3LUO A;  2XP9 A;  1QPL A;  2N87 A;  3B09 A;  2XP3 A;  2VCD A;  3EY6 A;  4ODR A;  2KFW A;  4GIV A;  2M08 A;  3B7X A;  1NMW A;  4MGV A;  1D7I A;  3RGC A;  4GGQ A;  1FKD A;  4ODO A;  4TX0 A;  2F4E A;  2RQS A;  2M1I A;  3JYJ A; 
#chains in the Genus database with same CATH topology
 2RUQ A;  1VQP V;  3SJB C;  4TW7 A;  5I98 A;  3ZMV A;  2WLI A;  2KSD A;  3ARW A;  2OIE A;  2BTQ A;  1MZE A;  2ATK C;  3OMI B;  4JI2 B;  3EIP A;  2XND G;  5JH8 A;  2QDO A;  3PJS K;  3CX5 F;  2UXN A;  1BE3 H;  1HNX O;  1YCI A;  1ZK6 A;  4XAK A;  1HWY A;  2GUZ A;  2WLJ A;  3JXV A;  1YI2 V;  2OIG A;  4ZHQ B;  4DH0 A;  2OTJ V;  3OTO B;  4R5E A;  2HR3 A;  1Q86 W;  1Y74 B;  1J95 A;  2DT1 A;  1UPG A;  3CHF A;  4O4J B;  1VQ8 V;  2DN9 A;  2DE0 X;  1B6C A;  1GK9 A;  1PL0 A;  2B1I A;  2WM0 A;  3ABU A;  3M99 B;  4B3S B;  4DV5 O;  4FLY A;  4LF5 B;  1OV9 A;  3FD9 A;  3SJA C;  1IBL O;  4YXW G;  4QT3 A;  1FYJ A;  4HAM A;  5FNV B;  1KEC A;  3BAA A;  1HR0 B;  1KP2 A;  3ZJZ A;  1XMO B;  4DZ3 A;  3ARY A;  3NRK A;  3TK1 A;  3K9A A;  1UR8 A;  2PZS A;  2CDY A;  5B1A B;  2V1D A;  1D5N A;  4F6E A;  2FAP A;  3SPG A;  4PA9 A;  4IYH A;  4KQZ A;  2PPO A;  4DV5 B;  1XHX A;  1M4U A;  1QQC A;  4B3R B;  3KAG A;  1BMF G;  2ZXW B;  5L3C A;  4DV6 B;  5BR8 O;  3OAA G;  1TVK A;  1RM1 C;  4P8X A;  1ZU8 A;  2X7R B;  4HZ3 A;  1BT8 A;  2OCC B;  4JYY A;  3ABT A;  4ODP A;  3HKB A;  5BZB A;  3RYF A;  1TUE B;  2WLY A;  3IAY A;  1I5X A;  1WB7 A;  2Q4P A;  5HW8 A;  3CXH F;  4LAY A;  4IL6 Z;  3HKC A;  4ODM A;  1FXK B;  1KT1 A;  3OR6 C;  5FPO A;  5LHH A;  4B3T B;  5BY1 A;  2QWQ B;  1IBK B;  4NKG B;  4JZ2 A;  1PP9 H;  2P22 C;  3T1Y B;  3X2Q B;  4FLT A;  4I0X A;  2RQS A;  3IK8 A;  1K7D A;  1MOF A;  1Y74 A;  3BAB A;  4ABM A;  5KMG A;  1IBK O;  1F7Y A;  3AS3 A;  3ARR A;  5DM6 V;  4O2B A;  3O5Q A;  3C90 A;  1G1X B;  3QO8 A;  4NB5 A;  4DRP A;  2R70 A;  1P49 A;  2F1M A;  2XUM A;  1EZV H;  3GWK C;  3IC9 A;  3WU2 Z;  1I5Y A;  4AQY B;  4PI2 A;  2EBO A;  1GM7 A;  1Z5V A;  2CH7 B;  4LH7 A;  1RSO A;  2FDM A;  2FKX A;  3AEI A;  3G4S V;  1IDS A;  3STL C;  1W9P A;  4LFC O;  2B31 A;  2YEV A;  1FAP A;  3CSX A;  3ABK B;  2LP7 A;  1AJN A;  4WKA A;  1VIB A;  3RT3 C;  2PPN A;  1B3Q A;  2JGU A;  4DRX B;  3K57 A;  3SPC A;  2JVD A;  2YI9 A;  5LGT A;  2X6B A;  2F21 A;  3CZ8 A;  4Z2W A;  4J41 A;  2IF4 A;  1FAF A;  4BAY A;  4IT5 A;  3AG3 C;  2Q67 A;  1PM9 A;  2WLN A;  2D9F A;  2WAM A;  2YEV B;  1PD3 A;  2N04 A;  3SPH A;  1YEW A;  3CRC A;  4RQF A;  1YW5 A;  3CJH A;  1KYO F;  4WCE V;  4TV8 B;  3KAD A;  2UU9 B;  5JWP A;  5IYD O;  1ZWI C;  1GN2 A;  4X1I A;  3ABL B;  1QPF A;  1XL4 A;  5IYZ A;  1B04 A;  4FIP C;  2HHH B;  2YDE A;  2QJ1 A;  4FFB A;  2PI6 A;  1AR5 A;  2Y78 A;  1Q3E A;  4IHJ A;  2VN1 A;  2QTO A;  4LF9 O;  2FKE A;  5GTI Z;  1NKD A;  4O4L A;  4FZ0 A;  2ZT9 B;  5ITZ B;  2ZM6 B;  2UXD B;  1AI6 A;  1EFR G;  1WLE A;  2YBT A;  2QWP B;  2UUB B;  3ASO B;  1XEQ A;  1H2M A;  2ZDI A;  3SDL A;  3AG4 C;  4O2A A;  4QPJ A;  4GCZ A;  4WKH A;  1NR7 A;  3WD1 A;  2M1I A;  1ZL8 B;  4PJ0 Z;  1YJN V;  3JYJ A;  1AI5 A;  4WFH A;  3MHS C;  3WFV A;  3THO A;  1E6R A;  1FXH A;  2PI5 A;  2E5L B;  1N33 O;  2WLM A;  3JSN A;  3ZS8 C;  2F66 C;  3K5N A;  1K4D C;  4UCV A;  1UFI A;  2PPP A;  5LMN O;  2DOS A;  5B5E Z;  2UXD O;  2PTM A;  3OFN G;  2QKC A;  1YJW V;  1ZBC A;  2WLH A;  2XPA A;  3B8N A;  1NWT A;  1S72 V;  5J6E A;  3HPL C;  2HJD A;  2M2A A;  2B9Z A;  2WK2 A;  2ZQT A;  2IJH A;  1FKS A;  5LBQ A;  2EUL A;  4HAR A;  4LFB B;  3ZRW A;  1GN3 A;  2CE4 A;  1NI8 A;  4TWK A;  1EN5 A;  5LMU O;  3RN4 A;  2AW9 A;  3H1J H;  2O92 A;  1WB0 A;  3JD4 A;  4LAW A;  4D6T H;  2ODM A;  2DSW A;  1I94 O;  2RUR A;  1GKF A;  2F23 A;  1EM1 A;  3K06 A;  1Y66 A;  3BEH A;  2UUB O;  2PV1 A;  1HXV A;  2KKW A;  2F43 G;  4GZR B;  1YSC A;  2ZKO A;  4FLX A;  2Z0A A;  2FL4 A;  4JI0 O;  1HDJ A;  2LW1 A;  4KP4 A;  5CA1 A;  5LMU B;  3IHZ A;  3RGB A;  2VQE O;  3FAV A;  2E76 B;  4DWS D;  1T5E A;  4JPR A;  1M1K W;  4U7O A;  4L8J A;  1K92 A;  3TXQ A;  1P4R A;  1EIB A;  4DR7 B;  4LR3 A;  3RFR A;  4TV9 A;  3F5W C;  3BCC H;  3ETD A;  3NXS A;  4DRI A;  3L72 H;  3OT7 A;  1ZL1 A;  4UCU A;  1SQF A;  2QGN A;  2X6A A;  5JJE B;  1XNR O;  4DR6 B;  2Q7H A;  5KHH A;  1LUW A;  5LMN B;  1TAE A;  2N74 A;  2IJJ A;  1X4T A;  5IJ0 B;  2ZDI C;  1X59 A;  4PI0 A;  3FY1 A;  5DIV A;  3STZ C;  2A3Q A;  3UQ8 A;  2AZ2 A;  1YIJ V;  3EY6 A;  2H94 A;  3SJC C;  1I0H A;  2M6Y A;  3P32 A;  2BCC H;  4ODO A;  4I5S A;  3B8M A;  3WL1 A;  2IH3 C;  1ZUQ A;  3OEE G;  2L35 A;  4DRO A;  4DV7 B;  3VOU A;  2QTS A;  4PDM A;  4JYB A;  1BKF A;  4DRH A;  3EXA A;  4JFL A;  4FAP A;  1NH6 A;  1NWU A;  5IY5 C;  1W1P A;  4DWS B;  3LSQ A;  4LGX A;  4DR3 B;  2LGO A;  4W5U A;  2ZM6 O;  4LC1 A;  5LL6 Y;  1AR1 B;  4UDM A;  2XP4 A;  4FLZ A;  1N0J A;  4QNH B;  2DSV A;  3EHB B;  4YHH B;  2CK3 G;  3T4D A;  4FK5 C;  2M7W A;  1AR4 A;  1WB8 A;  4KUM A;  2HHH O;  1HJX A;  1SA0 B;  2F4V O;  2IBZ H;  3ABK C;  4CH3 A;  4G2P A;  1JFF B;  4CS4 A;  4HBE A;  3AG1 B;  1CEZ A;  2YIC A;  2UXC O;  3HKD A;  4QGP A;  4ITZ A;  2RUD A;  4BR6 A;  3RM4 A;  2KQX A;  5LXT A;  3PA7 A;  2D2C B;  3QO5 A;  3L75 H;  3GB7 C;  4R50 A;  2NR5 A;  1HNW B;  2PF4 E;  4BIO A;  1K5Q A;  3LDE A;  4MTF A;  1R73 A;  1EN6 A;  2MNT A;  5CA1 B;  3QNE A;  2H8P C;  1P7B A;  2YXL A;  5H9C A;  4B08 A;  3WKZ A;  4QZV B;  3ZED A;  1L8D A;  1WP7 A;  3PRA A;  3CHE A;  3UI6 A;  4PDR A;  4ZS6 A;  4NXN B;  5D5P A;  4I7Z B;  3ZHS A;  3ARQ A;  4YHH O;  1IVS A;  4H13 B;  3ZMS A;  4QE9 A;  4H37 A;  3BVO A;  2JGD B;  1LUV A;  5KHG A;  3RYH A;  1XMQ O;  1K34 A;  2RUC A;  3ZHT A;  5IDJ A;  1RFY A;  3ARX A;  1CPY A;  2EJ7 A;  3FB7 C;  4I50 B;  3RYH B;  3I55 V;  1MSW D;  1JVW A;  2W0X A;  5BMV B;  1XMO O;  2A0L A;  2VCD A;  3MAQ A;  4EFE A;  4O4H B;  4DW0 A;  4I4T B;  4A5U B;  2IUZ A;  4RAI A;  2Y4T A;  4TQD A;  1KMI Z;  4JFJ A;  4L3N A;  3O5I A;  4D7T A;  2ADP A;  3SYA A;  4C7U A;  4TW6 A;  2OT5 A;  5DIU A;  2A3E A;  3B9D A;  1PBK A;  4EB6 A;  3E22 A;  3N2K B;  1FD9 A;  4E2L A;  2GTS A;  4I55 A;  3E89 A;  1XMQ B;  3OOB A;  3RWR D;  3AG2 B;  1AP5 A;  4W4K A;  5LP6 A;  3E2E A;  4LBE C;  4MW3 A;  3SYQ A;  4XBF A;  2VWK A;  1PPJ H;  2ESC A;  4ZPW R;  3W4R A;  3G6E V;  3ETG A;  4B3R O;  2E75 B;  1BSM A;  3O5J A;  4UFZ A;  1FJD A;  1VF8 A;  4PD4 F;  2ITK A;  3IC7 A;  1R9H A;  4WBN B;  1Y6X A;  4GX5 A;  2ZD9 A;  1YAT A;  1ITX A;  3LNN A;  2ETN A;  4JYS A;  1WAZ A;  1QBZ A;  5LP6 B;  3O5O A;  5KHJ A;  4Z1V A;  5HKG A;  3UKM A;  1U96 A;  3RVY A;  4MPK A;  4J11 A;  2LGQ A;  4IIJ A;  4F6R A;  1XNR B;  1Q8I A;  2RNB A;  3MDS A;  5GW7 A;  1COW G;  4P8V A;  4DR2 B;  1XBL A;  4LF4 O;  1ZCN A;  3CRA A;  1R6T A;  4TNS A;  1ZSP A;  2MW2 B;  4P8W A;  4U86 A;  2VQE B;  3QF7 A;  2OCC C;  3UT5 A;  3ARS A;  1HJW A;  4LAX A;  2P06 A;  2WPD G;  1E1Q G;  4FLW A;  4DRX A;  3H01 A;  4TT3 G;  2CTW A;  2DT0 A;  4JTC B;  3J7A U;  4X20 A;  1XL6 A;  3LDC A;  4I50 A;  1NSG A;  3EVK A;  1QPL A;  1I94 B;  1N34 O;  2QKS A;  1VEW A;  3H1H H;  2LQT A;  3TXS A;  4R7C A;  3WL0 A;  4TV9 B;  1I7F A;  1QR9 A;  3WD4 A;  3JAM N;  3QO7 A;  4Z2H A;  4J4N A;  2O57 A;  2HEP A;  3CHX A;  1FKJ A;  1R1B A;  1MAB G;  2UUC B;  3JAR B;  3ARO A;  2NNU A;  4UCS A;  3ALG A;  3FYI B;  4DR4 B;  1SQG A;  4UVC A;  2RSE A;  1VQ4 V;  3N2G A;  2Q69 A;  3ZN1 A;  3K79 A;  1HNZ O;  2QWR B;  3OUF A;  5EZY A;  1VF7 A;  1S76 D;  1H0G A;  1XRV A;  1X6N A;  2QM7 A;  1FXK A;  5HTG A;  2L6L A;  1OCO C;  2UXB O;  1E6N A;  1WJZ A;  5H6R A;  4D7S A;  1M5I A;  4LP8 A;  3CC7 V;  3ZRW B;  4CS2 A;  3QG5 A;  1S5J A;  1VF5 B;  3TCU A;  4DW1 A;  2DT3 A;  3AG1 C;  4WFF A;  1W2B U;  3ALF A;  4DV1 O;  3CRR A;  1BHA A;  4PDV A;  1SQQ H;  3JD1 A;  5GTH Z;  1HKJ A;  1D7J A;  5F2V O;  4NXM B;  1KT0 A;  3OW2 U;  1W0J G;  4DV2 B;  3CCJ V;  1Y67 A;  3JAW B;  4AY1 A;  1IUR A;  3OMN B;  2MPH A;  1ZLZ A;  4HYO A;  1F4M A;  3ARP A;  3VQX A;  2YXH A;  2YIB D;  4N23 A;  2IJK A;  1DGS A;  1XQ8 A;  2C2A A;  2XP7 A;  4J7Z A;  2GSM B;  4JYC A;  2G38 A;  3CME V;  5TIS Z;  3Q4H B;  2ZE8 A;  1XNQ O;  2EIN C;  3CCU V;  1K73 W;  4NTX A;  2DWD C;  4Z2K A;  3ZHU A;  1UJW B;  1Q6I A;  5FNV A;  3M8A A;  2AWG A;  1ZBV A;  3NI6 A;  1BS3 A;  5A2Q N;  2V7Q G;  3JCU Z;  4WIW A;  5GPG A;  1NTK H;  2HVK C;  3CCL V;  2CUG A;  5GQB A;  3ASO C;  1CXZ B;  3ZMU A;  5KUM A;  4X62 B;  3K08 A;  3CCE V;  3CCS V;  3A2F A;  3JAK A;  3JAR A;  3ART A;  1AIL A;  2VS0 A;  2KG7 B;  3D3Q A;  1FFR A;  1SET A;  5L3E A;  2LPV A;  3ARZ A;  2MF9 A;  2GV9 A;  2QSA A;  2XOK G;  3KKY A;  1XRE A;  3IKD A;  3UI4 A;  1SC5 B;  1AI7 A;  4JI3 O;  3HR0 A;  5IJ0 A;  5EYP B;  4PDL A;  2AHZ A;  3E22 B;  5L3B A;  2XAJ A;  1DK1 A;  1V9P A;  4Z1M G;  4CC5 A;  1OWQ A;  1VAR A;  4UV9 A;  4JI1 O;  3UM7 A;  4WK9 A;  5KHK A;  3CYO A;  5LYJ B;  1TGO A;  4X1K A;  4Z2L A;  1NWR A;  5DN6 G;  5BR8 B;  2JZV A;  4DV6 O;  1M57 B;  4LCU C;  3CE2 A;  4LF4 B;  3K58 A;  4DR1 B;  2MLY A;  3SPI A;  3UT5 B;  4UB8 Z;  1QVG U;  2ZIO A;  1SYT A;  3T1Y O;  3ABL C;  4P30 A;  2KG7 A;  1SQP H;  4MNK A;  3ML0 A;  2EJR A;  1GTO A;  4I9W A;  1OCC B;  4JGS A;  3UF8 A;  5DO2 A;  1V55 C;  4DXW A;  2Z5U A;  3FFQ A;  1Z2G A;  1H2L A;  2X6C A;  4YIP A;  5HW7 A;  4F6R B;  4PTM A;  2A7W A;  4LAV A;  1FKB A;  4QPK A;  2Q5Z A;  1IXB A;  3JCZ A;  2PV2 A;  1KUQ A;  2GBO A;  3HKC B;  1LL4 A;  4OX9 O;  5IYB O;  4MTO A;  1O9H A;  1R3L C;  2E3C A;  1OZ0 A;  2KR7 A;  2BE3 A;  4Q20 A;  4TW8 A;  1S3J A;  3RW0 A;  4JFK A;  3U10 A;  1MZF A;  5CMU A;  3C3S A;  4URI A;  1KB9 F;  4UXN A;  1SR0 A;  2CGN A;  2P90 A;  4H0L B;  4DK0 A;  5IWA O;  4JI8 O;  1BQZ A;  2DJV A;  2X0L A;  2DMX A;  5EIB C;  1HNX B;  2RMK B;  2AOS A;  1EQ3 A;  3P30 A;  3L71 H;  5HFL A;  3KG2 A;  4EEQ A;  3WB2 A;  1TUB A;  2RN9 A;  3B09 A;  4NTY A;  3TET A;  3L9D A;  5DEZ A;  1TUB B;  1NMW A;  3S3X A;  1GRJ A;  1ZL8 A;  2CTQ A;  1YVW A;  3C3T A;  1NU1 H;  3L74 H;  2P6J A;  1AJP A;  2LJ2 A;  4B3S O;  4WFB V;  4FLU A;  4DR1 O;  2XHB A;  3G6L A;  2ITC C;  1N32 B;  1V54 B;  2WLZ A;  1QLE C;  4YJ2 B;  4DWS C;  2BSK A;  4WFE A;  2Y0P A;  1XIL A;  4TV8 A;  5IWA B;  1KKD A;  3E8G A;  3QVN A;  4MVU A;  5HFM A;  4WKF A;  2G41 A;  2DG9 A;  4X65 B;  3RFW A;  3KCE A;  2HP8 A;  5EIB D;  4JTA B;  2P67 A;  3CEI A;  2V4D A;  5HUA A;  2JS3 A;  1ZBW A;  2MK3 A;  1J5E B;  3CHD A;  3CJH B;  1K97 A;  3ETE A;  1IBM B;  2EIJ B;  3ETQ A;  4UV8 A;  3JD2 A;  1JA8 A;  3CMA V;  1TCO C;  4UCR A;  2OFN A;  3KAF A;  4X62 O;  2AXT Z;  3B9A A;  1P7G A;  4X20 B;  1ZB5 A;  1F40 A;  3B77 A;  3A0B Z;  2FYU H;  3O5M A;  2JEU A;  1W1Y A;  3T4Z A;  2YID A;  3D36 C;  1HR0 O;  1KFW A;  5J2U B;  1K8A W;  3KZI Z;  1IBL B;  5J2U A;  2L2S A;  4GKK O;  1W1T A;  5LXT B;  3ZRV A;  4B3M B;  5DED A;  1NTZ H;  5L3D A;  3BPZ A;  4WFA V;  4B7E A;  4JV5 B;  2R9R B;  1E6Z A;  1FKF A;  3JAK B;  2GTA A;  2N05 A;  2HG5 C;  1H2K A;  3MD0 A;  1SA0 A;  4MSW C;  2CH7 A;  4IGG A;  5JQG A;  1FKH A;  3QOK A;  1FFQ A;  1U97 A;  3B4S A;  1FKR A;  5CBG A;  4DR3 O;  1D2K A;  2OTL V;  2Q9L A;  2YIA A;  2K9P A;  2ZNI A;  4J4O A;  3JAS B;  3UO3 A;  3K5O A;  4FVM A;  3WD2 A;  4YY3 B;  1SZT A;  4X8A A;  1QVF U;  2FB5 A;  1SER A;  3K5L A;  2WSS G;  1F23 A;  4OPA A;  3RGC A;  2RCV A;  4DV3 B;  4GGQ A;  3ABM B;  1FKD A;  1H2N A;  2A3B A;  3G80 A;  2CGO A;  4YJ3 A;  4UVA A;  5JH7 A;  4YJ2 A;  1ZTE A;  3CC2 V;  4DRN A;  4E4E A;  3W7X A;  3OUS A;  4RQE A;  1LR1 A;  3SGI A;  1XHG A;  3KCX A;  3RVZ A;  4ZKI A;  1G4Y B;  4JI1 B;  2DYR B;  3R65 A;  1KBH A;  4W9Q A;  2XP6 A;  2ZIN A;  3APQ A;  3UQB A;  4U3J A;  1TA8 A;  3DXR B;  2ZQU A;  2A3A A;  3AQU A;  1J4H A;  5IJ9 A;  4K0K B;  4JI4 B;  1N33 B;  4YIO A;  4LF8 O;  4S3K A;  1QCE A;  5JCO C;  1M56 B;  1JNT A;  2Y4U A;  4IPX A;  1D5A A;  5FL7 G;  1YTF D;  4QIW F;  1NVP D;  3ZRX A;  4DV3 O;  1OCZ C;  2WA4 A;  3J81 N;  2UZ5 A;  2DQ3 A;  1NQT A;  2DWE C;  2W0F C;  3N2G B;  4DZ2 A;  5JJN B;  4CC6 A;  2WLL A;  1FJG B;  5KHI A;  1SZX A;  2VQF O;  4YY3 O;  5B3S B;  1VQL V;  4IHJ B;  3VAW A;  5EBM C;  1VQO V;  1WPX A;  2Y0I A;  4ODL A;  2ZNJ A;  1JX9 A;  4ZHQ A;  5JJJ B;  5C93 A;  1FKG A;  3NTP A;  3WB1 A;  5CB4 A;  2DSZ A;  2AZ0 A;  1N36 B;  1XNQ B;  4JV5 O;  1LJY A;  4ASU G;  1A7X A;  5E79 Z;  4J7K A;  1N36 O;  2YIB A;  1H2S B;  5H5N A;  4U84 A;  3VQW A;  1H8E G;  2F95 B;  5BXZ A;  1E6P A;  4OXS A;  1K5S A;  3H1K H;  4DR4 O;  4DO2 A;  2GUZ B;  1FKK A;  4MTX A;  1YTF B;  3WQW A;  1O9G A;  3E8F A;  3T1H O;  2PI4 A;  2VQF B;  4R0X A;  5EK0 A;  5JVD A;  5LYJ A;  3OMA B;  3UI5 A;  1O6I A;  1JVM A;  3L73 H;  4TSF G;  5KA6 A;  3FXY A;  4MGV A;  1EN4 A;  4PHZ A;  2R72 A;  2JRI A;  4BW5 A;  2F4E A;  1Q81 W;  3ASN C;  3OEH G;  4ML4 A;  2MLZ A;  1JFF A;  3J80 N;  1A32 A;  1RSO B;  4LF8 B;  3BA8 A;  4FM2 A;  3APO A;  3DXR A;  4TUY A;  2D3O W;  5EC2 C;  1J4R A;  2ZR5 A;  3UQI A;  1YF2 A;  1KKC A;  3CWB H;  1JMK C;  4QIB A;  2XAH A;  5B1B B;  4PA3 A;  4UB6 Z;  5CA3 A;  3LSU A;  5IYC O;  5JH7 B;  1M5Y A;  4MW8 A;  1R3J C;  4J7J A;  4PEL A;  2K1E A;  2MLX A;  1THZ A;  1N32 O;  5HWC A;  1OCO B;  4IYI A;  4HBN A;  1N4C A;  5EBW C;  2YS8 A;  3PN1 A;  1E1R G;  2DG3 A;  2YBU A;  4BIZ A;  4EKW A;  3G6B A;  1SS3 A;  3CXC U;  1C9H A;  4X88 A;  1OGG A;  3Q4H A;  4WFG A;  2NLJ C;  3F5T A;  4TQF A;  4X64 B;  1YHQ V;  4JI5 B;  2DYS C;  4PA4 A;  1SQX H;  1IZ3 A;  4JAA A;  3KAI A;  3B2E E;  1JOY A;  1WNS A;  2UUA O;  4PA7 A;  1JCH A;  3B40 A;  2XT9 A;  2JEX A;  4EB6 B;  5J9P C;  1D2D A;  4MNM A;  3IJ4 A;  3JAW A;  4Q7N A;  4MVS A;  3MHH C;  1DLB A;  4NXN O;  4ODQ A;  4IQ2 A;  2PBC A;  2F93 B;  1GM9 A;  3FB6 C;  2ZR4 A;  4K0K O;  4L87 A;  4KHP O;  2DSU A;  1BCC H;  3UQA A;  1R6K A;  1E9L A;  1ZX3 A;  2W6I G;  3ZMZ A;  1ZAU A;  1K9T A;  2DW4 A;  4FM1 A;  4AQY O;  1Q6U A;  4J9Y B;  5L3F A;  1HNW O;  2ZE7 A;  3MDY B;  1PNK A;  5KLV H;  4MVQ A;  1DF4 A;  4JYA B;  3DGE A;  4I4T A;  3R66 A;  2XP9 A;  3LUO A;  1I08 A;  4O4H A;  3UO2 A;  3OM3 B;  4J10 A;  1ZBK A;  5J2T A;  4GUN A;  3OGC C;  4ZPV R;  3EFF K;  1EHN A;  1GOI A;  2A9H A;  3U11 A;  3ZN0 A;  4DK1 A;  1QNM A;  2JGD A;  3O5E A;  1Y4M A;  2IW5 A;  4JAS A;  3QTC A;  1WAW A;  1KC8 W;  4OPH A;  2ADQ B;  2BSK B;  3BY6 A;  2WA3 A;  3DSQ A;  3JYC A;  1OHH G;  4P2Z A;  3BA9 A;  1GO3 F;  3WIJ A;  2HKO A;  2R9A A;  4X1Y B;  2XAG A;  3K0G A;  1G8M A;  1URF A;  2ZIM A;  4KHP B;  1JND A;  3PR9 A;  4G27 B;  3VQV A;  2ITD C;  3WG7 B;  4G28 B;  5HBF A;  1PKX A;  3O5F A;  3FX7 A;  4B3M O;  4U7N A;  1NVP B;  1K3E A;  3K59 A;  3T2M A;  2OLH A;  2EZO A;  4PA6 A;  4MSP A;  2LFR A;  3CCM V;  2Q7G A;  4DRQ A;  1W0K G;  1HKI A;  2LJ4 A;  3O5R A;  1R3K C;  5CBH A;  4DT4 A;  2QA4 V;  4DV4 O;  4FZ1 A;  4JI5 O;  1LL7 A;  4ZI7 A;  4P9O A;  1W59 A;  1JCH B;  3TCZ A;  1BL4 A;  4DWS A;  1LG1 A;  2LKN A;  1PNL A;  3H1I H;  1FKI A;  3FAP A;  2PN0 A;  4DR6 O;  1IBM O;  5B66 Z;  4FFK A;  4JFI A;  4UVB A;  2EIK B;  1NT2 B;  2DT2 A;  3F7Y C;  3H9V A;  3B9E A;  1K9M W;  1R6N A;  2CTP A;  4MTV A;  1W9V A;  4NSB A;  3O5G A;  1AP6 A;  2RJZ A;  5H6Q A;  2Z3Y A;  1F51 A;  1IX9 A;  4X65 O;  4U3F H;  1B6Q A;  4DUY O;  4QJF B;  1Y76 A;  1SQV H;  4LF7 B;  1CTN A;  1IX5 A;  5JQG B;  3JYM A;  4O4I B;  2KI3 A;  1F4N A;  1M93 A;  4X9Q A;  5LHI A;  4MNL A;  3GVM A;  1K33 A;  4WJX A;  4NR1 A;  1US6 A;  2A79 B;  3BRC A;  2P7T C;  1OGB A;  1PV0 A;  3CRM A;  4DV7 O;  2KFW A;  2EIN B;  4MVZ A;  5B1O A;  3W7U A;  1NWS A;  4TX0 A;  4X66 O;  2EIL C;  5L3G A;  2ARH A;  4TUY B;  3WQV A;  2QM8 A;  3FAV B;  4TOI A;  1JQ0 A;  2WLI B;  3G67 A;  4LFB O;  1F8A B;  3RM8 A;  3PRB A;  3ZRS A;  2VRZ A;  3ZIA G;  4JYA O;  1ORQ C;  3JAT B;  1QLE B;  2Q7E A;  1NS1 A;  4MVO A;  3OD4 A;  1Q7Y W;  4KL1 A;  1M9N A;  2IU3 A;  1Q5O A;  4JAV A;  3K3W A;  2QWN B;  2GDS A;  1VF6 C;  3HB3 B;  5B1B C;  2P5O A;  4JI7 O;  5EC1 C;  1DTO A;  1JJ2 U;  1OCC C;  3CPW U;  4EFB A;  1Y0O A;  4DV0 O;  4GX0 A;  4MAV A;  1WA8 A;  4JI3 B;  1Q43 A;  1FFT B;  5KX5 A;  1KD1 W;  4O2B B;  3D3I A;  5KMG B;  1RD6 A;  1BHB A;  1LG2 A;  5JCO A;  1HKK A;  5CBF A;  5D75 A;  1FPO A;  3CHC A;  4I0X B;  4JFM A;  2B5U A;  2EIJ C;  4JI6 B;  4DUZ O;  3E86 A;  2RDC A;  5DIT A;  1GH6 A;  3I6C A;  3RBZ A;  3O5K A;  3CH9 A;  1EZJ A;  4K8Z A;  1RP3 B;  4Z2I A;  2PYL A;  4U85 A;  2JK5 C;  2DYS B;  3BHP A;  1PIN A;  1XI1 A;  3K03 A;  5CA0 A;  3WH0 A;  1M57 C;  2VWJ A;  1B06 A;  2OYQ A;  3FYE B;  3D36 A;  3RYI B;  1U79 A;  4Z2G A;  4AIL C;  3HKB B;  1SRY A;  4GX1 A;  2YUA A;  5LOV A;  5LA6 B;  2Y69 C;  3LDD A;  3SYO A;  4B7K A;  1WP8 A;  4NVP A;  1J4I A;  3D8C A;  1BQ0 A;  1R3I C;  4NTW A;  2ZE6 A;  2PV3 A;  1P84 F;  2DQ0 A;  3JD3 A;  4DR7 O;  2EZP A;  2JDI G;  1V55 B;  3BMB A;  4WF9 V;  2LO1 A;  4DV0 B;  1WNO A;  1N1A A;  4KFM A;  3LNM B;  1NR1 A;  3TJT A;  1FXV A;  3I56 V;  4BIU A;  3T1C A;  5ITZ A;  4IT6 A;  1M90 W;  2O9O A;  1JNE A;  4AHC A;  2E74 B;  5LA6 A;  5H2F Z;  1N8R W;  1D6O A;  1RPO A;  2EIM B;  1G6U A;  1HKM A;  2GHY A;  4LF6 O;  5CA0 B;  2M08 A;  5CN0 A;  1RM1 B;  2XAF A;  3IGA C;  4ZOL B;  4X66 B;  2QR4 A;  2H3O A;  5C8Y A;  4PV1 B;  2PY5 A;  4LF6 B;  4XDL A;  4Z2J A;  4O4L B;  1YZB A;  1HP8 A;  3W7W A;  5FPR A;  3CB2 A;  2DYR C;  5GON A;  5BXJ A;  1D7H A;  4W4L A;  4S3J A;  1VQM V;  1E79 G;  2ZCE A;  1AVM A;  3UCS C;  2A3C A;  1SKV A;  3X2Q C;  4K35 A;  1QLN A;  5J2T B;  1OCR B;  4CH6 A;  1ENV A;  3CCQ V;  3JAL A;  2YC0 A;  1SQB H;  2XP8 A;  3JSL A;  3AS2 A;  2IH1 C;  3WG7 C;  2ZR2 A;  2E5L O;  1BZK A;  5D5Q A;  3PRD A;  1V54 C;  4XDJ A;  1KQS U;  3CP1 A;  3SYP A;  1VQ5 V;  1L1P A;  1OCZ B;  2Q68 A;  1VMG A;  2HVJ C;  3HKE A;  4I9Q A;  3FB5 C;  4AI8 A;  3KAB A;  2Q8V A;  1K4C C;  3TC5 A;  1HJV A;  4LNU A;  3NR7 A;  3KAC A;  2YXY A;  1VQ6 V;  4HNA A;  3U0Z A;  4MNJ A;  4ZPT R;  4DYL A;  4X1K B;  1NH2 B;  2Y48 A;  1EYM A;  1MMM A;  4MS2 A;  1TFV A;  1XOU A;  3F7V C;  1YJ9 V;  1GN4 A;  4DUZ B;  4JI6 O;  2PYJ A;  4CH5 A;  1J5E O;  2G8Z A;  2EIK C;  4CZZ A;  4DUY B;  4TYO A;  3ZCC A;  3O65 A;  4JF3 A;  3JD0 A;  3GPK A;  3AG3 B;  2KGJ A;  1Z5W A;  4FM0 A;  3ICX A;  3ABM C;  5C8Y B;  2UU9 O;  4GKK B;  3AG7 A;  2FML A;  3H1L H;  1GN6 A;  4BWA A;  1AI4 A;  5GPR A;  4J42 A;  1NJI W;  2WWW A;  4GYC B;  4DV4 B;  3AK3 A;  2N87 A;  4XDK A;  2JIZ G;  1Y76 B;  3WD3 A;  1D7I A;  4MVM A;  2JJ2 G;  1BGY H;  1QHT A;  5IE9 A;  2BTO A;  2OWO A;  4X89 A;  4IT4 A;  3FB8 C;  2HFE C;  3O5P A;  5AG2 A;  2QF8 A;  3K9S A;  3FKS G;  1AB3 A;  5LHG A;  4I55 B;  1LL6 A;  4LWS A;  2IJI A;  4UCT A;  1VQ9 V;  4GLX A;  3AK1 A;  2ZQS A;  2XTA A;  2ZR3 A;  3ZHV A;  3N2K A;  5LOV B;  4L72 B;  3AG4 B;  2UXX A;  3KCY A;  1L1F A;  4RO2 A;  4W9O A;  3AS0 A;  4O2A B;  4Q22 A;  2BOC C;  3LSS A;  4GKJ O;  3DC6 A;  4LF7 O;  4X1Y A;  2NN4 A;  4RUE A;  4DRK A;  2CAZ C;  4H33 A;  4JI2 O;  3BFR A;  2YSU B;  5EZY B;  5B8I C;  5DEC A;  3SR2 C;  2ZQV A;  4O4J A;  4MT8 A;  3RYI A;  4MTG A;  4QT2 A;  1GM8 A;  3ZX6 A;  2UUA B;  5B1N A;  1EBO A;  2A06 H;  4FFB B;  5KX5 B;  1RPR A;  4IQC A;  3G6M A;  1NBM G;  1WA8 B;  3A8T A;  3RYC B;  1Q82 W;  4JI8 B;  1FS0 G;  4MVR A;  4K8X A;  4KXR A;  2QWO B;  2ILM A;  1W1V A;  4R8C A;  1M56 C;  2QKA A;  1FKA O;  4UUJ C;  4NZC A;  5HT1 A;  3I5D A;  2DPE A;  3GU0 A;  4ODK A;  4C02 B;  1GPF A;  3A0H Z;  5B3S C;  3ZHR A;  2F2D A;  2WLL B;  1N0N A;  1YXB A;  4J9Z B;  3ASN B;  2RQ6 A;  4GKJ B;  1NMV A;  3OTF A;  3CRQ A;  1VQ7 V;  3IKG A;  3OTO O;  1W26 A;  3OA5 A;  1J6Y A;  1BL8 A;  4X64 O;  1H2G A;  3RM9 A;  3CS5 A;  3JAT A;  1UR9 A;  2JS5 A;  5EYP A;  1VQN V;  3B7X A;  4LWS B;  4LF5 O;  1YIT V;  4IIJ B;  1W9U A;  5HW6 A;  4KR0 B;  4JAU A;  1JR9 A;  1GMG A;  1DF5 A;  2OCH A;  1S5H C;  4K3A A;  1PL4 A;  2ZE5 A;  4FN2 A;  5K1P A;  2W6J G;  3H9R B;  3SJQ C;  4NYK A;  1OJH A;  3ZBH A;  3E35 A;  1MNG A;  1ROU A;  1GAX A;  1FFX B;  1OCR C;  2CTR A;  2IM9 A;  1H38 A;  4ZOL A;  1Q6H A;  4RUF A;  4JTD B;  3WD0 A;  1EDQ A;  1XDC A;  2BOB C;  2ZQM A;  2QM4 A;  2PGG A;  1WPB A;  2XAS A;  4ZBM A;  3RYF B;  2P4V A;  3W7T A;  1IXM A;  2LGW A;  4OX9 B;  1FKT A;  4QE7 A;  4G50 A;  2R9I A;  1L0L H;  4FLV A;  3S3W A;  3CCR V;  1TVK B;  2LW7 A;  1SF9 A;  2QE7 G;  1KU9 A;  3VQY A;  4ZI7 B;  4GX2 A;  2PUS A;  4RWU A;  4NXM O;  3T1H B;  3O9O A;  2KE0 A;  3ARV A;  1ROP A;  4HBO A;  1Q1C A;  1FJG O;  4DRM A;  5B1A C;  1H8H G;  1XUQ A;  2ZR6 A;  3SPJ A;  4ODN A;  5KA5 A;  3LUT B;  4LFA B;  3DC5 A;  3P3P A;  3K0D A;  3TDB A;  1L0N H;  3O5L A;  5A9G A;  4DR5 O;  4LNU B;  2F4V B;  1E44 A;  2AHY A;  2UXB B;  2Q5A A;  2ZXW C;  3VBB A;  1JPX A;  4BW9 A;  3RME A;  2QEX V;  4JI4 O;  4DR5 B;  3SYC A;  2YI8 A;  3CGM A;  5K1X A;  1E15 A;  4P9P A;  4CBC A;  4P8U A;  4JI0 B;  4H44 B;  1Q90 D;  2FTK A;  3M7M X;  3B8S A;  1KP3 A;  3JAL B;  5CB4 B;  2B5U B;  3CGN A;  3RYC A;  4LH6 A;  1YDX A;  1FXK C;  5BMV A;  2UUC O;  2DG4 A;  1S77 D;  2HJF C;  5E1A C;  1MG1 A;  4JZG A;  4FMT A;  4DV1 B;  2EX3 A;  2P4K A;  2XP3 A;  4ODR A;  5GON B;  1H0I A;  1LNQ A;  5FLX N;  1PNM A;  3OR7 C;  3AG2 C;  5KAF Z;  4GIV A;  3N27 A;  1WN7 A;  1MSD A;  3WB0 A;  4W9P A;  1CP9 A;  4GT1 A;  4LFC B;  1ARO P;  2BTQ B;  2IU0 A;  2Q0A A;  3KAH A;  1P5Q A;  5IY5 B;  4OGQ B;  4DIP A;  2KB1 A;  3E83 A;  4BF8 A;  4JI7 B;  2XP5 A;  1VP7 A;  1VQK V;  4LF9 B;  5KUK A;  1VF6 A;  2Q73 A;  3A0R A;  4Q6G A;  3ZMT A;  3CC4 V;  1QZ2 A;  1SES A;  1S0V A;  3KZ7 A;  5LP6 C;  3GTY X;  1AJQ A;  3E8B A;  2HLD G;  3OGI B;  2KO7 A;  2Q0O C;  1XHZ A;  1HW7 A;  1QU7 A;  3L70 H;  4CS3 A;  1GUV A;  3HKD B;  4G2K A;  5IT9 N;  4N21 A;  4LFA O;  1X6L A;  4N19 A;  3P3N A;  1FKL A;  1N34 B;  5IJ9 B;  5LGU A;  4DV2 O;  4YJ3 B;  2B1G A;  2JJ1 G;  4O4I A;  4B3T O;  3K04 A;  1NZ6 A;  3GWO A;  1LQ0 A;  1NH2 D;  3ARU A;  4U3J B;  3ZHQ A;  3AK2 A;  1T11 A;  4ZIB A;  1QR8 A;  4O2T A;  3IFX A;  5LGN A;  3BXW A;  3K5M A;  4FPP A;  2Y69 B;  5DF0 A;  4R6Z A;  5IYZ B;  3DTU B;  4ICG A;  1S5L Z;  1ROT A;  1FFX A;  4X1I B;  1NTM H;  5HWB A;  2XPB A;  3ODK A;  4WBN A;  4CH4 A;  4F4L A;  3O5D A;  4DR2 O;  4DRJ A;  1JJO A;  4NNR A;  3CCV V;  1HNZ B;  3AS1 A;  2EIL B;  2XAQ A;  2K8I A;  2Q6A A;  2AGA A;  3OE7 G;  4J80 A;  3JAS A;  1MA1 A;  1JNS A;  2WLK A;  5EBL C;  5JVD B;  5KAI Z;  3G71 V;  4FJC C;  2EIM C;  4HNA B;  2LFS A;  3W7S A;  3TGU H;  4UCO A;  3CD6 V;  3E8H A;  2UXC B;  3HKE B; 
#chains in the Genus database with same CATH homology
 2RUQ A;  2A3B A;  4L3N A;  3O5I A;  4TW7 A;  5I98 A;  3ARW A;  4Z2J A;  4DRN A;  4TW6 A;  5JH8 A;  5DIU A;  2A3E A;  3B9D A;  1PBK A;  1XHG A;  1FD9 A;  1ZK6 A;  4XAK A;  4W9Q A;  1D7H A;  4S3J A;  3JXV A;  5BXJ A;  2XP6 A;  4DH0 A;  2A3C A;  4R5E A;  3UQB A;  3OOB A;  2ZQU A;  2A3A A;  3AQU A;  1J4H A;  2XP8 A;  3AS2 A;  2DT1 A;  2ESC A;  4ZPW R;  3W4R A;  3CHF A;  3PRD A;  4S3K A;  1B6C A;  3O5J A;  1JNT A;  4IPX A;  1FJD A;  1VF8 A;  2WM0 A;  2ITK A;  1L1P A;  1R9H A;  4QT3 A;  3KAB A;  2UZ5 A;  1YAT A;  1ITX A;  4DZ2 A;  3TC5 A;  1HJV A;  3KAC A;  4JYS A;  4DZ3 A;  3ARY A;  3VAW A;  4MNJ A;  4ZPT R;  3NRK A;  3O5O A;  1UR8 A;  5HKG A;  1EYM A;  1TFV A;  4MPK A;  4ODL A;  2FAP A;  2G8Z A;  4KQZ A;  2PPO A;  1FKG A;  3NTP A;  2DSZ A;  4P8V A;  4TYO A;  1LJY A;  3KAG A;  1ZCN A;  3GPK A;  1A7X A;  4TNS A;  2KGJ A;  4P8X A;  1ZU8 A;  4P8W A;  4U86 A;  4U84 A;  3ARS A;  1HJW A;  4LAX A;  1E6P A;  4ODP A;  2WLY A;  1FKK A;  5HW8 A;  2DT0 A;  5GPR A;  4LAY A;  3WQW A;  4ODM A;  4R0X A;  1KT1 A;  1NSG A;  3UI5 A;  1O6I A;  1QPL A;  2N87 A;  3FXY A;  3WD3 A;  4MGV A;  1D7I A;  3WL0 A;  2F4E A;  2RQS A;  3WD4 A;  4ML4 A;  3IK8 A;  2MLZ A;  4Z2H A;  4IT4 A;  4J4N A;  3AS3 A;  1FKJ A;  3ARR A;  1J4R A;  3O5P A;  2QF8 A;  2ZR5 A;  3O5Q A;  3UQI A;  4DRP A;  1LL6 A;  2ZQS A;  3ARO A;  4QIB A;  3ALG A;  4L72 B;  4W9O A;  3AS0 A;  4Q22 A;  2FDM A;  2RSE A;  1M5Y A;  1W9P A;  4DRK A;  1XRV A;  1H0G A;  2MLX A;  1X6N A;  2B31 A;  1FAP A;  5HWC A;  5B8I C;  5HTG A;  1E6N A;  2ZQV A;  4WKA A;  2PPN A;  2DT3 A;  2DG3 A;  2YBU A;  2F21 A;  4QT2 A;  3ALF A;  3CZ8 A;  2IF4 A;  1C9H A;  1OGG A;  1HKJ A;  2D9F A;  4IQC A;  1D7J A;  3G6M A;  1KT0 A;  3KAI A;  4MNM A;  1W1V A;  1YW5 A;  4AY1 A;  2MPH A;  4Q7N A;  3KAD A;  3ARP A;  4NZC A;  1QPF A;  5HT1 A;  2XP7 A;  2DPE A;  4ODQ A;  4IQ2 A;  4ODK A;  2PBC A;  2PI6 A;  4C02 B;  1GPF A;  2Y78 A;  2F2D A;  2ZR4 A;  2DSU A;  4Z2K A;  1Q6I A;  2VN1 A;  1NMV A;  2AWG A;  1ZBV A;  3UQA A;  2FKE A;  3NI6 A;  1E9L A;  3IKG A;  1W26 A;  3OA5 A;  1J6Y A;  4WIW A;  5GPG A;  1K9T A;  1Q6U A;  2YBT A;  5GQB A;  3MDY B;  3RM9 A;  1UR9 A;  3LUO A;  2XP9 A;  3ART A;  1ZBK A;  3B7X A;  4WKH A;  4ZPV R;  3WD1 A;  2M1I A;  3JYJ A;  1EHN A;  1W9U A;  5HW6 A;  1GOI A;  1FFR A;  2LPV A;  3ARZ A;  4KR0 B;  2MF9 A;  1E6R A;  3O5E A;  3IKD A;  4FN2 A;  3UI4 A;  1WAW A;  3H9R B;  2PPP A;  1ZBC A;  1OWQ A;  3WIJ A;  2XPA A;  1NWT A;  1ROU A;  4WK9 A;  5J6E A;  1JND A;  3PR9 A;  2M2A A;  4Z2L A;  1Q6H A;  2WK2 A;  2ZQT A;  1FKS A;  1NWR A;  3WD0 A;  2JZV A;  1EDQ A;  5HBF A;  3O5F A;  4HAR A;  2MLY A;  2OLH A;  1FKT A;  1SYT A;  4G50 A;  2O92 A;  4MSP A;  1WB0 A;  4MNK A;  4LAW A;  2DSW A;  2RUR A;  4DRQ A;  1HKI A;  2LJ4 A;  3O5R A;  3UF8 A;  4DT4 A;  5DO2 A;  2KE0 A;  3ARV A;  2PV1 A;  4HBO A;  1LL7 A;  5HW7 A;  1Q1C A;  1HXV A;  3TCZ A;  1BL4 A;  4DRM A;  4DWS A;  1LG1 A;  2LKN A;  2ZR6 A;  1FKI A;  4PTM A;  3FAP A;  4ODN A;  4LAV A;  1FKB A;  2PV2 A;  1LL4 A;  4JFI A;  3IHZ A;  2DT2 A;  3TDB A;  3B9E A;  3O5L A;  4MTV A;  4DWS D;  1W9V A;  2Q5A A;  2KR7 A;  1EIB A;  3O5G A;  4NSB A;  3RME A;  4TW8 A;  4JFK A;  3CGM A;  1E15 A;  4URI A;  1CTN A;  1IX5 A;  4DRI A;  1SR0 A;  1ZL1 A;  4P8U A;  3JYM A;  3B8S A;  2KI3 A;  4MNL A;  3CGN A;  2AOS A;  4WJX A;  1EQ3 A;  3FY1 A;  2DG4 A;  5DIV A;  1OGB A;  2XP3 A;  3B09 A;  3EY6 A;  4ODR A;  2KFW A;  1H0I A;  5DEZ A;  1NMW A;  1NWS A;  4ODO A;  4TX0 A;  4GIV A;  3WL1 A;  3WQV A;  1F8A B;  3RM8 A;  4DRO A;  3G6L A;  3PRB A;  4W9P A;  1BKF A;  4DRH A;  2WLZ A;  4JFL A;  4FAP A;  1NH6 A;  1NWU A;  4DWS C;  1W1P A;  3KAH A;  1P5Q A;  4DWS B;  4DIP A;  4LGX A;  2LGO A;  4W5U A;  4BF8 A;  2XP5 A;  2XP4 A;  2DSV A;  1Y0O A;  1QZ2 A;  4MAV A;  4WKF A;  2G41 A;  2DG9 A;  3KZ7 A;  3RFW A;  3KCE A;  2KO7 A;  1HJX A;  5HUA A;  1RD6 A;  4G2P A;  1LG2 A;  1GUV A;  1HKK A;  1ZBW A;  4HBE A;  5D75 A;  3CHC A;  3CHD A;  1X6L A;  4JFM A;  4N19 A;  1FKL A;  1TCO C;  2RUD A;  4ITZ A;  5DIT A;  3I6C A;  3RM4 A;  2OFN A;  1LQ0 A;  3KAF A;  3O5K A;  3PA7 A;  3CH9 A;  3ARU A;  3B9A A;  4Z2I A;  4U85 A;  1ZB5 A;  1F40 A;  3O5M A;  1PIN A;  1T11 A;  1W1Y A;  3WH0 A;  4O2T A;  1KFW A;  4Z2G A;  1U79 A;  2MNT A;  3BXW A;  2L2S A;  5DF0 A;  1J4I A;  1W1T A;  3WKZ A;  4QZV B;  1ROT A;  2PV3 A;  5HWB A;  2XPB A;  3ODK A;  3PRA A;  3UI6 A;  3CHE A;  4ZS6 A;  3O5D A;  1E6Z A;  4DRJ A;  1FKF A;  4NNR A;  3ARQ A;  3AS1 A;  1WNO A;  1N1A A;  2K8I A;  1FKH A;  3QOK A;  1FFQ A;  1FKR A;  2RUC A;  1D2K A;  1JNS A;  4IT6 A;  3ARX A;  2O9O A;  1JNE A;  4J4O A;  1JVW A;  3WD2 A;  1D6O A;  1HKM A;  2VCD A;  2M08 A;  3RGC A;  4GGQ A;  1FKD A;  2IUZ A;  4JFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...