1L1PA

Solution structure of the ppiase domain from e. coli trigger factor
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
106
structure length
106
Chain Sequence
GSHMQATWKEKDGAVEAEDRVTIDFTGSVDGEEFEGGKASDFVLAMGQGRMIPGFEDGIKGHKAGEEFTIDVTFPEEYHAENLKGKAAKFAINLKKVEERELPELT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords trigger factor
publication title Solution Structure of the Closed Form of a Peptidyl-Prolyl Isomerase Reveals the Mechanism of Protein Folding
rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 8
structure length 106
sequence length 106
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2002-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1l1pA00
2FKEA 3O5GA 4NNRA 4TW7A 3NRKA 3IK8A 4DT4A 5HKGA 2VCDA 2F21A 2LKNA 5HUAA 1J4RA 3KAIA 2IF4A 3EY6A 1M5YA 1T11A 2RURA 3B7XA 3KADA 1B6CA 3O5IA 3PRDA 2ZQVA 2Y78A 1FJDA 3O5JA 4ODPA 2PV1A 3TDBA 1YATA 3MDYB 4LAVA 4TW6A 1D7JA 2LJ4A 3O5DA 4G2PA 4ITZA 4BF8A 1Q1CA 2ZQSA 3PRBA 4ODKA 5BXJA 5J6EA 1QPFA 5DIUA 2DG4A 2MPHA 1PINA 3UI4A 2XP7A 3O5PA 5HTGA 4DRMA 1ROTA 2PPNA 5DIVA 2DG9A 2XP9A 1F40A 4JFKA 1L1PA 1FKTA 2RUDA 5D75A 1KT0A 4U86A 1JVWA 4FN2A 4JYSA 3JYJA 1BKFA 3TC5A 1Q6HA 2XPAA 4DRIA 4GIVA 3KAFA 2RUQA 4U85A 4DRNA 1FKRA 4J4NA 1D6OA 1N1AA 2OFNA 2XP8A 4GGQA 3TCZA 2LGOA 1HXVA 3CGMA 3O5FA 1U79A 2KE0A 5HWCA 2XP3A 4DRPA 1KT1A 1FKJA 2KI3A 4LAXA 3UI6A 4DZ3A 4DH0A 3UQBA 2ZR5A 4TNSA 1NSGA 3KAGA 3KABA 5HW6A 3NI6A 1FD9A 1FKKA 1ZCNA 2M1IA 4DIPA 2PV2A 2ZR6A 4LAYA 3WH0A 2F2DA 3I6CA 4DROA 3LUOA 5I98A 1Q6UA 3KZ7A 4ODRA 1FKHA 1J4HA 3O5MA 3O5LA 1NMWA 2AWGA 2LPVA 4DZ2A 5DITA 3UQAA 1FKBA 2RSEA 5HW7A 1FAPA 4MGVA 1F8AB 3VAWA 3OOBA 1FKLA 1J6YA 2KFWA 3IKGA 4JFIA 2K8IA 4O2TA 4TW8A 4IQCA 2VN1A 3UI5A 2RUCA 3H9RB 2MF9A 5HT1A 1QZ2A 4C02B 2MLYA 2KO7A 1EYMA 2KGJA 3GPKA 4MSPA 4DRKA 4FAPA 3RGCA 2PPPA 4W9QA 1ZK6A 1BL4A 3KCEA 2XP4A 4TYOA 2ZR4A 4G50A 1NMVA 1J4IA 2ZQUA 3ODKA 4DRJA 5HW8A 3PA7A 3RFWA 2MNTA 4N19A 2XP6A 4DRQA 2UZ5A 2JZVA 2F4EA 2ZQTA 3FAPA 4ODQA 2Q5AA 1EQ3A 1P5QA 3CGNA 1PBKA 2N87A 2XP5A 3KACA 3UQIA 3UF8A 4W9OA 5B8IC 2ITKA 3O5KA 3NTPA 4U84A 4JFJA 1C9HA 2L2SA 4TX0A 1FKFA 3JYMA 2MLZA 3O5RA 1JNSA 2FAPA 4ODOA 4ODNA 1QPLA 4DRHA 4IPXA 4ODMA 2M2AA 4ODLA 1R9HA 1D7IA 1ROUA 2DG3A 4IQ2A 3IKDA 1Q6IA 4LAWA 1FKIA 3IHZA 4QIBA 4QT3A 3O5OA 2M08A 2KR7A 4JFMA 1D7HA 4R0XA 1FKSA 2PV3A 5GPGA 1W26A 1FKDA 3O5EA 1A7XA 2PBCA 5HWBA 3KAHA 2PPOA 1YW5A 1JNTA 1TCOC 4QT2A 1Y0OA 2MLXA 2XPBA 2RQSA 3JXVA 3O5QA 2D9FA 4JFLA 4W9PA 1FKGA 4J4OA
chains in the Genus database with same CATH superfamily
1HKIA 2EULA 1JCHB 5HUAA 1J4RA 3EY6A 3KADA 1NWTA 3AS0A 3AS3A 4TW6A 4G2PA 5BXJA 2MPHA 2XP7A 1ROTA 5DIVA 2DG9A 1LL7A 1FKTA 5D75A 4U86A 3CZ8A 4JYSA 1BKFA 3TC5A 3KAFA 4U85A 1FKRA 1HJVA 1ZBWA 3TCZA 3O5FA 3WD4A 4LAXA 1FKJA 4TNSA 3NI6A 4WJXA 3BXWA 4MPKA 4LGXA 1W1PA 4DWSD 1FFQA 2A3EA 1Q6UA 2DT2A 4AY1A 1J4HA 3O5MA 2AWGA 2LPVA 4DZ2A 1H0GA 1GPFA 1LG2A 1ZBCA 1FKBA 2B31A 3UQAA 2RSEA 4DWSA 1F8AB 4WK9A 1LL4A 3VAWA 3OOBA 2VN1A 2MF9A 4MNMA 2KGJA 4W9QA 3ARRA 3KCEA 2XP4A 4WKAA 4WKFA 2QF8A 4N19A 4DRQA 2JZVA 2F4EA 2ZQTA 4P8XA 2DSVA 2Q5AA 1GRJA 3CGNA 1PBKA 2XP5A 3KACA 3NTPA 4IT4A 1E6ZA 4TX0A 3WL1A 3JYMA 1JNSA 2DT0A 5DF0A 2FAPA 4DRHA 2M2AA 1R9HA 1ROUA 4IQ2A 1KFWA 1FKIA 4P8VA 3IHZA 4Z2IA 3B8SA 4QT3A 2KR7A 1IX5A 3O5EA 2PBCA 3GU0A 2PPOA 2YBUA 4QT2A 1NWRA 3ARTA 1E6NA 4JFLA 4KR0B 3FY1A 4W9PA 1FKGA 4J4OA 4Z2LA 2FKEA 4NNRA 1EDQA 1WB0A 2LKNA 1M5YA 3O5IA 2WLYA 3PRDA 2ZQVA 2Y78A 1FJDA 1XRVA 3O5JA 4HBEA 1W1TA 1YATA 3MDYB 1CTNA 4ITZA 1Q1CA 3BMBA 5J6EA 4ODKA 2B5UB 1QPFA 5HTGA 3O5PA 2G41A 4DRMA 2XP9A 1H0IA 1F40A 4JFKA 4MNJA 1KT0A 1ZBVA 4DRIA 4GIVA 2O9OA 4DRNA 1NWSA 1TFVA 1D6OA 4MNKA 2OFNA 2XP8A 4GGQA 3ARQA 3PRAA 4S3JA 2XP3A 4DRPA 4ZS6A 3ARSA 1WNOA 1E15A 4L3NA 5HW6A 1JNEA 3B9AA 1FD9A 1ZCNA 2M1IA 3ARYA 2PV2A 4MAVA 2F2DA 3ARXA 5I98A 2DT1A 5DITA 3AS1A 1FFRA 2ETNA 1J6YA 4JFIA 3UI5A 5HT1A 5GPRA 2MLYA 4MSPA 4DRKA 1BL4A 2PI6A 3WD0A 4TYOA 2PN0A 2ZR4A 5DO2A 1NMVA 5HWBA 4DRJA 3PA7A 3RFWA 3CHDA 1RD6A 4UDMA 3ALFA 1EQ3A 2N87A 4WKHA 3UF8A 4W9OA 2AOSA 4U84A 1C9HA 3WD1A 4DWSB 4R5EA 2MLZA 4Z2HA 4QZVB 3CH9A 4MNLA 3WIJA 4PTMA 2DG3A 1Q6IA 3RMEA 2M08A 3WD3A 3QOKA 1W26A 1A7XA 1YW5A 1ZB5A 2XPBA 3CHEA 3O5GA 4TW7A 5JH8A 4KQZA 2F21A 3G6MA 3CHFA 2IF4A 2RURA 4HARA 2FDMA 4Z2KA 4ODPA 2PV1A 4XAKA 4LAVA 1WAWA 3O5DA 4BF8A 3AQUA 5DIUA 2DG4A 1PINA 1E9LA 1D2KA 2PPNA 1W9PA 2RUDA 1ZL1A 1JVWA 2OLHA 3ARPA 3JYJA 1HKMA 4FN2A 1OGGA 4Z2GA 1Q6HA 2XPAA 3WD2A 2DPEA 2RUQA 4J4NA 1NH6A 1XHGA 1SR0A 1E6RA 1HXVA 3CGMA 1U79A 2KE0A 1SYTA 2KI3A 1ZBKA 4DZ3A 4DH0A 2A3BA 3WL0A 1NSGA 1ZU8A 1FKKA 1LJYA 3WH0A 4LAYA 4Q7NA 4DWSC 1W1YA 4ODRA 1E44A 1W9UA 1K9TA 2DT3A 2WK2A 1EHNA 3WQVA 1FAPA 1HKKA 3G6LA 1FKLA 4O2TA 3IKGA 2K8IA 4TW8A 4L72B 4IQCA 2RUCA 1EYMA 3EIPA 3RGCA 2MNTA 3ARVA 2UZ5A 3W4RA 4URIA 2G8ZA 1P5QA 3PR9A 4ZPVR 2ITKA 3WQWA 2L2SA 3CHCA 2ESCA 4NSBA 1LL6A 4ODOA 1O6IA 4ODNA 1QPLA 3ALGA 3ARUA 1OGBA 4ML4A 4MTVA 4ODLA 1NWUA 1W9VA 5GQBA 3O5OA 4JFMA 1D7HA 4HBOA 4S3KA 1FKDA 4NZCA 4W5UA 1JNTA 1JNDA 1TCOC 3WKZA 2F23A 2WLZA 3JXVA 3O5QA 2D9FA 4ZPWR 1UR9A 3B9DA 1UR8A 3ARZA 2IUZA 4Z2JA 3NRKA 3IK8A 4IT6A 4DT4A 5HKGA 1LQ0A 2VCDA 1HKJA 3KAIA 1EIBA 1T11A 3B7XA 1B6CA 3ARWA 3RM8A 1E6PA 3TDBA 1D7JA 1HJWA 2LJ4A 2ZQSA 3PRBA 5DEZA 3UI4A 3RM4A 1X6LA 1L1PA 3RM9A 4P8UA 1N1AA 1LG1A 2LGOA 5HWCA 4Q22A 1KT1A 3UQBA 3UI6A 3AROA 2ZR5A 1W1VA 3KAGA 4ZPTR 3KABA 2A3CA 2DSZA 4DIPA 2A3AA 3B9EA 4P8WA 1X6NA 2ZR6A 2WM0A 1GUVA 3I6CA 4DROA 3LUOA 3KZ7A 1FKHA 3O5LA 5HBFA 1NMWA 5HW7A 4MGVA 1GOIA 2P4VA 3FXYA 1VF8A 2KFWA 3H9RB 1QZ2A 4C02B 2KO7A 3GPKA 4FAPA 2O92A 2PPPA 1ZK6A 4WIWA 4G50A 1J4IA 2ZQUA 3ODKA 5HW8A 2XP6A 1HJXA 3FAPA 4ODQA 3UQIA 2DSWA 5B8IC 3O5KA 4JFJA 1FKFA 3O5RA 3OA5A 2YBTA 4IPXA 1OWQA 4ODMA 1ITXA 1D7IA 2DSUA 4LAWA 3IKDA 4QIBA 4R0XA 1FKSA 3AS2A 2PV3A 5GPGA 3GTYX 3KAHA 1Y0OA 2MLXA 2RQSA
chains in the Genus database with same CATH topology
1HKIA 5HUAA 1J4RA 3EY6A 3KADA 1NWTA 3AS0A 3AS3A 4TW6A 4G2PA 5BXJA 2MPHA 2XP7A 1ROTA 5DIVA 2DG9A 1LL7A 1FKTA 5D75A 4U86A 3CZ8A 4JYSA 1BKFA 3TC5A 3KAFA 4U85A 1FKRA 1HJVA 1ZBWA 3TCZA 3O5FA 3WD4A 4LAXA 1FKJA 4TNSA 3NI6A 4WJXA 3BXWA 4MPKA 4LGXA 1W1PA 4DWSD 1FFQA 2A3EA 1Q6UA 2DT2A 4AY1A 1J4HA 3O5MA 2AWGA 2LPVA 4DZ2A 1H0GA 1GPFA 1LG2A 1ZBCA 1FKBA 2B31A 3UQAA 2RSEA 4DWSA 1F8AB 4WK9A 1LL4A 3VAWA 3OOBA 2VN1A 2MF9A 4MNMA 2KGJA 4W9QA 3ARRA 3KCEA 2XP4A 4WKAA 4WKFA 2QF8A 4N19A 4DRQA 2JZVA 2F4EA 2ZQTA 4P8XA 2DSVA 2Q5AA 3CGNA 1PBKA 2XP5A 3KACA 3NTPA 4IT4A 1E6ZA 4TX0A 3WL1A 3JYMA 1JNSA 2DT0A 5DF0A 2FAPA 4DRHA 2M2AA 1R9HA 1ROUA 4IQ2A 1KFWA 1FKIA 4P8VA 3IHZA 4Z2IA 3B8SA 4QT3A 2KR7A 1IX5A 3O5EA 2PBCA 2PPOA 2YBUA 4QT2A 1NWRA 3ARTA 1E6NA 4JFLA 4KR0B 3FY1A 4W9PA 1FKGA 4J4OA 4Z2LA 2FKEA 4NNRA 1EDQA 1WB0A 2LKNA 1M5YA 3O5IA 2WLYA 3PRDA 2ZQVA 2Y78A 1FJDA 1XRVA 3O5JA 4HBEA 1W1TA 1YATA 3MDYB 1CTNA 4ITZA 1Q1CA 5J6EA 4ODKA 1QPFA 5HTGA 3O5PA 2G41A 4DRMA 2XP9A 1H0IA 1F40A 4JFKA 4MNJA 1KT0A 1ZBVA 4DRIA 4GIVA 2O9OA 4DRNA 1NWSA 1TFVA 1D6OA 4MNKA 2OFNA 2XP8A 4GGQA 3ARQA 3PRAA 4S3JA 2XP3A 4DRPA 4ZS6A 3ARSA 1WNOA 1E15A 4L3NA 5HW6A 1JNEA 3B9AA 1FD9A 1ZCNA 2M1IA 3ARYA 2PV2A 4MAVA 2F2DA 3ARXA 5I98A 2DT1A 5DITA 3AS1A 1FFRA 1J6YA 4JFIA 3UI5A 5HT1A 5GPRA 2MLYA 4MSPA 4DRKA 1BL4A 2PI6A 3WD0A 4TYOA 2ZR4A 5DO2A 1NMVA 5HWBA 4DRJA 3PA7A 3RFWA 3CHDA 1RD6A 3ALFA 1EQ3A 2N87A 4WKHA 3UF8A 4W9OA 2AOSA 4U84A 1C9HA 3WD1A 4DWSB 4R5EA 2MLZA 4Z2HA 4QZVB 3CH9A 4MNLA 3WIJA 4PTMA 2DG3A 1Q6IA 3RMEA 2M08A 3WD3A 3QOKA 1W26A 1A7XA 1YW5A 1ZB5A 2XPBA 3CHEA 3O5GA 4TW7A 5JH8A 4KQZA 2F21A 3G6MA 3CHFA 2IF4A 2RURA 4HARA 2FDMA 4Z2KA 4ODPA 2PV1A 4XAKA 4LAVA 1WAWA 3O5DA 4BF8A 3AQUA 5DIUA 2DG4A 1PINA 1E9LA 1D2KA 2PPNA 1W9PA 2RUDA 1ZL1A 1JVWA 2OLHA 3ARPA 3JYJA 1HKMA 4FN2A 1OGGA 4Z2GA 1Q6HA 2XPAA 3WD2A 2DPEA 2RUQA 4J4NA 1NH6A 1XHGA 1SR0A 1E6RA 1HXVA 3CGMA 1U79A 2KE0A 1SYTA 2KI3A 1ZBKA 4DZ3A 4DH0A 2A3BA 3WL0A 1NSGA 1ZU8A 1FKKA 1LJYA 3WH0A 4LAYA 4Q7NA 4DWSC 1W1YA 4ODRA 1W9UA 1K9TA 2DT3A 2WK2A 1EHNA 3WQVA 1FAPA 1HKKA 3G6LA 1FKLA 4O2TA 3IKGA 2K8IA 4TW8A 4L72B 4IQCA 2RUCA 1EYMA 3RGCA 2MNTA 3ARVA 2UZ5A 3W4RA 4URIA 2G8ZA 1P5QA 3PR9A 4ZPVR 2ITKA 3WQWA 2L2SA 3CHCA 2ESCA 4NSBA 1LL6A 4ODOA 1O6IA 4ODNA 1QPLA 3ALGA 3ARUA 1OGBA 4ML4A 4MTVA 4ODLA 1NWUA 1W9VA 5GQBA 3O5OA 4JFMA 1D7HA 4HBOA 4S3KA 1FKDA 4NZCA 4W5UA 1JNTA 1JNDA 1TCOC 3WKZA 2WLZA 3JXVA 3O5QA 2D9FA 4ZPWR 1UR9A 3B9DA 1UR8A 3ARZA 2IUZA 4Z2JA 3NRKA 3IK8A 4IT6A 4DT4A 5HKGA 1LQ0A 2VCDA 1HKJA 3KAIA 1EIBA 1T11A 3B7XA 1B6CA 3ARWA 3RM8A 1E6PA 3TDBA 1D7JA 1HJWA 2LJ4A 2ZQSA 3PRBA 5DEZA 3UI4A 3RM4A 1X6LA 1L1PA 3RM9A 4P8UA 1N1AA 1LG1A 2LGOA 5HWCA 4Q22A 1KT1A 3UQBA 3UI6A 3AROA 2ZR5A 1W1VA 3KAGA 4ZPTR 3KABA 2A3CA 2DSZA 4DIPA 2A3AA 3B9EA 4P8WA 1X6NA 2ZR6A 2WM0A 1GUVA 3I6CA 4DROA 3LUOA 3KZ7A 1FKHA 3O5LA 5HBFA 1NMWA 5HW7A 4MGVA 1GOIA 3FXYA 1VF8A 2KFWA 3H9RB 1QZ2A 4C02B 2KO7A 3GPKA 4FAPA 2O92A 2PPPA 1ZK6A 4WIWA 4G50A 1J4IA 2ZQUA 3ODKA 5HW8A 2XP6A 1HJXA 3FAPA 4ODQA 3UQIA 2DSWA 5B8IC 3O5KA 4JFJA 1FKFA 3O5RA 3OA5A 2YBTA 4IPXA 1OWQA 4ODMA 1ITXA 1D7IA 2DSUA 4LAWA 3IKDA 4QIBA 4R0XA 1FKSA 3AS2A 2PV3A 5GPGA 3KAHA 1Y0OA 2MLXA 2RQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FKE A;  3O5G A;  4NNR A;  4TW7 A;  3NRK A;  3IK8 A;  4DT4 A;  5HKG A;  2VCD A;  2F21 A;  2LKN A;  5HUA A;  1J4R A;  3KAI A;  2IF4 A;  3EY6 A;  1M5Y A;  1T11 A;  2RUR A;  3B7X A;  3KAD A;  1B6C A;  3O5I A;  3PRD A;  2ZQV A;  2Y78 A;  1FJD A;  3O5J A;  4ODP A;  2PV1 A;  3TDB A;  1YAT A;  3MDY B;  4LAV A;  4TW6 A;  1D7J A;  2LJ4 A;  3O5D A;  4G2P A;  4ITZ A;  4BF8 A;  1Q1C A;  2ZQS A;  3PRB A;  4ODK A;  5BXJ A;  5J6E A;  1QPF A;  5DIU A;  2DG4 A;  2MPH A;  1PIN A;  3UI4 A;  2XP7 A;  3O5P A;  5HTG A;  4DRM A;  1ROT A;  2PPN A;  5DIV A;  2DG9 A;  2XP9 A;  1F40 A;  4JFK A;  1L1P A;  1FKT A;  2RUD A;  5D75 A;  1KT0 A;  4U86 A;  1JVW A;  4FN2 A;  4JYS A;  3JYJ A;  1BKF A;  3TC5 A;  1Q6H A;  2XPA A;  4DRI A;  4GIV A;  3KAF A;  2RUQ A;  4U85 A;  4DRN A;  1FKR A;  4J4N A;  1D6O A;  1N1A A;  2OFN A;  2XP8 A;  4GGQ A;  3TCZ A;  2LGO A;  1HXV A;  3CGM A;  3O5F A;  1U79 A;  2KE0 A;  5HWC A;  2XP3 A;  4DRP A;  1KT1 A;  1FKJ A;  2KI3 A;  4LAX A;  3UI6 A;  4DZ3 A;  4DH0 A;  3UQB A;  2ZR5 A;  4TNS A;  1NSG A;  3KAG A;  3KAB A;  5HW6 A;  3NI6 A;  1FD9 A;  1FKK A;  1ZCN A;  2M1I A;  4DIP A;  2PV2 A;  2ZR6 A;  4LAY A;  3WH0 A;  2F2D A;  3I6C A;  4DRO A;  3LUO A;  5I98 A;  1Q6U A;  3KZ7 A;  4ODR A;  1FKH A;  1J4H A;  3O5M A;  3O5L A;  1NMW A;  2AWG A;  2LPV A;  4DZ2 A;  5DIT A;  3UQA A;  1FKB A;  2RSE A;  5HW7 A;  1FAP A;  4MGV A;  1F8A B;  3VAW A;  3OOB A;  1FKL A;  1J6Y A;  2KFW A;  3IKG A;  4JFI A;  2K8I A;  4O2T A;  4TW8 A;  4IQC A;  2VN1 A;  3UI5 A;  2RUC A;  3H9R B;  2MF9 A;  5HT1 A;  1QZ2 A;  4C02 B;  2MLY A;  2KO7 A;  1EYM A;  2KGJ A;  3GPK A;  4MSP A;  4DRK A;  4FAP A;  3RGC A;  2PPP A;  4W9Q A;  1ZK6 A;  1BL4 A;  3KCE A;  2XP4 A;  4TYO A;  2ZR4 A;  4G50 A;  1NMV A;  1J4I A;  2ZQU A;  3ODK A;  4DRJ A;  5HW8 A;  3PA7 A;  3RFW A;  2MNT A;  4N19 A;  2XP6 A;  4DRQ A;  2UZ5 A;  2JZV A;  2F4E A;  2ZQT A;  3FAP A;  4ODQ A;  2Q5A A;  1EQ3 A;  1P5Q A;  3CGN A;  1PBK A;  2N87 A;  2XP5 A;  3KAC A;  3UQI A;  3UF8 A;  4W9O A;  5B8I C;  2ITK A;  3O5K A;  3NTP A;  4U84 A;  4JFJ A;  1C9H A;  2L2S A;  4TX0 A;  1FKF A;  3JYM A;  2MLZ A;  3O5R A;  1JNS A;  2FAP A;  4ODO A;  4ODN A;  1QPL A;  4DRH A;  4IPX A;  4ODM A;  2M2A A;  4ODL A;  1R9H A;  1D7I A;  1ROU A;  2DG3 A;  4IQ2 A;  3IKD A;  1Q6I A;  4LAW A;  1FKI A;  3IHZ A;  4QIB A;  4QT3 A;  3O5O A;  2M08 A;  2KR7 A;  4JFM A;  1D7H A;  4R0X A;  1FKS A;  2PV3 A;  5GPG A;  1W26 A;  1FKD A;  3O5E A;  1A7X A;  2PBC A;  5HWB A;  3KAH A;  2PPO A;  1YW5 A;  1JNT A;  1TCO C;  4QT2 A;  1Y0O A;  2MLX A;  2XPB A;  2RQS A;  3JXV A;  3O5Q A;  2D9F A;  4JFL A;  4W9P A;  1FKG A;  4J4O A; 
#chains in the Genus database with same CATH topology
 1HKI A;  2EUL A;  1JCH B;  5HUA A;  1J4R A;  3EY6 A;  3KAD A;  1NWT A;  3AS0 A;  3AS3 A;  4TW6 A;  4G2P A;  5BXJ A;  2MPH A;  2XP7 A;  1ROT A;  5DIV A;  2DG9 A;  1LL7 A;  1FKT A;  5D75 A;  4U86 A;  3CZ8 A;  4JYS A;  1BKF A;  3TC5 A;  3KAF A;  4U85 A;  1FKR A;  1HJV A;  1ZBW A;  3TCZ A;  3O5F A;  3WD4 A;  4LAX A;  1FKJ A;  4TNS A;  3NI6 A;  4WJX A;  3BXW A;  4MPK A;  4LGX A;  1W1P A;  4DWS D;  1FFQ A;  2A3E A;  1Q6U A;  2DT2 A;  4AY1 A;  1J4H A;  3O5M A;  2AWG A;  2LPV A;  4DZ2 A;  1H0G A;  1GPF A;  1LG2 A;  1ZBC A;  1FKB A;  2B31 A;  3UQA A;  2RSE A;  4DWS A;  1F8A B;  4WK9 A;  1LL4 A;  3VAW A;  3OOB A;  2VN1 A;  2MF9 A;  4MNM A;  2KGJ A;  4W9Q A;  3ARR A;  3KCE A;  2XP4 A;  4WKA A;  4WKF A;  2QF8 A;  4N19 A;  4DRQ A;  2JZV A;  2F4E A;  2ZQT A;  4P8X A;  2DSV A;  2Q5A A;  1GRJ A;  3CGN A;  1PBK A;  2XP5 A;  3KAC A;  3NTP A;  4IT4 A;  1E6Z A;  4TX0 A;  3WL1 A;  3JYM A;  1JNS A;  2DT0 A;  5DF0 A;  2FAP A;  4DRH A;  2M2A A;  1R9H A;  1ROU A;  4IQ2 A;  1KFW A;  1FKI A;  4P8V A;  3IHZ A;  4Z2I A;  3B8S A;  4QT3 A;  2KR7 A;  1IX5 A;  3O5E A;  2PBC A;  3GU0 A;  2PPO A;  2YBU A;  4QT2 A;  1NWR A;  3ART A;  1E6N A;  4JFL A;  4KR0 B;  3FY1 A;  4W9P A;  1FKG A;  4J4O A;  4Z2L A;  2FKE A;  4NNR A;  1EDQ A;  1WB0 A;  2LKN A;  1M5Y A;  3O5I A;  2WLY A;  3PRD A;  2ZQV A;  2Y78 A;  1FJD A;  1XRV A;  3O5J A;  4HBE A;  1W1T A;  1YAT A;  3MDY B;  1CTN A;  4ITZ A;  1Q1C A;  3BMB A;  5J6E A;  4ODK A;  2B5U B;  1QPF A;  5HTG A;  3O5P A;  2G41 A;  4DRM A;  2XP9 A;  1H0I A;  1F40 A;  4JFK A;  4MNJ A;  1KT0 A;  1ZBV A;  4DRI A;  4GIV A;  2O9O A;  4DRN A;  1NWS A;  1TFV A;  1D6O A;  4MNK A;  2OFN A;  2XP8 A;  4GGQ A;  3ARQ A;  3PRA A;  4S3J A;  2XP3 A;  4DRP A;  4ZS6 A;  3ARS A;  1WNO A;  1E15 A;  4L3N A;  5HW6 A;  1JNE A;  3B9A A;  1FD9 A;  1ZCN A;  2M1I A;  3ARY A;  2PV2 A;  4MAV A;  2F2D A;  3ARX A;  5I98 A;  2DT1 A;  5DIT A;  3AS1 A;  1FFR A;  2ETN A;  1J6Y A;  4JFI A;  3UI5 A;  5HT1 A;  5GPR A;  2MLY A;  4MSP A;  4DRK A;  1BL4 A;  2PI6 A;  3WD0 A;  4TYO A;  2PN0 A;  2ZR4 A;  5DO2 A;  1NMV A;  5HWB A;  4DRJ A;  3PA7 A;  3RFW A;  3CHD A;  1RD6 A;  4UDM A;  3ALF A;  1EQ3 A;  2N87 A;  4WKH A;  3UF8 A;  4W9O A;  2AOS A;  4U84 A;  1C9H A;  3WD1 A;  4DWS B;  4R5E A;  2MLZ A;  4Z2H A;  4QZV B;  3CH9 A;  4MNL A;  3WIJ A;  4PTM A;  2DG3 A;  1Q6I A;  3RME A;  2M08 A;  3WD3 A;  3QOK A;  1W26 A;  1A7X A;  1YW5 A;  1ZB5 A;  2XPB A;  3CHE A;  3O5G A;  4TW7 A;  5JH8 A;  4KQZ A;  2F21 A;  3G6M A;  3CHF A;  2IF4 A;  2RUR A;  4HAR A;  2FDM A;  4Z2K A;  4ODP A;  2PV1 A;  4XAK A;  4LAV A;  1WAW A;  3O5D A;  4BF8 A;  3AQU A;  5DIU A;  2DG4 A;  1PIN A;  1E9L A;  1D2K A;  2PPN A;  1W9P A;  2RUD A;  1ZL1 A;  1JVW A;  2OLH A;  3ARP A;  3JYJ A;  1HKM A;  4FN2 A;  1OGG A;  4Z2G A;  1Q6H A;  2XPA A;  3WD2 A;  2DPE A;  2RUQ A;  4J4N A;  1NH6 A;  1XHG A;  1SR0 A;  1E6R A;  1HXV A;  3CGM A;  1U79 A;  2KE0 A;  1SYT A;  2KI3 A;  1ZBK A;  4DZ3 A;  4DH0 A;  2A3B A;  3WL0 A;  1NSG A;  1ZU8 A;  1FKK A;  1LJY A;  3WH0 A;  4LAY A;  4Q7N A;  4DWS C;  1W1Y A;  4ODR A;  1E44 A;  1W9U A;  1K9T A;  2DT3 A;  2WK2 A;  1EHN A;  3WQV A;  1FAP A;  1HKK A;  3G6L A;  1FKL A;  4O2T A;  3IKG A;  2K8I A;  4TW8 A;  4L72 B;  4IQC A;  2RUC A;  1EYM A;  3EIP A;  3RGC A;  2MNT A;  3ARV A;  2UZ5 A;  3W4R A;  4URI A;  2G8Z A;  1P5Q A;  3PR9 A;  4ZPV R;  2ITK A;  3WQW A;  2L2S A;  3CHC A;  2ESC A;  4NSB A;  1LL6 A;  4ODO A;  1O6I A;  4ODN A;  1QPL A;  3ALG A;  3ARU A;  1OGB A;  4ML4 A;  4MTV A;  4ODL A;  1NWU A;  1W9V A;  5GQB A;  3O5O A;  4JFM A;  1D7H A;  4HBO A;  4S3K A;  1FKD A;  4NZC A;  4W5U A;  1JNT A;  1JND A;  1TCO C;  3WKZ A;  2F23 A;  2WLZ A;  3JXV A;  3O5Q A;  2D9F A;  4ZPW R;  1UR9 A;  3B9D A;  1UR8 A;  3ARZ A;  2IUZ A;  4Z2J A;  3NRK A;  3IK8 A;  4IT6 A;  4DT4 A;  5HKG A;  1LQ0 A;  2VCD A;  1HKJ A;  3KAI A;  1EIB A;  1T11 A;  3B7X A;  1B6C A;  3ARW A;  3RM8 A;  1E6P A;  3TDB A;  1D7J A;  1HJW A;  2LJ4 A;  2ZQS A;  3PRB A;  5DEZ A;  3UI4 A;  3RM4 A;  1X6L A;  1L1P A;  3RM9 A;  4P8U A;  1N1A A;  1LG1 A;  2LGO A;  5HWC A;  4Q22 A;  1KT1 A;  3UQB A;  3UI6 A;  3ARO A;  2ZR5 A;  1W1V A;  3KAG A;  4ZPT R;  3KAB A;  2A3C A;  2DSZ A;  4DIP A;  2A3A A;  3B9E A;  4P8W A;  1X6N A;  2ZR6 A;  2WM0 A;  1GUV A;  3I6C A;  4DRO A;  3LUO A;  3KZ7 A;  1FKH A;  3O5L A;  5HBF A;  1NMW A;  5HW7 A;  4MGV A;  1GOI A;  2P4V A;  3FXY A;  1VF8 A;  2KFW A;  3H9R B;  1QZ2 A;  4C02 B;  2KO7 A;  3GPK A;  4FAP A;  2O92 A;  2PPP A;  1ZK6 A;  4WIW A;  4G50 A;  1J4I A;  2ZQU A;  3ODK A;  5HW8 A;  2XP6 A;  1HJX A;  3FAP A;  4ODQ A;  3UQI A;  2DSW A;  5B8I C;  3O5K A;  4JFJ A;  1FKF A;  3O5R A;  3OA5 A;  2YBT A;  4IPX A;  1OWQ A;  4ODM A;  1ITX A;  1D7I A;  2DSU A;  4LAW A;  3IKD A;  4QIB A;  4R0X A;  1FKS A;  3AS2 A;  2PV3 A;  5GPG A;  3GTY X;  3KAH A;  1Y0O A;  2MLX A;  2RQS A; 
#chains in the Genus database with same CATH homology
 1HKI A;  5HUA A;  1J4R A;  3EY6 A;  3KAD A;  1NWT A;  3AS0 A;  3AS3 A;  4TW6 A;  4G2P A;  5BXJ A;  2MPH A;  2XP7 A;  1ROT A;  5DIV A;  2DG9 A;  1LL7 A;  1FKT A;  5D75 A;  4U86 A;  3CZ8 A;  4JYS A;  1BKF A;  3TC5 A;  3KAF A;  4U85 A;  1FKR A;  1HJV A;  1ZBW A;  3TCZ A;  3O5F A;  3WD4 A;  4LAX A;  1FKJ A;  4TNS A;  3NI6 A;  4WJX A;  3BXW A;  4MPK A;  4LGX A;  1W1P A;  4DWS D;  1FFQ A;  2A3E A;  1Q6U A;  2DT2 A;  4AY1 A;  1J4H A;  3O5M A;  2AWG A;  2LPV A;  4DZ2 A;  1H0G A;  1GPF A;  1LG2 A;  1ZBC A;  1FKB A;  2B31 A;  3UQA A;  2RSE A;  4DWS A;  1F8A B;  4WK9 A;  1LL4 A;  3VAW A;  3OOB A;  2VN1 A;  2MF9 A;  4MNM A;  2KGJ A;  4W9Q A;  3ARR A;  3KCE A;  2XP4 A;  4WKA A;  4WKF A;  2QF8 A;  4N19 A;  4DRQ A;  2JZV A;  2F4E A;  2ZQT A;  4P8X A;  2DSV A;  2Q5A A;  3CGN A;  1PBK A;  2XP5 A;  3KAC A;  3NTP A;  4IT4 A;  1E6Z A;  4TX0 A;  3WL1 A;  3JYM A;  1JNS A;  2DT0 A;  5DF0 A;  2FAP A;  4DRH A;  2M2A A;  1R9H A;  1ROU A;  4IQ2 A;  1KFW A;  1FKI A;  4P8V A;  3IHZ A;  4Z2I A;  3B8S A;  4QT3 A;  2KR7 A;  1IX5 A;  3O5E A;  2PBC A;  2PPO A;  2YBU A;  4QT2 A;  1NWR A;  3ART A;  1E6N A;  4JFL A;  4KR0 B;  3FY1 A;  4W9P A;  1FKG A;  4J4O A;  4Z2L A;  2FKE A;  4NNR A;  1EDQ A;  1WB0 A;  2LKN A;  1M5Y A;  3O5I A;  2WLY A;  3PRD A;  2ZQV A;  2Y78 A;  1FJD A;  1XRV A;  3O5J A;  4HBE A;  1W1T A;  1YAT A;  3MDY B;  1CTN A;  4ITZ A;  1Q1C A;  5J6E A;  4ODK A;  1QPF A;  5HTG A;  3O5P A;  2G41 A;  4DRM A;  2XP9 A;  1H0I A;  1F40 A;  4JFK A;  4MNJ A;  1KT0 A;  1ZBV A;  4DRI A;  4GIV A;  2O9O A;  4DRN A;  1NWS A;  1TFV A;  1D6O A;  4MNK A;  2OFN A;  2XP8 A;  4GGQ A;  3ARQ A;  3PRA A;  4S3J A;  2XP3 A;  4DRP A;  4ZS6 A;  3ARS A;  1WNO A;  1E15 A;  4L3N A;  5HW6 A;  1JNE A;  3B9A A;  1FD9 A;  1ZCN A;  2M1I A;  3ARY A;  2PV2 A;  4MAV A;  2F2D A;  3ARX A;  5I98 A;  2DT1 A;  5DIT A;  3AS1 A;  1FFR A;  1J6Y A;  4JFI A;  3UI5 A;  5HT1 A;  5GPR A;  2MLY A;  4MSP A;  4DRK A;  1BL4 A;  2PI6 A;  3WD0 A;  4TYO A;  2ZR4 A;  5DO2 A;  1NMV A;  5HWB A;  4DRJ A;  3PA7 A;  3RFW A;  3CHD A;  1RD6 A;  3ALF A;  1EQ3 A;  2N87 A;  4WKH A;  3UF8 A;  4W9O A;  2AOS A;  4U84 A;  1C9H A;  3WD1 A;  4DWS B;  4R5E A;  2MLZ A;  4Z2H A;  4QZV B;  3CH9 A;  4MNL A;  3WIJ A;  4PTM A;  2DG3 A;  1Q6I A;  3RME A;  2M08 A;  3WD3 A;  3QOK A;  1W26 A;  1A7X A;  1YW5 A;  1ZB5 A;  2XPB A;  3CHE A;  3O5G A;  4TW7 A;  5JH8 A;  4KQZ A;  2F21 A;  3G6M A;  3CHF A;  2IF4 A;  2RUR A;  4HAR A;  2FDM A;  4Z2K A;  4ODP A;  2PV1 A;  4XAK A;  4LAV A;  1WAW A;  3O5D A;  4BF8 A;  3AQU A;  5DIU A;  2DG4 A;  1PIN A;  1E9L A;  1D2K A;  2PPN A;  1W9P A;  2RUD A;  1ZL1 A;  1JVW A;  2OLH A;  3ARP A;  3JYJ A;  1HKM A;  4FN2 A;  1OGG A;  4Z2G A;  1Q6H A;  2XPA A;  3WD2 A;  2DPE A;  2RUQ A;  4J4N A;  1NH6 A;  1XHG A;  1SR0 A;  1E6R A;  1HXV A;  3CGM A;  1U79 A;  2KE0 A;  1SYT A;  2KI3 A;  1ZBK A;  4DZ3 A;  4DH0 A;  2A3B A;  3WL0 A;  1NSG A;  1ZU8 A;  1FKK A;  1LJY A;  3WH0 A;  4LAY A;  4Q7N A;  4DWS C;  1W1Y A;  4ODR A;  1W9U A;  1K9T A;  2DT3 A;  2WK2 A;  1EHN A;  3WQV A;  1FAP A;  1HKK A;  3G6L A;  1FKL A;  4O2T A;  3IKG A;  2K8I A;  4TW8 A;  4L72 B;  4IQC A;  2RUC A;  1EYM A;  3RGC A;  2MNT A;  3ARV A;  2UZ5 A;  3W4R A;  4URI A;  2G8Z A;  1P5Q A;  3PR9 A;  4ZPV R;  2ITK A;  3WQW A;  2L2S A;  3CHC A;  2ESC A;  4NSB A;  1LL6 A;  4ODO A;  1O6I A;  4ODN A;  1QPL A;  3ALG A;  3ARU A;  1OGB A;  4ML4 A;  4MTV A;  4ODL A;  1NWU A;  1W9V A;  5GQB A;  3O5O A;  4JFM A;  1D7H A;  4HBO A;  4S3K A;  1FKD A;  4NZC A;  4W5U A;  1JNT A;  1JND A;  1TCO C;  3WKZ A;  2WLZ A;  3JXV A;  3O5Q A;  2D9F A;  4ZPW R;  1UR9 A;  3B9D A;  1UR8 A;  3ARZ A;  2IUZ A;  4Z2J A;  3NRK A;  3IK8 A;  4IT6 A;  4DT4 A;  5HKG A;  1LQ0 A;  2VCD A;  1HKJ A;  3KAI A;  1EIB A;  1T11 A;  3B7X A;  1B6C A;  3ARW A;  3RM8 A;  1E6P A;  3TDB A;  1D7J A;  1HJW A;  2LJ4 A;  2ZQS A;  3PRB A;  5DEZ A;  3UI4 A;  3RM4 A;  1X6L A;  1L1P A;  3RM9 A;  4P8U A;  1N1A A;  1LG1 A;  2LGO A;  5HWC A;  4Q22 A;  1KT1 A;  3UQB A;  3UI6 A;  3ARO A;  2ZR5 A;  1W1V A;  3KAG A;  4ZPT R;  3KAB A;  2A3C A;  2DSZ A;  4DIP A;  2A3A A;  3B9E A;  4P8W A;  1X6N A;  2ZR6 A;  2WM0 A;  1GUV A;  3I6C A;  4DRO A;  3LUO A;  3KZ7 A;  1FKH A;  3O5L A;  5HBF A;  1NMW A;  5HW7 A;  4MGV A;  1GOI A;  3FXY A;  1VF8 A;  2KFW A;  3H9R B;  1QZ2 A;  4C02 B;  2KO7 A;  3GPK A;  4FAP A;  2O92 A;  2PPP A;  1ZK6 A;  4WIW A;  4G50 A;  1J4I A;  2ZQU A;  3ODK A;  5HW8 A;  2XP6 A;  1HJX A;  3FAP A;  4ODQ A;  3UQI A;  2DSW A;  5B8I C;  3O5K A;  4JFJ A;  1FKF A;  3O5R A;  3OA5 A;  2YBT A;  4IPX A;  1OWQ A;  4ODM A;  1ITX A;  1D7I A;  2DSU A;  4LAW A;  3IKD A;  4QIB A;  4R0X A;  1FKS A;  3AS2 A;  2PV3 A;  5GPG A;  3KAH A;  1Y0O A;  2MLX A;  2RQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...