5BXJA

Complex of the fk1 domain mutant a19t of fkbp51 with 4-nitrophenol
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
127
structure length
127
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title The environmental endocrine disruptor p-nitrophenol interacts with FKBP51, a positive regulator of androgen receptor and inhibits androgen receptor signaling in human cells
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 32
structure length 127
sequence length 127
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2015-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5bxjA00
1BL4A 2RUQA 1JNTA 1KT1A 3O5IA 2PPPA 4LAVA 5HWCA 5DITA 3PRBA 5HW8A 1F8AB 2ITKA 2MNTA 1YW5A 4DRMA 1JNSA 1FKTA 1A7XA 4DZ2A 3UQBA 1Q1CA 2ZR4A 2VN1A 1NMWA 5HTGA 3JYMA 2D9FA 3UI5A 4ODNA 2MF9A 5HT1A 2PPOA 1U79A 4ITZA 3KAHA 3O5EA 1QPLA 4R0XA 1EYMA 5DIVA 1QPFA 5BXJA 1NSGA 2KE0A 3O5FA 4G50A 4O2TA 5D75A 5HWBA 2RURA 4DT4A 4LAYA 3VAWA 1J6YA 1N1AA 3IKGA 1J4RA 1JVWA 3O5DA 1P5QA 3LUOA 4TYOA 2Q5AA 2KR7A 1R9HA 3EY6A 1KT0A 3UQIA 2F4EA 2PPNA 3NRKA 1F40A 4ODQA 4TX0A 3JYJA 3CGNA 2XP3A 2F2DA 2XP7A 2F21A 2PBCA 2RSEA 2XPBA 3NI6A 4TW6A 3ODKA 2LPVA 2AWGA 1Q6HA 4QIBA 3KCEA 1ZK6A 1TCOC 3NTPA 4ODOA 1D7JA 4TW8A 4NNRA 2XP8A 3WH0A 4DRHA 1C9HA 2KO7A 4DH0A 5GPGA 3KAIA 1FKSA 1M5YA 1FKDA 2L2SA 4ODMA 2OFNA 4W9OA 4FAPA 5HUAA 3IKDA 2M08A 3MDYB 2MLXA 5DIUA 1T11A 4MGVA 3TCZA 1YATA 3O5RA 1D6OA 1ROUA 3O5GA 4GGQA 4J4NA 1PBKA 3KAGA 1FKHA 3PA7A 2K8IA 4JFLA 3KACA 3KABA 3B7XA 4JFIA 4TNSA 4LAWA 3TDBA 3UI6A 1ROTA 2KI3A 4U84A 4BF8A 2ZR5A 4DIPA 4ODLA 3CGMA 2Y78A 3OOBA 4W9PA 1FKLA 1Q6UA 2PV2A 2XPAA 2ZQTA 4JYSA 4MSPA 2XP4A 4QT2A 4LAXA 5HW7A 2XP6A 2XP5A 2MPHA 2FAPA 3I6CA 4DRPA 1FKGA 2LKNA 3RFWA 2PV3A 2PV1A 2JZVA 4G2PA 3O5OA 2ZQVA 4N19A 1D7HA 2UZ5A 1FKFA 3H9RB 4IQ2A 4ODKA 4JFJA 4DRIA 5HW6A 1ZCNA 1J4HA 3KADA 3O5PA 4ODRA 1HXVA 1PINA 4IQCA 1NMVA 1FKBA 4JFMA 2MLYA 2DG4A 3O5MA 1B6CA 3KZ7A 2VCDA 1D7IA 3IK8A 2KGJA 3O5KA 2MLZA 3GPKA 3UF8A 2KFWA 3O5QA 4TW7A 4DRJA 1FJDA 4ODPA 3O5JA 2M1IA 4DRKA 2XP9A 2DG3A 1FKJA 2IF4A 4U85A 1FKIA 1BKFA 2ZQUA 2ZR6A 3RGCA 3UI4A 4DRQA 5J6EA 3IHZA 4GIVA 4C02B 2M2AA 2N87A 4FN2A 2LJ4A 4DRNA 5B8IC 1W26A 4JFKA 1QZ2A 4QT3A 1Y0OA 1J4IA 3O5LA 3TC5A 1FD9A 2RUCA 2DG9A 1L1PA 4J4OA 1FKRA 4U86A 5HKGA 4IPXA 4DZ3A 1FAPA 5I98A 3FAPA 2FKEA 1Q6IA 2RUDA 2LGOA 2RQSA 3PRDA 4DROA 3UQAA 1EQ3A 2ZQSA 1FKKA 4W9QA 3KAFA 3JXVA
chains in the Genus database with same CATH superfamily
1E44A 1KT1A 1E6PA 2YBTA 4LAVA 1ZU8A 5DITA 2ITKA 1JNSA 4DRMA 4DZ2A 2VN1A 4MAVA 1WNOA 4ODNA 2DT2A 4R0XA 1GUVA 3ARRA 4O2TA 3O5FA 1HKJA 3ALFA 3WD2A 4LAYA 3VAWA 3PR9A 1OGBA 1P5QA 1IX5A 1NWRA 3EY6A 3UQIA 3ARSA 3NRKA 3AQUA 4U86A 2XP3A 2PBCA 4WIWA 2DT3A 3BXWA 3NTPA 4TW8A 3ARQA 2A3EA 3AS3A 1E9LA 1ZBKA 1M5YA 2L2SA 5DEZA 1VF8A 4W9OA 3FY1A 1UR8A 2M08A 3G6LA 3WD0A 4MGVA 3O5RA 1D6OA 2ESCA 4GGQA 4J4NA 4JFLA 2K8IA 1TFVA 4TNSA 4LAWA 1ROTA 2KI3A 4DIPA 4ODLA 3WKZA 1Q6UA 2PV2A 4LAXA 2EULA 2FAPA 3I6CA 2O92A 2ZQVA 4DRIA 4ODKA 3CH9A 3KADA 4ODRA 1PINA 2WLYA 4UDMA 1K9TA 2WK2A 1ZBCA 1EHNA 1D7IA 2KGJA 2MLZA 3GPKA 3UF8A 3GU0A 3O5QA 4DRJA 4DRKA 2DG3A 4DWSD 2IF4A 2ZR6A 1W1YA 4C02B 2N87A 4FN2A 2LJ4A 4ZS6A 1QZ2A 3TC5A 4Z2HA 2RUCA 1L1PA 4HBEA 2DSWA 2DT0A 2IUZA 5I98A 3FAPA 2FKEA 1Q6IA 2LGOA 2DSVA 4IT4A 5DF0A 4NZCA 1BL4A 4P8UA 3CHDA 1GOIA 4MPKA 2PPPA 1X6NA 2DT1A 1F8AB 2MNTA 4LGXA 1FKTA 2PI6A 2DSUA 3UQBA 2ZR4A 1NMWA 5HTGA 2D9FA 4P8VA 3UI5A 1FFRA 2B5UB 1D2KA 2PPOA 4Z2GA 4P8XA 5GQBA 2A3AA 5BXJA 4G50A 5HWBA 5D75A 4WJXA 4XAKA 1J6YA 1N1AA 3IKGA 1XRVA 2Q5AA 3G6MA 1KT0A 1W9UA 4W5UA 2PN0A 3JYJA 3NI6A 2XP7A 2F2DA 2F21A 4ZPWR 1Q6HA 1LG1A 3WD3A 1D7JA 4NNRA 1FKSA 1LL4A 1E6NA 5HUAA 3IKDA 3MDYB 5DIUA 3TCZA 1ROUA 3ARYA 1W9VA 1FKHA 3KABA 3B7XA 1LG2A 3TDBA 2ZR5A 1FKLA 2ZQTA 4MSPA 5HW7A 2PV3A 3WQVA 3W4RA 2JZVA 3O5OA 3BMBA 3H9RB 4IQ2A 5HW6A 1H0IA 3O5PA 1NMVA 3ARVA 4JFMA 2DG4A 3O5MA 1B6CA 1WB0A 4AY1A 2KFWA 2WM0A 2WLZA 3O5JA 2XP9A 1FKJA 3ARUA 2A3BA 2ZQUA 4DRQA 5J6EA 3RM4A 1NWSA 3IHZA 4GIVA 2ETNA 2M2AA 4ML4A 4JFKA 1Y0OA 4ZPVR 1EIBA 4P8WA 5HKGA 4IPXA 4KR0B 3WQWA 4DZ3A 1E15A 2G41A 2RUDA 1HKMA 4Z2JA 1WAWA 3PRDA 3ALGA 4S3KA 4WKFA 4DROA 3UQAA 1EQ3A 3CHCA 1FKKA 4W9QA 3KAFA 1O6IA 2RUQA 1H0GA 1JNTA 2DPEA 3O5IA 3AS0A 1XHGA 3PRBA 1YW5A 3ARXA 4HARA 3B8SA 1E6RA 1GRJA 5GPRA 3B9AA 1FFQA 5DIVA 1QPFA 4MNJA 3OA5A 4DT4A 4HBOA 1JCHB 1J4RA 1JVWA 3AS2A 3O5DA 3WIJA 1R9HA 3WL0A 3WL1A 4ODQA 4TX0A 4IT6A 2DSZA 2RSEA 4TW6A 1LQ0A 2LPVA 2AWGA 1NH6A 3KCEA 1TCOC 3RMEA 3WH0A 2KO7A 5GPGA 3KAIA 2OFNA 3PRAA 1ITXA 2MLXA 1W1VA 2QF8A 1OWQA 1YATA 4WK9A 2YBUA 3O5GA 3B9DA 3ARZA 4JFIA 1W9PA 1UR9A 1ZB5A 1NWTA 2XPAA 4QT2A 2XP4A 3ARPA 3ARTA 2XP5A 4DRPA 2LKNA 2PV1A 1JNDA 2A3CA 4G2PA 3GTYX 2UZ5A 1FKFA 1ZL1A 3WD4A 1LL6A 1HKIA 1FKBA 2MLYA 3AS1A 2VCDA 3IK8A 3O5KA 4WKAA 1FJDA 4TW7A 4ODPA 3QOKA 1X6LA 1BKFA 2AOSA 3UI4A 2G8ZA 4MNLA 4QZVB 5B8IC 1EDQA 4S3JA 3EIPA 1J4IA 3O5LA 4MNMA 1FD9A 2FDMA 4L72B 2DG9A 4J4OA 1OGGA 1LL7A 3B9EA 4L3NA 1KFWA 2ZQSA 4DWSC 5DO2A 4DWSA 1SYTA 3WD1A 3CHFA 1SR0A 5HWCA 1W1PA 4KQZA 1A7XA 4MNKA 1Q1CA 3ARWA 3JYMA 2MF9A 5HT1A 1U79A 4ITZA 3KAHA 3O5EA 1QPLA 1EYMA 1NSGA 2KE0A 2RURA 4TYOA 3LUOA 1JNEA 2KR7A 2F4EA 2PPNA 3RM9A 1F40A 1HJXA 3CGNA 2XPBA 3ODKA 4QIBA 1ZK6A 4ODOA 4DRHA 2XP8A 3AROA 1C9HA 4DH0A 1FKDA 4ODMA 4FAPA 4Z2KA 1T11A 4URIA 4Z2IA 1PBKA 3KAGA 3PA7A 3KACA 3UI6A 4BF8A 4U84A 4MTVA 3CGMA 2Y78A 3OOBA 4W9PA 4Z2LA 1HJWA 4JYSA 4ZPTR 4PTMA 2XP6A 5HW8A 2MPHA 1FKGA 3RFWA 1ZBWA 4N19A 1D7HA 2F23A 2B31A 4JFJA 1ZCNA 1ZBVA 1J4HA 2OLHA 4Q7NA 1HXVA 4IQCA 3KZ7A 1LJYA 1RD6A 3FXYA 1NWUA 3RM8A 4R5EA 2M1IA 1W1TA 5HBFA 1HKKA 4U85A 1FKIA 3RGCA 4Q22A 5JH8A 1GPFA 1HJVA 4DRNA 3CZ8A 1W26A 4QT3A 4WKHA 1E6ZA 2O9OA 1FKRA 3CHEA 1CTNA 1FAPA 4DWSB 2RQSA 2P4VA 4NSBA 3JXVA
chains in the Genus database with same CATH topology
1KT1A 1E6PA 2YBTA 4LAVA 1ZU8A 5DITA 2ITKA 1JNSA 4DRMA 4DZ2A 2VN1A 4MAVA 1WNOA 4ODNA 2DT2A 4R0XA 1GUVA 3ARRA 4O2TA 3O5FA 1HKJA 3ALFA 3WD2A 4LAYA 3VAWA 3PR9A 1OGBA 1P5QA 1IX5A 1NWRA 3EY6A 3UQIA 3ARSA 3NRKA 3AQUA 4U86A 2XP3A 2PBCA 4WIWA 2DT3A 3BXWA 3NTPA 4TW8A 3ARQA 2A3EA 3AS3A 1E9LA 1ZBKA 1M5YA 2L2SA 5DEZA 1VF8A 4W9OA 3FY1A 1UR8A 2M08A 3G6LA 3WD0A 4MGVA 3O5RA 1D6OA 2ESCA 4GGQA 4J4NA 4JFLA 2K8IA 1TFVA 4TNSA 4LAWA 1ROTA 2KI3A 4DIPA 4ODLA 3WKZA 1Q6UA 2PV2A 4LAXA 2FAPA 3I6CA 2O92A 2ZQVA 4DRIA 4ODKA 3CH9A 3KADA 4ODRA 1PINA 2WLYA 1K9TA 2WK2A 1ZBCA 1EHNA 1D7IA 2KGJA 2MLZA 3GPKA 3UF8A 4DRJA 3O5QA 4DRKA 2DG3A 4DWSD 2IF4A 2ZR6A 1W1YA 4C02B 2N87A 4FN2A 2LJ4A 4ZS6A 1QZ2A 3TC5A 4Z2HA 2RUCA 1L1PA 4HBEA 2DSWA 2DT0A 2IUZA 5I98A 3FAPA 2FKEA 1Q6IA 2LGOA 2DSVA 4IT4A 5DF0A 4NZCA 1BL4A 4P8UA 3CHDA 1GOIA 4MPKA 2PPPA 1X6NA 2DT1A 1F8AB 2MNTA 4LGXA 1FKTA 2PI6A 2DSUA 3UQBA 2ZR4A 1NMWA 5HTGA 2D9FA 4P8VA 3UI5A 1FFRA 1D2KA 2PPOA 4Z2GA 4P8XA 5GQBA 2A3AA 5BXJA 4G50A 5HWBA 5D75A 4WJXA 4XAKA 1J6YA 1N1AA 3IKGA 1XRVA 2Q5AA 3G6MA 1KT0A 1W9UA 4W5UA 3JYJA 3NI6A 2XP7A 2F2DA 2F21A 4ZPWR 1Q6HA 1LG1A 3WD3A 1D7JA 4NNRA 1FKSA 1LL4A 1E6NA 5HUAA 3IKDA 3MDYB 5DIUA 3TCZA 1ROUA 3ARYA 1W9VA 1FKHA 3KABA 3B7XA 1LG2A 3TDBA 2ZR5A 1FKLA 2ZQTA 4MSPA 5HW7A 2PV3A 3WQVA 3W4RA 2JZVA 3O5OA 3H9RB 4IQ2A 5HW6A 1H0IA 3O5PA 1NMVA 3ARVA 4JFMA 2DG4A 3O5MA 1B6CA 1WB0A 4AY1A 2KFWA 2WM0A 2WLZA 3O5JA 2XP9A 1FKJA 3ARUA 2A3BA 2ZQUA 4DRQA 5J6EA 3RM4A 1NWSA 3IHZA 4GIVA 2M2AA 4ML4A 4JFKA 1Y0OA 4ZPVR 1EIBA 4P8WA 5HKGA 4IPXA 4KR0B 3WQWA 4DZ3A 1E15A 2G41A 2RUDA 1HKMA 4Z2JA 1WAWA 3PRDA 3ALGA 4S3KA 4WKFA 4DROA 3UQAA 1EQ3A 3CHCA 1FKKA 4W9QA 3KAFA 1O6IA 2RUQA 1H0GA 1JNTA 2DPEA 3O5IA 3AS0A 1XHGA 3PRBA 1YW5A 3ARXA 4HARA 3B8SA 1E6RA 5GPRA 3B9AA 1FFQA 5DIVA 1QPFA 4MNJA 3OA5A 4DT4A 4HBOA 1J4RA 1JVWA 3AS2A 3O5DA 3WIJA 1R9HA 3WL0A 3WL1A 4ODQA 4TX0A 4IT6A 2DSZA 2RSEA 4TW6A 1LQ0A 2LPVA 2AWGA 1NH6A 3KCEA 1TCOC 3RMEA 3WH0A 2KO7A 5GPGA 3KAIA 2OFNA 3PRAA 1ITXA 2MLXA 1W1VA 2QF8A 1OWQA 1YATA 4WK9A 2YBUA 3O5GA 3B9DA 3ARZA 4JFIA 1W9PA 1UR9A 1ZB5A 1NWTA 2XPAA 4QT2A 2XP4A 3ARPA 3ARTA 2XP5A 4DRPA 2LKNA 2PV1A 1JNDA 2A3CA 4G2PA 2UZ5A 1FKFA 1ZL1A 3WD4A 1LL6A 1HKIA 1FKBA 2MLYA 3AS1A 2VCDA 3IK8A 3O5KA 4WKAA 1FJDA 4TW7A 4ODPA 3QOKA 1X6LA 1BKFA 2AOSA 3UI4A 2G8ZA 4MNLA 4QZVB 5B8IC 1EDQA 4S3JA 1J4IA 3O5LA 4MNMA 1FD9A 2FDMA 4L72B 2DG9A 4J4OA 1OGGA 1LL7A 3B9EA 4L3NA 1KFWA 2ZQSA 4DWSC 5DO2A 4DWSA 1SYTA 3WD1A 3CHFA 1SR0A 5HWCA 1W1PA 4KQZA 1A7XA 4MNKA 1Q1CA 3ARWA 3JYMA 2MF9A 5HT1A 1U79A 4ITZA 3KAHA 3O5EA 1QPLA 1EYMA 1NSGA 2KE0A 2RURA 4TYOA 3LUOA 1JNEA 2KR7A 2F4EA 2PPNA 3RM9A 1F40A 1HJXA 3CGNA 2XPBA 3ODKA 4QIBA 1ZK6A 4ODOA 4DRHA 2XP8A 3AROA 1C9HA 4DH0A 1FKDA 4ODMA 4FAPA 4Z2KA 1T11A 4URIA 4Z2IA 1PBKA 3KAGA 3PA7A 3KACA 3UI6A 4BF8A 4U84A 4MTVA 3CGMA 2Y78A 3OOBA 4W9PA 4Z2LA 1HJWA 4JYSA 4ZPTR 4PTMA 2XP6A 5HW8A 2MPHA 1FKGA 3RFWA 1ZBWA 4N19A 1D7HA 2B31A 4JFJA 1ZCNA 1ZBVA 1J4HA 2OLHA 4Q7NA 1HXVA 4IQCA 3KZ7A 1LJYA 1RD6A 3FXYA 1NWUA 3RM8A 4R5EA 2M1IA 1W1TA 5HBFA 1HKKA 4U85A 1FKIA 3RGCA 4Q22A 5JH8A 1GPFA 1HJVA 4DRNA 3CZ8A 1W26A 4QT3A 4WKHA 1E6ZA 2O9OA 1FKRA 3CHEA 1CTNA 1FAPA 4DWSB 2RQSA 4NSBA 3JXVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BL4 A;  2RUQ A;  1JNT A;  1KT1 A;  3O5I A;  2PPP A;  4LAV A;  5HWC A;  5DIT A;  3PRB A;  5HW8 A;  1F8A B;  2ITK A;  2MNT A;  1YW5 A;  4DRM A;  1JNS A;  1FKT A;  1A7X A;  4DZ2 A;  3UQB A;  1Q1C A;  2ZR4 A;  2VN1 A;  1NMW A;  5HTG A;  3JYM A;  2D9F A;  3UI5 A;  4ODN A;  2MF9 A;  5HT1 A;  2PPO A;  1U79 A;  4ITZ A;  3KAH A;  3O5E A;  1QPL A;  4R0X A;  1EYM A;  5DIV A;  1QPF A;  5BXJ A;  1NSG A;  2KE0 A;  3O5F A;  4G50 A;  4O2T A;  5D75 A;  5HWB A;  2RUR A;  4DT4 A;  4LAY A;  3VAW A;  1J6Y A;  1N1A A;  3IKG A;  1J4R A;  1JVW A;  3O5D A;  1P5Q A;  3LUO A;  4TYO A;  2Q5A A;  2KR7 A;  1R9H A;  3EY6 A;  1KT0 A;  3UQI A;  2F4E A;  2PPN A;  3NRK A;  1F40 A;  4ODQ A;  4TX0 A;  3JYJ A;  3CGN A;  2XP3 A;  2F2D A;  2XP7 A;  2F21 A;  2PBC A;  2RSE A;  2XPB A;  3NI6 A;  4TW6 A;  3ODK A;  2LPV A;  2AWG A;  1Q6H A;  4QIB A;  3KCE A;  1ZK6 A;  1TCO C;  3NTP A;  4ODO A;  1D7J A;  4TW8 A;  4NNR A;  2XP8 A;  3WH0 A;  4DRH A;  1C9H A;  2KO7 A;  4DH0 A;  5GPG A;  3KAI A;  1FKS A;  1M5Y A;  1FKD A;  2L2S A;  4ODM A;  2OFN A;  4W9O A;  4FAP A;  5HUA A;  3IKD A;  2M08 A;  3MDY B;  2MLX A;  5DIU A;  1T11 A;  4MGV A;  3TCZ A;  1YAT A;  3O5R A;  1D6O A;  1ROU A;  3O5G A;  4GGQ A;  4J4N A;  1PBK A;  3KAG A;  1FKH A;  3PA7 A;  2K8I A;  4JFL A;  3KAC A;  3KAB A;  3B7X A;  4JFI A;  4TNS A;  4LAW A;  3TDB A;  3UI6 A;  1ROT A;  2KI3 A;  4U84 A;  4BF8 A;  2ZR5 A;  4DIP A;  4ODL A;  3CGM A;  2Y78 A;  3OOB A;  4W9P A;  1FKL A;  1Q6U A;  2PV2 A;  2XPA A;  2ZQT A;  4JYS A;  4MSP A;  2XP4 A;  4QT2 A;  4LAX A;  5HW7 A;  2XP6 A;  2XP5 A;  2MPH A;  2FAP A;  3I6C A;  4DRP A;  1FKG A;  2LKN A;  3RFW A;  2PV3 A;  2PV1 A;  2JZV A;  4G2P A;  3O5O A;  2ZQV A;  4N19 A;  1D7H A;  2UZ5 A;  1FKF A;  3H9R B;  4IQ2 A;  4ODK A;  4JFJ A;  4DRI A;  5HW6 A;  1ZCN A;  1J4H A;  3KAD A;  3O5P A;  4ODR A;  1HXV A;  1PIN A;  4IQC A;  1NMV A;  1FKB A;  4JFM A;  2MLY A;  2DG4 A;  3O5M A;  1B6C A;  3KZ7 A;  2VCD A;  1D7I A;  3IK8 A;  2KGJ A;  3O5K A;  2MLZ A;  3GPK A;  3UF8 A;  2KFW A;  3O5Q A;  4TW7 A;  4DRJ A;  1FJD A;  4ODP A;  3O5J A;  2M1I A;  4DRK A;  2XP9 A;  2DG3 A;  1FKJ A;  2IF4 A;  4U85 A;  1FKI A;  1BKF A;  2ZQU A;  2ZR6 A;  3RGC A;  3UI4 A;  4DRQ A;  5J6E A;  3IHZ A;  4GIV A;  4C02 B;  2M2A A;  2N87 A;  4FN2 A;  2LJ4 A;  4DRN A;  5B8I C;  1W26 A;  4JFK A;  1QZ2 A;  4QT3 A;  1Y0O A;  1J4I A;  3O5L A;  3TC5 A;  1FD9 A;  2RUC A;  2DG9 A;  1L1P A;  4J4O A;  1FKR A;  4U86 A;  5HKG A;  4IPX A;  4DZ3 A;  1FAP A;  5I98 A;  3FAP A;  2FKE A;  1Q6I A;  2RUD A;  2LGO A;  2RQS A;  3PRD A;  4DRO A;  3UQA A;  1EQ3 A;  2ZQS A;  1FKK A;  4W9Q A;  3KAF A;  3JXV A; 
#chains in the Genus database with same CATH topology
 1E44 A;  1KT1 A;  1E6P A;  2YBT A;  4LAV A;  1ZU8 A;  5DIT A;  2ITK A;  1JNS A;  4DRM A;  4DZ2 A;  2VN1 A;  4MAV A;  1WNO A;  4ODN A;  2DT2 A;  4R0X A;  1GUV A;  3ARR A;  4O2T A;  3O5F A;  1HKJ A;  3ALF A;  3WD2 A;  4LAY A;  3VAW A;  3PR9 A;  1OGB A;  1P5Q A;  1IX5 A;  1NWR A;  3EY6 A;  3UQI A;  3ARS A;  3NRK A;  3AQU A;  4U86 A;  2XP3 A;  2PBC A;  4WIW A;  2DT3 A;  3BXW A;  3NTP A;  4TW8 A;  3ARQ A;  2A3E A;  3AS3 A;  1E9L A;  1ZBK A;  1M5Y A;  2L2S A;  5DEZ A;  1VF8 A;  4W9O A;  3FY1 A;  1UR8 A;  2M08 A;  3G6L A;  3WD0 A;  4MGV A;  3O5R A;  1D6O A;  2ESC A;  4GGQ A;  4J4N A;  4JFL A;  2K8I A;  1TFV A;  4TNS A;  4LAW A;  1ROT A;  2KI3 A;  4DIP A;  4ODL A;  3WKZ A;  1Q6U A;  2PV2 A;  4LAX A;  2EUL A;  2FAP A;  3I6C A;  2O92 A;  2ZQV A;  4DRI A;  4ODK A;  3CH9 A;  3KAD A;  4ODR A;  1PIN A;  2WLY A;  4UDM A;  1K9T A;  2WK2 A;  1ZBC A;  1EHN A;  1D7I A;  2KGJ A;  2MLZ A;  3GPK A;  3UF8 A;  3GU0 A;  3O5Q A;  4DRJ A;  4DRK A;  2DG3 A;  4DWS D;  2IF4 A;  2ZR6 A;  1W1Y A;  4C02 B;  2N87 A;  4FN2 A;  2LJ4 A;  4ZS6 A;  1QZ2 A;  3TC5 A;  4Z2H A;  2RUC A;  1L1P A;  4HBE A;  2DSW A;  2DT0 A;  2IUZ A;  5I98 A;  3FAP A;  2FKE A;  1Q6I A;  2LGO A;  2DSV A;  4IT4 A;  5DF0 A;  4NZC A;  1BL4 A;  4P8U A;  3CHD A;  1GOI A;  4MPK A;  2PPP A;  1X6N A;  2DT1 A;  1F8A B;  2MNT A;  4LGX A;  1FKT A;  2PI6 A;  2DSU A;  3UQB A;  2ZR4 A;  1NMW A;  5HTG A;  2D9F A;  4P8V A;  3UI5 A;  1FFR A;  2B5U B;  1D2K A;  2PPO A;  4Z2G A;  4P8X A;  5GQB A;  2A3A A;  5BXJ A;  4G50 A;  5HWB A;  5D75 A;  4WJX A;  4XAK A;  1J6Y A;  1N1A A;  3IKG A;  1XRV A;  2Q5A A;  3G6M A;  1KT0 A;  1W9U A;  4W5U A;  2PN0 A;  3JYJ A;  3NI6 A;  2XP7 A;  2F2D A;  2F21 A;  4ZPW R;  1Q6H A;  1LG1 A;  3WD3 A;  1D7J A;  4NNR A;  1FKS A;  1LL4 A;  1E6N A;  5HUA A;  3IKD A;  3MDY B;  5DIU A;  3TCZ A;  1ROU A;  3ARY A;  1W9V A;  1FKH A;  3KAB A;  3B7X A;  1LG2 A;  3TDB A;  2ZR5 A;  1FKL A;  2ZQT A;  4MSP A;  5HW7 A;  2PV3 A;  3WQV A;  3W4R A;  2JZV A;  3O5O A;  3BMB A;  3H9R B;  4IQ2 A;  5HW6 A;  1H0I A;  3O5P A;  1NMV A;  3ARV A;  4JFM A;  2DG4 A;  3O5M A;  1B6C A;  1WB0 A;  4AY1 A;  2KFW A;  2WM0 A;  2WLZ A;  3O5J A;  2XP9 A;  1FKJ A;  3ARU A;  2A3B A;  2ZQU A;  4DRQ A;  5J6E A;  3RM4 A;  1NWS A;  3IHZ A;  4GIV A;  2ETN A;  2M2A A;  4ML4 A;  4JFK A;  1Y0O A;  4ZPV R;  1EIB A;  4P8W A;  5HKG A;  4IPX A;  4KR0 B;  3WQW A;  4DZ3 A;  1E15 A;  2G41 A;  2RUD A;  1HKM A;  4Z2J A;  1WAW A;  3PRD A;  3ALG A;  4S3K A;  4WKF A;  4DRO A;  3UQA A;  1EQ3 A;  3CHC A;  1FKK A;  4W9Q A;  3KAF A;  1O6I A;  2RUQ A;  1H0G A;  1JNT A;  2DPE A;  3O5I A;  3AS0 A;  1XHG A;  3PRB A;  1YW5 A;  3ARX A;  4HAR A;  3B8S A;  1E6R A;  1GRJ A;  5GPR A;  3B9A A;  1FFQ A;  5DIV A;  1QPF A;  4MNJ A;  3OA5 A;  4DT4 A;  4HBO A;  1JCH B;  1J4R A;  1JVW A;  3AS2 A;  3O5D A;  3WIJ A;  1R9H A;  3WL0 A;  3WL1 A;  4ODQ A;  4TX0 A;  4IT6 A;  2DSZ A;  2RSE A;  4TW6 A;  1LQ0 A;  2LPV A;  2AWG A;  1NH6 A;  3KCE A;  1TCO C;  3RME A;  3WH0 A;  2KO7 A;  5GPG A;  3KAI A;  2OFN A;  3PRA A;  1ITX A;  2MLX A;  1W1V A;  2QF8 A;  1OWQ A;  1YAT A;  4WK9 A;  2YBU A;  3O5G A;  3B9D A;  3ARZ A;  4JFI A;  1W9P A;  1UR9 A;  1ZB5 A;  1NWT A;  2XPA A;  4QT2 A;  2XP4 A;  3ARP A;  3ART A;  2XP5 A;  4DRP A;  2LKN A;  2PV1 A;  1JND A;  2A3C A;  4G2P A;  3GTY X;  2UZ5 A;  1FKF A;  1ZL1 A;  3WD4 A;  1LL6 A;  1HKI A;  1FKB A;  2MLY A;  3AS1 A;  2VCD A;  3IK8 A;  3O5K A;  4WKA A;  1FJD A;  4TW7 A;  4ODP A;  3QOK A;  1X6L A;  1BKF A;  2AOS A;  3UI4 A;  2G8Z A;  4MNL A;  4QZV B;  5B8I C;  1EDQ A;  4S3J A;  3EIP A;  1J4I A;  3O5L A;  4MNM A;  1FD9 A;  2FDM A;  4L72 B;  2DG9 A;  4J4O A;  1OGG A;  1LL7 A;  3B9E A;  4L3N A;  1KFW A;  2ZQS A;  4DWS C;  5DO2 A;  4DWS A;  1SYT A;  3WD1 A;  3CHF A;  1SR0 A;  5HWC A;  1W1P A;  4KQZ A;  1A7X A;  4MNK A;  1Q1C A;  3ARW A;  3JYM A;  2MF9 A;  5HT1 A;  1U79 A;  4ITZ A;  3KAH A;  3O5E A;  1QPL A;  1EYM A;  1NSG A;  2KE0 A;  2RUR A;  4TYO A;  3LUO A;  1JNE A;  2KR7 A;  2F4E A;  2PPN A;  3RM9 A;  1F40 A;  1HJX A;  3CGN A;  2XPB A;  3ODK A;  4QIB A;  1ZK6 A;  4ODO A;  4DRH A;  2XP8 A;  3ARO A;  1C9H A;  4DH0 A;  1FKD A;  4ODM A;  4FAP A;  4Z2K A;  1T11 A;  4URI A;  4Z2I A;  1PBK A;  3KAG A;  3PA7 A;  3KAC A;  3UI6 A;  4BF8 A;  4U84 A;  4MTV A;  3CGM A;  2Y78 A;  3OOB A;  4W9P A;  4Z2L A;  1HJW A;  4JYS A;  4ZPT R;  4PTM A;  2XP6 A;  5HW8 A;  2MPH A;  1FKG A;  3RFW A;  1ZBW A;  4N19 A;  1D7H A;  2F23 A;  2B31 A;  4JFJ A;  1ZCN A;  1ZBV A;  1J4H A;  2OLH A;  4Q7N A;  1HXV A;  4IQC A;  3KZ7 A;  1LJY A;  1RD6 A;  3FXY A;  1NWU A;  3RM8 A;  4R5E A;  2M1I A;  1W1T A;  5HBF A;  1HKK A;  4U85 A;  1FKI A;  3RGC A;  4Q22 A;  5JH8 A;  1GPF A;  1HJV A;  4DRN A;  3CZ8 A;  1W26 A;  4QT3 A;  4WKH A;  1E6Z A;  2O9O A;  1FKR A;  3CHE A;  1CTN A;  1FAP A;  4DWS B;  2RQS A;  2P4V A;  4NSB A;  3JXV A; 
#chains in the Genus database with same CATH homology
 1KT1 A;  1E6P A;  2YBT A;  4LAV A;  1ZU8 A;  5DIT A;  2ITK A;  1JNS A;  4DRM A;  4DZ2 A;  2VN1 A;  4MAV A;  1WNO A;  4ODN A;  2DT2 A;  4R0X A;  1GUV A;  3ARR A;  4O2T A;  3O5F A;  1HKJ A;  3ALF A;  3WD2 A;  4LAY A;  3VAW A;  3PR9 A;  1OGB A;  1P5Q A;  1IX5 A;  1NWR A;  3EY6 A;  3UQI A;  3ARS A;  3NRK A;  3AQU A;  4U86 A;  2XP3 A;  2PBC A;  4WIW A;  2DT3 A;  3BXW A;  3NTP A;  4TW8 A;  3ARQ A;  2A3E A;  3AS3 A;  1E9L A;  1ZBK A;  1M5Y A;  2L2S A;  5DEZ A;  1VF8 A;  4W9O A;  3FY1 A;  1UR8 A;  2M08 A;  3G6L A;  3WD0 A;  4MGV A;  3O5R A;  1D6O A;  2ESC A;  4GGQ A;  4J4N A;  4JFL A;  2K8I A;  1TFV A;  4TNS A;  4LAW A;  1ROT A;  2KI3 A;  4DIP A;  4ODL A;  3WKZ A;  1Q6U A;  2PV2 A;  4LAX A;  2FAP A;  3I6C A;  2O92 A;  2ZQV A;  4DRI A;  4ODK A;  3CH9 A;  3KAD A;  4ODR A;  1PIN A;  2WLY A;  1K9T A;  2WK2 A;  1ZBC A;  1EHN A;  1D7I A;  2KGJ A;  2MLZ A;  3GPK A;  3UF8 A;  4DRJ A;  3O5Q A;  4DRK A;  2DG3 A;  4DWS D;  2IF4 A;  2ZR6 A;  1W1Y A;  4C02 B;  2N87 A;  4FN2 A;  2LJ4 A;  4ZS6 A;  1QZ2 A;  3TC5 A;  4Z2H A;  2RUC A;  1L1P A;  4HBE A;  2DSW A;  2DT0 A;  2IUZ A;  5I98 A;  3FAP A;  2FKE A;  1Q6I A;  2LGO A;  2DSV A;  4IT4 A;  5DF0 A;  4NZC A;  1BL4 A;  4P8U A;  3CHD A;  1GOI A;  4MPK A;  2PPP A;  1X6N A;  2DT1 A;  1F8A B;  2MNT A;  4LGX A;  1FKT A;  2PI6 A;  2DSU A;  3UQB A;  2ZR4 A;  1NMW A;  5HTG A;  2D9F A;  4P8V A;  3UI5 A;  1FFR A;  1D2K A;  2PPO A;  4Z2G A;  4P8X A;  5GQB A;  2A3A A;  5BXJ A;  4G50 A;  5HWB A;  5D75 A;  4WJX A;  4XAK A;  1J6Y A;  1N1A A;  3IKG A;  1XRV A;  2Q5A A;  3G6M A;  1KT0 A;  1W9U A;  4W5U A;  3JYJ A;  3NI6 A;  2XP7 A;  2F2D A;  2F21 A;  4ZPW R;  1Q6H A;  1LG1 A;  3WD3 A;  1D7J A;  4NNR A;  1FKS A;  1LL4 A;  1E6N A;  5HUA A;  3IKD A;  3MDY B;  5DIU A;  3TCZ A;  1ROU A;  3ARY A;  1W9V A;  1FKH A;  3KAB A;  3B7X A;  1LG2 A;  3TDB A;  2ZR5 A;  1FKL A;  2ZQT A;  4MSP A;  5HW7 A;  2PV3 A;  3WQV A;  3W4R A;  2JZV A;  3O5O A;  3H9R B;  4IQ2 A;  5HW6 A;  1H0I A;  3O5P A;  1NMV A;  3ARV A;  4JFM A;  2DG4 A;  3O5M A;  1B6C A;  1WB0 A;  4AY1 A;  2KFW A;  2WM0 A;  2WLZ A;  3O5J A;  2XP9 A;  1FKJ A;  3ARU A;  2A3B A;  2ZQU A;  4DRQ A;  5J6E A;  3RM4 A;  1NWS A;  3IHZ A;  4GIV A;  2M2A A;  4ML4 A;  4JFK A;  1Y0O A;  4ZPV R;  1EIB A;  4P8W A;  5HKG A;  4IPX A;  4KR0 B;  3WQW A;  4DZ3 A;  1E15 A;  2G41 A;  2RUD A;  1HKM A;  4Z2J A;  1WAW A;  3PRD A;  3ALG A;  4S3K A;  4WKF A;  4DRO A;  3UQA A;  1EQ3 A;  3CHC A;  1FKK A;  4W9Q A;  3KAF A;  1O6I A;  2RUQ A;  1H0G A;  1JNT A;  2DPE A;  3O5I A;  3AS0 A;  1XHG A;  3PRB A;  1YW5 A;  3ARX A;  4HAR A;  3B8S A;  1E6R A;  5GPR A;  3B9A A;  1FFQ A;  5DIV A;  1QPF A;  4MNJ A;  3OA5 A;  4DT4 A;  4HBO A;  1J4R A;  1JVW A;  3AS2 A;  3O5D A;  3WIJ A;  1R9H A;  3WL0 A;  3WL1 A;  4ODQ A;  4TX0 A;  4IT6 A;  2DSZ A;  2RSE A;  4TW6 A;  1LQ0 A;  2LPV A;  2AWG A;  1NH6 A;  3KCE A;  1TCO C;  3RME A;  3WH0 A;  2KO7 A;  5GPG A;  3KAI A;  2OFN A;  3PRA A;  1ITX A;  2MLX A;  1W1V A;  2QF8 A;  1OWQ A;  1YAT A;  4WK9 A;  2YBU A;  3O5G A;  3B9D A;  3ARZ A;  4JFI A;  1W9P A;  1UR9 A;  1ZB5 A;  1NWT A;  2XPA A;  4QT2 A;  2XP4 A;  3ARP A;  3ART A;  2XP5 A;  4DRP A;  2LKN A;  2PV1 A;  1JND A;  2A3C A;  4G2P A;  2UZ5 A;  1FKF A;  1ZL1 A;  3WD4 A;  1LL6 A;  1HKI A;  1FKB A;  2MLY A;  3AS1 A;  2VCD A;  3IK8 A;  3O5K A;  4WKA A;  1FJD A;  4TW7 A;  4ODP A;  3QOK A;  1X6L A;  1BKF A;  2AOS A;  3UI4 A;  2G8Z A;  4MNL A;  4QZV B;  5B8I C;  1EDQ A;  4S3J A;  1J4I A;  3O5L A;  4MNM A;  1FD9 A;  2FDM A;  4L72 B;  2DG9 A;  4J4O A;  1OGG A;  1LL7 A;  3B9E A;  4L3N A;  1KFW A;  2ZQS A;  4DWS C;  5DO2 A;  4DWS A;  1SYT A;  3WD1 A;  3CHF A;  1SR0 A;  5HWC A;  1W1P A;  4KQZ A;  1A7X A;  4MNK A;  1Q1C A;  3ARW A;  3JYM A;  2MF9 A;  5HT1 A;  1U79 A;  4ITZ A;  3KAH A;  3O5E A;  1QPL A;  1EYM A;  1NSG A;  2KE0 A;  2RUR A;  4TYO A;  3LUO A;  1JNE A;  2KR7 A;  2F4E A;  2PPN A;  3RM9 A;  1F40 A;  1HJX A;  3CGN A;  2XPB A;  3ODK A;  4QIB A;  1ZK6 A;  4ODO A;  4DRH A;  2XP8 A;  3ARO A;  1C9H A;  4DH0 A;  1FKD A;  4ODM A;  4FAP A;  4Z2K A;  1T11 A;  4URI A;  4Z2I A;  1PBK A;  3KAG A;  3PA7 A;  3KAC A;  3UI6 A;  4BF8 A;  4U84 A;  4MTV A;  3CGM A;  2Y78 A;  3OOB A;  4W9P A;  4Z2L A;  1HJW A;  4JYS A;  4ZPT R;  4PTM A;  2XP6 A;  5HW8 A;  2MPH A;  1FKG A;  3RFW A;  1ZBW A;  4N19 A;  1D7H A;  2B31 A;  4JFJ A;  1ZCN A;  1ZBV A;  1J4H A;  2OLH A;  4Q7N A;  1HXV A;  4IQC A;  3KZ7 A;  1LJY A;  1RD6 A;  3FXY A;  1NWU A;  3RM8 A;  4R5E A;  2M1I A;  1W1T A;  5HBF A;  1HKK A;  4U85 A;  1FKI A;  3RGC A;  4Q22 A;  5JH8 A;  1GPF A;  1HJV A;  4DRN A;  3CZ8 A;  1W26 A;  4QT3 A;  4WKH A;  1E6Z A;  2O9O A;  1FKR A;  3CHE A;  1CTN A;  1FAP A;  4DWS B;  2RQS A;  4NSB A;  3JXV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...