1L1PA

Solution structure of the ppiase domain from e. coli trigger factor
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
106
structure length
106
Chain Sequence
b'GSHMQATWKEKDGAVEAEDRVTIDFTGSVDGEEFEGGKASDFVLAMGQGRMIPGFEDGIKGHKAGEEFTIDVTFPEEYHAENLKGKAAKFAINLKKVEERELPELT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords trigger factor
molecule tags Isomerase
source organism Escherichia coli
publication title Solution Structure of the Closed Form of a Peptidyl-Prolyl Isomerase Reveals the Mechanism of Protein Folding
rcsb
total genus 8
structure length 106
sequence length 106
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2002-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1l1pA00
4G2PA 1FKBA 3CGMA 4R0XA 2M2AA 5HKGA 1ROTA 1HXVA 3UQBA 1FKGA 2XP4A 3IK8A 1NMVA 2XPBA 1B6CA 1FKFA 3OOBA 5HW6A 3NTPA 3O5EA 3O5FA 1M5YA 2KGJA 3O5PA 4GIVA 4TW8A 1ROUA 2PV1A 1N1AA 1NSGA 2JZVA 2KR7A 4JFIA 5BXJA 3I6CA 1F8AB 3O5GA 1R9HA 3KCEA 4DRMA 5HW7A 2XP6A 2KFWA 1J6YA 2XP7A 1JNSA 2VCDA 2XP3A 4MSPA 2DG3A 3KAGA 2PPNA 2PPPA 1QZ2A 5D75A 3IHZA 4GGQA 3JXVA 3PRBA 4DRKA 3JYJA 1A7XA 1KT0A 3O5IA 1JNTA 2Q5AA 2UZ5A 1EYMA 2RUQA 2RURA 3UQIA 2N87A 1D6OA 5J6EA 1YATA 1F40A 1FD9A 3KADA 3KZ7A 4IQ2A 2DG9A 2PV2A 3KACA 3O5OA 4LAWA 2XP9A 1FKLA 4TYOA 2RSEA 4JFLA 5DIVA 4TX0A 1FKHA 1D7IA 1C9HA 3H9RB 4ODKA 4TW6A 1J4RA 2ZQUA 5HUAA 1FKTA 4TNSA 4ODQA 4W9QA 3O5LA 4DRHA 3O5RA 1FKKA 2Y78A 3GPKA 2ZQSA 4J4NA 3FAPA 1D7JA 3ODKA 5HW8A 3IKGA 4ODRA 4JYSA 4FAPA 3UI4A 2LJ4A 5DIUA 1Q1CA 3WH0A 4LAXA 5B8IC 5HWBA 2LGOA 2XP8A 4MGVA 2LPVA 2MNTA 4NNRA 4U85A 1EQ3A 1FKRA 4G50A 4IPXA 2ZR4A 1TCOC 2RQSA 5HWCA 5I98A 1BL4A 2MLZA 3TCZA 1L1PA 3CGNA 4DH0A 3KAHA 4TW7A 3EY6A 2F4EA 2FAPA 2F2DA 1NMWA 1T11A 4DROA 2DG4A 3O5QA 1Q6HA 2ZQVA 3NRKA 1ZCNA 1FKJA 1QPFA 3RFWA 3TDBA 2OFNA 3O5JA 5GPGA 4C02B 3PRDA 4ODPA 4JFKA 3PA7A 2PV3A 4O2TA 2MLXA 4DRIA 1ZK6A 2KO7A 3VAWA 3TC5A 1D7HA 3UI6A 2LKNA 1U79A 3O5DA 1Q6UA 4ODOA 3UF8A 4DZ3A 2KE0A 4DZ2A 3KAFA 5HTGA 2F21A 2M08A 2K8IA 4JFMA 1J4IA 4ODNA 4DRQA 4ODLA 4BF8A 1Y0OA 3LUOA 1PBKA 4JFJA 2PPOA 2VN1A 4QIBA 1JVWA 3O5MA 4IQCA 3MDYB 5HT1A 4DRPA 1FJDA 2ZR6A 1FKDA 1PINA 4U84A 1QPLA 1FKSA 2D9FA 4FN2A 4DIPA 4ITZA 4W9OA 2IF4A 1FAPA 2L2SA 4J4OA 4N19A 4QT2A 2AWGA 2ZQTA 4U86A 1W26A 3KAIA 4DRNA 1YW5A 4LAYA 2FKEA 5DITA 4ODMA 3O5KA 4LAVA 2MLYA 3NI6A 3KABA 4W9PA 3RGCA 2ITKA 2MPHA 2KI3A 1J4HA 2XP5A 3IKDA 4DT4A 2XPAA 2MF9A 4DRJA 2RUCA 2ZR5A 1KT1A 1Q6IA 2M1IA 3JYMA 3UQAA 2PBCA 1P5QA 2RUDA 1FKIA 3UI5A 1BKFA 3B7XA 4QT3A
chains in the Genus database with same CATH superfamily
4G2PA 1FKBA 2M2AA 5DO2A 5HKGA 1ROTA 2F23A 2PI6A 2XP4A 3PRAA 1W1TA 3RM9A 2AOSA 3O5FA 1ZU8A 1SR0A 1ROUA 1N1AA 2JZVA 1JCHB 1E6NA 3CHEA 1E44A 1W1VA 1JNSA 2PPNA 4GGQA 1EIBA 1KT0A 1LJYA 1JNTA 1NWTA 3UQIA 2N87A 3RM4A 1F40A 1FD9A 4Q7NA 2O92A 5HBFA 4TYOA 2RSEA 3QOKA 5DIVA 4TX0A 1FKHA 4ODKA 2A3EA 2ZQUA 1JNDA 2WK2A 3ARZA 3B9DA 4S3JA 4ODQA 1FFRA 3O5RA 1WNOA 2DT1A 3GPKA 3IKGA 3ARYA 3OA5A 3W4RA 2MNTA 4U85A 2DT0A 2RQSA 4DH0A 3KAHA 2F4EA 2FAPA 2PN0A 1XHGA 4DWSD 1Q6HA 2ZQVA 1NH6A 1OGBA 4WJXA 3BMBA 2OFNA 1EHNA 3O5JA 4Z2GA 3PA7A 4DRIA 4O2TA 1ZK6A 3WQWA 2LKNA 1GUVA 3UF8A 2F21A 1GOIA 4BF8A 4JFJA 2VN1A 1LG1A 3O5MA 4IQCA 1UR8A 4HBOA 1LL4A 2DSZA 2D9FA 4ITZA 4KR0B 2L2SA 3ARSA 4N19A 4WIWA 2AWGA 2ZQTA 1LL7A 1LQ0A 4ODMA 1K9TA 3KABA 2MPHA 3WQVA 1J4HA 3IKDA 1HKIA 4Z2LA 2MF9A 4DRJA 4Z2HA 1NWSA 2PBCA 1P5QA 3UI5A 4UDMA 1ZBCA 3B7XA 4R0XA 3IK8A 2XPBA 1B6CA 5HW6A 2DPEA 3NTPA 2KGJA 5JH8A 3I6CA 3ARQA 5DF0A 1R9HA 3KCEA 5HW7A 1J6YA 2KFWA 2XP7A 2OLHA 3ALFA 2PPPA 3IHZA 3JXVA 4DRKA 3JYJA 1A7XA 4DWSC 1CTNA 1W1YA 3KZ7A 4IQ2A 1VF8A 4WKFA 2PV2A 3O5OA 4HARA 2XP9A 3ARUA 4W5UA 4TW6A 1J4RA 3G6LA 1WB0A 3WD4A 2Y78A 4HBEA 4Q22A 3ODKA 2FDMA 3ARPA 1E9LA 1Q1CA 3WH0A 3AS2A 2LGOA 1ZBVA 2XP8A 3B9AA 1HJWA 1EQ3A 1TCOC 2DSWA 1BL4A 2MLZA 1L1PA 3AS3A 4QZVB 2F2DA 2WLYA 3O5QA 4R5EA 3PRDA 1EDQA 4JFKA 5GQBA 2MLXA 2KO7A 3TC5A 1D7HA 4ODOA 4DZ3A 5HTGA 4ZPVR 2M08A 2K8IA 4JFMA 1E6ZA 4Z2IA 1OGGA 1PBKA 4MTVA 1JNEA 4QIBA 2YBUA 1FJDA 4ZPWR 2ZR6A 1PINA 4DIPA 1FAPA 4U86A 1GPFA 1W26A 3ARRA 3RM8A 4DRNA 1YW5A 2FKEA 4LAVA 3NI6A 2ITKA 2IUZA 2XP5A 2B31A 2M1IA 3UQAA 3FXYA 1UR9A 2XP6A 1BKFA 4NZCA 3WL1A 2B5UB 3AQUA 4IT6A 1ZB5A 1HXVA 1W9VA 3OOBA 3O5EA 5DEZA 1M5YA 4TW8A 5BXJA 1LL6A 1KFWA 1NSGA 1NWUA 4KQZA 3FY1A 2A3CA 4DRMA 1OWQA 4P8XA 4IT4A 2XP3A 4MPKA 2DG3A 2ETNA 4ZS6A 3O5IA 3GU0A 3ARVA 1EYMA 2RURA 1ZBKA 5J6EA 1YATA 2DG9A 3KACA 4MNKA 1FKLA 4JFLA 1C9HA 1O6IA 1ZL1A 3WD3A 5HUAA 4TNSA 4NSBA 4ML4A 1FKKA 1IX5A 3ARWA 1D7JA 5HW8A 4MAVA 3AROA 4ODRA 4JYSA 3CHDA 4FAPA 2LJ4A 5HWBA 1NWRA 1X6NA 4DWSB 4MGVA 2LPVA 4WKHA 2ZR4A 5HWCA 5I98A 2O9OA 3TCZA 4PTMA 2DSVA 3CGNA 3AS1A 4TW7A 1NMWA 4DROA 3ARXA 3NRKA 3RFWA 3PR9A 3TDBA 4C02B 2DT2A 2PV3A 3CHFA 1U79A 3O5DA 1FFQA 2KE0A 3KAFA 3WD1A 4L3NA 4ODNA 4DRQA 1Y0OA 1TFVA 4MNLA 2ESCA 4P8WA 1W9UA 1JVWA 5HT1A 3MDYB 2G41A 1FKDA 4U84A 1H0IA 4W9OA 4J4OA 4WKAA 4LAYA 3O5KA 2MLYA 1ITXA 4W9PA 4P8VA 1HJVA 2XPAA 2RUCA 4MNMA 1GRJA 1Q6IA 3JYMA 3AS0A 1HKKA 4QT3A 3CGMA 1WAWA 4WK9A 2A3BA 3UQBA 1FKGA 1NMVA 1FKFA 3B8SA 4S3KA 3O5PA 4GIVA 2PV1A 2KR7A 1XRVA 4JFIA 5GPRA 3EIPA 1F8AB 3O5GA 1E15A 3WL0A 2VCDA 4MSPA 1W9PA 3KAGA 5D75A 1QZ2A 3WKZA 2WM0A 3PRBA 1E6PA 1E6RA 2Q5AA 2UZ5A 2RUQA 1D6OA 3KADA 4LAWA 3CHCA 4L72B 1D7IA 3H9RB 3BXWA 1FKTA 4W9QA 3O5LA 2EULA 4DRHA 2DT3A 4J4NA 2ZQSA 3FAPA 3WD2A 2YBTA 3G6MA 3UI4A 5DIUA 1W1PA 4LAXA 4DWSA 5B8IC 4NNRA 1FKRA 4G50A 2DSUA 4IPXA 4Z2JA 1D2KA 2A3AA 3CZ8A 4URIA 3EY6A 1T11A 3WIJA 2DG4A 1HKJA 1ZCNA 1FKJA 4Z2KA 1QPFA 3B9EA 5GPGA 3ALGA 4MNJA 4ODPA 1RD6A 4AY1A 3VAWA 3UI6A 2WLZA 1H0GA 1Q6UA 4DZ2A 2QF8A 1J4IA 4ODLA 3ARTA 3LUOA 2PPOA 1ZBWA 4DRPA 1HKMA 1QPLA 1FKSA 4FN2A 2IF4A 4QT2A 1LG2A 3KAIA 4XAKA 1SYTA 2P4VA 5DITA 3GTYX 3RGCA 2KI3A 1X6LA 4P8UA 4DT4A 4ZPTR 2G8ZA 2ZR5A 3RMEA 1KT1A 1HJXA 4LGXA 2RUDA 1FKIA 3WD0A 3CH9A
chains in the Genus database with same CATH topology
4G2PA 1FKBA 2M2AA 5DO2A 5HKGA 1ROTA 2PI6A 2XP4A 3PRAA 1W1TA 3RM9A 2AOSA 3O5FA 1ZU8A 1SR0A 1ROUA 1N1AA 2JZVA 1E6NA 3CHEA 1W1VA 1JNSA 2PPNA 4GGQA 1EIBA 1KT0A 1LJYA 1JNTA 1NWTA 3UQIA 2N87A 3RM4A 1F40A 1FD9A 4Q7NA 2O92A 5HBFA 4TYOA 2RSEA 3QOKA 5DIVA 4TX0A 1FKHA 4ODKA 2A3EA 2ZQUA 1JNDA 2WK2A 3ARZA 3B9DA 4S3JA 4ODQA 1FFRA 3O5RA 1WNOA 2DT1A 3GPKA 3IKGA 3ARYA 3OA5A 3W4RA 2MNTA 4U85A 2DT0A 2RQSA 4DH0A 3KAHA 2F4EA 2FAPA 1XHGA 4DWSD 1Q6HA 2ZQVA 1NH6A 1OGBA 4WJXA 2OFNA 1EHNA 3O5JA 4Z2GA 3PA7A 4DRIA 4O2TA 1ZK6A 3WQWA 2LKNA 1GUVA 3UF8A 2F21A 1GOIA 4BF8A 4JFJA 2VN1A 1LG1A 3O5MA 4IQCA 1UR8A 4HBOA 1LL4A 2DSZA 2D9FA 4ITZA 4KR0B 2L2SA 3ARSA 4N19A 4WIWA 2AWGA 2ZQTA 1LL7A 1LQ0A 4ODMA 1K9TA 3KABA 2MPHA 3WQVA 1J4HA 3IKDA 1HKIA 4Z2LA 2MF9A 4DRJA 4Z2HA 1NWSA 2PBCA 1P5QA 3UI5A 1ZBCA 3B7XA 4R0XA 3IK8A 2XPBA 1B6CA 5HW6A 2DPEA 3NTPA 2KGJA 5JH8A 3I6CA 3ARQA 5DF0A 1R9HA 3KCEA 5HW7A 1J6YA 2KFWA 2XP7A 2OLHA 3ALFA 2PPPA 3IHZA 3JXVA 4DRKA 3JYJA 1A7XA 4DWSC 1CTNA 1W1YA 3KZ7A 4IQ2A 1VF8A 4WKFA 2PV2A 3O5OA 4HARA 2XP9A 3ARUA 4W5UA 4TW6A 1J4RA 3G6LA 1WB0A 3WD4A 2Y78A 4HBEA 4Q22A 3ODKA 2FDMA 3ARPA 1E9LA 1Q1CA 3WH0A 3AS2A 2LGOA 1ZBVA 2XP8A 3B9AA 1HJWA 1EQ3A 1TCOC 2DSWA 1BL4A 2MLZA 1L1PA 3AS3A 4QZVB 2F2DA 2WLYA 3O5QA 4R5EA 3PRDA 1EDQA 4JFKA 5GQBA 2MLXA 2KO7A 3TC5A 1D7HA 4ODOA 4DZ3A 5HTGA 4ZPVR 2M08A 2K8IA 4JFMA 1E6ZA 4Z2IA 1OGGA 1PBKA 4MTVA 1JNEA 4QIBA 2YBUA 1FJDA 4ZPWR 2ZR6A 1PINA 4DIPA 1FAPA 4U86A 1GPFA 1W26A 3ARRA 3RM8A 4DRNA 1YW5A 2FKEA 4LAVA 3NI6A 2ITKA 2IUZA 2XP5A 2B31A 2M1IA 3UQAA 3FXYA 1UR9A 2XP6A 1BKFA 4NZCA 3WL1A 3AQUA 4IT6A 1ZB5A 1HXVA 1W9VA 3OOBA 3O5EA 5DEZA 1M5YA 4TW8A 5BXJA 1LL6A 1KFWA 1NSGA 1NWUA 4KQZA 3FY1A 2A3CA 4DRMA 1OWQA 4P8XA 4IT4A 2XP3A 4MPKA 2DG3A 4ZS6A 3O5IA 3ARVA 1EYMA 2RURA 1ZBKA 5J6EA 1YATA 2DG9A 3KACA 4MNKA 1FKLA 4JFLA 1C9HA 1O6IA 1ZL1A 3WD3A 5HUAA 4TNSA 4NSBA 4ML4A 1FKKA 1IX5A 3ARWA 1D7JA 5HW8A 4MAVA 3AROA 4ODRA 4JYSA 3CHDA 4FAPA 2LJ4A 5HWBA 1NWRA 1X6NA 4DWSB 4MGVA 2LPVA 4WKHA 2ZR4A 5HWCA 5I98A 2O9OA 3TCZA 4PTMA 2DSVA 3CGNA 3AS1A 4TW7A 1NMWA 4DROA 3ARXA 3NRKA 3RFWA 3PR9A 3TDBA 4C02B 2DT2A 2PV3A 3CHFA 1U79A 3O5DA 1FFQA 2KE0A 3KAFA 3WD1A 4L3NA 4ODNA 4DRQA 1Y0OA 1TFVA 4MNLA 2ESCA 4P8WA 1W9UA 1JVWA 5HT1A 3MDYB 2G41A 1FKDA 4U84A 1H0IA 4W9OA 4J4OA 4WKAA 4LAYA 3O5KA 2MLYA 1ITXA 4W9PA 4P8VA 1HJVA 2XPAA 2RUCA 4MNMA 1Q6IA 3JYMA 3AS0A 1HKKA 4QT3A 3CGMA 1WAWA 4WK9A 2A3BA 3UQBA 1FKGA 1NMVA 1FKFA 3B8SA 4S3KA 3O5PA 4GIVA 2PV1A 2KR7A 1XRVA 4JFIA 5GPRA 1F8AB 3O5GA 1E15A 3WL0A 2VCDA 4MSPA 1W9PA 3KAGA 5D75A 1QZ2A 3WKZA 2WM0A 3PRBA 1E6PA 1E6RA 2Q5AA 2UZ5A 2RUQA 1D6OA 3KADA 4LAWA 3CHCA 4L72B 1D7IA 3H9RB 3BXWA 1FKTA 4W9QA 3O5LA 4DRHA 2DT3A 4J4NA 2ZQSA 3FAPA 3WD2A 2YBTA 3G6MA 3UI4A 5DIUA 1W1PA 4LAXA 4DWSA 5B8IC 4NNRA 1FKRA 4G50A 2DSUA 4IPXA 4Z2JA 1D2KA 2A3AA 3CZ8A 4URIA 3EY6A 1T11A 3WIJA 2DG4A 1HKJA 1ZCNA 1FKJA 4Z2KA 1QPFA 3B9EA 5GPGA 3ALGA 4MNJA 4ODPA 1RD6A 4AY1A 3VAWA 3UI6A 2WLZA 1H0GA 1Q6UA 4DZ2A 2QF8A 1J4IA 4ODLA 3ARTA 3LUOA 2PPOA 1ZBWA 4DRPA 1HKMA 1QPLA 1FKSA 4FN2A 2IF4A 4QT2A 1LG2A 3KAIA 4XAKA 1SYTA 5DITA 3RGCA 2KI3A 1X6LA 4P8UA 4DT4A 4ZPTR 2G8ZA 2ZR5A 3RMEA 1KT1A 1HJXA 4LGXA 2RUDA 1FKIA 3WD0A 3CH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G2P A;  1FKB A;  3CGM A;  4R0X A;  2M2A A;  5HKG A;  1ROT A;  1HXV A;  3UQB A;  1FKG A;  2XP4 A;  3IK8 A;  1NMV A;  2XPB A;  1B6C A;  1FKF A;  3OOB A;  5HW6 A;  3NTP A;  3O5E A;  3O5F A;  1M5Y A;  2KGJ A;  3O5P A;  4GIV A;  4TW8 A;  1ROU A;  2PV1 A;  1N1A A;  1NSG A;  2JZV A;  2KR7 A;  4JFI A;  5BXJ A;  3I6C A;  1F8A B;  3O5G A;  1R9H A;  3KCE A;  4DRM A;  5HW7 A;  2XP6 A;  2KFW A;  1J6Y A;  2XP7 A;  1JNS A;  2VCD A;  2XP3 A;  4MSP A;  2DG3 A;  3KAG A;  2PPN A;  2PPP A;  1QZ2 A;  5D75 A;  3IHZ A;  4GGQ A;  3JXV A;  3PRB A;  4DRK A;  3JYJ A;  1A7X A;  1KT0 A;  3O5I A;  1JNT A;  2Q5A A;  2UZ5 A;  1EYM A;  2RUQ A;  2RUR A;  3UQI A;  2N87 A;  1D6O A;  5J6E A;  1YAT A;  1F40 A;  1FD9 A;  3KAD A;  3KZ7 A;  4IQ2 A;  2DG9 A;  2PV2 A;  3KAC A;  3O5O A;  4LAW A;  2XP9 A;  1FKL A;  4TYO A;  2RSE A;  4JFL A;  5DIV A;  4TX0 A;  1FKH A;  1D7I A;  1C9H A;  3H9R B;  4ODK A;  4TW6 A;  1J4R A;  2ZQU A;  5HUA A;  1FKT A;  4TNS A;  4ODQ A;  4W9Q A;  3O5L A;  4DRH A;  3O5R A;  1FKK A;  2Y78 A;  3GPK A;  2ZQS A;  4J4N A;  3FAP A;  1D7J A;  3ODK A;  5HW8 A;  3IKG A;  4ODR A;  4JYS A;  4FAP A;  3UI4 A;  2LJ4 A;  5DIU A;  1Q1C A;  3WH0 A;  4LAX A;  5B8I C;  5HWB A;  2LGO A;  2XP8 A;  4MGV A;  2LPV A;  2MNT A;  4NNR A;  4U85 A;  1EQ3 A;  1FKR A;  4G50 A;  4IPX A;  2ZR4 A;  1TCO C;  2RQS A;  5HWC A;  5I98 A;  1BL4 A;  2MLZ A;  3TCZ A;  1L1P A;  3CGN A;  4DH0 A;  3KAH A;  4TW7 A;  3EY6 A;  2F4E A;  2FAP A;  2F2D A;  1NMW A;  1T11 A;  4DRO A;  2DG4 A;  3O5Q A;  1Q6H A;  2ZQV A;  3NRK A;  1ZCN A;  1FKJ A;  1QPF A;  3RFW A;  3TDB A;  2OFN A;  3O5J A;  5GPG A;  4C02 B;  3PRD A;  4ODP A;  4JFK A;  3PA7 A;  2PV3 A;  4O2T A;  2MLX A;  4DRI A;  1ZK6 A;  2KO7 A;  3VAW A;  3TC5 A;  1D7H A;  3UI6 A;  2LKN A;  1U79 A;  3O5D A;  1Q6U A;  4ODO A;  3UF8 A;  4DZ3 A;  2KE0 A;  4DZ2 A;  3KAF A;  5HTG A;  2F21 A;  2M08 A;  2K8I A;  4JFM A;  1J4I A;  4ODN A;  4DRQ A;  4ODL A;  4BF8 A;  1Y0O A;  3LUO A;  1PBK A;  4JFJ A;  2PPO A;  2VN1 A;  4QIB A;  1JVW A;  3O5M A;  4IQC A;  3MDY B;  5HT1 A;  4DRP A;  1FJD A;  2ZR6 A;  1FKD A;  1PIN A;  4U84 A;  1QPL A;  1FKS A;  2D9F A;  4FN2 A;  4DIP A;  4ITZ A;  4W9O A;  2IF4 A;  1FAP A;  2L2S A;  4J4O A;  4N19 A;  4QT2 A;  2AWG A;  2ZQT A;  4U86 A;  1W26 A;  3KAI A;  4DRN A;  1YW5 A;  4LAY A;  2FKE A;  5DIT A;  4ODM A;  3O5K A;  4LAV A;  2MLY A;  3NI6 A;  3KAB A;  4W9P A;  3RGC A;  2ITK A;  2MPH A;  2KI3 A;  1J4H A;  2XP5 A;  3IKD A;  4DT4 A;  2XPA A;  2MF9 A;  4DRJ A;  2RUC A;  2ZR5 A;  1KT1 A;  1Q6I A;  2M1I A;  3JYM A;  3UQA A;  2PBC A;  1P5Q A;  2RUD A;  1FKI A;  3UI5 A;  1BKF A;  3B7X A;  4QT3 A; 
#chains in the Genus database with same CATH topology
 4G2P A;  1FKB A;  2M2A A;  5DO2 A;  5HKG A;  1ROT A;  2F23 A;  2PI6 A;  2XP4 A;  3PRA A;  1W1T A;  3RM9 A;  2AOS A;  3O5F A;  1ZU8 A;  1SR0 A;  1ROU A;  1N1A A;  2JZV A;  1JCH B;  1E6N A;  3CHE A;  1E44 A;  1W1V A;  1JNS A;  2PPN A;  4GGQ A;  1EIB A;  1KT0 A;  1LJY A;  1JNT A;  1NWT A;  3UQI A;  2N87 A;  3RM4 A;  1F40 A;  1FD9 A;  4Q7N A;  2O92 A;  5HBF A;  4TYO A;  2RSE A;  3QOK A;  5DIV A;  4TX0 A;  1FKH A;  4ODK A;  2A3E A;  2ZQU A;  1JND A;  2WK2 A;  3ARZ A;  3B9D A;  4S3J A;  4ODQ A;  1FFR A;  3O5R A;  1WNO A;  2DT1 A;  3GPK A;  3IKG A;  3ARY A;  3OA5 A;  3W4R A;  2MNT A;  4U85 A;  2DT0 A;  2RQS A;  4DH0 A;  3KAH A;  2F4E A;  2FAP A;  2PN0 A;  1XHG A;  4DWS D;  1Q6H A;  2ZQV A;  1NH6 A;  1OGB A;  4WJX A;  3BMB A;  2OFN A;  1EHN A;  3O5J A;  4Z2G A;  3PA7 A;  4DRI A;  4O2T A;  1ZK6 A;  3WQW A;  2LKN A;  1GUV A;  3UF8 A;  2F21 A;  1GOI A;  4BF8 A;  4JFJ A;  2VN1 A;  1LG1 A;  3O5M A;  4IQC A;  1UR8 A;  4HBO A;  1LL4 A;  2DSZ A;  2D9F A;  4ITZ A;  4KR0 B;  2L2S A;  3ARS A;  4N19 A;  4WIW A;  2AWG A;  2ZQT A;  1LL7 A;  1LQ0 A;  4ODM A;  1K9T A;  3KAB A;  2MPH A;  3WQV A;  1J4H A;  3IKD A;  1HKI A;  4Z2L A;  2MF9 A;  4DRJ A;  4Z2H A;  1NWS A;  2PBC A;  1P5Q A;  3UI5 A;  4UDM A;  1ZBC A;  3B7X A;  4R0X A;  3IK8 A;  2XPB A;  1B6C A;  5HW6 A;  2DPE A;  3NTP A;  2KGJ A;  5JH8 A;  3I6C A;  3ARQ A;  5DF0 A;  1R9H A;  3KCE A;  5HW7 A;  1J6Y A;  2KFW A;  2XP7 A;  2OLH A;  3ALF A;  2PPP A;  3IHZ A;  3JXV A;  4DRK A;  3JYJ A;  1A7X A;  4DWS C;  1CTN A;  1W1Y A;  3KZ7 A;  4IQ2 A;  1VF8 A;  4WKF A;  2PV2 A;  3O5O A;  4HAR A;  2XP9 A;  3ARU A;  4W5U A;  4TW6 A;  1J4R A;  3G6L A;  1WB0 A;  3WD4 A;  2Y78 A;  4HBE A;  4Q22 A;  3ODK A;  2FDM A;  3ARP A;  1E9L A;  1Q1C A;  3WH0 A;  3AS2 A;  2LGO A;  1ZBV A;  2XP8 A;  3B9A A;  1HJW A;  1EQ3 A;  1TCO C;  2DSW A;  1BL4 A;  2MLZ A;  1L1P A;  3AS3 A;  4QZV B;  2F2D A;  2WLY A;  3O5Q A;  4R5E A;  3PRD A;  1EDQ A;  4JFK A;  5GQB A;  2MLX A;  2KO7 A;  3TC5 A;  1D7H A;  4ODO A;  4DZ3 A;  5HTG A;  4ZPV R;  2M08 A;  2K8I A;  4JFM A;  1E6Z A;  4Z2I A;  1OGG A;  1PBK A;  4MTV A;  1JNE A;  4QIB A;  2YBU A;  1FJD A;  4ZPW R;  2ZR6 A;  1PIN A;  4DIP A;  1FAP A;  4U86 A;  1GPF A;  1W26 A;  3ARR A;  3RM8 A;  4DRN A;  1YW5 A;  2FKE A;  4LAV A;  3NI6 A;  2ITK A;  2IUZ A;  2XP5 A;  2B31 A;  2M1I A;  3UQA A;  3FXY A;  1UR9 A;  2XP6 A;  1BKF A;  4NZC A;  3WL1 A;  2B5U B;  3AQU A;  4IT6 A;  1ZB5 A;  1HXV A;  1W9V A;  3OOB A;  3O5E A;  5DEZ A;  1M5Y A;  4TW8 A;  5BXJ A;  1LL6 A;  1KFW A;  1NSG A;  1NWU A;  4KQZ A;  3FY1 A;  2A3C A;  4DRM A;  1OWQ A;  4P8X A;  4IT4 A;  2XP3 A;  4MPK A;  2DG3 A;  2ETN A;  4ZS6 A;  3O5I A;  3GU0 A;  3ARV A;  1EYM A;  2RUR A;  1ZBK A;  5J6E A;  1YAT A;  2DG9 A;  3KAC A;  4MNK A;  1FKL A;  4JFL A;  1C9H A;  1O6I A;  1ZL1 A;  3WD3 A;  5HUA A;  4TNS A;  4NSB A;  4ML4 A;  1FKK A;  1IX5 A;  3ARW A;  1D7J A;  5HW8 A;  4MAV A;  3ARO A;  4ODR A;  4JYS A;  3CHD A;  4FAP A;  2LJ4 A;  5HWB A;  1NWR A;  1X6N A;  4DWS B;  4MGV A;  2LPV A;  4WKH A;  2ZR4 A;  5HWC A;  5I98 A;  2O9O A;  3TCZ A;  4PTM A;  2DSV A;  3CGN A;  3AS1 A;  4TW7 A;  1NMW A;  4DRO A;  3ARX A;  3NRK A;  3RFW A;  3PR9 A;  3TDB A;  4C02 B;  2DT2 A;  2PV3 A;  3CHF A;  1U79 A;  3O5D A;  1FFQ A;  2KE0 A;  3KAF A;  3WD1 A;  4L3N A;  4ODN A;  4DRQ A;  1Y0O A;  1TFV A;  4MNL A;  2ESC A;  4P8W A;  1W9U A;  1JVW A;  5HT1 A;  3MDY B;  2G41 A;  1FKD A;  4U84 A;  1H0I A;  4W9O A;  4J4O A;  4WKA A;  4LAY A;  3O5K A;  2MLY A;  1ITX A;  4W9P A;  4P8V A;  1HJV A;  2XPA A;  2RUC A;  4MNM A;  1GRJ A;  1Q6I A;  3JYM A;  3AS0 A;  1HKK A;  4QT3 A;  3CGM A;  1WAW A;  4WK9 A;  2A3B A;  3UQB A;  1FKG A;  1NMV A;  1FKF A;  3B8S A;  4S3K A;  3O5P A;  4GIV A;  2PV1 A;  2KR7 A;  1XRV A;  4JFI A;  5GPR A;  3EIP A;  1F8A B;  3O5G A;  1E15 A;  3WL0 A;  2VCD A;  4MSP A;  1W9P A;  3KAG A;  5D75 A;  1QZ2 A;  3WKZ A;  2WM0 A;  3PRB A;  1E6P A;  1E6R A;  2Q5A A;  2UZ5 A;  2RUQ A;  1D6O A;  3KAD A;  4LAW A;  3CHC A;  4L72 B;  1D7I A;  3H9R B;  3BXW A;  1FKT A;  4W9Q A;  3O5L A;  2EUL A;  4DRH A;  2DT3 A;  4J4N A;  2ZQS A;  3FAP A;  3WD2 A;  2YBT A;  3G6M A;  3UI4 A;  5DIU A;  1W1P A;  4LAX A;  4DWS A;  5B8I C;  4NNR A;  1FKR A;  4G50 A;  2DSU A;  4IPX A;  4Z2J A;  1D2K A;  2A3A A;  3CZ8 A;  4URI A;  3EY6 A;  1T11 A;  3WIJ A;  2DG4 A;  1HKJ A;  1ZCN A;  1FKJ A;  4Z2K A;  1QPF A;  3B9E A;  5GPG A;  3ALG A;  4MNJ A;  4ODP A;  1RD6 A;  4AY1 A;  3VAW A;  3UI6 A;  2WLZ A;  1H0G A;  1Q6U A;  4DZ2 A;  2QF8 A;  1J4I A;  4ODL A;  3ART A;  3LUO A;  2PPO A;  1ZBW A;  4DRP A;  1HKM A;  1QPL A;  1FKS A;  4FN2 A;  2IF4 A;  4QT2 A;  1LG2 A;  3KAI A;  4XAK A;  1SYT A;  2P4V A;  5DIT A;  3GTY X;  3RGC A;  2KI3 A;  1X6L A;  4P8U A;  4DT4 A;  4ZPT R;  2G8Z A;  2ZR5 A;  3RME A;  1KT1 A;  1HJX A;  4LGX A;  2RUD A;  1FKI A;  3WD0 A;  3CH9 A; 
#chains in the Genus database with same CATH homology
 4G2P A;  1FKB A;  2M2A A;  5DO2 A;  5HKG A;  1ROT A;  2PI6 A;  2XP4 A;  3PRA A;  1W1T A;  3RM9 A;  2AOS A;  3O5F A;  1ZU8 A;  1SR0 A;  1ROU A;  1N1A A;  2JZV A;  1E6N A;  3CHE A;  1W1V A;  1JNS A;  2PPN A;  4GGQ A;  1EIB A;  1KT0 A;  1LJY A;  1JNT A;  1NWT A;  3UQI A;  2N87 A;  3RM4 A;  1F40 A;  1FD9 A;  4Q7N A;  2O92 A;  5HBF A;  4TYO A;  2RSE A;  3QOK A;  5DIV A;  4TX0 A;  1FKH A;  4ODK A;  2A3E A;  2ZQU A;  1JND A;  2WK2 A;  3ARZ A;  3B9D A;  4S3J A;  4ODQ A;  1FFR A;  3O5R A;  1WNO A;  2DT1 A;  3GPK A;  3IKG A;  3ARY A;  3OA5 A;  3W4R A;  2MNT A;  4U85 A;  2DT0 A;  2RQS A;  4DH0 A;  3KAH A;  2F4E A;  2FAP A;  1XHG A;  4DWS D;  1Q6H A;  2ZQV A;  1NH6 A;  1OGB A;  4WJX A;  2OFN A;  1EHN A;  3O5J A;  4Z2G A;  3PA7 A;  4DRI A;  4O2T A;  1ZK6 A;  3WQW A;  2LKN A;  1GUV A;  3UF8 A;  2F21 A;  1GOI A;  4BF8 A;  4JFJ A;  2VN1 A;  1LG1 A;  3O5M A;  4IQC A;  1UR8 A;  4HBO A;  1LL4 A;  2DSZ A;  2D9F A;  4ITZ A;  4KR0 B;  2L2S A;  3ARS A;  4N19 A;  4WIW A;  2AWG A;  2ZQT A;  1LL7 A;  1LQ0 A;  4ODM A;  1K9T A;  3KAB A;  2MPH A;  3WQV A;  1J4H A;  3IKD A;  1HKI A;  4Z2L A;  2MF9 A;  4DRJ A;  4Z2H A;  1NWS A;  2PBC A;  1P5Q A;  3UI5 A;  1ZBC A;  3B7X A;  4R0X A;  3IK8 A;  2XPB A;  1B6C A;  5HW6 A;  2DPE A;  3NTP A;  2KGJ A;  5JH8 A;  3I6C A;  3ARQ A;  5DF0 A;  1R9H A;  3KCE A;  5HW7 A;  1J6Y A;  2KFW A;  2XP7 A;  2OLH A;  3ALF A;  2PPP A;  3IHZ A;  3JXV A;  4DRK A;  3JYJ A;  1A7X A;  4DWS C;  1CTN A;  1W1Y A;  3KZ7 A;  4IQ2 A;  1VF8 A;  4WKF A;  2PV2 A;  3O5O A;  4HAR A;  2XP9 A;  3ARU A;  4W5U A;  4TW6 A;  1J4R A;  3G6L A;  1WB0 A;  3WD4 A;  2Y78 A;  4HBE A;  4Q22 A;  3ODK A;  2FDM A;  3ARP A;  1E9L A;  1Q1C A;  3WH0 A;  3AS2 A;  2LGO A;  1ZBV A;  2XP8 A;  3B9A A;  1HJW A;  1EQ3 A;  1TCO C;  2DSW A;  1BL4 A;  2MLZ A;  1L1P A;  3AS3 A;  4QZV B;  2F2D A;  2WLY A;  3O5Q A;  4R5E A;  3PRD A;  1EDQ A;  4JFK A;  5GQB A;  2MLX A;  2KO7 A;  3TC5 A;  1D7H A;  4ODO A;  4DZ3 A;  5HTG A;  4ZPV R;  2M08 A;  2K8I A;  4JFM A;  1E6Z A;  4Z2I A;  1OGG A;  1PBK A;  4MTV A;  1JNE A;  4QIB A;  2YBU A;  1FJD A;  4ZPW R;  2ZR6 A;  1PIN A;  4DIP A;  1FAP A;  4U86 A;  1GPF A;  1W26 A;  3ARR A;  3RM8 A;  4DRN A;  1YW5 A;  2FKE A;  4LAV A;  3NI6 A;  2ITK A;  2IUZ A;  2XP5 A;  2B31 A;  2M1I A;  3UQA A;  3FXY A;  1UR9 A;  2XP6 A;  1BKF A;  4NZC A;  3WL1 A;  3AQU A;  4IT6 A;  1ZB5 A;  1HXV A;  1W9V A;  3OOB A;  3O5E A;  5DEZ A;  1M5Y A;  4TW8 A;  5BXJ A;  1LL6 A;  1KFW A;  1NSG A;  1NWU A;  4KQZ A;  3FY1 A;  2A3C A;  4DRM A;  1OWQ A;  4P8X A;  4IT4 A;  2XP3 A;  4MPK A;  2DG3 A;  4ZS6 A;  3O5I A;  3ARV A;  1EYM A;  2RUR A;  1ZBK A;  5J6E A;  1YAT A;  2DG9 A;  3KAC A;  4MNK A;  1FKL A;  4JFL A;  1C9H A;  1O6I A;  1ZL1 A;  3WD3 A;  5HUA A;  4TNS A;  4NSB A;  4ML4 A;  1FKK A;  1IX5 A;  3ARW A;  1D7J A;  5HW8 A;  4MAV A;  3ARO A;  4ODR A;  4JYS A;  3CHD A;  4FAP A;  2LJ4 A;  5HWB A;  1NWR A;  1X6N A;  4DWS B;  4MGV A;  2LPV A;  4WKH A;  2ZR4 A;  5HWC A;  5I98 A;  2O9O A;  3TCZ A;  4PTM A;  2DSV A;  3CGN A;  3AS1 A;  4TW7 A;  1NMW A;  4DRO A;  3ARX A;  3NRK A;  3RFW A;  3PR9 A;  3TDB A;  4C02 B;  2DT2 A;  2PV3 A;  3CHF A;  1U79 A;  3O5D A;  1FFQ A;  2KE0 A;  3KAF A;  3WD1 A;  4L3N A;  4ODN A;  4DRQ A;  1Y0O A;  1TFV A;  4MNL A;  2ESC A;  4P8W A;  1W9U A;  1JVW A;  5HT1 A;  3MDY B;  2G41 A;  1FKD A;  4U84 A;  1H0I A;  4W9O A;  4J4O A;  4WKA A;  4LAY A;  3O5K A;  2MLY A;  1ITX A;  4W9P A;  4P8V A;  1HJV A;  2XPA A;  2RUC A;  4MNM A;  1Q6I A;  3JYM A;  3AS0 A;  1HKK A;  4QT3 A;  3CGM A;  1WAW A;  4WK9 A;  2A3B A;  3UQB A;  1FKG A;  1NMV A;  1FKF A;  3B8S A;  4S3K A;  3O5P A;  4GIV A;  2PV1 A;  2KR7 A;  1XRV A;  4JFI A;  5GPR A;  1F8A B;  3O5G A;  1E15 A;  3WL0 A;  2VCD A;  4MSP A;  1W9P A;  3KAG A;  5D75 A;  1QZ2 A;  3WKZ A;  2WM0 A;  3PRB A;  1E6P A;  1E6R A;  2Q5A A;  2UZ5 A;  2RUQ A;  1D6O A;  3KAD A;  4LAW A;  3CHC A;  4L72 B;  1D7I A;  3H9R B;  3BXW A;  1FKT A;  4W9Q A;  3O5L A;  4DRH A;  2DT3 A;  4J4N A;  2ZQS A;  3FAP A;  3WD2 A;  2YBT A;  3G6M A;  3UI4 A;  5DIU A;  1W1P A;  4LAX A;  4DWS A;  5B8I C;  4NNR A;  1FKR A;  4G50 A;  2DSU A;  4IPX A;  4Z2J A;  1D2K A;  2A3A A;  3CZ8 A;  4URI A;  3EY6 A;  1T11 A;  3WIJ A;  2DG4 A;  1HKJ A;  1ZCN A;  1FKJ A;  4Z2K A;  1QPF A;  3B9E A;  5GPG A;  3ALG A;  4MNJ A;  4ODP A;  1RD6 A;  4AY1 A;  3VAW A;  3UI6 A;  2WLZ A;  1H0G A;  1Q6U A;  4DZ2 A;  2QF8 A;  1J4I A;  4ODL A;  3ART A;  3LUO A;  2PPO A;  1ZBW A;  4DRP A;  1HKM A;  1QPL A;  1FKS A;  4FN2 A;  2IF4 A;  4QT2 A;  1LG2 A;  3KAI A;  4XAK A;  1SYT A;  5DIT A;  3RGC A;  2KI3 A;  1X6L A;  4P8U A;  4DT4 A;  4ZPT R;  2G8Z A;  2ZR5 A;  3RME A;  1KT1 A;  1HJX A;  4LGX A;  2RUD A;  1FKI A;  3WD0 A;  3CH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...