1L1PA

Solution structure of the ppiase domain from e. coli trigger factor
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
106
structure length
106
Chain Sequence
GSHMQATWKEKDGAVEAEDRVTIDFTGSVDGEEFEGGKASDFVLAMGQGRMIPGFEDGIKGHKAGEEFTIDVTFPEEYHAENLKGKAAKFAINLKKVEERELPELT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the Closed Form of a Peptidyl-Prolyl Isomerase Reveals the Mechanism of Protein Folding
rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords trigger factor
total genus 8
structure length 106
sequence length 106
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2002-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1l1pA00
2PBCA 2XPAA 4W9PA 2ZQSA 1J4HA 3O5FA 1QPLA 2RUCA 4U86A 4J4OA 2KR7A 4TW8A 4DROA 2MPHA 2DG4A 4DRPA 3UQBA 2KFWA 2RSEA 1D7JA 2AWGA 2PV1A 3H9RB 1TCOC 2F2DA 2JZVA 2XP4A 1N1AA 3MDYB 1J4RA 4TNSA 1FKBA 4DZ3A 2RQSA 2N87A 2Y78A 3ODKA 3O5RA 1FKDA 4DRNA 3O5IA 2LKNA 3UI5A 1Y0OA 2ZR5A 4JFIA 1D6OA 4ODLA 3WH0A 3B7XA 3KZ7A 3O5LA 4DRKA 4DRHA 1FJDA 1NMVA 5GPGA 1JNSA 1PINA 1FKGA 3NRKA 1JVWA 5HWCA 4ODMA 2XPBA 2F4EA 1D7IA 2XP6A 3IKGA 3O5OA 1J6YA 1M5YA 1NSGA 1T11A 2XP9A 3O5PA 5J6EA 4N19A 1FKIA 5D75A 4DH0A 3TC5A 2DG3A 4LAVA 1YATA 4IQCA 2L2SA 3IHZA 5HW7A 1QZ2A 1FKLA 4DZ2A 2VCDA 3UI4A 4JFJA 4JYSA 2RURA 4ITZA 3FAPA 4GIVA 2ZR4A 4QIBA 4ODRA 4TW6A 1ZCNA 3JXVA 4FN2A 1ROTA 1KT0A 2RUQA 4W9OA 2RUDA 2PPNA 3RGCA 4BF8A 4DRMA 1FKSA 2LGOA 2MNTA 2PV2A 1BKFA 3EY6A 2PPOA 2FAPA 4LAXA 1L1PA 2M08A 5HT1A 5HW8A 3O5QA 1U79A 3O5DA 4J4NA 1FKTA 1FKRA 1ZK6A 1P5QA 5HKGA 4QT3A 1C9HA 2ZQVA 4U85A 3GPKA 3KAHA 2LJ4A 1J4IA 4ODNA 1FKKA 5DIVA 4LAWA 3PA7A 1KT1A 1A7XA 2PPPA 3IK8A 4MGVA 4ODKA 4DIPA 2XP5A 2K8IA 3JYMA 3UQAA 2FKEA 5HWBA 3CGNA 2KE0A 3KAIA 1BL4A 5BXJA 5I98A 2ZR6A 1Q6IA 2Q5AA 4JFMA 4C02B 3O5GA 1F40A 2XP7A 3UI6A 2KGJA 3O5JA 4DRQA 3PRDA 2F21A 4DRIA 4QT2A 2DG9A 3TCZA 1D7HA 4TX0A 4U84A 1JNTA 3O5EA 1FAPA 4MSPA 3O5KA 3NI6A 1FD9A 1FKJA 4IQ2A 3VAWA 3I6CA 4DRJA 3JYJA 1QPFA 3UF8A 4DT4A 3TDBA 4ODPA 3NTPA 4G2PA 3KABA 1R9HA 2MF9A 1YW5A 2M2AA 2KI3A 5HUAA 2OFNA 3KCEA 5DIUA 1Q1CA 3KADA 5HW6A 3UQIA 1NMWA 4GGQA 3IKDA 2ZQTA 2VN1A 3CGMA 1EYMA 1Q6UA 2LPVA 2MLYA 2M1IA 4ODOA 4LAYA 3KAGA 4TW7A 1ROUA 4O2TA 5DITA 2UZ5A 3PRBA 1FKFA 2MLZA 4G50A 2ITKA 4JFKA 2ZQUA 4W9QA 2MLXA 1B6CA 3OOBA 1Q6HA 1PBKA 4ODQA 2XP8A 1HXVA 2KO7A 1FKHA 2PV3A 3RFWA 4FAPA 4TYOA 5HTGA 4IPXA 2D9FA 3KACA 1EQ3A 3LUOA 1W26A 5B8IC 2XP3A 3O5MA 4NNRA 2IF4A 4R0XA 1F8AB 4JFLA 3KAFA
chains in the Genus database with same CATH superfamily
3ARWA 1HKIA 4W9PA 1QPLA 4P8WA 4U86A 4J4OA 4NSBA 2KR7A 2RSEA 1D7JA 2PV1A 2QF8A 2F2DA 4ZS6A 2OLHA 3MDYB 4TNSA 2Y78A 3BXWA 3ODKA 4S3KA 3ARPA 3UI5A 4NZCA 4Q22A 1D6OA 3WH0A 1FJDA 2DPEA 2O9OA 3ARSA 5GPGA 1PINA 5HWCA 1LL4A 4ODMA 3OA5A 1LG2A 4Z2JA 3O5PA 1FKIA 1E6ZA 3IHZA 2VCDA 4HBEA 1ITXA 4JYSA 4TW6A 2YBTA 4GIVA 5I98A 2ZR4A 4DWSC 3JXVA 1ROTA 2DSVA 1KT0A 2O92A 4ZPWR 4URIA 4BF8A 2PPOA 4LAXA 1L1PA 4MNMA 3O5DA 4J4NA 4P8XA 1ZBKA 1FKRA 4QT3A 1C9HA 3ARRA 3CZ8A 1J4IA 4LAWA 3PA7A 1A7XA 4MGVA 2WM0A 4DIPA 1LL7A 2B5UB 5BXJA 4JFMA 2YBUA 4C02B 4Z2GA 1ZBCA 3O5GA 2DT3A 2KGJA 1NWTA 1WNOA 1D2KA 4ZPVR 3ARTA 1JNTA 1FD9A 1FKJA 4P8VA 4DRJA 3UF8A 1SYTA 1YW5A 2OFNA 1HKMA 3AS3A 2ZQTA 1HKKA 1Q6UA 1E6NA 1KFWA 4ODOA 4LAYA 3AROA 3WD1A 2IUZA 3BMBA 1ROUA 2DT2A 4MAVA 1GOIA 3B8SA 1B6CA 3OOBA 4ODQA 2FDMA 1EIBA 3CH9A 4WKAA 4FAPA 3RFWA 4TYOA 5HTGA 3KACA 1WAWA 1EQ3A 1F8AB 2PBCA 3O5FA 2RUCA 4DROA 2A3BA 2MPHA 2DG4A 2AWGA 3H9RB 3ARQA 2WK2A 4Z2KA 3CHCA 2AOSA 3WL1A 1GUVA 1E15A 1FKDA 4DRNA 2B31A 2LKNA 2G41A 2ZR5A 3O5LA 4DRHA 3WD3A 1NMVA 3NRKA 1JVWA 1E44A 2DT1A 2F4EA 2XP6A 3O5OA 1K9TA 3CHDA 1T11A 3PRAA 5J6EA 4N19A 4DH0A 5D75A 3TC5A 1XRVA 1FFRA 4IQCA 2L2SA 3AS0A 4DZ2A 2A3EA 4WK9A 4QIBA 2DSWA 3ARYA 4ODRA 1ZCNA 4Q7NA 4S3JA 2RUQA 5DF0A 2PPNA 1NH6A 1FKTA 1ZK6A 5HKGA 2ZQVA 3B9DA 4U85A 3GPKA 4WKFA 3WL0A 3WKZA 2DT0A 3WQWA 1CTNA 4ODNA 4ODKA 1KT1A 1W1YA 3RM8A 2K8IA 1OGBA 2FKEA 1W1VA 1O6IA 2ETNA 2ZR6A 1F40A 4DRQA 1EDQA 1W9PA 4MNKA 4IT6A 3FXYA 2DG9A 4QZVB 1TFVA 3RM4A 3TCZA 1D7HA 1NWRA 1FAPA 1X6NA 3RM9A 3VAWA 1R9HA 2MF9A 2M2AA 2KI3A 2A3AA 3GTYX 5HUAA 2WLZA 1Q1CA 3KADA 1NMWA 5GQBA 4KR0B 2VN1A 1GPFA 2M1IA 3ARXA 2PN0A 4TW7A 5DITA 2EULA 2MLZA 4G50A 4JFKA 4PTMA 1LL6A 4UDMA 4W9QA 2XP8A 1FKHA 1NWUA 4IPXA 1X6LA 3LUOA 4WKHA 1HJXA 3ARVA 2A3CA 4R5EA 2ZQSA 4L72B 2WLYA 4TW8A 4DRPA 3UQBA 2JZVA 1SR0A 1FKBA 3ARZA 2RQSA 2N87A 3FY1A 3O5RA 3O5IA 1E6RA 4JFIA 4ODLA 4DRKA 1W1PA 3KZ7A 3WIJA 1UR8A 1JNDA 2XPBA 3WD4A 4IT4A 1J6YA 1M5YA 2XP9A 4DWSA 4LAVA 1W9VA 3EIPA 2RURA 4ITZA 4FN2A 4W9OA 3RGCA 4DRMA 1UR9A 3EY6A 2M08A 4HARA 1U79A 5JH8A 1LG1A 3WD2A 4LGXA 1P5QA 3B9AA 3KAHA 3AS2A 4P8UA 4MNJA 2PPPA 3JYMA 3UQAA 5HWBA 2XP7A 3UI6A 3PRDA 4DRIA 4U84A 5DEZA 3QOKA 1NWSA 3JYJA 1QPFA 2G8ZA 4DT4A 3TDBA 3GU0A 4ODPA 3NTPA 4G2PA 3RMEA 3KABA 2PI6A 4Z2IA 4WJXA 4MNLA 1H0IA 3IKDA 1EYMA 2P4VA 1VF8A 4O2TA 2UZ5A 1JCHB 4DWSD 2ITKA 2ZQUA 2MLXA 1WB0A 5GPRA 2PV3A 2D9FA 5B8IC 3O5MA 4NNRA 2IF4A 4R0XA 4JFLA 1IX5A 4ML4A 2XPAA 1J4HA 3ALGA 1HJVA 3G6MA 4XAKA 2KFWA 3CHEA 1TCOC 2XP4A 5HBFA 1HJWA 1N1AA 1J4RA 1H0GA 4AY1A 4DZ3A 3WQVA 1ZB5A 1ZBVA 2DSZA 1Y0OA 4HBOA 3ALFA 3B7XA 1OGGA 3CHFA 1JNSA 1FKGA 1RD6A 2DSUA 1D7IA 3IKGA 1NSGA 1XHGA 1W1TA 2DG3A 1YATA 1JNEA 5HW7A 1QZ2A 1FKLA 3ARUA 4ZPTR 3UI4A 4JFJA 3FAPA 1W9UA 4WIWA 2RUDA 1FKSA 1FFQA 2LGOA 1EHNA 2MNTA 4MPKA 2PV2A 1BKFA 2FAPA 1OWQA 5HT1A 5HW8A 3O5QA 2LJ4A 2F23A 1FKKA 5DIVA 3IK8A 4MTVA 2XP5A 3CGNA 2KE0A 3KAIA 1BL4A 1Q6IA 2Q5AA 3O5JA 1ZU8A 1LQ0A 2ESCA 2F21A 4QT2A 3G6LA 4TX0A 1E6PA 3O5EA 4MSPA 1ZBWA 3O5KA 3NI6A 4IQ2A 4Z2LA 3I6CA 4L3NA 1LJYA 1E9LA 3KCEA 5DIUA 5HW6A 3UQIA 3B9EA 4GGQA 3CGMA 4W5UA 2LPVA 2MLYA 3AQUA 4Z2HA 3W4RA 3KAGA 1ZL1A 4DWSB 1HKJA 1GRJA 3PRBA 1FKFA 3WD0A 4KQZA 1Q6HA 1PBKA 1HXVA 2KO7A 3PR9A 1W26A 5DO2A 2XP3A 3AS1A 3KAFA
chains in the Genus database with same CATH topology
3ARWA 1HKIA 4W9PA 1QPLA 4P8WA 4U86A 4J4OA 4NSBA 2KR7A 2RSEA 1D7JA 2PV1A 2QF8A 2F2DA 4ZS6A 2OLHA 3MDYB 4TNSA 2Y78A 3BXWA 3ODKA 4S3KA 3ARPA 3UI5A 4NZCA 4Q22A 1D6OA 3WH0A 1FJDA 2DPEA 2O9OA 3ARSA 5GPGA 1PINA 5HWCA 1LL4A 4ODMA 3OA5A 1LG2A 4Z2JA 3O5PA 1FKIA 1E6ZA 3IHZA 2VCDA 4HBEA 1ITXA 4JYSA 4TW6A 2YBTA 4GIVA 5I98A 2ZR4A 4DWSC 3JXVA 1ROTA 2DSVA 1KT0A 2O92A 4ZPWR 4URIA 4BF8A 2PPOA 4LAXA 1L1PA 4MNMA 3O5DA 4J4NA 4P8XA 1ZBKA 1FKRA 4QT3A 1C9HA 3ARRA 3CZ8A 1J4IA 4LAWA 3PA7A 1A7XA 4MGVA 2WM0A 4DIPA 1LL7A 5BXJA 4JFMA 2YBUA 4C02B 4Z2GA 1ZBCA 3O5GA 2DT3A 2KGJA 1NWTA 1WNOA 1D2KA 4ZPVR 3ARTA 1JNTA 1FD9A 1FKJA 4P8VA 4DRJA 3UF8A 1SYTA 1YW5A 2OFNA 1HKMA 3AS3A 2ZQTA 1HKKA 1Q6UA 1E6NA 1KFWA 4ODOA 4LAYA 3AROA 3WD1A 2IUZA 1ROUA 2DT2A 4MAVA 1GOIA 3B8SA 1B6CA 3OOBA 4ODQA 2FDMA 1EIBA 3CH9A 4WKAA 4FAPA 3RFWA 4TYOA 5HTGA 3KACA 1WAWA 1EQ3A 1F8AB 2PBCA 3O5FA 2RUCA 4DROA 2A3BA 2MPHA 2DG4A 2AWGA 3H9RB 3ARQA 2WK2A 4Z2KA 3CHCA 2AOSA 3WL1A 1GUVA 1E15A 1FKDA 4DRNA 2B31A 2LKNA 2G41A 2ZR5A 3O5LA 4DRHA 3WD3A 1NMVA 3NRKA 1JVWA 2DT1A 2F4EA 2XP6A 3O5OA 1K9TA 3CHDA 1T11A 3PRAA 5J6EA 4N19A 4DH0A 5D75A 3TC5A 1XRVA 1FFRA 4IQCA 2L2SA 3AS0A 4DZ2A 2A3EA 4WK9A 4QIBA 2DSWA 3ARYA 4ODRA 1ZCNA 4Q7NA 4S3JA 2RUQA 5DF0A 2PPNA 1NH6A 1FKTA 1ZK6A 5HKGA 2ZQVA 3B9DA 4U85A 3GPKA 4WKFA 3WL0A 3WKZA 2DT0A 3WQWA 1CTNA 4ODNA 4ODKA 1KT1A 1W1YA 3RM8A 2K8IA 1OGBA 2FKEA 1W1VA 1O6IA 2ZR6A 1F40A 4DRQA 1EDQA 1W9PA 4MNKA 4IT6A 3FXYA 2DG9A 4QZVB 1TFVA 3RM4A 3TCZA 1D7HA 1NWRA 1FAPA 1X6NA 3RM9A 3VAWA 1R9HA 2MF9A 2M2AA 2KI3A 2A3AA 5HUAA 2WLZA 1Q1CA 3KADA 1NMWA 5GQBA 4KR0B 2VN1A 1GPFA 2M1IA 3ARXA 4TW7A 5DITA 2MLZA 4JFKA 4G50A 4PTMA 1LL6A 4W9QA 2XP8A 1FKHA 1NWUA 4IPXA 1X6LA 3LUOA 4WKHA 1HJXA 3ARVA 2A3CA 4R5EA 2ZQSA 4L72B 2WLYA 4TW8A 4DRPA 3UQBA 2JZVA 1SR0A 1FKBA 3ARZA 2RQSA 2N87A 3FY1A 3O5RA 3O5IA 1E6RA 4JFIA 4ODLA 4DRKA 1W1PA 3KZ7A 3WIJA 1UR8A 1JNDA 2XPBA 3WD4A 4IT4A 1J6YA 1M5YA 2XP9A 4DWSA 4LAVA 1W9VA 4ITZA 2RURA 4FN2A 4W9OA 3RGCA 4DRMA 1UR9A 3EY6A 2M08A 4HARA 1U79A 5JH8A 1LG1A 3WD2A 4LGXA 1P5QA 3B9AA 3KAHA 3AS2A 4P8UA 4MNJA 2PPPA 3JYMA 3UQAA 5HWBA 2XP7A 3UI6A 3PRDA 4DRIA 4U84A 5DEZA 3QOKA 1NWSA 3JYJA 1QPFA 2G8ZA 4DT4A 3TDBA 4ODPA 3NTPA 4G2PA 3RMEA 3KABA 2PI6A 4Z2IA 4WJXA 4MNLA 1H0IA 3IKDA 1EYMA 1VF8A 4O2TA 2UZ5A 4DWSD 2ITKA 2ZQUA 2MLXA 1WB0A 5GPRA 2PV3A 2D9FA 5B8IC 3O5MA 4NNRA 2IF4A 4R0XA 4JFLA 1IX5A 4ML4A 2XPAA 1J4HA 3ALGA 1HJVA 3G6MA 4XAKA 2KFWA 3CHEA 1TCOC 2XP4A 5HBFA 1HJWA 1N1AA 1J4RA 1H0GA 4AY1A 4DZ3A 3WQVA 1ZB5A 1ZBVA 2DSZA 1Y0OA 4HBOA 3ALFA 3B7XA 1OGGA 3CHFA 1JNSA 1FKGA 1RD6A 2DSUA 1D7IA 3IKGA 1NSGA 1XHGA 1W1TA 2DG3A 1YATA 1JNEA 5HW7A 1QZ2A 1FKLA 3ARUA 4ZPTR 3UI4A 4JFJA 3FAPA 1W9UA 4WIWA 2RUDA 1FKSA 1FFQA 2LGOA 1EHNA 2MNTA 4MPKA 2PV2A 1BKFA 2FAPA 1OWQA 5HT1A 5HW8A 3O5QA 2LJ4A 1FKKA 5DIVA 3IK8A 4MTVA 2XP5A 3CGNA 2KE0A 3KAIA 1BL4A 1Q6IA 2Q5AA 3O5JA 1ZU8A 1LQ0A 2ESCA 2F21A 4QT2A 3G6LA 4TX0A 1E6PA 3O5EA 4MSPA 1ZBWA 3O5KA 3NI6A 4IQ2A 4Z2LA 3I6CA 4L3NA 1LJYA 1E9LA 3KCEA 5DIUA 5HW6A 3UQIA 3B9EA 4GGQA 3CGMA 4W5UA 2LPVA 2MLYA 3AQUA 4Z2HA 3W4RA 3KAGA 1ZL1A 4DWSB 1HKJA 3PRBA 1FKFA 3WD0A 4KQZA 1Q6HA 1PBKA 1HXVA 2KO7A 3PR9A 1W26A 5DO2A 2XP3A 3AS1A 3KAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PBC A;  2XPA A;  4W9P A;  2ZQS A;  1J4H A;  3O5F A;  1QPL A;  2RUC A;  4U86 A;  4J4O A;  2KR7 A;  4TW8 A;  4DRO A;  2MPH A;  2DG4 A;  4DRP A;  3UQB A;  2KFW A;  2RSE A;  1D7J A;  2AWG A;  2PV1 A;  3H9R B;  1TCO C;  2F2D A;  2JZV A;  2XP4 A;  1N1A A;  3MDY B;  1J4R A;  4TNS A;  1FKB A;  4DZ3 A;  2RQS A;  2N87 A;  2Y78 A;  3ODK A;  3O5R A;  1FKD A;  4DRN A;  3O5I A;  2LKN A;  3UI5 A;  1Y0O A;  2ZR5 A;  4JFI A;  1D6O A;  4ODL A;  3WH0 A;  3B7X A;  3KZ7 A;  3O5L A;  4DRK A;  4DRH A;  1FJD A;  1NMV A;  5GPG A;  1JNS A;  1PIN A;  1FKG A;  3NRK A;  1JVW A;  5HWC A;  4ODM A;  2XPB A;  2F4E A;  1D7I A;  2XP6 A;  3IKG A;  3O5O A;  1J6Y A;  1M5Y A;  1NSG A;  1T11 A;  2XP9 A;  3O5P A;  5J6E A;  4N19 A;  1FKI A;  5D75 A;  4DH0 A;  3TC5 A;  2DG3 A;  4LAV A;  1YAT A;  4IQC A;  2L2S A;  3IHZ A;  5HW7 A;  1QZ2 A;  1FKL A;  4DZ2 A;  2VCD A;  3UI4 A;  4JFJ A;  4JYS A;  2RUR A;  4ITZ A;  3FAP A;  4GIV A;  2ZR4 A;  4QIB A;  4ODR A;  4TW6 A;  1ZCN A;  3JXV A;  4FN2 A;  1ROT A;  1KT0 A;  2RUQ A;  4W9O A;  2RUD A;  2PPN A;  3RGC A;  4BF8 A;  4DRM A;  1FKS A;  2LGO A;  2MNT A;  2PV2 A;  1BKF A;  3EY6 A;  2PPO A;  2FAP A;  4LAX A;  1L1P A;  2M08 A;  5HT1 A;  5HW8 A;  3O5Q A;  1U79 A;  3O5D A;  4J4N A;  1FKT A;  1FKR A;  1ZK6 A;  1P5Q A;  5HKG A;  4QT3 A;  1C9H A;  2ZQV A;  4U85 A;  3GPK A;  3KAH A;  2LJ4 A;  1J4I A;  4ODN A;  1FKK A;  5DIV A;  4LAW A;  3PA7 A;  1KT1 A;  1A7X A;  2PPP A;  3IK8 A;  4MGV A;  4ODK A;  4DIP A;  2XP5 A;  2K8I A;  3JYM A;  3UQA A;  2FKE A;  5HWB A;  3CGN A;  2KE0 A;  3KAI A;  1BL4 A;  5BXJ A;  5I98 A;  2ZR6 A;  1Q6I A;  2Q5A A;  4JFM A;  4C02 B;  3O5G A;  1F40 A;  2XP7 A;  3UI6 A;  2KGJ A;  3O5J A;  4DRQ A;  3PRD A;  2F21 A;  4DRI A;  4QT2 A;  2DG9 A;  3TCZ A;  1D7H A;  4TX0 A;  4U84 A;  1JNT A;  3O5E A;  1FAP A;  4MSP A;  3O5K A;  3NI6 A;  1FD9 A;  1FKJ A;  4IQ2 A;  3VAW A;  3I6C A;  4DRJ A;  3JYJ A;  1QPF A;  3UF8 A;  4DT4 A;  3TDB A;  4ODP A;  3NTP A;  4G2P A;  3KAB A;  1R9H A;  2MF9 A;  1YW5 A;  2M2A A;  2KI3 A;  5HUA A;  2OFN A;  3KCE A;  5DIU A;  1Q1C A;  3KAD A;  5HW6 A;  3UQI A;  1NMW A;  4GGQ A;  3IKD A;  2ZQT A;  2VN1 A;  3CGM A;  1EYM A;  1Q6U A;  2LPV A;  2MLY A;  2M1I A;  4ODO A;  4LAY A;  3KAG A;  4TW7 A;  1ROU A;  4O2T A;  5DIT A;  2UZ5 A;  3PRB A;  1FKF A;  2MLZ A;  4G50 A;  2ITK A;  4JFK A;  2ZQU A;  4W9Q A;  2MLX A;  1B6C A;  3OOB A;  1Q6H A;  1PBK A;  4ODQ A;  2XP8 A;  1HXV A;  2KO7 A;  1FKH A;  2PV3 A;  3RFW A;  4FAP A;  4TYO A;  5HTG A;  4IPX A;  2D9F A;  3KAC A;  1EQ3 A;  3LUO A;  1W26 A;  5B8I C;  2XP3 A;  3O5M A;  4NNR A;  2IF4 A;  4R0X A;  1F8A B;  4JFL A;  3KAF A; 
#chains in the Genus database with same CATH topology
 3ARW A;  1HKI A;  4W9P A;  1QPL A;  4P8W A;  4U86 A;  4J4O A;  4NSB A;  2KR7 A;  2RSE A;  1D7J A;  2PV1 A;  2QF8 A;  2F2D A;  4ZS6 A;  2OLH A;  3MDY B;  4TNS A;  2Y78 A;  3BXW A;  3ODK A;  4S3K A;  3ARP A;  3UI5 A;  4NZC A;  4Q22 A;  1D6O A;  3WH0 A;  1FJD A;  2DPE A;  2O9O A;  3ARS A;  5GPG A;  1PIN A;  5HWC A;  1LL4 A;  4ODM A;  3OA5 A;  1LG2 A;  4Z2J A;  3O5P A;  1FKI A;  1E6Z A;  3IHZ A;  2VCD A;  4HBE A;  1ITX A;  4JYS A;  4TW6 A;  2YBT A;  4GIV A;  5I98 A;  2ZR4 A;  4DWS C;  3JXV A;  1ROT A;  2DSV A;  1KT0 A;  2O92 A;  4ZPW R;  4URI A;  4BF8 A;  2PPO A;  4LAX A;  1L1P A;  4MNM A;  3O5D A;  4J4N A;  4P8X A;  1ZBK A;  1FKR A;  4QT3 A;  1C9H A;  3ARR A;  3CZ8 A;  1J4I A;  4LAW A;  3PA7 A;  1A7X A;  4MGV A;  2WM0 A;  4DIP A;  1LL7 A;  2B5U B;  5BXJ A;  4JFM A;  2YBU A;  4C02 B;  4Z2G A;  1ZBC A;  3O5G A;  2DT3 A;  2KGJ A;  1NWT A;  1WNO A;  1D2K A;  4ZPV R;  3ART A;  1JNT A;  1FD9 A;  1FKJ A;  4P8V A;  4DRJ A;  3UF8 A;  1SYT A;  1YW5 A;  2OFN A;  1HKM A;  3AS3 A;  2ZQT A;  1HKK A;  1Q6U A;  1E6N A;  1KFW A;  4ODO A;  4LAY A;  3ARO A;  3WD1 A;  2IUZ A;  3BMB A;  1ROU A;  2DT2 A;  4MAV A;  1GOI A;  3B8S A;  1B6C A;  3OOB A;  4ODQ A;  2FDM A;  1EIB A;  3CH9 A;  4WKA A;  4FAP A;  3RFW A;  4TYO A;  5HTG A;  3KAC A;  1WAW A;  1EQ3 A;  1F8A B;  2PBC A;  3O5F A;  2RUC A;  4DRO A;  2A3B A;  2MPH A;  2DG4 A;  2AWG A;  3H9R B;  3ARQ A;  2WK2 A;  4Z2K A;  3CHC A;  2AOS A;  3WL1 A;  1GUV A;  1E15 A;  1FKD A;  4DRN A;  2B31 A;  2LKN A;  2G41 A;  2ZR5 A;  3O5L A;  4DRH A;  3WD3 A;  1NMV A;  3NRK A;  1JVW A;  1E44 A;  2DT1 A;  2F4E A;  2XP6 A;  3O5O A;  1K9T A;  3CHD A;  1T11 A;  3PRA A;  5J6E A;  4N19 A;  4DH0 A;  5D75 A;  3TC5 A;  1XRV A;  1FFR A;  4IQC A;  2L2S A;  3AS0 A;  4DZ2 A;  2A3E A;  4WK9 A;  4QIB A;  2DSW A;  3ARY A;  4ODR A;  1ZCN A;  4Q7N A;  4S3J A;  2RUQ A;  5DF0 A;  2PPN A;  1NH6 A;  1FKT A;  1ZK6 A;  5HKG A;  2ZQV A;  3B9D A;  4U85 A;  3GPK A;  4WKF A;  3WL0 A;  3WKZ A;  2DT0 A;  3WQW A;  1CTN A;  4ODN A;  4ODK A;  1KT1 A;  1W1Y A;  3RM8 A;  2K8I A;  1OGB A;  2FKE A;  1W1V A;  1O6I A;  2ETN A;  2ZR6 A;  1F40 A;  4DRQ A;  1EDQ A;  1W9P A;  4MNK A;  4IT6 A;  3FXY A;  2DG9 A;  4QZV B;  1TFV A;  3RM4 A;  3TCZ A;  1D7H A;  1NWR A;  1FAP A;  1X6N A;  3RM9 A;  3VAW A;  1R9H A;  2MF9 A;  2M2A A;  2KI3 A;  2A3A A;  3GTY X;  5HUA A;  2WLZ A;  1Q1C A;  3KAD A;  1NMW A;  5GQB A;  4KR0 B;  2VN1 A;  1GPF A;  2M1I A;  3ARX A;  2PN0 A;  4TW7 A;  5DIT A;  2EUL A;  2MLZ A;  4G50 A;  4JFK A;  4PTM A;  1LL6 A;  4UDM A;  4W9Q A;  2XP8 A;  1FKH A;  1NWU A;  4IPX A;  1X6L A;  3LUO A;  4WKH A;  1HJX A;  3ARV A;  2A3C A;  4R5E A;  2ZQS A;  4L72 B;  2WLY A;  4TW8 A;  4DRP A;  3UQB A;  2JZV A;  1SR0 A;  1FKB A;  3ARZ A;  2RQS A;  2N87 A;  3FY1 A;  3O5R A;  3O5I A;  1E6R A;  4JFI A;  4ODL A;  4DRK A;  1W1P A;  3KZ7 A;  3WIJ A;  1UR8 A;  1JND A;  2XPB A;  3WD4 A;  4IT4 A;  1J6Y A;  1M5Y A;  2XP9 A;  4DWS A;  4LAV A;  1W9V A;  3EIP A;  2RUR A;  4ITZ A;  4FN2 A;  4W9O A;  3RGC A;  4DRM A;  1UR9 A;  3EY6 A;  2M08 A;  4HAR A;  1U79 A;  5JH8 A;  1LG1 A;  3WD2 A;  4LGX A;  1P5Q A;  3B9A A;  3KAH A;  3AS2 A;  4P8U A;  4MNJ A;  2PPP A;  3JYM A;  3UQA A;  5HWB A;  2XP7 A;  3UI6 A;  3PRD A;  4DRI A;  4U84 A;  5DEZ A;  3QOK A;  1NWS A;  3JYJ A;  1QPF A;  2G8Z A;  4DT4 A;  3TDB A;  3GU0 A;  4ODP A;  3NTP A;  4G2P A;  3RME A;  3KAB A;  2PI6 A;  4Z2I A;  4WJX A;  4MNL A;  1H0I A;  3IKD A;  1EYM A;  2P4V A;  1VF8 A;  4O2T A;  2UZ5 A;  1JCH B;  4DWS D;  2ITK A;  2ZQU A;  2MLX A;  1WB0 A;  5GPR A;  2PV3 A;  2D9F A;  5B8I C;  3O5M A;  4NNR A;  2IF4 A;  4R0X A;  4JFL A;  1IX5 A;  4ML4 A;  2XPA A;  1J4H A;  3ALG A;  1HJV A;  3G6M A;  4XAK A;  2KFW A;  3CHE A;  1TCO C;  2XP4 A;  5HBF A;  1HJW A;  1N1A A;  1J4R A;  1H0G A;  4AY1 A;  4DZ3 A;  3WQV A;  1ZB5 A;  1ZBV A;  2DSZ A;  1Y0O A;  4HBO A;  3ALF A;  3B7X A;  1OGG A;  3CHF A;  1JNS A;  1FKG A;  1RD6 A;  2DSU A;  1D7I A;  3IKG A;  1NSG A;  1XHG A;  1W1T A;  2DG3 A;  1YAT A;  1JNE A;  5HW7 A;  1QZ2 A;  1FKL A;  3ARU A;  4ZPT R;  3UI4 A;  4JFJ A;  3FAP A;  1W9U A;  4WIW A;  2RUD A;  1FKS A;  1FFQ A;  2LGO A;  1EHN A;  2MNT A;  4MPK A;  2PV2 A;  1BKF A;  2FAP A;  1OWQ A;  5HT1 A;  5HW8 A;  3O5Q A;  2LJ4 A;  2F23 A;  1FKK A;  5DIV A;  3IK8 A;  4MTV A;  2XP5 A;  3CGN A;  2KE0 A;  3KAI A;  1BL4 A;  1Q6I A;  2Q5A A;  3O5J A;  1ZU8 A;  1LQ0 A;  2ESC A;  2F21 A;  4QT2 A;  3G6L A;  4TX0 A;  1E6P A;  3O5E A;  4MSP A;  1ZBW A;  3O5K A;  3NI6 A;  4IQ2 A;  4Z2L A;  3I6C A;  4L3N A;  1LJY A;  1E9L A;  3KCE A;  5DIU A;  5HW6 A;  3UQI A;  3B9E A;  4GGQ A;  3CGM A;  4W5U A;  2LPV A;  2MLY A;  3AQU A;  4Z2H A;  3W4R A;  3KAG A;  1ZL1 A;  4DWS B;  1HKJ A;  1GRJ A;  3PRB A;  1FKF A;  3WD0 A;  4KQZ A;  1Q6H A;  1PBK A;  1HXV A;  2KO7 A;  3PR9 A;  1W26 A;  5DO2 A;  2XP3 A;  3AS1 A;  3KAF A; 
#chains in the Genus database with same CATH homology
 3ARW A;  1HKI A;  4W9P A;  1QPL A;  4P8W A;  4U86 A;  4J4O A;  4NSB A;  2KR7 A;  2RSE A;  1D7J A;  2PV1 A;  2QF8 A;  2F2D A;  4ZS6 A;  2OLH A;  3MDY B;  4TNS A;  2Y78 A;  3BXW A;  3ODK A;  4S3K A;  3ARP A;  3UI5 A;  4NZC A;  4Q22 A;  1D6O A;  3WH0 A;  1FJD A;  2DPE A;  2O9O A;  3ARS A;  5GPG A;  1PIN A;  5HWC A;  1LL4 A;  4ODM A;  3OA5 A;  1LG2 A;  4Z2J A;  3O5P A;  1FKI A;  1E6Z A;  3IHZ A;  2VCD A;  4HBE A;  1ITX A;  4JYS A;  4TW6 A;  2YBT A;  4GIV A;  5I98 A;  2ZR4 A;  4DWS C;  3JXV A;  1ROT A;  2DSV A;  1KT0 A;  2O92 A;  4ZPW R;  4URI A;  4BF8 A;  2PPO A;  4LAX A;  1L1P A;  4MNM A;  3O5D A;  4J4N A;  4P8X A;  1ZBK A;  1FKR A;  4QT3 A;  1C9H A;  3ARR A;  3CZ8 A;  1J4I A;  4LAW A;  3PA7 A;  1A7X A;  4MGV A;  2WM0 A;  4DIP A;  1LL7 A;  5BXJ A;  4JFM A;  2YBU A;  4C02 B;  4Z2G A;  1ZBC A;  3O5G A;  2DT3 A;  2KGJ A;  1NWT A;  1WNO A;  1D2K A;  4ZPV R;  3ART A;  1JNT A;  1FD9 A;  1FKJ A;  4P8V A;  4DRJ A;  3UF8 A;  1SYT A;  1YW5 A;  2OFN A;  1HKM A;  3AS3 A;  2ZQT A;  1HKK A;  1Q6U A;  1E6N A;  1KFW A;  4ODO A;  4LAY A;  3ARO A;  3WD1 A;  2IUZ A;  1ROU A;  2DT2 A;  4MAV A;  1GOI A;  3B8S A;  1B6C A;  3OOB A;  4ODQ A;  2FDM A;  1EIB A;  3CH9 A;  4WKA A;  4FAP A;  3RFW A;  4TYO A;  5HTG A;  3KAC A;  1WAW A;  1EQ3 A;  1F8A B;  2PBC A;  3O5F A;  2RUC A;  4DRO A;  2A3B A;  2MPH A;  2DG4 A;  2AWG A;  3H9R B;  3ARQ A;  2WK2 A;  4Z2K A;  3CHC A;  2AOS A;  3WL1 A;  1GUV A;  1E15 A;  1FKD A;  4DRN A;  2B31 A;  2LKN A;  2G41 A;  2ZR5 A;  3O5L A;  4DRH A;  3WD3 A;  1NMV A;  3NRK A;  1JVW A;  2DT1 A;  2F4E A;  2XP6 A;  3O5O A;  1K9T A;  3CHD A;  1T11 A;  3PRA A;  5J6E A;  4N19 A;  4DH0 A;  5D75 A;  3TC5 A;  1XRV A;  1FFR A;  4IQC A;  2L2S A;  3AS0 A;  4DZ2 A;  2A3E A;  4WK9 A;  4QIB A;  2DSW A;  3ARY A;  4ODR A;  1ZCN A;  4Q7N A;  4S3J A;  2RUQ A;  5DF0 A;  2PPN A;  1NH6 A;  1FKT A;  1ZK6 A;  5HKG A;  2ZQV A;  3B9D A;  4U85 A;  3GPK A;  4WKF A;  3WL0 A;  3WKZ A;  2DT0 A;  3WQW A;  1CTN A;  4ODN A;  4ODK A;  1KT1 A;  1W1Y A;  3RM8 A;  2K8I A;  1OGB A;  2FKE A;  1W1V A;  1O6I A;  2ZR6 A;  1F40 A;  4DRQ A;  1EDQ A;  1W9P A;  4MNK A;  4IT6 A;  3FXY A;  2DG9 A;  4QZV B;  1TFV A;  3RM4 A;  3TCZ A;  1D7H A;  1NWR A;  1FAP A;  1X6N A;  3RM9 A;  3VAW A;  1R9H A;  2MF9 A;  2M2A A;  2KI3 A;  2A3A A;  5HUA A;  2WLZ A;  1Q1C A;  3KAD A;  1NMW A;  5GQB A;  4KR0 B;  2VN1 A;  1GPF A;  2M1I A;  3ARX A;  4TW7 A;  5DIT A;  2MLZ A;  4JFK A;  4G50 A;  4PTM A;  1LL6 A;  4W9Q A;  2XP8 A;  1FKH A;  1NWU A;  4IPX A;  1X6L A;  3LUO A;  4WKH A;  1HJX A;  3ARV A;  2A3C A;  4R5E A;  2ZQS A;  4L72 B;  2WLY A;  4TW8 A;  4DRP A;  3UQB A;  2JZV A;  1SR0 A;  1FKB A;  3ARZ A;  2RQS A;  2N87 A;  3FY1 A;  3O5R A;  3O5I A;  1E6R A;  4JFI A;  4ODL A;  4DRK A;  1W1P A;  3KZ7 A;  3WIJ A;  1UR8 A;  1JND A;  2XPB A;  3WD4 A;  4IT4 A;  1J6Y A;  1M5Y A;  2XP9 A;  4DWS A;  4LAV A;  1W9V A;  4ITZ A;  2RUR A;  4FN2 A;  4W9O A;  3RGC A;  4DRM A;  1UR9 A;  3EY6 A;  2M08 A;  4HAR A;  1U79 A;  5JH8 A;  1LG1 A;  3WD2 A;  4LGX A;  1P5Q A;  3B9A A;  3KAH A;  3AS2 A;  4P8U A;  4MNJ A;  2PPP A;  3JYM A;  3UQA A;  5HWB A;  2XP7 A;  3UI6 A;  3PRD A;  4DRI A;  4U84 A;  5DEZ A;  3QOK A;  1NWS A;  3JYJ A;  1QPF A;  2G8Z A;  4DT4 A;  3TDB A;  4ODP A;  3NTP A;  4G2P A;  3RME A;  3KAB A;  2PI6 A;  4Z2I A;  4WJX A;  4MNL A;  1H0I A;  3IKD A;  1EYM A;  1VF8 A;  4O2T A;  2UZ5 A;  4DWS D;  2ITK A;  2ZQU A;  2MLX A;  1WB0 A;  5GPR A;  2PV3 A;  2D9F A;  5B8I C;  3O5M A;  4NNR A;  2IF4 A;  4R0X A;  4JFL A;  1IX5 A;  4ML4 A;  2XPA A;  1J4H A;  3ALG A;  1HJV A;  3G6M A;  4XAK A;  2KFW A;  3CHE A;  1TCO C;  2XP4 A;  5HBF A;  1HJW A;  1N1A A;  1J4R A;  1H0G A;  4AY1 A;  4DZ3 A;  3WQV A;  1ZB5 A;  1ZBV A;  2DSZ A;  1Y0O A;  4HBO A;  3ALF A;  3B7X A;  1OGG A;  3CHF A;  1JNS A;  1FKG A;  1RD6 A;  2DSU A;  1D7I A;  3IKG A;  1NSG A;  1XHG A;  1W1T A;  2DG3 A;  1YAT A;  1JNE A;  5HW7 A;  1QZ2 A;  1FKL A;  3ARU A;  4ZPT R;  3UI4 A;  4JFJ A;  3FAP A;  1W9U A;  4WIW A;  2RUD A;  1FKS A;  1FFQ A;  2LGO A;  1EHN A;  2MNT A;  4MPK A;  2PV2 A;  1BKF A;  2FAP A;  1OWQ A;  5HT1 A;  5HW8 A;  3O5Q A;  2LJ4 A;  1FKK A;  5DIV A;  3IK8 A;  4MTV A;  2XP5 A;  3CGN A;  2KE0 A;  3KAI A;  1BL4 A;  1Q6I A;  2Q5A A;  3O5J A;  1ZU8 A;  1LQ0 A;  2ESC A;  2F21 A;  4QT2 A;  3G6L A;  4TX0 A;  1E6P A;  3O5E A;  4MSP A;  1ZBW A;  3O5K A;  3NI6 A;  4IQ2 A;  4Z2L A;  3I6C A;  4L3N A;  1LJY A;  1E9L A;  3KCE A;  5DIU A;  5HW6 A;  3UQI A;  3B9E A;  4GGQ A;  3CGM A;  4W5U A;  2LPV A;  2MLY A;  3AQU A;  4Z2H A;  3W4R A;  3KAG A;  1ZL1 A;  4DWS B;  1HKJ A;  3PRB A;  1FKF A;  3WD0 A;  4KQZ A;  1Q6H A;  1PBK A;  1HXV A;  2KO7 A;  3PR9 A;  1W26 A;  5DO2 A;  2XP3 A;  3AS1 A;  3KAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...