4WJXA

Crystal structure of human chitotriosidase-1 catalytic domain at 1.0 a resolution
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
369
structure length
369
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELSLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Chitotriosidase-1
publication title New insights into the enzymatic mechanism of human chitotriosidase (CHIT1) catalytic domain by atomic resolution X-ray diffraction and hybrid QM/MM
pubmed doi rcsb
source organism Homo sapiens
total genus 137
structure length 369
sequence length 369
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4wjxA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4wjxA01
3BSGA 3AS0A 4HOXA 1ZBCA 4K68A 4M8UA 4WKHA 4UQDA 1VAHA 3SCTA 1B3VA 2Q8XA 5FL1A 1Q4NX 1FP8A 4CU6A 1CXEA 4LXFA 2GJXA 2WSPA 2VX4A 1PPIA 1DEDA 5JIPA 2WK2A 1KWGA 2DT1A 3WBEA 1I1XA 1HJQA 1W1PA 4DUWA 1K9FA 5A69A 1GOMA 3EBVA 3NJ3A 2WBKA 2WHKA 4D71A 1QI0A 1E6XM 2FH8A 4AMCA 1CGYA 2EQDA 3VIGA 4OKDA 1V02A 5FIPA 3VMNA 1CXHA 3QOKA 1G1YA 5LYRA 2O9RA 2PWEA 3RPMA 3L4YA 4PTXA 4QP0A 4UZSA 2VZTA 4MNKA 2Y4SA 3BAYA 4EE9A 3L4XA 2QLYA 5BXSA 4NZCA 4H7VA 1FFRA 1C7SA 2YDSA 5EFDA 3ARYA 3W24A 4J3VA 4PMYA 4PMQA 5KZ6A 4DWSC 4V2XA 3K8MA 4W7VA 3VNZA 4WK9A 2VRJA 4HTYA 3TTQA 1UWQA 1B30A 2VCCA 3BLKA 5CZKA 4AZCB 3PZMA 4PEEA 3ARQA 1XV8A 4KMQA 4PMZA 3VDHA 4XX6A 2YOCA 3N18A 2OSXA 4RE3A 3OGVA 2D20A 5A3HA 3RM9A 3K8KA 4JFWA 5CPSA 1B3XA 1H41A 2J7DA 4BQ2A 3GH7A 1DP0A 2RGMA 4A3HA 4ATLA 1ODUA 4TVDA 4UFIA 1GUVA 4PCSA 5GQBA 2GSJA 2DH3A 2E8ZA 4BQ4A 3APGA 2A3EA 3I3BA 1NP0A 3T09A 3ARPA 3UETA 5A6AA 3UG5A 3WDHA 2DQXA 2WMJA 2WVUA 3N9KA 3T0BA 5AC4A 3BAIA 4UQBA 3ARWA 1UH2A 2WMFA 4CUCA 5A6LA 1GOOA 2D24A 2GK1B 1D3CA 4AD2A 1NQ6A 2AMGA 1R85A 1EIBA 3BXWA 1GQKA 1C90A 1LQ0A 3TTSA 2J75A 2VR4A 2ZXBA 1CXIA 1OIFA 4ZXLA 3DHPA 1UR8A 5I3DA 3WQVA 3WD2A 3FAXA 1E3ZA 1R8LA 5E0CA 1XYZA 4JKKA 4HA4A 1V6XA 3WUBA 1JF5A 2J78A 3DC0A 4CCDA 1W3HA 4CD7A 1CIUA 4D6CA 3A3HA 3OB8A 2QMJA 2QPSA 4J3XA 2O9PA 1EDGA 4CN1A 5CLWA 2CHNA 3VO0A 2BHUA 4S3JA 3AIVA 3VX0A 3CUHA 3THCA 5CSYA 3U5YA 3KL3A 3AZSA 3BAJA 3U7VA 4PMDA 1UD5A 1K9DA 1H49A 3N15A 6CGTA 4AZIA 5HOSA 2WCGA 1BLIA 3ARZA 4NRRA 3VGHA 4ML4A 4UFJA 4H8HA 2OYMA 1W1TA 1V03A 2XVNA 3AQUA 3IK2A 2W63A 1QI2A 3NDZA 2XVKA 4F66A 2OLHA 3A6OA 2NT1A 4RE4A 3WNOA 1E4LA 2BY3A 1R87A 3W27A 2AAAA 3U5UA 3VGGA 3SUSA 1ZJBA 4EAMA 2CYGA 1C8XA 4KRTA 4PMXA 4NSBA 3VIOA 1OD8A 3KZSA 2JIEA 1DTUA 3E1F1 2BV9A 4GXPA 3GXIA 1VJZA 4LGXA 4Z2HA 1MXDA 2PBOA 3AS3A 3ZT6A 2F8QA 1B90A 1UWSA 3B9AA 5AY7A 3NUKA 2CKSA 4MNLA 2VZUA 3VX1A 2VR5A 3FHAA 3PTQA 8CGTA 3AMKA 4PMUA 1JFHA 1NOUA 1VEMA 3CHFA 4J27A 2V5DA 1PX3A 3PZGA 4MB4A 2VZOA 4XZBA 4LQ1A 2YIHA 4UQAA 4WLCA 3ALGA 3VU2A 4HU0A 3AIUA 3AHVA 1HN1A 2FH6A 2FHBA 3JUGA 2Z1SA 3PZOA 2C8NA 2DH2A 3AXHA 3T2OA 4KH2A 2JIWA 1QBBA 3AOFA 1DWHM 3VUPA 4AZ6A 3CZEA 2WMKA 3OLEA 3EYPA 1JL8A 4JFTA 4W86A 5I23A 3SCVA 4LYRA 1CNVA 2XIIA 5IHRA 4AD3A 3VDBA 4LX4A 2CKRA 1WCGA 1ITXA 1QNOA 3OGSA 3EDJA 4CU7A 3W53A 3QOMA 3RIKA 3WH7A 2CBVA 3W4RA 3EDFA 4CD8A 1JXJA 3NCOA 3WD0A 4U3CA 2A3CA 1H3GA 3OG2A 4WSJA 3WQ4A 3WNNA 5CGTA 1JZ6A 2WB5A 3RMEA 5HPOA 3N04A 2PI6A 3ZJKA 1TFVA 1ZBKA 3WELA 3VM7A 4W8BA 1MWOA 3W38A 3K1DA 3SCOA 1E6PA 1HXJA 2XHYA 3HJEA 1CGVA 3AICA 4HPGA 4CN6A 4ZE5A 3MKKA 4AZCA 2Y8VA 2AOSA 2WMIB 1UH3A 4PUDA 4Z2JA 1PBGA 5D9PA 1UZ4A 1MW2A 3RCNA 4AZGA 3CUJA 3VGEA 3MMWA 1UWRA 5A6JA 1W9XA 4TX8A 1HP4A 4C7FA 5BWFA 3PTMA 2J7CA 4FK9A 3ALFA 2ZOXA 2GJRA 4IUGA 1G01A 4AZ5A 1YHTA 1XD0A 2JF6A 4U2YA 1ISVA 3WD4A 3AISA 2CNCA 1W1VA 1V6WA 4BZYA 2IXUA 5CJ5A 1AQMA 1SFSA 3MS8A 3WDJA 1H5VA 4JHOA 3ZT5A 2ZX8A 4M82A 4U2ZA 5EFFA 1VFOA 1CPUA 2DSUA 1HVXA 4GI6A 1GQJA 1JZ5A 3A47A 4P8WA 3MUAA 3MO4A 1BYBA 1MVYA 4WKAA 1JI1A 2CITA 1UUQA 1WO2A 1WDSA 3WQ6A 3L4ZA 3BCDA 4MJ2A 1IV8A 2OYLA 1E4MM 2GDVA 2EPOA 1MQPA 1HJVA 4LPCA 1W1YA 2GK1A 2BXZA 1C3FA 2WMHA 3WFZA 1JZ8A 1JDCA 2D22A 3SIMA 1E0XA 4TTUA 1HKMA 1VENA 1QBAA 3OGRA 1NH6A 1W32A 3WNPA 3N1AA 1CXFA 2G41A 4DWSD 1IT0A 4MB1A 1JD7A 2CHOA 6A3HA 3W6MA 1QNRA 1NP2A 3CBWA 2O9TA 5JH8A 3CIVA 1BAGA 5AC5A 3G6LA 3KWXA 4JKMA 4JFSA 2XVLA 3PZNA 5DF0A 1XSKA 2G8ZA 2D3NA 3WKZA 2WYSA 3EMZA 1HJSA 1LWHA 1WZKA 4HMEA 3AIQA 1HP5A 4D6JA 1MW0A 1KCLA 3GXMA 3WUFA 5BRPA 4C7GA 4JIEA 1UD6A 2G3NA 1QNPA 4FLRA 5A6BA 3VMPA 3WH5A 3MMUA 4CCCA 4F8XA 2DT3A 1PEZA 1LG1A 1HX0A 1IZKA 2WBGA 2X09A 4AC1X 1QW9A 3FAWA 1KGUA 1E9LA 1JDDA 3SEPA 1AMYA 1KXQA 4FLQA 2V5CA 4PCTA 3B9EA 1A3HA 2WW5A 5BRQA 4Z2LA 5M03A 3WY1A 3VIHA 1K9TA 3W29A 4P8UA 3VIMA 1HKIA 4Z2GA 1UKQA 3OLGA 3WL1A 2YLLA 4WSKA 3SCWA 3CUGA 3O2LA 2WZIA 4DUVA 3AHZA 3CGTA 3HU7A 3WEZA 1E5JA 1KWKA 1V3JA 3VOCA 4FLOA 2ZIDA 1US3A 5IHSA 4UFHA 3BMVA 1V08A 4QLLA 4IPNB 1EHNA 5CXPA 3FXYA 2W91A 1GPFA 2WANA 2EBNA 2OYKA 1J18A 2E8YA 1UR9A 3ARVA 1B9ZA 2J25A 1H2JA 1J0YA 1JNDA 4R5EA 2VCBA 3AMLA 3K4DA 4B9YA 1EA9C 4JCMA 3N13A 2BVYA 2NW0A 4HOZA 1UWTA 2BY2A 3ZM8A 1TG7A 4J3TA 4UOZA 1BVZA 1SMDA 4JFVA 1UH4A 2VZVA 4PBGA 2VX5A 1V02E 5E6ZA 4CU8A 3CHCA 1I1WA 4F9JA 1JIBA 4AD1A 3RDKA 3FHQA 3NSMA 1W9PA 3L4WA 1W9VA 4PN2A 4GPNA 3HN3A 1XD1A 4BA0A 1QPKA 1V3KA 2J7HA 5JIWA 1TUXA 3AS1A 2WKLA 1ECEA 1NWSA 4P7LA 1XSIA 2ZUNA 3ZMRA 1JFXA 3WL0A 4X0NA 1AQHA 1E6SM 4J7RA 3ZJ7A 2FGZA 1O7AA 3WEOA 2J4GA 2D23A 1H1NA 4GI8A 3W28A 3ZR5A 1JZ3A 4GINA 2XGBA 1TR1A 2B31A 1BTCA 1CGUA 1CWYA 3POHA 4W8AA 2ZWYA 4CCEA 2YLAA 1OBAA 4BQ5A 4CD6A 4CVWA 4UFKA 4TVCA 3UR7A 1FA2A 4UR9A 5FD0A 3WNMA 4J3WA 1QI3A 1Q6CA 1G9HA 4J3UA 1VRXA 2VRQA 4DM2A 1V0MA 1GOWA 3OZPA 1LF1A 1TVPA 2WMIA 3DYMA 4ATDA 4XZWA 1I75A 1WNOA 2CESA 3WH6A 3L2MA 2BVDA 1H0IA 2GFTA 1WP6A 1OGGA 2EPNA 3B9DA 3WSUA 3VINA 2DT0A 1X6LA 3A4AA 4HZ7A 3UESA 1V0LA 2WVTA 3EDEA 3TA9A 1FFQA 4AW7A 7TAAA 1SYTA 3WQ5A 3UG3A 3QHOA 8A3HA 5M17A 2X0YA 4KGJA 1JZ2A 3GYCA 5I79A 4M56A 5A8PA 2WXDM 4D1JA 1J10A 5EBAA 1V3IA 1EGZA 1S46A 5A2AA 3FW6A 2EO7A 2GUYA 4BCEA 3WENA 1OIMA 1BHGA 4R27A 4HOWA 3I3EA 3ARUA 3K8LA 3CTTA 3WF3A 1EOKA 1ZS2A 2E0PA 3EDKA 3FN9A 4GZJA 3GNOA 5ABGA 4EK7A 4B16A 2PB1A 3AHXA 1RD6A 1BG4A 2A3BA 1XHGA 2A3AA 1G5AA 3SUUA 1CDGA 3LPGA 5A8OA 2WZHA 3A4WA 4MADA 4V27A 3WUEA 1M04A 1LLOA 5IFPA 1V3MA 3AHTA 1CTNA 1EO5A 1E6NA 5A8NA 1UD4A 3D5HA 1LL6A 1WDQA 5I77A 3F4VA 1VIWA 2Y24A 3CZLA 5CPQA 5I6SA 4TUFA 3BH4A 5E09A 4OUEA 1UG6A 3UG4A 5LA1A 3WMCA 4JL1A 1ZL1A 3DYOA 3AXIA 2EEXA 2J7EA 5EMYA 4PTMA 3W25A 3TTOA 4FMVA 2W62A 2VQTA 3AZTA 2J47A 3U7BA 4GQQA 3AXXA 2W67A 1UQYA 3ZIZA 4M81A 4CN4A 4HPHA 4AD5A 4HMCA 1ODZA 4AZHA 3T2QA 1EH9A 3FNDA 4W87A 1ISYA 3MMDA 2E9MA 2G3IA 4UZUA 1MW1A 2CERA 3IAPA 3PZTA 4W7WA 1ZJAA 5D9OA 2ZUTA 4UFLA 4QLJA 1GOQA 3II1A 1Q6DA 1R7OA 1J12A 1VBRA 4JL2A 1TVNA 1B0IA 2IUZA 4ACZB 3VNYA 3BAXA 4A3YA 3GH5A 2GDUA 1JD9A 2YJQA 2FGLA 3NDYA 4H04A 4W85A 2A3HA 5FCZA 5E0FA 3SCNA 2VMFA 1VB9A 2QV4A 3UEQA 3WQ8A 2V3GA 1OCQA 1OM0A 3RJYA 2YA2A 1W3KA 2DPEA 3W37A 3SCUA 2NSXA 1W3LA 4TOQA 3GDBA 1PIGA 4PMOA 4W5ZA 1Q6GA 3WFLA 5ABFB 2XSAA 3OZOA 4UQ9A 2ZX6A 1D7FA 1U2YA 5LA2A 4B3LA 3U57A 2D0FA 2F2HA 4Q22A 2OSWA 4W7UA 1UA3A 2E40A 5CPTA 2YDQA 3BGAA 3VMOA 4UOQA 1OWQA 3ARXA 1KXTA 2J74A 2ZWZA 3LMYA 4GI9A 1Q6FA 5A95A 1EO7A 2QHAA 2VI0A 4HA1A 1L0PA 5CQ1A 1NOWA 1MFVA 5DT5A 1G94A 2BHYA 4GO8A 3VIKA 2EXOA 3MUY1 3J7HA 3AI0A 4QFUA 5D8ZA 1PIFA 3GNPA 4PRWA 3AIBA 3ARRA 1U30A 1UZ1A 2WHJA 1PZ3A 3AROA 1OSEA 1GHSA 5GNZA 5A8MA 2JF7A 3AMDA 1HF6A 1RP8A 4WF7A 4GKLA 3RM4A 3OLDA 2E4TA 2UWFA 3BSHA 1GQIA 1XCXA 1TE1A 4HMDA 2BXYA 4AD4A 1E4IA 1HL9A 4PMNA 1XH0A 1OGBA 2XSBA 2WVSA 2J7BA 3M46A 2DT2A 3KEHA 1QVBA 4HZ8A 2CPUA 2DIEA 3WUGA 1CXKA 1VEOA 5CG0A 2VZSA 1VJSA 4W5UA 1M53A 3PTKA 2MANA 2WC3A 5CSUA 1RP9A 3VTRA 1DWJM 1XGZA 4L4OA 1FHDA 1CEOA 5F7UA 1KFWA 3PZQA 3SCQA 1QNSA 4KGLA 1R7AA 2C7FA 3IJ8A 3N11A 1KCKA 5HDRA 5C8BB 3AFBA 1Y7VA 3T0AA 1E1FA 1HKKA 2XM1A 1A47A 2WMGA 3VD5A 1EHAA 3W81A 3GH4A 3O6AA 3PHAA 4URIA 2CETA 4M24A 2VQUA 4WIWA 1JNEA 1B2YA 4QCFA 1VFFA 4J28A 4LYPA 4ZEPA 2XWDA 1LWJA 1UKTA 3GM8A 1PX4A 1XYFA 1BGGA 3FY1A 3DECA 3IANA 3NSNA 3DYPA 3CZ8A 2XPKA 5A6BD 2G4FA 1BSIA 3CZKA 1VFUA 3CLWA 3TOPA 2VOTA 5IFTA 1X1NA 1GZJA 2Y5EA 1F4AA 1WB0A 3W6LA 2V3EA 1KBKA 2E9BA 3VIJA 4M80A 1N82A 1ZBWA 2CCRA 4H8UA 2G3JA 3NIYA 2J7GA 3MV11 4P7RA 1UKPA 3WD1A 4MDPA 3THDA 2XVGA 4CGTA 1CLVA 4B15A 2D2OA 3L4VA 4TVUA 4U5IA 1OD0A 3T0DA 5ABEA 3MANA 4TXEA 3GBEA 2DSWA 1TCMA 2DIJA 3AMGA 1BYDA 2Y8KA 4QLKA 4P8VA 2WCSA 3VD4A 1BYAA 1FH8A 2V3FA 1E0WA 5BYWA 3WDQA 1WZMA 2J62A 1HNYA 4N0RA 2CBIA 4W84A 5CLTA 4MJ4A 2HISA 3DHUA 4CVUA 3QGVA 3AIWA 4D6FA 1W91A 3L2LA 3WN6A 3CMGA 3CHEA 2XG9A 2Y2WA 3PZIA 3ZJ8A 4D6HA 1UA7A 2NT0A 1W2VA 1R86A 4AIOA 3WF1A 3RJXA 4CD4A 3KL5A 2Z1KA 1MYRA 3LPOA 2VC9A 4BQ3A 1QHZA 1HJWA 2D1ZA 1E55A 4D6IA 2QMKA 1TZ7A 3OA5A 2YA0A 1B1YA 3IAQA 4PSPA 4HU8A 2FHCA 4FF5A 2XFRA 5JBFA 1MQQA 3WF0A 1V6UA 2UY3A 1C8YA 4W93A 1ZU8A 3OBAA 1F4HA 5BCAA 4P8XA 1E4NA 1KB3A 4PMRA 1DWAM 1B31A 2WVVB 2E3ZA 4D72A 4ACZA 4AZ7A 2CXGA 4MNJA 4DM1A 1B3WA 4GZEA 4S3KA 4OOUA 1EXPA 1IZJA 1KGXA 1U33A 1W9BM 3M7SA 1XRVA 3CPUA 5GNYA 2C0HA 1VFMA 2W5FA 2W92A 5DMYA 3S6TA 5A1AA 1V0NA 1JAEA 1D2KA 1WZAA 3IJ7A 1EDQA 4ZXOA 1SMAA 1BFNA 3I3DA 3W26A 5A2BA 2VX6A 5ABFA 1GOIA 4M1RA 2EJ1A 3ZOAA 3BLPX 2ZUVA 3F5KA 4D6DA 3SCSA 1TMQA 2BS9A 3EMCA 4Q7NA 5I2UA 1W3JA 4IISA 2FDMA 1YQ2A 3N12A 3PN8A 2ZXAA 1WAWA 1EOMA 4AZBA 2YL5A 3F5LA 3UCQA 5M5DA 2ZX7A 3WNKA 1MFUA 1PAMA 3SURA 4PYSA 2JEPA 4E4PA 1JI2A 5FL0A 5GPRA 1QHPA 2W61A 3VGFA 1W9DM 4W89A 1QNQA 2XM2A 2IXVA 3CUFA 2WSKA 4ZE4A 3BCFA 1GJUA 1GHRA 2XJ7A 1L8NA 4JAWA 3T08A 2WZEA 3KE0A 1J0ZA 3GXFA 5C70A 4C7DA 1JF6A 1LL4A 3K46A 3ARSA 1XC6A 3EMQA 2WKGA 2ZE0A 3TP4A 1V3LA 1OB0A 1E0VA 4AY1A 2PC8A 5BROA 2YKKA 3AZRA 2VT0A 3ZJ6A 1HT6A 4TTGA 2X8RA 4UOJA 1UR0A 4U31A 4QDMA 1V6VA 3VGBA 3KL0A 4OJYA 1XSJA 1CGTA 1JYVA 1JZ7A 1OGSA 1HJXA 1VEPA 5EB8A 5JBDA 1CGXA 2VRKA 3AJ7A 2DDXA 1WDPA 1E70M 2WWDA 2DGAA 4UQCA 4Y7EA 5FKYA 4E8CA 1UR4A 2VTFA 1PJ9A 2ZX5A 1H0GA 4JZ5A 1W9UA 7A3HA 1KXVA 2EPKX 5IXEA 2DEPA 3GTNA 1H4PA 3PZUA 4HA3A 1JG9A 5D9NA 1J0KA 1QW8A 3AIRA 2CBUA 1GNXA 4JKLA 2WM0A 4OBSA 5FOOA 4D6EA 1E1EA 1CYGA 1RH9A 3OLIA 1WKYA 2WNWA 2PWFA 4X9YA 2O9OA 4JCLA 3RILA 1KR0A 3SUVA 1FH7A 3BAWA 1HIZA 1BF2A 1NWTA 4X0VA 1XH2A 3WBAA 3VDCA 1HJUA 1E3XA 2ZUUA 4BF7A 1ZB5A 4IM4A 2BY0A 5D8WA 1CGWA 1JDAA 2BHZA 4N42A 4EANA 2CIPA 5A2CA 1PX8A 4OZOA 3VIPA 2E9LA 4H2CA 2UY5A 3K4AA 3LPPA 2WLYA 1K9EA 2J8GA 1GORA 5LA0A 3VD9A 2J79A 2XWEA 2ZXDA 2CBJA 5BXTA 4ATWA 4U33A 4MB3A 3SCPA 2DSZA 3TTYA 1JGIA 4U5KA 4RE2A 2CEQA 4TX6A 4E2OA 1DWIM 1GOKA 5BXRA 2BFGA 2ZUWA 3VKKA 3AIEA 4U3AA 4KWUA 1KXHA 2XGIA 3BMWA 1DWGM 3VILA 1UD8A 5GNXA 4AISA 3WF2A 2OWCA 3GXDA 5E9AA 1M7XA 4YHEA 4HZ6A 1X6NA 2WC7A 1J0JA 5C71A 2UY4A 1E15A 4B3KA 2D3LA 4H8VA 1HKJA 3UERA 1TA3B 4PTWA 5HPCA 2EPMX 1UOKA 3WDPP 1UYQA 3LPFA 1ISXA 2WVVA 1EQPA 3CZJA 4PMVA 2J8FA 2WHMA 4D6GA 5JUVA 1WZLA 3VDAA 2ESCA 5AYBA 4MTVA 5TD4A 1V3HA 1J01A 3ZQ9A 5HXMA 1P6WA 5M3WA 3PZVA 4M29A 3CHDA 2WLZA 2VVSA 2X0HA 5HNNA 3TONA 1BPLB 5I24A 3HMCA 2ZUSA 1ISWA 3SUWA 5D9MA 1LL7A 3N17A 4UCFA 3VM5A 4P7OA 1ISZA 4DWSB 1OT2A 2XUCA 5A6MA 1CBGA 4NRSA 3WNLA 1AQ0A 4AIUA 2V3DA 1BYCA 3MSGA 1GQLA 3VD7A 3O9NA 5JBEA 4ZFMA 2YL9A 3W82A 4HP5A 4UNIA 4WKFA 3AYRA 1VBUA 3WH9A 3T2PA 4ZENA 3L4UA 4MB5A 3VD3A 1JZ4A 2XTKA 1MW3A 4EKJA 2RGLA 1BVNP 2XFFA 1B3YA 4LYQA 3D3AA 1UD2A 2GJXB 1JYNA 3PBGA 3MSDA 4OIFA 4MAZA 2JALA 3UR8A 4AYSA 4JFUA 1KBBA 1JXKA 5CGMA 4P7NA 1XCWA 4J3SA 1GJWA 3VPLA 1JYXA 1J0HA 4QAWA 2J7FA 4MAVA 1GVIA 1G0CA 1HVQA 1PZ2A 2VUYA 4NF7A 1LJYA 4AWEA 2D0HA 1CENA 3WDIA 2OSYA 1CECA 3BC9A 4YHGA 1E56A 3WD3A 4BS0A 1UKSA 1RPKA 1QHOA 1US2A 2WC4A 3MUIA 1FP9A 1HL8A 2JEQA 1K6AA 1JAKA 3ARTA 1FOBA 2UY2A 2ZUMA 4UQEA 5E70A 4JHZA 3S2CA 4XV0A 1M03A 1NARA 1UWIA 3SCRA 3CO4A 2PWDA 1E73M 3F5JA 2YA1A 1H09A 1C7TA 1CXLA 1ESWA 1NOFA 4W88A 6TAAA 3SUTA 2DSVA 3AHYA 2JFEX 1LG2A 5DFAA 1SR0A 3CZGA 4PTVA 1DHKA 2XIBA 1AVAA 3WIJA 4F79A 1MXGA 3VIFA 5I5RA 1E5NA 1KQYA 2G3MA 3QHMA 4IPLA 1NWRA 2OWWA 1J0IA 1VF8A 2GVYA 3NYDA 1E6ZA 4YPJA 1KR1A 3ZSTA 3WF4A 1XH1A 1UKOA 3AMCA 1KQZA 1C93A 1ZBVA 5KEZA 3M07A 4V28A 3WDRA 4CKQA 4AEEA 3ECQA 1J9YA 1C91A 4GO9A 1EQCA 4AIEA 1EDTA 1FH9A 5BXPA 1V6YA 3QR3A 4UTFA 2VJXA 4L4PA 2QPUA 4DUXA 1CLXA 4W8LA 5E6YA 1OINA 3MUZ1 2OWXA 1QOXA 4XB3A 1J11A 1UD3A 4B9ZA 3CH9A 4UFMA 4CD5A 5I78A 2V38A 4F9DA 4PSRA 4Z2IA 1KGWA 1C92A 1GW1A 2ZICA 2XFYA 2WPGA 2BNJA 2XYLA 3W0KA 3ZSSA 4P7QA 3ZT7A 1Q6EA 5DT7A 2W4XA 1BQCA 1H11A 2X05A 4MDOA 2X1IA 3EDDA 4MPKA 3OIHA 1W2PA 3VGDA 4MNMA 3VIIA 2YBTA 4AD0A 2FHFA 3CMJA 1BGAA 4ACYA 4PUEA 2J77A 2VNCA 2BY1A 5I0DA 1E43A 3A4XA 3MU7A 3WH8A 5ECUA 1ITCA 4YN5A 4NI3A 2VVNA 2O92A 4WJXA 2PBGA 1MQRA 2F61A 2QF8A 2PF0A 1C8QA 5A94A 2WAGA 4D1IA 5IDIA 4GZIA 2WHLA 3AYSA 3MV01 3RM8A 1QI4A 3NSXA 9CGTA 1UQZA 3ZO9A 3B8SA 2WCAA 3WMBA 5A8QA 2YL8A 1JYWA 1FHLA 3IJ9A 2BVTA 2ZXQA 3M6DA 2YBUA 2HVMA 2VX7A 3ZR6A 3GNRA 1UR1A 2EPLX 2YL6A 1B3ZA 1OT1A 4E8DA 4QCEA 3GBDA 3BAKA 2YDRA 2VL4A 1QI5A 4GQRA 4OBRA 2JE8A 4GIAA 1TA3A 2PWHA 3WEMA 3GZAA 1NWUA 3G6MA 1GONA 3QHNA 5ABHA 1UWUA 1CZ1A 5D4YA 2XVPA 2VO5A 3VVGA 1WDRA 4FLSA 2VURA 7CGTA 1V0KA 3L4TA 5AYIA 4RL3A 2VCAA 2WWCA 2DSKA 1GCYA 3WMSA 5HBFA 1Z32X 3CUIA 1UHVA 4Z2KA 1BG9A 2X2YA 4OOZA 5A6SA 1DWFM 3AS2A 2PWGA 2TAAA 4AEFA 2ZX9A 3WQWA 1E6QM 3POCA 3PZ9A 1NM9A 5DO8A 4DWSA 1M01A 4XUYA 1E72M 1WPCA 1UR2A 1E71M 1E6RA 1GVYA 4KRUA 2GJPA 5A6KA 4H41A 1O6IA 3RO8A 4AXNA 2D0GA 4A4AA 2W66A 1WE5A 1E40A 5DEZA
chains in the Genus database with same CATH superfamily
5A6TC 5DXYA 2OCZA 3AS0A 2WSRA 4IGHA 2D2JA 3DBPA 1WKFA 2PCQA 3O07A 1GVFA 1E9YB 3GTFA 4ILSA 3U2ZA 3UWYA 4ZPVR 4UTKA 1OZMA 4O8RA 2EKCA 4LXFA 3ODKA 2GJXA 1EA0A 1POKA 3T0CA 4GXMA 2DT1A 3WBEA 1HJQA 1W1PA 4YIWA 2OEMA 4DIPA 5A69A 3UGVA 2WBKA 2I9UA 2FH8A 3BANA 1V02A 1M7JA 4GUJA 4LBRA 1CXHA 1DJGA 2HCVA 2XP5A 1KFBA 2O9RA 4HT3A 5FEPA 1TJPA 4HNCA 2QUUA 2E1DA 5DLCA 3W7DA 1FFRA 4LCSA 5EFDA 3PM6A 4LS1A 4HPXA 1VCFA 3UY8A 4NJKA 1P5QA 1JCMP 1HO4A 3T1GA 1R3QA 4PMQA 4DRHA 4W7VA 3W71A 2VRJA 4HTYA 5FF4A 3I6EA 3BV4A 3BLKA 4Q8MA 4FIRA 4UTWA 4C5YA 3ARQA 1GW9A 3GTHA 1BL4A 4B5WA 3CL7A 4HBOA 1Q6RA 3N18A 3PJTA 4GVIA 1EF3A 1YDVA 5A3HA 4C6FA 2P76A 1DIEA 3K8KA 5CPSA 1H41A 4B5UA 4ATLA 4TVDA 3F4DA 1BWVA 4PCSA 3E2QA 4BQ4A 3UQBA 1GTEA 4JQ1A 3I3BA 1G7UA 3VAWA 1QZ2A 2ACUA 1C9HA 1EYWA 2C1HA 2R91A 2GVGA 3PUGA 2Y61A 5LNVA 2WVUA 1XYCA 3N9KA 4DBWA 4A35A 3TR9A 3VE7A 3UJRA 1F9CA 4FNUA 1F05A 3TJ4A 5T9BG 3BLFA 3GXNA 5CPOA 2Y1HA 4CUCA 1SO3A 1GOOA 4EXQA 3E0FA 1NQ6A 3FA4A 4WY0F 3I7SA 1EIBA 5DITA 1XYBA 3IIVA 4LAXA 2J75A 2AGKA 1CXIA 4FF7A 1OFDA 5HR6A 3FX4A 4ZXLA 9XIAA 3DHPA 1P7TA 3EWYA 3GKFA 5I3DA 4DF2A 3FAXA 4K8GA 4MLRA 1A5SA 3IV8A 1V6XA 1SJBA 2J78A 2E25A 4PA8A 4LT9A 2PD5A 3TOYA 4YTUA 3OP2A 1EX5A 2V8ZA 4J3XA 2O9PA 4L1WA 3USZA 2OZ3A 4YTTA 4AXKA 3AIVA 1X97A 4C6KA 3G77A 6PTDA 3S0CA 3W86A 3CO8A 3SECA 3S3GA 4PMDA 4KWOA 2NX1A 3CMFA 2VEFA 3O5QA 3WX7A 4KIEA 2Y85A 3HPSA 4M6UA 3ARZA 4ML4A 4J4NA 2GVJA 2OYMA 4GJJA 1V03A 3SFKA 3NDZA 5XIAA 3PBYA 2QUMA 3BJSA 4ODQA 1ZRQA 2BY3A 1NQKA 3SUSA 4LAUA 3LNPA 3I65A 1JRBA 3SGGA 3OYXA 5PTDA 4KRTA 4NSBA 2CLIA 3FEQA 3CUZA 4GXPA 1VJZA 3NVTA 1TWSA 1MXDA 2PBOA 3VCRA 5AY7A 2HTMA 3NUKA 1S2CA 2AQVA 4IJRA 1XCFA 1Y8BA 8CGTA 3N29A 4US5D 3GNNA 4IFKA 1G4PA 4J27A 2V5DA 1UUOA 2Q01A 1Q7QA 4WLCA 3AIUA 2FFIA 1M3UA 1T8QA 4JX5A 3IVTA 4GK8A 4FEZA 2DH2A 5HW6A 5DANA 3VUPA 1EBGA 1PTGA 2AL2A 3EYPA 4PL2A 3SCVA 1U79A 1CNVA 3GDMA 4AD3A 3BSMA 1HZYA 2ZQVA 2CKRA 3RGTA 2F9RA 2ISSA 3DFYA 4YWIA 5DMNA 1AZ1A 1JJKA 3QOMA 3WH7A 4KIRA 3W4RA 4LVGA 1XP3A 3TX9A 3NCOA 3WD0A 1PUDA 1H3GA 4GVHA 4U3CA 4WSJA 3WQ4A 3WNNA 4JQAA 1OCJA 5CGTA 3W1QA 3WLKX 3H8AA 4ODOA 4WOZA 1E9ZB 3ZJKA 4N9EA 4XD5A 3H4GA 1MWOA 2GQ8A 3W38A 1MXSA 3L7RA 2VFDA 3V16A 4AWUA 2F2DA 4LVAA 1Z41A 2XHYA 3HJEA 1Q2SA 4CN6A 4ZE5A 2Y8VA 3LBOA 4HSHA 5HWMA 3WMLA 3ATZA 3CUJA 4FA3A 3VGEA 2FZDA 3EA2A 3WLPA 4TX8A 4C7FA 5EU9A 3URNA 3ALFA 2HBVA 4AYGA 2DW7A 4U2YA 1ISVA 3ITLA 1RBLA 1KKOA 1TCDA 2CZDA 2YXOA 3GAKA 2HRWA 1LM1A 3KX6A 2IXUA 1RVGA 1AQMA 1SFSA 4JHOA 2Q8ZA 4ECLA 4U2ZA 4M6QA 5EFFA 4DYEA 1SW0A 1CPUA 3GK0A 3I4KA 1MVYA 4WKAA 1HTIA 4MJ2A 2A4AA 3GD6A 4O16A 2OYLA 4U85A 1YMYA 1XIGA 1MEIA 5CSRA 4WDWA 1X1OA 2GK1A 2BXZA 1VCVA 1JDCA 3CGNA 3TLLA 3V4BA 1FCBA 5G1TA 3OGRA 1XIJA 4UTTC 1L6FA 4PCNA 1NTHA 2C3ZA 3WNPA 3DI0A 2LPVA 4MJMA 3V35A 2FB3A 2CZ5A 2CHOA 2PC4A 1FWTA 4N2YA 3CEUA 1BAGA 2EGZA 4JKMA 2QDDA 4V1XA 3EGJA 3CV1A 4WJEA 1SM9A 3EMZA 3B8DA 3ZR4A 3NQFA 5DIUA 3AIQA 5CCZA 3TXZA 1R3RA 4D6JA 3MSRA 3WUFA 3KP0A 1UD6A 3VC5A 4ODNA 1QNPA 3LI1A 2BMBA 3WH5A 3MMUA 4CCCA 1Y0EA 2A6LA 2PLJA 2WBGA 3W1LA 4AC1X 1QW9A 3T9PA 3ES8A 4J4KA 4H9TA 3DI1A 1E9LA 1JDDA 4ITZA 2MLZA 2WZMA 1DORA 1DQWA 1W56A 3ABZA 1WV2A 2V5CA 5DY3A 4PCTA 3B9EA 1B4KA 3CV6A 3VIHA 3W29A 1OCNA 4LBSA 2IPJA 3SN1A 3AXKA 2YLLA 3SCWA 1D8WA 3CUGA 3O2LA 2X30A 3AHZA 1RCXB 2PV3A 3CGTA 1K6WA 3PP7A 5CPMA 3SFWA 4FLOA 1XLLA 1US3A 4UUIA 1V08A 1PYFA 4J3ZA 3QGKC 1EHNA 1OJXA 3FXYA 3PNUA 4KQNA 3M0LA 3V0SA 1D3HA 2OYKA 3BQ6A 3BW3A 2IS7A 3MCMA 4JY8A 1J0YA 2DVXA 2VC5A 4K37A 2C91A 5BNKA 4LS0A 2VEMA 4LUTA 3UGRA 3B40A 1Z89A 2RJHA 1TG7A 5DRIA 1QU4A 4PBGA 2ZZ6A 3O5LA 3QMTA 1ZHAA 2MNRA 3RDKA 1SZFA 2HMCA 3FHQA 3NSMA 1W9PA 3B9NA 1W9VA 2Z4GA 3GC5A 3HN3A 5I7GA 1V3KA 2W9MA 2W0UA 3UZYA 1K4HA 1LT8A 1LP6A 3ZS4A 1AH0A 3W7JA 2MLXA 4DRQA 1JFXA 3WL0A 3KLKA 4J7RA 3TH6A 2NQLA 5HQLA 1B9BA 2ISDA 3LGDA 3LHVA 1H1NA 4KCVA 1QR7A 1S5MA 4FPSA 2B31A 4AU0A 1SW3A 2JGQA 3OPSA 3UJEA 2I14A 3POHA 4CCEA 2R1NA 1OBAA 1KM3A 1TB3A 4OV4A 2QCDB 3WNMA 3ITYA 1QI3A 1Q6CA 4JX6A 1IWPA 3GR8A 4GKTA 3MCNA 1LRQA 1V0MA 3CYVA 3EX2A 1QCWA 1KTNA 3RX4A 4AVFA 2CESA 3WH6A 4L4LA 1F3TA 4EX4A 2GFTA 3H23A 1WP6A 3B9DA 3WLMA 1ZAIA 3AAMA 3S9YA 1D9EA 1V0LA 3KOZA 1TSIA 3TA9A 1FFQA 3HGRA 4IQLA 7TAAA 1O1HA 3WQ5A 1LYXA 3QHOA 8A3HA 2Z28A 1KTCA 1AG1O 3ANVA 4M56A 5A8PA 1YATA 5FF7A 2HNHA 5LXXA 1J10A 5EBAA 1QTWA 4QQ3A 4YL2A 1S46A 1FKSA 4MZ8A 3GHRA 2GUYA 1VYSX 3S1VA 3S6OA 4R27A 3EPNA 3G0XA 3ARUA 1NDYA 3CTTA 3WF3A 1OX6A 2E0PA 4RJEA 4CNUA 4GZJA 5ABGA 2PB1A 1ITQA 4Y9MA 2A3BA 5I98A 2HE8A 4QSFA 2GVLA 4WCJA 4V27A 2OG9A 4DO6A 5IFPA 3VABA 1U1JA 1CTNA 1P5BA 4GGBA 3O0FA 3GHTA 4IT4A 1LL6A 5D2WA 1EEPA 4GQ0A 4WX2A 3W7PA 3F4VA 5CPQA 1RCOB 2ACQA 2TODA 3KRUA 5E09A 4HNTA 2CLEA 3UG4A 3UBPC 1H61A 3LGGA 3DYOA 3AXIA 4DY1A 2EEXA 4ICMA 4UR8A 4FMVA 2W62A 4WEVX 3NTYA 4RKAA 3ZIZA 4CN4A 2GGEA 3FV9A 1J2WA 5FEXA 3EXRA 4B92A 3T2QA 1EH9A 1XRFA 3N9SA 3IAPA 3EOSA 1Q6QA 3QYQA 4UFLA 2C18A 4GOAA 1FKXA 2GQAA 3AUJA 4Q8PA 5FEZA 4LCQA 1Q6DA 4MWAC 2J88A 4Y9AA 1R7OA 1VBRA 4A8NA 2UBPC 1B0IA 3GO2A 4ZB0A 2HPMA 4XK2A 3AU2A 3GH5A 2X7WA 3NDYA 2A3HA 5FCZA 3SCNA 2DY3A 2PDFA 3WQ8A 2NXHA 2PCEA 3NG3A 3IK4A 1FHVA 1W3KA 2YA2A 5H6HA 4XZ9A 2NSXA 3ZLGA 2FZ9A 1W3LA 4TOQA 1AFSA 3C0LA 1XIFA 1A3WA 4JTEA 4UQ9A 4LRTA 1VZWA 3HGSA 3M0KA 1BXCA 5LA2A 1HL2A 1KV8A 3G24A 3KAFA 3CUXA 5C9RA 4Q22A 1IXOA 1O12A 4DBDA 1KRMA 3OVQA 3ITOA 5CPTA 3T07A 3MYPA 1F8MA 1LBMA 1VYPX 3ARXA 5RUBA 4YLWA 2QJIA 1NOWA 1CB7B 3VIKA 3MUY1 2G95A 3EX1A 4KEUA 1PIFA 1S5NA 3O5IA 4QIUA 4QRNA 3ARRA 2Z7GA 2FB2A 1PZ3A 3QN3A 3I68A 5A8MA 3AMDA 1OK6A 3EKGA 4DXVA 1RP8A 3CAWA 3C4UA 4WF7A 4UCGA 1R9YA 3OLDA 2PGWA 3NVDA 2RUDA 4KFPA 1GQIA 4MKVA 4A8RA 1EPVA 4J2MA 4NZ3A 1TKKA 1TE1A 4AD4A 1HL9A 4PMNA 4G1NA 4LF2A 1OGBA 5AVHA 3QMRA 1VR6A 1HFBA 4JEJA 2A3LA 4R3UA 2OKTA 1GK8A 2QQ6A 1EJXC 1TPWA 1QVBA 4MYAA 1T0OA 4HZ8A 1IHIA 1UCWA 1AJZA 4LC6A 2EG7A 3L5LA 4DAFA 2O4QA 3C5QA 3GVWA 4JTIA 1TVLA 1Q8AA 1M53A 4ZQRA 1RP9A 1FHDA 5F7UA 3SCQA 1QNSA 2C7FA 1W26A 1ENUA 3MT1A 3N11A 4NAEA 4REQB 1KCKA 3SSZA 4C90A 1BXNA 1PSCA 4JTGA 2HK0A 3A9BA 1TRDA 1P0EA 5KZMA 4ZA0A 4WQ6A 4B3ZA 2YR1A 1IT7A 3PHAA 1LUCB 4URIA 2CETA 3LQLA 1JNEA 4QZVB 2GGGA 4LYPA 5D2TA 1PBKA 3AO0A 1DBTA 1G4SA 2C1IA 1BGGA 2XN2A 2QAFA 3IANA 3EWUA 3GC2A 3CZ8A 5A6BD 1BSIA 1U83A 1FVPA 3PJXA 4U86A 2Y89A 3CZKA 4L61A 4QJ1A 4IMEA 2OODA 4G50A 1RALA 6TIMA 4IPPA 3UFYA 3GUGA 1X1NA 3W6LA 4DPQA 3G18A 2DJLA 5SWUA 5C9XA 2PSNA 2E9BA 3LQGA 1ZP3A 1WKDA 5HJLA 4IMGA 4Q4OA 3ID7A 3NIYA 4L1GA 5M1TA 1XS2A 4O0KA 3O5GA 5D02A 4MDPA 2OLAA 1TJRA 4HIBA 4BY3A 1J5TA 1JPHA 4TXEA 3OW1A 4GUFA 3K30A 1BYDA 1KFCA 4P8VA 3NM1A 2V3FA 2WJDA 1E0WA 1WZMA 1HNYA 2OLSA 1BRLB 5CLTA 2ODOA 4GYPA 1O5RA 3KFTA 4G6CA 1XLKA 1FKLA 4K1WA 3S2MA 3CQKA 4FOJA 5U4NA 1Y5WA 1Z44A 2GJNA 1IIGA 4PEKA 4CLMA 4D6HA 4B4HA 4FIQA 5REQB 3KZ7A 3KL5A 2D1ZA 4F2BA 4D6IA 3ITTA 3ABSA 2Z24A 1XDJA 3IAQA 5J5RA 3DG7A 5I3KA 4RW5A 4HN8A 3OEXA 3WF0A 4HCDA 1V6UA 1C8YA 1IEXA 1U22A 2UZ9A 2IKJA 1FWFC 1REQA 4O4WA 1B31A 4S3CA 1AL7A 2BX7A 3QPZA 1UR3M 5LNSA 2H6RA 4HQVA 4D72A 1TPVA 4YJ5A 4DM1A 4GZEA 4HU3A 3U9IA 5GNYA 3KAIA 1RXOB 3KRSA 3DERA 1KW1A 1YXCA 4CCZA 4XSMA 4LY8A 3CT7A 5ABFA 4H3DA 2VD9A 4C5ZA 1XLFA 4FNSA 2EJ1A 4JIIX 3U6WA 2PDMA 3PJUA 3T05A 3IHZA 4Z0JA 4I3GA 4DRIA 4A8IA 1SJAA 1SGJA 2DQWA 4NJIA 1WAWA 1EOMA 4AZBA 3NQMA 4NXSA 4Q4PA 3EB4A 1RA5A 1QATA 3QSRA 1MFUA 5AFDA 1PAMA 2IQTA 4G1KA 4PYSA 4HB7A 2A85A 3H7UA 2PE4A 5FL0A 7PTDA 1FUYA 4ZPTR 1KRBC 4TMBA 4W89A 2IXVA 3CUFA 2VEPA 3G1YA 1QFEA 3PFMA 4L6DA 4U84A 1EC8A 3V5FA 1L8NA 4JAWA 5C9ZA 4MWAD 3KE0A 1I2PA 2VFEA 3S83A 1PHQA 2G37A 1JCXA 4BI7A 1OB0A 1E0VA 4AY1A 4LUSA 5FEWA 2VT0A 1YEYA 1SZGA 3SJ3A 4ERAA 2ZRZA 1M41A 4UOJA 2GQ3A 4H6RA 4YMZA 2E6AA 1VJIA 1JYVA 1TMLA 2Z0IA 2W3ZA 5C2GA 3DZ1A 1WDPA 1DJQA 3HG2A 1ONEA 1UR4A 1SO4A 3TYZA 3LXBA 3OO2A 2ZRYA 3M4HA 4H19A 2DEPA 2Z2UA 3GTNA 2P10A 1JG9A 4ODLA 3AIRA 4MWAE 1PIIA 1S2AA 2A7PA 3CXOA 1GNXA 1KLZA 4QITA 4FHAA 1E1EA 2FJKA 4HHHA 3V0UA 1L6GA 4R9XA 1UZHA 1CYGA 1QXLA 3H24A 2M2AA 1XYLA 1PZ1A 3SJNA 4X9YA 3HM7A 4JCLA 1IF2A 2FDSA 4H6QA 3M0XA 3SUVA 3H2AA 4JNMA 4QE1A 4X0VA 1HJUA 4GUGA 3GAYA 3VFCA 2IPGA 1E3XA 4QX4A 3TZFA 2BY0A 4PTDA 1TPC1 2BLEA 1PX8A 1XLIA 1DTNA 1P4CA 1E0UA 1YTEA 2E9LA 4F2TA 3S42A 4XAFA 1K9EA 3R1ZA 4IG2B 1PXGA 3L0KA 2QGYA 1ML1A 1XGDA 3UA4A 2QGHA 4U33A 3G5EA 1GVRA 5BWAA 3M44A 3PR9A 1LRTA 4A29A 3S8HA 4M3PA 3T7VA 4ES4A 4H9XA 1EF2A 2PP3A 4U3AA 3UJ2A 1JDEA 3NWRA 1VFTA 4H7ZA 2CLMA 3TAKA 4IL2A 4AISA 1RA0A 1SFJA 4R53A 3UXIA 4HZ6A 4EOUA 3MBFA 8XIAA 1E15A 2XZ9A 3TWAA 4B3KA 3N2TA 1HKJA 2QS8A 2EHHA 4PZVA 3UERA 2ON3A 4L9XA 1SQ7A 2YGYA 5HPCA 2J8TA 4CNTA 1UYQA 2WVVA 1EQPA 1RJPA 3EEGA 2YW4A 2WHMA 2ZZ1A 5JUVA 4TV5A 1V3HA 1P6WA 5M3WA 3PZVA 4M29A 2X41A 2R1PA 2VVSA 2X0HA 5HNNA 3TONA 1A5AA 1S2VA 5I24A 3HMCA 2ZUSA 1ISWA 1LLWA 3T44A 5D9MA 3IKGA 3P84A 3QV9A 4UCFA 5JQ9A 4P7OA 1ISZA 2XUCA 3RXZA 5A6MA 1CBGA 2JKEA 3S46A 4H8NA 4QEHA 1GQLA 4GGHA 2P0IA 3P82A 2YL9A 3KAHA 3MKCA 4WKFA 3PPCA 2HSAA 1O95A 1C9WA 4XVDA 3B0XA 2PMQA 3TEVA 1YDNA 4ZENA 3L4UA 1JZ4A 2XTKA 3OIXA 4FO4A 1BVNP 1XDLA 3KOFA 3W2UA 3DFQA 1R5YA 3QFEA 5EMUA 1OG6A 3HQPA 3U3HA 1JYNA 3LZ3A 4MAZA 2JALA 3LYEA 2EAWA 2G5WA 2QIWA 1XCWA 4J3SA 1JYXA 4QAWA 2J7FA 4MAVA 3BCJA 1GVIA 1G0CA 4WDTA 3VE9A 1KCXA 1W5PA 2D0HA 5C6MA 2OSYA 4A2SA 1QK2A 1SR9A 3W84A 4JTHA 3Q2DA 2C14A 3UVIA 2WC4A 5B80A 1FP9A 4RR4A 2JEQA 4C1NB 4OGZA 1S1RA 1V79A 2P8BA 2ETNA 2A21A 4H9UA 2ZUMA 4GXWA 4ZOEA 3OG3A 3S2CA 2FZMA 1NARA 2DJXA 4C6IA 2PWDA 4AX7A 5F2MA 3NQ6A 1H09A 1XLHA 2P88A 5HA7A 4W88A 6TAAA 4S38A 4UC5A 1LG2A 4NX0A 4O1AA 5DFAA 1SR0A 1S2WA 4O14A 1RJRA 2F38A 1XKJA 4PTVA 4HYWA 3OTRA 3OU8A 4FNPA 4F0LA 5I5RA 3TYAA 3QLLA 1E5NA 1W8GA 3L9CA 1PCKA 3QHMA 1NWRA 2OWWA 5LIXX 2GVYA 1A4LA 3PG8A 1KR1A 2VR2A 3URBA 2YB4A 1XH1A 3AMCA 3E3HA 2ADAA 4CKQA 4C1KA 3ECQA 4ORMA 1J9YA 1C91A 4GO9A 1Q7MA 4AIEA 1EDTA 1FH9A 4NHVA 2JZVA 3M5YA 4LCRA 4KR0B 1V6YA 4KS0A 2QPUA 1KBJA 2XINA 2RDXA 3I6CA 3KLLA 4GJ1A 4V33A 2CWXA 2VENA 3AWOA 1UBSA 4Z42C 1AK5A 4GMEA 4L65A 1H7WA 1FKHA 1UD3A 4B9ZA 3IGSA 3NR0A 3GDRA 5I78A 3QH2A 4PSRA 3LZ5A 4HKPA 1DKWA 1EUAA 2JBMA 1HW6A 2GSEA 1FWGC 4R88A 3ZSSA 3ZT7A 2B7NA 1Q6EA 3WLTA 5DT7A 1BQCA 2FZ8A 5T9CE 1H11A 4YTQA 3SZ8A 2X1IA 3EDDA 3EOEA 1W2PA 5H2ZA 3VIIA 4AD0A 2FHFA 3UZ5A 3SIZA 1PWLA 3GXPA 2VNCA 4RE0A 2HQAA 5I0DA 1UZDA 3MU7A 5AHLA 3WH8A 5ECUA 3B03A 3B4YA 4NI3A 2PWUA 2VVNA 3UR2A 4N9DA 2F61A 1THFD 5A94A 5IDIA 3CS2A 3MV01 5KMYA 3RM8A 2VGFA 1UQZA 3UJSA 2WCAA 2G0WA 1E1CA 4TW7A 2YL8A 4G2DA 3RG6A 4F0RA 2DORA 1I9CB 2Q02A 3LLFA 5HWJA 3E6EA 2R1KA 4QTGA 3GHSA 5F1VA 5BMXA 1IR2A 2EPLX 3WQEA 4CEUC 1F6YA 3GBDA 2P3ZA 3DESA 3SY8A 4PCFA 2I56A 1TIWA 1GONA 4HBEA 4NUWA 3STEA 3P60A 1WDRA 3NL6A 1RAKA 5AYIA 4DAIA 3CUIA 1BG9A 3WJWA 4O0QA 2TAAA 4AEFA 5LXEA 4N6EA 1E6QM 3PBUA 1LDCA 1R3TA 3G1XA 4X63A 4C91A 3PC0A 3O0KA 1OX4B 3G1DA 3HTWA 1NDVA 3TROA 4F0SA 4Q4KA 1E71M 1E6RA 3N3MA 1GVYA 3QTPA 2PGEA 1K03A 4AXNA 1P0NA 2PLCA 1HGYA 2GGJA 3LXAA 4A4AA 3HPXA 3QLDA 2QUVA 4F2UA 1TCOC 5EL1A 3S2LA 2W6RA 2R14A 4M7SA 4WKHA 3DFSA 3QMSA 5HKGA 1V51A 2G50A 3AWNA 3SCTA 5BU9A 1RR2A 1B3VA 5AN7A 1Q4NX 5FF0A 5IBXC 2VEGA 3R13A 3UWZA 4UTMA 3PBWA 1A7XA 1JPMA 2PU1A 4DZ3A 3F1QA 1GOMA 3FEMA 1CI1A 4Q4SA 5CPLA 2QF7A 4FXFA 3D0CA 1E6XM 3E2RA 4AMCA 1L1PA 3R94A 4IMDA 1CGYA 4UTJA 3VMNA 3H26A 2WKJA 3QOKA 4B90A 5LYRA 1VC4A 3LENA 4MM1A 3RPMA 4JNYA 2Y4SA 3L4XA 3S2NA 2QLYA 5B8IC 5IRPA 4H7VA 2B7QA 1C7SA 3QC3A 4G7EB 4O8AA 3UJFA 1TPEA 3ARYA 4RX0A 4CQ9A 3ONCA 4GX9A 3W24A 1EBHA 1KFEA 3LMZA 4PMYA 1F07A 4DWSC 4V2XA 3K8MA 4IF2A 3O8AA 3SADA 2Q09A 1AJ2A 4REQA 5AZ1A 5J8LA 1KM2A 1B30A 3EXSA 1FCQA 3OHMB 4KW2A 4R85A 1QWKA 4AZCB 2RAGA 2QUNA 2X42A 3MI3A 2PD9A 3OVRA 2YOCA 1LUCA 2OSXA 3WK2A 2M08A 3N34A 3OGVA 4Q8NA 3NM3A 4NQ1A 3RM9A 3QY6A 4JFWA 1FCUA 2Z1XA 3UXLA 1XINA 2J7DA 4BQ2A 3GH7A 2RGMA 4QROA 4A3HA 3GNXA 1ODUA 3EZ4A 1TTJA 4ZO9A 1R3YA 1FBAA 3UA3A 5IDZA 4LW7A 4MZYA 3VCNA 3W2JA 4BI5A 4M19A 3D3FA 4O1EA 2PDUA 2H9AB 4QM1A 1SFTA 3UETA 5A6AA 4LUJA 2DQXA 2WMJA 5AC4A 1TRIA 3H54A 4GG9A 5BMWA 4UQBA 1K77A 3A5FA 2WMFA 5A6LA 2D24A 4KT2A 3O5JA 4AD2A 3B8IA 4UTUA 2P0OA 3TTSA 2Z26A 4JTTA 2HZGA 2PFHA 1OIFA 2ZRVA 5EY5A 2DP3A 2XIOA 1E3ZA 1R8LA 1BRLA 1DXIA 1Q66A 3WUBA 3PUOA 1VBJA 1JF5A 4UTWC 3PNZA 3GFYA 3W88A 1KFKA 3GS6A 4JTCA 4UDMA 1CIUA 1V93A 4D6CA 4ROQA 2E5DA 2QPSA 3BVJA 1ONWA 4GLEA 3KBSA 1EDGA 2FKEA 4O1FA 1DJZA 1PTDA 2Z6JA 1XXXA 3VKCA 4S3JA 4S3DA 1GKRA 3EOUA 3VX0A 3TJLA 4KCTA 3OVGA 3CUHA 3THCA 5CSYA 1UC5A 2J9ZA 4C6JA 3KL3A 3R25A 3W7KA 3AZSA 3BAJA 1Q3NA 5AC6A 1H49A 1R0MA 1XIMA 2ONEA 3N15A 4MY8A 6CGTA 4AZIA 3UQNA 3CWOX 3MZ2A 2VOMA 2WCGA 1BLIA 3C2YA 2PWVA 3TQKA 3H2CA 3QQWA 4UFJA 4H8HA 3W2LA 1W1TA 4UR7A 3ELFA 5JU6A 4PC8A 4F66A 4TX0A 3VKAA 5C5YA 3GR7A 2OLHA 3A6OA 4RE4A 4GQBA 5LKYA 1E4LA 1R87A 3W27A 4IMFA 4KFNA 4LAKA 5G1MA 3RR4A 4HJWA 1I6NA 4PMXA 3NGJA 3PAOA 3WLQA 4DZHA 3M0IA 3V0TA 1RVKA 1R9XA 3TW9A 5D05A 3AS3A 3KBWA 3ZT6A 2F8QA 2DVTA 1B90A 3B9AA 3K4WA 3W9ZA 4CNOA 3RRAA 3KWSA 4J4OA 1MSSA 2FAPA 3W70A 2CKSA 3VX1A 2BBFA 2PDIA 4JBRA 4JIQA 3FHAA 1T5AA 4TYOA 3PTQA 1EGMA 3C0SA 4PMUA 1JFHA 3CHFA 2XZ7A 1GT8A 2A5HA 4M7TA 4MB4A 2AKZA 4D8ZA 4LQ1A 5FJUA 3ALGA 4DLMA 4YU1A 2GL5A 3AHVA 1HN1A 4PFHA 1X96A 2CWNA 2R9RA 1LORA 3IGUA 2FHBA 3VCCA 2QDHA 4QR6A 2X16A 3AXHA 3T2OA 4KH2A 4BHYA 1QBBA 1DWHM 3CWHA 3PBMA 2WMKA 4K7VA 3DKJA 4FSAA 2WO5A 3ONBA 2J9YA 4JFTA 1FWNA 1MUMA 2XIIA 3CASA 4DH0A 5IHRA 1NMWA 2PU0A 1TV7A 3VDBA 4LX4A 4Q32A 1WCGA 3KOYA 3OGSA 4CU7A 1H1YA 1DIDA 3RIKA 3D47A 2CBVA 1R2SA 3FVDA 2F6XA 2A3CA 5HANA 2ZVIA 3FYPA 3NO5A 1LOQA 5HAOA 3P0XA 4I9MA 4NL1A 3IRDA 3ZWSA 5HPOA 4MUZA 1TE6A 1AZ2A 3BGGA 2OT0A 3GIPA 3SCOA 3C61A 1HXJA 3MZNA 1Z69A 1ME7A 4HNNA 3AICA 4HPGA 1SJDA 2QR6A 1VFSA 3TQPA 2H8XA 1UH3A 3LUTA 3KS5A 2G97A 4KEVA 3MMWA 3IVUA 1HXVA 5D33A 1HP4A 2G96A 4FK9A 3HOJA 2F2KA 4IUGA 2KO7A 4AZ5A 2FTWA 4O0ZA 1XD0A 2JF6A 1XUZA 2Y0FA 2CNCA 5CG7A 1QOPA 3CH0A 5CJ5A 3A13A 1FKTA 3MS8A 2RUCA 1GVOA 3WDJA 3ZT5A 3M64A 7TIMA 4DYJA 3BG9A 4NVTA 1HVXA 1GQJA 1JZ5A 3RNDA 5AB3A 3MO4A 3O06A 1JI1A 1OEPA 1WO2A 4ZFCA 1WDSA 4OTKA 3WQ6A 4IIFA 1IV8A 3GFZA 3IRSA 3G3DA 1MQPA 4LPCA 3U4FA 1SZRA 3WCZA 1W1YA 1OADA 2HE5A 1ADOA 1JZ8A 3WFZA 2NUXA 3BL3A 3HMJG 2XU2A 5L6UA 3KDOA 1J96A 4I5XA 4TTUA 3REQB 2WOQA 1HKMA 1VENA 5HINA 4UNKA 2VEKA 4NT0A 1W32A 3WQOA 4DRKA 3C2RA 3L0NA 1IZCA 1CXFA 2OX4A 4DWSD 1IE7C 1NSGA 4DB7A 2HEJA 1BKHA 2F21A 5AC5A 3JW7A 4DI8A 3TC6A 1VFHA 4MFEA 5DF0A 1EXBA 2NQJA 4CQAA 4R9OA 4N4QA 1IT8A 1HJSA 1LWHA 2PZNA 1T41A 1WZKA 3O5RA 3B0YA 1F3EA 4DJFA 3B8UA 1MW0A 4GHRA 4QSHA 1KCLA 5C9WA 2YW3A 1XG4A 4FS9A 4LC8A 2DZBA 2QEZA 2EPHA 4JIEA 2G3NA 1J6PA 2V69A 3UNTA 4HJFA 1X38A 3LK6A 3SQSA 2DT3A 1LG1A 3IUHA 3L12A 2X09A 1XICA 4TMCA 1XGEA 3R11A 3HPAA 5D38A 3XINA 5BU6A 2ZC8A 4PB4A 2D69A 2Z29A 4F48A 1AMYA 1KXQA 4FLQA 3W76A 5BRQA 4WXYA 3GC4A 5LSMA 3WY1A 4ADTA 1ADDA 4RDYA 2V82A 1TPUA 3QQ1A 1HKIA 3OLGA 4IXXA 1S2TA 1DQXA 1FWEC 3H55A 1KWKA 1O4UA 5CJMA 3SBFA 5DN1A 3GE7A 3TE9A 5CXPA 4QT3A 2W91A 2WANA 2VFFA 1T99A 1SZNA 4P2VA 4FAPA 3V5OA 3MSYA 1JNDA 3TVAA 4A05A 2VCBA 2OU4A 4QISA 1D7JA 4QG9A 4MIMA 3V75A 4B9YA 4E2VA 2V2CA 4HNVA 3N13A 4O1CA 2CW6A 2BY2A 4J3TA 2CLPA 5FAGA 1SMDA 1UH4A 1YE4A 4RLIA 2REQB 4HARA 1V02E 5E6ZA 1NU5A 3VXGA 5DBUA 4F9JA 4ICCX 1JIBA 4AD1A 2DUZA 3L4WA 1IQ8A 5D2YA 3W2KA 4PN2A 4GPNA 4JIHA 3T40A 1XD1A 4BA0A 4AC7C 4JN7A 1QPKA 4H7CA 2J7HA 3O16A 1TUXA 1R2TA 3NEVA 5G4WA 5DMLA 3MCOA 3IKDA 1H63A 2PEVA 2JK2A 4FALA 2HBXA 1TZ9A 3C6CA 1O7AA 3QR0A 2J4GA 1FDZA 1ME8A 2C79A 3SW6A 4C6CA 2D23A 3L5AA 4GI8A 3ZR5A 1JZ3A 2XGBA 3CAKA 3DFHA 1BTCA 3UPMA 3H7VA 1CGUA 5AYXA 4E0CA 4XZMX 4CNPA 1QPNA 1Q4WA 3P14A 3U2EA 4GIYA 2PDBA 4W8AA 2ZWYA 4MMWA 4CD6A 1ICQA 3WLOA 2YCEA 3UR7A 1FA2A 4H01A 3NZPA 4LB4A 5GJPA 1W1B1 1YXYA 1ADSA 4J3UA 1VYRA 1VRXA 2IMRA 3N4EA 2VRQA 1DIKA 1GOWA 1TVPA 2WMIA 4IFRA 5KSWA 5FACA 3V18A 4NZJA 4K7YA 2INFA 3P7YA 1IXPA 1H0IA 3IV3A 3SGZA 2IQDA 1IGWA 2EPNA 3VINA 2DT0A 4JEQA 5HJXA 3A4AA 5TAOA 2WVTA 3FK4A 3BPWA 3UG3A 4HMNA 3S1XA 5AHEA 2X0YA 1JZ2A 5B7ZA 1VPYA 4QS6A 2H8ZA 4HNLA 4D9PA 2Z2AA 1KRCC 4LAYA 4H6KA 3F4NA 2WXDM 3P2VA 1QRQA 4D1JA 5AHIA 1FWIC 3R5EA 3VDGA 1XI3A 5D03A 4UTIA 3GNDA 3MWCA 2W27A 1R30A 1G6CA 1EB3A 1RQHA 4BCEA 3S9ZA 1OIMA 4R34A 3QV6A 4WR3A 3I3EA 3W7QA 5ENLA 1I2NA 3EDKA 1I0DA 3FN9A 3WLNA 4EPEC 3W75A 3AHXA 1RD6A 2YBVA 3P80A 4H9YA 1XHGA 2A3AA 3SUUA 4A22A 3LPGA 4IQJA 2WZHA 5DMMA 3A4WA 4MADA 2I17A 4HCHA 3W22A 3CQ0A 2HXTA 3AHTA 2WZTA 4NZFA 1E6NA 2CFFA 3D5HA 1WDQA 3S4TA 3U0HA 5J6EA 3KTSA 4N7QA 5I6SA 4TU1A 5FJPA 1GTHA 4R7WA 4OUEA 1L6YA 3EPMA 3VZXA 1US0A 4YYCA 5EMYA 2PV2A 4PTMA 2ZCGA 1PV8A 3W25A 1NFGA 4DXXA 2NUYA 2AAMA 4S23A 4WD0A 2QVHA 5I3JA 3U7BA 3FSUA 3URAA 1UQYA 5H8UA 2RSEA 3NQDA 2GJLA 1V7YA 4AZHA 1P48A 2PDYA 2V63A 4ODPA 1M65A 3TN3A 3FNDA 4ADSA 3MMDA 3HG4A 2E9MA 3MHUA 4AFYA 2NLIA 4W7WA 3QY7A 5HWNA 2XSXA 3TSBA 3GXTA 1VGAA 1JCHB 2ZUTA 4S3GA 4QLJA 2ABAA 1GOQA 3II1A 3NL3A 3TA6A 4WY0A 4U28A 4CQ8A 2IUZA 1KNWA 1QJWA 1A0DA 3ORWA 4A3YA 3EKZA 3KVJA 2GDUA 3NZQA 2YJQA 4RV8A 3SI9A 5E0FA 3RLHA 4B2DA 1ZCOA 1DE5A 1VB9A 1H7RA 2DPEA 3NAVA 2ZR5A 3FSTA 3JS3A 4W5ZA 2ACSA 4DO7A 4XQ6A 2ZX6A 3HGJA 2BASA 1Q6UA 2RDTA 1T6MA 1FWHC 4ZB2A 4Z17A 1U2YA 2V5BA 4HYRA 4H2HA 2F2HA 3EOOA 4DUOA 4ZO7A 4YNGA 2DFAA 4W7UA 4ZQMA 1UA3A 4ODMA 3USBA 1KXTA 3LMYA 5D2VA 1Q6FA 1PL9A 2ZYFA 5A95A 2DUXA 1GKPA 2QHAA 2VI0A 3G1RA 4J5NA 3O5DA 1H7PA 4A21A 1MFVA 5DT5A 1G94A 3BOFA 2C16A 3AI0A 1ZCCA 3AIBA 4KEMA 1UZ1A 3JZUA 1GHSA 2JF7A 3M41A 1HF6A 1OCBA 3KCOA 4GKLA 2ZTJA 3RM4A 4Z1BA 2ZQTA 1DJIA 1MNZA 3BSHA 2QPXA 4NKCA 4XTIA 4HMDA 9RUBA 1E4IA 3UXDA 3ZVHA 3UI4A 1EJRC 3CL6A 4G7EA 2AQWA 1FHUA 4N4PA 4LANA 1ALDA 3MUXA 5FAJA 4EPDC 4H9ZA 2KE0A 5CEWA 4DLFA 2VYOA 4WSHA 3TCEA 4ZO8A 1M68A 1VEOA 3W85A 3JR2A 4W5UA 3W7GA 5HQEA 1A5CA 2VGGA 5CSUA 3VTRA 1DWJM 1XGZA 1YW1A 1CEOA 1KFWA 3PZQA 3BTNA 1R3WA 4GISA 2HV5A 4GUIA 1A47A 4JNZA 3QBUA 3VD5A 3NPVA 3OOBA 1EHAA 3W81A 1FWDC 4WIWA 1BSLA 1JUEA 2FVKA 1JUBA 2F23A 1VFFA 4J28A 1DQUA 2GOUA 1UKTA 4YS1A 1YPXA 1PX4A 2H9AA 3NZRA 3PB2A 4K1GA 2XPKA 3UYCA 2G4FA 1VFUA 3P62A 5GVJA 3TYCA 3ABRA 1XFCA 1F4AA 2V3EA 1L8PA 2A7NA 1G67A 3VIJA 2RDWA 4M80A 1B3OA 4RUBA 1ZBWA 2OZ8A 4CNNA 4KERA 4AF0A 4E6MA 3WD1A 4GY7A 2PRMA 4LV4A 3SR7A 3VOGA 3MTWA 4ODRA 3HQ1A 4U5IA 4F3HA 4EAYA 5ABTA 5ABEA 3GBEA 4WJ8A 2DIJA 1GVEA 2Y8KA 4IP7A 4QLKA 4JTQA 2WCSA 1BYAA 2HXUA 5C55A 1P1MA 3N2OA 3H9RB 2J62A 4HNUA 2PRHA 4TQTA 2A79A 4MJ4A 1PWMA 5D32A 4LNYA 3AIWA 4D6FA 4U10A 4XIMA 3L2LA 3FJNA 3WN6A 2Y2WA 1UA7A 2NT0A 1RBOB 1W2VA 1R86A 3WF1A 1VHNA 3CU2A 4BQ3A 1QHZA 1E55A 3OA5A 2YA0A 4PBFA 5CZSA 4RK8A 2HNEA 4RNFA 4PSPA 2FHCA 1UUMA 4LOCA 1MQQA 1ZU8A 3W1PA 2QYGA 4JIPA 2Y5JA 1VRDA 3W7EA 5D37A 2E3ZA 4BWLA 4ACZA 1TPFA 4H6EA 4MNJA 1X7FA 1A3XA 4S3KA 1ZJHA 1KGXA 1ZP4A 1W9BM 2AKMA 4IX0A 3OJGA 2W92A 5DMYA 5GJNA 3TYUA 5MKGA 1WZAA 2XH7A 1JUKA 3W26A 5A2BA 3ANUA 5F4WA 4JTAA 2VX6A 3M0HA 4LS2A 5I07A 2A6NA 3ZOAA 3BLPX 4GYPC 2K8IA 3F5KA 3TW7A 2DG4A 4ZS6A 1T96A 4IIGA 4M6PA 4ROPA 4HPNA 4ZOAA 5I2UA 5I09A 7REQA 2V5KA 2FDMA 3PN8A 1YQ2A 1I60A 3N12A 1YRRA 3N6QA 1FWBC 1HKVA 2BZNA 4Y9OA 2PODA 2X1TA 3LBCA 4N19A 2E6DA 5F2GA 1XLGA 1JQXA 3N6HA 5MF5A 2JEPA 2OKOA 1JI2A 3MA8A 2HWGA 5GPRA 2E7FA 2ZDSA 1QHPA 2W61A 1TJ2A 3VGFA 4N6FA 2C15A 4H00A 1W1A1 2XM2A 4Z08A 3E2SA 5BOEA 3PWAA 3RF9A 3WYZA 3FIGA 2WSKA 4Q4MA 2PTYA 3MVTA 4I6VA 5TNVA 4XBSA 4FXRA 1VLWA 4DBEA 5J04A 1J0ZA 3WK0A 5C70A 4GGQA 3LOTA 3M0VA 4EWJA 2Y88A 1PCWA 3EMQA 3TP4A 1MNSA 1V3LA 3FGCB 4CQCA 2PC8A 2OR2A 2VELA 5BROA 3GB6A 2QV5A 3TKFA 3ZJ6A 3Q94A 4TTGA 2X8RA 5D30A 1UR0A 3P5ZA 4QDMA 2DZAA 1MUCA 3ITXA 1V8EA 3JRKA 1XSJA 1HJXA 4RNHA 1RBAA 3FKKA 5JBDA 4A3UA 6XIMA 3TDBA 4QNEA 2VRKA 4EPBC 2QIIA 4NZ1A 1E70M 3GR4A 4ERGA 5FKYA 4PTNA 2VTFA 1PJ9A 3R89A 2Q5AA 2QCNA 2ZX5A 3L68A 4G8TA 1H0GA 3M5VA 2ZRXA 1UWAA 7A3HA 2EPKX 4FNQA 4RZ4A 4QGCA 1H4PA 3PZUA 5DIVA 4DO4A 4HA3A 5D9NA 3SN4A 3VKJA 1J0KA 3NGFA 3C2EA 3CTLA 4JKLA 4ODKA 3OBEA 1B4EA 3QSTA 4JYSA 2R8WA 3OLIA 4GWEA 4EXBA 1TV3A 4PR4A 3TR2A 4GE8A 3RILA 4I8DA 2EF9A 6REQB 1FH7A 5K2ZA 2TMDA 4EPKA 1FY6A 3SRHA 2QXWA 1QWGA 2ZUUA 5LNUA 2PDLA 3RX2A 3DC8A 4N42A 2PDXA 1AD4A 3TWBA 4KPLA 4ZSUA 1SO5A 4H2CA 2I7GA 3FDKA 3K4AA 3R43A 5LA0A 2J79A 5E5CA 3FVMA 4JTLA 5BXTA 5EA9A 3N3TA 3QZ6A 3V7PA 4BJHA 4L4MA 5LIYX 1XIDA 1X8CA 3TTYA 4U5KA 1YX1A 3L0GA 3T0TA 4TX6A 1EQ3A 2BFGA 2ZUWA 3IGHX 1ONXA 3EA3A 4IIHA 2XGIA 5I3FA 2WSQA 3VILA 4DJEA 3WLLA 2VDIA 2OWCA 3Q58A 1M7XA 3NQCA 1J0JA 4DJDA 2YB1A 3QV7A 3H70A 1O5XA 1OZQA 1X8FA 1LROA 2NSOA 1TA3B 4PTWA 1RLDA 1EJVC 3NQ8A 4GBDA 4N02A 3TNOA 2EPMX 4EACA 3B7XA 1UOKA 1H50A 1TWDA 1XBZA 3WDPP 1ISXA 4D6GA 3UWUA 1D7KA 4DI9A 3VC6A 1J01A 5HXMA 1AODA 4TR9A 1OFQA 3UW6A 3WBWA 4AVNA 3WQGA 1MZRA 1Q2RA 4S3EA 4JFMA 1W5MA 2ZE3A 4DXKA 3KZPA 1LL7A 1N8IA 2X7VA 3QXBA 4E4UA 4DWSB 2NV1A 4NRSA 3WNLA 4AG0A 4XO6A 3RLGA 1C29A 3TZNA 2EJAA 3TQ0A 2I57A 3SY1A 3AYTA 3O9NA 5JBEA 4L72B 4ZFMA 3W82A 3GZ3A 4HP5A 3AYRA 4JICA 4AH7A 3C86A 1U5HA 4NAFB 3NO1A 3QYSA 3WH9A 1VLIA 4O1BA 1KKRA 4GIEA 1R3VA 4PE8A 3VA8A 4EKJA 1A5NC 3KW3A 1B3YA 3EIPA 2GJXB 4AYSA 3CJPA 1FDJA 1LRNA 2RHGA 1OQFA 2OELA 4ZODA 3EWDA 1N8FA 2X1UA 1AL8A 3LCXA 2E09A 1PZ2A 5HMFA 2VUYA 3WDIA 4Q33A 3WQCA 1VCGA 2Y7EA 1CECA 4E5TA 3WD3A 5FJTA 1UKSA 4AIBA 1US2A 1JAKA 4GZ7A 1ZENA 2UY2A 3NO3A 4ZQNA 1SJCA 4UQEA 1M5YA 4DIAA 5E70A 1UMLA 4JHZA 1M03A 4XO7A 1PKNA 3F5JA 3QTGA 4GNKB 1CXLA 2KAUC 1ESWA 3SUTA 3IJQA 1I2OA 1OF6A 1R3SA 1FKGA 3L5MA 3CZGA 2Z00A 2XIBA 1AVAA 3WIJA 4L9YA 4F79A 1MXGA 3VIFA 3UU0A 5HNRA 3GTYX 4A2RA 3GU0A 1J0IA 4B5XA 3NYDA 4JD4A 3T8QA 3ZSTA 2XH4A 3WF4A 1UKOA 3W7CA 4C6NA 2Y7FA 3P61A 4AEEA 2KR7A 1EQCA 5BXPA 3TU9A 3L21A 4FOUA 3FOKA 4PL1A 2TPSA 2PBCA 3JYJA 2XIMA 3NTPA 1XDMA 2ZA2A 1OINA 4LVBA 5G2WA 5HK4A 3OOQA 1QOXA 4Q6JA 2ZBTA 1J11A 4YCOA 4IICA 3CH9A 1TJ0A 4UFMA 2Y7GA 4CD5A 2V38A 3BARA 4ZVJA 4Z2IA 1C92A 4JTRA 4QQUA 2XFYA 1X6UA 2WPGA 2XYLA 1PYMA 1KLYA 1R6WA 4JTDA 3EB3A 3W1UA 3TCSA 1ZY9A 4I5UA 2W4XA 3ANYA 3VAVA 3M9YA 2X05A 3VGDA 4OU1A 2GGHA 3N4FA 1D7IA 2H3BA 4ZMGA 1FWRA 1P7TB 4Q6XA 3BG3A 3LB0A 2OMAA 1XPYA 4PUMA 3IJLA 1GKQA 4YN5A 4GYJA 4I90A 3S1GA 1ELSA 2HPIA 3P8JA 2QF8A 3I10A 2B4GA 1J93A 3ZYZA 5XINA 1QI4A 5G5IA 3NSXA 3TN6A 1RD5A 3WMBA 1XWYA 1GJPA 1FHLA 4GIVA 3PBVA 3M6DA 1JCTA 5HNUA 3K1GA 1YLVA 3DGBA 3JVAA 2YL6A 2RURA 1OT1A 3GW0A 2CLHA 4MKNA 2OVLA 1NIUA 3L67A 4QCEA 2YDRA 4GQRA 3WEMA 3GZAA 1NWUA 3G6MA 3QHNA 2PP0A 4RDVA 1XR2A 1CZ1A 4ML9A 8TIMA 4BK9A 2XVPA 2FZBA 4HK7A 3RITA 4HU4A 1BEUA 7CGTA 1R2RA 4NIRA 2WWCA 1GCYA 4UMCA 5I06A 5HBFA 5JMUA 5I3IA 4Z2KA 3LCFA 4OOZA 1DWFM 2PWGA 3WQWA 3PZ9A 3POCA 4LAWA 4Z1DA 1NM9A 1M01A 1JQVA 3O15A 1WPCA 3H6OA 3E0WA 3R8HA 4DN1A 1KC7A 5A6KA 3GDLA 2VD8A 1KT0A 1O6IA 4H41A 3RO8A 2D0GA 2CXEA 2W66A 1WE5A 5TQLA 5JH1A 4AVOA 5H91A 5DEZA 3E0LA 4RNIA 4HOXA 1XC4A 4O19A 1ZBCA 1ZPTA 3LHWA 2ICSA 1QNVA 1T7LA 1ICPA 1VAHA 4G7FA 2CC0A 5DCBA 1Q6OA 2FLIA 1FP8A 3CV2A 2QULA 2WSPA 1PPIA 1DEDA 1Y5VA 5H8MA 2WK2A 2AL2B 4QBXA 1RHCA 1K9FA 2GYIA 4HSNA 1TJ1A 1MDRA 3EBVA 4IWWA 2WHKA 2ATSA 3DFTA 3VIGA 4OKDA 4NX5A 3N25A 2R1LA 4ASTA 5H8PA 1TR9A 1MO0A 4BF5A 2PWEA 3SGUA 3QR1A 3CM4A 3GVVA 4DF1A 1Q6HA 4QP0A 2VZTA 2OT1A 2E28A 3BAYA 4EE9A 5BXSA 4NZCA 4NYYA 1XX1A 1CLKA 4DPPA 2YDSA 1ZK6A 4C6OA 3LSBA 1XBXA 4J3VA 4E8GA 3VNZA 4WK9A 3EWCA 3KCLA 1UWQA 4EVZA 2Q8LA 3IS4A 1XBYA 3EX6A 4XKYA 3GDTA 4PMZA 5LNRA 3DOPA 3C0QA 3B97A 3TQVA 3D6NA 3NXFA 1QK0A 4GNVA 4D8LA 4FB7A 1B3XA 1EYEA 3M1ZA 4OFCA 3VNLA 1DP0A 2V81A 4UFIA 1GUVA 2DIKA 2GSJA 2E8ZA 4DRNA 1XYAA 1JCNA 2A3EA 4UIOA 3T09A 3UG5A 3BLLA 3WDHA 1DPMA 4RCXA 4GH1A 3T0BA 8XIMA 3BAIA 1X1ZA 5EMMA 4IPJA 1UH2A 2N87A 4L5ZA 3VFLA 4UXDA 2WJEA 2GK1B 2NLYA 1BVWA 2OEKA 3MMTA 2XIQA 2AMGA 2NXGA 1GQKA 2DW6A 1LQ0A 4Q8QA 4XZLX 3B8WA 3TNBA 1DHPA 2BGQA 4BFAA 3LI0A 4GVGA 1A53A 4I8YA 4DBUA 4HA4A 1ZFJA 1DL3A 1ROUA 4Z1CA 4GD0A 4YXGA 1W3HA 4FAMA 4PULA 3NQAA 2POZA 4XKMA 3OB8A 2QMJA 4XAYA 2KGJA 3BQ5A 3VO0A 4MYXA 2BHUA 1WQ5A 4KCUA 3BW4A 6ALDA 2J27A 3LEPA 5DBTA 2XP9A 4ZOCA 5EGRA 4DZAA 2QCCA 2R1MA 3UZZA 4NNRA 3Q65A 2VC6A 1EPXA 4HHMA 3TIMA 1UD5A 1WDDA 1K9DA 3U7VA 5FF2A 4QDWA 4IOTA 1BXBA 3FKRA 2NQHA 1LOSA 3VGHA 4HSOA 2XP6A 1EJWC 1F2JA 2P1FA 2XVNA 3E38A 3AQUA 5FJRA 2ZC1A 1QI2A 2XIJA 3SAZA 3A21A 5CC6A 4PMJA 2NT1A 1IEWA 2AAAA 3VGGA 4FOKA 1ZJBA 1D6OA 2CYGA 1BF6A 2J9XA 1OD8A 2O7SA 3KZSA 2JIEA 1DTUA 3E1F1 2VHLA 5G4EA 4WVXA 3LNMA 3GXIA 4D2JA 3UT0A 4LGXA 4Z2HA 1H7OA 3A12A 1ICSA 4W4QA 4MNLA 2VZUA 3WZ0E 3PPHA 2VR5A 2NX3A 4NJHA 3ZLHA 1VEMA 2VGIA 1PX3A 1XLMA 1MRQA 4M5PA 1B57A 4XZBA 1M9HA 1AD1A 2YIHA 4UQAA 3VU2A 4LUTB 2FVLA 2FH6A 3ATYA 2IW0A 2C8NA 3R2GA 5DY2A 1PZ0A 3V36A 2BWGA 3LU2A 3EWZA 4AZ6A 4QE4A 2FMNA 3CZEA 1QT1A 1JL8A 1UP0A 3QM3A 4Y8FA 5I23A 4LYRA 4PBEA 4F40A 2ZRUA 2V9DA 1M1BA 3W1XA 3W01A 2Z1BA 2FIQA 3W7IA 3LTYA 3EDJA 2P53A 3W53A 3PFRA 1BTMA 2P5NA 4POCA 2ZQSA 3EDFA 4CD8A 1J4IA 1MZHA 4FNTA 4GC4A 3IJIA 3OG2A 4PODA 4PB5A 3GRIA 1ECQA 4LALA 4JTKA 5EYWA 4X2RA 4NJJA 2WB5A 3IPWA 3TXVA 3RMEA 2MF9A 5K3VA 1TUFA 3N04A 1TFVA 1TWZA 1XPGA 3VM7A 1LBFA 4W8BA 1RCQA 4QDPA 1YTKA 3K1DA 1YTDA 1E6PA 4E38A 4GY1A 1CGVA 2VFIA 1VBHA 1EKOA 2AOSA 1Z3NA 2BOFX 4Z2JA 1PBGA 1K8ZA 5D9PA 1PVNA 1UZ4A 1MW2A 3RCNA 4QJ4B 4QT2A 2QZRA 1UWRA 1W9XA 2YFNA 3NFUA 1D7HA 3NQEA 3PTMA 3UCCA 4F0KA 2J7CA 3BZGA 2ZOXA 2GJRA 4BR1A 2H3DA 3RLVA 4LY4A 1G01A 1YHTA 3RX3A 3AISA 2CLKA 1W1VA 5I02A 3KDNA 1F6KA 1YIXA 4BZYA 3B0VC 1H5VA 5HNTA 1AMKA 2Y6ZA 1VFOA 3MUAA 4IL0A 4I5RA 1BYBA 5G2HA 2P3EA 3L4ZA 3GQYA 5I03A 1GWJA 1MUWA 2OZ0A 4PB3A 5LNWA 4DZ5A 1E4MM 2GDVA 1L9WA 3B9OA 2INEA 4MY9A 4YTSA 1Y5XA 2WMHA 1Q63A 1R9HA 4LJ3A 5XIMA 1RQEA 2D22A 3SIMA 1E0XA 5EKYA 4OHQA 3TN5A 1QBAA 1EWEA 4X22A 1NH6A 2Q6ZA 1TWIA 2VEIA 2XP3A 3N1AA 3HPFA 4UTLA 3IVSA 2F4EA 3WJZA 3UWWA 1JD7A 1A4MA 5H1WA 6A3HA 2LJ4A 1OYCA 3GSMA 3QV8A 2O9TA 4MY1A 4DRMA 3CIVA 3G6LA 3KWXA 3EB2A 2XVLA 3PZNA 2OO0A 3BWWA 2GWNA 4O57A 1XSKA 2G8ZA 3LRKA 3LV5A 5AOUA 2IPFA 1M7OA 2WYSA 2ALDA 2X40A 1HG3A 1DJXA 1U5JA 3UP8A 3TMQA 3L23A 3GIYA 5FJOA 1KFJA 4C7GA 3F03K 4FLRA 3W2MA 2YXXA 3VMPA 4F8XA 1PEZA 3EAUA 4O11A 3C0JA 1IZKA 5J5DA 4LNCA 3DIPA 3SEPA 2NQ5A 1XRSA 3G1VA 3UD6A 4O4VA 1A3HA 2WW5A 3NI6A 5M03A 3PPFA 3KOXA 4L56A 4J1OA 3W23A 3ABOA 3DFPA 4JTUA 1UKQA 4AHQA 4I7UA 1LLZA 4DUVA 4LVFA 2JQXA 1E5JA 1V3JA 3VOCA 2ZIDA 4UFHA 3BMVA 5HW7A 3DENA 4QLLA 4LBUA 4MLJA 4UNLA 3WBYA 4R7OA 2XP8A 1P0BA 1GPFA 2EBNA 3GG1A 3UWEA 1FD9A 4IGSA 1E44A 4NAFA 2E8YA 2FKPA 1UR9A 1B9ZA 3VNDA 2J25A 1H2JA 4NNAA 3U48A 1TV2A 3NNTA 3RMJA 1GOXA 1EA9C 3W72A 2NW0A 4HOZA 1UWTA 3OZMA 4DJFC 4M51A 1SO6A 2RKXA 1IGSA 4I7VA 3CHCA 1K7XA 3N2CA 4MGGA 3TYEA 2GVEA 4MKSA 3LHYA 3S47A 4PFMA 5JIWA 3AS1A 2WKLA 1FKJA 4HA0A 2NVAA 1NWSA 2XISA 4HZMA 3ZMRA 4G2PA 1E6SM 1RK5A 3RFWA 5AC7A 4JDBA 3WEOA 3VZZA 3HA1A 2PTWA 3W28A 4GINA 4DZ2A 2PUZA 1TX0A 1H5YA 3OA3A 3BMBA 8RUCA 1AW1A 1PS9A 4ZO6A 2YLAA 2FMOA 5CC3A 4UFKA 4UR9A 1LCOA 4MHBA 4LU0A 4LUYA 1MEHA 1XIEA 1G9HA 3BURA 1DJYA 2OEJA 4QJ5B 4JX4A 2PLKA 1UJQA 2X0SA 1KT1A 4MFDA 3F2DA 4DM2A 3DYMA 4XZWA 1I75A 4YVXA 4NAEB 2BVDA 3N2BA 2O4MA 5FA5A 4DELA 1PKMA 1OGGA 1VD6A 2AWGA 4IUOA 3WSUA 4OWGA 3LG3A 4KQZA 1BD0A 3EDEA 4R33A 4JS3A 5LGZA 1SYTA 1I8JA 2D9FA 2YCJA 1K3UA 3DDMA 5CH9A 1A50A 4DRSA 5M17A 1PDZA 1ROTA 3Q45A 1SZEA 3S5YA 4KGJA 3M0MA 3GYCA 5AHNA 2DV0A 5I79A 3GG7A 5DELA 3IEBA 5CGQA 3GKAA 1QASA 4Y9PA 1EGZA 2VDHA 5A2AA 3FW6A 2IKHA 3P3BA 2EO7A 3LSCA 4LEFA 3M0JA 2BGSA 4ZQOA 5AVNA 1XKYA 3W7RA 4JFKA 4NG3A 1Q5MA 4HOWA 3K8LA 4KEZA 3NYZA 1R46A 4FZIA 5HUPA 3C8NA 4B16A 5HULA 1EIXA 3IUIA 2Z1VA 1G5AA 5FJIA 4J40A 2ZZ3A 4MF4A 3WUEA 3ITGA 1LLOA 4M0XA 2PPPA 2E67A 1P6CA 5KETA 4XD4A 1VIWA 3CZLA 3N2XA 3BH4A 2D2HA 2Y70A 5HUAA 3VZYA 2HDJA 1UG6A 3KS6A 1JGMA 4L1XA 3PULA 3T4WA 3OHIA 4TV6A 5LA1A 3WMCA 4K36A 4JL1A 3S5OA