4WJXA

Crystal structure of human chitotriosidase-1 catalytic domain at 1.0 a resolution
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
369
structure length
369
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELSLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitotriosidase-1
publication title New insights into the enzymatic mechanism of human chitotriosidase (CHIT1) catalytic domain by atomic resolution X-ray diffraction and hybrid QM/MM
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 137
structure length 369
sequence length 369
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4wjxA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4wjxA01
4ATLA 1OCQA 1V3MA 2EEXA 1NWTA 4HOZA 1US2A 2AAAA 1JZ6A 4M8UA 4ACYA 3MV11 4Q22A 3SCUA 4TXEA 2BS9A 2WMIA 4J3WA 4ZEPA 1VBRA 3ZR5A 5I2UA 2DSZA 1MWOA 1CXFA 3NYDA 3M46A 1RH9A 1V0MA 1HJVA 2FGLA 3OA5A 3FAXA 1ZBWA 2OWXA 3PZOA 1W3HA 3N9KA 3E1F1 1UKOA 3MSDA 5CSYA 1G9HA 1G01A 1UWIA 4UFLA 3L4WA 3UG5A 4B3LA 4W86A 3VIHA 3ARVA 1H09A 3BAKA 2J62A 3PZ9A 3WY1A 1JF6A 2E9BA 1KXHA 5FOOA 1XH0A 4AIOA 1JYNA 5A6KA 7TAAA 1XYFA 4J3XA 3BGAA 2A3EA 3NSNA 4NF7A 2EO7A 3L4XA 5IFPA 3MSGA 4J3TA 2WVVB 1CECA 3UR7A 5CPSA 3IK2A 2AMGA 3VNZA 3IAPA 1OT1A 3K46A 4HA3A 2WMFA 3CUGA 2OWWA 4ZE4A 3AXXA 2WKGA 2BVDA 4JL2A 3LPOA 4AEEA 5M5DA 2VI0A 1GW1A 2E9LA 5GNYA 4FMVA 2DDXA 5A8OA 4U5IA 4DWSA 3WBEA 1HP5A 4RL3A 4D6JA 2A3BA 1VEOA 5BXTA 3PTMA 4R27A 3O2LA 5JBEA 4H2CA 4EK7A 1W32A 3PZNA 1L8NA 2G8ZA 2XVKA 4AEFA 1C3FA 3GZAA 2VO5A 1BYAA 2WMHA 1M04A 2FH6A 1Y7VA 3RJYA 2X0HA 3WL0A 1EDQA 2XVPA 2PWEA 3AMCA 1BGAA 4AWEA 1VBUA 2TAAA 4W85A 5A6MA 1PBGA 2NT0A 2VURA 2YDQA 4F79A 1VJZA 3AHXA 1OGGA 1OBAA 1UOKA 1V3JA 5IDIA 1OSEA 1GONA 2WC4A 3QGVA 1GCYA 5D9PA 5FD0A 2WLZA 1B90A 4TTUA 5D9NA 4PRWA 3ARWA 1Q4NX 5FL0A 2CITA 2V5DA 4GI8A 4HMEA 1BGGA 4U3AA 3OGVA 3B9EA 3NIYA 1V6VA 1HF6A 1NP2A 3DHUA 5A2AA 3PHAA 1X1NA 1E71M 4C7GA 1G0CA 4TTGA 3WEOA 4XV0A 4PTMA 2GJPA 2BXYA 1DWGM 1UR8A 1NOWA 2VMFA 3U7BA 1UZ4A 2VX7A 3UERA 3VIJA 1BAGA 5CJ5A 4C7FA 3GM8A 1UWSA 1FH8A 4D1JA 2UY5A 1UQZA 3DHPA 1HNYA 1D7FA 1BHGA 4XUYA 3OGRA 2XHYA 2Q8XA 3OZPA 4PYSA 5M17A 4AIUA 1JAEA 2V38A 1J0YA 2XGBA 3KWXA 3RM8A 5JBFA 5ABGA 3WH6A 1UQYA 4BF7A 4WK9A 3OB8A 1CGUA 2CNCA 2XM1A 4P7QA 3MUIA 2VJXA 1QI5A 5GNXA 1AVAA 3CHFA 1UH4A 2VRKA 4TUFA 4Z2LA 2UY2A 3HMCA 1FH7A 3F5LA 2W63A 3WIJA 1JNEA 2JF7A 3WEZA 2J8GA 5D9MA 2YBUA 1OGSA 1OINA 1UUQA 4P7OA 2D24A 4CU7A 3AZRA 3HJEA 2E40A 2NT1A 2PWDA 1NH6A 5HBFA 4AZ5A 4PMDA 4TX8A 4JKKA 3SCQA 1EHNA 3VIFA 1JI1A 1CDGA 1KFWA 2QLYA 1Z32X 3ARTA 3BC9A 1C7SA 1E1EA 3LPPA 1BYCA 4H8UA 3WQ5A 3TTYA 3RMEA 2YOCA 2XIBA 4PTXA 3VIGA 4HPGA 4BS0A 8A3HA 2D2OA 1VFMA 1H11A 4U2YA 1ODZA 2WZEA 1V08A 3WF2A 3VINA 1LWHA 1HJXA 1TCMA 3GYCA 4WKAA 4P8UA 4HU8A 2D23A 1JZ4A 1E70M 1J01A 1KXVA 4E2OA 1EXPA 1CXIA 1SFSA 5DFAA 4MB5A 2QPSA 4U5KA 1LQ0A 1UWTA 3WELA 1UR0A 1MW3A 2J4GA 1CTNA 1MXDA 5A95A 5BROA 3W25A 3MV01 4BA0A 3QR3A 4J27A 5JUVA 1E6PA 3AYRA 4PUEA 2W66A 2VZTA 3GXIA 4GO9A 4CN6A 2GJRA 3W6LA 1PJ9A 3WUFA 1YHTA 3SUWA 1PZ3A 4PCSA 1J0JA 4UFMA 4ZE5A 1GOIA 4A3HA 1KWKA 3PZGA 2WHMA 2ZXQA 5JIWA 3WUEA 4W84A 1GVIA 1GORA 2OYLA 2ZX9A 4PMUA 2E0PA 4HOWA 3ALFA 4PMVA 1PZ2A 1WNOA 3MS8A 2Y24A 2J75A 1CGWA 3S2CA 5A2CA 2WMKA 3AIEA 3WF3A 2J7CA 2F2HA 2WSKA 3IJ7A 2BHYA 3N13A 1EOMA 3N04A 1H3GA 4FLQA 4MB3A 2X09A 1NOUA 2ZXDA 3MU7A 1HJWA 2YLLA 2B31A 2BVTA 3LPFA 2WK2A 3ALGA 2ZUMA 1EQCA 4HP5A 2DH2A 4MJ4A 3SCNA 2C8NA 3PZMA 4ZXOA 1NARA 1DWAM 4D1IA 1WDSA 5DMYA 5DT7A 1UWRA 1I1XA 1X6NA 1CEOA 3B9AA 1IT0A 3WQWA 2DSKA 4HTYA 1J11A 4KRUA 1JXKA 2GVYA 3VU2A 3A3HA 2BXZA 2WCGA 1RP8A 3QHNA 3U5UA 2G3JA 2WC3A 5A8PA 1QI0A 1JYXA 3B8SA 3FN9A 1JDCA 4YPJA 4CCEA 1VENA 4PUDA 4QLKA 4JKMA 3CTTA 2JEPA 3KL5A 3WDRA 5HOSA 2XIIA 2EPNA 3POHA 1RPKA 4FK9A 1QW9A 1UR9A 1LL4A 4UR9A 1BF2A 1VFOA 1BVNP 2Y8KA 3GXMA 2YL8A 1GQKA 1VF8A 1C7TA 2OLHA 1E6XM 4UQAA 2DSWA 2IUZA 1JDDA 2YL6A 3EMZA 3WF0A 1WDQA 3BSHA 3CHCA 1CNVA 2V3DA 2J7FA 4OUEA 1JI2A 1AQHA 1PX8A 4OOZA 1UD4A 3VGHA 4GKLA 4GQQA 3KE0A 4JCMA 1E4MM 1QBAA 3AISA 2DQXA 2D0HA 4AYSA 3CZJA 2RGLA 1WZAA 3SEPA 3QOMA 2VTFA 1R85A 2QF8A 2D0GA 2OYMA 1HXJA 2X1IA 3BAXA 4PMNA 4U2ZA 3VDHA 2XVGA 1ESWA 3EDEA 3W53A 1J10A 1QI2A 1KQYA 2VZUA 3EMQA 2DSUA 3GDBA 4URIA 5GQBA 1E43A 5CSUA 2F61A 1GVYA 1LWJA 5A6JA 1XRVA 1J0ZA 4KGJA 5A6BD 4M24A 4P8VA 1LF1A 2BY3A 1QW8A 2WMIB 1TZ7A 3GBEA 5EFDA 1UWUA 3RM4A 1L0PA 1VJSA 4H41A 2VX5A 2XYLA 4D6FA 2EPMX 4KH2A 1BYBA 1WP6A 6TAAA 3AS1A 1C8YA 2WC7A 6CGTA 4CD4A 1M7XA 3WH8A 1CENA 1XYZA 2VCBA 2W67A 2CBVA 2C0HA 3AIWA 5CGTA 1E0VA 2PB1A 2XTKA 4P7RA 4MNMA 5BXSA 1VFUA 4QLJA 4W93A 4MNJA 1UH2A 1HL8A 2JE8A 4CGTA 4TVUA 1OGBA 3ZJ6A 1BFNA 5EFFA 2F8QA 3LPGA 1E5JA 1KR1A 3CHDA 4MPKA 3MMUA 4MTVA 3SUSA 1ZU8A 4PMOA 4CU8A 4Z2HA 1HKKA 1C92A 2DT2A 2Y8VA 3ARRA 4WJXA 1K6AA 1U30A 4XX6A 1B3VA 3A4AA 3GH5A 4AZCB 1EGZA 1CWYA 4J28A 2VVSA 1J18A 1R87A 1JZ5A 1TR1A 1MW0A 1ITXA 2PC8A 4AD0A 2O9PA 4W89A 3THDA 2PWHA 3FHAA 4DWSD 1TVNA 5A94A 2ZUVA 5IHSA 3WNOA 3GNOA 2WVUA 2BVYA 4M29A 4F9DA 5A6BA 2WANA 3K4AA 1RP9A 4MDPA 2RGMA 1B3XA 4J3VA 4DWSB 4MNLA 1SMAA 5C70A 3AMGA 3WH7A 2ZUSA 4CCCA 3ZJ8A 1ZBKA 3W81A 1UA7A 3VKKA 3AZSA 4XB3A 3IAQA 3PBGA 1E0WA 3MMDA 5C71A 3ARZA 2WMJA 1K9EA 1F4AA 1J0HA 4DUXA 1O6IA 1GHSA 1Q6DA 3EMCA 2DH3A 3ZT6A 1HKJA 5CZKA 2O9TA 4JHZA 4AZCA 3ARPA 1H2JA 1B31A 1N82A 3BMWA 1PIGA 3WH9A 3WD0A 2YLAA 1E4NA 3WUGA 1FOBA 2MANA 3OIHA 4CCDA 3WMSA 2WYSA 2DT0A 5E09A 4HA1A 4FF5A 3WN6A 2PF0A 3F5KA 1XH1A 2G3MA 3D5HA 5F7UA 4D6GA 3T0BA 2V5CA 2WM0A 4CVUA 4UTFA 3ZR6A 2VZVA 3AXIA 3G6LA 1DWHM 3WQVA 4AXNA 5KZ6A 2W61A 2YL5A 3HN3A 4OBRA 5DF0A 3WDJA 3BLKA 3AMKA 2VL4A 3AIRA 4W8LA 2XGIA 4GIAA 2WCSA 3NSMA 5CPQA 4U33A 4WF7A 5FCZA 1HKIA 1IZJA 3GBDA 1FHLA 3CZGA 4RE4A 3W38A 3L4ZA 4OBSA 3AQUA 5AC5A 1KBBA 4D71A 3AXHA 3TTOA 1W3LA 4D6EA 1CGXA 4PMXA 1JFXA 2NSXA 4JHOA 5I0DA 1JYVA 3RJXA 4CD7A 2BHZA 2CBIA 5A2BA 4LYRA 2WNWA 1JD7A 1E1FA 1WKYA 5FL1A 3OZOA 3AROA 3VNYA 1DWFM 1J9YA 4H7VA 1B2YA 1E15A 3VDCA 2JIEA 3VOCA 3CUFA 3DYPA 3W29A 3WNLA 1HJQA 1MW1A 3D3AA 3VDAA 3EDDA 3WD3A 3K8KA 1GZJA 2Z1KA 4A4AA 1JF5A 2EPKX 1V6UA 3WDQA 2GJXB 3JUGA 4UFKA 1P6WA 5A6AA 1Q6FA 3AS3A 2JIWA 3VD9A 3ARSA 1ZJBA 4GPNA 2YA1A 2ZUWA 1UKPA 4J3UA 3AZTA 5BCAA 4KRTA 3AS0A 3AJ7A 1JXJA 3WD2A 3BAJA 1ZS2A 5A69A 5D4YA 4YHEA 3CLWA 3T2OA 1OIMA 4OKDA 1LJYA 4UOJA 2VX4A 1JNDA 1GOMA 4JKLA 3WQ6A 3AFBA 3EYPA 3VIIA 3MUAA 4B16A 1B3YA 3AOFA 3ZT7A 1UG6A 2OSWA 2FGZA 4NRSA 5IXEA 2G3IA 2ZUTA 3U7VA 3VD4A 3POCA 4UFIA 4BZYA 1JIBA 2UY4A 4CVWA 4IUGA 2W91A 3OLDA 3W6MA 1HN1A 2O9OA 2GUYA 5D8WA 1EDTA 3BH4A 3I3EA 4F8XA 1CXLA 1KBKA 3RM9A 2GFTA 2DEPA 1TUXA 3U57A 8CGTA 2D1ZA 4UQBA 4LGXA 4RE2A 2ZXAA 2W62A 2GJXA 1XSIA 3K8LA 1W2VA 4X0VA 5JIPA 4GZJA 1C93A 2IXUA 4UQCA 3WBAA 2GDUA 4LYPA 4DWSC 2XVLA 3AHZA 3UESA 1E4LA 3GXFA 1MQRA 4AZ6A 5IFTA 1JFHA 2VUYA 1CGYA 3W37A 2BFGA 3M7SA 1HP4A 4B9ZA 3BLPX 1AQ0A 3WDHA 3TTSA 1ODUA 3N11A 4RE3A 2VX6A 3OLIA 1UA3A 4PTWA 4CN1A 1ITCA 3O9NA 3I3DA 3WEMA 3CBWA 5ECUA 5CG0A 1MW2A 1FFQA 5HNNA 4XZWA 1CLXA 5JH8A 1UZ1A 3RIKA 4J7RA 1JZ2A 2YJQA 3TOPA 3TONA 2XSAA 5A3HA 3EDKA 4QAWA 1CXEA 4PSPA 3SCTA 1TVPA 2CHOA 1NP0A 1DEDA 1KB3A 2BV9A 4PN2A 4E4PA 1CYGA 1ZBVA 3MO4A 4Q7NA 2XG9A 1C8XA 3VGGA 4BCEA 1KGXA 5KEZA 1TA3A 4OOUA 1WB0A 1OD8A 3WL1A 1QNPA 3A47A 1UWQA 1QI3A 1R7AA 2OWCA 4MDOA 2D22A 1WPCA 3PTKA 1QVBA 4AY1A 3ZJ7A 2XWDA 1ISYA 3CUJA 3GH4A 5E6ZA 1UD5A 3GXDA 4NI3A 4LPCA 4D6IA 3M07A 3B9DA 1PPIA 1V6XA 2BHUA 2G4FA 3UR8A 1QHPA 3OLEA 1V03A 4CU6A 2WZHA 2DT3A 2ZX5A 4UZUA 2YDSA 2QHAA 4HZ6A 1SR0A 2VVNA 1Q6EA 1JAKA 3T2QA 5A6LA 1OWQA 2YA2A 2PBGA 1TMQA 5M03A 5A8NA 2VQUA 1FP8A 3QHOA 1KR0A 1EDGA 4KGLA 3NSXA 1UR1A 4MAZA 4W5UA 5BXRA 2ZUUA 3EDFA 4QP0A 1W9UA 1V02E 4MAVA 4BQ4A 4AZBA 3BCFA 1BPLB 4LYQA 1V6WA 3NDYA 1V02A 3VIPA 3ZT5A 1HVQA 1TE1A 5HDRA 4JZ5A 2BY2A 2WLYA 1GOWA 2WHLA 4TVCA 2WXDM 4Z2JA 4PBGA 2W5FA 3VMOA 4N42A 4W5ZA 1BTCA 4HOXA 3W27A 4WSKA 2DPEA 1K9FA 3MANA 5I5RA 1ISXA 4AD4A 4UNIA 5A1AA 4CN4A 4HMCA 3T08A 1H1NA 1QNOA 1C90A 1GHRA 2VNCA 4DUWA 2FDMA 4ZENA 1AMYA 4W8AA 1K9TA 5EBAA 1OB0A 1GJWA 5HXMA 1XV8A 3SCRA 1QHZA 1OIFA 3DECA 5CPTA 3VUPA 2YKKA 1XH2A 2XFRA 2GK1B 3UETA 3PN8A 1H0GA 3WENA 3N12A 1LLOA 1E6QM 5DO8A 1CLVA 1PX3A 5A8MA 1XSKA 2E9MA 2E8ZA 2ZE0A 4MNKA 1MQQA 5I3DA 3SCPA 3ZMRA 1H49A 3AMLA 1VRXA 2JF6A 3CZEA 1GQJA 5I23A 1E3XA 4W8BA 4AZHA 1SMDA 4K68A 1HIZA 1UR4A 1EOKA 3NJ3A 2DT1A 1VEPA 4AISA 3F4VA 4MJ2A 1GUVA 5AY7A 1W1VA 1DTUA 4GINA 1MVYA 2X8RA 2DIEA 2PWGA 2VRJA 2A3AA 3ARUA 4R5EA 1AQMA 4WKFA 3J7HA 3VGEA 4GI9A 1E6SM 2ZOXA 5M3WA 1NWSA 5HPOA 2HISA 1KGWA 2VZSA 3WF4A 3CGTA 5I79A 3AHTA 1CIUA 1BG4A 3CO4A 3ZM8A 4EAMA 2WVSA 3ARXA 1US3A 4B3KA 9CGTA 1DHKA 3NDZA 3MUZ1 2GK1A 5E9AA 4JIEA 3KEHA 1E0XA 4U3CA 3L4UA 2X05A 2ZICA 1NWUA 3ZOAA 4W7VA 1MXGA 3L2LA 4ML4A 1M53A 1NOFA 3VIKA 1R86A 2VT0A 2XJ7A 5E0CA 1JGIA 1XSJA 4M82A 4M1RA 4JL1A 4W7WA 3WFZA 4CKQA 1JZ7A 3CZLA 1GPFA 4Z2GA 1E4IA 4FLSA 3F5JA 3BCDA 4HPHA 3VX1A 3OGSA 3TA9A 4J3SA 5E6YA 2W4XA 1E6ZA 4JFWA 2EBNA 3AYSA 1B9ZA 5IHRA 6A3HA 2ZX8A 1ECEA 1S46A 4PMRA 3K4DA 4CD8A 2VOTA 1MFUA 4PTVA 3PZIA 5I24A 5ABFA 1WZKA 3DYMA 1FP9A 4CD5A 2YL9A 4JFVA 5EB8A 1WAWA 3VD3A 1TG7A 1V0NA 7A3HA 1FA2A 2BY1A 1EO7A 4PMYA 5GPRA 3S6TA 1E55A 4QCEA 3OG2A 3VO0A 1LL7A 5A8QA 2WBGA 4AMCA 1JZ3A 5BRPA 4GI6A 4UZSA 1W9DM 5CXPA 1OT2A 4P7LA 3CUHA 1WE5A 3VIMA 3G6MA 3RPMA 2XWEA 2CBJA 1Q6CA 4L4OA 1QNRA 4C7DA 1UD2A 1PAMA 3PTQA 1W9BM 1JZ8A 3WF1A 1XD1A 3QHMA 2A3CA 1W9PA 4M56A 4P8WA 2O9RA 1VFFA 4W88A 4NSBA 2NW0A 1IZKA 1B3WA 1BG9A 1F4HA 1V3LA 2XVNA 5E70A 5CGMA 3WNKA 3SCWA 1ISZA 1PX4A 3WNPA 5I77A 3WQ8A 5AYIA 1M03A 1VB9A 5I6SA 2D20A 2QV4A 2WMGA 1LG2A 2EQDA 1GQLA 1V3IA 1HJUA 2JEQA 2PWFA 3A4XA 4QCFA 1XCXA 4D6DA 4CUCA 1E73M 2WWDA 5DT5A 3VIOA 4ACZA 3AS2A 1NQ6A 1QBBA 1QOXA 3N18A 4ZXLA 4AD3A 3W4RA 4TOQA 4UCFA 3GNRA 3ECQA 3QOKA 4AD5A 1H0IA 3WD4A 5CLWA 3FY1A 4WKHA 3FW6A 4AC1X 4V27A 2CHNA 3T0DA 3ZSTA 3VTRA 1EQPA 1MQPA 3VGDA 3HU7A 3OLGA 5I78A 1G1YA 1WDRA 4KWUA 3GTNA 1W2PA 1ZB5A 2YIHA 3O6AA 3WNNA 5EMYA 4ATDA 3VM5A 3AIQA 3CHEA 2J25A 2DSVA 1GQIA 4GQRA 5LYRA 1W3JA 2X0YA 5AYBA 3L4YA 3VD7A 4MB1A 2D0FA 4ATWA 1WCGA 1J0IA 2J7BA 3AHYA 4X9YA 2VQTA 1UD6A 3FAWA 3WMBA 4HA4A 4GXPA 1UD3A 3ZJKA 2WHKA 2J7GA 4E8CA 3L2MA 1H5VA 1V3KA 3CUIA 2G3NA 3FNDA 4QFUA 3VMNA 1VAHA 2VRQA 4EANA 3KL0A 4S3KA 2WVTA 3CZKA 2WVVA 4M81A 1U2YA 1GNXA 2WPGA 1TFVA 1B3ZA 1BLIA 3VPLA 4W7UA 3RDKA 3VVGA 1BQCA 1UH3A 3DYOA 3PZUA 1HX0A 2Y4SA 4M80A 4WLCA 1E40A 4TVDA 3W0KA 3TTQA 1W1YA 1OM0A 2QMJA 2D3NA 1A47A 4UOQA 4BQ3A 3BXWA 1UKQA 1BYDA 2ZWZA 3WDPP 4B15A 5BYWA 1C91A 4H04A 2CETA 4JFSA 4D6CA 4WIWA 5LA2A 1GOKA 1V0KA 1NWRA 4ZFMA 1GJUA 3ZQ9A 1NM9A 2CEQA 2V3GA 1BVZA 1D3CA 4MB4A 1J12A 1RD6A 4BQ2A 1UYQA 2ZWYA 1FHDA 2BY0A 4H8VA 1JDAA 1MFVA 3UEQA 1W1TA 4D72A 5TD4A 1V0LA 3L4VA 2ZUNA 1LL6A 3UG3A 1O7AA 1KGUA 1KQZA 1V6YA 2J8FA 2ZX6A 4AZ7A 1G94A 1R7OA 3N1AA 3APGA 4XZBA 4AD2A 3AI0A 1KXTA 2UY3A 1KWGA 4PMZA 2EJ1A 4X0NA 1TA3B 1WDPA 2E8YA 3T09A 3A6OA 2CERA 3WNMA 1XHGA 2QPUA 1UD8A 3KZSA 3WFLA 2WSPA 1I1WA 2XFYA 1KCKA 3I3BA 3OBAA 4AW7A 1BSIA 2VZOA 4H8HA 1V3HA 2OSXA 3CPUA 1EH9A 4NZCA 5GNZA 1QNSA 4P7NA 1JL8A 1HL9A 3DC0A 3AMDA 3W28A 1E72M 4DM1A 3IANA 3LMYA 4LX4A 1GOOA 4W87A 3W82A 2J7DA 4KMQA 2EXOA 2JALA 4GZEA 4U31A 3SCSA 1JYWA 4AZIA 5LA1A 1QPKA 2CIPA 5FIPA 1CBGA 2VCCA 1CPUA 2J47A 4JAWA 3WUBA 3FXYA 1YQ2A 4E8DA 3KL3A 2YDRA 3IJ9A 2CPUA 1X6LA 5AC4A 5ABHA 4P8XA 3T2PA 1CZ1A 2EPLX 3BAYA 3II1A 4OZOA 4HU0A 4PCTA 3SURA 1XD0A 4TX6A 5BWFA 3NUKA 4GZIA 2CBUA 1HVXA 3BAIA 2J79A 3CZ8A 4UQ9A 1QHOA 3WDIA 2UWFA 2D3LA 7CGTA 5CLTA 2J78A 1WO2A 4B9YA 2X2YA 1W9XA 1EO5A 1G5AA 1UKSA 2WAGA 1H41A 2FHBA 2J7HA 4L4PA 4YHGA 2FHCA 1UR2A 3VM7A 5E0FA 3SIMA 4AIEA 4UOZA 2WBKA 4DUVA 4EKJA 1GOQA 4AZGA 2AOSA 1B0IA 3AIBA 3PZTA 1FH9A 2DGAA 4IM4A 4V2XA 2Z1SA 4JFTA 4MADA 1ZL1A 1QI4A 3FHQA 2XSBA 2CCRA 4GO8A 1UKTA 2ZX7A 4IPNB 5ABEA 5A6SA 3W24A 1D2KA 5HPCA 1M01A 2VCAA 1B30A 4JFUA 3VILA 3WSUA 1LG1A 1U33A 4LXFA 3K8MA 2ESCA 2VR4A 4V28A 3CH9A 1DWIM 5DEZA 2CESA 3AIVA 4QDMA 1E5NA 1EHAA 2QMKA 4OIFA 2PBOA 3ZO9A 2Y5EA 1J0KA 1HJSA 3ZSSA 1QNQA 3CIVA 2CYGA 2V3FA 4FLRA 4FLOA 2VR5A 2WZIA 3SUVA 2XPKA 3AIUA 3BAWA 2E3ZA 4PEEA 4N0RA 2WW5A 4F9JA 3SUUA 4S3JA 1E56A 4PSRA 5D8ZA 3RO8A 3ZIZA 1WZMA 2HVMA 4JCLA 1CXHA 1XGZA 4HZ7A 3ARYA 5FKYA 3UCQA 1A3HA 1PIFA 1JG9A 3EBVA 1DWJM 2GSJA 2YA0A 1WZLA 1IV8A 3THCA 4UQEA 1CGVA 1XCWA 3AHVA 3VMPA 5C8BB 1I75A 2CKSA 2A3HA 2PI6A 1C8QA 4IPLA 2J77A 2CKRA 1EIBA 1E6RA 1W3KA 2W92A 2ZXBA 1W91A 3WD1A 1KXQA 3MUY1 3IJ8A 4UFHA 4AD1A 1HT6A 1E6NA 2EPOA 4F66A 4YN5A 3VX0A 1ZBCA 2XUCA 4Z2KA 4OJYA 3NCOA 4UQDA 1ISWA 4Y7EA 3RCNA 3W26A 4IISA 5D9OA 3PZVA 3RILA 3SCVA 3BMVA 3PZQA 4BQ5A 1FFRA 1E9LA 1CXKA 1EA9C 4HMDA 5CQ1A 5LA0A 2C7FA 1H4PA 2XFFA 3K1DA 2BNJA 4HZ8A 3VGBA 1K9DA 2GDVA 3M6DA 2O92A 3BSGA 2WKLA 1CGTA 1R8LA 3GNPA 4A3YA 5ABFB 2WHJA 1VIWA 4CD6A 4QLLA 2JFEX 3EDJA 1B1YA 1OD0A 3GH7A 2CXGA 2WCAA 5BXPA 1ISVA 3MMWA 1KCLA 3U5YA 1VEMA 3WQ4A 3VDBA 2V3EA 1JD9A 3WMCA 2YBTA 3T0AA 3WH5A 1W9VA 3N17A 4PMQA 3SUTA 2IXVA 3WKZA 4DM2A 2FH8A 3CMGA 2OSYA 4NRRA 4LQ1A 3L4TA 3A4WA 3ARQA 1E3ZA 4EE9A 5JBDA 2DIJA 2Y2WA 3N15A 1DP0A 1Q6GA 1SYTA 4D6HA 3VD5A 4Z2IA 2WB5A 3AICA 5BRQA 2J74A 3TP4A 2OYKA 4WSJA 2J7EA 2WWCA 2FHFA 3VGFA 2XM2A 1MYRA 1W1PA 3MKKA 3CMJA 1XC6A 1PEZA 3SCOA 2ZIDA 1ZJAA 1UHVA 2E4TA 3UG4A 1HKMA 2G41A 4UFJA 4ACZB 2VC9A
chains in the Genus database with same CATH superfamily
4ATLA 1V3MA 1RCQA 3DU0A 4HOZA 1US2A 1JZ6A 4ACYA 4QITA 4Q22A 2MLXA 3ITLA 4KERA 1EJWC 4LVAA 1MUMA 5CBJA 5AHLA 3ZR5A 1MWOA 4PC8A 1UIOA 1PWMA 1B3OA 1RH9A 4V15A 4OV9A 3FAXA 2J6XA 4IQCA 3E1F1 1BRLA 7XIMA 3STPA 1G01A 3KTXA 4TV6A 4UFLA 3UG5A 5I09A 4W86A 4BWLA 3GSMA 4UTMA 1YKWA 2DZUA 3WY1A 2FAPA 2O4QA 1KXHA 1GKQA 2ZZ3A 2P53A 5AHNA 4AIOA 1LUCA 9RUBA 5A6KA 1XYFA 4J3XA 2A3EA 4NF7A 5HUAA 1CI1A 4J3TA 2WVVB 3V0TA 2QVNA 1UJQA 4LAKA 3CC1A 3PK7A 4MSSA 5CC5A 3HPXA 1NAL1 3BARA 3GZ3A 4ZE4A 3USZA 3T0TA 4EPKA 3CV6A 5HULA 1OC7A 2MUCA 5M5DA 3T9PA 2E9LA 1AJZA 3H12A 3K13A 5LXXA 4QIBA 1JCLA 4RL3A 4YTUA 2ZA2A 1XLBA 1ROTA 3PTMA 5AYYA 3I65A 4H2CA 4IOTA 3R0UA 1W32A 3VI2A 2G8ZA 4A2RA 4AEFA 4ZQMA 3UY8A 4GC4A 2B0MA 3FX4A 2QCMA 1TELA 1BVWA 4LV4A 3H54A 2X0HA 4QBXA 3AC0A 2X1TA 4LVDA 3TXVA 4FB7A 4UMAA 2QJIA 1FKDA 3A3WA 4X9SA 5I98A 4F2BA 2PWEA 5HQLA 4AWEA 4A6GA 2TAAA 4W85A 4PMJA 3BLOA 1PBGA 4YVVA 4IP4A 3AHXA 4GIRA 3S2JA 1UOKA 1V3JA 4ICMA 3GU1A 4JTRA 4Q8WA 1OABA 1WKEA 2A2IA 4KIRA 4LB3A 4Z1BA 5TF0A 4RDVA 3QV6A 1QNVA 2E6AA 4ZTYA 1NQKA 1Q4NX 2V5DA 4MVAA 3OGVA 4N19A 1UIPA 2PURA 1SW7A 3C0JA 3PHAA 1X1NA 1E71M 1MSSA 4C7GA 1G0CA 1TPH1 3IWPA 3M0JA 1PDYA 1UR8A 2VMFA 1RLCL 4EPEC 3G0UA 3KZPA 3TMQA 4F0RA 2EKGA 1ZTVA 1UWSA 1AG1O 4M51A 3UI4A 2OB3A 1NVMA 3OW1A 1B6CA 1VIZA 1HNYA 3B0PA 2F23A 1D7FA 1BHGA 2WKJA 5M2FX 3SZ8A 3QVQA 1GVOA 4S39A 2NV1A 1G7VA 3IGHX 1N7KA 1QAPA 1J0YA 1HG3A 3KWXA 1DTNA 5JBFA 1UASA 5FEWA 1Q13A 3WH6A 1UQYA 4WK9A 3GTHA 3I7RA 2XM1A 1XFBA 3MUIA 2FZDA 1AVAA 2O56A 1UH4A 2HE5A 2VRKA 2Z7GA 2ZR5A 1V51A 1KT0A 3BLIA 3S6DA 1FH7A 3LDVA 3UJFA 2C16A 2FB2A 2F6XA 3CYJA 1XLEA 3CAVA 5C2XA 3KCOA 5FJJA 2JF7A 3P61A 4REQA 3I4EA 5D9MA 2YBUA 4NZ4A 4DELA 3MHGA 5JH1A 1X1OA 2D24A 2E67A 1G6CA 2E40A 4ZO6A 1FWDC 5DX7A 4JKKA 4L61A 3P2VA 1CDGA 3IRSA 1Z32X 3BC9A 4DF1A 3F4DA 3LD5A 1BYCA 4H8UA 5IRPA 3RMEA 1RD5A 3GVRA 4HPGA 1L6SA 4RKAA 4KR0B 1XLKA 3A3XA 2WZEA 1V79A 3FKRA 2XIOA 4QEHA 3TQKA 3K4WA 2RKXA 2IPJA 3FA4A 3F2DA 5CH9A 4KFPA 1JZ4A 2QUUA 1KXVA 1EXPA 5DFAA 1NF7A 4Q8TA 1LQ0A 3CV1A 1UWTA 1CTNA 3M4HA 2OPJA 1MXDA 4Q4SA 1S5MA 3FDGA 3RGCA 1YPXA 5BROA 3MV01 4JFIA 4BA0A 4BK9A 4J27A 3LCIA 3KHDA 1RHCA 3MO7A 3FGCA 3NA8A 3NQMA 3VOGA 1O66A 1QPFA 4IXXA 3T07A 3W6LA 3EA3A 4NJHA 2YCIX 3C2RA 1YHTA 4DJFC 4O28A 4ZE5A 1AZ2A 4I7UA 2WHMA 3L0KA 4DJED 3GIQA 3D47A 4Z42C 3O06A 1GORA 4RXGA 4WGHA 2JBMA 1JCTA 1XC4A 3MP5A 3N9SA 1R9HA 1PZ2A 1WNOA 3MS8A 2Y24A 3Q94A 5LIYX 1CGWA 1Z89A 2PTDA 1TR9A 4ODLA 4NASA 3WF3A 2EKCA 3A13A 4J4NA 2WSKA 5HTGA 3IJ7A 2BHYA 1HKVA 3N13A 4NL1A 4JYSA 3GUWA 2ZTJA 2V5BA 4MB3A 4YCOA 4UBPC 5RUBA 1QK0A 2UZ9A 3LPFA 1SO3A 2WK2A 1ZAHA 4ODMA 2XDFA 3ALGA 4H4IA 5C5YA 1H7XA 2QT3A 2C8NA 9XIMA 3TLQA 5CC3A 2NUXA 1LT7A 5LGZA 2Z2BA 1W26A 2V68A 2WJDA 1TV5A 1UWRA 4IFKB 4ICCX 3N2MA 1CEOA 2ZZ1A 2DSKA 4HTYA 1J6YA 2GVYA 4BI7A 3A3HA 3QHNA 1RP8A 4XKYA 2WSRA 4RCXA 1QI0A 3N14A 1JDCA 4YPJA 4PUDA 3P84A 5EYWA 4UB9A 4JKMA 3WDRA 2XIIA 2ZDSA 4UIOA 2EPNA 2G37A 4LYKA 3RRXA 1QPNA 5FJTA 3SM0A 4FK9A 1QW9A 1UR9A 4IH3A 4I7VA 1VFOA 1BVNP 4H6RA 1VFSA 3GXMA 2YL8A 4MOZA 1C7TA 2OLHA 2DQWA 2OCZA 4K8EA 1JDDA 2X1RA 3B0XA 3R79A 1IT7A 4NZFA 3MSRA 4J9JA 2V3DA 3CYVA 1SFTA 2J7FA 3VNIA 3P8JA 1QASA 2PDFA 4OOZA 4J5NA 3VOFA 1UD4A 3VGHA 3VFLA 3WQCA 1S3HA 1KFBA 3LHVA 4C91A 4O1FA 3PBYA 1ZNNA 3CZJA 5K3VA 5FESA 2VTFA 3OVGA 2QF8A 5LNRA 1Z3NA 3RR1A 2X1IA 4ZQOA 4PMNA 2O7QA 3EDEA 3BOFA 4YJ5A 4FEZA 2OEJA 1C9DA 3GNXA 2DSUA 3GDBA 4URIA 3DFYA 4XSMA 3CIXA 3IACA 2F61A 1GVYA 3VC5A 4PRTA 4GHRA 2FKPA 3PPHA 1QW8A 1XS2A 4C6FA 5HJXA 2X30A 4L9XA 3GBEA 5EFDA 3ITVA 3DFOA 2VX5A 3S1WA 4D6FA 1ZCOA 6TAAA 4DRMA 3KFTA 2Y61A 3W7PA 4E2DA 3WH8A 1CENA 4BY3A 2VCBA 4G7EA 3WK2A 3M0YA 2QDEA 4GE8A 2RSEA 2QXWA 3GG8A 2CLFA 2PB1A 1RQHA 4WDTA 5D38A 4MNMA 3RR4A 1AD1A 1EPXA 1IWPA 4TVUA 1OGBA 1SO5A 1H62A 5EFFA 3U4AA 3A5VA 1IEXA 4MPKA 3GC5A 1NSJA 1SR9A 3MMUA 4IGMA 4QS5A 2AGKA 2R24A 4EPBC 4HK7A 4PMOA 2VHLA 4CU8A 4S38A 1Q7ZA 4Z2HA 4L80A 5JVLA 3KADA 1W5QA 3H4WA 1K6AA 2A7PA 4RK8A 1EJXC 2GGHA 3A4AA 1CWYA 4QE1A 2VVSA 2NWRA 2NX1A 3DEQA 2UV8G 4A8IA 2RDXA 1MW0A 4IMEA 3C6CA 3ISIX 4F0LA 3THDA 5I3IA 2HJPA 4DIAA 2IW0A 4DH0A 4XZHA 5IBXC 3LOTA 1N1AA 2ZUVA 5TAOA 3IK4A 3GNOA 2WVUA 3CUXA 4ORIA 3QR1A 4DWDA 4OBTA 3KUMA 4MDPA 2F21A 3SQLA 2RGMA 4ML9A 2FZBA 2YW3A 3IK8A 3IEBA 5T26A 4GVHA 4RUBA 2ZUSA 5A6TC 4EF8A 1ZBKA 3NURA 3IUHA 4XB3A 3IJIA 3MI6A 1POKA 3IS4A 1E0WA 4S2CA 1SPQA 4ODOA 3M0XA 1F4AA 5AKQA 1X96A 4H83A 4NJJA 4DUXA 4MY8A 2ZRUA 2W27A 1Q6DA 1CB7B 5CZKA 4I9MA 2VGGA 5CC6A 2ZCGA 2PSNA 2GUUA 2YLAA 4C1NB 2HSAA 2WQPA 3WUGA 1DJIA 3EWUA 1A5NC 4TW8A 3GX9A 2WYSA 2EPHA 1PS9A 2G3MA 1FRBA 3D5HA 4H00A 2WM0A 4JPGA 4CVUA 1RJQA 1HKWA 2OOFA 3Q2DA 4MLJA 1UOZA 3F4NA 3AXIA 1DWHM 5ENLA 3WQVA 4H9YA 4PTNA 3N4FA 2MPHA 5GVJA 3EWWA 4FIRA 1KRAC 2I16A 5KMYA 2P3EA 4DO6A 4EAYA 2VL4A 1OQFA 2QYGA 1T8XA 3QF0A 5CPQA 2Q5AA 3DERA 3MSYA 4GY1A 3DI0A 5BW6A 4C6EA 1IZJA 3PSVA 4Y8EA 4E4UA 4IT1A 1H5YA 2DW6A 3CZGA 3GY1A 1KBBA 4D71A 1CGXA 2NSXA 2QAFA 2HXUA 1FWIC 1EGMA 2R91A 3PNUA 3ABSA 4XISA 5SWUA 3M41A 3RJXA 1YDOA 2YFOA 3EX6A 2BHZA 4XSLA 5A2BA 4NZ1A 3QV8A 1RA0A 3UZ5A 4WEVX 1JD7A 1WKYA 2GGIA 2KGJA 5FL1A 3OZOA 3W2MA 2WV8A 1UC5A 1DIEA 4HIBA 1LLZA 4L65A 1E15A 4HA0A 4WUIA 1R3WA 3IGSA 4LAXA 3BCJA 4ZOAA 3QZEA 2Y7EA 4WZHA 1N8IA 3G8RA 4DBSA 5FSEC 4LALA 1R3QA 3VDAA 4LBUA 1LOQA 2Z1KA 3TOYA 2XIMA 2GJXB 3JUGA 1BXBA 5A6AA 3BLFA 4WX2A 3WLNA 1ZJBA 4GPNA 2WPBA 4XZ9A 4O8AA 4FNRA 1EUAA 2ZUWA 5HMDA 1KCZA 4J3UA 3AZTA 1V7AA 1TIWA 2RUQA 3WD2A 5A69A 3L9CA 4NNBA 4Q8UA 2K8IA 1OIMA 4KWVA 4P2VA 3A22A 3WQ6A 1Z41A 5KZMA 3KZ7A 3MUAA 4B16A 3ZT7A 3DC8A 4Q4KA 4OUIA 1LRTA 2J8TA 1HO4A 3OZMA 5EMJA 4HHLA 3O5JA 1XIGA 4GI4A 3KOYA 3E12A 3VD4A 2MNRA 2UY4A 4ROQA 1SJCA 3H24A 2ANUA 2W91A 3OLDA 2QULA 5I02A 1MUWA 1HN1A 1UC4A 5T91A 2QCFA 2PDKA 3W2UA 2HBVA 4DX3A 1FXPA 4US6A 3NO5A 1KBKA 1DQXA 1XICA 3UWVA 2FTWA 5CCZA 3PB0A 2W62A 3BOXA 4FNUA 3VOJA 1C93A 2IXUA 4N9CA 3IGXA 2XVLA 5FJUA 4JYFA 3EA2A 3RX4A 2CWNA 3LXCA 2QCNA 2ISFA 4AZ6A 3TDBA 2VUYA 1NU5A 3COTA 4D2JA 3W37A 3AALA 4B9ZA 4C6NA 4Q8VA 1SFLA 3WDHA 2VGFA 3IPWA 3FYOA 1K4GA 3EWXA 3N11A 3UPBA 4C60A 4RZ5A 3MJYA 1ITCA 3WEMA 3NM3A 5ECUA 5CG0A 4NJGA 2QUMA 4QT3A 1FFQA 2Z6JA 1S1RA 1FKXA 2XN2A 3DX5A 1VP5A 3MP3A 2YJQA 3LNPA 4MGVA 4N9BA 2YB4A 3EDKA 1LBLA 4QAWA 3P82A 2ZTKA 4PSPA 2IQTA 2CHOA 4BJHA 3PA7A 1KB3A 4GKTA 4PN2A 1IIGA 4E4PA 2UZ5A 1ZBVA 3DI1A 2V2HA 1MEIA 3VGGA 4Z1DA 4BF8A 3CAWA 4F3HA 1WB0A 1OD8A 2A85A 2OWCA 3RLHA 1P48A 5B7ZA 4MUZA 2VM8A 5HWCA 1EJTC 1B54A 1TTQA 3G1FA 2FFIA 2GJLA 1ISYA 2VDGA 3W1UA 1ZAIA 4WY0F 5E6ZA 3PF3A 4XAYA 3LCFA 4LFYA 4WR3A 4C6PA 3M07A 1V6XA 3RU8X 1EP3A 3LBCA 3UZZA 4EPDC 3UR8A 3TKFA 4JBRA 3WK0A 3W7DA 3OLEA 4CU6A 1E9YB 1V4YA 4GUGA 3RRAA 4L6HA 3FYYA 3W87A 1Q8JA 2VVNA 3R25A 1OWQA 2YA2A 3WQPA 4NHVA 3UXIA 1MDRA 2PBGA 4XAZA 3LV6A 2A7RA 2VQUA 3QHOA 4PODA 3GDMA 4HCDA 3VAVA 1EDGA 3MDUA 4FS9A 4KGLA 5LIKX 4MIMA 4PCPA 2ZUUA 2FJKA 4DEFA 4BQ4A 5HWBA 5FJOA 5DIVA 4LYQA 1KA9F 1V6WA 3NDYA 1GVRA 1FAPA 3O7UA 4JTDA 3WJWA 3P80A 1K77A 3TWBA 4TVCA 1VCVA 4Z2JA 4QNEA 3VMOA 2RQSA 5J5RA 4H7ZA 1J4IA 4JTEA 3UQAA 2DPEA 3DHDA 3LM3A 5D37A 1ISXA 4UNIA 1H1NA 1Q5MA 4G1KA 2BX7A 4WDWA 2FDMA 1ME8A 1CX9A 2EHHA 1RALA 4N9DA 3OO2A 5HWMA 4AQLA 3WLHA 3LZ3A 4ALDA 2Q02A 1EWDA 5TIMA 3OVRA 1VFLA 2GK1B 1M5YA 3UETA 5I06A 1H0GA 2OR2A 3L0GA 3A23A 3IARA 3ZVHB 1E6QM 4L56A 1N8WA 1XSKA 2E8ZA 4GZ7A 4MNKA 2QQ6A 3G1YA 3EOOA 3BWWA 3ZMRA 3PUGA 2AAMA 1VRXA 3GR7A 3KAHA 4W8BA 1O1HA 3BLLA 1EOKA 3NJ3A 1VEPA 3UXAA 4QJ1A 1DIKA 1W54A 3A4JA 3I6RA 2A3AA 3ARUA 3J7HA 1DVJA 2XP8A 4L4MA 5HPOA 4XD6A 1KGWA 3WF4A 3HQ1A 4L6OA 4OQVA 3TYDA 3VE9A 4DXKA 2GQ9A 4EAMA 4L4LA 1FQ0A 4WGXA 5AFDA 9CGTA 4ZTXA 3W7LA 3IV3A 3GXPA 2XINA 3QKZA 2FZ8A 2PDYA 3KEHA 1Q2SA 4QE4A 2Y7FA 1NWUA 2BGQA 1MXGA 1F3XA 2A5HA 5CZ0A 2X40A 3OA3A 2AQWA 1BWLA 2QF7A 4W7WA 1JZ7A 2NV2A 1GPFA 3RFAA 1E4IA 5C9XA 3BCDA 2DG4A 3DFSA 4J3SA 2W4XA 1E6ZA 2RJGA 4JFWA 2EBNA 1AUSL 4GXWA 4A29A 3UJ2A 1ECEA 4IICA 1S5VA 3UFYA 4CD8A 1MFUA 4PTVA 3PZIA 3UWEA 3EXRA 4LVBA 3S9IA 2TRSA 4DIPA 5EB8A 1WAWA 3ZR4A 4Q8OA 2OZTA 7A3HA 3MQTA 3G1AA 3T42A 3T40A 4PMYA 3ITXA 4IFRA 1OZQA 3FS2A 3DOPA 3D6NA 1LL7A 2ZZ5A 4X60A 1N2VA 4YNGA 5BRPA 4GIYA 4UZSA 4N7QA 4MJMA 2D9FA 1OT2A 1VHNA 2XFWA 3CUHA 2CBJA 4NAEB 3CWHA 3SRHA 3ELFA 4C7DA 1GVQA 2QJHA 3PTQA 1JZ8A 3V36A 4IPXA 2IPGA 1I6NA 1XRTA 1XD1A 3U0HA 3LGGA 4M56A 2NUYA 3OBKA 1VFFA 4M6UA 3MJMA 1AZ1A 1BG9A 5MF5A 3WNKA 3SCWA 4AB4A 3R12A 3T81A 2E5BA 5AYIA 3R6IA 2D20A 1KM4A 2WMGA 5XIMA 1FWEC 1V3IA 2ZZ7A 3MZ2A 3ITCA 4QCFA 3WLRA 1E73M 2PS2A 2WWDA 1OFDA 3M16A 4L5ZA 1WUFA 3RK8A 3SY5A 1QOXA 3N18A 5CSSA 2R1MA 4UCFA 3GNRA 1JCMP 3TYAA 1H0IA 1LQAA 4H7CA 4EXBA 2P0IA 1S2WA 3O5OA 4LAVA 3T0DA 2Q6ZA 4NIRA 4DJFD 3ZSTA 3PNZA 2RFGA 3VTRA 4OWGA 3VGDA 3HU7A 3SSJA 2M2AA 1G1YA 3O5KA 3DHFA 2Q8LA 5D05A 3WNNA 5EMYA 4DRIA 5HW7A 2VD9A 1I45A 1XIEA 1XKJA 3CHEA 2J25A 2MF9A 1ZJIA 4DY1A 2DSVA 4MPQA 3RPTA 3L66A 5AYBA 3L4YA 2B7PA 2KZHA 4FI4A 1S2VA 1GKRA 3MTWA 4LV9A 4IX0A 3FAWA 1IX5A 3GXNA 1EZ2A 2J7GA 3L2MA 2IKGA 4JDBA 2G3NA 4YVPA 2PF8A 1OCBA 2FIQA 1A5MC 3KL0A 4S3KA 4R7WA 4AVNA 2WVVA 4ZS6A 1W5NA 3M0KA 1GNXA 2PDUA 3U2EA 3LHWA 1XUUA 3IIVA 4DRPA 1N55A 1REQB 3FKKA 4W9TA 4NI8A 3QGKC 3HF3A 4WLCA 1E40A 4KF1A 2HBXA 2CLHA 3VKAA 3W0KA 3TAOA 3UG8A 1J79A 2DORA 4DLMA 2DVXA 2D3NA 4UOQA 1BYDA 6ALDA 2XN0A 2ZWZA 3WDPP 4B15A 3ABRA 4WIWA 4CNPA 1V0KA 1GJUA 1K1DA 3MWAA 1QTWA 3IJLA 1BVZA 3W1LA 4MB4A 1LDCA 3GTIA 1J12A 4IGSA 1I2QA 1UYQA 1TTPA 2BY0A 4YCPA 5LHEA 1JDAA 1MFVA 1OX4B 4H2HA 1ENUA 1V0LA 1LL6A 1WOAA 3CLMA 3GHSA 2GYIA 2VEFA 4BHYA 2J8FA 4N6FA 2ZX6A 3FDKA 4AZ7A 1G94A 2ACSA 1X1ZA 4XZBA 3AI0A 1QPRA 1F61A 4GWEA 3NL6A 2NQ9A 1JCHB 1M7OA 1WDPA 2E8YA 3OPSA 2FVKA 1TMHA 3USBA 3WFLA 2VR2A 2CLMA 1W5OA 3I3BA 3DFTA 4AW7A 3W7HA 1BSIA 3CPUA 5AVNA 4NZCA 1OFRA 5H8MA 4P7NA 1JL8A 1AJ0A 4G9PA 3DC0A 3AMDA 4FZIA 4MYXA 2ODOA 4QIUA 4LX4A 4GX8A 1D8WA 4LY4A 2ISVA 4AIBA 3B40A 4U31A 4AZIA 1M3UA 5FIPA 1GT8A 1EBHA 1CBGA 2YR1A 3WUBA 4E8DA 3IJ9A 3W7EA 2CPUA 1NSGA 1NELA 3BAYA 2FKEA 3E3HA 4R3UA 3TJIA 4PCTA 4DO7A 3DH7A 3NQCA 2GSEA 3QYQA 3NUKA 1DJQA 3CZ8A 5IM51 4GD0A 4UQ9A 1QHOA 4Q8PA 4DUOA 3RU6A 1TCDA 1ZPTA 1DJYA 3IKGA 1YMYA 2PP0A 4B9YA 4ZQNA 5A8GA 1PB0A 2J7HA 1ADOA 4Y6GA 4OTKA 1ZRQA 3UCDA 3UD6A 3VM7A 3V3WA 1BXNA 4JD4A 2ZR4A 4LS0A 1BWVA 1IIHA 3SIMA 5AHIA 4UMBA 4DUVA 3M0HA 3AIBA 3KCLA 1FH9A 2DGAA 3R94A 2PLKA 1L1PA 1JCJA 1R3VA 4IPNB 2YCEA 1QO2A 3TQVA 4GH3A 4X2RA 3W24A 4TYOA 4W9QA 8RUCA 1UB3A 2V0TA 2GVGA 4HARA 2ESCA 2DFAA 1RLDA 4QDMA 3TJLA 1EHAA 4P5UA 4OIFA 1WXYA 2PBOA 3ZO9A 1V5XA 3ZSSA 3I7QA 4OGZA 2V3FA 3O5RA 1G4TA 3W7GA 3TNOA 4IIEA 2Q71A 4F9JA 3SUUA 4E3TA 5D8ZA 2VFEA 3M5ZA 3ME3A 4XUGA 4QJ3B 2PPNA 2HVMA 1G69A 2H6RA 1XIHA 3C86A 4CQDA 1PSCA 4HZ7A 5FKYA 3UI5A 1Q6IA 3UCQA 3EBVA 2GSJA 2YA0A 2GGJA 1EIXA 1UPMB 3VZXA 1IV8A 5HR6A 1J5TA 3W74A 3IVUA 5C8BB 2WO5A 2PRHA 3D3FA 2CKRA 3R7MA 3F2CA 1EIBA 3WH0A 3CT2A 4IJRA 3WD1A 3RXZA 3UWUA 3E0LA 3MVTA 2DJLA 5BU9A 3W6YA 1TREA 2LKNA 2B4GA 3WLMA 4DYEA 3GPKA 5C55A 1ISWA 4AAJA 1O1ZA 4IISA 5D9OA 3SCVA 3PZQA 4LRTA 1PO9A 2I9EA 1YPIA 4IFOA 1EWEA 3SO7A 1IF2A 1J5SA 5AB3A 1SZEA 3DDMA 4Q7BA 1AD4A 1OADA 4IFKA 5U7SA 5DMMA 2O92A 3BSGA 1PHWA 3RPDA 2WKLA 1CGTA 2QDHA 3U4FA 1XIFA 1JUEA 5ABFB 3RYSA 5H91A 1ITQA 3EDJA 3W2KA 4C5ZA 1TUFA 3U8GA 1TVLA 2Y8UA 2HROA 4B91A 4HCLA 3QW3A 4KT2A 3W07A 3WMCA 3UXLA 2YBTA 4I5UA 1W9VA 3N17A 4B5WA 3SUTA 3WKZA 3CB3A 4DNHA 2CZFA 4KWSA 5GPGA 3UW6A 1JCXA 3LSCA 2ITKA 4IX2A 7TIMA 1JRBA 1Z8AA 5DITA 1THFD 4O18A 1FWSA 4DZ2A 1E3ZA 5FJPA 5JBDA 3N15A 1EEXA 1XLLA 1SYTA 3VD5A 4Z2IA 5BRQA 2GQ3A 1LROA 1BRLB 2J74A 3TP4A 3EKGA 2OYKA 3ANYA 3E49A 1JPHA 3NRKA 1G4EA 3H55A 5KETA 2AL2B 3MKKA 4GIEA 1YXDA 1DQWA 3A21A 2ZIDA 3T7VA 1OG6A 4RV8A 3JZUA 3UG4A 4N4QA 2KR7A 3CO8A 5D2XA 4Y9NA 4GYPA 1TPB1 1W56A 4ACZB 2VC9A 2EEXA 2QUNA 2AAAA 5JU6A 3GVWA 2F2DA 4TXEA 2DY3A 2HS6A 4KIEA 1BKFA 3AWOA 4J3WA 4XIMA 4ZEPA 3VUSA 1VBRA 3CPGA 4JTUA 4FR6A 5AC8A 2BZNA 4I9AA 4XAPA 1XLMA 1CXFA 3ABXA 1UBSA 1PE1A 2FPVA 1KKOA 4EWND 4H3DA 3M46A 3DFPA 2FGLA 3N9KA 2VELA 2FDSA 1D6OA 1TWWA 1FWNA 2FFCA 5CPOA 1UWIA 3KLLA 3L4WA 2EAWA 1FCBA 3R8RA 3MHUA 3VIHA 3ARVA 4AHPA 1RUSA 1JCNA 3KVJA 3PZ9A 3UJRA 1JF6A 1WBHA 5FOOA 5DANA 4GIVA 3TN6A 3EX3A 3K5XA 3R43A 3WBWA 4C6MA 4Q4RA 5FAJA 3TLLA 4H9XA 3SJ3A 1KCXA 1SJAA 4ZL1A 1WDDA 3MSGA 2REQB 4S3CA 1CECA 3KAGA 4HNVA 3WQDA 1BQGA 2W79A 2ZQTA 3HB9A 3IAPA 3K46A 3NVTA 2WMFA 1F6YA 3OOQA 3GVQA 4EACA 3CUGA 2OWWA 1GKPA 2QUTA 3TZFA 3AXXA 4D8AA 4MMWA 1A5KC 4M5PA 3QLDA 1IWAA 4AEEA 3LBOA 3WQOA 4RDZA 4MJZA 2EF9A 2JKEA 5GNYA 4NX5A 2DDXA 5A8OA 4ADSA 3B06A 4U5IA 4DZHA 3S5NA 1HP5A 1VEOA 1KRMA 2Y7GA 4M1BA 2OQYA 3I10A 1WDWA 4DZAA 3GZAA 2R1KA 1BYAA 3IVSA 1B9BA 2FH6A 3CEUA 1Y7VA 3RJYA 3ABOA 1EF2A 3IV8A 1K7FA 3LSBA 3WL0A 1KM5A 1RQBA 5GJNA 1IEVA 1H1ZA 3HGRA 1BGAA 1O5KA 4C1NA 3HIJA 5A6MA 5K9CA 2NT0A 1J6PA 2YDQA 3A9IA 3GE7A 4F79A 1IEWA 1OK4A 3LV5A 1O68A 1OBAA 4HSOA 5IDIA 1GONA 1DQUA 1TPUA 2WC4A 3QGVA 1RCXB 4FALA 3LI0A 5D9PA 5FD0A 1B90A 3N6JA 5FL0A 2CITA 2HQAA 1K3UA 3CUZA 3S4TA 3RITA 3B9EA 3NIYA 3W00A 1V6VA 1HF6A 1D7KA 1PKLA 5A2AA 5KINA 3GD6A 4XV0A 4V1XA 5ECVA 4NNAA 3ES7A 1DWGM 3LLFA 1IGSA 1NOWA 1RBAA 4Z0SA 1F3WA 3U7BA 2QGHA 2OLAA 2XP3A 2VC7A 4IMAA 3UERA 3G1VA 1TZ9A 3S9ZA 1AW5A 4ZOBA 3LG3A 1UQZA 2E6DA 3DHPA 1HTIA 1ME7A 3BMBA 4XUYA 4BEUA 3OGRA 2ZADA 3OEXA 3OZPA 4OECA 3CM4A 2P8CA 5M17A 4Q8QA 4AIUA 2PDWA 1JAEA 2XGBA 4IIGA 3RM8A 5ABGA 1GZGA 5FACA 2Y7DA 2CNCA 4NZ5A 4P7QA 1T40A 2KX9A 3L5MA 2CZDA 3CHFA 3V0SA 4XO7A 1B4EA 2W63A 4QX4A 2LJ4A 1JNEA 1FVPA 3ZWSA 3S3GA 3WEZA 1MO0A 4TW7A 1OINA 3KRUA 1B5TA 3TYZA 4UCGA 2QIWA 3AZRA 3HJEA 1FKBA 2NT1A 4GC3A 4C6QA 2H9AA 3MCOA 1NH6A 4LCQA 1K4HA 3PPGA 3FGCB 4KFOA 4R88A 3ZXWA 4G6CA 4TX8A 1JNSA 3SCQA 4K8GA 1Q3NA 1TPDA 1IR1A 3LPPA 3TTYA 2HK1A 2AL1A 2YOCA 4EVZA 4PTXA 1W0MA 3G24A 3GS6A 3VIGA 1W8SA 8A3HA 3PRBA 3C4UA 4MHBA 3VINA 3VE7A 3N6HA 1M7PA 2HWGA 1ZK6A 1Y8BA 5C7VA 2HVOA 4O4VA 4QR6A 3GG1A 4HU8A 2G50A 1FDZA 2XH7A 3H26A 3THUA 3S5SA 2QPSA 3L21A 4QZVB 4HHHA 4MWAA 2J4GA 3WZ0E 3C2EA 4RZBA 4QNWA 3W25A 2Z27A 3QR3A 3VDGA 2YW4A 4HHMA 1E6PA 3B8DA 3R11A 3GXIA 1RK5A 4LF2A 1P6BA 3LHUA 1PJ9A 4IQJA 1PZ3A 1J0JA 2PDPA 1QPLA 4ZVJA 4XKYB 3PZGA 2O7SA 3PANA 3MBDA 1SUXA 5FJRA 4W84A 4B4HA 1GVIA 2F2KA 5BRBA 4PMUA 3LYEA 3ALFA 2YYTA 3RLGA 3I6EA 1AH4A 2WMKA 2A4AA 2F2HA 1G4PA 3NL2A 4B3ZA 3WYZA 2I1OA 4JTAA 1H3GA 1NOUA 3M5XA 2ZXDA 3MU7A 1HJWA 2BVTA 4IIHA 1EQCA 4Q7IA 4HP5A 1EYEA 3LXBA 4MJ4A 3SCNA 2MLZA 4ZXOA 3OG3A 2ZBTA 1J8VA 1NARA 2PGRA 1JPMA 5DMYA 4XAKA 3QRHA 3KAOA 1X6NA 3UR2A 1ZJHA 2QJNA 1FKRA 1IT0A 5DBTA 3WQWA 1OYBA 1J11A 2Y5SA 2GZXA 1JXKA 1WV2A 3QY6A 3U5UA 1DJXA 2WSYA 4E5TA 3UZWA 1JYXA 3FN9A 2PWUA 4F0MA 4IQDA 4CCEA 1VENA 3DESA 3CTTA 5HOSA 3P74A 4ZQRA 3UA4A 2ZZ4A 1LL4A 4BEQA 4S23A 3WBXA 1ZP4A 3EB3A 3G77A 1BF2A 3LTSA 2Y8KA 4B2DA 6REQA 1VF8A 4UQAA 2IUZA 3SRFA 3WF0A 4K6AA 4ZPTR 3AWNA 3UQIA 4JYDA 4PL2A 4GACA 1SSGA 4G7EB 2TMDA 4GKLA 2G95A 4PEKA 2DIKA 4AYSA 1R2RA 2DZAA 1WZAA 2ONEA 3MDYB 1HXJA 3UY7A 4XBKA 3W7IA 2B5UB 3W86A 3S47A 3WQFA 4K39A 2XVGA 3BURA 3W53A 3N4AA 4S3AA 1KQYA 1VYSX 2EG7A 5F4XA 3EMQA 5GQBA 3KHJA 4M0XA 1LWJA 1PYFA 3TW9A 2X0SA 1XRVA 1Z9AA 4KGJA 4M24A 4P8VA 5K9DA 2PV2A 1MZRA 4KS0A 4QAIA 2WMIB 1TZ7A 2INEA 1UWUA 1VJSA 4H41A 1L0PA 2OFNA 4M7SA 1KTCA 4GVFA 1OVDA 1IEIA 2EPMX 4KH2A 1C8YA 1M7XA 5TNVA 3DIPA 5CGTA 1E0VA 4QJ4B 4WDXA 4N2YA 4W93A 3CQHA 3EOUA 5BXSA 1GJPA 4R0XA 1HL8A 1A49A 2JE8A 3PM6A 1BFNA 3GNDA 3LPGA 3CHDA 1XBYA 4JTJA 4M7TA 1F8AB 1XG4A 1VZWA 2JKAA 2Y85A 5HATA 3NGJA 3S46A 2V5KA 2H3DA 3UWQA 2SFPA 3NR0A 1K7EA 1U79A 4AVFA 4I8DA 5F2MA 3ARRA 4WJXA 4XX6A 3QM3A 4HPJA 4QSHA 3CGNA 1EJSC 4J28A 1J18A 1GEQA 1DIOA 4IPPA 1Y0OA 4AD0A 2O9PA 3JU2A 2PWHA 3FHAA 4QDWA 3WNOA 3VNLA 4QROA 4M29A 1VFHA 4F9DA 3SB0A 5A6BA 1PCWA 1RP9A 2P3ZA 3TFXA 2J9YA 1VPYA 4N9EA 1DV7A 1B3XA 4DWSB 1DPMA 4HPXA 4MNLA 2QV5A 3WH7A 4S3GA 5I3GA 2I7GA 4ZZ9A 1SVDA 3L65A 3O5MA 1UA7A 3VKKA 4DJEC 3AZSA 3EWZA 6ENLA 1XL9A 3IAQA 5C71A 2WMJA 1K9EA 3AUOA 1PINA 4INFA 1AW1A 3HPSA 2DH3A 2O9TA 3SY8A 4AZCA 3DKJA 1H2JA 3LY0A 1N82A 3G3DA 4LEQA 1TJ1A 4YS1A 5LGXA 3QPYA 4O1EA 1XI3A 1J4EA 2PDBA 3OIHA 4CCDA 4GNKB 3GIPA 4FF5A 1TPWA 4GQ0A 3WN6A 2Q3RA 3F5KA 4I6KA 2PN0A 1UZHA 4D6GA 4AY7A 3WQGA 3WLJA 3URNA 3R1ZA 4UTFA 5G4WA 3B97A 3ZR6A 1FX6A 3G6LA 2VGIA 4NAEA 2Z00A 4JY8A 4E2BA 4OVXA 2Q01A 3FJNA 3KAIA 2I17A 3WDJA 1R9YA 3P6LA 3AIRA 4W8LA 3W1PA 4MFDA 2WCSA 3NSMA 1X6UA 4UTTC 2V67A 3SBFA 1HKIA 5F4WA 3IUIA 4I5RA 2WJEA 2X42A 4PUMA 5AC5A 3R13A 3TTOA 3W1NA 3G8EA 4JHOA 3M7WA 1CW2A 5C9WA 2Z28A 5G2IA 2A1YA 3H23A 2QUVA 4JTLA 4PA8A 4LYRA 1KLYA 1IGWA 4QG9A 1G7UA 3TA6A 3LN3A 3VNYA 2WNZA 2HXTA 3FJ6A 3W1AA 2HZGA 4DZIA 2GQ8A 3NEVA 4H7VA 2ABBA 1B2YA 5L9FA 2XSXA 1VLWA 3ZYZA 2IPFA 4GUHA 3N3TA 3W29A 1VRDA 4ECLA 3SN1A 3L7RA 3ES8A 1MW1A 2RDWA 3K8KA 3LQLA 1GZJA 4A4AA 5A5WA 1JF5A 4LF1A 2EPKX 2PTZA 2E5CA 4UR7A 3NDOA 1XIIA 4JTSA 1Q6FA 3AS3A 5FF0A 2YA1A 3W9ZA 4ICNA 1Q2RA 2B7OA 3CS2A 2G0WA 4XTIA 3BAJA 2D2HA 1K8YA 4MKSA 4BWLC 5E5CA 4OKDA 4AWTA 4DRSA 2VX4A 3P8IA 1GOMA 1RAKA 5HMSA 3OYZA 5CAHA 4J1OA 3BDKA 3EWDA 3VIIA 3JW7A 4LANA 1UG6A 4F40A 4NRSA 4Y9PA 2ZUTA 5DQPA 3KOXA 4UXDA 3U7VA 3UWYA 4CNOA 3W7NA 4BZYA 3WLSA 1LCOA 1REQA 2O9OA 5D8WA 5K2ZA 3I3EA 1PBKA 4F8XA 5G2HA 3GDTA 2GFTA 1TUXA 3M0IA 4UQBA 5K4XA 1A5UA 4FNTA 1XSIA 3K8LA 1AMKA 1SZFA 1SW0A 3WBAA 2GDUA 1M5WA 4FP1A 4WJ8A 4DAIA 2DU2A 4K38A 4O15A 3AHZA 3UESA 1E4LA 3KWSA 3GXFA 5D2VA 2P5NA 1IXNA 1QOPA 1U83A 2YCJA 3W76A 3HJZA 2R1LA 2BFGA 3M7SA 1P1MA 3BLPX 2PDXA 4LU0A 2A6LA 2C15A 3TTSA 5FF7A 2VX6A 4PTWA 1UA3A 3C3NA 4CN1A 3I3DA 1W3IA 4JFKA 1OX4A 3RAOA 4GYKA 3RIKA 3UCCA 2PC4A 3TOPA 2M08A 3TONA 4YYFA 5A3HA 3R8HA 2PTYA 5GJMA 3HGJA 3KTCA 4OFCA 1VPQA 2OU4A 3PAJA 1R47A 1TVPA 1I4NA 2FVMA 3V16A 3BV7A 4GABA 4AEOA 3CNYA 5HNRA 3UVAA 4Q7NA 2XG9A 1XIMA 4BCEA 2E7FA 2DVTA 3SGZA 1TE6A 5KZDA 2CZEA 1R7AA 1FBAA 3W7MA 2FVLA 4XQ6A 3GW3A 4GNJA 2D22A 3H53A 1E44A 1QVBA 1T5AA 3ZJ7A 2XWDA 3CUJA 3LCXA 3GH4A 3GNNA 4NI3A 3R10A 3M0LA 3TQPA 5CG7A 4LAMA 3ZZ1A 2IMRA 4IPIA 1OHLA 4DRNA 2DT3A 3KBMA 4HZ6A 4MG4A 1Q6EA 4DJDA 5A6LA 1M65A 5DMNA 3OBEA 4F4RA 1KR0A 3I4KA 3NSXA 1UR1A 4ES4A 2YGYA 4W5UA 1DORA 1TX2A 2VEKA 1W9UA 1V02E 4MAVA 3PG8A 1BPLB 1SZNA 1QFEA 1ZY9A 4PFMA 1TE1A 4LJ3A 2BY2A 1GOWA 3B4YA 2Y78A 4N42A 4W5ZA 1BTCA 5T9BG 2FZMA 3W27A 1QW7A 2ZZ6A 3MANA 2ZVIA 4AD4A 2ZRVA 3ITTA 4CN4A 3HG5A 4HMCA 1QNOA 1GHRA 3PR2A 2I56A 1AMYA 3T78A 1R2TA 3GB6A 5AC6A 3IKDA 1XV8A 5DRCA 2W9MA 4A2SA 4DRHA 3VUPA 3F1QA 2D2GA 2R94A 3B8VA 3DBNA 3XINA 1ZCNA 1HGYA 3WENA 5FEZA 2C79A 1ALDA 2J9ZA 4DF0A 2ZE0A 1MQQA 1SGJA 3TC6A 2CLLA 3AMLA 4KEUA 5HWJA 1GZ1A 2JF6A 3CZEA 4R7JA 2RDUA 4EOUA 1E3XA 5I23A 1W5PA 4PBFA 3N9RA 2ZYFA 3BJFA 1UR4A 4GY7A 2O0TA 3F4VA 1VYRA 1TPEA 1W1VA 4GINA 3MA8A 1TRDA 2PWGA 4R5EA 3VGEA 4GI9A 2ZOXA 1NWSA 3KS5A 1LOSA 4Q6JA 3CGTA 2QJJA 3AHTA 4GBUA 1BG4A 1XW8A 3VNMA 3CO4A 3ZM8A 1BXCA 3UJSA 1RQEA 1F6PA 2GQAA 5T9CE 1MXSA 4O2TA 2OFJA 1PZ1A 3IUDA 2HCVA 1L6FA 4WOZA 1FWAC 3O0FA 3E38A 4MYAA 3BG5A 1E0XA 3L4UA 4Z1YA 3BJSA 3E5BA 4I9JA 4JNYA 3GTFA 2DZXA 4W7VA 4O12A 4WVXA 3SAZA 3L2LA 1NOFA 5EMMA 3GXTA 5DIUA 4MLRA 1JGIA 4KBXA 2C3ZA 3A12A 4Z2GA 3F5JA 2GSHA 2AKMA 1R46A 1UR3M 3NQ2A 4IMCA 4ONVA 4Z17A 3W85A 6A3HA 1KFKA 2PGEA 2WJFA 3K4DA 3C8FA 3NQBA 4HT3A 2OGJA 5ABFA 3PBMA 4LTSA 3DYMA 4FX7A 1V0NA 1DJZA 1VQTA 2INZA 5GPRA 3N6QA 3S6TA 3WJXA 5LNVA 5I03A 1GW9A 3VO0A 3B9NA 4K1GA 1U1JA 2KAUC 1P7TA 4MUPA 1W9DM 3TXZA 5CXPA 4P7LA 1WE5A 3LCLA 4LSBA 3HOJA 3G6MA 1R3RA 4Q4PA 4ZQPA 2ASHA 2DV0A 1QNRA 4CQAA 3LHYA 1PAMA 2OVLA 1Z48A 4AH7A 3VKCA 3WF1A 4XZIA 4BF9A 4W88A 4NSBA 3QBUA 2NW0A 1F74A 5E70A 1PX4A 3WNPA 1FY6A 3LK6A 2F6KA 4FPSA 2AL2A 1VB9A 2QV4A 1LG2A 2EQDA 4IMDA 1GQLA 1HQTA 3RLVA 1HJUA 1U5JA 2OO0A 2IKIA 4D6DA 3EEZA 5DT5A 4ACZA 1JPKA 1NQ6A 1QBBA 1JVNA 3ZLGA 5HWNA 3LZ5A 4N02A 3W4RA 1Q7MA 2IKJA 2YDAA 3QOKA 4H01A 1OCJA 2FQIA 2DZTA 4WKHA 5C9ZA 4DBEA 4GXMA 1YDYA 2GVEA 4GY0A 1XG3A 2GUBA 4ADUA 5IOBA 3N2CA 3QPZA 3CTLA 3GAYA 2A7NA 2YIHA 4EXQA 4ZOCA 3AIQA 3P62A 1GQIA 5LYRA 1W3JA 1Y5XA 3WJSA 4J35A 3NEHA 1Z7AA 4HVXA 1J0IA 2J7BA 4BI6A 2VQTA 1UD6A 3W3OA 1VBHA 4HA4A 4GXPA 3ZJKA 2WHKA 4C02B 1H5VA 3CUIA 3LA4A 5DCEA 3FEQA 3AAMA 2VC5A 4QFUA 3VMNA 2VRQA 3UNTA 2REQA 4GFIA 3TSDA 4JTIA 3LB0A 2XP9A 3TJXA 1U2YA 2DZWA 2ZQSA 1BLIA 1TWIA 4TU1A 3Q65A 1MEWA 3WLIA 2P76A 4DPQA 3PZUA 1TTIA 3SI9A 2J88A 3QH2A 3HGOA 4TVDA 1J93A 3QYSA 2YX0A 3B0VC 2F38A 1OM0A 2KI3A 1A47A 3ODKA 4H6QA 4HYRA 3BXWA 1UKQA 4ODNA 1C8VA 3HG2A 2Z2UA 4H04A 5C7HA 3QMRA 2NV9A 3HQOA 4JFSA 4WQ6A 4UTJA 3QZAA 2PCQA 1NWRA 4Y9MA 3ZQ9A 1WBJA 1XINA 1OC6A 1L9WA 1AK5A 2HE8A 4WHBA 2Y62A 2B7NA 1H63A 3CMFA 1D3CA 3CGMA 5G1TA 1DJNA 4MKNA 4BQ2A 3UEQA 4X2PA 1W1TA 5I7GA 3H7VA 5TD4A 1P5QA 2R1NA 4EX4A 3L4VA 4K37A 2PBCA 1VPXA 4XD4A 3C2VA 1NJJA 1A5LC 2QCDB 1Q7QA 3ZFHA 4AD2A 1KXTA 1ZCCA 2UY3A 3SECA 1KWGA 4FXJA 1PKYA 3TROA 1KBLA 1V7YA 2HTMA 4E38A 4PMZA 2EJ1A 3GDLA 4X0NA 3LTPA 1QXLA 3CQ0A 1E1CA 2CERA 4GFSA 2WSPA 1I1WA 1YLVA 1JQVA 3OBAA 4JY9A 4IIFA 3MHFA 4DJDD 2OSXA 3AU2A 4ZBCA 1EH9A 1C9WA 5GNZA 2DJXA 1KBIA 1O95A 1E72M 3IANA 3LMYA 3W82A 1XYBA 3L67A 2J7DA 2XP6A 1VGAA 4TQTA 2EXOA 1BSLA 3SCSA 4F0SA 2PD9A 4LEFA 1QPKA 4HGXA 4LUJA 5FA5A 3GFXA 3IIXA 4DF2A 1M7JA 3KL3A 2YDRA 3E0IA 3ATZA 2QCEA 3L68A 2G96A 2EPLX 2FMOA 2L2SA 2RURA 3C0LA 1PTDA 3BPWA 2BVWA 4OZOA 3VYLA 1XD0A 4BR1A 5D03A 1V93A 5BWFA 4GZIA 4LC6A 1SO6A 1TZZA 3CJPA 3WDIA 4CNUA 1F76A 1WO2A 1O60A 3FVDA 1EO5A 1KFJA 1G5AA 4L4PA 3B3DA 4XK2A 4YHGA 4ZCWA 2FHCA 5AHFA 3B8IA 4UOZA 2WBKA 4MF4A 1DOSA 5AECA 4AZGA 2AOSA 1B0IA 5G4HC 4ZSUA 4IM4A 4V2XA 2FJUB 3MYPA 4OE7A 4LY8A 2YYUA 3FHQA 3R2GA 3AYTA 4GO8A 1UKTA 4AFYA 3FOKA 1ZQ5A 3UP8A 5F2LA 1YTDA 1D2KA 5HPCA 5F4SA 3EA1A 3HO8A 4JFUA 3T4CA 4DRKA 3DG7A 1LG1A 5BMWA 3SQSA 5DELA 2VR4A 4V28A 3CH9A 4C1LA 1DWIM 2CESA 3AIVA 1I0DA 3O07A 2QMKA 2Y5EA 1J0KA 5REQA 1EC9A 4HNNA 3HG4A 2D73A 3W2NA 2WZIA 3GHRA 3SUVA 2Y0FA 3BAWA 3STGA 6TIMA 1OFQA 2F84A 3RUBL 2A21A 3DG3A 2QDDA 3ZIZA 3ITYA 4FX8A 2GVLA 4YMZA 5HW8A 1EGVA 4C6KA 4U84A 2C1HA 1P1XA 2DZSA 3ARYA 4K3ZA 1JG9A 1DWJM 1XLCA 1XLIA 3BQ6A 3THCA 1OFBA 1ZLPA 3AHVA 4GQBA 3VMPA 1JVWA 1YRRA 5HQEA 1WAUA 3ZVIA 2A3HA 4IPLA 2J77A 3DENA 2W92A 3NQ6A 1W91A 1KXQA 2ATSA 3MUY1 4AD1A 3EEGA 1QPOA 4JIRA 3O16A 1HT6A 1O94A 1S5TA 3VX0A 4AVOA 2XUCA 2Z25A 4OJYA 3PBVA 5D32A 4UQDA 4Y7EA 3T0CA 3W26A 2P50A 3PZVA 3BMVA 1EYWA 4N6EA 1XLHA 1E9LA 1EA9C 5AZ1A 4POCA 1H4PA 2WNNA 3ZLFA 4H8NA 2BNJA 3VGBA 1K9DA 2GDVA 3M6DA 4ZB5A 4BI5A 3GNPA 4XZMX 3H2OA 3NOEA 3LM7A 2P10A 3UNDA 3O5EA 3NQ8A 3CIWA 3GH7A 2CXGA 4AG0A 2Z1XA 1VEMA 4KCUA 3VDBA 1MZHA 1EP1A 3T0AA 2GWNA 4JNZA 4HJWA 1V6TA 4PMQA 2IXVA 2OSYA 1R6WA 1TCOC 4NRRA 3URBA 1RPXA 4LQ1A 4Q6XA 4ERGA 4HBKA 4MKVA 5IDZA 4NUWA 1EX1A 3ARQA 3O5LA 2DIJA 1UPPA 4WJEA 3TSMA 2WB5A 1MUCA 2CHRA 4GRSA 4DNMA 3TDFA 3VGFA 1XDMA 2PDMA 1R9XA 1MYRA 2NX3A 3LCHA 5JXQA 2HRWA 3CMJA 3CAQA 1ZFJA 3MWCA 4HMNA 1PEZA 3SCOA 1ZJAA 1UHVA 3QY8A 2WJZA 2G41A 4WDUA 3KRSA 4PZVA 3P0WA 4I9TA 4UTKA 1GK8A 3MV11 1R3YA 5ABTA 3SCUA 4Y9OA 3FYPA 2BS9A 5J8LA 2WMIA 2ACRA 3BVJA 2PRLA 3TE9A 2DSZA 1NEYA 4S3FA 3H2CA 3QQ0A 3OZYA 3UXDA 3NYDA 1HJVA 3OA5A 3QKEA 1ZBWA 2OWXA 3PZOA 1W3HA 2FYMA 2EULA 1UKOA 5CSYA 1G9HA 2PD5A 3RCMA 3WX7A 3NO1A 4O50A 4PUKA 3V4BA 3ABQA 1K03A 4DZ5A 3KP1A 1GTEA 4XBJA 2E25A 1FCQA 3BAKA 2J62A 3VNJA 3KM8A 1OZMA 2E9BA 4ODQA 3URQA 1MI3A 3M43A 3PG9A 1RBOB 1XH0A 2PDQA 1JYNA 1F6KA 5D75A 3BGAA 2BG5A 1OYAA 2EO7A 5D02A 3KVKA 2JGYA 2Q3OA 1FCVA 4ODPA 1D3HA 1S2TA 4O17A 4GJIA 4FR1A 3I68A 5AZ0A 1A0DA 1K6WA 3LMZA 1TJ0A 2WKGA 2C1IA 3SN0A 4XWUA 3WJYA 4LCRA 3XISA 4JL2A 3UBPC 3LPOA 3TC7A 1GW1A 3OQEA 1XX1A 2VCDA 2UBPC 5DY3A 1W1ZA 1G67A 4DWSA 3VA8A 3KDNA 5BXTA 3KBWA 3WO8A 8TIMA 1EJVC 3O2LA 4EK7A 1TJPA 3TR9A 2PUZA 1CT5A 1DE5A 3PZNA 1L8NA 2X7WA 1C3FA 2VO5A 3M0ZA 3VNDA 2WMHA 2EGZA 1M04A 3T4WA 2BLEA 5XIAA 3P5ZA 5AHEA 4W4QA 4B92A 3CXOA 5H8UA 2P88A 3AMCA 1VBUA 4QDPA 1H7NA 3QMTA 2QCLA 1P5BA 4HNUA 1L2QA 1EKOA 4UTUA 2VURA 5D30A 3HZ3A 3BO9A 4RZ6A 1S39A 1SJDA 4KQNA 3KABA 1K70A 3FEMA 3DGBA 3ONBA 1GCYA 2WLZA 4PRWA 5FJIA 3TYUA 1R0MA 4GI8A 5DCDA 3SJNA 4AHOA 4U3AA 5BXJA 1PIIA 1NP2A 1C29A 1PYMA 1OF8A 2XIJA 4TTGA 3WEOA 4EF9A 2GJPA 2BXYA 4CEUC 7PTDA 1J2WA 3TNBA 1AFSA 1UZ4A 2VX7A 1PV8A 2C1GA 2H9AB 3IIZA 3VIJA 1BAGA 4X61A 5CJ5A 3GM8A 1KD0A 3E9AA 2PU1A 4Y2WA 5HJYA 3PULA 1LBMA 3K1GA 1FH8A 1YDVA 1SO4A 1T99A 4RPQA 1YADA 1OYCA 3SADA 2VEPA 3VK5A 2HVNA 3SGGA 1BL4A 1TV7A 3TH6A 3NPVA 4BF7A 3OB8A 1CGUA 5K7JA 4NYYA 1QI5A 4PB4A 4A05A 5GNXA 5HUOA 4GVGA 3VCCA 2UY2A 4JYEA 3HMCA 2DZPA 4NAFB 4A35A 5HKGA 4MWAB 2J8GA 1ICPA 1Y65A 1DJHA 1OGSA 3DG6A 2PU0A 4CU7A 3B03A 1DBTA 5H2ZA 3GRIA 1YEYA 3MT1A 4AZ5A 2XP4A 4MFEA 4PMDA 2OZ0A 4U28A 1JI1A 5GJPA 2W0UA 1E1EA 3WQ5A 1Q63A 3GHUA 4YXGA 2PWVA 4RE0A 1P0BA 5DY2A 4BS0A 2D2OA 1W1B1 4H19A 1I2PA 3M64A 4L72B 1ZSXA 5AHMA 1V08A 3WF2A 1LWHA 4NYUA 4RW3A 1HJXA 3THQA 4WKAA 4P8UA 5K9XA 3PUDA 3NQGA 1DYSA 1E70M 1U1UA 1KM2A 3QY7A 2Y63A 4E2OA 4UTLA 5EA9A 1CXIA 1SFSA 5FEPA 5EPDA 4U4MA 4U5KA 2ZA1A 3UYIA 1UR0A 4UTWA 5H6HA 3PUOA 5A95A 2OZ8A 3VKDA 3SW6A 1X7IA 2DP3A 1I9CB 3UT0A 3AYRA 3E6EA 4PUEA 2W66A 2VZTA 4GO9A 4EXAA 3L2IA 3NWRA 1Q6RA 1KWKA 3HFYA 3RF9A 4O1DA 5CZTA 2VUNA 2OYLA 2OX1A 3KBJA 2E0PA 2PE4A 3QLLA 4PMVA 2OTDA 2J75A 1LTDA 3S2CA 1YXYA 3AIEA 4H9TA 2J7CA 4LAUA 1EOMA 4XTDA 1Z69A 6REQB 2I57A 3N04A 4G2DA 4FLQA 2X09A 2XZ9A 3DFNA 2B31A 2FZNA 3HURA 2ZUMA 4DAFA 4DXVA 2G3FA 1YE4A 4IXHA 4LAYA 1WKFA 1KKRA 1QZ2A 3TN3A 3FK4A 2OG9A 3SFWA 2VC6A 2G5WA 1DWAM 4D1IA 5DT7A 1KLZA 3TW6A 2LLEA 1WXZA 4ZR8A 3MCNA 3CAKA 2G3JA 1D8CA 2WC3A 5A8PA 4DZ3A 3B8SA 3FCPA 3KL5A 3V35A 1I2NA 3POHA 1RPKA 1CLKA 3SDOA 4A3QA 2IS7A 2QAPA 4FXRA 1A4LA 1DXFA 1KTBA 4HNLA 1GQKA 3GLCA 1UWAA 4O0ZA 2YB1A 2DSWA 3NFUA 2YL6A 3EMZA 4NT0A 3BSHA 3VOHA 2Y5JA 1TO3A 3CHCA 1CNVA 3N2OA 4OUEA 2VWTA 5D09A 1KNWA 4JS3A 1AQHA 3GKFA 4KW2A 1ITUA 5DCBA 3DXIA 1SU5A 4GQQA 4JCMA 4XO6A 4C6JA 1QBAA 3AISA 2DQXA 2D0HA 4H1ZA 3PSWA 1EBGA 1Q45A 2RGLA 3SEPA 3QOMA 2GL5A 1XBVA 2D69A 4DB7A 3WCZA 3BAXA 5TQLA 9XIAA 4B5NA 3VDHA 3BW3A 1X7FA 3FFSA 3W70A 1QI2A 3CL8A 2VZUA 3UQNA 5D2TA 3B9OA 3E0VA 3T1GA 5CSUA 1RR2A 3HPAA 4JTHA 4HNCA 3N34A 4IT6A 1XRFA 3GVVA 1J0ZA 5MHBA 1NMVA 2OXNA 2BY3A 3UYCA 1LYXA 1H1YA 4E6MA 3RM4A 1A50A 3LUOA 2XYLA 2PDCA 4TX9A 1QOQA 4FX6M 3AS1A 2WC7A 4V1YA 2R1PA 4HN4A 1XYZA 5G2WA 4JTKA 1T96A 2W67A 4KEVA 3PRAA 3VAWA 1FWCC 2C0HA 3AIWA 4P7RA 1JUKA 2Z4GA 4QLJA 3TZNA 4MNJA 4UNKA 1T41A 3T8LA 3B7XA 3N25A 3V18A 5HJLA 1E5JA 3AXMA 1D9EA 7REQB 2ABAA 1FWRA 1A0CA 1IE7C 1ZU8A 3VZYA 4QISA 3N4EA 2Y8VA 5I3JA 1U30A 1Q66A 1B3VA 1DXEA 3LCWA 4AZCB 1A3WA 1R87A 1JZ5A 1R3SA 1AH0A 1ITXA 2Z6IA 4K2SA 3KW3A 4AUBA 3PRDA 4DWSD 1J6OA 5IHSA 2BMBA 3IJDA 3GVGA 4LBRA 3O5IA 3PR9A 1OFPA 3MI2A 4TNSA 5XINA 2BVYA 4H9MA 3FXGA 3N73A 2DVUA 2Z24A 2OKTA 2CXEA 3KAFA 4HK5A 4HSHA 3LS9A 3VC6A 5FSDC 5C70A 3AMGA 1HUVA 2XGZA 3WJZA 3BICA 1VCFA 2WZTA 3W81A 2NX9A 4ZO8A 4JFLA 3PBGA 2E1DA 3ARZA 4L1GA 4K36A 3V5OA 2BBFA 3NL5A 1KM0A 4JHZA 4HQVA 3FVMA 3ARPA 1YATA 1AL7A 4WRHA 3BMWA 5DMLA 1E4NA 1S2UA 1WQ5A 2HS8A 4EP8C 1FOBA 3UF9A 3KBNA 4XZNX 4NILA 2OO6A 4O4WA 2PF0A 1XH1A 3RX3A 2G4JA 5F7UA 3T0BA 2HV5A 4TIMA 3UGRA 3IHZA 4MY9A 3U2ZA 3W1TA 3FV9A 1NY1A 2A79A 1L6YA 2PV3A 2HK0A 3TWAA 4AXNA 5KZ6A 2EJAA 3HN3A 4OBRA 4JX5A 2NVCA 2PDHA 2PLMA 3BLKA 3SSZA 1DKWA 3AMKA 2OOGA 4O11A 4GUJA 2YCKX 3UVIA 1NDWA 4JFJA 3M47A 4WF7A 5LNUA 1LBFA 3NTYA 1XRSA 3GBDA 4O1AA 4C6LA 4RE4A 3UWZA 3L4ZA 3W38A 2BDQA 1NF0A 4OBSA 3AXHA 1S1PA 3DFHA 4X3ZA 3ICJA 3WLTA 4WXZA 3S6OA 4PMXA 1JFXA 5CBIA 1X8FA 3B04A 5I0DA 3E2RA 1ONWA 1JYVA 1FKFA 5I00A 4IP7A 4CD7A 1A5OC 2WSQA 5BOEA 4LUTB 4XD5A 4UR8A 4YU1A 2QJGA 1OJXA 3G1RA 3AROA 4GYPC 2BASA 1QWKA 4FOKA 4DBWA 3VDCA 2JIEA 5LHFA 4FN2<