5BXJA

Complex of the fk1 domain mutant a19t of fkbp51 with 4-nitrophenol
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
127
structure length
127
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The environmental endocrine disruptor p-nitrophenol interacts with FKBP51, a positive regulator of androgen receptor and inhibits androgen receptor signaling in human cells
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 32
structure length 127
sequence length 127
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2015-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5bxjA00
1F8AB 1ZCNA 1FKIA 3PA7A 4DH0A 5DIUA 1U79A 4DT4A 1Q6UA 2VN1A 2XP9A 3UF8A 3O5RA 4DRJA 1FD9A 4DRPA 3O5IA 3CGNA 3TC5A 3MDYB 1KT1A 1L1PA 4TW8A 1YW5A 1JNTA 2MLZA 1FKRA 2Q5AA 3O5JA 4C02B 2ZR5A 1FKSA 1QZ2A 4LAWA 2FKEA 4TYOA 3GPKA 3OOBA 5GPGA 5HWBA 2FAPA 2RUQA 1NMVA 3KAFA 4LAYA 4GGQA 5HUAA 4JFKA 3O5EA 3IHZA 5D75A 1FKBA 1JVWA 1P5QA 3UI6A 1FJDA 2RURA 3O5OA 2PV3A 2XPBA 1PBKA 2KFWA 2MF9A 1FKKA 2D9FA 4IQ2A 4QT3A 4U84A 3EY6A 1FAPA 2LPVA 1Q6IA 3CGMA 3FAPA 3NRKA 3O5GA 5DITA 4JFMA 2PPPA 3IKDA 2ITKA 3KAHA 3WH0A 3JXVA 2IF4A 2M1IA 2RUCA 3O5KA 3IKGA 4DRKA 1D7IA 3KADA 4O2TA 4JFIA 1N1AA 1T11A 2KI3A 4G50A 1KT0A 3O5DA 2LGOA 2Y78A 3UI5A 5B8IC 2ZR4A 1B6CA 4IQCA 3PRBA 1NSGA 2F21A 2ZR6A 3JYJA 2F4EA 2KGJA 4NNRA 2ZQTA 4QIBA 4QT2A 1D7HA 4N19A 3IK8A 4W9QA 5DIVA 2VCDA 1EQ3A 4W9PA 2PV1A 2L2SA 5HW7A 2PV2A 5BXJA 2F2DA 2XP6A 5HTGA 5I98A 5HKGA 2RUDA 3KAIA 2MNTA 4R0XA 3UQIA 1PINA 2JZVA 2N87A 3TCZA 3UI4A 2LJ4A 4ITZA 1TCOC 1ZK6A 4J4OA 1M5YA 3NI6A 4DRHA 3RFWA 2KE0A 4GIVA 4LAVA 4BF8A 3RGCA 3UQBA 1YATA 1FKJA 2XP8A 1Y0OA 4ODPA 4ODLA 4ODMA 4TW7A 1NMWA 4G2PA 2MLYA 1J6YA 4ODKA 3H9RB 4DZ3A 1R9HA 2OFNA 1J4IA 2RSEA 3KZ7A 3VAWA 1FKHA 2ZQSA 2UZ5A 4ODOA 2ZQVA 3NTPA 3JYMA 1A7XA 2XP4A 4TX0A 4DZ2A 1D7JA 1J4HA 2DG9A 1QPFA 1Q1CA 1D6OA 5J6EA 4JYSA 4U86A 4MSPA 2M2AA 4LAXA 1ROTA 1BKFA 4W9OA 2MLXA 4ODNA 4J4NA 2XP7A 2PPOA 3ODKA 3O5QA 1HXVA 2M08A 2KR7A 2XP5A 1FKTA 2K8IA 3KCEA 4DRQA 3LUOA 4DRNA 4DIPA 2DG4A 3O5MA 4DRIA 4FAPA 2MPHA 1QPLA 1BL4A 1Q6HA 2KO7A 3B7XA 1FKDA 1FKFA 3O5PA 4IPXA 1FKGA 3TDBA 4ODRA 3UQAA 1F40A 5HW8A 5HWCA 2XP3A 1W26A 4FN2A 2DG3A 2ZQUA 1J4RA 4JFLA 1EYMA 3KACA 3KABA 4JFJA 4DRMA 2XPAA 1FKLA 3I6CA 3O5FA 4DROA 3KAGA 4ODQA 1JNSA 2LKNA 1C9HA 4MGVA 3PRDA 3O5LA 2AWGA 2PBCA 2PPNA 2RQSA 4TNSA 4U85A 5HT1A 1ROUA 4TW6A 5HW6A
chains in the Genus database with same CATH superfamily
1GRJA 2FDMA 1FKIA 4DH0A 5DIUA 1NWTA 4DRJA 3ARVA 3CZ8A 1L1PA 4L72B 4C02B 2ZR5A 3ALFA 3AROA 1FKSA 5HWBA 1WAWA 2RUQA 3KAFA 2WM0A 4JFKA 1LL4A 3BMBA 5DF0A 1P5QA 1FJDA 2RURA 4Z2HA 1CTNA 4QT3A 1E6NA 1E15A 1W9UA 3ARXA 3EY6A 3FAPA 3RM8A 1W1TA 4P8WA 3RMEA 4WK9A 3WL1A 2PPPA 1GOIA 2M1IA 3WD0A 2PN0A 1KT0A 3AQUA 3PRBA 4XAKA 3JYJA 2F4EA 4NNRA 2ZQTA 1KFWA 2DT3A 4QT2A 2DSVA 4W9QA 4WIWA 4Z2IA 5BXJA 2XP6A 5I98A 4HBOA 2RUDA 1WB0A 2MNTA 3UQIA 1PINA 2JZVA 1HKJA 4ZPWR 3WKZA 1TCOC 3GTYX 4J4OA 5JH8A 4LGXA 3WD3A 1ZBCA 1NWUA 4GIVA 2EULA 1YATA 2G8ZA 2XP8A 1HXVA 4ODKA 1R9HA 1J4IA 3KZ7A 2UZ5A 3NTPA 3B9AA 4R5EA 4Z2LA 1QPFA 1Q1CA 2DPEA 5J6EA 4MSPA 1ROTA 4W9OA 4Z2GA 2DSZA 2O9OA 2M08A 1D2KA 2XP5A 1FKTA 3ARUA 3CHDA 2DG4A 1IX5A 3B7XA 1FKDA 5HWCA 2ZQUA 2WK2A 4UDMA 4JFJA 1HJWA 1ZBKA 1OGGA 3AS3A 4P8UA 3O5FA 1XRVA 3KAGA 4MGVA 2AWGA 2PBCA 5HT1A 1ROUA 4IT4A 5HW6A 1F8AB 2A3EA 3PA7A 1H0GA 3W4RA 2XP9A 3UF8A 1LJYA 2YBUA 3WQWA 3B9EA 3CGNA 1JNTA 4ZS6A 2Q5AA 2AOSA 1GPFA 3B9DA 2FKEA 3RM4A 4LAYA 5HUAA 1K9TA 2PV3A 4MNKA 4L3NA 3ARSA 2KFWA 2MF9A 4IQ2A 3ARZA 2LPVA 1W9VA 2DT1A 3IKDA 2ITKA 2OLHA 5DEZA 2IF4A 1E6RA 1D7IA 3AS1A 3KADA 3RM9A 1N1AA 2KI3A 3O5DA 3ARPA 5B8IC 4IQCA 1B6CA 2F21A 2DT2A 1EIBA 4MNJA 1EQ3A 2L2SA 4MNMA 3TCZA 2LJ4A 2WLYA 1W1YA 5DO2A 4ITZA 1W1VA 1NH6A 3RFWA 1HJVA 4DWSD 1SR0A 4WKFA 4ODPA 4ODLA 4ODMA 4G2PA 2MLYA 3H9RB 3VAWA 4IT6A 4ODOA 2ZQVA 2B5UB 3JYMA 1RD6A 2PI6A 1J4HA 2DG9A 2O92A 3WQVA 2M2AA 2MLXA 2XP7A 3ALGA 2PPOA 4NZCA 2KR7A 4PTMA 3LUOA 4FAPA 4DRIA 1LG1A 2MPHA 2G41A 1Q6HA 3UQAA 3O5PA 1FKFA 2B31A 1ZL1A 4FN2A 3KACA 1LL7A 4DWSB 3ARYA 4ODQA 4NSBA 1EDQA 4TW6A 3WD4A 4DT4A 1U79A 1Q6UA 4DRPA 3O5IA 3MDYB 1KT1A 1ZB5A 1YW5A 4Q7NA 3G6MA 4LAWA 4TYOA 5GPGA 3OOBA 3O5EA 5D75A 1FKBA 1LG2A 3O5OA 1GUVA 1PBKA 4U84A 3EIPA 1FAPA 1Q6IA 3CGMA 3O5GA 5DITA 4MPKA 3WH0A 2RUCA 3O5KA 1T11A 3UI5A 3OA5A 2LGOA 2Y78A 3PR9A 2ZR4A 3FXYA 4HBEA 2ESCA 3PRAA 5DIVA 2VCDA 4W9PA 2PV1A 5HW7A 2PV2A 2F2DA 3WIJA 4MAVA 1JCHB 2IUZA 4QZVB 2WLZA 1HKKA 1M5YA 3NI6A 4DWSC 4LAVA 1FKJA 3CHEA 1O6IA 4S3KA 1Y0OA 2A3AA 4DZ3A 2OFNA 3CH9A 1JNDA 1NWSA 2ZQSA 1WNOA 3AS2A 1OGBA 3GU0A 1D6OA 1W9PA 4P8VA 4U86A 4LAXA 1BKFA 4ODNA 4J4NA 1HKIA 2K8IA 3WD2A 3KCEA 4DIPA 1QPLA 2KO7A 1FKGA 4KQZA 2F23A 5HW8A 4Z2JA 1UR8A 1ITXA 1J4RA 4JFLA 1EYMA 1FKLA 1ZU8A 3PRDA 2A3CA 4MNLA 4URIA 4TNSA 4U85A 2QF8A 4ML4A 1NWRA 1ZCNA 2VN1A 3O5RA 1FD9A 3TC5A 3B8SA 4DWSA 5GQBA 4TW8A 4P8XA 2MLZA 1FKRA 3O5JA 1ZBWA 2DSWA 1QZ2A 3GPKA 2FAPA 1NMVA 2DT0A 4GGQA 3IHZA 1JVWA 3UI6A 1E44A 2XPBA 1FKKA 2D9FA 3NRKA 3BXWA 4JFMA 3KAHA 3JXVA 4DRKA 3IKGA 1FFQA 4O2TA 4JFIA 4S3JA 4G50A 1EHNA 1SYTA 1NSGA 2ZR6A 3FY1A 1HJXA 2KGJA 4QIBA 1LL6A 1D7HA 4N19A 3IK8A 2YBTA 1H0IA 1XHGA 5HTGA 5HKGA 3KAIA 4R0XA 2N87A 3UI4A 1OWQA 2ETNA 3CHFA 1ZK6A 1E6PA 1X6LA 4DRHA 1E6ZA 2KE0A 1X6NA 4BF8A 3RGCA 3UQBA 1W1PA 4HARA 1HKMA 3ARQA 4TW7A 1NMWA 3ARWA 4KR0B 1J6YA 3QOKA 1JNEA 2RSEA 1FKHA 4W5UA 1ZBVA 1FFRA 3G6LA 1A7XA 2XP4A 4TX0A 4WKHA 4DZ2A 1D7JA 4ZPTR 1TFVA 5HBFA 4JYSA 3WL0A 1UR9A 4ZPVR 3ODKA 3O5QA 1VF8A 3ARTA 4DRQA 2DSUA 4DRNA 4MTVA 3O5MA 3ARRA 3WD1A 1BL4A 3TDBA 4IPXA 1F40A 3AS0A 4ODRA 5GPRA 2XP3A 1W26A 2DG3A 3CHCA 3KABA 1LQ0A 4AY1A 4DRMA 2XPAA 3I6CA 4DROA 2A3BA 4Z2KA 2LKNA 1C9HA 1JNSA 2P4VA 3O5LA 2PPNA 2RQSA 4Q22A 4WKAA 1E9LA 4WJXA
chains in the Genus database with same CATH topology
2FDMA 4DH0A 1FKIA 5DIUA 1NWTA 4DRJA 3ARVA 3CZ8A 1L1PA 4L72B 4C02B 2ZR5A 3ALFA 3AROA 1FKSA 5HWBA 1WAWA 2RUQA 3KAFA 2WM0A 4JFKA 1LL4A 5DF0A 1P5QA 1FJDA 2RURA 4Z2HA 1CTNA 4QT3A 1E6NA 1E15A 1W9UA 3ARXA 3EY6A 3FAPA 3RM8A 1W1TA 4P8WA 3RMEA 4WK9A 3WL1A 2PPPA 1GOIA 2M1IA 3WD0A 1KT0A 3AQUA 3PRBA 4XAKA 3JYJA 2F4EA 4NNRA 2ZQTA 1KFWA 2DT3A 4QT2A 2DSVA 4W9QA 4WIWA 4Z2IA 5BXJA 2XP6A 5I98A 4HBOA 2RUDA 1WB0A 2MNTA 3UQIA 1PINA 2JZVA 1HKJA 4ZPWR 3WKZA 1TCOC 4J4OA 5JH8A 4LGXA 3WD3A 1ZBCA 1NWUA 4GIVA 1YATA 2G8ZA 2XP8A 1HXVA 4ODKA 1R9HA 1J4IA 3KZ7A 2UZ5A 3NTPA 3B9AA 4R5EA 4Z2LA 1QPFA 1Q1CA 2DPEA 5J6EA 4MSPA 1ROTA 4W9OA 4Z2GA 2DSZA 2O9OA 2M08A 1D2KA 2XP5A 1FKTA 3ARUA 3CHDA 2DG4A 1IX5A 3B7XA 1FKDA 5HWCA 2ZQUA 2WK2A 4JFJA 1HJWA 1ZBKA 1OGGA 3AS3A 4P8UA 3O5FA 1XRVA 3KAGA 4MGVA 2AWGA 2PBCA 5HT1A 1ROUA 4IT4A 5HW6A 1F8AB 2A3EA 3PA7A 1H0GA 3W4RA 2XP9A 3UF8A 1LJYA 2YBUA 3WQWA 3B9EA 3CGNA 1JNTA 4ZS6A 2Q5AA 2AOSA 1GPFA 3B9DA 2FKEA 3RM4A 4LAYA 5HUAA 1K9TA 2PV3A 4MNKA 4L3NA 3ARSA 2KFWA 2MF9A 4IQ2A 3ARZA 2LPVA 1W9VA 2DT1A 3IKDA 2ITKA 2OLHA 5DEZA 2IF4A 1E6RA 1D7IA 3AS1A 3KADA 3RM9A 1N1AA 2KI3A 3O5DA 3ARPA 5B8IC 4IQCA 1B6CA 2F21A 2DT2A 1EIBA 4MNJA 1EQ3A 2L2SA 4MNMA 3TCZA 2LJ4A 2WLYA 1W1YA 5DO2A 4ITZA 1W1VA 1NH6A 3RFWA 1HJVA 4DWSD 1SR0A 4WKFA 4ODPA 4ODLA 4ODMA 4G2PA 2MLYA 3H9RB 3VAWA 4IT6A 4ODOA 2ZQVA 1RD6A 3JYMA 2PI6A 1J4HA 2DG9A 2O92A 3WQVA 2M2AA 2MLXA 2XP7A 3ALGA 2PPOA 4NZCA 2KR7A 4PTMA 3LUOA 4FAPA 4DRIA 1LG1A 2MPHA 2G41A 1Q6HA 3UQAA 3O5PA 1FKFA 2B31A 1ZL1A 4FN2A 3KACA 1LL7A 4DWSB 3ARYA 4ODQA 4NSBA 1EDQA 4TW6A 3WD4A 4DT4A 1U79A 1Q6UA 4DRPA 3O5IA 3MDYB 1KT1A 1ZB5A 1YW5A 4Q7NA 3G6MA 4LAWA 4TYOA 5GPGA 3OOBA 3O5EA 5D75A 1FKBA 1LG2A 3O5OA 1GUVA 1PBKA 4U84A 1FAPA 1Q6IA 3CGMA 3O5GA 5DITA 4MPKA 3WH0A 2RUCA 3O5KA 1T11A 3UI5A 3OA5A 2LGOA 2Y78A 3PR9A 2ZR4A 3FXYA 4HBEA 2ESCA 3PRAA 5DIVA 2VCDA 4W9PA 2PV1A 5HW7A 2PV2A 2F2DA 3WIJA 4MAVA 2IUZA 4QZVB 2WLZA 1HKKA 1M5YA 3NI6A 4DWSC 4LAVA 1FKJA 3CHEA 1O6IA 4S3KA 1Y0OA 2A3AA 4DZ3A 2OFNA 3CH9A 1JNDA 1NWSA 2ZQSA 1WNOA 3AS2A 1OGBA 1D6OA 1W9PA 4P8VA 4U86A 4LAXA 1BKFA 4ODNA 4J4NA 1HKIA 2K8IA 3WD2A 3KCEA 4DIPA 1QPLA 2KO7A 1FKGA 4KQZA 5HW8A 4Z2JA 1UR8A 1ITXA 1J4RA 4JFLA 1EYMA 1FKLA 1ZU8A 3PRDA 2A3CA 4MNLA 4URIA 4TNSA 4U85A 2QF8A 4ML4A 1NWRA 1ZCNA 2VN1A 3O5RA 1FD9A 3TC5A 3B8SA 4DWSA 5GQBA 4TW8A 4P8XA 2MLZA 1FKRA 3O5JA 1ZBWA 2DSWA 1QZ2A 3GPKA 2FAPA 1NMVA 2DT0A 4GGQA 3IHZA 1JVWA 3UI6A 2XPBA 1FKKA 2D9FA 3NRKA 3BXWA 4JFMA 3KAHA 3JXVA 4DRKA 3IKGA 1FFQA 4O2TA 4JFIA 4S3JA 4G50A 1EHNA 1SYTA 1NSGA 2ZR6A 3FY1A 1HJXA 2KGJA 4QIBA 1LL6A 1D7HA 4N19A 3IK8A 2YBTA 1H0IA 1XHGA 5HTGA 5HKGA 3KAIA 4R0XA 2N87A 3UI4A 1OWQA 3CHFA 1ZK6A 1E6PA 1X6LA 4DRHA 1E6ZA 2KE0A 1X6NA 4BF8A 3RGCA 3UQBA 1W1PA 4HARA 1HKMA 3ARQA 4TW7A 1NMWA 3ARWA 4KR0B 1J6YA 3QOKA 1JNEA 2RSEA 1FKHA 4W5UA 1ZBVA 1FFRA 3G6LA 1A7XA 2XP4A 4TX0A 4WKHA 4DZ2A 1D7JA 4ZPTR 1TFVA 5HBFA 4JYSA 3WL0A 1UR9A 4ZPVR 3ODKA 3O5QA 1VF8A 3ARTA 4DRQA 2DSUA 4DRNA 4MTVA 3O5MA 3ARRA 3WD1A 1BL4A 3TDBA 4IPXA 1F40A 3AS0A 4ODRA 5GPRA 2XP3A 1W26A 2DG3A 3CHCA 3KABA 1LQ0A 4AY1A 4DRMA 2XPAA 3I6CA 4DROA 2A3BA 4Z2KA 2LKNA 1C9HA 1JNSA 3O5LA 2PPNA 2RQSA 4Q22A 4WKAA 1E9LA 4WJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F8A B;  1ZCN A;  1FKI A;  3PA7 A;  4DH0 A;  5DIU A;  1U79 A;  4DT4 A;  1Q6U A;  2VN1 A;  2XP9 A;  3UF8 A;  3O5R A;  4DRJ A;  1FD9 A;  4DRP A;  3O5I A;  3CGN A;  3TC5 A;  3MDY B;  1KT1 A;  1L1P A;  4TW8 A;  1YW5 A;  1JNT A;  2MLZ A;  1FKR A;  2Q5A A;  3O5J A;  4C02 B;  2ZR5 A;  1FKS A;  1QZ2 A;  4LAW A;  2FKE A;  4TYO A;  3GPK A;  3OOB A;  5GPG A;  5HWB A;  2FAP A;  2RUQ A;  1NMV A;  3KAF A;  4LAY A;  4GGQ A;  5HUA A;  4JFK A;  3O5E A;  3IHZ A;  5D75 A;  1FKB A;  1JVW A;  1P5Q A;  3UI6 A;  1FJD A;  2RUR A;  3O5O A;  2PV3 A;  2XPB A;  1PBK A;  2KFW A;  2MF9 A;  1FKK A;  2D9F A;  4IQ2 A;  4QT3 A;  4U84 A;  3EY6 A;  1FAP A;  2LPV A;  1Q6I A;  3CGM A;  3FAP A;  3NRK A;  3O5G A;  5DIT A;  4JFM A;  2PPP A;  3IKD A;  2ITK A;  3KAH A;  3WH0 A;  3JXV A;  2IF4 A;  2M1I A;  2RUC A;  3O5K A;  3IKG A;  4DRK A;  1D7I A;  3KAD A;  4O2T A;  4JFI A;  1N1A A;  1T11 A;  2KI3 A;  4G50 A;  1KT0 A;  3O5D A;  2LGO A;  2Y78 A;  3UI5 A;  5B8I C;  2ZR4 A;  1B6C A;  4IQC A;  3PRB A;  1NSG A;  2F21 A;  2ZR6 A;  3JYJ A;  2F4E A;  2KGJ A;  4NNR A;  2ZQT A;  4QIB A;  4QT2 A;  1D7H A;  4N19 A;  3IK8 A;  4W9Q A;  5DIV A;  2VCD A;  1EQ3 A;  4W9P A;  2PV1 A;  2L2S A;  5HW7 A;  2PV2 A;  5BXJ A;  2F2D A;  2XP6 A;  5HTG A;  5I98 A;  5HKG A;  2RUD A;  3KAI A;  2MNT A;  4R0X A;  3UQI A;  1PIN A;  2JZV A;  2N87 A;  3TCZ A;  3UI4 A;  2LJ4 A;  4ITZ A;  1TCO C;  1ZK6 A;  4J4O A;  1M5Y A;  3NI6 A;  4DRH A;  3RFW A;  2KE0 A;  4GIV A;  4LAV A;  4BF8 A;  3RGC A;  3UQB A;  1YAT A;  1FKJ A;  2XP8 A;  1Y0O A;  4ODP A;  4ODL A;  4ODM A;  4TW7 A;  1NMW A;  4G2P A;  2MLY A;  1J6Y A;  4ODK A;  3H9R B;  4DZ3 A;  1R9H A;  2OFN A;  1J4I A;  2RSE A;  3KZ7 A;  3VAW A;  1FKH A;  2ZQS A;  2UZ5 A;  4ODO A;  2ZQV A;  3NTP A;  3JYM A;  1A7X A;  2XP4 A;  4TX0 A;  4DZ2 A;  1D7J A;  1J4H A;  2DG9 A;  1QPF A;  1Q1C A;  1D6O A;  5J6E A;  4JYS A;  4U86 A;  4MSP A;  2M2A A;  4LAX A;  1ROT A;  1BKF A;  4W9O A;  2MLX A;  4ODN A;  4J4N A;  2XP7 A;  2PPO A;  3ODK A;  3O5Q A;  1HXV A;  2M08 A;  2KR7 A;  2XP5 A;  1FKT A;  2K8I A;  3KCE A;  4DRQ A;  3LUO A;  4DRN A;  4DIP A;  2DG4 A;  3O5M A;  4DRI A;  4FAP A;  2MPH A;  1QPL A;  1BL4 A;  1Q6H A;  2KO7 A;  3B7X A;  1FKD A;  1FKF A;  3O5P A;  4IPX A;  1FKG A;  3TDB A;  4ODR A;  3UQA A;  1F40 A;  5HW8 A;  5HWC A;  2XP3 A;  1W26 A;  4FN2 A;  2DG3 A;  2ZQU A;  1J4R A;  4JFL A;  1EYM A;  3KAC A;  3KAB A;  4JFJ A;  4DRM A;  2XPA A;  1FKL A;  3I6C A;  3O5F A;  4DRO A;  3KAG A;  4ODQ A;  1JNS A;  2LKN A;  1C9H A;  4MGV A;  3PRD A;  3O5L A;  2AWG A;  2PBC A;  2PPN A;  2RQS A;  4TNS A;  4U85 A;  5HT1 A;  1ROU A;  4TW6 A;  5HW6 A; 
#chains in the Genus database with same CATH topology
 1GRJ A;  2FDM A;  1FKI A;  4DH0 A;  5DIU A;  1NWT A;  4DRJ A;  3ARV A;  3CZ8 A;  1L1P A;  4L72 B;  4C02 B;  2ZR5 A;  3ALF A;  3ARO A;  1FKS A;  5HWB A;  1WAW A;  2RUQ A;  3KAF A;  2WM0 A;  4JFK A;  1LL4 A;  3BMB A;  5DF0 A;  1P5Q A;  1FJD A;  2RUR A;  4Z2H A;  1CTN A;  4QT3 A;  1E6N A;  1E15 A;  1W9U A;  3ARX A;  3EY6 A;  3FAP A;  3RM8 A;  1W1T A;  4P8W A;  3RME A;  4WK9 A;  3WL1 A;  2PPP A;  1GOI A;  2M1I A;  3WD0 A;  2PN0 A;  1KT0 A;  3AQU A;  3PRB A;  4XAK A;  3JYJ A;  2F4E A;  4NNR A;  2ZQT A;  1KFW A;  2DT3 A;  4QT2 A;  2DSV A;  4W9Q A;  4WIW A;  4Z2I A;  5BXJ A;  2XP6 A;  5I98 A;  4HBO A;  2RUD A;  1WB0 A;  2MNT A;  3UQI A;  1PIN A;  2JZV A;  1HKJ A;  4ZPW R;  3WKZ A;  1TCO C;  3GTY X;  4J4O A;  5JH8 A;  4LGX A;  3WD3 A;  1ZBC A;  1NWU A;  4GIV A;  2EUL A;  1YAT A;  2G8Z A;  2XP8 A;  1HXV A;  4ODK A;  1R9H A;  1J4I A;  3KZ7 A;  2UZ5 A;  3NTP A;  3B9A A;  4R5E A;  4Z2L A;  1QPF A;  1Q1C A;  2DPE A;  5J6E A;  4MSP A;  1ROT A;  4W9O A;  4Z2G A;  2DSZ A;  2O9O A;  2M08 A;  1D2K A;  2XP5 A;  1FKT A;  3ARU A;  3CHD A;  2DG4 A;  1IX5 A;  3B7X A;  1FKD A;  5HWC A;  2ZQU A;  2WK2 A;  4UDM A;  4JFJ A;  1HJW A;  1ZBK A;  1OGG A;  3AS3 A;  4P8U A;  3O5F A;  1XRV A;  3KAG A;  4MGV A;  2AWG A;  2PBC A;  5HT1 A;  1ROU A;  4IT4 A;  5HW6 A;  1F8A B;  2A3E A;  3PA7 A;  1H0G A;  3W4R A;  2XP9 A;  3UF8 A;  1LJY A;  2YBU A;  3WQW A;  3B9E A;  3CGN A;  1JNT A;  4ZS6 A;  2Q5A A;  2AOS A;  1GPF A;  3B9D A;  2FKE A;  3RM4 A;  4LAY A;  5HUA A;  1K9T A;  2PV3 A;  4MNK A;  4L3N A;  3ARS A;  2KFW A;  2MF9 A;  4IQ2 A;  3ARZ A;  2LPV A;  1W9V A;  2DT1 A;  3IKD A;  2ITK A;  2OLH A;  5DEZ A;  2IF4 A;  1E6R A;  1D7I A;  3AS1 A;  3KAD A;  3RM9 A;  1N1A A;  2KI3 A;  3O5D A;  3ARP A;  5B8I C;  4IQC A;  1B6C A;  2F21 A;  2DT2 A;  1EIB A;  4MNJ A;  1EQ3 A;  2L2S A;  4MNM A;  3TCZ A;  2LJ4 A;  2WLY A;  1W1Y A;  5DO2 A;  4ITZ A;  1W1V A;  1NH6 A;  3RFW A;  1HJV A;  4DWS D;  1SR0 A;  4WKF A;  4ODP A;  4ODL A;  4ODM A;  4G2P A;  2MLY A;  3H9R B;  3VAW A;  4IT6 A;  4ODO A;  2ZQV A;  2B5U B;  3JYM A;  1RD6 A;  2PI6 A;  1J4H A;  2DG9 A;  2O92 A;  3WQV A;  2M2A A;  2MLX A;  2XP7 A;  3ALG A;  2PPO A;  4NZC A;  2KR7 A;  4PTM A;  3LUO A;  4FAP A;  4DRI A;  1LG1 A;  2MPH A;  2G41 A;  1Q6H A;  3UQA A;  3O5P A;  1FKF A;  2B31 A;  1ZL1 A;  4FN2 A;  3KAC A;  1LL7 A;  4DWS B;  3ARY A;  4ODQ A;  4NSB A;  1EDQ A;  4TW6 A;  3WD4 A;  4DT4 A;  1U79 A;  1Q6U A;  4DRP A;  3O5I A;  3MDY B;  1KT1 A;  1ZB5 A;  1YW5 A;  4Q7N A;  3G6M A;  4LAW A;  4TYO A;  5GPG A;  3OOB A;  3O5E A;  5D75 A;  1FKB A;  1LG2 A;  3O5O A;  1GUV A;  1PBK A;  4U84 A;  3EIP A;  1FAP A;  1Q6I A;  3CGM A;  3O5G A;  5DIT A;  4MPK A;  3WH0 A;  2RUC A;  3O5K A;  1T11 A;  3UI5 A;  3OA5 A;  2LGO A;  2Y78 A;  3PR9 A;  2ZR4 A;  3FXY A;  4HBE A;  2ESC A;  3PRA A;  5DIV A;  2VCD A;  4W9P A;  2PV1 A;  5HW7 A;  2PV2 A;  2F2D A;  3WIJ A;  4MAV A;  1JCH B;  2IUZ A;  4QZV B;  2WLZ A;  1HKK A;  1M5Y A;  3NI6 A;  4DWS C;  4LAV A;  1FKJ A;  3CHE A;  1O6I A;  4S3K A;  1Y0O A;  2A3A A;  4DZ3 A;  2OFN A;  3CH9 A;  1JND A;  1NWS A;  2ZQS A;  1WNO A;  3AS2 A;  1OGB A;  3GU0 A;  1D6O A;  1W9P A;  4P8V A;  4U86 A;  4LAX A;  1BKF A;  4ODN A;  4J4N A;  1HKI A;  2K8I A;  3WD2 A;  3KCE A;  4DIP A;  1QPL A;  2KO7 A;  1FKG A;  4KQZ A;  2F23 A;  5HW8 A;  4Z2J A;  1UR8 A;  1ITX A;  1J4R A;  4JFL A;  1EYM A;  1FKL A;  1ZU8 A;  3PRD A;  2A3C A;  4MNL A;  4URI A;  4TNS A;  4U85 A;  2QF8 A;  4ML4 A;  1NWR A;  1ZCN A;  2VN1 A;  3O5R A;  1FD9 A;  3TC5 A;  3B8S A;  4DWS A;  5GQB A;  4TW8 A;  4P8X A;  2MLZ A;  1FKR A;  3O5J A;  1ZBW A;  2DSW A;  1QZ2 A;  3GPK A;  2FAP A;  1NMV A;  2DT0 A;  4GGQ A;  3IHZ A;  1JVW A;  3UI6 A;  1E44 A;  2XPB A;  1FKK A;  2D9F A;  3NRK A;  3BXW A;  4JFM A;  3KAH A;  3JXV A;  4DRK A;  3IKG A;  1FFQ A;  4O2T A;  4JFI A;  4S3J A;  4G50 A;  1EHN A;  1SYT A;  1NSG A;  2ZR6 A;  3FY1 A;  1HJX A;  2KGJ A;  4QIB A;  1LL6 A;  1D7H A;  4N19 A;  3IK8 A;  2YBT A;  1H0I A;  1XHG A;  5HTG A;  5HKG A;  3KAI A;  4R0X A;  2N87 A;  3UI4 A;  1OWQ A;  2ETN A;  3CHF A;  1ZK6 A;  1E6P A;  1X6L A;  4DRH A;  1E6Z A;  2KE0 A;  1X6N A;  4BF8 A;  3RGC A;  3UQB A;  1W1P A;  4HAR A;  1HKM A;  3ARQ A;  4TW7 A;  1NMW A;  3ARW A;  4KR0 B;  1J6Y A;  3QOK A;  1JNE A;  2RSE A;  1FKH A;  4W5U A;  1ZBV A;  1FFR A;  3G6L A;  1A7X A;  2XP4 A;  4TX0 A;  4WKH A;  4DZ2 A;  1D7J A;  4ZPT R;  1TFV A;  5HBF A;  4JYS A;  3WL0 A;  1UR9 A;  4ZPV R;  3ODK A;  3O5Q A;  1VF8 A;  3ART A;  4DRQ A;  2DSU A;  4DRN A;  4MTV A;  3O5M A;  3ARR A;  3WD1 A;  1BL4 A;  3TDB A;  4IPX A;  1F40 A;  3AS0 A;  4ODR A;  5GPR A;  2XP3 A;  1W26 A;  2DG3 A;  3CHC A;  3KAB A;  1LQ0 A;  4AY1 A;  4DRM A;  2XPA A;  3I6C A;  4DRO A;  2A3B A;  4Z2K A;  2LKN A;  1C9H A;  1JNS A;  2P4V A;  3O5L A;  2PPN A;  2RQS A;  4Q22 A;  4WKA A;  1E9L A;  4WJX A; 
#chains in the Genus database with same CATH homology
 2FDM A;  4DH0 A;  1FKI A;  5DIU A;  1NWT A;  4DRJ A;  3ARV A;  3CZ8 A;  1L1P A;  4L72 B;  4C02 B;  2ZR5 A;  3ALF A;  3ARO A;  1FKS A;  5HWB A;  1WAW A;  2RUQ A;  3KAF A;  2WM0 A;  4JFK A;  1LL4 A;  5DF0 A;  1P5Q A;  1FJD A;  2RUR A;  4Z2H A;  1CTN A;  4QT3 A;  1E6N A;  1E15 A;  1W9U A;  3ARX A;  3EY6 A;  3FAP A;  3RM8 A;  1W1T A;  4P8W A;  3RME A;  4WK9 A;  3WL1 A;  2PPP A;  1GOI A;  2M1I A;  3WD0 A;  1KT0 A;  3AQU A;  3PRB A;  4XAK A;  3JYJ A;  2F4E A;  4NNR A;  2ZQT A;  1KFW A;  2DT3 A;  4QT2 A;  2DSV A;  4W9Q A;  4WIW A;  4Z2I A;  5BXJ A;  2XP6 A;  5I98 A;  4HBO A;  2RUD A;  1WB0 A;  2MNT A;  3UQI A;  1PIN A;  2JZV A;  1HKJ A;  4ZPW R;  3WKZ A;  1TCO C;  4J4O A;  5JH8 A;  4LGX A;  3WD3 A;  1ZBC A;  1NWU A;  4GIV A;  1YAT A;  2G8Z A;  2XP8 A;  1HXV A;  4ODK A;  1R9H A;  1J4I A;  3KZ7 A;  2UZ5 A;  3NTP A;  3B9A A;  4R5E A;  4Z2L A;  1QPF A;  1Q1C A;  2DPE A;  5J6E A;  4MSP A;  1ROT A;  4W9O A;  4Z2G A;  2DSZ A;  2O9O A;  2M08 A;  1D2K A;  2XP5 A;  1FKT A;  3ARU A;  3CHD A;  2DG4 A;  1IX5 A;  3B7X A;  1FKD A;  5HWC A;  2ZQU A;  2WK2 A;  4JFJ A;  1HJW A;  1ZBK A;  1OGG A;  3AS3 A;  4P8U A;  3O5F A;  1XRV A;  3KAG A;  4MGV A;  2AWG A;  2PBC A;  5HT1 A;  1ROU A;  4IT4 A;  5HW6 A;  1F8A B;  2A3E A;  3PA7 A;  1H0G A;  3W4R A;  2XP9 A;  3UF8 A;  1LJY A;  2YBU A;  3WQW A;  3B9E A;  3CGN A;  1JNT A;  4ZS6 A;  2Q5A A;  2AOS A;  1GPF A;  3B9D A;  2FKE A;  3RM4 A;  4LAY A;  5HUA A;  1K9T A;  2PV3 A;  4MNK A;  4L3N A;  3ARS A;  2KFW A;  2MF9 A;  4IQ2 A;  3ARZ A;  2LPV A;  1W9V A;  2DT1 A;  3IKD A;  2ITK A;  2OLH A;  5DEZ A;  2IF4 A;  1E6R A;  1D7I A;  3AS1 A;  3KAD A;  3RM9 A;  1N1A A;  2KI3 A;  3O5D A;  3ARP A;  5B8I C;  4IQC A;  1B6C A;  2F21 A;  2DT2 A;  1EIB A;  4MNJ A;  1EQ3 A;  2L2S A;  4MNM A;  3TCZ A;  2LJ4 A;  2WLY A;  1W1Y A;  5DO2 A;  4ITZ A;  1W1V A;  1NH6 A;  3RFW A;  1HJV A;  4DWS D;  1SR0 A;  4WKF A;  4ODP A;  4ODL A;  4ODM A;  4G2P A;  2MLY A;  3H9R B;  3VAW A;  4IT6 A;  4ODO A;  2ZQV A;  1RD6 A;  3JYM A;  2PI6 A;  1J4H A;  2DG9 A;  2O92 A;  3WQV A;  2M2A A;  2MLX A;  2XP7 A;  3ALG A;  2PPO A;  4NZC A;  2KR7 A;  4PTM A;  3LUO A;  4FAP A;  4DRI A;  1LG1 A;  2MPH A;  2G41 A;  1Q6H A;  3UQA A;  3O5P A;  1FKF A;  2B31 A;  1ZL1 A;  4FN2 A;  3KAC A;  1LL7 A;  4DWS B;  3ARY A;  4ODQ A;  4NSB A;  1EDQ A;  4TW6 A;  3WD4 A;  4DT4 A;  1U79 A;  1Q6U A;  4DRP A;  3O5I A;  3MDY B;  1KT1 A;  1ZB5 A;  1YW5 A;  4Q7N A;  3G6M A;  4LAW A;  4TYO A;  5GPG A;  3OOB A;  3O5E A;  5D75 A;  1FKB A;  1LG2 A;  3O5O A;  1GUV A;  1PBK A;  4U84 A;  1FAP A;  1Q6I A;  3CGM A;  3O5G A;  5DIT A;  4MPK A;  3WH0 A;  2RUC A;  3O5K A;  1T11 A;  3UI5 A;  3OA5 A;  2LGO A;  2Y78 A;  3PR9 A;  2ZR4 A;  3FXY A;  4HBE A;  2ESC A;  3PRA A;  5DIV A;  2VCD A;  4W9P A;  2PV1 A;  5HW7 A;  2PV2 A;  2F2D A;  3WIJ A;  4MAV A;  2IUZ A;  4QZV B;  2WLZ A;  1HKK A;  1M5Y A;  3NI6 A;  4DWS C;  4LAV A;  1FKJ A;  3CHE A;  1O6I A;  4S3K A;  1Y0O A;  2A3A A;  4DZ3 A;  2OFN A;  3CH9 A;  1JND A;  1NWS A;  2ZQS A;  1WNO A;  3AS2 A;  1OGB A;  1D6O A;  1W9P A;  4P8V A;  4U86 A;  4LAX A;  1BKF A;  4ODN A;  4J4N A;  1HKI A;  2K8I A;  3WD2 A;  3KCE A;  4DIP A;  1QPL A;  2KO7 A;  1FKG A;  4KQZ A;  5HW8 A;  4Z2J A;  1UR8 A;  1ITX A;  1J4R A;  4JFL A;  1EYM A;  1FKL A;  1ZU8 A;  3PRD A;  2A3C A;  4MNL A;  4URI A;  4TNS A;  4U85 A;  2QF8 A;  4ML4 A;  1NWR A;  1ZCN A;  2VN1 A;  3O5R A;  1FD9 A;  3TC5 A;  3B8S A;  4DWS A;  5GQB A;  4TW8 A;  4P8X A;  2MLZ A;  1FKR A;  3O5J A;  1ZBW A;  2DSW A;  1QZ2 A;  3GPK A;  2FAP A;  1NMV A;  2DT0 A;  4GGQ A;  3IHZ A;  1JVW A;  3UI6 A;  2XPB A;  1FKK A;  2D9F A;  3NRK A;  3BXW A;  4JFM A;  3KAH A;  3JXV A;  4DRK A;  3IKG A;  1FFQ A;  4O2T A;  4JFI A;  4S3J A;  4G50 A;  1EHN A;  1SYT A;  1NSG A;  2ZR6 A;  3FY1 A;  1HJX A;  2KGJ A;  4QIB A;  1LL6 A;  1D7H A;  4N19 A;  3IK8 A;  2YBT A;  1H0I A;  1XHG A;  5HTG A;  5HKG A;  3KAI A;  4R0X A;  2N87 A;  3UI4 A;  1OWQ A;  3CHF A;  1ZK6 A;  1E6P A;  1X6L A;  4DRH A;  1E6Z A;  2KE0 A;  1X6N A;  4BF8 A;  3RGC A;  3UQB A;  1W1P A;  4HAR A;  1HKM A;  3ARQ A;  4TW7 A;  1NMW A;  3ARW A;  4KR0 B;  1J6Y A;  3QOK A;  1JNE A;  2RSE A;  1FKH A;  4W5U A;  1ZBV A;  1FFR A;  3G6L A;  1A7X A;  2XP4 A;  4TX0 A;  4WKH A;  4DZ2 A;  1D7J A;  4ZPT R;  1TFV A;  5HBF A;  4JYS A;  3WL0 A;  1UR9 A;  4ZPV R;  3ODK A;  3O5Q A;  1VF8 A;  3ART A;  4DRQ A;  2DSU A;  4DRN A;  4MTV A;  3O5M A;  3ARR A;  3WD1 A;  1BL4 A;  3TDB A;  4IPX A;  1F40 A;  3AS0 A;  4ODR A;  5GPR A;  2XP3 A;  1W26 A;  2DG3 A;  3CHC A;  3KAB A;  1LQ0 A;  4AY1 A;  4DRM A;  2XPA A;  3I6C A;  4DRO A;  2A3B A;  4Z2K A;  2LKN A;  1C9H A;  1JNS A;  3O5L A;  2PPN A;  2RQS A;  4Q22 A;  4WKA A;  1E9L A;  4WJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...