5BXJA

Complex of the fk1 domain mutant a19t of fkbp51 with 4-nitrophenol
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
127
structure length
127
Chain Sequence
b'GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title The environmental endocrine disruptor p-nitrophenol interacts with FKBP51, a positive regulator of androgen receptor and inhibits androgen receptor signaling in human cells
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 32
structure length 127
sequence length 127
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2015-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5bxjA00
3GPKA 2KI3A 3KACA 4G2PA 4DT4A 2ZR4A 1FKFA 2KR7A 4LAVA 1NSGA 2JZVA 3KAFA 5HW6A 2MLYA 1QPLA 2DG3A 2DG9A 4TYOA 5DIVA 2XP6A 3O5GA 4U84A 3O5DA 2RQSA 3O5KA 1N1AA 1J6YA 4DZ2A 1FKTA 3O5IA 3O5JA 4U85A 4JFMA 2L2SA 4BF8A 1FKBA 2MLZA 3EY6A 4MGVA 4ODOA 1BL4A 4LAWA 3MDYB 4W9OA 4DRIA 4DRMA 1ROTA 2XP8A 3I6CA 4ODMA 4QT3A 2RSEA 2XPAA 4LAXA 1D7IA 4TX0A 1HXVA 4TW8A 5HUAA 4FN2A 3TC5A 1FKSA 1J4IA 2PV3A 2DG4A 2RUDA 5HT1A 3TCZA 4DIPA 5BXJA 1Q6UA 5HTGA 2FAPA 1TCOC 2ITKA 1Q1CA 3KAHA 3UQBA 1ROUA 3O5FA 5D75A 1L1PA 2M1IA 2VCDA 1NMVA 2PPOA 2K8IA 2MPHA 4IQCA 3UQIA 5I98A 1FKIA 2F2DA 2LGOA 4JYSA 3LUOA 5HWCA 4TW7A 4W9PA 4U86A 3UI5A 2KGJA 4MSPA 3KAGA 3O5OA 4JFKA 1QZ2A 4DRJA 4DH0A 2ZR5A 1C9HA 4DRQA 5HWBA 2M08A 3JYMA 3KAIA 2ZQVA 2PPNA 4J4OA 1D6OA 3PRDA 1FKGA 4W9QA 1D7JA 1KT0A 2PPPA 2UZ5A 3KADA 3KABA 2RURA 3NRKA 1JVWA 1NMWA 1QPFA 2N87A 4IPXA 1FKKA 3O5PA 2ZR6A 3NI6A 2PBCA 1W26A 3O5QA 4ODRA 1FAPA 4QIBA 3IKGA 2KFWA 1FKLA 3O5EA 1A7XA 3WH0A 1D7HA 3IHZA 1JNTA 1PBKA 1Y0OA 5HW7A 2LKNA 4ODLA 1YW5A 4JFLA 5B8IC 2D9FA 2XP3A 5HW8A 4IQ2A 4ODQA 2MF9A 1FKDA 3UI4A 1FKHA 2RUQA 2Y78A 4JFIA 3UI6A 1FKJA 2XP4A 2XP7A 1J4HA 3ODKA 4J4NA 4ODPA 1ZK6A 2XP9A 3IKDA 2FKEA 4O2TA 4ITZA 4R0XA 3JYJA 3PA7A 5DITA 2XPBA 4N19A 2VN1A 5GPGA 3O5MA 3KCEA 4GGQA 4TW6A 4DRKA 2F4EA 3IK8A 1P5QA 2Q5AA 4LAYA 2F21A 1T11A 4NNRA 4ODKA 3UF8A 1EQ3A 1F40A 3UQAA 1U79A 3PRBA 5DIUA 1JNSA 3NTPA 3O5RA 1KT1A 3O5LA 3CGMA 2AWGA 2KE0A 2RUCA 1PINA 2OFNA 4QT2A 4DRNA 1F8AB 1R9HA 2LPVA 1ZCNA 1EYMA 4C02B 3KZ7A 1FD9A 4G50A 5HKGA 1Q6IA 1J4RA 1M5YA 2PV2A 1BKFA 1FKRA 3CGNA 4JFJA 2PV1A 2ZQSA 1YATA 2LJ4A 2KO7A 2XP5A 1FJDA 1B6CA 2MLXA 3H9RB 2MNTA 3TDBA 2IF4A 4DRHA 1Q6HA 3FAPA 2ZQTA 4GIVA 3OOBA 4ODNA 4DRPA 4DZ3A 5J6EA 2M2AA 3B7XA 4DROA 4TNSA 3VAWA 4FAPA 3JXVA 2ZQUA 3RFWA 3RGCA
chains in the Genus database with same CATH superfamily
2EULA 3KACA 4G2PA 4DT4A 1FKFA 4LAVA 4NSBA 3KAFA 5HW6A 2MLYA 1QPLA 3O5KA 4DZ2A 4Z2JA 4JFMA 2DSZA 2L2SA 3CH9A 2MLZA 1CTNA 3EY6A 4ODOA 4W5UA 1W1VA 4W9OA 2RSEA 2XPAA 1HXVA 4TW8A 2G8ZA 2DT1A 3QOKA 1ZBCA 1X6NA 5D75A 1HJVA 2M1IA 4KR0B 1NMVA 2PPOA 2K8IA 1ZBKA 4JYSA 2LGOA 4W9PA 4U86A 3UI5A 4MSPA 3ARRA 4DRJA 4DH0A 2ZR5A 3JYMA 3KAIA 2ZQVA 4LGXA 2ESCA 2YBUA 1FKGA 1HKJA 1HJXA 1FKKA 4NZCA 4ODRA 1FAPA 3IKGA 3WH0A 1A7XA 3AQUA 5DEZA 4IQ2A 4ZPTR 4L3NA 4ODQA 2Y78A 3UI6A 1FKJA 1O6IA 4ODPA 4MNJA 3JYJA 1VF8A 3ARZA 2WK2A 1OWQA 3O5MA 1W1PA 4DRKA 4GGQA 2OLHA 4P8WA 3O5RA 1KT1A 2KE0A 3RM9A 1F8AB 1R9HA 1ZCNA 3KZ7A 1GRJA 4UDMA 5HKGA 1Q6IA 3AROA 1BKFA 1B6CA 4Z2GA 2IF4A 4DWSA 4L72B 3ARSA 4ODNA 4DRPA 4P8VA 2DT0A 1NH6A 3B7XA 4TNSA 4DROA 3W4RA 2ZQUA 3RGCA 4MNMA 4IT6A 4TYOA 2XP6A 4U84A 2RQSA 1J6YA 1FKTA 2P4VA 3O5IA 3O5JA 3WKZA 1W9UA 2DT3A 1FKBA 4MGVA 3RMEA 1OGGA 4DRIA 4LAWA 3RM8A 2XP8A 1JCHB 4ODMA 4TX0A 1D7IA 3B8SA 3BMBA 2F23A 4FN2A 1FKSA 1J4IA 5HT1A 5HTGA 1TCOC 1ROUA 2QF8A 1FFQA 2MPHA 4MPKA 1W1TA 1KFWA 4S3KA 4TW7A 2A3AA 1C9HA 1W1YA 2M08A 3GU0A 1D2KA 4W9QA 4IT4A 4XAKA 3NRKA 2RURA 4O2TA 1GUVA 1NMWA 3AS3A 5I98A 4Q22A 3O5PA 2ZR6A 3O5QA 4TW6A 1W26A 3ARQA 1FKLA 3O5EA 3WD3A 1JNTA 1WAWA 3CHCA 4MTVA 5HW7A 1E6NA 4WKHA 2D9FA 2XP3A 1GPFA 1FKDA 1E15A 2DT2A 1LQ0A 4JFIA 3ARVA 4Z2LA 4J4NA 1NWRA 3CZ8A 2FDMA 2FKEA 3GTYX 3WQVA 5DITA 1H0IA 2A3CA 5JH8A 2F4EA 3IK8A 2Q5AA 4LAYA 2F21A 1T11A 1RD6A 1EHNA 3UQAA 1U79A 3PRBA 5DIUA 4MAVA 3O5LA 2AWGA 2OFNA 5DF0A 1EYMA 1J4RA 3ARUA 4AY1A 1FKRA 4JFJA 1E44A 1SYTA 1YATA 2LJ4A 4PTMA 2MLXA 1X6LA 1E9LA 3TDBA 3CHDA 1Q6HA 2ZQTA 4DWSD 1W9VA 4GIVA 3OOBA 2M2AA 1HKIA 1K9TA 4P8XA 3VAWA 1WB0A 2KI3A 2ZR4A 3OA5A 2ETNA 2KR7A 1NSGA 2DG3A 2DG9A 3O5GA 1NWSA 3O5DA 4ZPWR 3BXWA 3PR9A 4BF8A 3B9AA 1BL4A 4DRMA 4WIWA 1ROTA 4LAXA 5HUAA 3TC5A 3B9EA 2RUDA 2PV3A 2DG4A 3TCZA 4WKAA 1GOIA 1UR8A 2FAPA 1LL6A 1Q1CA 3UQBA 1E6PA 3O5FA 1W9PA 4WJXA 1L1PA 2VCDA 4IQCA 3UQIA 5HWCA 2B31A 1LJYA 1SR0A 2KGJA 1HJWA 3O5OA 1QZ2A 1EIBA 1ITXA 4DRQA 1ZBVA 2PPNA 1D7JA 3KADA 1ZB5A 3WL0A 1QPFA 4MNLA 2N87A 2WLYA 3NI6A 2PBCA 1LG2A 4QIBA 4DWSB 2KFWA 3IHZA 4R5EA 1PBKA 1Y0OA 2LKNA 1E6ZA 4JFLA 5HW8A 3UI4A 4HARA 1FKHA 2RUQA 3WD0A 2WM0A 2XP7A 1J4HA 3ODKA 3WD1A 3ARXA 2XP9A 3IKDA 5DO2A 2G41A 4ITZA 1WNOA 2XPBA 4N19A 4Q7NA 3ARPA 4ZPVR 4ODKA 2PN0A 4NNRA 3UF8A 3WIJA 1F40A 1ZBWA 3ALGA 3EIPA 4S3JA 1JNSA 3NTPA 4QT2A 4DRNA 4C02B 1FD9A 1M5YA 4ML4A 2ZQSA 1NWUA 1FJDA 2MNTA 4DWSC 3ALFA 3FAPA 1JNEA 1LL4A 2WLZA 3G6MA 4DZ3A 5J6EA 1OGBA 1ZL1A 1ZU8A 4Z2KA 3GPKA 3ARTA 2JZVA 2YBTA 1NWTA 3FY1A 2A3BA 5DIVA 1N1AA 1EDQA 4WK9A 1IX5A 4U85A 1JNDA 3AS2A 1EQ3A 2A3EA 1E6RA 3MDYB 3I6CA 4QT3A 3G6LA 1XHGA 4URIA 4MNKA 3ARYA 4DIPA 5BXJA 2DPEA 2PI6A 1Q6UA 3AS0A 4Z2IA 2ITKA 3KAHA 1FKIA 2F2DA 3LUOA 3WD4A 1FFRA 1LG1A 1UR9A 3KAGA 4JFKA 5HWBA 2O92A 3WL1A 4J4OA 4HBEA 4QZVB 2DSVA 1D6OA 3PRDA 2PPPA 1KT0A 2UZ5A 4ZS6A 5HBFA 3KABA 2DSUA 1JVWA 2B5UB 4IPXA 4KQZA 5GPRA 3RM4A 3B9DA 1XRVA 1D7HA 3CHFA 3PRAA 2DSWA 4P8UA 3WQWA 4ODLA 1YW5A 5B8IC 4HBOA 2MF9A 3WD2A 4Z2HA 1HKMA 2XP4A 1HKKA 1H0GA 5GQBA 1ZK6A 4R0XA 3PA7A 2VN1A 5GPGA 3AS1A 3KCEA 1LL7A 4WKFA 3ARWA 1P5QA 1TFVA 2IUZA 2O9OA 3CGMA 2RUCA 1PINA 2LPVA 4G50A 2PV2A 3CGNA 2PV1A 2KO7A 2XP5A 3FXYA 2AOSA 3H9RB 4DRHA 3CHEA 4FAPA 3JXVA 3RFWA
chains in the Genus database with same CATH topology
3KACA 4G2PA 4DT4A 1FKFA 4LAVA 4NSBA 3KAFA 5HW6A 2MLYA 1QPLA 3O5KA 4DZ2A 4Z2JA 4JFMA 2DSZA 2L2SA 3CH9A 2MLZA 1CTNA 3EY6A 4ODOA 4W5UA 1W1VA 4W9OA 2RSEA 2XPAA 1HXVA 4TW8A 2G8ZA 2DT1A 3QOKA 1ZBCA 1X6NA 5D75A 1HJVA 2M1IA 4KR0B 1NMVA 2PPOA 2K8IA 1ZBKA 4JYSA 2LGOA 4W9PA 4U86A 3UI5A 4MSPA 3ARRA 4DRJA 4DH0A 2ZR5A 3JYMA 3KAIA 2ZQVA 4LGXA 2ESCA 2YBUA 1FKGA 1HKJA 1HJXA 1FKKA 4NZCA 4ODRA 1FAPA 3IKGA 3WH0A 1A7XA 3AQUA 5DEZA 4IQ2A 4ZPTR 4L3NA 4ODQA 2Y78A 3UI6A 1FKJA 1O6IA 4ODPA 4MNJA 3JYJA 1VF8A 3ARZA 2WK2A 1OWQA 3O5MA 1W1PA 4DRKA 4GGQA 2OLHA 4P8WA 3O5RA 1KT1A 2KE0A 3RM9A 1F8AB 1R9HA 1ZCNA 3KZ7A 5HKGA 1Q6IA 3AROA 1BKFA 1B6CA 4Z2GA 2IF4A 4DWSA 4L72B 3ARSA 4ODNA 4DRPA 4P8VA 2DT0A 1NH6A 3B7XA 4TNSA 4DROA 3W4RA 2ZQUA 3RGCA 4MNMA 4IT6A 4TYOA 2XP6A 4U84A 2RQSA 1J6YA 1FKTA 3O5IA 3O5JA 3WKZA 1W9UA 2DT3A 1FKBA 4MGVA 3RMEA 1OGGA 4DRIA 4LAWA 3RM8A 2XP8A 4ODMA 4TX0A 1D7IA 3B8SA 4FN2A 1FKSA 1J4IA 5HT1A 5HTGA 1TCOC 1ROUA 2QF8A 1FFQA 2MPHA 4MPKA 1W1TA 1KFWA 4S3KA 4TW7A 2A3AA 1C9HA 1W1YA 2M08A 1D2KA 4W9QA 4IT4A 4XAKA 3NRKA 2RURA 4O2TA 1GUVA 1NMWA 3AS3A 5I98A 4Q22A 3O5PA 2ZR6A 3O5QA 4TW6A 1W26A 3ARQA 1FKLA 3O5EA 3WD3A 1JNTA 1WAWA 3CHCA 4MTVA 5HW7A 1E6NA 4WKHA 2D9FA 2XP3A 1GPFA 1FKDA 1E15A 2DT2A 1LQ0A 4JFIA 3ARVA 4Z2LA 4J4NA 1NWRA 3CZ8A 2FDMA 2FKEA 3WQVA 5DITA 1H0IA 2A3CA 5JH8A 2F4EA 3IK8A 2Q5AA 4LAYA 2F21A 1T11A 1RD6A 1EHNA 3UQAA 1U79A 3PRBA 5DIUA 4MAVA 3O5LA 2AWGA 2OFNA 5DF0A 1EYMA 1J4RA 3ARUA 4AY1A 1FKRA 4JFJA 1YATA 1SYTA 2LJ4A 4PTMA 2MLXA 1X6LA 1E9LA 3TDBA 3CHDA 1Q6HA 2ZQTA 4DWSD 1W9VA 4GIVA 3OOBA 2M2AA 1HKIA 1K9TA 4P8XA 3VAWA 1WB0A 2KI3A 2ZR4A 3OA5A 2KR7A 1NSGA 2DG3A 2DG9A 3O5GA 1NWSA 3O5DA 4ZPWR 3BXWA 3PR9A 4BF8A 3B9AA 1BL4A 4DRMA 4WIWA 1ROTA 4LAXA 5HUAA 3TC5A 3B9EA 2RUDA 2PV3A 2DG4A 3TCZA 4WKAA 1GOIA 1UR8A 2FAPA 1LL6A 1Q1CA 3UQBA 1E6PA 3O5FA 1W9PA 4WJXA 1L1PA 2VCDA 4IQCA 3UQIA 5HWCA 2B31A 1LJYA 1SR0A 2KGJA 1HJWA 3O5OA 1QZ2A 1EIBA 1ITXA 4DRQA 1ZBVA 2PPNA 1D7JA 3KADA 1ZB5A 3WL0A 1QPFA 4MNLA 2N87A 2WLYA 3NI6A 2PBCA 1LG2A 4QIBA 4DWSB 2KFWA 3IHZA 4R5EA 1PBKA 1Y0OA 2LKNA 1E6ZA 4JFLA 5HW8A 3UI4A 4HARA 1FKHA 2RUQA 3WD0A 2WM0A 2XP7A 1J4HA 3ODKA 3WD1A 3ARXA 2XP9A 3IKDA 5DO2A 2G41A 4ITZA 1WNOA 2XPBA 4N19A 4Q7NA 3ARPA 4ZPVR 4ODKA 4NNRA 3UF8A 3WIJA 1F40A 1ZBWA 3ALGA 4S3JA 1JNSA 3NTPA 4QT2A 4DRNA 4C02B 1FD9A 1M5YA 4ML4A 2ZQSA 1NWUA 1FJDA 2MNTA 4DWSC 3ALFA 3FAPA 1JNEA 1LL4A 2WLZA 3G6MA 4DZ3A 5J6EA 1OGBA 1ZL1A 1ZU8A 4Z2KA 3GPKA 3ARTA 2JZVA 2YBTA 1NWTA 3FY1A 2A3BA 5DIVA 1N1AA 1EDQA 4WK9A 1IX5A 4U85A 1JNDA 3AS2A 1EQ3A 2A3EA 1E6RA 3MDYB 3I6CA 4QT3A 3G6LA 1XHGA 4URIA 4MNKA 3ARYA 4DIPA 5BXJA 2DPEA 2PI6A 1Q6UA 3AS0A 4Z2IA 2ITKA 3KAHA 1FKIA 2F2DA 3LUOA 3WD4A 1FFRA 1LG1A 1UR9A 3KAGA 4JFKA 5HWBA 2O92A 3WL1A 4J4OA 4HBEA 4QZVB 2DSVA 1D6OA 3PRDA 2PPPA 1KT0A 2UZ5A 4ZS6A 5HBFA 3KABA 2DSUA 1JVWA 4IPXA 4KQZA 5GPRA 3RM4A 3B9DA 1XRVA 1D7HA 3CHFA 3PRAA 2DSWA 4P8UA 3WQWA 4ODLA 1YW5A 5B8IC 4HBOA 2MF9A 3WD2A 4Z2HA 1HKMA 2XP4A 1HKKA 1H0GA 5GQBA 1ZK6A 4R0XA 3PA7A 2VN1A 5GPGA 3AS1A 3KCEA 1LL7A 4WKFA 3ARWA 1P5QA 1TFVA 2IUZA 2O9OA 3CGMA 2RUCA 1PINA 2LPVA 4G50A 2PV2A 3CGNA 2PV1A 2KO7A 2XP5A 3FXYA 2AOSA 3H9RB 4DRHA 3CHEA 4FAPA 3JXVA 3RFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GPK A;  2KI3 A;  3KAC A;  4G2P A;  4DT4 A;  2ZR4 A;  1FKF A;  2KR7 A;  4LAV A;  1NSG A;  2JZV A;  3KAF A;  5HW6 A;  2MLY A;  1QPL A;  2DG3 A;  2DG9 A;  4TYO A;  5DIV A;  2XP6 A;  3O5G A;  4U84 A;  3O5D A;  2RQS A;  3O5K A;  1N1A A;  1J6Y A;  4DZ2 A;  1FKT A;  3O5I A;  3O5J A;  4U85 A;  4JFM A;  2L2S A;  4BF8 A;  1FKB A;  2MLZ A;  3EY6 A;  4MGV A;  4ODO A;  1BL4 A;  4LAW A;  3MDY B;  4W9O A;  4DRI A;  4DRM A;  1ROT A;  2XP8 A;  3I6C A;  4ODM A;  4QT3 A;  2RSE A;  2XPA A;  4LAX A;  1D7I A;  4TX0 A;  1HXV A;  4TW8 A;  5HUA A;  4FN2 A;  3TC5 A;  1FKS A;  1J4I A;  2PV3 A;  2DG4 A;  2RUD A;  5HT1 A;  3TCZ A;  4DIP A;  5BXJ A;  1Q6U A;  5HTG A;  2FAP A;  1TCO C;  2ITK A;  1Q1C A;  3KAH A;  3UQB A;  1ROU A;  3O5F A;  5D75 A;  1L1P A;  2M1I A;  2VCD A;  1NMV A;  2PPO A;  2K8I A;  2MPH A;  4IQC A;  3UQI A;  5I98 A;  1FKI A;  2F2D A;  2LGO A;  4JYS A;  3LUO A;  5HWC A;  4TW7 A;  4W9P A;  4U86 A;  3UI5 A;  2KGJ A;  4MSP A;  3KAG A;  3O5O A;  4JFK A;  1QZ2 A;  4DRJ A;  4DH0 A;  2ZR5 A;  1C9H A;  4DRQ A;  5HWB A;  2M08 A;  3JYM A;  3KAI A;  2ZQV A;  2PPN A;  4J4O A;  1D6O A;  3PRD A;  1FKG A;  4W9Q A;  1D7J A;  1KT0 A;  2PPP A;  2UZ5 A;  3KAD A;  3KAB A;  2RUR A;  3NRK A;  1JVW A;  1NMW A;  1QPF A;  2N87 A;  4IPX A;  1FKK A;  3O5P A;  2ZR6 A;  3NI6 A;  2PBC A;  1W26 A;  3O5Q A;  4ODR A;  1FAP A;  4QIB A;  3IKG A;  2KFW A;  1FKL A;  3O5E A;  1A7X A;  3WH0 A;  1D7H A;  3IHZ A;  1JNT A;  1PBK A;  1Y0O A;  5HW7 A;  2LKN A;  4ODL A;  1YW5 A;  4JFL A;  5B8I C;  2D9F A;  2XP3 A;  5HW8 A;  4IQ2 A;  4ODQ A;  2MF9 A;  1FKD A;  3UI4 A;  1FKH A;  2RUQ A;  2Y78 A;  4JFI A;  3UI6 A;  1FKJ A;  2XP4 A;  2XP7 A;  1J4H A;  3ODK A;  4J4N A;  4ODP A;  1ZK6 A;  2XP9 A;  3IKD A;  2FKE A;  4O2T A;  4ITZ A;  4R0X A;  3JYJ A;  3PA7 A;  5DIT A;  2XPB A;  4N19 A;  2VN1 A;  5GPG A;  3O5M A;  3KCE A;  4GGQ A;  4TW6 A;  4DRK A;  2F4E A;  3IK8 A;  1P5Q A;  2Q5A A;  4LAY A;  2F21 A;  1T11 A;  4NNR A;  4ODK A;  3UF8 A;  1EQ3 A;  1F40 A;  3UQA A;  1U79 A;  3PRB A;  5DIU A;  1JNS A;  3NTP A;  3O5R A;  1KT1 A;  3O5L A;  3CGM A;  2AWG A;  2KE0 A;  2RUC A;  1PIN A;  2OFN A;  4QT2 A;  4DRN A;  1F8A B;  1R9H A;  2LPV A;  1ZCN A;  1EYM A;  4C02 B;  3KZ7 A;  1FD9 A;  4G50 A;  5HKG A;  1Q6I A;  1J4R A;  1M5Y A;  2PV2 A;  1BKF A;  1FKR A;  3CGN A;  4JFJ A;  2PV1 A;  2ZQS A;  1YAT A;  2LJ4 A;  2KO7 A;  2XP5 A;  1FJD A;  1B6C A;  2MLX A;  3H9R B;  2MNT A;  3TDB A;  2IF4 A;  4DRH A;  1Q6H A;  3FAP A;  2ZQT A;  4GIV A;  3OOB A;  4ODN A;  4DRP A;  4DZ3 A;  5J6E A;  2M2A A;  3B7X A;  4DRO A;  4TNS A;  3VAW A;  4FAP A;  3JXV A;  2ZQU A;  3RFW A;  3RGC A; 
#chains in the Genus database with same CATH topology
 2EUL A;  3KAC A;  4G2P A;  4DT4 A;  1FKF A;  4LAV A;  4NSB A;  3KAF A;  5HW6 A;  2MLY A;  1QPL A;  3O5K A;  4DZ2 A;  4Z2J A;  4JFM A;  2DSZ A;  2L2S A;  3CH9 A;  2MLZ A;  1CTN A;  3EY6 A;  4ODO A;  4W5U A;  1W1V A;  4W9O A;  2RSE A;  2XPA A;  1HXV A;  4TW8 A;  2G8Z A;  2DT1 A;  3QOK A;  1ZBC A;  1X6N A;  5D75 A;  1HJV A;  2M1I A;  4KR0 B;  1NMV A;  2PPO A;  2K8I A;  1ZBK A;  4JYS A;  2LGO A;  4W9P A;  4U86 A;  3UI5 A;  4MSP A;  3ARR A;  4DRJ A;  4DH0 A;  2ZR5 A;  3JYM A;  3KAI A;  2ZQV A;  4LGX A;  2ESC A;  2YBU A;  1FKG A;  1HKJ A;  1HJX A;  1FKK A;  4NZC A;  4ODR A;  1FAP A;  3IKG A;  3WH0 A;  1A7X A;  3AQU A;  5DEZ A;  4IQ2 A;  4ZPT R;  4L3N A;  4ODQ A;  2Y78 A;  3UI6 A;  1FKJ A;  1O6I A;  4ODP A;  4MNJ A;  3JYJ A;  1VF8 A;  3ARZ A;  2WK2 A;  1OWQ A;  3O5M A;  1W1P A;  4DRK A;  4GGQ A;  2OLH A;  4P8W A;  3O5R A;  1KT1 A;  2KE0 A;  3RM9 A;  1F8A B;  1R9H A;  1ZCN A;  3KZ7 A;  1GRJ A;  4UDM A;  5HKG A;  1Q6I A;  3ARO A;  1BKF A;  1B6C A;  4Z2G A;  2IF4 A;  4DWS A;  4L72 B;  3ARS A;  4ODN A;  4DRP A;  4P8V A;  2DT0 A;  1NH6 A;  3B7X A;  4TNS A;  4DRO A;  3W4R A;  2ZQU A;  3RGC A;  4MNM A;  4IT6 A;  4TYO A;  2XP6 A;  4U84 A;  2RQS A;  1J6Y A;  1FKT A;  2P4V A;  3O5I A;  3O5J A;  3WKZ A;  1W9U A;  2DT3 A;  1FKB A;  4MGV A;  3RME A;  1OGG A;  4DRI A;  4LAW A;  3RM8 A;  2XP8 A;  1JCH B;  4ODM A;  4TX0 A;  1D7I A;  3B8S A;  3BMB A;  2F23 A;  4FN2 A;  1FKS A;  1J4I A;  5HT1 A;  5HTG A;  1TCO C;  1ROU A;  2QF8 A;  1FFQ A;  2MPH A;  4MPK A;  1W1T A;  1KFW A;  4S3K A;  4TW7 A;  2A3A A;  1C9H A;  1W1Y A;  2M08 A;  3GU0 A;  1D2K A;  4W9Q A;  4IT4 A;  4XAK A;  3NRK A;  2RUR A;  4O2T A;  1GUV A;  1NMW A;  3AS3 A;  5I98 A;  4Q22 A;  3O5P A;  2ZR6 A;  3O5Q A;  4TW6 A;  1W26 A;  3ARQ A;  1FKL A;  3O5E A;  3WD3 A;  1JNT A;  1WAW A;  3CHC A;  4MTV A;  5HW7 A;  1E6N A;  4WKH A;  2D9F A;  2XP3 A;  1GPF A;  1FKD A;  1E15 A;  2DT2 A;  1LQ0 A;  4JFI A;  3ARV A;  4Z2L A;  4J4N A;  1NWR A;  3CZ8 A;  2FDM A;  2FKE A;  3GTY X;  3WQV A;  5DIT A;  1H0I A;  2A3C A;  5JH8 A;  2F4E A;  3IK8 A;  2Q5A A;  4LAY A;  2F21 A;  1T11 A;  1RD6 A;  1EHN A;  3UQA A;  1U79 A;  3PRB A;  5DIU A;  4MAV A;  3O5L A;  2AWG A;  2OFN A;  5DF0 A;  1EYM A;  1J4R A;  3ARU A;  4AY1 A;  1FKR A;  4JFJ A;  1E44 A;  1SYT A;  1YAT A;  2LJ4 A;  4PTM A;  2MLX A;  1X6L A;  1E9L A;  3TDB A;  3CHD A;  1Q6H A;  2ZQT A;  4DWS D;  1W9V A;  4GIV A;  3OOB A;  2M2A A;  1HKI A;  1K9T A;  4P8X A;  3VAW A;  1WB0 A;  2KI3 A;  2ZR4 A;  3OA5 A;  2ETN A;  2KR7 A;  1NSG A;  2DG3 A;  2DG9 A;  3O5G A;  1NWS A;  3O5D A;  4ZPW R;  3BXW A;  3PR9 A;  4BF8 A;  3B9A A;  1BL4 A;  4DRM A;  4WIW A;  1ROT A;  4LAX A;  5HUA A;  3TC5 A;  3B9E A;  2RUD A;  2PV3 A;  2DG4 A;  3TCZ A;  4WKA A;  1GOI A;  1UR8 A;  2FAP A;  1LL6 A;  1Q1C A;  3UQB A;  1E6P A;  3O5F A;  1W9P A;  4WJX A;  1L1P A;  2VCD A;  4IQC A;  3UQI A;  5HWC A;  2B31 A;  1LJY A;  1SR0 A;  2KGJ A;  1HJW A;  3O5O A;  1QZ2 A;  1EIB A;  1ITX A;  4DRQ A;  1ZBV A;  2PPN A;  1D7J A;  3KAD A;  1ZB5 A;  3WL0 A;  1QPF A;  4MNL A;  2N87 A;  2WLY A;  3NI6 A;  2PBC A;  1LG2 A;  4QIB A;  4DWS B;  2KFW A;  3IHZ A;  4R5E A;  1PBK A;  1Y0O A;  2LKN A;  1E6Z A;  4JFL A;  5HW8 A;  3UI4 A;  4HAR A;  1FKH A;  2RUQ A;  3WD0 A;  2WM0 A;  2XP7 A;  1J4H A;  3ODK A;  3WD1 A;  3ARX A;  2XP9 A;  3IKD A;  5DO2 A;  2G41 A;  4ITZ A;  1WNO A;  2XPB A;  4N19 A;  4Q7N A;  3ARP A;  4ZPV R;  4ODK A;  2PN0 A;  4NNR A;  3UF8 A;  3WIJ A;  1F40 A;  1ZBW A;  3ALG A;  3EIP A;  4S3J A;  1JNS A;  3NTP A;  4QT2 A;  4DRN A;  4C02 B;  1FD9 A;  1M5Y A;  4ML4 A;  2ZQS A;  1NWU A;  1FJD A;  2MNT A;  4DWS C;  3ALF A;  3FAP A;  1JNE A;  1LL4 A;  2WLZ A;  3G6M A;  4DZ3 A;  5J6E A;  1OGB A;  1ZL1 A;  1ZU8 A;  4Z2K A;  3GPK A;  3ART A;  2JZV A;  2YBT A;  1NWT A;  3FY1 A;  2A3B A;  5DIV A;  1N1A A;  1EDQ A;  4WK9 A;  1IX5 A;  4U85 A;  1JND A;  3AS2 A;  1EQ3 A;  2A3E A;  1E6R A;  3MDY B;  3I6C A;  4QT3 A;  3G6L A;  1XHG A;  4URI A;  4MNK A;  3ARY A;  4DIP A;  5BXJ A;  2DPE A;  2PI6 A;  1Q6U A;  3AS0 A;  4Z2I A;  2ITK A;  3KAH A;  1FKI A;  2F2D A;  3LUO A;  3WD4 A;  1FFR A;  1LG1 A;  1UR9 A;  3KAG A;  4JFK A;  5HWB A;  2O92 A;  3WL1 A;  4J4O A;  4HBE A;  4QZV B;  2DSV A;  1D6O A;  3PRD A;  2PPP A;  1KT0 A;  2UZ5 A;  4ZS6 A;  5HBF A;  3KAB A;  2DSU A;  1JVW A;  2B5U B;  4IPX A;  4KQZ A;  5GPR A;  3RM4 A;  3B9D A;  1XRV A;  1D7H A;  3CHF A;  3PRA A;  2DSW A;  4P8U A;  3WQW A;  4ODL A;  1YW5 A;  5B8I C;  4HBO A;  2MF9 A;  3WD2 A;  4Z2H A;  1HKM A;  2XP4 A;  1HKK A;  1H0G A;  5GQB A;  1ZK6 A;  4R0X A;  3PA7 A;  2VN1 A;  5GPG A;  3AS1 A;  3KCE A;  1LL7 A;  4WKF A;  3ARW A;  1P5Q A;  1TFV A;  2IUZ A;  2O9O A;  3CGM A;  2RUC A;  1PIN A;  2LPV A;  4G50 A;  2PV2 A;  3CGN A;  2PV1 A;  2KO7 A;  2XP5 A;  3FXY A;  2AOS A;  3H9R B;  4DRH A;  3CHE A;  4FAP A;  3JXV A;  3RFW A; 
#chains in the Genus database with same CATH homology
 3KAC A;  4G2P A;  4DT4 A;  1FKF A;  4LAV A;  4NSB A;  3KAF A;  5HW6 A;  2MLY A;  1QPL A;  3O5K A;  4DZ2 A;  4Z2J A;  4JFM A;  2DSZ A;  2L2S A;  3CH9 A;  2MLZ A;  1CTN A;  3EY6 A;  4ODO A;  4W5U A;  1W1V A;  4W9O A;  2RSE A;  2XPA A;  1HXV A;  4TW8 A;  2G8Z A;  2DT1 A;  3QOK A;  1ZBC A;  1X6N A;  5D75 A;  1HJV A;  2M1I A;  4KR0 B;  1NMV A;  2PPO A;  2K8I A;  1ZBK A;  4JYS A;  2LGO A;  4W9P A;  4U86 A;  3UI5 A;  4MSP A;  3ARR A;  4DRJ A;  4DH0 A;  2ZR5 A;  3JYM A;  3KAI A;  2ZQV A;  4LGX A;  2ESC A;  2YBU A;  1FKG A;  1HKJ A;  1HJX A;  1FKK A;  4NZC A;  4ODR A;  1FAP A;  3IKG A;  3WH0 A;  1A7X A;  3AQU A;  5DEZ A;  4IQ2 A;  4ZPT R;  4L3N A;  4ODQ A;  2Y78 A;  3UI6 A;  1FKJ A;  1O6I A;  4ODP A;  4MNJ A;  3JYJ A;  1VF8 A;  3ARZ A;  2WK2 A;  1OWQ A;  3O5M A;  1W1P A;  4DRK A;  4GGQ A;  2OLH A;  4P8W A;  3O5R A;  1KT1 A;  2KE0 A;  3RM9 A;  1F8A B;  1R9H A;  1ZCN A;  3KZ7 A;  5HKG A;  1Q6I A;  3ARO A;  1BKF A;  1B6C A;  4Z2G A;  2IF4 A;  4DWS A;  4L72 B;  3ARS A;  4ODN A;  4DRP A;  4P8V A;  2DT0 A;  1NH6 A;  3B7X A;  4TNS A;  4DRO A;  3W4R A;  2ZQU A;  3RGC A;  4MNM A;  4IT6 A;  4TYO A;  2XP6 A;  4U84 A;  2RQS A;  1J6Y A;  1FKT A;  3O5I A;  3O5J A;  3WKZ A;  1W9U A;  2DT3 A;  1FKB A;  4MGV A;  3RME A;  1OGG A;  4DRI A;  4LAW A;  3RM8 A;  2XP8 A;  4ODM A;  4TX0 A;  1D7I A;  3B8S A;  4FN2 A;  1FKS A;  1J4I A;  5HT1 A;  5HTG A;  1TCO C;  1ROU A;  2QF8 A;  1FFQ A;  2MPH A;  4MPK A;  1W1T A;  1KFW A;  4S3K A;  4TW7 A;  2A3A A;  1C9H A;  1W1Y A;  2M08 A;  1D2K A;  4W9Q A;  4IT4 A;  4XAK A;  3NRK A;  2RUR A;  4O2T A;  1GUV A;  1NMW A;  3AS3 A;  5I98 A;  4Q22 A;  3O5P A;  2ZR6 A;  3O5Q A;  4TW6 A;  1W26 A;  3ARQ A;  1FKL A;  3O5E A;  3WD3 A;  1JNT A;  1WAW A;  3CHC A;  4MTV A;  5HW7 A;  1E6N A;  4WKH A;  2D9F A;  2XP3 A;  1GPF A;  1FKD A;  1E15 A;  2DT2 A;  1LQ0 A;  4JFI A;  3ARV A;  4Z2L A;  4J4N A;  1NWR A;  3CZ8 A;  2FDM A;  2FKE A;  3WQV A;  5DIT A;  1H0I A;  2A3C A;  5JH8 A;  2F4E A;  3IK8 A;  2Q5A A;  4LAY A;  2F21 A;  1T11 A;  1RD6 A;  1EHN A;  3UQA A;  1U79 A;  3PRB A;  5DIU A;  4MAV A;  3O5L A;  2AWG A;  2OFN A;  5DF0 A;  1EYM A;  1J4R A;  3ARU A;  4AY1 A;  1FKR A;  4JFJ A;  1YAT A;  1SYT A;  2LJ4 A;  4PTM A;  2MLX A;  1X6L A;  1E9L A;  3TDB A;  3CHD A;  1Q6H A;  2ZQT A;  4DWS D;  1W9V A;  4GIV A;  3OOB A;  2M2A A;  1HKI A;  1K9T A;  4P8X A;  3VAW A;  1WB0 A;  2KI3 A;  2ZR4 A;  3OA5 A;  2KR7 A;  1NSG A;  2DG3 A;  2DG9 A;  3O5G A;  1NWS A;  3O5D A;  4ZPW R;  3BXW A;  3PR9 A;  4BF8 A;  3B9A A;  1BL4 A;  4DRM A;  4WIW A;  1ROT A;  4LAX A;  5HUA A;  3TC5 A;  3B9E A;  2RUD A;  2PV3 A;  2DG4 A;  3TCZ A;  4WKA A;  1GOI A;  1UR8 A;  2FAP A;  1LL6 A;  1Q1C A;  3UQB A;  1E6P A;  3O5F A;  1W9P A;  4WJX A;  1L1P A;  2VCD A;  4IQC A;  3UQI A;  5HWC A;  2B31 A;  1LJY A;  1SR0 A;  2KGJ A;  1HJW A;  3O5O A;  1QZ2 A;  1EIB A;  1ITX A;  4DRQ A;  1ZBV A;  2PPN A;  1D7J A;  3KAD A;  1ZB5 A;  3WL0 A;  1QPF A;  4MNL A;  2N87 A;  2WLY A;  3NI6 A;  2PBC A;  1LG2 A;  4QIB A;  4DWS B;  2KFW A;  3IHZ A;  4R5E A;  1PBK A;  1Y0O A;  2LKN A;  1E6Z A;  4JFL A;  5HW8 A;  3UI4 A;  4HAR A;  1FKH A;  2RUQ A;  3WD0 A;  2WM0 A;  2XP7 A;  1J4H A;  3ODK A;  3WD1 A;  3ARX A;  2XP9 A;  3IKD A;  5DO2 A;  2G41 A;  4ITZ A;  1WNO A;  2XPB A;  4N19 A;  4Q7N A;  3ARP A;  4ZPV R;  4ODK A;  4NNR A;  3UF8 A;  3WIJ A;  1F40 A;  1ZBW A;  3ALG A;  4S3J A;  1JNS A;  3NTP A;  4QT2 A;  4DRN A;  4C02 B;  1FD9 A;  1M5Y A;  4ML4 A;  2ZQS A;  1NWU A;  1FJD A;  2MNT A;  4DWS C;  3ALF A;  3FAP A;  1JNE A;  1LL4 A;  2WLZ A;  3G6M A;  4DZ3 A;  5J6E A;  1OGB A;  1ZL1 A;  1ZU8 A;  4Z2K A;  3GPK A;  3ART A;  2JZV A;  2YBT A;  1NWT A;  3FY1 A;  2A3B A;  5DIV A;  1N1A A;  1EDQ A;  4WK9 A;  1IX5 A;  4U85 A;  1JND A;  3AS2 A;  1EQ3 A;  2A3E A;  1E6R A;  3MDY B;  3I6C A;  4QT3 A;  3G6L A;  1XHG A;  4URI A;  4MNK A;  3ARY A;  4DIP A;  5BXJ A;  2DPE A;  2PI6 A;  1Q6U A;  3AS0 A;  4Z2I A;  2ITK A;  3KAH A;  1FKI A;  2F2D A;  3LUO A;  3WD4 A;  1FFR A;  1LG1 A;  1UR9 A;  3KAG A;  4JFK A;  5HWB A;  2O92 A;  3WL1 A;  4J4O A;  4HBE A;  4QZV B;  2DSV A;  1D6O A;  3PRD A;  2PPP A;  1KT0 A;  2UZ5 A;  4ZS6 A;  5HBF A;  3KAB A;  2DSU A;  1JVW A;  4IPX A;  4KQZ A;  5GPR A;  3RM4 A;  3B9D A;  1XRV A;  1D7H A;  3CHF A;  3PRA A;  2DSW A;  4P8U A;  3WQW A;  4ODL A;  1YW5 A;  5B8I C;  4HBO A;  2MF9 A;  3WD2 A;  4Z2H A;  1HKM A;  2XP4 A;  1HKK A;  1H0G A;  5GQB A;  1ZK6 A;  4R0X A;  3PA7 A;  2VN1 A;  5GPG A;  3AS1 A;  3KCE A;  1LL7 A;  4WKF A;  3ARW A;  1P5Q A;  1TFV A;  2IUZ A;  2O9O A;  3CGM A;  2RUC A;  1PIN A;  2LPV A;  4G50 A;  2PV2 A;  3CGN A;  2PV1 A;  2KO7 A;  2XP5 A;  3FXY A;  2AOS A;  3H9R B;  4DRH A;  3CHE A;  4FAP A;  3JXV A;  3RFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...