5BXJA

Complex of the fk1 domain mutant a19t of fkbp51 with 4-nitrophenol
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
127
structure length
127
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title The environmental endocrine disruptor p-nitrophenol interacts with FKBP51, a positive regulator of androgen receptor and inhibits androgen receptor signaling in human cells
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 127
sequence length 127
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2015-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5bxjA00
3O5QA 3NI6A 2RUCA 1ROTA 1Q6HA 3PRDA 4G2PA 3O5RA 4TW7A 2MNTA 2LPVA 4MSPA 2XPAA 5HTGA 4GGQA 4JFLA 3FAPA 4JFKA 1F40A 2XP6A 2D9FA 4J4OA 4MGVA 5HT1A 3TCZA 2RUDA 1QZ2A 1QPFA 4TX0A 4BF8A 1J4RA 3IKGA 4FN2A 3I6CA 3UI6A 2PPPA 2ZQSA 3O5IA 3OOBA 4TW8A 3KAHA 4DRQA 3KAFA 2XP7A 3KZ7A 2KE0A 3O5JA 5HWBA 1EYMA 4W9QA 4G50A 4FAPA 5HW7A 1Q1CA 4ODRA 4U84A 3O5DA 3MDYB 1FKBA 2LJ4A 1F8AB 2XP8A 3RGCA 3UF8A 3PA7A 1PINA 3UQAA 2F2DA 2K8IA 2XP5A 3KAGA 1FD9A 4JFMA 5HKGA 4C02B 3UI4A 3UI5A 1BKFA 2DG9A 1W26A 4IPXA 2JZVA 1B6CA 2FAPA 4O2TA 3H9RB 1FKGA 2PV2A 3JYMA 5B8IC 2RSEA 3LUOA 4ODPA 3JXVA 3TC5A 4TYOA 4DROA 1D7JA 2VN1A 4DRIA 4DRHA 3CGMA 1D7HA 4QT2A 4DH0A 4JYSA 1ZCNA 4QIBA 2KGJA 2LGOA 3WH0A 1A7XA 5J6EA 2ZQUA 2PPNA 1L1PA 2F4EA 1FKSA 4W9PA 1FKIA 4IQ2A 2ZR4A 2KFWA 3O5KA 1M5YA 2N87A 2ZR5A 4DRMA 1KT0A 1BL4A 2ITKA 2M2AA 2Q5AA 3ODKA 1QPLA 3PRBA 1U79A 1FKJA 1FJDA 1NMVA 1Q6IA 1JNSA 5HUAA 2MLYA 4NNRA 2LKNA 2FKEA 4R0XA 1Y0OA 1FKDA 3KABA 3O5FA 5HW8A 4LAVA 3O5LA 2RUQA 5D75A 2ZR6A 4J4NA 2MF9A 2PV1A 1YATA 5DIVA 1JNTA 2M1IA 2OFNA 2VCDA 2Y78A 3IKDA 4GIVA 4ODLA 4ODOA 1NMWA 2PPOA 3JYJA 4U85A 1FKLA 4JFIA 4ODMA 2PBCA 4ODQA 2ZQVA 4W9OA 4IQCA 4TW6A 4DRPA 2DG3A 4TNSA 5BXJA 5I98A 2KR7A 3O5OA 3KACA 1KT1A 1FAPA 1FKKA 1FKRA 1N1AA 2ZQTA 2L2SA 1ZK6A 5HW6A 2M08A 4ITZA 1J4HA 3UQIA 3O5MA 4DIPA 4DZ3A 3UQBA 3O5PA 1EQ3A 3NTPA 1D6OA 3B7XA 3IK8A 2KI3A 2UZ5A 4LAXA 4DRKA 1T11A 1TCOC 4U86A 1P5QA 1ROUA 2MLXA 4DZ2A 1R9HA 3NRKA 3O5GA 2DG4A 1Q6UA 1PBKA 2RURA 4DRJA 1FKHA 1YW5A 3O5EA 3TDBA 2XP9A 3RFWA 3VAWA 2PV3A 2XP3A 1D7IA 3CGNA 4ODKA 4ODNA 2XP4A 1C9HA 1NSGA 4N19A 1FKTA 5HWCA 2KO7A 4LAWA 3KAIA 3GPKA 4QT3A 2F21A 5GPGA 2XPBA 1J4IA 2IF4A 1JVWA 3KADA 5DIUA 1FKFA 5DITA 1HXVA 3EY6A 2AWGA 2RQSA 4DT4A 3IHZA 2MPHA 4JFJA 4DRNA 3KCEA 4LAYA 1J6YA 2MLZA
chains in the Genus database with same CATH superfamily
4UDMA 1Q6HA 4G2PA 1ZBCA 4GGQA 3FAPA 2XP6A 1ZBWA 4ZPWR 3O5IA 3KAFA 3WD1A 3O5JA 1EYMA 1Q1CA 3AQUA 4U84A 1HKIA 1FKBA 1F8AB 1FFQA 3KAGA 3UI4A 3UI5A 4IPXA 4WKHA 1H0IA 1HJVA 4HBEA 1W9PA 1GRJA 2VN1A 4Z2IA 3CGMA 4QT2A 1LG2A 4JYSA 4QIBA 5J6EA 1A7XA 5DF0A 1ZU8A 3ARYA 1L1PA 4W9PA 2DT3A 2N87A 4DRMA 1KT0A 2Q5AA 3PRBA 5HUAA 2LKNA 1JCHB 3W4RA 3O5LA 4GIVA 4ODLA 3IKDA 1HJXA 1SYTA 4ODQA 4W9OA 1E15A 4TW6A 4DRPA 1X6LA 4TNSA 1HKJA 2A3CA 2KR7A 1KT1A 1GUVA 1D6OA 4LAXA 4DRKA 1W9VA 3GTYX 3WQWA 1TCOC 1EIBA 3WD3A 1XRVA 1Q6UA 2ESCA 1FKHA 1YW5A 4MNLA 2PV3A 1RD6A 1D7IA 2XP3A 3CGNA 1C9HA 4S3JA 1XHGA 5HWCA 2A3EA 3GPKA 4QT3A 5GPGA 2XPBA 2IF4A 3CH9A 1HXVA 4DWSA 2O9OA 2G8ZA 3IHZA 1NWTA 4DRNA 2OLHA 5JH8A 3B8SA 1ROTA 5HTGA 1K9TA 3O5RA 3WD2A 1IX5A 1E6ZA 3EIPA 4JFKA 2D9FA 5HT1A 3CZ8A 2RUDA 1QPFA 4XAKA 4AY1A 1J4RA 3IKGA 4FN2A 2ZQSA 3OOBA 4TW8A 3KAHA 2XP7A 5HWBA 2KE0A 1HJWA 4HBOA 4W9QA 4DWSD 3RM8A 1E6PA 1EHNA 3GU0A 4P8UA 2DG9A 1W26A 3ARVA 1B6CA 4QZVB 3ARSA 4P8VA 3H9RB 3ARQA 1UR8A 1ZBKA 1JNDA 1OGGA 3G6LA 3RMEA 3B9EA 4DRIA 4DRHA 1OWQA 2DT1A 3ARRA 4DH0A 1ZCNA 2KGJA 2O92A 3AS2A 5GQBA 2DSVA 2IUZA 2F4EA 1X6NA 5DEZA 1W1TA 2ZR4A 4IT4A 4DWSB 1M5YA 4Q22A 2PI6A 1WB0A 1QPLA 3AROA 1FJDA 1TFVA 3AS1A 4NNRA 2YBTA 1FKDA 3KABA 3O5FA 3PRAA 1LJYA 4Z2GA 1WAWA 4IT6A 3ARUA 2VCDA 4ODOA 4Z2KA 1NMWA 4U85A 1FKLA 2A3BA 4ODMA 2PBCA 2ZQVA 2DG3A 5I98A 4MNKA 3BMBA 1FAPA 1FKKA 1N1AA 2L2SA 1ZK6A 2M08A 2DPEA 4ITZA 3O5MA 3AS3A 3IK8A 2AOSA 4U86A 3ARTA 1NWRA 4URIA 3CHFA 3CHEA 4L72B 2EULA 3NRKA 3O5GA 3ARZA 1LL4A 2DG4A 4DRJA 3O5EA 3TDBA 3OA5A 3RFWA 3VAWA 4ZPTR 1W9UA 4ODNA 1NSGA 4N19A 3WKZA 3FXYA 1FKTA 1LQ0A 2KO7A 4LAWA 1GPFA 3KAIA 3KADA 3EY6A 1SR0A 2RQSA 1W1VA 2MPHA 4LAYA 1NWSA 3O5QA 4MNJA 2RUCA 3PRDA 4TW7A 2LPVA 2XPAA 1ZBVA 4MGVA 1KFWA 3TCZA 1QZ2A 4TX0A 3I6CA 2G41A 2PPPA 2DT0A 4DRQA 1WNOA 4FAPA 5HW7A 2ETNA 4ODRA 3FY1A 3ARPA 3O5DA 2LJ4A 2DSZA 3RGCA 3UF8A 2DSUA 2WLZA 2K8IA 2XP5A 4HARA 4C02B 2A3AA 1O6IA 2JZVA 2QF8A 1NWUA 2FAPA 4O2TA 4S3KA 1FKGA 3JYMA 5B8IC 3LUOA 4MPKA 3TC5A 4DROA 3ALFA 1D7JA 4LGXA 3ALGA 1GOIA 1W1PA 4DWSC 1D7HA 3WH0A 2P4VA 3CHDA 2ZQUA 1FKSA 5GPRA 2KFWA 3ARWA 5HBFA 2M2AA 3ODKA 3B9DA 1JNSA 1EDQA 2FKEA 5HW8A 1Y0OA 4KQZA 3CHCA 4W5UA 5DO2A 3RM4A 4LAVA 4ZS6A 2DT2A 3QOKA 2ZR6A 4PTMA 1YATA 5DIVA 1E9LA 3B9AA 3WD0A 2Y78A 2PPOA 3JYJA 4WKFA 4JFIA 4IQCA 3O5OA 3KACA 4MAVA 1LL6A 4KR0B 1FKRA 5HW6A 4Q7NA 1J4HA 4ML4A 4DZ3A 1EQ3A 3O5PA 1CTNA 3NTPA 2UZ5A 4NZCA 1P5QA 1HKMA 4DZ2A 3ARXA 1OGBA 2XP9A 2XP4A 3WD4A 1HKKA 1ZL1A 2F21A 1J4IA 5DIUA 2AWGA 4DT4A 4JFJA 4WKAA 4Z2LA 3NI6A 2MNTA 4MSPA 1ITXA 4JFLA 3WL1A 4ZPVR 1F40A 4J4OA 4BF8A 4P8WA 3UI6A 1E6NA 3KZ7A 4G50A 4WIWA 2DSWA 3MDYB 3BXWA 2XP8A 1H0GA 1PINA 3PA7A 3UQAA 2F2DA 5HKGA 4JFMA 1FD9A 1BKFA 1E44A 3RM9A 4NSBA 2PV2A 2RSEA 4ODPA 3JXVA 4TYOA 3PR9A 2WLYA 4MNMA 1ZB5A 2LGOA 1NH6A 2B31A 2PPNA 1FKIA 4IQ2A 4L3NA 3O5KA 2ZR5A 3G6MA 4WK9A 3WQVA 1BL4A 2ITKA 3AS0A 1U79A 1FKJA 1NMVA 1Q6IA 1FFRA 2MLYA 2RUQA 5D75A 4J4NA 1D2KA 2MF9A 2PV1A 1JNTA 2M1IA 2OFNA 4R0XA 3WIJA 2FDMA 2WM0A 2B5UB 3WL0A 5BXJA 2WK2A 4R5EA 1LL7A 2ZQTA 4MTVA 3UQIA 4DIPA 3UQBA 1UR9A 3B7XA 2KI3A 2PN0A 4WJXA 1T11A 4P8XA 2YBUA 1ROUA 2MLXA 1R9HA 1JNEA 2RURA 1PBKA 4ODKA 4Z2JA 1VF8A 1E6RA 1W1YA 2F23A 1JVWA 1LG1A 5DITA 1FKFA 4Z2HA 3KCEA 1J6YA 2MLZA
chains in the Genus database with same CATH topology
1Q6HA 4G2PA 1ZBCA 4GGQA 3FAPA 2XP6A 1ZBWA 4ZPWR 3O5IA 3KAFA 3WD1A 3O5JA 1EYMA 1Q1CA 3AQUA 4U84A 1HKIA 1FKBA 1F8AB 1FFQA 3KAGA 3UI4A 3UI5A 4IPXA 4WKHA 1H0IA 1HJVA 4HBEA 1W9PA 2VN1A 4Z2IA 3CGMA 4QT2A 1LG2A 4JYSA 4QIBA 5J6EA 1A7XA 5DF0A 1ZU8A 3ARYA 1L1PA 4W9PA 2DT3A 2N87A 4DRMA 1KT0A 2Q5AA 3PRBA 5HUAA 2LKNA 3W4RA 3O5LA 4GIVA 4ODLA 3IKDA 1HJXA 1SYTA 4ODQA 4W9OA 1E15A 4TW6A 4DRPA 1X6LA 4TNSA 1HKJA 2A3CA 2KR7A 1KT1A 1GUVA 1D6OA 4LAXA 4DRKA 1W9VA 3WQWA 1TCOC 1EIBA 3WD3A 1XRVA 1Q6UA 2ESCA 1FKHA 1YW5A 4MNLA 2PV3A 1RD6A 1D7IA 2XP3A 3CGNA 1C9HA 4S3JA 1XHGA 5HWCA 2A3EA 3GPKA 4QT3A 5GPGA 2XPBA 2IF4A 3CH9A 1HXVA 4DWSA 2O9OA 2G8ZA 3IHZA 1NWTA 4DRNA 2OLHA 5JH8A 3B8SA 1ROTA 5HTGA 1K9TA 3O5RA 3WD2A 1IX5A 1E6ZA 4JFKA 2D9FA 5HT1A 3CZ8A 2RUDA 1QPFA 4XAKA 4AY1A 1J4RA 3IKGA 4FN2A 2ZQSA 3OOBA 4TW8A 3KAHA 2XP7A 5HWBA 2KE0A 1HJWA 4HBOA 4W9QA 4DWSD 3RM8A 1E6PA 1EHNA 4P8UA 2DG9A 1W26A 3ARVA 1B6CA 4QZVB 3ARSA 4P8VA 3H9RB 3ARQA 1UR8A 1ZBKA 1JNDA 1OGGA 3G6LA 3RMEA 3B9EA 4DRIA 4DRHA 1OWQA 2DT1A 3ARRA 4DH0A 1ZCNA 2KGJA 2O92A 3AS2A 5GQBA 2DSVA 2IUZA 2F4EA 1X6NA 5DEZA 1W1TA 2ZR4A 4IT4A 4DWSB 1M5YA 4Q22A 2PI6A 1WB0A 1QPLA 3AROA 1FJDA 1TFVA 3AS1A 4NNRA 2YBTA 1FKDA 3KABA 3O5FA 3PRAA 1LJYA 4Z2GA 1WAWA 4IT6A 3ARUA 2VCDA 4ODOA 4Z2KA 1NMWA 4U85A 1FKLA 2A3BA 4ODMA 2PBCA 2ZQVA 2DG3A 5I98A 4MNKA 1FAPA 1FKKA 1N1AA 2L2SA 1ZK6A 2M08A 2DPEA 4ITZA 3O5MA 3AS3A 3IK8A 2AOSA 4U86A 3ARTA 1NWRA 4URIA 3CHFA 3CHEA 4L72B 3NRKA 3O5GA 3ARZA 1LL4A 2DG4A 4DRJA 3O5EA 3TDBA 3OA5A 3RFWA 3VAWA 4ZPTR 1W9UA 4ODNA 1NSGA 4N19A 3WKZA 3FXYA 1FKTA 1LQ0A 2KO7A 4LAWA 1GPFA 3KAIA 3KADA 3EY6A 1SR0A 2RQSA 1W1VA 2MPHA 4LAYA 1NWSA 3O5QA 4MNJA 2RUCA 3PRDA 4TW7A 2LPVA 2XPAA 1ZBVA 4MGVA 1KFWA 3TCZA 1QZ2A 4TX0A 3I6CA 2G41A 2PPPA 2DT0A 4DRQA 1WNOA 4FAPA 5HW7A 4ODRA 3FY1A 3ARPA 3O5DA 2LJ4A 2DSZA 3RGCA 3UF8A 2DSUA 2WLZA 2K8IA 2XP5A 4HARA 4C02B 2A3AA 1O6IA 2JZVA 2QF8A 1NWUA 2FAPA 4O2TA 4S3KA 1FKGA 3JYMA 5B8IC 3LUOA 4MPKA 3TC5A 4DROA 3ALFA 1D7JA 4LGXA 3ALGA 1GOIA 1W1PA 4DWSC 1D7HA 3WH0A 3CHDA 2ZQUA 1FKSA 5GPRA 2KFWA 3ARWA 5HBFA 2M2AA 3ODKA 3B9DA 1JNSA 1EDQA 2FKEA 5HW8A 1Y0OA 4KQZA 3CHCA 4W5UA 5DO2A 3RM4A 4LAVA 4ZS6A 2DT2A 3QOKA 2ZR6A 4PTMA 1YATA 5DIVA 1E9LA 3B9AA 3WD0A 2Y78A 2PPOA 3JYJA 4WKFA 4JFIA 4IQCA 3O5OA 3KACA 4MAVA 1LL6A 4KR0B 1FKRA 5HW6A 4Q7NA 1J4HA 4ML4A 4DZ3A 1EQ3A 3O5PA 1CTNA 3NTPA 2UZ5A 4NZCA 1P5QA 1HKMA 4DZ2A 3ARXA 1OGBA 2XP9A 2XP4A 3WD4A 1HKKA 1ZL1A 2F21A 1J4IA 5DIUA 2AWGA 4DT4A 4JFJA 4WKAA 4Z2LA 3NI6A 2MNTA 4MSPA 1ITXA 4JFLA 3WL1A 4ZPVR 1F40A 4J4OA 4BF8A 4P8WA 3UI6A 1E6NA 3KZ7A 4G50A 4WIWA 2DSWA 3MDYB 3BXWA 2XP8A 1H0GA 1PINA 3PA7A 3UQAA 2F2DA 5HKGA 4JFMA 1FD9A 1BKFA 3RM9A 4NSBA 2PV2A 2RSEA 4ODPA 3JXVA 4TYOA 3PR9A 2WLYA 4MNMA 1ZB5A 2LGOA 1NH6A 2B31A 2PPNA 1FKIA 4IQ2A 4L3NA 3O5KA 2ZR5A 3G6MA 4WK9A 3WQVA 1BL4A 2ITKA 3AS0A 1U79A 1FKJA 1NMVA 1Q6IA 1FFRA 2MLYA 2RUQA 5D75A 4J4NA 1D2KA 2MF9A 2PV1A 1JNTA 2M1IA 2OFNA 4R0XA 3WIJA 2FDMA 2WM0A 3WL0A 5BXJA 2WK2A 4R5EA 1LL7A 2ZQTA 4MTVA 3UQIA 4DIPA 3UQBA 1UR9A 3B7XA 2KI3A 4WJXA 1T11A 4P8XA 2YBUA 1ROUA 2MLXA 1R9HA 1JNEA 2RURA 1PBKA 4ODKA 4Z2JA 1VF8A 1E6RA 1W1YA 1JVWA 1LG1A 5DITA 1FKFA 4Z2HA 3KCEA 1J6YA 2MLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5Q A;  3NI6 A;  2RUC A;  1ROT A;  1Q6H A;  3PRD A;  4G2P A;  3O5R A;  4TW7 A;  2MNT A;  2LPV A;  4MSP A;  2XPA A;  5HTG A;  4GGQ A;  4JFL A;  3FAP A;  4JFK A;  1F40 A;  2XP6 A;  2D9F A;  4J4O A;  4MGV A;  5HT1 A;  3TCZ A;  2RUD A;  1QZ2 A;  1QPF A;  4TX0 A;  4BF8 A;  1J4R A;  3IKG A;  4FN2 A;  3I6C A;  3UI6 A;  2PPP A;  2ZQS A;  3O5I A;  3OOB A;  4TW8 A;  3KAH A;  4DRQ A;  3KAF A;  2XP7 A;  3KZ7 A;  2KE0 A;  3O5J A;  5HWB A;  1EYM A;  4W9Q A;  4G50 A;  4FAP A;  5HW7 A;  1Q1C A;  4ODR A;  4U84 A;  3O5D A;  3MDY B;  1FKB A;  2LJ4 A;  1F8A B;  2XP8 A;  3RGC A;  3UF8 A;  3PA7 A;  1PIN A;  3UQA A;  2F2D A;  2K8I A;  2XP5 A;  3KAG A;  1FD9 A;  4JFM A;  5HKG A;  4C02 B;  3UI4 A;  3UI5 A;  1BKF A;  2DG9 A;  1W26 A;  4IPX A;  2JZV A;  1B6C A;  2FAP A;  4O2T A;  3H9R B;  1FKG A;  2PV2 A;  3JYM A;  5B8I C;  2RSE A;  3LUO A;  4ODP A;  3JXV A;  3TC5 A;  4TYO A;  4DRO A;  1D7J A;  2VN1 A;  4DRI A;  4DRH A;  3CGM A;  1D7H A;  4QT2 A;  4DH0 A;  4JYS A;  1ZCN A;  4QIB A;  2KGJ A;  2LGO A;  3WH0 A;  1A7X A;  5J6E A;  2ZQU A;  2PPN A;  1L1P A;  2F4E A;  1FKS A;  4W9P A;  1FKI A;  4IQ2 A;  2ZR4 A;  2KFW A;  3O5K A;  1M5Y A;  2N87 A;  2ZR5 A;  4DRM A;  1KT0 A;  1BL4 A;  2ITK A;  2M2A A;  2Q5A A;  3ODK A;  1QPL A;  3PRB A;  1U79 A;  1FKJ A;  1FJD A;  1NMV A;  1Q6I A;  1JNS A;  5HUA A;  2MLY A;  4NNR A;  2LKN A;  2FKE A;  4R0X A;  1Y0O A;  1FKD A;  3KAB A;  3O5F A;  5HW8 A;  4LAV A;  3O5L A;  2RUQ A;  5D75 A;  2ZR6 A;  4J4N A;  2MF9 A;  2PV1 A;  1YAT A;  5DIV A;  1JNT A;  2M1I A;  2OFN A;  2VCD A;  2Y78 A;  3IKD A;  4GIV A;  4ODL A;  4ODO A;  1NMW A;  2PPO A;  3JYJ A;  4U85 A;  1FKL A;  4JFI A;  4ODM A;  2PBC A;  4ODQ A;  2ZQV A;  4W9O A;  4IQC A;  4TW6 A;  4DRP A;  2DG3 A;  4TNS A;  5BXJ A;  5I98 A;  2KR7 A;  3O5O A;  3KAC A;  1KT1 A;  1FAP A;  1FKK A;  1FKR A;  1N1A A;  2ZQT A;  2L2S A;  1ZK6 A;  5HW6 A;  2M08 A;  4ITZ A;  1J4H A;  3UQI A;  3O5M A;  4DIP A;  4DZ3 A;  3UQB A;  3O5P A;  1EQ3 A;  3NTP A;  1D6O A;  3B7X A;  3IK8 A;  2KI3 A;  2UZ5 A;  4LAX A;  4DRK A;  1T11 A;  1TCO C;  4U86 A;  1P5Q A;  1ROU A;  2MLX A;  4DZ2 A;  1R9H A;  3NRK A;  3O5G A;  2DG4 A;  1Q6U A;  1PBK A;  2RUR A;  4DRJ A;  1FKH A;  1YW5 A;  3O5E A;  3TDB A;  2XP9 A;  3RFW A;  3VAW A;  2PV3 A;  2XP3 A;  1D7I A;  3CGN A;  4ODK A;  4ODN A;  2XP4 A;  1C9H A;  1NSG A;  4N19 A;  1FKT A;  5HWC A;  2KO7 A;  4LAW A;  3KAI A;  3GPK A;  4QT3 A;  2F21 A;  5GPG A;  2XPB A;  1J4I A;  2IF4 A;  1JVW A;  3KAD A;  5DIU A;  1FKF A;  5DIT A;  1HXV A;  3EY6 A;  2AWG A;  2RQS A;  4DT4 A;  3IHZ A;  2MPH A;  4JFJ A;  4DRN A;  3KCE A;  4LAY A;  1J6Y A;  2MLZ A; 
#chains in the Genus database with same CATH topology
 4UDM A;  1Q6H A;  4G2P A;  1ZBC A;  4GGQ A;  3FAP A;  2XP6 A;  1ZBW A;  4ZPW R;  3O5I A;  3KAF A;  3WD1 A;  3O5J A;  1EYM A;  1Q1C A;  3AQU A;  4U84 A;  1HKI A;  1FKB A;  1F8A B;  1FFQ A;  3KAG A;  3UI4 A;  3UI5 A;  4IPX A;  4WKH A;  1H0I A;  1HJV A;  4HBE A;  1W9P A;  1GRJ A;  2VN1 A;  4Z2I A;  3CGM A;  4QT2 A;  1LG2 A;  4JYS A;  4QIB A;  5J6E A;  1A7X A;  5DF0 A;  1ZU8 A;  3ARY A;  1L1P A;  4W9P A;  2DT3 A;  2N87 A;  4DRM A;  1KT0 A;  2Q5A A;  3PRB A;  5HUA A;  2LKN A;  1JCH B;  3W4R A;  3O5L A;  4GIV A;  4ODL A;  3IKD A;  1HJX A;  1SYT A;  4ODQ A;  4W9O A;  1E15 A;  4TW6 A;  4DRP A;  1X6L A;  4TNS A;  1HKJ A;  2A3C A;  2KR7 A;  1KT1 A;  1GUV A;  1D6O A;  4LAX A;  4DRK A;  1W9V A;  3GTY X;  3WQW A;  1TCO C;  1EIB A;  3WD3 A;  1XRV A;  1Q6U A;  2ESC A;  1FKH A;  1YW5 A;  4MNL A;  2PV3 A;  1RD6 A;  1D7I A;  2XP3 A;  3CGN A;  1C9H A;  4S3J A;  1XHG A;  5HWC A;  2A3E A;  3GPK A;  4QT3 A;  5GPG A;  2XPB A;  2IF4 A;  3CH9 A;  1HXV A;  4DWS A;  2O9O A;  2G8Z A;  3IHZ A;  1NWT A;  4DRN A;  2OLH A;  5JH8 A;  3B8S A;  1ROT A;  5HTG A;  1K9T A;  3O5R A;  3WD2 A;  1IX5 A;  1E6Z A;  3EIP A;  4JFK A;  2D9F A;  5HT1 A;  3CZ8 A;  2RUD A;  1QPF A;  4XAK A;  4AY1 A;  1J4R A;  3IKG A;  4FN2 A;  2ZQS A;  3OOB A;  4TW8 A;  3KAH A;  2XP7 A;  5HWB A;  2KE0 A;  1HJW A;  4HBO A;  4W9Q A;  4DWS D;  3RM8 A;  1E6P A;  1EHN A;  3GU0 A;  4P8U A;  2DG9 A;  1W26 A;  3ARV A;  1B6C A;  4QZV B;  3ARS A;  4P8V A;  3H9R B;  3ARQ A;  1UR8 A;  1ZBK A;  1JND A;  1OGG A;  3G6L A;  3RME A;  3B9E A;  4DRI A;  4DRH A;  1OWQ A;  2DT1 A;  3ARR A;  4DH0 A;  1ZCN A;  2KGJ A;  2O92 A;  3AS2 A;  5GQB A;  2DSV A;  2IUZ A;  2F4E A;  1X6N A;  5DEZ A;  1W1T A;  2ZR4 A;  4IT4 A;  4DWS B;  1M5Y A;  4Q22 A;  2PI6 A;  1WB0 A;  1QPL A;  3ARO A;  1FJD A;  1TFV A;  3AS1 A;  4NNR A;  2YBT A;  1FKD A;  3KAB A;  3O5F A;  3PRA A;  1LJY A;  4Z2G A;  1WAW A;  4IT6 A;  3ARU A;  2VCD A;  4ODO A;  4Z2K A;  1NMW A;  4U85 A;  1FKL A;  2A3B A;  4ODM A;  2PBC A;  2ZQV A;  2DG3 A;  5I98 A;  4MNK A;  3BMB A;  1FAP A;  1FKK A;  1N1A A;  2L2S A;  1ZK6 A;  2M08 A;  2DPE A;  4ITZ A;  3O5M A;  3AS3 A;  3IK8 A;  2AOS A;  4U86 A;  3ART A;  1NWR A;  4URI A;  3CHF A;  3CHE A;  4L72 B;  2EUL A;  3NRK A;  3O5G A;  3ARZ A;  1LL4 A;  2DG4 A;  4DRJ A;  3O5E A;  3TDB A;  3OA5 A;  3RFW A;  3VAW A;  4ZPT R;  1W9U A;  4ODN A;  1NSG A;  4N19 A;  3WKZ A;  3FXY A;  1FKT A;  1LQ0 A;  2KO7 A;  4LAW A;  1GPF A;  3KAI A;  3KAD A;  3EY6 A;  1SR0 A;  2RQS A;  1W1V A;  2MPH A;  4LAY A;  1NWS A;  3O5Q A;  4MNJ A;  2RUC A;  3PRD A;  4TW7 A;  2LPV A;  2XPA A;  1ZBV A;  4MGV A;  1KFW A;  3TCZ A;  1QZ2 A;  4TX0 A;  3I6C A;  2G41 A;  2PPP A;  2DT0 A;  4DRQ A;  1WNO A;  4FAP A;  5HW7 A;  2ETN A;  4ODR A;  3FY1 A;  3ARP A;  3O5D A;  2LJ4 A;  2DSZ A;  3RGC A;  3UF8 A;  2DSU A;  2WLZ A;  2K8I A;  2XP5 A;  4HAR A;  4C02 B;  2A3A A;  1O6I A;  2JZV A;  2QF8 A;  1NWU A;  2FAP A;  4O2T A;  4S3K A;  1FKG A;  3JYM A;  5B8I C;  3LUO A;  4MPK A;  3TC5 A;  4DRO A;  3ALF A;  1D7J A;  4LGX A;  3ALG A;  1GOI A;  1W1P A;  4DWS C;  1D7H A;  3WH0 A;  2P4V A;  3CHD A;  2ZQU A;  1FKS A;  5GPR A;  2KFW A;  3ARW A;  5HBF A;  2M2A A;  3ODK A;  3B9D A;  1JNS A;  1EDQ A;  2FKE A;  5HW8 A;  1Y0O A;  4KQZ A;  3CHC A;  4W5U A;  5DO2 A;  3RM4 A;  4LAV A;  4ZS6 A;  2DT2 A;  3QOK A;  2ZR6 A;  4PTM A;  1YAT A;  5DIV A;  1E9L A;  3B9A A;  3WD0 A;  2Y78 A;  2PPO A;  3JYJ A;  4WKF A;  4JFI A;  4IQC A;  3O5O A;  3KAC A;  4MAV A;  1LL6 A;  4KR0 B;  1FKR A;  5HW6 A;  4Q7N A;  1J4H A;  4ML4 A;  4DZ3 A;  1EQ3 A;  3O5P A;  1CTN A;  3NTP A;  2UZ5 A;  4NZC A;  1P5Q A;  1HKM A;  4DZ2 A;  3ARX A;  1OGB A;  2XP9 A;  2XP4 A;  3WD4 A;  1HKK A;  1ZL1 A;  2F21 A;  1J4I A;  5DIU A;  2AWG A;  4DT4 A;  4JFJ A;  4WKA A;  4Z2L A;  3NI6 A;  2MNT A;  4MSP A;  1ITX A;  4JFL A;  3WL1 A;  4ZPV R;  1F40 A;  4J4O A;  4BF8 A;  4P8W A;  3UI6 A;  1E6N A;  3KZ7 A;  4G50 A;  4WIW A;  2DSW A;  3MDY B;  3BXW A;  2XP8 A;  1H0G A;  1PIN A;  3PA7 A;  3UQA A;  2F2D A;  5HKG A;  4JFM A;  1FD9 A;  1BKF A;  1E44 A;  3RM9 A;  4NSB A;  2PV2 A;  2RSE A;  4ODP A;  3JXV A;  4TYO A;  3PR9 A;  2WLY A;  4MNM A;  1ZB5 A;  2LGO A;  1NH6 A;  2B31 A;  2PPN A;  1FKI A;  4IQ2 A;  4L3N A;  3O5K A;  2ZR5 A;  3G6M A;  4WK9 A;  3WQV A;  1BL4 A;  2ITK A;  3AS0 A;  1U79 A;  1FKJ A;  1NMV A;  1Q6I A;  1FFR A;  2MLY A;  2RUQ A;  5D75 A;  4J4N A;  1D2K A;  2MF9 A;  2PV1 A;  1JNT A;  2M1I A;  2OFN A;  4R0X A;  3WIJ A;  2FDM A;  2WM0 A;  2B5U B;  3WL0 A;  5BXJ A;  2WK2 A;  4R5E A;  1LL7 A;  2ZQT A;  4MTV A;  3UQI A;  4DIP A;  3UQB A;  1UR9 A;  3B7X A;  2KI3 A;  2PN0 A;  4WJX A;  1T11 A;  4P8X A;  2YBU A;  1ROU A;  2MLX A;  1R9H A;  1JNE A;  2RUR A;  1PBK A;  4ODK A;  4Z2J A;  1VF8 A;  1E6R A;  1W1Y A;  2F23 A;  1JVW A;  1LG1 A;  5DIT A;  1FKF A;  4Z2H A;  3KCE A;  1J6Y A;  2MLZ A; 
#chains in the Genus database with same CATH homology
 1Q6H A;  4G2P A;  1ZBC A;  4GGQ A;  3FAP A;  2XP6 A;  1ZBW A;  4ZPW R;  3O5I A;  3KAF A;  3WD1 A;  3O5J A;  1EYM A;  1Q1C A;  3AQU A;  4U84 A;  1HKI A;  1FKB A;  1F8A B;  1FFQ A;  3KAG A;  3UI4 A;  3UI5 A;  4IPX A;  4WKH A;  1H0I A;  1HJV A;  4HBE A;  1W9P A;  2VN1 A;  4Z2I A;  3CGM A;  4QT2 A;  1LG2 A;  4JYS A;  4QIB A;  5J6E A;  1A7X A;  5DF0 A;  1ZU8 A;  3ARY A;  1L1P A;  4W9P A;  2DT3 A;  2N87 A;  4DRM A;  1KT0 A;  2Q5A A;  3PRB A;  5HUA A;  2LKN A;  3W4R A;  3O5L A;  4GIV A;  4ODL A;  3IKD A;  1HJX A;  1SYT A;  4ODQ A;  4W9O A;  1E15 A;  4TW6 A;  4DRP A;  1X6L A;  4TNS A;  1HKJ A;  2A3C A;  2KR7 A;  1KT1 A;  1GUV A;  1D6O A;  4LAX A;  4DRK A;  1W9V A;  3WQW A;  1TCO C;  1EIB A;  3WD3 A;  1XRV A;  1Q6U A;  2ESC A;  1FKH A;  1YW5 A;  4MNL A;  2PV3 A;  1RD6 A;  1D7I A;  2XP3 A;  3CGN A;  1C9H A;  4S3J A;  1XHG A;  5HWC A;  2A3E A;  3GPK A;  4QT3 A;  5GPG A;  2XPB A;  2IF4 A;  3CH9 A;  1HXV A;  4DWS A;  2O9O A;  2G8Z A;  3IHZ A;  1NWT A;  4DRN A;  2OLH A;  5JH8 A;  3B8S A;  1ROT A;  5HTG A;  1K9T A;  3O5R A;  3WD2 A;  1IX5 A;  1E6Z A;  4JFK A;  2D9F A;  5HT1 A;  3CZ8 A;  2RUD A;  1QPF A;  4XAK A;  4AY1 A;  1J4R A;  3IKG A;  4FN2 A;  2ZQS A;  3OOB A;  4TW8 A;  3KAH A;  2XP7 A;  5HWB A;  2KE0 A;  1HJW A;  4HBO A;  4W9Q A;  4DWS D;  3RM8 A;  1E6P A;  1EHN A;  4P8U A;  2DG9 A;  1W26 A;  3ARV A;  1B6C A;  4QZV B;  3ARS A;  4P8V A;  3H9R B;  3ARQ A;  1UR8 A;  1ZBK A;  1JND A;  1OGG A;  3G6L A;  3RME A;  3B9E A;  4DRI A;  4DRH A;  1OWQ A;  2DT1 A;  3ARR A;  4DH0 A;  1ZCN A;  2KGJ A;  2O92 A;  3AS2 A;  5GQB A;  2DSV A;  2IUZ A;  2F4E A;  1X6N A;  5DEZ A;  1W1T A;  2ZR4 A;  4IT4 A;  4DWS B;  1M5Y A;  4Q22 A;  2PI6 A;  1WB0 A;  1QPL A;  3ARO A;  1FJD A;  1TFV A;  3AS1 A;  4NNR A;  2YBT A;  1FKD A;  3KAB A;  3O5F A;  3PRA A;  1LJY A;  4Z2G A;  1WAW A;  4IT6 A;  3ARU A;  2VCD A;  4ODO A;  4Z2K A;  1NMW A;  4U85 A;  1FKL A;  2A3B A;  4ODM A;  2PBC A;  2ZQV A;  2DG3 A;  5I98 A;  4MNK A;  1FAP A;  1FKK A;  1N1A A;  2L2S A;  1ZK6 A;  2M08 A;  2DPE A;  4ITZ A;  3O5M A;  3AS3 A;  3IK8 A;  2AOS A;  4U86 A;  3ART A;  1NWR A;  4URI A;  3CHF A;  3CHE A;  4L72 B;  3NRK A;  3O5G A;  3ARZ A;  1LL4 A;  2DG4 A;  4DRJ A;  3O5E A;  3TDB A;  3OA5 A;  3RFW A;  3VAW A;  4ZPT R;  1W9U A;  4ODN A;  1NSG A;  4N19 A;  3WKZ A;  3FXY A;  1FKT A;  1LQ0 A;  2KO7 A;  4LAW A;  1GPF A;  3KAI A;  3KAD A;  3EY6 A;  1SR0 A;  2RQS A;  1W1V A;  2MPH A;  4LAY A;  1NWS A;  3O5Q A;  4MNJ A;  2RUC A;  3PRD A;  4TW7 A;  2LPV A;  2XPA A;  1ZBV A;  4MGV A;  1KFW A;  3TCZ A;  1QZ2 A;  4TX0 A;  3I6C A;  2G41 A;  2PPP A;  2DT0 A;  4DRQ A;  1WNO A;  4FAP A;  5HW7 A;  4ODR A;  3FY1 A;  3ARP A;  3O5D A;  2LJ4 A;  2DSZ A;  3RGC A;  3UF8 A;  2DSU A;  2WLZ A;  2K8I A;  2XP5 A;  4HAR A;  4C02 B;  2A3A A;  1O6I A;  2JZV A;  2QF8 A;  1NWU A;  2FAP A;  4O2T A;  4S3K A;  1FKG A;  3JYM A;  5B8I C;  3LUO A;  4MPK A;  3TC5 A;  4DRO A;  3ALF A;  1D7J A;  4LGX A;  3ALG A;  1GOI A;  1W1P A;  4DWS C;  1D7H A;  3WH0 A;  3CHD A;  2ZQU A;  1FKS A;  5GPR A;  2KFW A;  3ARW A;  5HBF A;  2M2A A;  3ODK A;  3B9D A;  1JNS A;  1EDQ A;  2FKE A;  5HW8 A;  1Y0O A;  4KQZ A;  3CHC A;  4W5U A;  5DO2 A;  3RM4 A;  4LAV A;  4ZS6 A;  2DT2 A;  3QOK A;  2ZR6 A;  4PTM A;  1YAT A;  5DIV A;  1E9L A;  3B9A A;  3WD0 A;  2Y78 A;  2PPO A;  3JYJ A;  4WKF A;  4JFI A;  4IQC A;  3O5O A;  3KAC A;  4MAV A;  1LL6 A;  4KR0 B;  1FKR A;  5HW6 A;  4Q7N A;  1J4H A;  4ML4 A;  4DZ3 A;  1EQ3 A;  3O5P A;  1CTN A;  3NTP A;  2UZ5 A;  4NZC A;  1P5Q A;  1HKM A;  4DZ2 A;  3ARX A;  1OGB A;  2XP9 A;  2XP4 A;  3WD4 A;  1HKK A;  1ZL1 A;  2F21 A;  1J4I A;  5DIU A;  2AWG A;  4DT4 A;  4JFJ A;  4WKA A;  4Z2L A;  3NI6 A;  2MNT A;  4MSP A;  1ITX A;  4JFL A;  3WL1 A;  4ZPV R;  1F40 A;  4J4O A;  4BF8 A;  4P8W A;  3UI6 A;  1E6N A;  3KZ7 A;  4G50 A;  4WIW A;  2DSW A;  3MDY B;  3BXW A;  2XP8 A;  1H0G A;  1PIN A;  3PA7 A;  3UQA A;  2F2D A;  5HKG A;  4JFM A;  1FD9 A;  1BKF A;  3RM9 A;  4NSB A;  2PV2 A;  2RSE A;  4ODP A;  3JXV A;  4TYO A;  3PR9 A;  2WLY A;  4MNM A;  1ZB5 A;  2LGO A;  1NH6 A;  2B31 A;  2PPN A;  1FKI A;  4IQ2 A;  4L3N A;  3O5K A;  2ZR5 A;  3G6M A;  4WK9 A;  3WQV A;  1BL4 A;  2ITK A;  3AS0 A;  1U79 A;  1FKJ A;  1NMV A;  1Q6I A;  1FFR A;  2MLY A;  2RUQ A;  5D75 A;  4J4N A;  1D2K A;  2MF9 A;  2PV1 A;  1JNT A;  2M1I A;  2OFN A;  4R0X A;  3WIJ A;  2FDM A;  2WM0 A;  3WL0 A;  5BXJ A;  2WK2 A;  4R5E A;  1LL7 A;  2ZQT A;  4MTV A;  3UQI A;  4DIP A;  3UQB A;  1UR9 A;  3B7X A;  2KI3 A;  4WJX A;  1T11 A;  4P8X A;  2YBU A;  1ROU A;  2MLX A;  1R9H A;  1JNE A;  2RUR A;  1PBK A;  4ODK A;  4Z2J A;  1VF8 A;  1E6R A;  1W1Y A;  1JVW A;  1LG1 A;  5DIT A;  1FKF A;  4Z2H A;  3KCE A;  1J6Y A;  2MLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...