5BXJA

Complex of the fk1 domain mutant a19t of fkbp51 with 4-nitrophenol
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
127
structure length
127
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The environmental endocrine disruptor p-nitrophenol interacts with FKBP51, a positive regulator of androgen receptor and inhibits androgen receptor signaling in human cells
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 32
structure length 127
sequence length 127
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2015-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5bxjA00
2RUDA 3TCZA 5HW6A 2F21A 4W9QA 3IHZA 3O5FA 3H9RB 1FD9A 1EQ3A 1ZK6A 1FKSA 1P5QA 5DITA 1PINA 4J4OA 1FKIA 2FAPA 3NI6A 3O5IA 4FN2A 4ODRA 5I98A 2ZR6A 4TW7A 1FKJA 3IKGA 2KGJA 5HW7A 3UQIA 2XP7A 1NSGA 2DG9A 2RUCA 1QZ2A 2VCDA 4LAVA 1FJDA 5DIUA 3GPKA 2K8IA 2MF9A 3PRBA 4N19A 4DZ3A 5HTGA 3O5MA 2KR7A 3O5OA 2PBCA 3KAGA 4IQ2A 5D75A 1R9HA 2M08A 4U86A 5HW8A 1QPLA 1QPFA 3KAFA 1YW5A 3O5JA 4QT2A 3KCEA 1D7HA 3TC5A 4DROA 1N1AA 2KO7A 2XPBA 4DRMA 5HKGA 3KAHA 1EYMA 2XP3A 1Q6IA 2XP4A 3IKDA 3TDBA 4GIVA 2M1IA 2ZR4A 4NNRA 4DT4A 1KT0A 3JYJA 1Q6HA 2RURA 2N87A 3UI6A 4DIPA 1FKTA 1T11A 3PRDA 2KI3A 4G50A 4LAYA 2L2SA 1NMVA 3UI4A 2XP8A 2M2AA 4JFMA 4DRPA 2XP5A 3UQAA 4DRIA 4ODKA 2ZQTA 1J6YA 1JNTA 1U79A 3O5QA 1FKFA 4ODPA 2PPPA 2IF4A 2XP6A 4DRHA 1FKKA 2RUQA 3KABA 2ZR5A 4ITZA 5HUAA 1Q1CA 2KFWA 4QIBA 1J4HA 3JXVA 3UQBA 3VAWA 2RSEA 4R0XA 1FKBA 3NTPA 3O5DA 3RGCA 1M5YA 2Y78A 1FKLA 3KAIA 2LPVA 2ZQSA 2FKEA 3KZ7A 4JYSA 4ODNA 5DIVA 4FAPA 2AWGA 2JZVA 5HT1A 2ZQUA 3JYMA 3MDYB 1J4IA 1FKGA 4TNSA 3O5LA 4BF8A 2UZ5A 3I6CA 1ROTA 2D9FA 4TW6A 4LAXA 3RFWA 1YATA 4DRJA 1JVWA 1D7IA 5HWBA 2LGOA 3CGNA 3LUOA 1L1PA 2ZQVA 3CGMA 1NMWA 4TW8A 3IK8A 4DH0A 5B8IC 1A7XA 1Y0OA 2RQSA 1BL4A 4QT3A 3UI5A 4JFIA 1W26A 5GPGA 2LJ4A 2ITKA 2MNTA 3ODKA 1C9HA 5J6EA 4MGVA 1KT1A 2PV3A 4O2TA 4DRKA 4IQCA 5HWCA 2MLXA 1TCOC 3UF8A 2PV1A 2XPAA 4GGQA 1ZCNA 1Q6UA 3KACA 4G2PA 1FKRA 3PA7A 2MLYA 4W9PA 2MPHA 1FKDA 2MLZA 3EY6A 2LKNA 3O5RA 3FAPA 4MSPA 4TX0A 2PPOA 4TYOA 2F4EA 3NRKA 3WH0A 1F40A 3B7XA 2DG4A 1JNSA 1HXVA 1D6OA 2VN1A 3O5GA 2XP9A 3KADA 3O5KA 3O5EA 4ODLA 4J4NA 1BKFA 3OOBA 4ODOA 4U85A 2PV2A 1B6CA 5BXJA 4JFLA 4DZ2A 4JFJA 4W9OA 3O5PA 2OFNA 4IPXA 4JFKA 2F2DA 4ODMA 1F8AB 1D7JA 4ODQA 4C02B 4U84A 2DG3A 2Q5AA 2KE0A 4DRQA 1PBKA 4DRNA 2PPNA 1J4RA 1FKHA 1FAPA 1ROUA 4LAWA
chains in the Genus database with same CATH superfamily
2RUDA 3TCZA 4IT6A 4W9QA 1WB0A 5GQBA 1W9VA 3H9RB 4MTVA 1FKSA 1FKIA 3NI6A 1UR8A 3GU0A 5HW7A 2KGJA 2DG9A 2RUCA 4LAVA 4P8XA 1OWQA 2MF9A 2AOSA 1NWUA 1OGGA 3UQBA 1NWRA 4URIA 1R9HA 2QF8A 3O5JA 3ALFA 1YW5A 1N1AA 4DRMA 3KAHA 1W1VA 1W9UA 4GIVA 2M1IA 4NNRA 1ITXA 4QZVB 4DWSC 2DT1A 1NMVA 3ARSA 2XP8A 3CHEA 1H0GA 3UQAA 4DRIA 1U79A 1FKFA 2IF4A 2XP6A 3KABA 2ZR5A 1Q1CA 1J4HA 2WLYA 4S3JA 2O9OA 1JNDA 1K9TA 3O5DA 2Y78A 1FKLA 2FKEA 2G8ZA 4FAPA 2JZVA 5HT1A 4DWSD 4IT4A 4TNSA 1LL4A 1YATA 1D7IA 1HKMA 2DT0A 4DH0A 4XAKA 1A7XA 4P8VA 3ARXA 3UI5A 4JFIA 2A3EA 1C9HA 1TCOC 1HJWA 1FKRA 2MLYA 4R5EA 1FKDA 2MLZA 4MSPA 1W1PA 4TX0A 3FAPA 3RGCA 3NRKA 3CHFA 1XRVA 4MPKA 1E6PA 1O6IA 4Z2JA 1HXVA 2WM0A 2XP9A 3KADA 3O5KA 4J4NA 4MAVA 3CZ8A 5DO2A 4JFJA 1FFRA 3O5PA 4C02B 1F8AB 3AROA 4ODQA 2DT3A 2KE0A 1X6LA 2PPNA 3GTYX 1ZL1A 3FXYA 2F21A 1OGBA 4WKHA 1NWSA 1PINA 2ZR6A 1W1TA 1NSGA 3BXWA 1FJDA 1QZ2A 2VCDA 1WNOA 5HTGA 3PRBA 2B5UB 3WD0A 2M08A 4U86A 5HW8A 1QPLA 3AS3A 3KAFA 4W5UA 4AY1A 1D7HA 3TC5A 4DROA 5HKGA 2KO7A 2XPBA 4WKAA 1NH6A 2XP3A 4PTMA 5DEZA 4WK9A 2ZR4A 4NSBA 3WD3A 3JYJA 2PN0A 2WLZA 3RM8A 1VF8A 3CH9A 4ML4A 1FKTA 1T11A 1WAWA 4LAYA 2YBUA 2M2AA 2G41A 4ODKA 4P8UA 1JNTA 1GRJA 4ODPA 2PPPA 4ITZA 2A3CA 2KFWA 3WL1A 1E9LA 4DWSA 3KAIA 3B9AA 2ZQSA 4ZPWR 3KZ7A 4ODNA 3JYMA 1HKIA 4BF8A 4TW6A 1ROTA 3ARWA 3RFWA 5HWBA 2F23A 4L3NA 1L1PA 3IK8A 3B9DA 5B8IC 4Q22A 1BL4A 3AQUA 4QT3A 1HKJA 1W26A 4Z2HA 2LJ4A 2YBTA 1KT1A 4O2TA 4DRKA 3UF8A 2PV1A 4G2PA 1ZCNA 3ARZA 2WK2A 3AS1A 3QOKA 3O5RA 3EY6A 4TYOA 3ARTA 2PPOA 4NZCA 3WD2A 1W1YA 3ARQA 3PRAA 4KR0B 3O5GA 1IX5A 4U85A 3O5EA 5GPRA 2PV2A 1E15A 3OA5A 4JFLA 4W9OA 3G6LA 1LJYA 2DG3A 4WIWA 4Z2IA 4J4OA 4LAWA 1X6NA 3WKZA 3WL0A 3IHZA 3B8SA 1ZBVA 1EQ3A 1ZK6A 4ZPVR 5DITA 4Z2KA 2DSUA 4ODRA 2FAPA 4FN2A 1FKJA 3IKGA 4MNJA 3UQIA 3GPKA 2K8IA 3AS0A 4DZ3A 2DSVA 4DWSB 1LG1A 2KR7A 3O5OA 2PBCA 4IQ2A 4MNKA 1QPFA 4QT2A 3KCEA 1HJVA 1Q6IA 3IKDA 3RM9A 3FY1A 4MNMA 1KT0A 1GPFA 2O92A 1RD6A 2N87A 4DIPA 3UI4A 4JFMA 4DRPA 2ZQTA 1J6YA 3ARUA 4DRHA 3JXVA 2FDMA 3VAWA 4ZPTR 1FKBA 3WD1A 1JNEA 2DT2A 4WJXA 1LL6A 5DIVA 4JYSA 2AWGA 2ZQUA 3G6MA 1FFQA 3MDYB 4WKFA 1FKGA 3O5LA 2UZ5A 3I6CA 2D9FA 4LAXA 4DRJA 1JVWA 3CGNA 3LUOA 4TW8A 1E44A 3W4RA 1Y0OA 2MNTA 3ODKA 2PV3A 3ARYA 4IQCA 1HJXA 4KQZA 1Q6UA 3ARVA 3KACA 2DPEA 1NWTA 2LKNA 3PR9A 2F4EA 3WH0A 4HBEA 4Q7NA 2VN1A 1SR0A 2DSZA 1E6ZA 4ODLA 3EIPA 1BKFA 3OOBA 1B6CA 2A3AA 1LL7A 4DZ2A 4IPXA 2F2DA 1D7JA 1HKKA 4DRQA 1PBKA 4DRNA 1J4RA 1ROUA 1E6RA 4Z2LA 5HW6A 3O5FA 1XHGA 4Z2GA 1FD9A 1P5QA 4MNLA 5I98A 3O5IA 4P8WA 2B31A 4TW7A 4HBOA 5HBFA 2XP7A 5DIUA 2EULA 4N19A 3O5MA 5D75A 3KAGA 1D2KA 1EYMA 2XP4A 3TDBA 1ZBKA 5DF0A 1GOIA 4LGXA 1TFVA 1EDQA 4DT4A 1Q6HA 2RURA 3UI6A 2P4VA 3PRDA 2KI3A 4G50A 3CHCA 2L2SA 2XP5A 2ESCA 1ZBWA 3O5QA 4HARA 1UR9A 3WD4A 3CHDA 1FKKA 2PI6A 2RUQA 5HUAA 4QIBA 2RSEA 4R0XA 3ARRA 3NTPA 4S3KA 4ZS6A 1M5YA 2LPVA 4L72B 1ZBCA 3WIJA 3RMEA 1J4IA 2LGOA 2IUZA 2ZQVA 3CGMA 1NMWA 3BMBA 3ALGA 2OLHA 2RQSA 1GUVA 1LG2A 1E6NA 5GPGA 3WQVA 2ITKA 5J6EA 4MGVA 5HWCA 2MLXA 2ETNA 2XPAA 4GGQA 1H0IA 1W9PA 1LQ0A 4UDMA 3PA7A 4W9PA 2MPHA 1ZB5A 3B9EA 1EIBA 2DSWA 2A3BA 1CTNA 1F40A 3B7XA 1JCHB 2DG4A 1JNSA 1D6OA 1SYTA 4ODOA 3AS2A 1KFWA 3ARPA 5BXJA 5JH8A 3RM4A 2OFNA 4JFKA 1EHNA 4ODMA 4U84A 2Q5AA 1FKHA 1FAPA 1ZU8A 3WQWA
chains in the Genus database with same CATH topology
2RUDA 3TCZA 4IT6A 4W9QA 1WB0A 5GQBA 1W9VA 3H9RB 4MTVA 1FKSA 1FKIA 3NI6A 1UR8A 5HW7A 2KGJA 2DG9A 2RUCA 4LAVA 4P8XA 1OWQA 2MF9A 2AOSA 1NWUA 1OGGA 3UQBA 1NWRA 4URIA 1R9HA 2QF8A 3O5JA 3ALFA 1YW5A 1N1AA 4DRMA 3KAHA 1W1VA 1W9UA 4GIVA 2M1IA 4NNRA 1ITXA 4QZVB 4DWSC 2DT1A 1NMVA 3ARSA 2XP8A 3CHEA 1H0GA 3UQAA 4DRIA 1U79A 1FKFA 2IF4A 2XP6A 3KABA 2ZR5A 1Q1CA 1J4HA 2WLYA 4S3JA 2O9OA 1JNDA 1K9TA 3O5DA 2Y78A 1FKLA 2FKEA 2G8ZA 4FAPA 2JZVA 5HT1A 4DWSD 4IT4A 4TNSA 1LL4A 1YATA 1D7IA 1HKMA 2DT0A 4DH0A 4XAKA 1A7XA 4P8VA 3ARXA 3UI5A 4JFIA 2A3EA 1C9HA 1TCOC 1HJWA 1FKRA 2MLYA 4R5EA 1FKDA 2MLZA 4MSPA 1W1PA 4TX0A 3FAPA 3RGCA 3NRKA 3CHFA 1XRVA 4MPKA 1E6PA 1O6IA 4Z2JA 1HXVA 2WM0A 2XP9A 3KADA 3O5KA 4J4NA 4MAVA 3CZ8A 5DO2A 4JFJA 1FFRA 3O5PA 4C02B 1F8AB 3AROA 4ODQA 2DT3A 2KE0A 1X6LA 2PPNA 1ZL1A 3FXYA 2F21A 1OGBA 4WKHA 1NWSA 1PINA 2ZR6A 1W1TA 1NSGA 3BXWA 1FJDA 1QZ2A 2VCDA 1WNOA 5HTGA 3PRBA 3WD0A 2M08A 4U86A 5HW8A 1QPLA 3AS3A 3KAFA 4W5UA 4AY1A 1D7HA 3TC5A 4DROA 5HKGA 2KO7A 2XPBA 4WKAA 1NH6A 2XP3A 4PTMA 5DEZA 4WK9A 2ZR4A 4NSBA 3WD3A 3JYJA 2WLZA 3RM8A 1VF8A 3CH9A 4ML4A 1FKTA 1T11A 1WAWA 4LAYA 2YBUA 2M2AA 2G41A 4ODKA 4P8UA 1JNTA 4ODPA 2PPPA 4ITZA 2A3CA 2KFWA 3WL1A 1E9LA 4DWSA 3KAIA 3B9AA 2ZQSA 4ZPWR 3KZ7A 4ODNA 3JYMA 1HKIA 4BF8A 4TW6A 1ROTA 3ARWA 3RFWA 5HWBA 4L3NA 1L1PA 3IK8A 3B9DA 5B8IC 4Q22A 1BL4A 3AQUA 4QT3A 1HKJA 1W26A 4Z2HA 2LJ4A 2YBTA 1KT1A 4O2TA 4DRKA 3UF8A 2PV1A 4G2PA 1ZCNA 3ARZA 2WK2A 3AS1A 3QOKA 3O5RA 3EY6A 4TYOA 3ARTA 2PPOA 4NZCA 3WD2A 1W1YA 3ARQA 3PRAA 4KR0B 3O5GA 1IX5A 4U85A 3O5EA 5GPRA 2PV2A 1E15A 3OA5A 4JFLA 4W9OA 3G6LA 1LJYA 2DG3A 4WIWA 4Z2IA 4J4OA 4LAWA 1X6NA 3WKZA 3WL0A 3IHZA 3B8SA 1ZBVA 1EQ3A 1ZK6A 4ZPVR 5DITA 4Z2KA 2DSUA 4ODRA 2FAPA 4FN2A 1FKJA 3IKGA 4MNJA 3UQIA 3GPKA 2K8IA 3AS0A 4DZ3A 2DSVA 4DWSB 1LG1A 2KR7A 3O5OA 2PBCA 4IQ2A 4MNKA 1QPFA 4QT2A 3KCEA 1HJVA 1Q6IA 3IKDA 3RM9A 3FY1A 4MNMA 1KT0A 1GPFA 2O92A 1RD6A 2N87A 4DIPA 3UI4A 4JFMA 4DRPA 2ZQTA 1J6YA 3ARUA 4DRHA 3JXVA 2FDMA 3VAWA 4ZPTR 1FKBA 3WD1A 1JNEA 2DT2A 4WJXA 1LL6A 5DIVA 4JYSA 2AWGA 2ZQUA 3G6MA 1FFQA 3MDYB 4WKFA 1FKGA 3O5LA 2UZ5A 3I6CA 2D9FA 4LAXA 4DRJA 1JVWA 3CGNA 3LUOA 4TW8A 3W4RA 1Y0OA 2MNTA 3ODKA 2PV3A 3ARYA 4IQCA 1HJXA 4KQZA 1Q6UA 3ARVA 3KACA 2DPEA 1NWTA 2LKNA 3PR9A 2F4EA 3WH0A 4HBEA 4Q7NA 2VN1A 1SR0A 2DSZA 1E6ZA 4ODLA 1BKFA 3OOBA 1B6CA 2A3AA 1LL7A 4DZ2A 4IPXA 2F2DA 1D7JA 1HKKA 4DRQA 1PBKA 4DRNA 1J4RA 1ROUA 1E6RA 4Z2LA 5HW6A 3O5FA 1XHGA 4Z2GA 1FD9A 1P5QA 4MNLA 5I98A 3O5IA 4P8WA 2B31A 4TW7A 4HBOA 5HBFA 2XP7A 5DIUA 4N19A 3O5MA 5D75A 3KAGA 1D2KA 1EYMA 2XP4A 3TDBA 1ZBKA 5DF0A 1GOIA 4LGXA 1TFVA 1EDQA 4DT4A 1Q6HA 2RURA 3UI6A 3PRDA 2KI3A 4G50A 3CHCA 2L2SA 2XP5A 2ESCA 1ZBWA 3O5QA 4HARA 1UR9A 3WD4A 3CHDA 1FKKA 2PI6A 2RUQA 5HUAA 4QIBA 2RSEA 4R0XA 3ARRA 3NTPA 4S3KA 4ZS6A 1M5YA 2LPVA 4L72B 1ZBCA 3WIJA 3RMEA 1J4IA 2LGOA 2IUZA 2ZQVA 3CGMA 1NMWA 3ALGA 2OLHA 2RQSA 1GUVA 1LG2A 1E6NA 5GPGA 3WQVA 2ITKA 5J6EA 4MGVA 5HWCA 2MLXA 2XPAA 4GGQA 1H0IA 1W9PA 1LQ0A 3PA7A 4W9PA 2MPHA 1ZB5A 3B9EA 1EIBA 2DSWA 2A3BA 1CTNA 1F40A 3B7XA 2DG4A 1JNSA 1D6OA 1SYTA 4ODOA 3AS2A 1KFWA 3ARPA 5BXJA 5JH8A 3RM4A 2OFNA 4JFKA 1EHNA 4ODMA 4U84A 2Q5AA 1FKHA 1FAPA 1ZU8A 3WQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RUD A;  3TCZ A;  5HW6 A;  2F21 A;  4W9Q A;  3IHZ A;  3O5F A;  3H9R B;  1FD9 A;  1EQ3 A;  1ZK6 A;  1FKS A;  1P5Q A;  5DIT A;  1PIN A;  4J4O A;  1FKI A;  2FAP A;  3NI6 A;  3O5I A;  4FN2 A;  4ODR A;  5I98 A;  2ZR6 A;  4TW7 A;  1FKJ A;  3IKG A;  2KGJ A;  5HW7 A;  3UQI A;  2XP7 A;  1NSG A;  2DG9 A;  2RUC A;  1QZ2 A;  2VCD A;  4LAV A;  1FJD A;  5DIU A;  3GPK A;  2K8I A;  2MF9 A;  3PRB A;  4N19 A;  4DZ3 A;  5HTG A;  3O5M A;  2KR7 A;  3O5O A;  2PBC A;  3KAG A;  4IQ2 A;  5D75 A;  1R9H A;  2M08 A;  4U86 A;  5HW8 A;  1QPL A;  1QPF A;  3KAF A;  1YW5 A;  3O5J A;  4QT2 A;  3KCE A;  1D7H A;  3TC5 A;  4DRO A;  1N1A A;  2KO7 A;  2XPB A;  4DRM A;  5HKG A;  3KAH A;  1EYM A;  2XP3 A;  1Q6I A;  2XP4 A;  3IKD A;  3TDB A;  4GIV A;  2M1I A;  2ZR4 A;  4NNR A;  4DT4 A;  1KT0 A;  3JYJ A;  1Q6H A;  2RUR A;  2N87 A;  3UI6 A;  4DIP A;  1FKT A;  1T11 A;  3PRD A;  2KI3 A;  4G50 A;  4LAY A;  2L2S A;  1NMV A;  3UI4 A;  2XP8 A;  2M2A A;  4JFM A;  4DRP A;  2XP5 A;  3UQA A;  4DRI A;  4ODK A;  2ZQT A;  1J6Y A;  1JNT A;  1U79 A;  3O5Q A;  1FKF A;  4ODP A;  2PPP A;  2IF4 A;  2XP6 A;  4DRH A;  1FKK A;  2RUQ A;  3KAB A;  2ZR5 A;  4ITZ A;  5HUA A;  1Q1C A;  2KFW A;  4QIB A;  1J4H A;  3JXV A;  3UQB A;  3VAW A;  2RSE A;  4R0X A;  1FKB A;  3NTP A;  3O5D A;  3RGC A;  1M5Y A;  2Y78 A;  1FKL A;  3KAI A;  2LPV A;  2ZQS A;  2FKE A;  3KZ7 A;  4JYS A;  4ODN A;  5DIV A;  4FAP A;  2AWG A;  2JZV A;  5HT1 A;  2ZQU A;  3JYM A;  3MDY B;  1J4I A;  1FKG A;  4TNS A;  3O5L A;  4BF8 A;  2UZ5 A;  3I6C A;  1ROT A;  2D9F A;  4TW6 A;  4LAX A;  3RFW A;  1YAT A;  4DRJ A;  1JVW A;  1D7I A;  5HWB A;  2LGO A;  3CGN A;  3LUO A;  1L1P A;  2ZQV A;  3CGM A;  1NMW A;  4TW8 A;  3IK8 A;  4DH0 A;  5B8I C;  1A7X A;  1Y0O A;  2RQS A;  1BL4 A;  4QT3 A;  3UI5 A;  4JFI A;  1W26 A;  5GPG A;  2LJ4 A;  2ITK A;  2MNT A;  3ODK A;  1C9H A;  5J6E A;  4MGV A;  1KT1 A;  2PV3 A;  4O2T A;  4DRK A;  4IQC A;  5HWC A;  2MLX A;  1TCO C;  3UF8 A;  2PV1 A;  2XPA A;  4GGQ A;  1ZCN A;  1Q6U A;  3KAC A;  4G2P A;  1FKR A;  3PA7 A;  2MLY A;  4W9P A;  2MPH A;  1FKD A;  2MLZ A;  3EY6 A;  2LKN A;  3O5R A;  3FAP A;  4MSP A;  4TX0 A;  2PPO A;  4TYO A;  2F4E A;  3NRK A;  3WH0 A;  1F40 A;  3B7X A;  2DG4 A;  1JNS A;  1HXV A;  1D6O A;  2VN1 A;  3O5G A;  2XP9 A;  3KAD A;  3O5K A;  3O5E A;  4ODL A;  4J4N A;  1BKF A;  3OOB A;  4ODO A;  4U85 A;  2PV2 A;  1B6C A;  5BXJ A;  4JFL A;  4DZ2 A;  4JFJ A;  4W9O A;  3O5P A;  2OFN A;  4IPX A;  4JFK A;  2F2D A;  4ODM A;  1F8A B;  1D7J A;  4ODQ A;  4C02 B;  4U84 A;  2DG3 A;  2Q5A A;  2KE0 A;  4DRQ A;  1PBK A;  4DRN A;  2PPN A;  1J4R A;  1FKH A;  1FAP A;  1ROU A;  4LAW A; 
#chains in the Genus database with same CATH topology
 2RUD A;  3TCZ A;  4IT6 A;  4W9Q A;  1WB0 A;  5GQB A;  1W9V A;  3H9R B;  4MTV A;  1FKS A;  1FKI A;  3NI6 A;  1UR8 A;  3GU0 A;  5HW7 A;  2KGJ A;  2DG9 A;  2RUC A;  4LAV A;  4P8X A;  1OWQ A;  2MF9 A;  2AOS A;  1NWU A;  1OGG A;  3UQB A;  1NWR A;  4URI A;  1R9H A;  2QF8 A;  3O5J A;  3ALF A;  1YW5 A;  1N1A A;  4DRM A;  3KAH A;  1W1V A;  1W9U A;  4GIV A;  2M1I A;  4NNR A;  1ITX A;  4QZV B;  4DWS C;  2DT1 A;  1NMV A;  3ARS A;  2XP8 A;  3CHE A;  1H0G A;  3UQA A;  4DRI A;  1U79 A;  1FKF A;  2IF4 A;  2XP6 A;  3KAB A;  2ZR5 A;  1Q1C A;  1J4H A;  2WLY A;  4S3J A;  2O9O A;  1JND A;  1K9T A;  3O5D A;  2Y78 A;  1FKL A;  2FKE A;  2G8Z A;  4FAP A;  2JZV A;  5HT1 A;  4DWS D;  4IT4 A;  4TNS A;  1LL4 A;  1YAT A;  1D7I A;  1HKM A;  2DT0 A;  4DH0 A;  4XAK A;  1A7X A;  4P8V A;  3ARX A;  3UI5 A;  4JFI A;  2A3E A;  1C9H A;  1TCO C;  1HJW A;  1FKR A;  2MLY A;  4R5E A;  1FKD A;  2MLZ A;  4MSP A;  1W1P A;  4TX0 A;  3FAP A;  3RGC A;  3NRK A;  3CHF A;  1XRV A;  4MPK A;  1E6P A;  1O6I A;  4Z2J A;  1HXV A;  2WM0 A;  2XP9 A;  3KAD A;  3O5K A;  4J4N A;  4MAV A;  3CZ8 A;  5DO2 A;  4JFJ A;  1FFR A;  3O5P A;  4C02 B;  1F8A B;  3ARO A;  4ODQ A;  2DT3 A;  2KE0 A;  1X6L A;  2PPN A;  3GTY X;  1ZL1 A;  3FXY A;  2F21 A;  1OGB A;  4WKH A;  1NWS A;  1PIN A;  2ZR6 A;  1W1T A;  1NSG A;  3BXW A;  1FJD A;  1QZ2 A;  2VCD A;  1WNO A;  5HTG A;  3PRB A;  2B5U B;  3WD0 A;  2M08 A;  4U86 A;  5HW8 A;  1QPL A;  3AS3 A;  3KAF A;  4W5U A;  4AY1 A;  1D7H A;  3TC5 A;  4DRO A;  5HKG A;  2KO7 A;  2XPB A;  4WKA A;  1NH6 A;  2XP3 A;  4PTM A;  5DEZ A;  4WK9 A;  2ZR4 A;  4NSB A;  3WD3 A;  3JYJ A;  2PN0 A;  2WLZ A;  3RM8 A;  1VF8 A;  3CH9 A;  4ML4 A;  1FKT A;  1T11 A;  1WAW A;  4LAY A;  2YBU A;  2M2A A;  2G41 A;  4ODK A;  4P8U A;  1JNT A;  1GRJ A;  4ODP A;  2PPP A;  4ITZ A;  2A3C A;  2KFW A;  3WL1 A;  1E9L A;  4DWS A;  3KAI A;  3B9A A;  2ZQS A;  4ZPW R;  3KZ7 A;  4ODN A;  3JYM A;  1HKI A;  4BF8 A;  4TW6 A;  1ROT A;  3ARW A;  3RFW A;  5HWB A;  2F23 A;  4L3N A;  1L1P A;  3IK8 A;  3B9D A;  5B8I C;  4Q22 A;  1BL4 A;  3AQU A;  4QT3 A;  1HKJ A;  1W26 A;  4Z2H A;  2LJ4 A;  2YBT A;  1KT1 A;  4O2T A;  4DRK A;  3UF8 A;  2PV1 A;  4G2P A;  1ZCN A;  3ARZ A;  2WK2 A;  3AS1 A;  3QOK A;  3O5R A;  3EY6 A;  4TYO A;  3ART A;  2PPO A;  4NZC A;  3WD2 A;  1W1Y A;  3ARQ A;  3PRA A;  4KR0 B;  3O5G A;  1IX5 A;  4U85 A;  3O5E A;  5GPR A;  2PV2 A;  1E15 A;  3OA5 A;  4JFL A;  4W9O A;  3G6L A;  1LJY A;  2DG3 A;  4WIW A;  4Z2I A;  4J4O A;  4LAW A;  1X6N A;  3WKZ A;  3WL0 A;  3IHZ A;  3B8S A;  1ZBV A;  1EQ3 A;  1ZK6 A;  4ZPV R;  5DIT A;  4Z2K A;  2DSU A;  4ODR A;  2FAP A;  4FN2 A;  1FKJ A;  3IKG A;  4MNJ A;  3UQI A;  3GPK A;  2K8I A;  3AS0 A;  4DZ3 A;  2DSV A;  4DWS B;  1LG1 A;  2KR7 A;  3O5O A;  2PBC A;  4IQ2 A;  4MNK A;  1QPF A;  4QT2 A;  3KCE A;  1HJV A;  1Q6I A;  3IKD A;  3RM9 A;  3FY1 A;  4MNM A;  1KT0 A;  1GPF A;  2O92 A;  1RD6 A;  2N87 A;  4DIP A;  3UI4 A;  4JFM A;  4DRP A;  2ZQT A;  1J6Y A;  3ARU A;  4DRH A;  3JXV A;  2FDM A;  3VAW A;  4ZPT R;  1FKB A;  3WD1 A;  1JNE A;  2DT2 A;  4WJX A;  1LL6 A;  5DIV A;  4JYS A;  2AWG A;  2ZQU A;  3G6M A;  1FFQ A;  3MDY B;  4WKF A;  1FKG A;  3O5L A;  2UZ5 A;  3I6C A;  2D9F A;  4LAX A;  4DRJ A;  1JVW A;  3CGN A;  3LUO A;  4TW8 A;  1E44 A;  3W4R A;  1Y0O A;  2MNT A;  3ODK A;  2PV3 A;  3ARY A;  4IQC A;  1HJX A;  4KQZ A;  1Q6U A;  3ARV A;  3KAC A;  2DPE A;  1NWT A;  2LKN A;  3PR9 A;  2F4E A;  3WH0 A;  4HBE A;  4Q7N A;  2VN1 A;  1SR0 A;  2DSZ A;  1E6Z A;  4ODL A;  3EIP A;  1BKF A;  3OOB A;  1B6C A;  2A3A A;  1LL7 A;  4DZ2 A;  4IPX A;  2F2D A;  1D7J A;  1HKK A;  4DRQ A;  1PBK A;  4DRN A;  1J4R A;  1ROU A;  1E6R A;  4Z2L A;  5HW6 A;  3O5F A;  1XHG A;  4Z2G A;  1FD9 A;  1P5Q A;  4MNL A;  5I98 A;  3O5I A;  4P8W A;  2B31 A;  4TW7 A;  4HBO A;  5HBF A;  2XP7 A;  5DIU A;  2EUL A;  4N19 A;  3O5M A;  5D75 A;  3KAG A;  1D2K A;  1EYM A;  2XP4 A;  3TDB A;  1ZBK A;  5DF0 A;  1GOI A;  4LGX A;  1TFV A;  1EDQ A;  4DT4 A;  1Q6H A;  2RUR A;  3UI6 A;  2P4V A;  3PRD A;  2KI3 A;  4G50 A;  3CHC A;  2L2S A;  2XP5 A;  2ESC A;  1ZBW A;  3O5Q A;  4HAR A;  1UR9 A;  3WD4 A;  3CHD A;  1FKK A;  2PI6 A;  2RUQ A;  5HUA A;  4QIB A;  2RSE A;  4R0X A;  3ARR A;  3NTP A;  4S3K A;  4ZS6 A;  1M5Y A;  2LPV A;  4L72 B;  1ZBC A;  3WIJ A;  3RME A;  1J4I A;  2LGO A;  2IUZ A;  2ZQV A;  3CGM A;  1NMW A;  3BMB A;  3ALG A;  2OLH A;  2RQS A;  1GUV A;  1LG2 A;  1E6N A;  5GPG A;  3WQV A;  2ITK A;  5J6E A;  4MGV A;  5HWC A;  2MLX A;  2ETN A;  2XPA A;  4GGQ A;  1H0I A;  1W9P A;  1LQ0 A;  4UDM A;  3PA7 A;  4W9P A;  2MPH A;  1ZB5 A;  3B9E A;  1EIB A;  2DSW A;  2A3B A;  1CTN A;  1F40 A;  3B7X A;  1JCH B;  2DG4 A;  1JNS A;  1D6O A;  1SYT A;  4ODO A;  3AS2 A;  1KFW A;  3ARP A;  5BXJ A;  5JH8 A;  3RM4 A;  2OFN A;  4JFK A;  1EHN A;  4ODM A;  4U84 A;  2Q5A A;  1FKH A;  1FAP A;  1ZU8 A;  3WQW A; 
#chains in the Genus database with same CATH homology
 2RUD A;  3TCZ A;  4IT6 A;  4W9Q A;  1WB0 A;  5GQB A;  1W9V A;  3H9R B;  4MTV A;  1FKS A;  1FKI A;  3NI6 A;  1UR8 A;  5HW7 A;  2KGJ A;  2DG9 A;  2RUC A;  4LAV A;  4P8X A;  1OWQ A;  2MF9 A;  2AOS A;  1NWU A;  1OGG A;  3UQB A;  1NWR A;  4URI A;  1R9H A;  2QF8 A;  3O5J A;  3ALF A;  1YW5 A;  1N1A A;  4DRM A;  3KAH A;  1W1V A;  1W9U A;  4GIV A;  2M1I A;  4NNR A;  1ITX A;  4QZV B;  4DWS C;  2DT1 A;  1NMV A;  3ARS A;  2XP8 A;  3CHE A;  1H0G A;  3UQA A;  4DRI A;  1U79 A;  1FKF A;  2IF4 A;  2XP6 A;  3KAB A;  2ZR5 A;  1Q1C A;  1J4H A;  2WLY A;  4S3J A;  2O9O A;  1JND A;  1K9T A;  3O5D A;  2Y78 A;  1FKL A;  2FKE A;  2G8Z A;  4FAP A;  2JZV A;  5HT1 A;  4DWS D;  4IT4 A;  4TNS A;  1LL4 A;  1YAT A;  1D7I A;  1HKM A;  2DT0 A;  4DH0 A;  4XAK A;  1A7X A;  4P8V A;  3ARX A;  3UI5 A;  4JFI A;  2A3E A;  1C9H A;  1TCO C;  1HJW A;  1FKR A;  2MLY A;  4R5E A;  1FKD A;  2MLZ A;  4MSP A;  1W1P A;  4TX0 A;  3FAP A;  3RGC A;  3NRK A;  3CHF A;  1XRV A;  4MPK A;  1E6P A;  1O6I A;  4Z2J A;  1HXV A;  2WM0 A;  2XP9 A;  3KAD A;  3O5K A;  4J4N A;  4MAV A;  3CZ8 A;  5DO2 A;  4JFJ A;  1FFR A;  3O5P A;  4C02 B;  1F8A B;  3ARO A;  4ODQ A;  2DT3 A;  2KE0 A;  1X6L A;  2PPN A;  1ZL1 A;  3FXY A;  2F21 A;  1OGB A;  4WKH A;  1NWS A;  1PIN A;  2ZR6 A;  1W1T A;  1NSG A;  3BXW A;  1FJD A;  1QZ2 A;  2VCD A;  1WNO A;  5HTG A;  3PRB A;  3WD0 A;  2M08 A;  4U86 A;  5HW8 A;  1QPL A;  3AS3 A;  3KAF A;  4W5U A;  4AY1 A;  1D7H A;  3TC5 A;  4DRO A;  5HKG A;  2KO7 A;  2XPB A;  4WKA A;  1NH6 A;  2XP3 A;  4PTM A;  5DEZ A;  4WK9 A;  2ZR4 A;  4NSB A;  3WD3 A;  3JYJ A;  2WLZ A;  3RM8 A;  1VF8 A;  3CH9 A;  4ML4 A;  1FKT A;  1T11 A;  1WAW A;  4LAY A;  2YBU A;  2M2A A;  2G41 A;  4ODK A;  4P8U A;  1JNT A;  4ODP A;  2PPP A;  4ITZ A;  2A3C A;  2KFW A;  3WL1 A;  1E9L A;  4DWS A;  3KAI A;  3B9A A;  2ZQS A;  4ZPW R;  3KZ7 A;  4ODN A;  3JYM A;  1HKI A;  4BF8 A;  4TW6 A;  1ROT A;  3ARW A;  3RFW A;  5HWB A;  4L3N A;  1L1P A;  3IK8 A;  3B9D A;  5B8I C;  4Q22 A;  1BL4 A;  3AQU A;  4QT3 A;  1HKJ A;  1W26 A;  4Z2H A;  2LJ4 A;  2YBT A;  1KT1 A;  4O2T A;  4DRK A;  3UF8 A;  2PV1 A;  4G2P A;  1ZCN A;  3ARZ A;  2WK2 A;  3AS1 A;  3QOK A;  3O5R A;  3EY6 A;  4TYO A;  3ART A;  2PPO A;  4NZC A;  3WD2 A;  1W1Y A;  3ARQ A;  3PRA A;  4KR0 B;  3O5G A;  1IX5 A;  4U85 A;  3O5E A;  5GPR A;  2PV2 A;  1E15 A;  3OA5 A;  4JFL A;  4W9O A;  3G6L A;  1LJY A;  2DG3 A;  4WIW A;  4Z2I A;  4J4O A;  4LAW A;  1X6N A;  3WKZ A;  3WL0 A;  3IHZ A;  3B8S A;  1ZBV A;  1EQ3 A;  1ZK6 A;  4ZPV R;  5DIT A;  4Z2K A;  2DSU A;  4ODR A;  2FAP A;  4FN2 A;  1FKJ A;  3IKG A;  4MNJ A;  3UQI A;  3GPK A;  2K8I A;  3AS0 A;  4DZ3 A;  2DSV A;  4DWS B;  1LG1 A;  2KR7 A;  3O5O A;  2PBC A;  4IQ2 A;  4MNK A;  1QPF A;  4QT2 A;  3KCE A;  1HJV A;  1Q6I A;  3IKD A;  3RM9 A;  3FY1 A;  4MNM A;  1KT0 A;  1GPF A;  2O92 A;  1RD6 A;  2N87 A;  4DIP A;  3UI4 A;  4JFM A;  4DRP A;  2ZQT A;  1J6Y A;  3ARU A;  4DRH A;  3JXV A;  2FDM A;  3VAW A;  4ZPT R;  1FKB A;  3WD1 A;  1JNE A;  2DT2 A;  4WJX A;  1LL6 A;  5DIV A;  4JYS A;  2AWG A;  2ZQU A;  3G6M A;  1FFQ A;  3MDY B;  4WKF A;  1FKG A;  3O5L A;  2UZ5 A;  3I6C A;  2D9F A;  4LAX A;  4DRJ A;  1JVW A;  3CGN A;  3LUO A;  4TW8 A;  3W4R A;  1Y0O A;  2MNT A;  3ODK A;  2PV3 A;  3ARY A;  4IQC A;  1HJX A;  4KQZ A;  1Q6U A;  3ARV A;  3KAC A;  2DPE A;  1NWT A;  2LKN A;  3PR9 A;  2F4E A;  3WH0 A;  4HBE A;  4Q7N A;  2VN1 A;  1SR0 A;  2DSZ A;  1E6Z A;  4ODL A;  1BKF A;  3OOB A;  1B6C A;  2A3A A;  1LL7 A;  4DZ2 A;  4IPX A;  2F2D A;  1D7J A;  1HKK A;  4DRQ A;  1PBK A;  4DRN A;  1J4R A;  1ROU A;  1E6R A;  4Z2L A;  5HW6 A;  3O5F A;  1XHG A;  4Z2G A;  1FD9 A;  1P5Q A;  4MNL A;  5I98 A;  3O5I A;  4P8W A;  2B31 A;  4TW7 A;  4HBO A;  5HBF A;  2XP7 A;  5DIU A;  4N19 A;  3O5M A;  5D75 A;  3KAG A;  1D2K A;  1EYM A;  2XP4 A;  3TDB A;  1ZBK A;  5DF0 A;  1GOI A;  4LGX A;  1TFV A;  1EDQ A;  4DT4 A;  1Q6H A;  2RUR A;  3UI6 A;  3PRD A;  2KI3 A;  4G50 A;  3CHC A;  2L2S A;  2XP5 A;  2ESC A;  1ZBW A;  3O5Q A;  4HAR A;  1UR9 A;  3WD4 A;  3CHD A;  1FKK A;  2PI6 A;  2RUQ A;  5HUA A;  4QIB A;  2RSE A;  4R0X A;  3ARR A;  3NTP A;  4S3K A;  4ZS6 A;  1M5Y A;  2LPV A;  4L72 B;  1ZBC A;  3WIJ A;  3RME A;  1J4I A;  2LGO A;  2IUZ A;  2ZQV A;  3CGM A;  1NMW A;  3ALG A;  2OLH A;  2RQS A;  1GUV A;  1LG2 A;  1E6N A;  5GPG A;  3WQV A;  2ITK A;  5J6E A;  4MGV A;  5HWC A;  2MLX A;  2XPA A;  4GGQ A;  1H0I A;  1W9P A;  1LQ0 A;  3PA7 A;  4W9P A;  2MPH A;  1ZB5 A;  3B9E A;  1EIB A;  2DSW A;  2A3B A;  1CTN A;  1F40 A;  3B7X A;  2DG4 A;  1JNS A;  1D6O A;  1SYT A;  4ODO A;  3AS2 A;  1KFW A;  3ARP A;  5BXJ A;  5JH8 A;  3RM4 A;  2OFN A;  4JFK A;  1EHN A;  4ODM A;  4U84 A;  2Q5A A;  1FKH A;  1FAP A;  1ZU8 A;  3WQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...