1L1PA

Solution structure of the ppiase domain from e. coli trigger factor
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
106
structure length
106
Chain Sequence
GSHMQATWKEKDGAVEAEDRVTIDFTGSVDGEEFEGGKASDFVLAMGQGRMIPGFEDGIKGHKAGEEFTIDVTFPEEYHAENLKGKAAKFAINLKKVEERELPELT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords trigger factor
publication title Solution Structure of the Closed Form of a Peptidyl-Prolyl Isomerase Reveals the Mechanism of Protein Folding
rcsb
source organism Escherichia coli
total genus 8
structure length 106
sequence length 106
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2002-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1l1pA00
2MLYA 2RUDA 1FKSA 2M2AA 1D7HA 1L1PA 2MPHA 3UQIA 3PRDA 2RQSA 3O5GA 4FAPA 2MF9A 1FJDA 4MSPA 2JZVA 2KE0A 2ZR4A 4QT3A 1KT1A 1NMVA 3KAIA 4DRIA 2XP4A 1Y0OA 4ODOA 4DRHA 1J4RA 4LAYA 4DRKA 1A7XA 1JNTA 4TX0A 4QT2A 2L2SA 3I6CA 3OOBA 3IHZA 1KT0A 2ITKA 3JXVA 4TW8A 4W9OA 4J4NA 2K8IA 4U84A 2M1IA 4JFJA 1Q6UA 4ODLA 2RURA 1FKDA 2Y78A 3GPKA 4ODMA 4ODPA 2VN1A 1N1AA 4JFMA 1FD9A 3UF8A 3VAWA 4R0XA 4DIPA 3CGNA 5HWCA 1D7JA 3KABA 3UQAA 1PINA 5HW8A 1D6OA 4U85A 1D7IA 3IKGA 1BL4A 3TCZA 4DRPA 4IQCA 4DH0A 5HW6A 2XP6A 2DG9A 1FKTA 1PBKA 4LAVA 3UQBA 1C9HA 1YATA 1FKGA 3JYMA 2LGOA 3NTPA 4TYOA 4DT4A 3O5EA 1FKKA 3B7XA 2AWGA 2MLXA 3IKDA 4JFLA 3KCEA 4TW6A 3RFWA 1FKFA 2KFWA 3IK8A 3KACA 2LPVA 4IQ2A 2XP5A 3PA7A 1EQ3A 2PV1A 1ROTA 3FAPA 3KADA 5HTGA 1QPLA 2XPAA 1FAPA 2ZR5A 1Q6HA 2PPNA 2ZR6A 2RUQA 5HT1A 1YW5A 3UI5A 2PPOA 4ODRA 3WH0A 1T11A 1FKLA 1JNSA 2PV2A 2D9FA 3JYJA 1BKFA 4DRJA 2IF4A 2ZQVA 2MNTA 1P5QA 1F40A 3O5OA 1W26A 3UI4A 2XP8A 1J4IA 5J6EA 5B8IC 1Q6IA 1M5YA 1U79A 2PBCA 2RUCA 5HW7A 5I98A 1F8AB 4O2TA 3PRBA 4W9QA 3O5MA 4DZ2A 4JFIA 5BXJA 2F4EA 4TW7A 1HXVA 4BF8A 4G2PA 4U86A 5HWBA 3O5DA 4DRNA 2ZQTA 3MDYB 4LAXA 2OFNA 1NSGA 2MLZA 3KAHA 2PPPA 2Q5AA 3O5JA 1EYMA 4J4OA 4JFKA 5HKGA 5HUAA 1QPFA 3CGMA 3NI6A 2LKNA 3O5FA 4N19A 1B6CA 2LJ4A 3TC5A 3O5QA 5GPGA 1JVWA 4DRMA 1J4HA 3H9RB 3LUOA 1R9HA 3O5PA 2F21A 3O5KA 4IPXA 3ODKA 3TDBA 3KZ7A 3EY6A 4JYSA 4MGVA 4QIBA 4DZ3A 2ZQSA 3RGCA 3O5LA 4FN2A 1TCOC 2XP7A 1Q1CA 3UI6A 2KI3A 2FAPA 1FKHA 4GGQA 5DIVA 4NNRA 2ZQUA 1ROUA 4ITZA 5D75A 2DG3A 3O5RA 1FKBA 1NMWA 1QZ2A 4ODNA 4DRQA 4ODQA 2XP9A 5DITA 2DG4A 2XPBA 3O5IA 1FKRA 4TNSA 4G50A 4GIVA 2KGJA 2M08A 2PV3A 1FKJA 3KAFA 3KAGA 4W9PA 5DIUA 1ZK6A 2KO7A 2F2DA 4LAWA 4DROA 1ZCNA 3NRKA 4ODKA 2UZ5A 1FKIA 2KR7A 2VCDA 2XP3A 1J6YA 2FKEA 4C02B 2N87A 2RSEA
chains in the Genus database with same CATH superfamily
2A3BA 1L1PA 4HBOA 2MF9A 4MSPA 4IT6A 1Y0OA 1W1YA 4L72B 1J4RA 2DT0A 1A7XA 3CHFA 2L2SA 2O9OA 3ALFA 3JXVA 4TW8A 4W9OA 3QOKA 4ODPA 2VN1A 1EIBA 1WAWA 3WD2A 3FY1A 5HWCA 4U85A 3WL0A 4NZCA 2F23A 1ZBVA 1IX5A 1HJWA 4MAVA 1LL7A 1JNEA 1GOIA 3UQBA 1NWRA 3WD0A 3O5EA 4DT4A 3KCEA 4Z2LA 2G41A 3OA5A 1SYTA 1ROTA 1VF8A 1QPLA 1EHNA 2ZR6A 2B5UB 3WQVA 2D9FA 1HJXA 1BKFA 2YBTA 2IF4A 4UDMA 3O5OA 3ARXA 3PR9A 2XP8A 4Z2IA 4WKAA 1Q6IA 5HW7A 3GTYX 5BXJA 4HARA 4TW7A 4MPKA 2ZQTA 4LAXA 5HKGA 4KR0B 2PPPA 5HUAA 4JFKA 4MNMA 3AQUA 2LKNA 1K9TA 3O5FA 1HJVA 5GPGA 4HBEA 2ETNA 3O5PA 3ODKA 4Z2GA 1W9PA 3KZ7A 4DZ3A 2XP7A 2A3EA 3AS1A 4GGQA 1E6PA 2ZQUA 4ITZA 1HKKA 1NWTA 2ESCA 3AROA 2DG4A 1FFRA 2XPBA 3O5IA 1X6NA 4W5UA 1E44A 1FKJA 3WD3A 1HKIA 2OLHA 1FKIA 1UR9A 4C02B 2N87A 4KQZA 2DSZA 4MNJA 3UQIA 2JZVA 2KE0A 4QT3A 1KT1A 4MTVA 1NMVA 3AS3A 4DRHA 4ODOA 1GUVA 4DRKA 1JNTA 2G8ZA 2DT2A 4P8UA 2ITKA 4R5EA 4XAKA 4J4NA 2K8IA 4U84A 4JFJA 4ODLA 4S3KA 4ODMA 1CTNA 1FD9A 3WQWA 2A3AA 3PRAA 3UF8A 4MNLA 3CGNA 4ML4A 2DSUA 5HW8A 1D6OA 4WKFA 1LL4A 3ARZA 3IKGA 5HW6A 2XP6A 1PBKA 5DEZA 1C9HA 3NTPA 1NWUA 1FKKA 3B7XA 3IKDA 4JFLA 3RFWA 1FKFA 3IK8A 1UR8A 4IQ2A 3ARRA 5HTGA 3KADA 4NSBA 4P8XA 2PPNA 1XHGA 1X6LA 2PPOA 1T11A 1ZU8A 1P5QA 1F40A 1E6NA 1HKJA 2DSWA 1M5YA 1U79A 1RD6A 5I98A 4O2TA 3PRBA 4DZ2A 4JFIA 4BF8A 4U86A 5HWBA 3MDYB 3KAHA 2Q5AA 3O5JA 1D2KA 4ZPTR 1QPFA 2EULA 1TFVA 1OGGA 3TC5A 4P8WA 4Z2KA 3WD4A 4IT4A 5GQBA 2F21A 3O5KA 3B9DA 3EY6A 2FDMA 4JYSA 2ZQSA 1E15A 3ARVA 3CHCA 4L3NA 2KI3A 5DIVA 4NNRA 5DF0A 2DG3A 4Z2JA 1QZ2A 1KFWA 1W9VA 2O92A 4ODQA 2XP9A 3GU0A 1E9LA 3KAFA 2PV3A 5DIUA 1ZK6A 4LAWA 1ZCNA 2XP3A 1XRVA 1GPFA 2RUDA 1FKSA 2M2AA 4AY1A 2MPHA 1HKMA 3WD1A 1ITXA 3B9AA 4S3JA 2ZR4A 1LQ0A 4DRIA 4LAYA 4QT2A 1KT0A 4ZPWR 1ZBWA 2M1IA 1FKDA 3GPKA 3ARSA 3WKZA 4LGXA 1N1AA 3ARQA 1W9UA 3CH9A 4R0XA 4DIPA 1D7JA 1W1TA 3BXWA 1LL6A 1D7IA 4DRPA 4ZS6A 4IQCA 4DH0A 1YATA 3JYMA 2LGOA 3BMBA 4WIWA 4WKHA 4MNKA 2AWGA 2KFWA 3KACA 3RM4A 2LPVA 1JNSA 5DO2A 2PV1A 1EQ3A 2XPAA 2ZR5A 1Q6HA 3FXYA 5HT1A 1YW5A 5JH8A 3WH0A 4DWSB 1FKLA 2PV2A 1ZB5A 3JYJA 4DRJA 2ZQVA 1LG2A 1W26A 1J4IA 2IUZA 1H0GA 1FFQA 2WLYA 3WL1A 2F4EA 1HXVA 3AS0A 3O5DA 4DRNA 1NSGA 1WB0A 2MLZA 4QZVB 4URIA 3NI6A 2WLZA 4N19A 1WNOA 2LJ4A 3ARUA 3O5QA 1JVWA 1NH6A 4DRMA 3LUOA 1R9HA 3ARPA 4IPXA 3TDBA 1O6IA 4MGVA 4QIBA 3RGCA 3O5LA 1TCOC 3RM9A 2FAPA 1FKHA 1OWQA 1ZBKA 5DITA 4TNSA 2AOSA 2M08A 4W9PA 2KO7A 3NRKA 3B8SA 2UZ5A 2KR7A 2VCDA 1J6YA 3IHZA 2FKEA 4G2PA 4Q22A 2MLYA 1W1VA 2P4VA 1D7HA 3PRDA 2A3CA 2RQSA 3O5GA 3ARWA 4FAPA 1FJDA 2DT1A 4Z2HA 2DSVA 3KAIA 2DPEA 2XP4A 3AS2A 3G6LA 2QF8A 3B9EA 4TX0A 3I6CA 3OOBA 3G6MA 1Q6UA 2RURA 2Y78A 3ARYA 4JFMA 3VAWA 3KABA 3UQAA 1PINA 2PI6A 3TCZA 1BL4A 1W1PA 2DG9A 1FKTA 4LAVA 4DWSC 3RMEA 1FKGA 4TYOA 1NWSA 2MLXA 4TW6A 3RM8A 2XP5A 3PA7A 3FAPA 1FAPA 2DT3A 2RUQA 3UI5A 1EDQA 4ODRA 4PTMA 5HBFA 2MNTA 3UI4A 5J6EA 5B8IC 2PBCA 3WIJA 2RUCA 4ZPVR 1F8AB 4W9QA 3O5MA 1SR0A 4DWSA 2B31A 3EIPA 1JCHB 2OFNA 1EYMA 2WK2A 4J4OA 3CGMA 2PN0A 1JNDA 1B6CA 1ZBCA 1J4HA 3CZ8A 3H9RB 4P8VA 1LG1A 4FN2A 1ZL1A 1Q1CA 5GPRA 3UI6A 3ARTA 2WM0A 4DWSD 1E6RA 1ROUA 5D75A 1GRJA 3O5RA 1FKBA 1NMWA 4ODNA 1OGBA 4DRQA 2YBUA 4Q7NA 1FKRA 4G50A 4GIVA 4WK9A 1E6ZA 1H0IA 2KGJA 3KAGA 4DROA 2F2DA 3CHEA 4ODKA 3CHDA 3W4RA 1LJYA 3ALGA 4WJXA 2RSEA
chains in the Genus database with same CATH topology
2A3BA 1L1PA 4HBOA 2MF9A 4MSPA 4IT6A 1Y0OA 1W1YA 4L72B 1J4RA 2DT0A 1A7XA 3CHFA 2L2SA 2O9OA 3ALFA 3JXVA 4TW8A 4W9OA 3QOKA 4ODPA 2VN1A 1EIBA 1WAWA 3WD2A 3FY1A 5HWCA 4U85A 3WL0A 4NZCA 1ZBVA 1IX5A 1HJWA 4MAVA 1LL7A 1JNEA 1GOIA 3UQBA 1NWRA 3WD0A 3O5EA 4DT4A 3KCEA 4Z2LA 2G41A 3OA5A 1SYTA 1ROTA 1VF8A 1QPLA 1EHNA 2ZR6A 3WQVA 2D9FA 1HJXA 1BKFA 2YBTA 2IF4A 3O5OA 3ARXA 3PR9A 2XP8A 4Z2IA 4WKAA 1Q6IA 5HW7A 5BXJA 4HARA 4TW7A 4MPKA 2ZQTA 4LAXA 5HKGA 4KR0B 2PPPA 5HUAA 4JFKA 4MNMA 3AQUA 2LKNA 1K9TA 3O5FA 1HJVA 5GPGA 4HBEA 3O5PA 3ODKA 4Z2GA 1W9PA 3KZ7A 4DZ3A 2XP7A 2A3EA 3AS1A 4GGQA 1E6PA 2ZQUA 4ITZA 1HKKA 1NWTA 2ESCA 3AROA 2DG4A 1FFRA 2XPBA 3O5IA 1X6NA 4W5UA 1FKJA 3WD3A 1HKIA 2OLHA 1FKIA 1UR9A 4C02B 2N87A 4KQZA 2DSZA 4MNJA 3UQIA 2JZVA 2KE0A 4QT3A 1KT1A 4MTVA 1NMVA 3AS3A 4DRHA 4ODOA 1GUVA 4DRKA 1JNTA 2G8ZA 2DT2A 4P8UA 2ITKA 4R5EA 4XAKA 4J4NA 2K8IA 4U84A 4JFJA 4ODLA 4S3KA 4ODMA 1CTNA 1FD9A 3WQWA 2A3AA 3PRAA 3UF8A 4MNLA 3CGNA 4ML4A 2DSUA 5HW8A 1D6OA 4WKFA 1LL4A 3ARZA 3IKGA 5HW6A 2XP6A 1PBKA 5DEZA 1C9HA 3NTPA 1NWUA 1FKKA 3B7XA 3IKDA 4JFLA 3RFWA 1FKFA 3IK8A 1UR8A 4IQ2A 3ARRA 5HTGA 3KADA 4NSBA 4P8XA 2PPNA 1XHGA 1X6LA 2PPOA 1T11A 1ZU8A 1P5QA 1F40A 1E6NA 1HKJA 2DSWA 1M5YA 1U79A 1RD6A 5I98A 4O2TA 3PRBA 4DZ2A 4JFIA 4BF8A 4U86A 5HWBA 3MDYB 3KAHA 2Q5AA 3O5JA 1D2KA 4ZPTR 1QPFA 1TFVA 1OGGA 3TC5A 4P8WA 4Z2KA 3WD4A 4IT4A 5GQBA 2F21A 3O5KA 3B9DA 3EY6A 2FDMA 4JYSA 2ZQSA 1E15A 3ARVA 3CHCA 4L3NA 2KI3A 5DIVA 4NNRA 5DF0A 2DG3A 4Z2JA 1QZ2A 1KFWA 1W9VA 2O92A 4ODQA 2XP9A 1E9LA 3KAFA 2PV3A 5DIUA 1ZK6A 4LAWA 1ZCNA 2XP3A 1XRVA 1GPFA 2RUDA 1FKSA 2M2AA 4AY1A 2MPHA 1HKMA 3WD1A 1ITXA 3B9AA 4S3JA 2ZR4A 1LQ0A 4DRIA 4LAYA 4QT2A 1KT0A 4ZPWR 1ZBWA 2M1IA 1FKDA 3GPKA 3ARSA 3WKZA 4LGXA 1N1AA 3ARQA 1W9UA 3CH9A 4R0XA 4DIPA 1D7JA 1W1TA 3BXWA 1LL6A 1D7IA 4DRPA 4ZS6A 4IQCA 4DH0A 1YATA 3JYMA 2LGOA 4WIWA 4WKHA 4MNKA 2AWGA 2KFWA 3KACA 3RM4A 2LPVA 1JNSA 5DO2A 2PV1A 1EQ3A 2XPAA 2ZR5A 1Q6HA 3FXYA 5HT1A 1YW5A 5JH8A 3WH0A 4DWSB 1FKLA 2PV2A 1ZB5A 3JYJA 4DRJA 2ZQVA 1LG2A 1W26A 1J4IA 2IUZA 1H0GA 1FFQA 2WLYA 3WL1A 2F4EA 1HXVA 3AS0A 3O5DA 4DRNA 1NSGA 1WB0A 2MLZA 4QZVB 4URIA 3NI6A 2WLZA 4N19A 1WNOA 2LJ4A 3ARUA 3O5QA 1JVWA 1NH6A 4DRMA 3LUOA 1R9HA 3ARPA 4IPXA 3TDBA 1O6IA 4MGVA 4QIBA 3RGCA 3O5LA 1TCOC 3RM9A 2FAPA 1FKHA 1OWQA 1ZBKA 5DITA 4TNSA 2AOSA 2M08A 4W9PA 2KO7A 3NRKA 3B8SA 2UZ5A 2KR7A 2VCDA 1J6YA 3IHZA 2FKEA 4G2PA 4Q22A 2MLYA 1W1VA 1D7HA 3PRDA 2A3CA 2RQSA 3O5GA 3ARWA 4FAPA 1FJDA 2DT1A 4Z2HA 2DSVA 3KAIA 2DPEA 2XP4A 3AS2A 3G6LA 2QF8A 3B9EA 4TX0A 3I6CA 3OOBA 3G6MA 1Q6UA 2RURA 2Y78A 3ARYA 4JFMA 3VAWA 3KABA 3UQAA 1PINA 2PI6A 3TCZA 1BL4A 1W1PA 2DG9A 1FKTA 4LAVA 4DWSC 3RMEA 1FKGA 4TYOA 1NWSA 2MLXA 4TW6A 3RM8A 2XP5A 3PA7A 3FAPA 1FAPA 2DT3A 2RUQA 3UI5A 1EDQA 4ODRA 4PTMA 5HBFA 2MNTA 3UI4A 5J6EA 5B8IC 2PBCA 3WIJA 2RUCA 4ZPVR 1F8AB 4W9QA 3O5MA 1SR0A 4DWSA 2B31A 2OFNA 1EYMA 2WK2A 4J4OA 3CGMA 1JNDA 1B6CA 1ZBCA 1J4HA 3CZ8A 3H9RB 4P8VA 1LG1A 4FN2A 1ZL1A 1Q1CA 5GPRA 3UI6A 3ARTA 2WM0A 4DWSD 1E6RA 1ROUA 5D75A 3O5RA 1FKBA 1NMWA 4ODNA 1OGBA 4DRQA 2YBUA 4Q7NA 1FKRA 4G50A 4GIVA 4WK9A 1E6ZA 1H0IA 2KGJA 3KAGA 4DROA 2F2DA 3CHEA 4ODKA 3CHDA 3W4RA 1LJYA 3ALGA 4WJXA 2RSEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MLY A;  2RUD A;  1FKS A;  2M2A A;  1D7H A;  1L1P A;  2MPH A;  3UQI A;  3PRD A;  2RQS A;  3O5G A;  4FAP A;  2MF9 A;  1FJD A;  4MSP A;  2JZV A;  2KE0 A;  2ZR4 A;  4QT3 A;  1KT1 A;  1NMV A;  3KAI A;  4DRI A;  2XP4 A;  1Y0O A;  4ODO A;  4DRH A;  1J4R A;  4LAY A;  4DRK A;  1A7X A;  1JNT A;  4TX0 A;  4QT2 A;  2L2S A;  3I6C A;  3OOB A;  3IHZ A;  1KT0 A;  2ITK A;  3JXV A;  4TW8 A;  4W9O A;  4J4N A;  2K8I A;  4U84 A;  2M1I A;  4JFJ A;  1Q6U A;  4ODL A;  2RUR A;  1FKD A;  2Y78 A;  3GPK A;  4ODM A;  4ODP A;  2VN1 A;  1N1A A;  4JFM A;  1FD9 A;  3UF8 A;  3VAW A;  4R0X A;  4DIP A;  3CGN A;  5HWC A;  1D7J A;  3KAB A;  3UQA A;  1PIN A;  5HW8 A;  1D6O A;  4U85 A;  1D7I A;  3IKG A;  1BL4 A;  3TCZ A;  4DRP A;  4IQC A;  4DH0 A;  5HW6 A;  2XP6 A;  2DG9 A;  1FKT A;  1PBK A;  4LAV A;  3UQB A;  1C9H A;  1YAT A;  1FKG A;  3JYM A;  2LGO A;  3NTP A;  4TYO A;  4DT4 A;  3O5E A;  1FKK A;  3B7X A;  2AWG A;  2MLX A;  3IKD A;  4JFL A;  3KCE A;  4TW6 A;  3RFW A;  1FKF A;  2KFW A;  3IK8 A;  3KAC A;  2LPV A;  4IQ2 A;  2XP5 A;  3PA7 A;  1EQ3 A;  2PV1 A;  1ROT A;  3FAP A;  3KAD A;  5HTG A;  1QPL A;  2XPA A;  1FAP A;  2ZR5 A;  1Q6H A;  2PPN A;  2ZR6 A;  2RUQ A;  5HT1 A;  1YW5 A;  3UI5 A;  2PPO A;  4ODR A;  3WH0 A;  1T11 A;  1FKL A;  1JNS A;  2PV2 A;  2D9F A;  3JYJ A;  1BKF A;  4DRJ A;  2IF4 A;  2ZQV A;  2MNT A;  1P5Q A;  1F40 A;  3O5O A;  1W26 A;  3UI4 A;  2XP8 A;  1J4I A;  5J6E A;  5B8I C;  1Q6I A;  1M5Y A;  1U79 A;  2PBC A;  2RUC A;  5HW7 A;  5I98 A;  1F8A B;  4O2T A;  3PRB A;  4W9Q A;  3O5M A;  4DZ2 A;  4JFI A;  5BXJ A;  2F4E A;  4TW7 A;  1HXV A;  4BF8 A;  4G2P A;  4U86 A;  5HWB A;  3O5D A;  4DRN A;  2ZQT A;  3MDY B;  4LAX A;  2OFN A;  1NSG A;  2MLZ A;  3KAH A;  2PPP A;  2Q5A A;  3O5J A;  1EYM A;  4J4O A;  4JFK A;  5HKG A;  5HUA A;  1QPF A;  3CGM A;  3NI6 A;  2LKN A;  3O5F A;  4N19 A;  1B6C A;  2LJ4 A;  3TC5 A;  3O5Q A;  5GPG A;  1JVW A;  4DRM A;  1J4H A;  3H9R B;  3LUO A;  1R9H A;  3O5P A;  2F21 A;  3O5K A;  4IPX A;  3ODK A;  3TDB A;  3KZ7 A;  3EY6 A;  4JYS A;  4MGV A;  4QIB A;  4DZ3 A;  2ZQS A;  3RGC A;  3O5L A;  4FN2 A;  1TCO C;  2XP7 A;  1Q1C A;  3UI6 A;  2KI3 A;  2FAP A;  1FKH A;  4GGQ A;  5DIV A;  4NNR A;  2ZQU A;  1ROU A;  4ITZ A;  5D75 A;  2DG3 A;  3O5R A;  1FKB A;  1NMW A;  1QZ2 A;  4ODN A;  4DRQ A;  4ODQ A;  2XP9 A;  5DIT A;  2DG4 A;  2XPB A;  3O5I A;  1FKR A;  4TNS A;  4G50 A;  4GIV A;  2KGJ A;  2M08 A;  2PV3 A;  1FKJ A;  3KAF A;  3KAG A;  4W9P A;  5DIU A;  1ZK6 A;  2KO7 A;  2F2D A;  4LAW A;  4DRO A;  1ZCN A;  3NRK A;  4ODK A;  2UZ5 A;  1FKI A;  2KR7 A;  2VCD A;  2XP3 A;  1J6Y A;  2FKE A;  4C02 B;  2N87 A;  2RSE A; 
#chains in the Genus database with same CATH topology
 2A3B A;  1L1P A;  4HBO A;  2MF9 A;  4MSP A;  4IT6 A;  1Y0O A;  1W1Y A;  4L72 B;  1J4R A;  2DT0 A;  1A7X A;  3CHF A;  2L2S A;  2O9O A;  3ALF A;  3JXV A;  4TW8 A;  4W9O A;  3QOK A;  4ODP A;  2VN1 A;  1EIB A;  1WAW A;  3WD2 A;  3FY1 A;  5HWC A;  4U85 A;  3WL0 A;  4NZC A;  2F23 A;  1ZBV A;  1IX5 A;  1HJW A;  4MAV A;  1LL7 A;  1JNE A;  1GOI A;  3UQB A;  1NWR A;  3WD0 A;  3O5E A;  4DT4 A;  3KCE A;  4Z2L A;  2G41 A;  3OA5 A;  1SYT A;  1ROT A;  1VF8 A;  1QPL A;  1EHN A;  2ZR6 A;  2B5U B;  3WQV A;  2D9F A;  1HJX A;  1BKF A;  2YBT A;  2IF4 A;  4UDM A;  3O5O A;  3ARX A;  3PR9 A;  2XP8 A;  4Z2I A;  4WKA A;  1Q6I A;  5HW7 A;  3GTY X;  5BXJ A;  4HAR A;  4TW7 A;  4MPK A;  2ZQT A;  4LAX A;  5HKG A;  4KR0 B;  2PPP A;  5HUA A;  4JFK A;  4MNM A;  3AQU A;  2LKN A;  1K9T A;  3O5F A;  1HJV A;  5GPG A;  4HBE A;  2ETN A;  3O5P A;  3ODK A;  4Z2G A;  1W9P A;  3KZ7 A;  4DZ3 A;  2XP7 A;  2A3E A;  3AS1 A;  4GGQ A;  1E6P A;  2ZQU A;  4ITZ A;  1HKK A;  1NWT A;  2ESC A;  3ARO A;  2DG4 A;  1FFR A;  2XPB A;  3O5I A;  1X6N A;  4W5U A;  1E44 A;  1FKJ A;  3WD3 A;  1HKI A;  2OLH A;  1FKI A;  1UR9 A;  4C02 B;  2N87 A;  4KQZ A;  2DSZ A;  4MNJ A;  3UQI A;  2JZV A;  2KE0 A;  4QT3 A;  1KT1 A;  4MTV A;  1NMV A;  3AS3 A;  4DRH A;  4ODO A;  1GUV A;  4DRK A;  1JNT A;  2G8Z A;  2DT2 A;  4P8U A;  2ITK A;  4R5E A;  4XAK A;  4J4N A;  2K8I A;  4U84 A;  4JFJ A;  4ODL A;  4S3K A;  4ODM A;  1CTN A;  1FD9 A;  3WQW A;  2A3A A;  3PRA A;  3UF8 A;  4MNL A;  3CGN A;  4ML4 A;  2DSU A;  5HW8 A;  1D6O A;  4WKF A;  1LL4 A;  3ARZ A;  3IKG A;  5HW6 A;  2XP6 A;  1PBK A;  5DEZ A;  1C9H A;  3NTP A;  1NWU A;  1FKK A;  3B7X A;  3IKD A;  4JFL A;  3RFW A;  1FKF A;  3IK8 A;  1UR8 A;  4IQ2 A;  3ARR A;  5HTG A;  3KAD A;  4NSB A;  4P8X A;  2PPN A;  1XHG A;  1X6L A;  2PPO A;  1T11 A;  1ZU8 A;  1P5Q A;  1F40 A;  1E6N A;  1HKJ A;  2DSW A;  1M5Y A;  1U79 A;  1RD6 A;  5I98 A;  4O2T A;  3PRB A;  4DZ2 A;  4JFI A;  4BF8 A;  4U86 A;  5HWB A;  3MDY B;  3KAH A;  2Q5A A;  3O5J A;  1D2K A;  4ZPT R;  1QPF A;  2EUL A;  1TFV A;  1OGG A;  3TC5 A;  4P8W A;  4Z2K A;  3WD4 A;  4IT4 A;  5GQB A;  2F21 A;  3O5K A;  3B9D A;  3EY6 A;  2FDM A;  4JYS A;  2ZQS A;  1E15 A;  3ARV A;  3CHC A;  4L3N A;  2KI3 A;  5DIV A;  4NNR A;  5DF0 A;  2DG3 A;  4Z2J A;  1QZ2 A;  1KFW A;  1W9V A;  2O92 A;  4ODQ A;  2XP9 A;  3GU0 A;  1E9L A;  3KAF A;  2PV3 A;  5DIU A;  1ZK6 A;  4LAW A;  1ZCN A;  2XP3 A;  1XRV A;  1GPF A;  2RUD A;  1FKS A;  2M2A A;  4AY1 A;  2MPH A;  1HKM A;  3WD1 A;  1ITX A;  3B9A A;  4S3J A;  2ZR4 A;  1LQ0 A;  4DRI A;  4LAY A;  4QT2 A;  1KT0 A;  4ZPW R;  1ZBW A;  2M1I A;  1FKD A;  3GPK A;  3ARS A;  3WKZ A;  4LGX A;  1N1A A;  3ARQ A;  1W9U A;  3CH9 A;  4R0X A;  4DIP A;  1D7J A;  1W1T A;  3BXW A;  1LL6 A;  1D7I A;  4DRP A;  4ZS6 A;  4IQC A;  4DH0 A;  1YAT A;  3JYM A;  2LGO A;  3BMB A;  4WIW A;  4WKH A;  4MNK A;  2AWG A;  2KFW A;  3KAC A;  3RM4 A;  2LPV A;  1JNS A;  5DO2 A;  2PV1 A;  1EQ3 A;  2XPA A;  2ZR5 A;  1Q6H A;  3FXY A;  5HT1 A;  1YW5 A;  5JH8 A;  3WH0 A;  4DWS B;  1FKL A;  2PV2 A;  1ZB5 A;  3JYJ A;  4DRJ A;  2ZQV A;  1LG2 A;  1W26 A;  1J4I A;  2IUZ A;  1H0G A;  1FFQ A;  2WLY A;  3WL1 A;  2F4E A;  1HXV A;  3AS0 A;  3O5D A;  4DRN A;  1NSG A;  1WB0 A;  2MLZ A;  4QZV B;  4URI A;  3NI6 A;  2WLZ A;  4N19 A;  1WNO A;  2LJ4 A;  3ARU A;  3O5Q A;  1JVW A;  1NH6 A;  4DRM A;  3LUO A;  1R9H A;  3ARP A;  4IPX A;  3TDB A;  1O6I A;  4MGV A;  4QIB A;  3RGC A;  3O5L A;  1TCO C;  3RM9 A;  2FAP A;  1FKH A;  1OWQ A;  1ZBK A;  5DIT A;  4TNS A;  2AOS A;  2M08 A;  4W9P A;  2KO7 A;  3NRK A;  3B8S A;  2UZ5 A;  2KR7 A;  2VCD A;  1J6Y A;  3IHZ A;  2FKE A;  4G2P A;  4Q22 A;  2MLY A;  1W1V A;  2P4V A;  1D7H A;  3PRD A;  2A3C A;  2RQS A;  3O5G A;  3ARW A;  4FAP A;  1FJD A;  2DT1 A;  4Z2H A;  2DSV A;  3KAI A;  2DPE A;  2XP4 A;  3AS2 A;  3G6L A;  2QF8 A;  3B9E A;  4TX0 A;  3I6C A;  3OOB A;  3G6M A;  1Q6U A;  2RUR A;  2Y78 A;  3ARY A;  4JFM A;  3VAW A;  3KAB A;  3UQA A;  1PIN A;  2PI6 A;  3TCZ A;  1BL4 A;  1W1P A;  2DG9 A;  1FKT A;  4LAV A;  4DWS C;  3RME A;  1FKG A;  4TYO A;  1NWS A;  2MLX A;  4TW6 A;  3RM8 A;  2XP5 A;  3PA7 A;  3FAP A;  1FAP A;  2DT3 A;  2RUQ A;  3UI5 A;  1EDQ A;  4ODR A;  4PTM A;  5HBF A;  2MNT A;  3UI4 A;  5J6E A;  5B8I C;  2PBC A;  3WIJ A;  2RUC A;  4ZPV R;  1F8A B;  4W9Q A;  3O5M A;  1SR0 A;  4DWS A;  2B31 A;  3EIP A;  1JCH B;  2OFN A;  1EYM A;  2WK2 A;  4J4O A;  3CGM A;  2PN0 A;  1JND A;  1B6C A;  1ZBC A;  1J4H A;  3CZ8 A;  3H9R B;  4P8V A;  1LG1 A;  4FN2 A;  1ZL1 A;  1Q1C A;  5GPR A;  3UI6 A;  3ART A;  2WM0 A;  4DWS D;  1E6R A;  1ROU A;  5D75 A;  1GRJ A;  3O5R A;  1FKB A;  1NMW A;  4ODN A;  1OGB A;  4DRQ A;  2YBU A;  4Q7N A;  1FKR A;  4G50 A;  4GIV A;  4WK9 A;  1E6Z A;  1H0I A;  2KGJ A;  3KAG A;  4DRO A;  2F2D A;  3CHE A;  4ODK A;  3CHD A;  3W4R A;  1LJY A;  3ALG A;  4WJX A;  2RSE A; 
#chains in the Genus database with same CATH homology
 2A3B A;  1L1P A;  4HBO A;  2MF9 A;  4MSP A;  4IT6 A;  1Y0O A;  1W1Y A;  4L72 B;  1J4R A;  2DT0 A;  1A7X A;  3CHF A;  2L2S A;  2O9O A;  3ALF A;  3JXV A;  4TW8 A;  4W9O A;  3QOK A;  4ODP A;  2VN1 A;  1EIB A;  1WAW A;  3WD2 A;  3FY1 A;  5HWC A;  4U85 A;  3WL0 A;  4NZC A;  1ZBV A;  1IX5 A;  1HJW A;  4MAV A;  1LL7 A;  1JNE A;  1GOI A;  3UQB A;  1NWR A;  3WD0 A;  3O5E A;  4DT4 A;  3KCE A;  4Z2L A;  2G41 A;  3OA5 A;  1SYT A;  1ROT A;  1VF8 A;  1QPL A;  1EHN A;  2ZR6 A;  3WQV A;  2D9F A;  1HJX A;  1BKF A;  2YBT A;  2IF4 A;  3O5O A;  3ARX A;  3PR9 A;  2XP8 A;  4Z2I A;  4WKA A;  1Q6I A;  5HW7 A;  5BXJ A;  4HAR A;  4TW7 A;  4MPK A;  2ZQT A;  4LAX A;  5HKG A;  4KR0 B;  2PPP A;  5HUA A;  4JFK A;  4MNM A;  3AQU A;  2LKN A;  1K9T A;  3O5F A;  1HJV A;  5GPG A;  4HBE A;  3O5P A;  3ODK A;  4Z2G A;  1W9P A;  3KZ7 A;  4DZ3 A;  2XP7 A;  2A3E A;  3AS1 A;  4GGQ A;  1E6P A;  2ZQU A;  4ITZ A;  1HKK A;  1NWT A;  2ESC A;  3ARO A;  2DG4 A;  1FFR A;  2XPB A;  3O5I A;  1X6N A;  4W5U A;  1FKJ A;  3WD3 A;  1HKI A;  2OLH A;  1FKI A;  1UR9 A;  4C02 B;  2N87 A;  4KQZ A;  2DSZ A;  4MNJ A;  3UQI A;  2JZV A;  2KE0 A;  4QT3 A;  1KT1 A;  4MTV A;  1NMV A;  3AS3 A;  4DRH A;  4ODO A;  1GUV A;  4DRK A;  1JNT A;  2G8Z A;  2DT2 A;  4P8U A;  2ITK A;  4R5E A;  4XAK A;  4J4N A;  2K8I A;  4U84 A;  4JFJ A;  4ODL A;  4S3K A;  4ODM A;  1CTN A;  1FD9 A;  3WQW A;  2A3A A;  3PRA A;  3UF8 A;  4MNL A;  3CGN A;  4ML4 A;  2DSU A;  5HW8 A;  1D6O A;  4WKF A;  1LL4 A;  3ARZ A;  3IKG A;  5HW6 A;  2XP6 A;  1PBK A;  5DEZ A;  1C9H A;  3NTP A;  1NWU A;  1FKK A;  3B7X A;  3IKD A;  4JFL A;  3RFW A;  1FKF A;  3IK8 A;  1UR8 A;  4IQ2 A;  3ARR A;  5HTG A;  3KAD A;  4NSB A;  4P8X A;  2PPN A;  1XHG A;  1X6L A;  2PPO A;  1T11 A;  1ZU8 A;  1P5Q A;  1F40 A;  1E6N A;  1HKJ A;  2DSW A;  1M5Y A;  1U79 A;  1RD6 A;  5I98 A;  4O2T A;  3PRB A;  4DZ2 A;  4JFI A;  4BF8 A;  4U86 A;  5HWB A;  3MDY B;  3KAH A;  2Q5A A;  3O5J A;  1D2K A;  4ZPT R;  1QPF A;  1TFV A;  1OGG A;  3TC5 A;  4P8W A;  4Z2K A;  3WD4 A;  4IT4 A;  5GQB A;  2F21 A;  3O5K A;  3B9D A;  3EY6 A;  2FDM A;  4JYS A;  2ZQS A;  1E15 A;  3ARV A;  3CHC A;  4L3N A;  2KI3 A;  5DIV A;  4NNR A;  5DF0 A;  2DG3 A;  4Z2J A;  1QZ2 A;  1KFW A;  1W9V A;  2O92 A;  4ODQ A;  2XP9 A;  1E9L A;  3KAF A;  2PV3 A;  5DIU A;  1ZK6 A;  4LAW A;  1ZCN A;  2XP3 A;  1XRV A;  1GPF A;  2RUD A;  1FKS A;  2M2A A;  4AY1 A;  2MPH A;  1HKM A;  3WD1 A;  1ITX A;  3B9A A;  4S3J A;  2ZR4 A;  1LQ0 A;  4DRI A;  4LAY A;  4QT2 A;  1KT0 A;  4ZPW R;  1ZBW A;  2M1I A;  1FKD A;  3GPK A;  3ARS A;  3WKZ A;  4LGX A;  1N1A A;  3ARQ A;  1W9U A;  3CH9 A;  4R0X A;  4DIP A;  1D7J A;  1W1T A;  3BXW A;  1LL6 A;  1D7I A;  4DRP A;  4ZS6 A;  4IQC A;  4DH0 A;  1YAT A;  3JYM A;  2LGO A;  4WIW A;  4WKH A;  4MNK A;  2AWG A;  2KFW A;  3KAC A;  3RM4 A;  2LPV A;  1JNS A;  5DO2 A;  2PV1 A;  1EQ3 A;  2XPA A;  2ZR5 A;  1Q6H A;  3FXY A;  5HT1 A;  1YW5 A;  5JH8 A;  3WH0 A;  4DWS B;  1FKL A;  2PV2 A;  1ZB5 A;  3JYJ A;  4DRJ A;  2ZQV A;  1LG2 A;  1W26 A;  1J4I A;  2IUZ A;  1H0G A;  1FFQ A;  2WLY A;  3WL1 A;  2F4E A;  1HXV A;  3AS0 A;  3O5D A;  4DRN A;  1NSG A;  1WB0 A;  2MLZ A;  4QZV B;  4URI A;  3NI6 A;  2WLZ A;  4N19 A;  1WNO A;  2LJ4 A;  3ARU A;  3O5Q A;  1JVW A;  1NH6 A;  4DRM A;  3LUO A;  1R9H A;  3ARP A;  4IPX A;  3TDB A;  1O6I A;  4MGV A;  4QIB A;  3RGC A;  3O5L A;  1TCO C;  3RM9 A;  2FAP A;  1FKH A;  1OWQ A;  1ZBK A;  5DIT A;  4TNS A;  2AOS A;  2M08 A;  4W9P A;  2KO7 A;  3NRK A;  3B8S A;  2UZ5 A;  2KR7 A;  2VCD A;  1J6Y A;  3IHZ A;  2FKE A;  4G2P A;  4Q22 A;  2MLY A;  1W1V A;  1D7H A;  3PRD A;  2A3C A;  2RQS A;  3O5G A;  3ARW A;  4FAP A;  1FJD A;  2DT1 A;  4Z2H A;  2DSV A;  3KAI A;  2DPE A;  2XP4 A;  3AS2 A;  3G6L A;  2QF8 A;  3B9E A;  4TX0 A;  3I6C A;  3OOB A;  3G6M A;  1Q6U A;  2RUR A;  2Y78 A;  3ARY A;  4JFM A;  3VAW A;  3KAB A;  3UQA A;  1PIN A;  2PI6 A;  3TCZ A;  1BL4 A;  1W1P A;  2DG9 A;  1FKT A;  4LAV A;  4DWS C;  3RME A;  1FKG A;  4TYO A;  1NWS A;  2MLX A;  4TW6 A;  3RM8 A;  2XP5 A;  3PA7 A;  3FAP A;  1FAP A;  2DT3 A;  2RUQ A;  3UI5 A;  1EDQ A;  4ODR A;  4PTM A;  5HBF A;  2MNT A;  3UI4 A;  5J6E A;  5B8I C;  2PBC A;  3WIJ A;  2RUC A;  4ZPV R;  1F8A B;  4W9Q A;  3O5M A;  1SR0 A;  4DWS A;  2B31 A;  2OFN A;  1EYM A;  2WK2 A;  4J4O A;  3CGM A;  1JND A;  1B6C A;  1ZBC A;  1J4H A;  3CZ8 A;  3H9R B;  4P8V A;  1LG1 A;  4FN2 A;  1ZL1 A;  1Q1C A;  5GPR A;  3UI6 A;  3ART A;  2WM0 A;  4DWS D;  1E6R A;  1ROU A;  5D75 A;  3O5R A;  1FKB A;  1NMW A;  4ODN A;  1OGB A;  4DRQ A;  2YBU A;  4Q7N A;  1FKR A;  4G50 A;  4GIV A;  4WK9 A;  1E6Z A;  1H0I A;  2KGJ A;  3KAG A;  4DRO A;  2F2D A;  3CHE A;  4ODK A;  3CHD A;  3W4R A;  1LJY A;  3ALG A;  4WJX A;  2RSE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...