1L1PA

Solution structure of the ppiase domain from e. coli trigger factor
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
106
structure length
106
Chain Sequence
GSHMQATWKEKDGAVEAEDRVTIDFTGSVDGEEFEGGKASDFVLAMGQGRMIPGFEDGIKGHKAGEEFTIDVTFPEEYHAENLKGKAAKFAINLKKVEERELPELT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords trigger factor
publication title Solution Structure of the Closed Form of a Peptidyl-Prolyl Isomerase Reveals the Mechanism of Protein Folding
rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 8
structure length 106
sequence length 106
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2002-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1l1pA00
2D9FA 4W9PA 2XP3A 3IK8A 3O5KA 1FKDA 2ZQSA 1NSGA 4TW8A 5DIVA 1D6OA 2ZR6A 1ZCNA 2FAPA 3FAPA 3PRBA 5HUAA 1FKHA 4DRKA 4J4OA 3KAIA 3UI4A 1EQ3A 1N1AA 3UQBA 1A7XA 3O5JA 1QPFA 4DRMA 1KT0A 1YW5A 5HW8A 2DG3A 2KO7A 1HXVA 1Q6IA 4JFLA 2LPVA 5HTGA 1D7JA 3NRKA 2XPBA 4NNRA 1C9HA 1U79A 1JVWA 4J4NA 1FKLA 3KADA 2ZQTA 3NI6A 4IQ2A 5HT1A 1Y0OA 2LKNA 4ODMA 1M5YA 4TYOA 5DITA 3O5MA 3WH0A 2DG9A 4JFIA 4ODQA 3UI5A 5HW7A 5J6EA 1JNSA 5BXJA 3KAGA 1FKGA 4LAVA 4GIVA 2XP9A 3IHZA 4MGVA 2JZVA 2KR7A 4DRIA 2L2SA 2IF4A 2OFNA 2LJ4A 3JYJA 4IPXA 1FKTA 2M1IA 2MNTA 4FAPA 2MLXA 2ZR5A 2F4EA 1F8AB 1P5QA 4G2PA 2N87A 3RGCA 3B7XA 3PA7A 4QT2A 2PPPA 3CGMA 2K8IA 4ODKA 4MSPA 2PBCA 4ODRA 3CGNA 4ODOA 2MLYA 5HKGA 4G50A 1FKKA 4DRPA 2F2DA 2ZR4A 4O2TA 3UQAA 1FKRA 4DZ3A 2PV2A 4LAXA 2Q5AA 4DROA 1KT1A 4ODLA 2RSEA 1FKJA 2PV1A 1TCOC 4ITZA 4LAWA 3TCZA 2XP5A 2MPHA 2RUDA 4ODPA 2KI3A 3JXVA 3JYMA 3O5EA 2UZ5A 4GGQA 1D7IA 3KCEA 2XP4A 4DIPA 5HW6A 2AWGA 4U86A 1FKBA 3O5GA 3O5IA 1BKFA 1J4RA 2XPAA 3KAFA 1YATA 1NMWA 4C02B 1ROUA 1JNTA 2KFWA 1Q6HA 3TC5A 2ZQVA 4IQCA 3KABA 3O5OA 4ODNA 3IKDA 1B6CA 3O5QA 2VN1A 5HWBA 1PBKA 4QIBA 4U85A 2ITKA 2RQSA 1FAPA 3RFWA 4DZ2A 1NMVA 2F21A 3ODKA 3OOBA 4JYSA 2M2AA 4QT3A 1T11A 4TW6A 2XP7A 1ROTA 2KE0A 3PRDA 3IKGA 4BF8A 3GPKA 2FKEA 2VCDA 3O5DA 2PPOA 4TX0A 4U84A 5GPGA 3UI6A 5HWCA 1FJDA 1BL4A 2RUCA 1L1PA 3O5FA 4DRJA 2XP8A 2MLZA 2KGJA 3KZ7A 5DIUA 4LAYA 1FKSA 1PINA 3MDYB 3TDBA 4FN2A 1D7HA 1Q6UA 2MF9A 2Y78A 4N19A 3KAHA 4JFJA 4DRHA 3NTPA 1FD9A 2PV3A 3UF8A 4W9QA 1W26A 4DRNA 4TNSA 4TW7A 4W9OA 3O5PA 1J4IA 4JFMA 2M08A 5I98A 2RUQA 1Q1CA 2PPNA 2XP6A 2DG4A 2LGOA 2RURA 2ZQUA 1F40A 3O5RA 1ZK6A 1J6YA 1J4HA 3LUOA 3I6CA 4DRQA 4JFKA 4DH0A 5B8IC 1EYMA 4DT4A 3EY6A 3KACA 3UQIA 4R0XA 1QPLA 3VAWA 1FKIA 5D75A 1QZ2A 1R9HA 3O5LA 1FKFA 3H9RB
chains in the Genus database with same CATH superfamily
2D9FA 3W4RA 3O5KA 4ZS6A 2DT2A 2QF8A 3RM4A 3FY1A 4J4OA 3UI4A 4WIWA 3O5JA 1KT0A 1ZBVA 1HXVA 2DG3A 4JFLA 5HTGA 1U79A 1EHNA 1W9PA 2IUZA 1NWSA 4TYOA 4Q7NA 3G6LA 4Z2GA 2JZVA 2KR7A 2L2SA 2IF4A 2M1IA 4MPKA 4DWSC 3WQWA 1F8AB 2DSUA 2G41A 2N87A 1W9VA 3PA7A 1ZBCA 4ODKA 4MSPA 1W9UA 2B31A 4ODOA 2WLZA 4G50A 4DRPA 3B8SA 4ZPTR 1TCOC 4LAWA 2MPHA 1GPFA 1LG2A 2EULA 1LQ0A 2P4VA 5HW6A 1ZU8A 2A3BA 4U86A 1E6PA 3ARTA 3QOKA 2KFWA 2YBUA 1E6RA 4WKAA 4AY1A 3WD1A 2A3AA 2F21A 4JYSA 3ODKA 4QT3A 1O6IA 3ARVA 3CZ8A 3PRDA 2FKEA 1L1PA 4WJXA 2MLZA 1EDQA 3KZ7A 4LAYA 1KFWA 4ZPVR 4R5EA 3ARZA 4DRHA 3PRAA 2F23A 4MNJA 3AS2A 1JNDA 1J4IA 2RUQA 1Q1CA 2XP6A 4IT4A 2DG4A 1ZK6A 3B9AA 4DH0A 5B8IC 1ZB5A 3EY6A 1LJYA 3VAWA 4R0XA 4W9PA 3IK8A 1FFRA 4WKHA 1NSGA 5DEZA 2OLHA 2ZR6A 1ZCNA 2FAPA 3PRBA 5HUAA 4DWSB 1FKHA 2WK2A 3KAIA 1UR8A 1CTNA 1N1AA 3UQBA 2AOSA 4DRMA 1FFQA 3WIJA 2KO7A 1HJXA 5DO2A 3WD2A 2LPVA 2XPBA 1JVWA 4J4NA 5HT1A 2FDMA 4ODMA 2DT1A 1M5YA 5DITA 3O5MA 4WK9A 5HW7A 3G6MA 1E9LA 5BXJA 2WM0A 1K9TA 4IPXA 2LJ4A 1JNEA 4WKFA 1FKTA 2ZR5A 2F4EA 1P5QA 3AS0A 2WLYA 1SYTA 4QT2A 3CGMA 3CGNA 4DWSA 5HKGA 2ZR4A 1FKRA 4LAXA 1KT1A 3AQUA 4ODLA 1FKJA 3TCZA 2KI3A 3JXVA 4GGQA 1D7IA 4MAVA 1FKBA 3O5IA 1H0IA 2XPAA 1ROUA 1Q6HA 3TC5A 2VN1A 3RM9A 5HWBA 4QIBA 1E6ZA 3CH9A 5GPRA 2M2AA 2YBTA 4HBEA 3IKGA 4BF8A 1FJDA 3WQVA 3RM8A 2KGJA 5DIUA 1FKSA 1OWQA 1XHGA 1D7HA 2Y78A 4JFJA 1GUVA 3CHDA 4MNKA 4DRNA 3ARSA 3EIPA 4TNSA 1RD6A 4TW7A 1GRJA 3O5PA 2M08A 1E6NA 1ZBWA 2LGOA 2ZQUA 4P8VA 1F40A 3I6CA 4JFKA 1HKJA 3UQIA 5JH8A 3ARRA 1QZ2A 3O5LA 4S3JA 3ARWA 1EIBA 3ARYA 1NWRA 4XAKA 3WD3A 4DRKA 3WD4A 4Q22A 1EQ3A 1JCHB 1QPFA 4Z2HA 1YW5A 1C9HA 1X6LA 3RMEA 3KADA 2ZQTA 3NI6A 4NZCA 3B9EA 4P8XA 2LKNA 2A3CA 3WH0A 4JFIA 4ODQA 1JNSA 1FKGA 1LL4A 4GIVA 3IHZA 4MGVA 2OFNA 3JYJA 1TFVA 2MNTA 5GQBA 1W1YA 2DSZA 2DT0A 3RGCA 5DF0A 1WNOA 3CHEA 3WKZA 4Z2JA 4ODRA 2MLYA 1WB0A 1HKMA 2F2DA 4O2TA 3AROA 4DZ3A 4HBOA 4DROA 4Z2IA 1HJVA 2PV1A 3B9DA 4ODPA 1ZL1A 3ALGA 3O5EA 2UZ5A 4DIPA 1W1VA 3O5GA 1BKFA 1J4RA 3KAFA 1YATA 1NMWA 1NWUA 1JNTA 4MTVA 4IQCA 3O5OA 1B6CA 4HARA 4Z2KA 1NWTA 2ITKA 2RQSA 4UDMA 4DZ2A 1T11A 3CHCA 4TW6A 1ROTA 1HJWA 1IX5A 2VCDA 4U84A 5HWCA 3UI6A 2RUCA 3O5FA 2XP8A 1NH6A 4P8WA 4URIA 1OGGA 3MDYB 3TDBA 3ARQA 2ESCA 4FN2A 5HBFA 2MF9A 4N19A 1E44A 3FXYA 1FD9A 3ARPA 3ARUA 2PV3A 4PTMA 3UF8A 3BXWA 4W9QA 4W9OA 4JFMA 1ITXA 3AS3A 2RURA 3OA5A 1W1TA 1J6YA 4DRQA 4DT4A 5D75A 3AS1A 3PR9A 3H9RB 2XP3A 2DSWA 1FKDA 4ML4A 2ZQSA 4TW8A 5DIVA 1D6OA 3FAPA 3ALFA 3WL0A 1UR9A 1W1PA 4W5UA 4KQZA 3GTYX 1A7XA 3BMBA 5HW8A 1Q6IA 1D7JA 3NRKA 1LG1A 4NNRA 1FKLA 4IQ2A 1HKIA 1Y0OA 1LL6A 2DG9A 3UI5A 5J6EA 3KAGA 4LAVA 4DWSD 2XP9A 4DRIA 2DT3A 3WL1A 4FAPA 2MLXA 4G2PA 3B7XA 2PPPA 2K8IA 4S3KA 1D2KA 2PI6A 2PBCA 4NSBA 1FKKA 1E15A 3UQAA 2PV2A 2Q5AA 1WAWA 1LL7A 2RSEA 2O9OA 4ITZA 2XP5A 2RUDA 3JYMA 3KCEA 2XP4A 2AWGA 4C02B 1OGBA 2ZQVA 4L72B 3KABA 4ODNA 3IKDA 4MNLA 4LGXA 3O5QA 1PBKA 2B5UB 3CHFA 4U85A 4KR0B 1FAPA 3RFWA 1NMVA 3OOBA 4ZPWR 4P8UA 2PN0A 2G8ZA 2O92A 2XP7A 2KE0A 1ZBKA 3GPKA 4TX0A 3O5DA 5GPGA 2PPOA 3ARXA 1BL4A 4DRJA 1GOIA 1XRVA 4QZVB 1PINA 4MNMA 1Q6UA 3KAHA 3NTPA 1W26A 3WD0A 1HKKA 2DSVA 4IT6A 5I98A 2PPNA 3O5RA 1VF8A 1J4HA 1X6NA 2ETNA 3LUOA 3GU0A 4Z2LA 4L3NA 1EYMA 2DPEA 2A3EA 3KACA 1QPLA 1FKIA 1R9HA 1SR0A 1FKFA 1H0GA
chains in the Genus database with same CATH topology
2D9FA 3W4RA 3O5KA 4ZS6A 2DT2A 2QF8A 3RM4A 3FY1A 4J4OA 3UI4A 4WIWA 3O5JA 1KT0A 1ZBVA 1HXVA 2DG3A 4JFLA 5HTGA 1U79A 1EHNA 1W9PA 2IUZA 1NWSA 4TYOA 4Q7NA 3G6LA 4Z2GA 2JZVA 2KR7A 2L2SA 2IF4A 2M1IA 4MPKA 4DWSC 3WQWA 1F8AB 2DSUA 2G41A 2N87A 1W9VA 3PA7A 1ZBCA 4ODKA 4MSPA 1W9UA 2B31A 4ODOA 2WLZA 4G50A 4DRPA 3B8SA 4ZPTR 1TCOC 4LAWA 2MPHA 1GPFA 1LG2A 1LQ0A 5HW6A 1ZU8A 2A3BA 4U86A 1E6PA 3ARTA 3QOKA 2KFWA 2YBUA 1E6RA 4WKAA 4AY1A 3WD1A 2A3AA 2F21A 4JYSA 3ODKA 4QT3A 1O6IA 3ARVA 3CZ8A 3PRDA 2FKEA 1L1PA 4WJXA 2MLZA 1EDQA 3KZ7A 4LAYA 1KFWA 4ZPVR 4R5EA 3ARZA 4DRHA 3PRAA 4MNJA 3AS2A 1JNDA 1J4IA 2RUQA 1Q1CA 2XP6A 4IT4A 2DG4A 1ZK6A 3B9AA 4DH0A 5B8IC 1ZB5A 3EY6A 1LJYA 3VAWA 4R0XA 4W9PA 3IK8A 1FFRA 4WKHA 1NSGA 5DEZA 2OLHA 2ZR6A 1ZCNA 2FAPA 3PRBA 5HUAA 4DWSB 1FKHA 2WK2A 3KAIA 1UR8A 1CTNA 1N1AA 3UQBA 2AOSA 4DRMA 1FFQA 3WIJA 2KO7A 1HJXA 5DO2A 3WD2A 2LPVA 2XPBA 1JVWA 4J4NA 5HT1A 2FDMA 4ODMA 2DT1A 1M5YA 5DITA 3O5MA 4WK9A 5HW7A 3G6MA 1E9LA 5BXJA 2WM0A 1K9TA 4IPXA 2LJ4A 1JNEA 4WKFA 1FKTA 2ZR5A 2F4EA 1P5QA 3AS0A 2WLYA 1SYTA 4QT2A 3CGMA 3CGNA 4DWSA 5HKGA 2ZR4A 1FKRA 4LAXA 1KT1A 3AQUA 4ODLA 1FKJA 3TCZA 2KI3A 3JXVA 4GGQA 1D7IA 4MAVA 1FKBA 3O5IA 1H0IA 2XPAA 1ROUA 1Q6HA 3TC5A 2VN1A 3RM9A 5HWBA 4QIBA 1E6ZA 3CH9A 5GPRA 2M2AA 2YBTA 4HBEA 3IKGA 4BF8A 1FJDA 3WQVA 3RM8A 2KGJA 5DIUA 1FKSA 1OWQA 1XHGA 1D7HA 2Y78A 4JFJA 1GUVA 3CHDA 4MNKA 4DRNA 3ARSA 4TNSA 1RD6A 4TW7A 3O5PA 2M08A 1E6NA 1ZBWA 2LGOA 2ZQUA 4P8VA 1F40A 3I6CA 4JFKA 1HKJA 3UQIA 5JH8A 3ARRA 1QZ2A 3O5LA 4S3JA 3ARWA 1EIBA 3ARYA 1NWRA 4XAKA 3WD3A 4DRKA 3WD4A 4Q22A 1EQ3A 1QPFA 4Z2HA 1YW5A 1C9HA 1X6LA 3RMEA 3KADA 2ZQTA 3NI6A 4NZCA 3B9EA 4P8XA 2LKNA 2A3CA 3WH0A 4JFIA 4ODQA 1JNSA 1FKGA 1LL4A 4GIVA 3IHZA 4MGVA 2OFNA 3JYJA 1TFVA 2MNTA 5GQBA 1W1YA 2DSZA 2DT0A 3RGCA 5DF0A 1WNOA 3CHEA 3WKZA 4Z2JA 4ODRA 2MLYA 1WB0A 1HKMA 2F2DA 4O2TA 3AROA 4DZ3A 4HBOA 4DROA 4Z2IA 1HJVA 2PV1A 3B9DA 4ODPA 1ZL1A 3ALGA 3O5EA 2UZ5A 4DIPA 1W1VA 3O5GA 1BKFA 1J4RA 3KAFA 1YATA 1NMWA 1NWUA 1JNTA 4MTVA 4IQCA 3O5OA 1B6CA 4HARA 4Z2KA 1NWTA 2ITKA 2RQSA 4DZ2A 1T11A 3CHCA 4TW6A 1ROTA 1HJWA 1IX5A 2VCDA 4U84A 5HWCA 3UI6A 2RUCA 3O5FA 2XP8A 1NH6A 4P8WA 4URIA 1OGGA 3MDYB 3TDBA 3ARQA 2ESCA 4FN2A 5HBFA 2MF9A 4N19A 3FXYA 1FD9A 3ARPA 3ARUA 2PV3A 4PTMA 3UF8A 3BXWA 4W9QA 4W9OA 4JFMA 1ITXA 3AS3A 2RURA 3OA5A 1W1TA 1J6YA 4DRQA 4DT4A 5D75A 3AS1A 3PR9A 3H9RB 2XP3A 2DSWA 1FKDA 4ML4A 2ZQSA 4TW8A 5DIVA 1D6OA 3FAPA 3ALFA 3WL0A 1UR9A 1W1PA 4W5UA 4KQZA 1A7XA 5HW8A 1Q6IA 1D7JA 3NRKA 1LG1A 4NNRA 1FKLA 4IQ2A 1HKIA 1Y0OA 1LL6A 2DG9A 3UI5A 5J6EA 3KAGA 4LAVA 4DWSD 2XP9A 4DRIA 2DT3A 3WL1A 4FAPA 2MLXA 4G2PA 3B7XA 2PPPA 2K8IA 4S3KA 1D2KA 2PI6A 2PBCA 4NSBA 1FKKA 1E15A 3UQAA 2PV2A 2Q5AA 1WAWA 1LL7A 2RSEA 2O9OA 4ITZA 2XP5A 2RUDA 3JYMA 3KCEA 2XP4A 2AWGA 4C02B 1OGBA 2ZQVA 4L72B 3KABA 4ODNA 3IKDA 4MNLA 4LGXA 3O5QA 1PBKA 4U85A 3CHFA 4KR0B 1FAPA 3RFWA 1NMVA 3OOBA 4ZPWR 4P8UA 2G8ZA 2O92A 2XP7A 2KE0A 1ZBKA 3GPKA 4TX0A 3O5DA 5GPGA 2PPOA 3ARXA 1BL4A 4DRJA 1GOIA 1XRVA 4QZVB 1PINA 4MNMA 1Q6UA 3KAHA 3NTPA 1W26A 3WD0A 1HKKA 2DSVA 4IT6A 5I98A 2PPNA 3O5RA 1VF8A 1J4HA 1X6NA 3LUOA 4Z2LA 4L3NA 1EYMA 2DPEA 2A3EA 3KACA 1QPLA 1FKIA 1R9HA 1SR0A 1FKFA 1H0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D9F A;  4W9P A;  2XP3 A;  3IK8 A;  3O5K A;  1FKD A;  2ZQS A;  1NSG A;  4TW8 A;  5DIV A;  1D6O A;  2ZR6 A;  1ZCN A;  2FAP A;  3FAP A;  3PRB A;  5HUA A;  1FKH A;  4DRK A;  4J4O A;  3KAI A;  3UI4 A;  1EQ3 A;  1N1A A;  3UQB A;  1A7X A;  3O5J A;  1QPF A;  4DRM A;  1KT0 A;  1YW5 A;  5HW8 A;  2DG3 A;  2KO7 A;  1HXV A;  1Q6I A;  4JFL A;  2LPV A;  5HTG A;  1D7J A;  3NRK A;  2XPB A;  4NNR A;  1C9H A;  1U79 A;  1JVW A;  4J4N A;  1FKL A;  3KAD A;  2ZQT A;  3NI6 A;  4IQ2 A;  5HT1 A;  1Y0O A;  2LKN A;  4ODM A;  1M5Y A;  4TYO A;  5DIT A;  3O5M A;  3WH0 A;  2DG9 A;  4JFI A;  4ODQ A;  3UI5 A;  5HW7 A;  5J6E A;  1JNS A;  5BXJ A;  3KAG A;  1FKG A;  4LAV A;  4GIV A;  2XP9 A;  3IHZ A;  4MGV A;  2JZV A;  2KR7 A;  4DRI A;  2L2S A;  2IF4 A;  2OFN A;  2LJ4 A;  3JYJ A;  4IPX A;  1FKT A;  2M1I A;  2MNT A;  4FAP A;  2MLX A;  2ZR5 A;  2F4E A;  1F8A B;  1P5Q A;  4G2P A;  2N87 A;  3RGC A;  3B7X A;  3PA7 A;  4QT2 A;  2PPP A;  3CGM A;  2K8I A;  4ODK A;  4MSP A;  2PBC A;  4ODR A;  3CGN A;  4ODO A;  2MLY A;  5HKG A;  4G50 A;  1FKK A;  4DRP A;  2F2D A;  2ZR4 A;  4O2T A;  3UQA A;  1FKR A;  4DZ3 A;  2PV2 A;  4LAX A;  2Q5A A;  4DRO A;  1KT1 A;  4ODL A;  2RSE A;  1FKJ A;  2PV1 A;  1TCO C;  4ITZ A;  4LAW A;  3TCZ A;  2XP5 A;  2MPH A;  2RUD A;  4ODP A;  2KI3 A;  3JXV A;  3JYM A;  3O5E A;  2UZ5 A;  4GGQ A;  1D7I A;  3KCE A;  2XP4 A;  4DIP A;  5HW6 A;  2AWG A;  4U86 A;  1FKB A;  3O5G A;  3O5I A;  1BKF A;  1J4R A;  2XPA A;  3KAF A;  1YAT A;  1NMW A;  4C02 B;  1ROU A;  1JNT A;  2KFW A;  1Q6H A;  3TC5 A;  2ZQV A;  4IQC A;  3KAB A;  3O5O A;  4ODN A;  3IKD A;  1B6C A;  3O5Q A;  2VN1 A;  5HWB A;  1PBK A;  4QIB A;  4U85 A;  2ITK A;  2RQS A;  1FAP A;  3RFW A;  4DZ2 A;  1NMV A;  2F21 A;  3ODK A;  3OOB A;  4JYS A;  2M2A A;  4QT3 A;  1T11 A;  4TW6 A;  2XP7 A;  1ROT A;  2KE0 A;  3PRD A;  3IKG A;  4BF8 A;  3GPK A;  2FKE A;  2VCD A;  3O5D A;  2PPO A;  4TX0 A;  4U84 A;  5GPG A;  3UI6 A;  5HWC A;  1FJD A;  1BL4 A;  2RUC A;  1L1P A;  3O5F A;  4DRJ A;  2XP8 A;  2MLZ A;  2KGJ A;  3KZ7 A;  5DIU A;  4LAY A;  1FKS A;  1PIN A;  3MDY B;  3TDB A;  4FN2 A;  1D7H A;  1Q6U A;  2MF9 A;  2Y78 A;  4N19 A;  3KAH A;  4JFJ A;  4DRH A;  3NTP A;  1FD9 A;  2PV3 A;  3UF8 A;  4W9Q A;  1W26 A;  4DRN A;  4TNS A;  4TW7 A;  4W9O A;  3O5P A;  1J4I A;  4JFM A;  2M08 A;  5I98 A;  2RUQ A;  1Q1C A;  2PPN A;  2XP6 A;  2DG4 A;  2LGO A;  2RUR A;  2ZQU A;  1F40 A;  3O5R A;  1ZK6 A;  1J6Y A;  1J4H A;  3LUO A;  3I6C A;  4DRQ A;  4JFK A;  4DH0 A;  5B8I C;  1EYM A;  4DT4 A;  3EY6 A;  3KAC A;  3UQI A;  4R0X A;  1QPL A;  3VAW A;  1FKI A;  5D75 A;  1QZ2 A;  1R9H A;  3O5L A;  1FKF A;  3H9R B; 
#chains in the Genus database with same CATH topology
 2D9F A;  3W4R A;  3O5K A;  4ZS6 A;  2DT2 A;  2QF8 A;  3RM4 A;  3FY1 A;  4J4O A;  3UI4 A;  4WIW A;  3O5J A;  1KT0 A;  1ZBV A;  1HXV A;  2DG3 A;  4JFL A;  5HTG A;  1U79 A;  1EHN A;  1W9P A;  2IUZ A;  1NWS A;  4TYO A;  4Q7N A;  3G6L A;  4Z2G A;  2JZV A;  2KR7 A;  2L2S A;  2IF4 A;  2M1I A;  4MPK A;  4DWS C;  3WQW A;  1F8A B;  2DSU A;  2G41 A;  2N87 A;  1W9V A;  3PA7 A;  1ZBC A;  4ODK A;  4MSP A;  1W9U A;  2B31 A;  4ODO A;  2WLZ A;  4G50 A;  4DRP A;  3B8S A;  4ZPT R;  1TCO C;  4LAW A;  2MPH A;  1GPF A;  1LG2 A;  2EUL A;  1LQ0 A;  2P4V A;  5HW6 A;  1ZU8 A;  2A3B A;  4U86 A;  1E6P A;  3ART A;  3QOK A;  2KFW A;  2YBU A;  1E6R A;  4WKA A;  4AY1 A;  3WD1 A;  2A3A A;  2F21 A;  4JYS A;  3ODK A;  4QT3 A;  1O6I A;  3ARV A;  3CZ8 A;  3PRD A;  2FKE A;  1L1P A;  4WJX A;  2MLZ A;  1EDQ A;  3KZ7 A;  4LAY A;  1KFW A;  4ZPV R;  4R5E A;  3ARZ A;  4DRH A;  3PRA A;  2F23 A;  4MNJ A;  3AS2 A;  1JND A;  1J4I A;  2RUQ A;  1Q1C A;  2XP6 A;  4IT4 A;  2DG4 A;  1ZK6 A;  3B9A A;  4DH0 A;  5B8I C;  1ZB5 A;  3EY6 A;  1LJY A;  3VAW A;  4R0X A;  4W9P A;  3IK8 A;  1FFR A;  4WKH A;  1NSG A;  5DEZ A;  2OLH A;  2ZR6 A;  1ZCN A;  2FAP A;  3PRB A;  5HUA A;  4DWS B;  1FKH A;  2WK2 A;  3KAI A;  1UR8 A;  1CTN A;  1N1A A;  3UQB A;  2AOS A;  4DRM A;  1FFQ A;  3WIJ A;  2KO7 A;  1HJX A;  5DO2 A;  3WD2 A;  2LPV A;  2XPB A;  1JVW A;  4J4N A;  5HT1 A;  2FDM A;  4ODM A;  2DT1 A;  1M5Y A;  5DIT A;  3O5M A;  4WK9 A;  5HW7 A;  3G6M A;  1E9L A;  5BXJ A;  2WM0 A;  1K9T A;  4IPX A;  2LJ4 A;  1JNE A;  4WKF A;  1FKT A;  2ZR5 A;  2F4E A;  1P5Q A;  3AS0 A;  2WLY A;  1SYT A;  4QT2 A;  3CGM A;  3CGN A;  4DWS A;  5HKG A;  2ZR4 A;  1FKR A;  4LAX A;  1KT1 A;  3AQU A;  4ODL A;  1FKJ A;  3TCZ A;  2KI3 A;  3JXV A;  4GGQ A;  1D7I A;  4MAV A;  1FKB A;  3O5I A;  1H0I A;  2XPA A;  1ROU A;  1Q6H A;  3TC5 A;  2VN1 A;  3RM9 A;  5HWB A;  4QIB A;  1E6Z A;  3CH9 A;  5GPR A;  2M2A A;  2YBT A;  4HBE A;  3IKG A;  4BF8 A;  1FJD A;  3WQV A;  3RM8 A;  2KGJ A;  5DIU A;  1FKS A;  1OWQ A;  1XHG A;  1D7H A;  2Y78 A;  4JFJ A;  1GUV A;  3CHD A;  4MNK A;  4DRN A;  3ARS A;  3EIP A;  4TNS A;  1RD6 A;  4TW7 A;  1GRJ A;  3O5P A;  2M08 A;  1E6N A;  1ZBW A;  2LGO A;  2ZQU A;  4P8V A;  1F40 A;  3I6C A;  4JFK A;  1HKJ A;  3UQI A;  5JH8 A;  3ARR A;  1QZ2 A;  3O5L A;  4S3J A;  3ARW A;  1EIB A;  3ARY A;  1NWR A;  4XAK A;  3WD3 A;  4DRK A;  3WD4 A;  4Q22 A;  1EQ3 A;  1JCH B;  1QPF A;  4Z2H A;  1YW5 A;  1C9H A;  1X6L A;  3RME A;  3KAD A;  2ZQT A;  3NI6 A;  4NZC A;  3B9E A;  4P8X A;  2LKN A;  2A3C A;  3WH0 A;  4JFI A;  4ODQ A;  1JNS A;  1FKG A;  1LL4 A;  4GIV A;  3IHZ A;  4MGV A;  2OFN A;  3JYJ A;  1TFV A;  2MNT A;  5GQB A;  1W1Y A;  2DSZ A;  2DT0 A;  3RGC A;  5DF0 A;  1WNO A;  3CHE A;  3WKZ A;  4Z2J A;  4ODR A;  2MLY A;  1WB0 A;  1HKM A;  2F2D A;  4O2T A;  3ARO A;  4DZ3 A;  4HBO A;  4DRO A;  4Z2I A;  1HJV A;  2PV1 A;  3B9D A;  4ODP A;  1ZL1 A;  3ALG A;  3O5E A;  2UZ5 A;  4DIP A;  1W1V A;  3O5G A;  1BKF A;  1J4R A;  3KAF A;  1YAT A;  1NMW A;  1NWU A;  1JNT A;  4MTV A;  4IQC A;  3O5O A;  1B6C A;  4HAR A;  4Z2K A;  1NWT A;  2ITK A;  2RQS A;  4UDM A;  4DZ2 A;  1T11 A;  3CHC A;  4TW6 A;  1ROT A;  1HJW A;  1IX5 A;  2VCD A;  4U84 A;  5HWC A;  3UI6 A;  2RUC A;  3O5F A;  2XP8 A;  1NH6 A;  4P8W A;  4URI A;  1OGG A;  3MDY B;  3TDB A;  3ARQ A;  2ESC A;  4FN2 A;  5HBF A;  2MF9 A;  4N19 A;  1E44 A;  3FXY A;  1FD9 A;  3ARP A;  3ARU A;  2PV3 A;  4PTM A;  3UF8 A;  3BXW A;  4W9Q A;  4W9O A;  4JFM A;  1ITX A;  3AS3 A;  2RUR A;  3OA5 A;  1W1T A;  1J6Y A;  4DRQ A;  4DT4 A;  5D75 A;  3AS1 A;  3PR9 A;  3H9R B;  2XP3 A;  2DSW A;  1FKD A;  4ML4 A;  2ZQS A;  4TW8 A;  5DIV A;  1D6O A;  3FAP A;  3ALF A;  3WL0 A;  1UR9 A;  1W1P A;  4W5U A;  4KQZ A;  3GTY X;  1A7X A;  3BMB A;  5HW8 A;  1Q6I A;  1D7J A;  3NRK A;  1LG1 A;  4NNR A;  1FKL A;  4IQ2 A;  1HKI A;  1Y0O A;  1LL6 A;  2DG9 A;  3UI5 A;  5J6E A;  3KAG A;  4LAV A;  4DWS D;  2XP9 A;  4DRI A;  2DT3 A;  3WL1 A;  4FAP A;  2MLX A;  4G2P A;  3B7X A;  2PPP A;  2K8I A;  4S3K A;  1D2K A;  2PI6 A;  2PBC A;  4NSB A;  1FKK A;  1E15 A;  3UQA A;  2PV2 A;  2Q5A A;  1WAW A;  1LL7 A;  2RSE A;  2O9O A;  4ITZ A;  2XP5 A;  2RUD A;  3JYM A;  3KCE A;  2XP4 A;  2AWG A;  4C02 B;  1OGB A;  2ZQV A;  4L72 B;  3KAB A;  4ODN A;  3IKD A;  4MNL A;  4LGX A;  3O5Q A;  1PBK A;  2B5U B;  3CHF A;  4U85 A;  4KR0 B;  1FAP A;  3RFW A;  1NMV A;  3OOB A;  4ZPW R;  4P8U A;  2PN0 A;  2G8Z A;  2O92 A;  2XP7 A;  2KE0 A;  1ZBK A;  3GPK A;  4TX0 A;  3O5D A;  5GPG A;  2PPO A;  3ARX A;  1BL4 A;  4DRJ A;  1GOI A;  1XRV A;  4QZV B;  1PIN A;  4MNM A;  1Q6U A;  3KAH A;  3NTP A;  1W26 A;  3WD0 A;  1HKK A;  2DSV A;  4IT6 A;  5I98 A;  2PPN A;  3O5R A;  1VF8 A;  1J4H A;  1X6N A;  2ETN A;  3LUO A;  3GU0 A;  4Z2L A;  4L3N A;  1EYM A;  2DPE A;  2A3E A;  3KAC A;  1QPL A;  1FKI A;  1R9H A;  1SR0 A;  1FKF A;  1H0G A; 
#chains in the Genus database with same CATH homology
 2D9F A;  3W4R A;  3O5K A;  4ZS6 A;  2DT2 A;  2QF8 A;  3RM4 A;  3FY1 A;  4J4O A;  3UI4 A;  4WIW A;  3O5J A;  1KT0 A;  1ZBV A;  1HXV A;  2DG3 A;  4JFL A;  5HTG A;  1U79 A;  1EHN A;  1W9P A;  2IUZ A;  1NWS A;  4TYO A;  4Q7N A;  3G6L A;  4Z2G A;  2JZV A;  2KR7 A;  2L2S A;  2IF4 A;  2M1I A;  4MPK A;  4DWS C;  3WQW A;  1F8A B;  2DSU A;  2G41 A;  2N87 A;  1W9V A;  3PA7 A;  1ZBC A;  4ODK A;  4MSP A;  1W9U A;  2B31 A;  4ODO A;  2WLZ A;  4G50 A;  4DRP A;  3B8S A;  4ZPT R;  1TCO C;  4LAW A;  2MPH A;  1GPF A;  1LG2 A;  1LQ0 A;  5HW6 A;  1ZU8 A;  2A3B A;  4U86 A;  1E6P A;  3ART A;  3QOK A;  2KFW A;  2YBU A;  1E6R A;  4WKA A;  4AY1 A;  3WD1 A;  2A3A A;  2F21 A;  4JYS A;  3ODK A;  4QT3 A;  1O6I A;  3ARV A;  3CZ8 A;  3PRD A;  2FKE A;  1L1P A;  4WJX A;  2MLZ A;  1EDQ A;  3KZ7 A;  4LAY A;  1KFW A;  4ZPV R;  4R5E A;  3ARZ A;  4DRH A;  3PRA A;  4MNJ A;  3AS2 A;  1JND A;  1J4I A;  2RUQ A;  1Q1C A;  2XP6 A;  4IT4 A;  2DG4 A;  1ZK6 A;  3B9A A;  4DH0 A;  5B8I C;  1ZB5 A;  3EY6 A;  1LJY A;  3VAW A;  4R0X A;  4W9P A;  3IK8 A;  1FFR A;  4WKH A;  1NSG A;  5DEZ A;  2OLH A;  2ZR6 A;  1ZCN A;  2FAP A;  3PRB A;  5HUA A;  4DWS B;  1FKH A;  2WK2 A;  3KAI A;  1UR8 A;  1CTN A;  1N1A A;  3UQB A;  2AOS A;  4DRM A;  1FFQ A;  3WIJ A;  2KO7 A;  1HJX A;  5DO2 A;  3WD2 A;  2LPV A;  2XPB A;  1JVW A;  4J4N A;  5HT1 A;  2FDM A;  4ODM A;  2DT1 A;  1M5Y A;  5DIT A;  3O5M A;  4WK9 A;  5HW7 A;  3G6M A;  1E9L A;  5BXJ A;  2WM0 A;  1K9T A;  4IPX A;  2LJ4 A;  1JNE A;  4WKF A;  1FKT A;  2ZR5 A;  2F4E A;  1P5Q A;  3AS0 A;  2WLY A;  1SYT A;  4QT2 A;  3CGM A;  3CGN A;  4DWS A;  5HKG A;  2ZR4 A;  1FKR A;  4LAX A;  1KT1 A;  3AQU A;  4ODL A;  1FKJ A;  3TCZ A;  2KI3 A;  3JXV A;  4GGQ A;  1D7I A;  4MAV A;  1FKB A;  3O5I A;  1H0I A;  2XPA A;  1ROU A;  1Q6H A;  3TC5 A;  2VN1 A;  3RM9 A;  5HWB A;  4QIB A;  1E6Z A;  3CH9 A;  5GPR A;  2M2A A;  2YBT A;  4HBE A;  3IKG A;  4BF8 A;  1FJD A;  3WQV A;  3RM8 A;  2KGJ A;  5DIU A;  1FKS A;  1OWQ A;  1XHG A;  1D7H A;  2Y78 A;  4JFJ A;  1GUV A;  3CHD A;  4MNK A;  4DRN A;  3ARS A;  4TNS A;  1RD6 A;  4TW7 A;  3O5P A;  2M08 A;  1E6N A;  1ZBW A;  2LGO A;  2ZQU A;  4P8V A;  1F40 A;  3I6C A;  4JFK A;  1HKJ A;  3UQI A;  5JH8 A;  3ARR A;  1QZ2 A;  3O5L A;  4S3J A;  3ARW A;  1EIB A;  3ARY A;  1NWR A;  4XAK A;  3WD3 A;  4DRK A;  3WD4 A;  4Q22 A;  1EQ3 A;  1QPF A;  4Z2H A;  1YW5 A;  1C9H A;  1X6L A;  3RME A;  3KAD A;  2ZQT A;  3NI6 A;  4NZC A;  3B9E A;  4P8X A;  2LKN A;  2A3C A;  3WH0 A;  4JFI A;  4ODQ A;  1JNS A;  1FKG A;  1LL4 A;  4GIV A;  3IHZ A;  4MGV A;  2OFN A;  3JYJ A;  1TFV A;  2MNT A;  5GQB A;  1W1Y A;  2DSZ A;  2DT0 A;  3RGC A;  5DF0 A;  1WNO A;  3CHE A;  3WKZ A;  4Z2J A;  4ODR A;  2MLY A;  1WB0 A;  1HKM A;  2F2D A;  4O2T A;  3ARO A;  4DZ3 A;  4HBO A;  4DRO A;  4Z2I A;  1HJV A;  2PV1 A;  3B9D A;  4ODP A;  1ZL1 A;  3ALG A;  3O5E A;  2UZ5 A;  4DIP A;  1W1V A;  3O5G A;  1BKF A;  1J4R A;  3KAF A;  1YAT A;  1NMW A;  1NWU A;  1JNT A;  4MTV A;  4IQC A;  3O5O A;  1B6C A;  4HAR A;  4Z2K A;  1NWT A;  2ITK A;  2RQS A;  4DZ2 A;  1T11 A;  3CHC A;  4TW6 A;  1ROT A;  1HJW A;  1IX5 A;  2VCD A;  4U84 A;  5HWC A;  3UI6 A;  2RUC A;  3O5F A;  2XP8 A;  1NH6 A;  4P8W A;  4URI A;  1OGG A;  3MDY B;  3TDB A;  3ARQ A;  2ESC A;  4FN2 A;  5HBF A;  2MF9 A;  4N19 A;  3FXY A;  1FD9 A;  3ARP A;  3ARU A;  2PV3 A;  4PTM A;  3UF8 A;  3BXW A;  4W9Q A;  4W9O A;  4JFM A;  1ITX A;  3AS3 A;  2RUR A;  3OA5 A;  1W1T A;  1J6Y A;  4DRQ A;  4DT4 A;  5D75 A;  3AS1 A;  3PR9 A;  3H9R B;  2XP3 A;  2DSW A;  1FKD A;  4ML4 A;  2ZQS A;  4TW8 A;  5DIV A;  1D6O A;  3FAP A;  3ALF A;  3WL0 A;  1UR9 A;  1W1P A;  4W5U A;  4KQZ A;  1A7X A;  5HW8 A;  1Q6I A;  1D7J A;  3NRK A;  1LG1 A;  4NNR A;  1FKL A;  4IQ2 A;  1HKI A;  1Y0O A;  1LL6 A;  2DG9 A;  3UI5 A;  5J6E A;  3KAG A;  4LAV A;  4DWS D;  2XP9 A;  4DRI A;  2DT3 A;  3WL1 A;  4FAP A;  2MLX A;  4G2P A;  3B7X A;  2PPP A;  2K8I A;  4S3K A;  1D2K A;  2PI6 A;  2PBC A;  4NSB A;  1FKK A;  1E15 A;  3UQA A;  2PV2 A;  2Q5A A;  1WAW A;  1LL7 A;  2RSE A;  2O9O A;  4ITZ A;  2XP5 A;  2RUD A;  3JYM A;  3KCE A;  2XP4 A;  2AWG A;  4C02 B;  1OGB A;  2ZQV A;  4L72 B;  3KAB A;  4ODN A;  3IKD A;  4MNL A;  4LGX A;  3O5Q A;  1PBK A;  4U85 A;  3CHF A;  4KR0 B;  1FAP A;  3RFW A;  1NMV A;  3OOB A;  4ZPW R;  4P8U A;  2G8Z A;  2O92 A;  2XP7 A;  2KE0 A;  1ZBK A;  3GPK A;  4TX0 A;  3O5D A;  5GPG A;  2PPO A;  3ARX A;  1BL4 A;  4DRJ A;  1GOI A;  1XRV A;  4QZV B;  1PIN A;  4MNM A;  1Q6U A;  3KAH A;  3NTP A;  1W26 A;  3WD0 A;  1HKK A;  2DSV A;  4IT6 A;  5I98 A;  2PPN A;  3O5R A;  1VF8 A;  1J4H A;  1X6N A;  3LUO A;  4Z2L A;  4L3N A;  1EYM A;  2DPE A;  2A3E A;  3KAC A;  1QPL A;  1FKI A;  1R9H A;  1SR0 A;  1FKF A;  1H0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...