4WJXA

Crystal structure of human chitotriosidase-1 catalytic domain at 1.0 a resolution
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
369
structure length
369
Chain Sequence
b'AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELSLVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitotriosidase-1
publication title New insights into the enzymatic mechanism of human chitotriosidase (CHIT1) catalytic domain by atomic resolution X-ray diffraction and hybrid QM/MM
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 137
structure length 369
sequence length 369
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4wjxA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4wjxA01
1CXHA 4DWSC 2IXVA 3BCFA 4UNIA 4AIEA 4DUXA 1KGUA 3QR3A 4WJXA 2A3BA 2FH8A 3AMGA 3PZ9A 3ZOAA 1UR4A 1D2KA 1C8QA 3VIFA 3T2PA 1V08A 4W8BA 3G6MA 3SUUA 3K4AA 4J3VA 3K8MA 3EDFA 4Y7EA 3PZMA 2VRKA 2XG9A 1HT6A 3N12A 4FLQA 1BTCA 1C90A 2WHJA 3WDPP 1K9FA 3ARWA 1V6UA 3CGTA 4AD4A 4Z2LA 3WELA 1C91A 2WNWA 5HDRA 3KEHA 1GORA 4JL1A 5CGTA 5E70A 3NJ3A 2XVKA 1XV8A 2JF6A 4Q7NA 3IJ7A 1E6SM 5D9MA 3VIJA 1MVYA 2ZUTA 4TVCA 1WZLA 1U33A 4HZ7A 2CBUA 2PWGA 3SCUA 1PX8A 2BHZA 3M6DA 2JFEX 1JXKA 1J12A 3VDHA 3ARSA 1PPIA 4GZEA 2AMGA 5FL1A 5ABGA 3UESA 3APGA 1SFSA 2XHYA 2G3NA 1WDQA 1H0GA 1U2YA 3BAJA 3AS2A 3KL3A 3GNPA 1UKPA 1LLOA 4D6EA 4F9DA 3AMDA 2GJRA 1JNDA 1ZB5A 1GW1A 3VM7A 4AMCA 2GJXB 5FD0A 1W1VA 2WBKA 5A6MA 2EPLX 1UR1A 1RPKA 5LA2A 1M01A 5HBFA 4CCDA 1QI3A 4PYSA 1DP0A 4QLKA 3VNZA 3K8KA 3F4VA 2WHMA 5CPSA 3UG5A 4GKLA 2DIJA 2V3EA 5EFDA 1C8XA 2ZX5A 4WF7A 1B3YA 1KR0A 1UG6A 5BXRA 1WP6A 2HISA 1E6NA 4CN1A 1H41A 3AIEA 3ZSTA 5IXEA 3SCVA 3W29A 3RIKA 3ZQ9A 4AD0A 3ARPA 4J3SA 3BH4A 2XFRA 3SCSA 1UD8A 4MJ4A 1CXFA 3AZSA 4CUCA 3VD7A 2WSPA 3MO4A 1XSKA 4W8AA 4N42A 4CCCA 2DH3A 1MQRA 4DUVA 1BGAA 1W1TA 3LMYA 1G1YA 3BC9A 1E71M 4GZJA 1CPUA 2NT1A 2IXUA 3W25A 3ZMRA 4AZ5A 4CD4A 1E4NA 1PX3A 4DWSB 2VC9A 1GQIA 1OB0A 1MFVA 3NYDA 2G8ZA 1VFOA 2CESA 1GVYA 5CSYA 4UQ9A 1ISVA 1B3VA 1ISZA 3MS8A 1MQQA 1QNPA 3WF0A 4AD2A 4M81A 3OGSA 3BLPX 2PBGA 4NSBA 1DWGM 3A4AA 2VX5A 3AQUA 1OSEA 3CZLA 2BFGA 4ATLA 1NP2A 2BHUA 1OD0A 1QHZA 2ZWZA 3AZRA 3VX0A 5I79A 3ZT6A 2PWFA 1XD1A 1BGGA 2DDXA 5ABFB 5A6BA 4XX6A 1WZAA 2YL9A 3THCA 1QI2A 4BQ2A 2C8NA 3PBGA 1HN1A 1TCMA 4Z2KA 4W87A 4ZENA 3EYPA 4XB3A 4UQEA 3AMKA 3ZJ8A 3NSNA 2OYMA 2WVVB 2W92A 2A3HA 2D0FA 4HOXA 4W7UA 2WW5A 3B9EA 4HMCA 5AY7A 4AW7A 1XCXA 4H7VA 5I23A 1UKQA 3RM8A 2FDMA 1JZ2A 3CUFA 1E0WA 2CHNA 4ZE5A 5BYWA 1IT0A 2NSXA 3UR8A 2WMHA 4JL2A 4XZWA 1JFHA 4PSPA 3AIWA 4JHOA 3CHCA 3WF2A 3ZSSA 1GQJA 2BV9A 5CPTA 3D3AA 2YIHA 1ISXA 1W3JA 2OSXA 4JFWA 2FHBA 4M29A 1E3XA 1XH1A 1XD0A 4UCFA 1GHRA 2DSWA 1J0ZA 1E70M 4ACYA 2WWCA 4PMOA 4C7FA 4CU6A 4XUYA 3PZNA 1HVQA 3PTQA 1KWKA 2NT0A 4BQ5A 1EO7A 4JZ5A 1E6RA 1CWYA 1FP9A 4F79A 2IUZA 4MNMA 3MMWA 1CGYA 1DHKA 2D2OA 5DT5A 1R7AA 1ZL1A 2XJ7A 4HTYA 4WSKA 4AYSA 3I3DA 5DMYA 4F8XA 3WQ8A 1ZBKA 3CHFA 3CZ8A 2PWDA 1V02E 1MQPA 4HMEA 1E1FA 4AD5A 3BGAA 1H11A 1V0LA 1BYCA 2VOTA 3ZIZA 3N1AA 3AJ7A 5F7UA 3EMZA 3DHPA 1HVXA 3B9DA 1QHOA 1CLXA 2BVDA 3S6TA 3UG4A 5TD4A 2E40A 4F66A 1EOMA 2VR4A 3BAYA 2Y2WA 3GDBA 4D6CA 5A8NA 1YQ2A 1KBKA 4JCMA 1OT1A 3VO0A 1E15A 1JYXA 4KRUA 1QW8A 1KXHA 1XCWA 3K8LA 1AQHA 4QFUA 5BRPA 1JZ5A 2YDSA 2X8RA 4QCEA 3T0AA 5D9NA 1DWAM 4ATDA 3MMUA 1TA3A 2QHAA 2D0GA 1UKTA 5I3DA 1CECA 1TR1A 2VZTA 6TAAA 3PZVA 4W89A 3WNPA 1W9BM 3VGDA 3AXXA 2ZIDA 3BCDA 3CO4A 1JXJA 1HKKA 4AISA 5KZ6A 4QDMA 3BAXA 3ARYA 1OIMA 2WSKA 3E1F1 1HIZA 3GYCA 2VRQA 2F61A 1UH3A 4PUEA 2OYLA 3WMCA 3KE0A 3PHAA 1MYRA 3UEQA 4WKFA 2DT1A 4UOQA 4IM4A 7A3HA 2BXZA 2BVYA 3DHUA 1BQCA 2Y8VA 5IFPA 2D3NA 1J0YA 3WDIA 4RE2A 1BG4A 5CLTA 3CUJA 3WH6A 3GZAA 4W86A 2DGAA 4U3CA 4ZXLA 2TAAA 2WCSA 5M3WA 3WBAA 2CETA 1CGUA 1H1NA 4HA4A 2WC7A 4IISA 4E4PA 2GSJA 3T0BA 2JEQA 3AXHA 1KQYA 3K46A 2V3FA 1BVNP 1V3LA 3VGGA 2D23A 4UQCA 2QF8A 2DSZA 6CGTA 4HOZA 1DEDA 3NIYA 3ZJ7A 4ATWA 4FLRA 1JZ4A 4TX8A 3MUAA 2OLHA 2O92A 4L4OA 2EJ1A 2X0YA 1NOFA 3OZPA 1KGXA 4FF5A 4AIOA 1C92A 2GVYA 2E9LA 5M5DA 1UKOA 3DECA 4LX4A 4OOUA 4BA0A 4KWUA 4J27A 4C7GA 2MANA 1GPFA 3WUGA 3EBVA 4TX6A 3M7SA 3GTNA 4GO9A 4D6IA 2Q8XA 1TZ7A 4BF7A 4D6FA 1V6YA 3AMCA 3OLGA 1JDCA 2J77A 4PMXA 4UFHA 5D8WA 3AIBA 3WEMA 1WZKA 1E72M 4AZIA 4UR9A 1L8NA 1QI0A 5BXTA 1XC6A 4U5KA 5D8ZA 1UD5A 2VVNA 1UOKA 3PZQA 1UHVA 2O9PA 3M46A 4BQ4A 1UD6A 5BROA 1TFVA 4H41A 1UQZA 1VB9A 1UWUA 5BRQA 1E6ZA 1AVAA 2XVGA 5A6KA 5E6YA 3EDDA 1JL8A 2UWFA 1AMYA 4H8VA 2C0HA 4YHEA 2GDVA 4EK7A 1H2JA 5DF0A 5CG0A 4H8HA 3N15A 1LWHA 3NDZA 3N04A 3NDYA 4DWSD 1UZ4A 5E6ZA 4WKHA 3SCWA 2EPMX 3PZTA 3TOPA 3TA9A 3K1DA 5IHRA 3DYPA 3OGRA 1CXIA 2CKRA 3QHOA 1JZ7A 3TP4A 2C7FA 4OZOA 4Z2HA 3ARVA 1HL9A 2CERA 3AS1A 3GH7A 4HPHA 4CCEA 1RH9A 4AWEA 1WDSA 3WNLA 4P7NA 1GJWA 4R27A 2VJXA 5E0CA 3T0DA 4RE3A 3WUEA 4MDPA 3FAXA 3EDJA 3U7BA 1UUQA 1H3GA 4WIWA 3RILA 2BY0A 3FHAA 2YKKA 2WB5A 3WFZA 2O9TA 3VX1A 5LA0A 3WNKA 1RP9A 3BAKA 1C7SA 3RO8A 2W63A 3WDJA 4ACZA 3FN9A 2EPOA 4KRTA 2FGZA 2QMJA 3ARTA 4CU7A 5CLWA 1M53A 1PZ3A 4UFJA 1L0PA 4IPNB 2WK2A 3WL1A 4WKAA 2ZXDA 4JKKA 2YL8A 3QHMA 1J0JA 4GI6A 1M7XA 3L4XA 3A3HA 1FH8A 1NH6A 3LPPA 1E4IA 1VENA 2J74A 3BSGA 5D9OA 3WY1A 4PTXA 3WEZA 1LJYA 3PZUA 4TVDA 1UWSA 4GI9A 5EB8A 1R7OA 2XPKA 1GOQA 2WMIB 3DYOA 1QHPA 3L4UA 3VD9A 4QLLA 2VVSA 4HZ8A 5EFFA 5I24A 3FHQA 4AZ7A 1FP8A 1OINA 4AEEA 4AZ6A 3J7HA 1KQZA 3RDKA 3IJ9A 3SUWA 5GPRA 1K9TA 2ZUVA 1OD8A 3ARUA 2DEPA 3II1A 1JYNA 4W88A 1UH2A 1BYDA 4UQBA 1V02A 2DT3A 1GVIA 3IJ8A 4CU8A 3AIVA 3WMSA 3VMNA 5C71A 1UZ1A 2GK1B 3VIIA 1ZJAA 1KCKA 4AZGA 4PN2A 1MXDA 3VIGA 2QV4A 3MV01 1GJUA 1QPKA 3ARQA 5A8MA 1NP0A 5I6SA 1XRVA 1XHGA 3SURA 2E3ZA 3O2LA 1EHNA 1E73M 3N18A 1US3A 1GOIA 1O6IA 4W7VA 2UY2A 1KB3A 1R87A 2VCBA 4TTGA 4W5ZA 4JAWA 6A3HA 3OLIA 7CGTA 1NOWA 1B3WA 1KGWA 4AZHA 2PF0A 3QGVA 1G5AA 4AY1A 3FXYA 1KXTA 2CITA 5A69A 4U3AA 4MNLA 5HOSA 1W1PA 1C3FA 5EBAA 1RP8A 4D6DA 1E6QM 1TE1A 5A6JA 1U30A 4GQRA 4JFSA 4PMUA 1TUXA 3IK2A 1JZ8A 1WPCA 1W32A 1V3HA 3B8SA 2G3MA 3L4YA 4FLSA 2D0HA 5AC4A 3CZEA 3AHTA 2OYKA 5A6SA 4HP5A 1P6WA 1QI5A 1DWHM 4GXPA 3CPUA 1EDQA 3ARZA 2X0HA 3MUIA 3VMPA 4HOWA 5ABHA 2CEQA 1DWFM 3W26A 1A3HA 2ZUMA 3MSDA 3VOCA 3WQ5A 1VEOA 4WK9A 1J18A 1E0VA 4PCTA 3S2CA 2WCGA 3BMWA 3M07A 4BCEA 2ESCA 5M17A 1QW9A 3ALFA 4UTFA 1E5NA 1GQLA 2VTFA 1FHLA 3POHA 3N13A 4PUDA 5M03A 5A94A 3AOFA 3OIHA 1UWRA 4MB3A 4MB1A 4E8CA 2CNCA 3BAIA 3ZO9A 1J9YA 1Q6CA 1CGXA 2W61A 2UY4A 1W9VA 3L4VA 1B9ZA 2CBVA 2CKSA 4MPKA 1WB0A 5DEZA 4EAMA 1LF1A 3SCOA 1G9HA 3BMVA 3W37A 3WENA 5AYBA 3WUFA 1ZBVA 1W9DM 3O6AA 2VUYA 1EDGA 3VD5A 5JBDA 3CTTA 2DQXA 3RJXA 5CXPA 1CTNA 1XSIA 1D7FA 4NRSA 3CZJA 3T08A 2V5CA 5LA1A 2J78A 3ZR5A 3W0KA 3RPMA 1N82A 2GJXA 1UR2A 2WXDM 3AI0A 1ZJBA 1H09A 4PMQA 2YLAA 3VGFA 1BYAA 3L4WA 1XGZA 1IZJA 3IAPA 2CBJA 4R5EA 1KXVA 2QMKA 2J75A 2VZOA 3W4RA 1LQ0A 1Q6DA 1HJVA 2ZUSA 2YOCA 4MB4A 4P8WA 3L2LA 3CHDA 1HJSA 1VBUA 2VL4A 2VX6A 4U31A 1TVNA 3N9KA 1FFRA 1B0IA 3IAQA 3WD4A 2XTKA 3GNOA 1E43A 3PTMA 1J10A 2FH6A 4ML4A 1E56A 3SCTA 4AC1X 1UQYA 2EPKX 2XSBA 1HX0A 3HN3A 2X1IA 3SCPA 3ZJ6A 3DYMA 3W28A 4RL3A 2VT0A 1QNRA 3VIOA 1GOOA 1WE5A 1GHSA 1UKSA 1W3KA 1OIFA 1CGTA 3PTKA 3OG2A 1NOUA 1UR9A 5ABEA 3SUVA 1HNYA 1OGBA 4U2YA 4J3WA 2D1ZA 2DSVA 3THDA 4GI8A 4AD3A 5IFTA 3MV11 2EO7A 1O7AA 4DWSA 1MWOA 4YHGA 1V0MA 3OGVA 4JKLA 3U7VA 1UYQA 1JAEA 1J0HA 3OB8A 1QBBA 1LG2A 2Y4SA 2WC4A 5A6LA 2YDQA 4Z2IA 3JUGA 2Y24A 4MNJA 2BXYA 4IUGA 4H8UA 1G0CA 1ODZA 1HL8A 5A8QA 8CGTA 4PMRA 1ISWA 1G94A 3OBAA 2BS9A 5A2BA 2WVUA 3AHVA 2JE8A 1XSJA 5ABFA 2BY1A 1W2VA 4N0RA 3VDAA 4LYRA 3WD2A 1FFQA 2ZWYA 3SCQA 4D71A 2XFFA 4W85A 5FOOA 1EIBA 1LWJA 4MAVA 2VQTA 2J62A 1HP5A 3EDEA 2XM1A 2GUYA 4PTVA 2GJPA 2WPGA 4J28A 2XVNA 3VGEA 1KCLA 1GOMA 2CIPA 3OA5A 2AAAA 4UFIA 1PIGA 5BXPA 2CXGA 3ZT7A 3HMCA 1EXPA 2B31A 3N17A 1FOBA 3CUIA 4J7RA 4P8XA 1C8YA 2YL5A 2XWEA 3BXWA 4FLOA 1KR1A 3UCQA 1AQ0A 3WF4A 1VFFA 3AHZA 5ECUA 1V6XA 4HU8A 2FGLA 4H04A 1V03A 4PEEA 3GXDA 1E40A 2ZUUA 1R8LA 1CYGA 1JIBA 2GFTA 2Y5EA 2Z1SA 4M82A 2YLLA 3WN6A 4NI3A 2E8ZA 4WSJA 2UY3A 2A3CA 4CD5A 2F2HA 4PMVA 2Y8KA 1CZ1A 3W24A 1Q6GA 3SCRA 1TMQA 1CENA 1EOKA 3NUKA 2DT0A 2WLYA 3DC0A 3FNDA 1GNXA 5A6BD 1S46A 1EGZA 2BHYA 3AHXA 2GDUA 3W6LA 1E0XA 2WWDA 5JIPA 1E1EA 1NWSA 1CGWA 2WKLA 1W9PA 3F5JA 1ITCA 1JZ3A 1CIUA 3FW6A 1B1YA 1VAHA 4Z2GA 1WCGA 1CXLA 4QP0A 4KH2A 2ZICA 3GNRA 3EMQA 2QLYA 4UZUA 4CVWA 1V6WA 3CUHA 3SUTA 5CJ5A 2ZXAA 1OCQA 3QOMA 2ZX7A 3WF3A 4X0NA 1UR8A 2E9MA 1CXKA 1JAKA 5E0FA 1LL6A 5C8BB 1F4AA 1W9UA 1QNOA 4ZE4A 7TAAA 2DH2A 4Q22A 2OWWA 2D24A 4PMNA 2OSWA 2ZOXA 1X6NA 3VU2A 1NWUA 2JIWA 3ZR6A 2BVTA 2W62A 4ZFMA 1MFUA 4HZ6A 4NF7A 5HXMA 2RGLA 3KZSA 3MMDA 3AIQA 3W38A 3AMLA 2BY2A 4GPNA 1D3CA 2VI0A 4L4PA 5A8OA 4TUFA 4KGJA 2DPEA 1UA3A 2XSAA 4TVUA 5JBEA 3ARXA 1GOKA 3SEPA 1ZBWA 1G01A 4P7QA 4PMDA 1VIWA 2X2YA 1B30A 2JIEA 2VO5A 4YPJA 2EBNA 2VZVA 1VFUA 4AZCA 1PEZA 5GNYA 1PIFA 2PC8A 1V3JA 3MUY1 4GINA 4U2ZA 4P7RA 1K9EA 1BG9A 5FKYA 5D4YA 1CDGA 3AICA 1B90A 4P8VA 1B31A 1K6AA 1CLVA 1X6LA 3L2MA 2WCAA 3SIMA 3VILA 4JFVA 1SYTA 1DWIM 2WKGA 1JZ6A 2WHLA 1CNVA 2VCAA 3W27A 2CYGA 1V3MA 2X05A 4NZCA 1DTUA 1NWTA 4AD1A 3WQVA 3A47A 4HU0A 2CPUA 2O9RA 3HJEA 4B16A 1SR0A 4OIFA 3WQWA 4X9YA 4CKQA 3W82A 4IPLA 4WLCA 3ZM8A 1VEPA 3F5LA 5DO8A 2VR5A 2J79A 2J4GA 1JYVA 1JDDA 1J0IA 2VX4A 4KMQA 1JI2A 3PZOA 4B15A 1CEOA 4GIAA 3OLEA 2V3GA 1UH4A 1X1NA 3GM8A 1JDAA 2E9BA 2EEXA 1EH9A 4UFMA 1JFXA 4QAWA 3LPGA 3W81A 3IANA 2WM0A 2XVPA 1V3KA 2J7EA 1UWTA 4W93A 1K9DA 1W9XA 3ECQA 1B3ZA 4UOJA 3WH5A 3RM9A 1LG1A 2XIIA 1QVBA 3K4DA 2WMFA 1M04A 4NRRA 1H0IA 3GH4A 3TTOA 3SUSA 2WMJA 1I1XA 1HJWA 1ZS2A 1UD4A 1BAGA 9CGTA 5IHSA 3AIUA 2VQUA 1JD9A 1F4HA 1OM0A 1H5VA 4U5IA 3T09A 2JALA 4D6HA 5HNNA 4W7WA 2YBTA 4LPCA 2YBUA 5A2CA 4DM2A 3GXMA 4UQAA 4TTUA 1OT2A 3N11A 4JHZA 2VRJA 1BVZA 1RD6A 2WVSA 4JKMA 2WHKA 3AS0A 5JUVA 3L4TA 3VKKA 3HU7A 1EA9C 4M24A 3VMOA 4F9JA 4XV0A 1WKYA 3AXIA 4OBSA 1MW0A 1NWRA 3PZGA 4OBRA 5I2UA 4KGLA 4UFKA 2XGIA 5A8PA 3T2OA 4S3JA 4CD6A 1J11A 2WC3A 1BFNA 1B2YA 1FH9A 3QOKA 5E9AA 3RJYA 4OKDA 2YA1A 1JGIA 1M03A 4M8UA 1HKJA 3W53A 4GO8A 2WBGA 1VF8A 4TOQA 3ZT5A 4PMZA 1E55A 4QLJA 2YA0A 4ZEPA 4MNKA 1LL4A 2G4FA 4EE9A 3GH5A 5I77A 3VIMA 2UY5A 5A2AA 1MW2A 4CVUA 1UR0A 5JBFA 1QNQA 5HPOA 4W5UA 2PWHA 5DFAA 3TTYA 5I0DA 5I78A 1PBGA 3G6LA 4UFLA 4P8UA 1UWIA 4PTMA 4YN5A 3VIHA 3AIRA 5FCZA 4H2CA 3A4XA 4LQ1A 4HA1A 2E4TA 2ZXBA 1Y7VA 4X0VA 1E9LA 2A3AA 1ISYA 1H4PA 2D20A 3CMGA 1KXQA 1E5JA 1EQCA 3LPOA 2WMIA 3LPFA 1E6XM 1JG9A 1GONA 3GXFA 1HJQA 5D9PA 5CQ1A 1MW1A 5GNZA 1KFWA 2XGBA 1OGSA 2WZHA 2XFYA 1W2PA 4OOZA 1PX4A 4M1RA 4J3XA 2WLZA 5AYIA 1OGGA 3ARRA 3D5HA 3CUGA 1PJ9A 1TA3B 1BPLB 1US2A 1E4MM 1HJUA 3WQ4A 3VD4A 4HMDA 4LYQA 2WVTA 2GK1A 2NW0A 3ALGA 3WNMA 1OBAA 3ZJKA 4AXNA 2ZUWA 2J8GA 4PTWA 2YDRA 4EANA 4P7LA 4CGTA 1JNEA 1KBBA 1OWQA 4URIA 1VRXA 4MB5A 1WZMA 3AS3A 4MAZA 4HPGA 1JF5A 2G3JA 1UD2A 5CSUA 3KL0A 3AFBA 1JF6A 5A6AA 5GQBA 1V3IA 3WSUA 3WD0A 4LYPA 3CLWA 3VPLA 3WF1A 5C70A 1W91A 3I3EA 1TG7A 3CMJA 1GCYA 2VNCA 1I75A 1E4LA 3U5UA 4MJ2A 4BQ3A 4E2OA 1GOWA 1HF6A 2E8YA 1B3XA 3T2QA 3WD3A 2DT2A 3VD3A 3WDQA 3AROA 2EPNA 4JCLA 2CHOA 2XUCA 3CIVA 4OUEA 5LYRA 3WH7A 2A3EA 4PCSA 1UD3A 2ZXQA 2WYSA 3WEOA 4LGXA 1GZJA 2VX7A 3MUZ1 2WZIA 3GBEA 1XYFA 4D72A 1E6PA 4PBGA 3NCOA 3TONA 1CBGA 3EMCA 4GQQA 1WDRA 4W84A 5KEZA 4S3KA 1ECEA 4A3HA 1JD7A 3AYRA 3WMBA 1EO5A 2J7HA 1R85A 1MW3A 2CCRA 3CZKA 3VM5A 1IV8A 4J3TA 2J7BA 2WANA 1UWQA 4U33A 3UG3A 1VJSA 1J01A 4AIUA 4JIEA 5FIPA 3CBWA 1CGVA 5JH8A 2J8FA 3VUPA 3CH9A 3WDHA 3A4WA 3POCA 4PRWA 3WQ6A 1VEMA 3TTQA 3PZIA 3VINA 2YL6A 2D22A 3CZGA 2X09A 2VZSA 4B3KA 5BWFA 3A6OA 3VGHA 4Z2JA 1ESWA 1FH7A 2VMFA 4CD7A 2J7CA 3UR7A 4B3LA 1C93A 3I3BA 4UZSA 1NARA 1PAMA 4M80A 2ZUNA 3WL0A 1J0KA 3OZOA 2V5DA 4HA3A 2OWXA 1UA7A 2AOSA 1DWJM 2XWDA 3WH9A 3UETA 5AC5A 1W1YA 2FHCA 4JFTA 1WDPA 3PN8A 1JYWA 2WVVA 4LXFA 2W5FA 5BXSA 1QBAA 4P7OA 2E0PA 2EQDA 5HPCA 3VTRA 3B9AA 1HP4A 4PSRA 2DSKA 4D1IA 2J7FA 2WMKA 2W66A 4B9ZA 3BLKA 1XH0A 3O9NA 2JEPA 3FAWA 4M56A 1QI4A 1XH2A 5DT7A 2YJQA 4JFUA 3WBEA 1BHGA 1GQKA 2WAGA 1GUVA 1Q6FA 2V38A 3VDBA 2ZX9A 3VIKA 1V6VA 1BSIA 2OSYA 4K68A 2PI6A 2OWCA 3VNYA 5A3HA 5A1AA 3MKKA 4PMYA 3WNNA 4ZXOA 4CN4A 4UOZA 3VDCA 4AZCB 4MADA 2PBOA 4C7DA 2V3DA 1QNSA 1ODUA 1EDTA 3WKZA 1BF2A 1R86A 4V27A 1LL7A 2J47A 1WNOA 5CZKA 1W3HA 4BZYA 1FHDA 4W8LA 1VJZA 2EXOA 2J7DA 1Q6EA 1QOXA 2BY3A 4V2XA 3KWXA 4V28A 4BS0A 1SMAA 3WNOA 1HKIA 5GNXA 1C7TA 4ACZB 1HKMA 1HJXA 4MTVA 1FA2A 2JF7A 1PZ2A 1CXEA 3MSGA 4D6JA 4EKJA 2WMGA 3BAWA 2VURA 1NM9A 3AYSA 2QPUA 2G41A 2HVMA 1WO2A 5E09A 4CD8A 4AZBA 4DUWA 4DM1A 5A95A 5EMYA 5IDIA 1WAWA 2W91A 1TVPA 4D6GA 2PWEA 5BCAA 2W67A 1H49A 3BSHA 1ZU8A 3CHEA 1XYZA 4GZIA 3W6MA 2ZX8A 3VVGA 2DIEA 1JI1A 3F5KA 2J7GA 4AEFA 4CN6A 2WZEA 3KL5A 3RMEA 1KWGA 1YHTA 1Z32X 2CBIA 4A4AA 2QPSA 3SCNA 4OJYA 3NSXA 2RGMA 1V0KA 2YA2A 1NQ6A 4B9YA 3GXIA 8A3HA 2XVLA 1Q4NX 4FK9A 2G3IA 2ZX6A 1ITXA 3L4ZA 5FL0A 4XZBA 3QHNA 1EQPA 1MXGA 2F8QA 3RM4A 2J25A 1BYBA 1I1WA 2VZUA 1EHAA 3U5YA 2XIBA 4J3UA 2XM2A 3AHYA 4RE4A 2D3LA 1SMDA 3WUBA 2VCCA 3WIJA 4MDOA 1IZKA 5JIWA 1VBRA 3FY1A 4QCFA 2FHFA 2DSUA 3GBDA 3VGBA 4A3YA 3AZTA 1W3LA 4D1JA 1BLIA 2W4XA 2XYLA 3UERA 1AQMA 3U57A 2O9OA 1VFMA 3MU7A 1HXJA 1E3ZA 3EDKA 3WD1A 2PB1A 4TXEA 3WFLA 3NSMA 1V0NA 3VIPA 2BNJA 3OLDA 5CGMA 4E8DA 3MANA 4FMVA 3RCNA 3AISA 3WH8A 5CPQA 5I5RA 1A47A 2ZE0A 3WDRA 3TTSA 4UQDA 1ZBCA 2Z1KA
chains in the Genus database with same CATH superfamily
3UYCA 4MZ8A 2X42A 3BCFA 4Q8TA 1ZALA 4V33A 3QR3A 4WJXA 4N6FA 3AMGA 2FH8A 4JS3A 3GVQA 4E8GA 4KERA 5ENLA 5AC8A 3HQOA 1C8QA 2VC6A 3VIFA 3T2PA 1V08A 4IIDA 4F0MA 4O52A 1O4UA 3CL8A 1L6SA 3S5OA 1QPQA 2I9EA 4O0QA 2XP8A 3SUUA 3TC3A 2GUUA 3MA8A 2J27A 4C1NA 3EDFA 1ELSA 3N25A 3MHGA 2W0UA 2VRKA 5FJRA 4UBPC 3N12A 3AJXA 3WDPP 3P3BA 2RUDA 3IJLA 3L0NA 4FHAA 1V6UA 2PDCA 4AD4A 3WELA 3QV7A 1C91A 2WNWA 3NPWA 2GPTA 3DIPA 1H1YA 1G7UA 2JF6A 1RVKA 1E6SM 5D9MA 1UBSA 2Y61A 1OVDA 1AL7A 1VJIA 4LOCA 4TVCA 4K3ZA 2GGIA 3SCUA 5KMYA 3MBFA 1UWAA 1PPIA 1XUZA 3NZQA 3GR4A 8XIAA 4BEUA 5FL1A 5ABGA 2HK0A 4YTUA 1SFSA 1MNSA 1XYAA 1ZQ5A 3TN6A 3FFSA 1UKPA 3C8FA 4D6EA 4F9DA 4NU7A 1WKEA 3FJ6A 1FHUA 3E6EA 4AMCA 5FD0A 4QJ1A 5A6TC 8RUCA 1OEPA 5A6MA 2EPLX 3NEVA 3PSVA 1ICPA 4C6FA 5HBFA 3CWNA 3NA8A 4QLKA 1DQUA 3M0JA 4OV9A 2AKMA 7PTDA 1C8XA 2ZX5A 1KR0A 1XDMA 2HISA 3KBVA 1KM2A 1ZGDA 3AIEA 3ZSTA 5IXEA 3ZQ9A 1IQ8A 1JGMA 2RUSA 3N9SA 1V93A 4EAYA 4HVXA 1CXFA 4CUCA 1P7TB 3VD7A 3PWGA 2PD9A 2R1PA 4N4PA 2NQLA 3MO4A 1XSKA 3MT1A 4DZ5A 2OGJA 1H7WA 4DUVA 4N4QA 3LMYA 3LX9A 1E71M 1DPMA 2VC9A 2E77A 2I9UA 3C2RA 2XH4A 4HHMA 5HW8A 2KO7A 1FWEC 1DV7A 3H22A 1ISVA 1ISZA 1MQQA 4L9YA 1HKVA 4AD2A 3BLPX 1KRCC 1JCYA 2PDPA 3MHUA 3QV9A 4DXVA 3CZLA 4N9DA 2BFGA 4EXQA 2BHUA 3H6OA 3AZRA 4LS0A 4RR4A 4K2SA 3T1GA 4L61A 4FN2A 1O12A 4L64A 1YDOA 4XO7A 5A6BA 4UTMA 4UTTA 3IWPA 3Q4DA 4X2PA 2C8NA 4TW6A 3BGJA 3TXVA 4NJJA 3B8WA 2ZQUA 4Z2KA 4GUGA 2FDSA 4ZENA 1SQ7A 2BTMA 1EJWC 4BR1A 4NUWA 1UC4A 3NSNA 1K7FA 2FZNA 2W92A 3REQA 4HOXA 3WJZA 3PBMA 2VFFA 3LRMA 1X1ZA 2XP7A 3W1LA 1W1B1 3I4KA 3CUFA 1KV5A 4GY0A 1YBQA 3IRSA 5BNKA 2KZHA 3OQEA 1R2RA 3ZFHA 2X1SA 4ZE5A 5BYWA 1IT0A 2NSXA 3SRKA 2X1UA 2WMHA 3AO0A 3S2LA 1KFCA 5HQLA 4JL2A 4XZWA 4KQZA 5F2MA 4JHOA 3CHCA 3WF2A 4P61A 1L6GA 3IUHA 5CPTA 2PP1A 3PRDA 2HRWA 1R9YA 5MKGB 4HU3A 5I03A 4G8TA 3QGAC 2D69A 2FHBA 3N2OA 1E3XA 4GYPC 4HNUA 1GHRA 3LCGA 1E70M 1J0ZA 3E0IA 4FZIA 2WOQA 3TE9A 1S3HA 4PMOA 5JQ9A 1K6WA 3S4TA 3PZNA 2V81A 3LGDA 3S1XA 8TIMA 2NT0A 1EO7A 2DUXA 2FPTA 4JZ5A 4O17A 3LNMA 4J9JA 1CGYA 3GNDA 4MLRA 5DT5A 1R7AA 2I16A 4O8AA 5K3VA 4C6MA 2I7GA 4XIMA 3ZLFA 4B91A 3TYBA 3GHRA 3FVDA 4GVGA 3O5FA 4A29A 1E1FA 5J8LA 2OTDA 1PKLA 3VKJA 2FZDA 3ZIZA 4MG4A 2XIJA 3DHPA 4NAEB 1QHOA 4PMJA 1CLXA 2BVDA 3S6TA 3UG4A 5TD4A 1WXYA 3IGUA 3NZPA 4F66A 1EOMA 1VCFA 5A8NA 2QVNA 4LUSA 1ZP4A 1KFLA 3P80A 4KRUA 1KXHA 2P3ZA 4AX7A 3BMXA 3ITYA 1TA3A 2QHAA 2D0GA 1K02A 3GS6A 4WX2A 5DELA 3WNPA 2NQZA 4FS9A 1W9BM 3WLJA 1PZ0A 2P5NA 3RXZA 1C9DA 3TEVA 1YDVA 3MSYA 3R43A 4QDMA 1Q63A 3P67A 4DO5A 5H8UA 1OIMA 2A5HA 4ZL1A 2AWGA 2VRQA 4B5WA 2PDYA 3V4BA 3WMCA 3W72A 1ME9A 2ZZ3A 3PHAA 3G3DA 3QZ6A 1EEXA 2BXZA 4QHRA 3DHUA 4C6OA 4NNRA 4LB4A 5IFPA 3NPUA 5D04C 3WH6A 3H2EA 1GT8A 1B5TA 3OIXA 4KFNA 3WBAA 1W5MA 1ZUAX 4HA4A 4YXGA 1LT7A 4J5NA 4GKTA 3QZEA 3ITLA 3K46A 2MLYA 4OWGA 3NZGA 1EPVA 2QF8A 3OW1A 2DSZA 1Z9AA 5XIAA 4HOZA 2PE4A 3GDKA 2Y63A 1RCOB 3NIYA 4EX4A 4FLRA 4JTSA 1TWDA 5I00A 1PKMA 4L4OA 1SZEA 4LAUA 3CGMA 3IJ6A 1A5AA 1FKBA 4UTUA 4OOUA 4KWUA 4YS1A 1Y0EA 4C7GA 1GPFA 3NL5A 1IWBA 2QCCA 4Q8PA 3H7VA 3SQLA 1NELA 1V6YA 2QYGA 1X38A 4OHQA 1JDCA 4PMXA 2O7SA 3AIBA 1TJPA 4LV4A 4FXSA 1PWMA 4H9UA 3PP7A 3T05A 3EWCA 3PZQA 4O4VA 2Z29A 1VHCA 4MIMA 3Q2DA 3APTA 2EG6A 2L2SA 1H62A 1LZOA 2TYSA 2C13A 1AMYA 1EX1A 3LM7A 3IKDA 1IIGA 3N15A 2P76A 2GVJA 3BG3A 4B5XA 1QW7A 3D47A 3B0VC 3N04A 1U83A 3NDYA 4DWSD 1R3RA 4HYWA 1XPGA 4RZ5A 3SCWA 4N6EA 4JTUA 2Q5AA 4RDVA 1XLJA 2QCHA 1SW3A 5IHRA 3DYPA 3OGRA 5C9RA 3LV6A 1FWRA 4Q8WA 3AS1A 1ZNNA 5DMMA 4AWEA 2VJXA 3T0DA 1GRJA 4RE3A 4IT6A 1XLCA 1H3GA 3A21A 2Q8LA 3CO8A 1M7JA 1BRLA 2YKKA 2XIQA 2QJMA 5LA0A 1OCJA 2QULA 4IMDA 3BAKA 1C7SA 4HJFA 1X6UA 2FFCA 3GDTA 1L6FA 3SAZA 3KFTA 4O0ZA 2FGZA 4RDZA 5G2WA 4XKYB 2ZZ4A 2P8CA 3ARTA 1RSCA 2PU0A 4XVEA 1P48A 3NL3A 3K13A 1R9ZA 3P6LA 1VCVA 3ONBA 5FJIA 1S2AA 5CBBA 4AWUA 4M6VA 3NYZA 2XINA 3DCPA 3U3HA 1FH8A 1OG6A 3LPPA 3WY1A 4PTXA 1LJYA 2MLXA 4TVDA 2QVHA 3CV1A 3IRDA 4Y2WA 3W1MA 4GI9A 5EB8A 4F48A 3IVTA 1R7OA 1ALDA 1QHPA 3OHIA 4Q4QA 5CCZA 3VD9A 3LOTA 3PRBA 3KOWA 5I24A 3SRFA 4G2PA 1OINA 3MKVA 3E5BA 3RX3A 3SUWA 4TV6A 4O1EA 1M41A 2DEPA 1IX5A 3II1A 1JYNA 3STFA 1XLBA 3SDOA 2B7NA 5D37A 1MUWA 2X40A 4CU8A 3AIVA 4HK6A 5C71A 3VIIA 2XIMA 4PCPA 1SSGA 1P0BA 2QV4A 1TV5A 3NXLA 1QPKA 2MUCA 5G4WA 4FEZA 1NP0A 5I6SA 1XRVA 1XHGA 2E3ZA 1EHNA 3DFYA 1LORA 1O6IA 4W7VA 1W17A 3KTSA 5FI8A 2VCBA 1XLFA 5FESA 1ITUA 3OLIA 4IX2A 3EWYA 1NOWA 1PKYA 3EWUA 1B3WA 3MKCA 3V18A 3MP5A 2VYOA 1G5AA 1T5AA 1KXTA 5D32A 4OQVA 4MNLA 1FWHC 4YL2A 3NVTA 1W1PA 2ZQVA 4D6DA 3WLQA 2RDUA 4MYAA 1WKDA 4LFYA 4JFKA 3IK2A 1JZ8A 1W32A 3A64A 2BSLA 2NUWA 2G3MA 4O16A 3K2GA 2IKHA 3QEZA 2HBXA 3W22A 5BZAA 4ADTA 1RPXA 4QNEA 3ARZA 3MDYB 4S3EA 4HOWA 3SM0A 3QV6A 1FDZA 1XP3A 3P0XA 1ICSA 3GD6A 1DWFM 4WGHA 3WQ5A 3H26A 4PCTA 2WCGA 3KABA 4PUUA 3ALFA 2JQXA 4UTFA 1NFGA 2VTFA 1FHLA 3POHA 3RF9A 5M03A 1IWPA 4JDBA 4MB1A 4F0HA 3KLLA 3ZO9A 3UA3A 3CAKA 3SY1A 1W9VA 2UY4A 1WB0A 4UUIA 1H7NA 3W37A 4FNTA 2C3ZA 2VUYA 1EDGA 5C0QA 4Z1BA 1DXIA 4HU4A 3CTTA 1OCNA 1CTNA 3LA4A 1XSIA 2Z7KA 3ZZ1A 3ZR5A 1UR2A 2IKJA 4YIWA 2VWTA 4TX9A 1H09A 1TCDA 1X39A 2YLAA 1AW5A 4IJCA 1XM3A 2DORA 4R5EA 3DAQA 2HSAA 3HG3A 3P7YA 2VZOA 3W4RA 2ZDSA 3U9IA 1LQ0A 1Q6DA 2YOCA 1XLEA 3V5OA 2CZDA 4ODPA 1TV7A 2VL4A 2VX6A 4U31A 2TSYA 2ICSA 4LBRA 1PHQA 2XFWA 4TMCA 1FFRA 4UC5A 1Q4WA 1E43A 2PDKA 1TWIA 3CIWA 1J10A 3PTMA 3THUA 3KRSA 2FH6A 3R8GA 3HGSA 3LDVA 2QW5A 1UQYA 2XSBA 3FVMA 1F8AB 3DYMA 4RXFA 4UTKA 2NQJA 4X22A 3TYAA 2E25A 1QNRA 2A3LA 3VIOA 4S23A 3GB6A 4K7VA 1CGTA 1UR9A 4GUJA 3TMQA 3V0SA 3W6YA 2DJLA 1OY0A 3B4YA 1OGBA 2OKOA 3I7QA 1TPEA 3THDA 1K8CA 4DWSA 5HMEA 1NU5A 3WLNA 4UMBA 3U7VA 1DJZA 1DL3A 1Y5VA 3V5FA 1DORA 4JQ3A 4RX0A 1JCMP 4Z2IA 4JGDA 1YPXA 1RJQA 4MNJA 1K3UA 1G0CA 1VD6A 1KTBA 3SY5A 2K8IA 1S2WA 1G94A 1H7RA 1R47A 1XLGA 3WH0A 4LAKA 3RR4A 5HT1A 3VK5A 2JE8A 1XSJA 3GVRA 4NJKA 4U10A 4LYRA 1RVGA 3SCQA 2R1MA 4ENLA 5FOOA 4NXKA 2JKPA 1TRIA 2FIQA 1GEHA 4MAVA 3HFTA 2VQTA 4O50A 1HP5A 3LTPA 1E0TA 3B8DA 4HYVA 4NQ1A 6REQB 3I6RA 3KVLA 2XVNA 3W7OA 2VFIA 1GOMA 2CIPA 3SZ8A 3OA5A 2QIWA 4IFKB 4O28A 3TN3A 1I6NA 1GVSA 4UNLA 2B31A 4L5ZA 3NRKA 1EF2A 3IJDA 2YL5A 1FKLA 1DYSA 3IGHX 2XWEA 4FLOA 1MRQA 3UYIA 3TAKA 3BLEA 3CWOX 4KT2A 3LRKA 4EF8A 1TWZA 2XSXA 4R34A 3E2QA 3HPSA 1W3IA 1V6XA 3I65A 3O5DA 2ZUUA 4S3BA 2GFTA 4M82A 2Y5EA 5LHFA 4NI3A 2QCDB 2ZRUA 2HDJA 4WSJA 3MCNA 5EMKA 5EMUA 1R38A 1Q6GA 1AA1B 1PB0A 1EX5A 2R1KA 3NUKA 2DT0A 1GNXA 1BL4A 2R82A 1EGZA 2OZ0A 3MVIA 2BHYA 4JQAA 4HZMA 1O1HA 1AZ1A 1MRAA 3BQ6A 3FIGA 2FZ9A 3HGRA 2GDUA 4LUIA 1E0XA 3PNUA 5JIPA 2Y70A 2WKLA 2G0WA 1W9PA 3F5JA 4AB4A 4IMFA 1JZ3A 4N9EA 3WMLA 4QP0A 4KH2A 1NDWA 4S3GA 1UZHA 4LNCA 2QLYA 4REQA 5CJ5A 1YNYA 3UPMA 1OCQA 1ZJHA 1JRCA 4C1NB 4X0NA 1TIMA 1UR8A 1FKHA 1CXKA 4K1WA 2RDXA 2RQSA 2FFIA 5I09A 4ERIA 5C8BB 1F4AA 5AC6A 4DYKA 7ENLA 4UTTC 1QNOA 1KLZA 1GVEA 7TAAA 3GNXA 1AJ0A 3I10A 4O11A 4OU1A 3IKGA 1V4YA 2OSWA 3WBWA 1OCBA 2ZOXA 1JPHA 1RQHA 3VU2A 4BF9A 2HPMA 3S9ZA 2BVTA 2W62A 4ZFMA 4HZ6A 3S1UA 1FWBC 5BMWA 4JYDA 1N8IA 2PV3A 2WV8A 4A8RA 4ES4A 4YTTA 9XIMA 2QJHA 5E0KA 5A8OA 5D30A 5LSMA 2DPEA 1UA3A 4TVUA 3ARXA 1GOKA 4GJ1A 2TRSA 4P7QA 3UCDA 4DO4A 1B30A 2JIEA 2EBNA 4L56A 4M1BA 2VZVA 1J5TA 1VFUA 3SR7A 4IP5A 5GNYA 4KRZA 5F4WA 3UF9A 3HF3A 3SFKA 2LGOA 4Z0SA 3VOGA 1LUCA 3PPCA 1UJQA 3W7QA 3O5QA 5E1QA 4G56A 1B90A 1B31A 1V79A 2V5JA 3L2MA 1SYTA 1TZZA 1DWIM 3OZYA 1JZ6A 5HA7A 2BLEA 3PBVA 4X9SA 1V3MA 2H3DA 3JYMA 4NZFA 3OTRA 4AD1A 4ZPTR 1F3XA 1LROA 3WQVA 1IZCA 5CC7A 4B16A 1SR0A 2RHGA 3T55A 2F38A 4IPLA 4CKQA 3NQEA 4H9TA 3ZM8A 1VEPA 1KRBC 5DO8A 3SSJA 3KOYA 2RFGA 3MZNA 1J0IA 3URNA 3PZOA 3JXVA 4GIAA 4DX3A 4XAGA 3H21A 1VZWA 1UZDA 1UP3A 1A5LC 2F2KA 2EEXA 1EH9A 4UFMA 3LPGA 3W81A 4JHMA 3G1RA 5FJOA 3W1QA 2AKZA 4KWVA 1XS2A 3PY2A 1K9DA 1CW2A 3F7JA 4IIGA 1H60A 4GNVA 3RM9A 1QVBA 2DZWA 4DNMA 1KT0A 3NQFA 4NRRA 1H0IA 4O15A 3C2EA 3MYOA 3PAJA 1LYXA 3SUSA 1I1XA 2OFJA 5KETA 1ZS2A 4PUWA 1S2TA 1BAGA 1JD9A 4B90A 4FNQA 2JALA 3U0HA 2TMDA 4A8IA 3REQB 4G2DA 5KSWA 4LPCA 3LXAA 2HVNA 4BY3A 3KVKA 3KRBA 2FVKA 2FMNA 1S39A 2A7NA 4JHZA 1YBQB 1AQFA 2VRJA 4FSAA 1YATA 2C91A 2WHKA 1M6JA 3BW4A 3AXIA 4OBSA 4OBRA 2PDLA 4KGLA 3LHVA 5I02A 3M41A 1J11A 3P84A 1B4KA 1S5TA 3NWRA 1MDLA 4E0CA 3VKCA 4OKDA 1M03A 4M8UA 2FKPA 1HKJA 3SGZA 5JH2A 4IG2A 4NG3A 4XSMA 1VF8A 4PMZA 2V2HA 2H9AA 5K2ZA 2DG9A 4ZEPA 4GI4A 1NJJA 1QFEA 2F9RA 5REQA 2UY5A 4DPPA 4PTDA 2E7FA 1UR0A 1QNQA 1W5OA 4IIBA 2Z2BA 5I0DA 1G67A 5I78A 3WJXA 3G6LA 1RCXB 2PDFA 4P8UA 3HA1A 4HSOA 3VIHA 3O5JA 5AHEA 2ZC8A 4MWAE 5DLCA 4J4NA 1HUVA 4YWIA 4H2CA 3A4XA 3W2JA 1DBTA 5C55A 3TK7A 4X0VA 4F40A 2PDJA 2A3AA 4A3UA 2D20A 3CMGA 1EQCA 5CBIA 3LPOA 2WMIA 3UJ2A 1YXYA 4V1XA 1E6XM 1V5XA 3ID7A 3KZ7A 5D9PA 5GNZA 1PCWA 1KFWA 1OGSA 2WZHA 4LUSB 4DBEA 4Z1AA 4OOZA 5AYIA 4M1RA 4FNRA 3HO8A 1OGGA 3ARRA 2PA6A 3O5RA 1NFPA 1TA3B 2QQ6A 5AECA 2B81A 1B54A 1EF3A 2HBVA 3TAOA 3VD4A 2WVTA 2GK1A 2NW0A 4E6MA 2Z24A 3HPXA 3IGXA 3ALGA 3ZJKA 4AXNA 2ZUWA 3P2VA 4FXRA 1WX0A 4P7LA 3BPWA 1FVPA 1ENUA 1JNEA 1KBBA 3N4AA 1KRMA 2J9YA 1K1DA 2OZ3A 4TQTA 1JF5A 1UD2A 3G1YA 3P8JA 3KL0A 5GQBA 3NDOA 4Q6JA 3VPLA 1XFBA 4MKSA 4Y8FA 4MPQA 5C70A 2C15A 1MEWA 3RITA 1TG7A 3CMJA 4WOZA 4AHOA 1GCYA 1Q66A 2GQAA 4A05A 2XPAA 3R0KA 3TH6A 1O1ZA 2DT2A 3WDQA 3EGJA 2EPNA 2CHOA 4S3CA 2WJEA 4LS1A 1A3WA 4HSHA 1J8VA 2A3EA 4PCSA 2ZXQA 3WEOA 4LGXA 3DN5A 3MUZ1 4K8HA 1KFEA 3BLIA 4JTLA 5JVLA 4H6QA 1DQXA 4AMAA 4DNHA 3QV8A 1E9IA 4DRQA 1OHLA 1XLDA 4W84A 1WDRA 3LGGA 3T40A 1JD7A 4HGXA 5D03A 2VUNA 1EQ3A 4W9QA 3KS5A 1XYBA 3H2FA 1M9HA 3CZKA 3I6TA 4U33A 3UG3A 4MUZA 3H4WA 3GU0A 4JIEA 2PTXA 5JH8A 3WX7A 2J8FA 5BU6A 5TIMA 3A4WA 3C56A 3TTQA 3PZIA 4K7YA 3E5PA 2BASA 1IXPA 3KAGA 4Z2JA 1ESWA 4PBEA 5LIYX 4WDTA 5AOUA 4JXCA 1VIZA 3S5SA 4CD7A 1NARA 2A6NA 2XU2A 4HARA 1J0KA 3WLLA 3V35A 4DF0A 1SJBA 4OBTA 1TELA 4H4IA 1W1YA 3B9NA 2WJZA 3ITGA 1JYWA 4C65A 2QJNA 2WVVA 1RK5A 4LXFA 2W5FA 3VI2A 1QBAA 1XC4A 4HN4A 4I9AA 1TJ2A 2QT3A 3OU8A 4AY7A 4D1IA 5FAGA 3T07A 4DZ3A 1XH0A 2ODOA 2H6RA 3HBLA 3WQOA 5LNRA 2EKGA 4WXZA 1U79A 4FP1A 5DT7A 1D8CA 2QNEA 3U2CA 4OFCA 2CLMA 2V38A 4JTKA 1DE5A 3RPTA 3DI1A 4DH0A 4F0LA 3VNYA 3GVWA 4PR4A 4UOZA 4JNMA 3QF0A 4K8GA 4A8NA 4C7DA 4I90A 1LM1A 2QCLA 2V3DA 4H83A 4O12A 5DANA 5F1VA 3EX1A 1HXVA 1EDTA 4Q8OA 1L8PA 1BF2A 1R86A 5MHBA 1WNOA 5CZKA 1W3HA 3AWOA 3UPWA 1FHDA 4LF2A 3F03K 1BRLB 3TW9A 1DTNA 1P0NA 1VJZA 2J7DA 4MKNA 1Q6EA 3TC6A 3KWXA 4I6VA 2Q01A 3E0LA 2X0SA 1SMAA 3U6WA 4LVBA 3UJEA 2G3FA 3P60A 3AXMA 3WNOA 1LWIA 2PRHA 1FA2A 3WO8A 1XCFA 3MSGA 4D6JA 2V68A 2XN0A 3C2YA 1NM9A 4IFRA 1GVQA 4L65A 2YB4A 5J5RA 5E09A 4DUWA 4DM1A 5A95A 4M6PA 1TVPA 3PG9A 1ZU8A 4LAMA 3CHEA 3W6MA 1JULA 3CT7A 3VVGA 4I7WA 3F5KA 1UIOA 3FOKA 2G96A 1S5MA 2J7GA 1EGMA 5DIUA 2AL2B 2YCEA 1KWGA 2Y5JA 5LNVA 4KCWA 4A4AA 2QPSA 7ODCA 3P14A 2RGMA 1L6WA 3T0TA 1VFTA 2YA2A 2NX1A 4ZO6A 1ZCNA 4FK9A 3GZ3A 3NM1A 2O7QA 2GL5A 3CYJA 1QR7A 3KTXA 2ZVIA 2J25A 1S2UA 5CPLA 4LB3A 4F0SA 1A50A 3AHYA 5C9WA 1SSDA 4RE4A 4HB7A 1LOLA 3TYCA 3HV8A 3Q65A 3B8TA 3WUBA 2OXNA 2VCCA 3KCOA 5FEZA 4MDOA 1VBRA 3FY1A 1AH4A 4C6CA 3H53A 3KADA 2P10A 3CAWA 4H7ZA 4QG8A 4MZYA 1Q7ZA 4CNTA 1OK6A 2W4XA 2XYLA 3UERA 1PYMA 3GIPA 3MP4A 1VFMA 1I2QA 5AHFA 4DLFA 2CLIA 3HPAA 4KQNA 3DG3A 3UJFA 3CM4A 2FTYA 2C6QA 5FEXA 4GX8A 4FOUA 4GFIA 1FWAC 2DZSA 3SRDA 1NFBA 2X1TA 2YW3A 3IIPA 2DV0A 4FMVA 3AISA 2ZE0A 4UQDA 3BGGA 1CXHA 4DWSC 2ZZ2A 2IXVA 4UNIA 5FSEC 4AIEA 4QQUA 4U28A 3L5MA 3TC5A 1PTDA 3PZ9A 1UR3M 1N7KA 3W1PA 4U85A 3B0UX 3FGCA 4DXKA 2E6FA 3INPA 3N3MA 1F6KA 3G6MA 3K4AA 3LHUA 2VGFA 4Q4KA 1KLYA 4Y7EA 5E93A 1I45A 1HT6A 1C90A 1Q13A 2WHJA 4H19A 3U48A 3LENA 3CGTA 5CJMA 1DJQA 5HDRA 5D75A 5E70A 2XVKA 1XV8A 3IJ7A 4Q6XA 2P53A 1F61A 3VZZA 2ZUTA 1RJPA 4GK8A 2VCDA 2O55A 3M0IA 1PX8A 3B7XA 2BHZA 4GJJA 1W31A 4JDYA 3VDHA 3PUGA 1J96A 1N55A 4D9PA 4GZEA 4O8RA 2AMGA 3ABOA 1C9HA 4Y9PA 3PSWA 1XLMA 3E3HA 4L9XA 3RFAA 3APGA 1JCJA 3ZWSA 2XHYA 4H00A 2DFAA 3QMTA 7REQA 1KV8A 3IIZA 1U2YA 3GE7A 2QEZA 1JNDA 1ZB5A 3VKBA 3LCHA 3D3FA 2IPWA 1OYCA 2Y7EA 3W84A 4FALA 2M1IA 3TLLA 1UR1A 1RPKA 1KTCA 3F4NA 4L1GA 9XIAA 1M01A 2R94A 4JTAA 1J79A 4PYSA 1OFBA 4CCZA 3V0TA 3K8KA 4NL1A 3S2NA 3TROA 4AH7A 1JCHB 1MUCA 4MKVA 4O13A 5DBTA 1OFPA 3UXAA 5EFDA 4WF7A 1B3YA 5DCBA 2GYIA 1UW9A 4CN1A 1E6NA 1H41A 1UMYA 4JTGA 4MYXA 3RIKA 1S2VA 3IACA 4J3SA 4GISA 2XFRA 1IT7A 5TF0A 9RUBA 4XZMX 3MP3A 1KM4A 1FWJC 2WSPA 5I3KA 1DXEA 4J4KA 3A22A 4N42A 4CCCA 4OT7A 1BGAA 4I8DA 1W1TA 1G1YA 2XN2A 3W00A 2ZRWA 2YPIA 4GZJA 4CD4A 4AZ5A 4DWSB 4ZPWR 2F6UA 3DUGA 4GUIA 1MFVA 1U5JA 3VFCA 2G8ZA 3GUGA 2Z1BA 2WZTA 1LLWA 1VFOA 3N2MA 1GVYA 5CSYA 4AU0A 3CPRA 1B3VA 3MS8A 4HPXA 1UPPA 3XISA 2CXEA 4M81A 1FWWA 5K9XA 4NSBA 3A4AA 2NUXA 4DJFD 1XRTA 3N2XA 2DUAA 4IJRA 4ATLA 1QHZA 3VX0A 2GSEA 4HHHA 3CUZA 3W1UA 3OVGA 1XBVA 2H8ZA 5C5YA 4XX6A 1PXGA 3I7SA 2VN1A 4Q3MA 4BQ2A 3R7MA 2BGSA 4QITA 5C54A 3HMJG 5LGXA 1O94A 4H1ZA 2PDGA 1POJA 1W8GA 1WUFA 1R9HA 4I7VA 4H9ZA 3WLTA 2A3HA 3H23A 1A5KC 1T7LA 4W7UA 2EPHA 3TCSA 4JN8A 3IUIA 4Q4MA 4MSSA 1XIEA 4IL0A 3G22A 4Q4SA 1JZ2A 3DFPA 1K8ZA 5HINA 2CHNA 2EHHA 3LMZA 5FF0A 4S3DA 1G4EA 4ZQRA 1H7XA 1FUYA 2I5IA 2ZQSA 3AIWA 4Q4OA 3ZSSA 3JS3A 4ZVJA 3S3GA 1GQJA 3BO9A 2BV9A 4RXGA 2YIHA 4GYFA 1ISXA 3C0SA 3STGA 1PVNA 1XH1A 4GC4A 3RPDA 2DSWA 2VD9A 3EB3A 3TYZA 3M0VA 2WWCA 4CU6A 1HVQA 4TYOA 4HCDA 2B5UB 4BQ5A 1OJXA 3MI6A 3PBWA 1GKRA 4F79A 5CC3A 4MNMA 3MMWA 4A2RA 3O6YX 4PB5A 3RGTA 2VEIA 1ZL1A 4I9JA 3QY8A 4AYSA 3WQ8A 3FX4A 1RZMA 3CZ8A 2PWDA 5F2GA 1RA5A 4REQB 4XZLX 3BGAA 4PH6A 3RNDA 2VOTA 4G7EA 1FDYA 1FKRA 3RR1A 1NMVA 5F7UA 2HE5A 1T96A 3Q94A 3EXSA 4OE7A 1XIIA 5I3GA 3NL2A 1IT8A 3GDBA 2VHLA 1YQ2A 1SM9A 4M7TA 1TE6A 2E6AA 5HWMA 4JCMA 1OT1A 3EOUA 1QW8A 1XCWA 3K8LA 2XH7A 3L67A 1JZ5A 4XD6A 4Q8NA 3TA6A 1DWAM 5CZ0A 3MMUA 1VP5A 5I3DA 1TR1A 4W89A 4NNCA 3VGDA 1X7FA 3AXXA 1XLAA 3BCDA 3CO4A 3E12A 1JXJA 5KZ6A 1Z8AA 3FEMA 4JIQA 3ARYA 1YTDA 1I8JA 5DX7A 3E1F1 5DITA 1HIZA 4PBFA 3TJLA 1UH3A 1DIDA 3WG6A 3QW3A 4WD0A 1MYRA 2BVWA 2NWSA 3UEQA 5BMXA 1TWSA 2DT1A 4UOQA 7A3HA 1A7XA 3B03A 2ITKA 2D3NA 3ES8A 3WDIA 3L65A 3CUJA 4TW7A 1UMLA 1FQ0A 4W86A 2PDBA 1ME7A 4ZXLA 2WCSA 1OFAA 3G1HA 1QUMA 1CGUA 3MMTA 1LUCB 3SJNA 2WC7A 1E0UA 2GSJA 2JEQA 2IS7A 3AXHA 4NJIA 4UQCA 4CQDA 4JYEA 1W5QA 5HUAA 1QZ2A 3XINA 1F74A 4LCSA 2ZR5A 3R58A 4I9MA 3GR7A 3TNBA 5FEWA 3URBA 4JTHA 3LXCA 2FTPA 3SY8A 2O92A 1KFJA 4IF2A 3EX2A 3OZPA 1KGXA 3EOEA 1C92A 5GVJA 3EOOA 4PUNA 1R3TA 1UKOA 3DECA 4LX4A 4BA0A 3CK5A 3LXBA 4BF5A 4J27A 3IJIA 3WUGA 4GO9A 4JYSA 1TZ7A 4KF1A 4BF7A 4R3UA 5I07A 3NQMA 4IQ2A 4HNOA 3K30A 3AMCA 4RDWA 1R30A 3OLGA 3W2NA 4AAJA 2FLIA 4O14A 2F84A 1WZKA 4AZIA 4ZB5A 4HNNA 4EOUA 1L8NA 1XC6A 4U5KA 1ZSXA 3L0KA 3C2FA 3G1FA 1M7PA 1WBHA 3GWQA 1UD5A 1OFQA 1FXQA 1OZMA 1JQXA 2O9PA 3W7NA 3WBXA 1XRSA 5LXXA 1HO4A 3ENLA 2PS2A 5F2IA 1TFVA 4ODLA 1VB9A 2CLOA 4OUIA 1RV8A 2KI3A 3EDDA 2UWFA 4W9OA 3HB9A 2C0HA 5G4EA 2POTA 3EX3A 3H55A 3R12A 5DF0A 5CG0A 1W5PA 3QR0A 3NDZA 3HIJA 4QBXA 1F07A 2Y7DA 1UZ4A 3A5FA 1V51A 5E6ZA 3WQFA 2OG9A 1S5VA 2EPMX 3P5YA 3NG3A 1H1ZA 1UP0A 1CXIA 3OVQA 4Z2HA 4HPHA 3QJAA 4JTDA 4DJFA 3UCCA 5HWNA 4CCEA 1JPKA 1ZTVA 4P7NA 1GJWA 3WUEA 5GJMA 3GFZA 2PTWA 5H8MA 2PDIA 4JYFA 3NFUA 4O0KA 1I0DA 3UP8A 4QT2A 4WXYA 2HV5A 2WB5A 4IG2B 3WFZA 1YMYA 3VX1A 4QT3A 5LZLA 4A3RA 2H9AB 3WNKA 1RP9A 3RO8A 5EMMA 4EPEC 4N9CA 2QJGA 3DKLA 2PF8A 2UZ9A 3MUXA 4GYPA 4GUHA 4ZFCA 1U1HA 7TIMA 1JQVA 5REQB 3OYZA 4R0XA 4NZ1A 1PZ3A 1GYNA 1YKWA 2ZADA 2WK2A 3WYZA 4WKAA 4JKKA 2ZA1A 3ATYA 3TYUA 2YL8A 3E0FA 3EX4A 2DVXA 1AW2A 3WLKX 1KM5A 2Y7GA 4NXSA 4DO7A 1Z6KA 4B5SA 3BJTA 5G5IA 3UQNA 2GQ8A 2QCFA 1X97A 3CHVA 2A21A 2XPKA 2WMIB 3PJUA 4YYCA 3L4UA 4QLLA 5EKYA 2VVSA 2IW0A 4HZ8A 1LQ2A 1RBAA 3GU2A 3FHQA 1F8MA 1FP8A 5FF3A 2PAJA 1PDZA 4AEEA 3J7HA 3IJ9A 3WQEA 5GPRA 3H4GA 4I7UA 1G4SA 1OADA 4UQBA 1QOPA 4X2RA 1GVIA 3WMSA 3PVFA 1Q5MA 2GK1B 1KCKA 3S5NA 1MXDA 3LZ3A 1VYRA 1GJUA 3AUJA 2HNEA 2ZYFA 4HA0A 4JNZA 5A8MA 3G5EA 2PFHA 2B7PA 1RY0A 3I7RA 4GLEA 1E73M 5IDZA 3HG4A 4DXXA 3BARA 3EPOA 2UY2A 3DG6A 3WLHA 3WLOA 3ANUA 2M2AA 4JAWA 3FA3A 3KBMA 3BCJA 3QGVA 3A5VA 3FXYA 1VPQA 3NVDA 2POZA 5M1TA 4W4QA 3JRKA 4I5RA 2B0MA 4ZA0A 1K4GA 1C3FA 4IWWA 3DU0A 3TV8A 4YWSA 2WSYA 1TE1A 1VS1A 3IARA 5TAOA 4I5XA 4LWWA 3M0XA 2XP5A 4G1NA 3MDUA 5HW7A 3ZLGA 1FWSA 5A6SA 4OGZA 1QATA 3A12A 1QI5A 3WLMA 4AIBA 2PZNA 3W7DA 1ZRQA 3MDWA 2H3BA 3L9CA 3MUIA 3R89A 1YXCA 4M6QA 4B2DA 3SGGA 2I1OA 1O95A 1V7YA 3VOCA 2NWRA 1J18A 2Y1HA 3S2CA 2R1NA 4GACA 3M07A 2ESCA 5M17A 1E5NA 1GQLA 1EUNA 5CC5A 3RU6A 1UWRA 4KEMA 2LLEA 2BDQA 1REQA 1CGXA 2AL1A 2RUQA 1B9ZA 1SU5A 3TSBA 4MPKA 5DEZA 4O1BA 1LF1A 2VDGA 3WUFA 1W9DM 1GVOA 1UUOA 3KRUA 5JBDA 3W2KA 4LUYA 4EACA 2DQXA 3VCRA 2FGBA 1KBIA 2I56A 3TQPA 3NNTA 1BWVA 2V5CA 4BI7A 3ME3A 1ONWA 2JZVA 3LHWA 4D2JA 3GC5A 2GJXA 1DOSA 1RR2A 2WXDM 3RU8X 3LV5A 3AI0A 4PMQA 1TUFA 3B9OA 3VGFA 1BYAA 3L4WA 2Z2AA 3W1AA 1KXVA 1DJIA 2QMKA 4C1KA 2YB1A 2WJDA 3M0KA 1KKOA 1E1CA 1HJVA 4TMBA 4PCFA 4PUKA 1VBUA 4A8LA 4GUFA 5JMUA 4DQWA 5C2XA 3G1VA 3N9KA 2R24A 1XI3A 2DZVA 1CCWB 2R14A 4YVPA 2XTKA 3GNOA 1TPC1 5JU6A 3QR1A 5AZ0A 3NO3A 4ML4A 4QE5A 3R1ZA 1O66A 4ALDA 2X1IA 3SCPA 3ZJ6A 1MMFA 4I5UA 3W28A 2RH9A 4RL3A 1TPDA 1GOOA 4E4UA 1W3KA 1UKSA 1OIFA 3PTKA 5IM51 3GAKA 4ZZ9A 3O1NA 3V0UA 4G9PA 4C6EA 1PHWA 4U2YA 2YCLA 2F7FA 1FCBA 3W75A 1TJ0A 4RV3A 2QDHA 5F1UA 1O7AA 1OC6A 4LYKA 3OGVA 4AVNA 1UYQA 3KAIA 4MY1A 4WZHA 2Y4SA 3HQ1A 5A6LA 1JDFA 2X41A 3JUGA 4DF2A 2HTMA 4PEKA 4IUGA 4H8UA 1HL8A 3DFSA 4L4LA 4JTTA 4FR1A 3QRHA 1RJRA 5DRIA 3EKGA 3QH2A 2ETNA 2O4MA 1TTIA 3WLPA 4ZQOA 3AHVA 4MLJA 5ABFA 4LAOA 4HNCA 3T4CA 4N0RA 1KFKA 5M2FX 3VDAA 3WD2A 2A0NA 3H70A 1FFQA 2QGYA 4W85A 4F2UA 1SZGA 3TCEA 2ZR4A 1OZQA 1R2TA 1B57A 1KC7A 4JQ1A 3EDEA 3UJRA 3PJWA 4MY9A 4PTVA 2GJPA 2PLCA 2WPGA 4Y6GA 2ZZ6A 4QTGA 4J28A 2DIKA 1A0DA 1X96A 3KW3A 3VGEA 4YCPA 1LDCA 5BXPA 1EGVA 3HMCA 3WFAA 1HW6A 3HPFA 3ZVIA 2QCNA 3RCYA 3G1SA 3B8IA 5HAOA 3QFEA 1ITQA 1KR1A 5H8PA 4GVIA 1S5WA 1U1UA 1VFFA 5J5DA 3DOPA 2FGLA 1D7KA 1VGAA 1ZK6A 4IHCA 3C6CA 4QS6A 1E40A 1R8LA 1JPMA 3R13A 2BZNA 2E8ZA 4IXHA 2CLFA 3NPVA 2UY3A 1I2NA 3O16A 3PK7A 3CIXA 2R91A 4XAYA 4H01A 3N6JA 4PMVA 4OTKA 2Y8KA 1CZ1A 3SCRA 2HJPA 1TMQA 2ZTKA 2Z6JA 3PFRA 3B0PA 3PM6A 4BKNA 1S46A 5A6BD 5DCEA 3ZXWA 1I9CB 1FXPA 1D7HA 3GO2A 3HPZA 1ML1A 2WWDA 1E1EA 1FWIC 3R6IA 1ITCA 4TX0A 1NF7A 1CIUA 1B1YA 3BDKA 3QPZA 2PPOA 2VKZG 3EMQA 3FGCB 4CVWA 3EAUA 1V6WA 2EJAA 2ZX7A 3MTWA 4L6DA 4QM1A 3TDBA 2E9MA 1JAKA 5H1WA 4JIPA 5E0FA 1GYLA 3UI4A 1W9UA 1DIEA 2OZTA 4UB9A 3O15A 5CPOA 2PLMA 3OVRA 2IQ0A 1Z48A 4JQ4A 3GSMA 5AHLA 4HT3A 3DESA 2Z1XA 3M5YA 2RAGA 1XINA 4PMNA 1X6NA 3BOFA 2KX9A 2JIWA 2OKTA 2YXOA 4FR6A 2V30A 4S3AA 2ZR6A 2V8ZA 3UZZA 4XZ9A 4EPDC 3KZSA 2HVOA 3ODKA 2JKEA 4PL2A 3AMLA 2BY2A 4GPNA 4WCJA 1F6PA 1PV8A 1GZ1A 2DZAA 1X8CA 2VI0A 1MSSA 1KM3A 7REQB 3W87A 1Q2RA 4NASA 4QSHA 3UWWA 3MW7A 1QO5A 5B8IC 3ICJA 1XGEA 4QE1A 3SEPA 1ZBWA 1D7JA 1M7OA 1G01A 2UV8G 1VIWA 2X2YA 1H50A 1JRBA 1TO3A 1NQKA 3VOFA 1W1A1 2DY3A 4HYRA 1FKXA 4DJEA 3ZWTA 5EU9A 2QCGA 4L7ZA 3Q58A 2LPVA 1R3QA 4N19A 4UTWA 3SN0A 2PUZA 3MUY1 5B7ZA 3LBOA 4WDWA 3STEA 3T8LA 1K9EA 1MI3A 2Y6ZA 1BG9A 1SGJA 3CPGA 5FKYA 2ALDA 2E28A 4ILSA 4YVVA 4XBSA 5HJXA 1A53A 3SIMA 1EA0A 3VILA 4JFVA 4DF1A 2WKGA 3AU2A 2WHLA 3VZXA 2X05A 4NZCA 4WHBA 4XD4A 1NWTA 1A4MA 1T0OA 2CPUA 4FX7A 4NJGA 3SW6A 5D2WA 3BW2A 3HJEA 4G7FA 3ZR4A 3S5ZA 4WLCA 3UWUA 3E2RA 1TPB1 3F5LA 3AC0A 2VR5A 1JYVA 4Z0JA 2VX4A 4KMQA 4L1XA 2G97A 3SSZA 1XPYA 3VXGA 4Y9OA 2V3GA 2YW4A 5AN7A 2VR2A 5CBJA 1R6WA 4CQAA 1AH3A 1ZZMA 1D8WA 2E9BA 1DKWA 3N19B 2ZFAA 2QCMA 2ZE3A 1OQFA 2XVPA 1V3KA 4QRNA 3A24A 4LAXA 1HO1A 3B04A 2ISVA 3ECQA 1B3ZA 4UOJA 1C8VA 1Q45A 1LG1A 4EP8C 2Y0FA 4IGNA 4E2DA 3UF8A 3N29A 4DAFA 3CEUA 2E5CA 1HJWA 2OODA 3UXDA 1Q6OA 3O6DA 3CV7A 4KEUA 1A5OC 3L5LA 5IHSA 3OP2A 4GHRA 1OX4B 1OM0A 3EA2A 1QT1A 1XIFA 4U5IA 1Q7MA 3H54A 4W7WA 1YX1A 1VFLA 2ABAA 3V7PA 3GC2A 4XAKA 5A2CA 4C6PA 1XRFA 1F3EA 3LD5A 4TTUA 3PBUA 1F73A 3O5MA 3N11A 4EPBC 1BVZA 4DLMA 4JKMA 1H51A 3DFNA 1EJXC 3L4TA 3HU7A 3VKKA 1EA9C 2VGBA 4M24A 3VMOA 1NWRA 4LY8A 2DVTA 4UNKA 3NEHA 4UFKA 1U5VA 2BP1A 4S3JA 1LBFA 3VNKA 4CD6A 2WC3A 2X7WA 3TMLA 1BFNA 2R6OA 3GXPA 3RJYA 2YA1A 1EBGA 3W53A 2MF9A 2ZQ0A 2WBGA 3ZT5A 1XG4A 6ENLA 4QLJA 1YE6A 2X16A 3TQ0A 3TSMA 2G4FA 1S1RA 4EE9A 5ECVA 1YW5A 3VIMA 4E38A 2HWGA 4DBSA 3SGUA 1LT8A 4NJHA 2JBMA 2WZMA 4K38A 2QGHA 2OR2A 4RNIA 4S2CA 4MWAD 4RDYA 5JBFA 1OABA 5HPOA 2PWHA 1W6TA 3UD6A 1PCKA 3TTYA 2BOFX 1M65A 5H6HA 3WJSA 3HV9A 1RA0A 1UWIA 3BL3A 1YTKA 5PTDA 3SJ3A 2I5QA 3AIRA 3C2VA 4QIUA 1DJWA 4G1KA 8XIMA 3SI9A 3NQCA 3R79A 4Z1YA 4LQ1A 1JNTA 1LTDA 2ZXBA 2C19A 5KINA 3P8IA 4GOAA 4G7EB 2KR7A 4YTRA 3ABQA 3N6HA 1HQTA 1CB2A 2VFEA 4LJ3A 4ICNA 3XIMA 3GXFA 4AF0A 5CQ1A 1MW1A 3T42A 2CLHA 1MO0A 5DBUA 3URAA 3VZYA 4JN7A 1W2PA 1PX4A 1L2UA 2VC7A 3GIQA 4JNYA 2DG4A 3D5HA 3OHMB 3CUGA 1PJ9A 2PEVA 1SO4A 3N2CA 3A9BA 3WQ4A 1GWJA 4GYKA 4HK5A 4YLWA 1EJ7L 4NP7A 2YDRA 3CGNA 4EANA 2WM1A 3N3TA 4CGTA 1OWQA 4URIA 3QTPA 3FA4A 1WZMA 4MB5A 3VNDA 3GVVA 3LCIA 4MAZA 2B7QA 4NAFB 3FK4A 4DJFC 4H9YA 4PODA 1R2SA 1FBAA 1V3IA 3WSUA 3I6EA 1SO3A 4GIEA 1J4EA 1XKYA 3PFMA 4LYPA 1YNQA 2XGZA 2OOFA 5D2TA 3WF1A 4H7CA 2HE8A 3I3EA 3MSRA 1I2RA 3V16A 3ZYZA 1E4LA 4E2OA 1HL2A 2ACSA 1WBJA 1HF6A 3HTWA 3T2QA 3WD3A 4V15A 3VD3A 3H2MA 4JCLA 5HULA 1X8FA 3OPSA 2GWNA 4O18A 1RBOB 1Y8BA 4JFLA 3GVGA 3LGEA 2ATMA 1DJXA 4S2BA 5KEZA 1ZENA 4S3KA 1ECEA 3RLGA 4EPKA 3STCA 4IPIA 4CNUA 3USZA 4JX6A 3LTSA 4M7SA 5F2LA 1LBLA 3EKZA 1EO5A 2J7HA 2A1YA 3MHFA 5K9CA 1MW3A 4AG0A 1NIUA 3OBKA 1IV8A 3S6OA 5HR7A 1J01A 3PNZA 4AIUA 3NI6A 1RQBA 3GAYA 5FIPA 4W9TA 1CGVA 3AYVA 2REQA 3LB0A 2G37A 3HOJA 3KBSA 5GPGA 3WDHA 3POCA 4LVFA 3FDKA 3KLKA 1IXQA 1V6TA 4IJBA 3H12A 4YTSA 1TQJA 2X09A 3A6OA 3VGHA 2WNZA 1YEYA 5FF4A 2QAFA 1SJDA 4JFJA 1RXOB 3PJTA 3I3BA 3WL0A 1AZ2A 2XN1A 3MVTA 2ZA3A 5ABTA 1J4RA 1UA7A 1XQKA 2RSEA 1XL9A 3EXTA 1DWJM 4M19A 3PN8A 1VRDA 2E0PA 2EQDA 5HPCA 3VTRA 3B9AA 2ZRYA 2DSKA 1IEQA 3WJYA 3BLKA 3ITOA 1VPYA 4HQVA 1R3YA 6ALDA 3M1ZA 1XH2A 2YJQA 1GQKA 1XYLA 3TZFA 4C6QA 3CJPA 1Q6FA 3EX6A 2ZX9A 1BSIA 2OSYA 4UCGA 3TTEA 2Z1VA 4CN4A 2QUVA 3VDCA 4AZCB 2PBOA 1SUXA 4QGCA 1QNSA 1ODUA 3ATZA 2Q02A 1W0MA 1DHPA 4V27A 1SO5A 2A4AA 2W27A 2XH2A 3E96A 3MC5A 3BLFA 2OQYA 2Y62A 2BY3A 4ODMA 1JUBA 1G6CA 4ZQPA 2PV1A 2ZZ7A 1C7TA 4EKJA 4C1LA 2VURA 4GXMA 3WQPA 4RV8A 3FA5A 2VFHA 2QPUA 5CAKA 5DMLA 2HVMA 3W1NA 4UDMA 4AZBA 3JYJA 3MO7A 2PLJA 5EMYA 1EEPA 1B6CA 4RCXA 4IMEA 5IDIA 5TQLA 2PP0A 3KP0A 3DHDA 1XQLA 4KWSA 4CN6A 2WZEA 3KL5A 3GUWA 3RMEA 5LHEA 1XLIA 1WV2A 4ERAA 3V1HA 2GGEA 2CBIA 3DKJA 4PUMA 1OFRA 1FWGC 3GDMA 4FPSA 3TR9A 3NAVA 1Q6HA 5EYWA 1ROTA 4B9YA 3GXIA 3PF3A 4QR6A 3F4WA 2ZX6A 3W85A 4JTQA 6TIMA 1MXGA 1LRNA 1I1WA 2VZUA 2XIBA 3UZXA 4LUTA 3VNIA 4MWAA 3RLUA 3T44A 3TX9A 3BLLA 1OYAA 3CS2A 3B06A 4KEZA 4NZ3A 2V5KA 3JU2A 2VGGA 3AZTA 1W3LA 4D1JA 1M3UA 5LGZA 2NLIA 3DERA 3MU7A 4MUPA 3O5KA 1L6YA 4JN6A 3O3RA 4ICCX 1TJRA 2AAMA 3WFLA 3P5ZA 4HHLA 2BNJA 4KKXA 3OLDA 2XP3A 5CGMA 2FB2A 3ABXA 3EPNA 3MANA 5I5RA 4WY0A 1FAPA 3UR2A 1ZBCA 4XKMA 3KAHA 4R7WA 4XQ6A 4B3ZA 1KGUA 4DUXA 4IGMA 2A3BA 3MI3A 3CQIA 4QDPA 5LNSA 4W8BA 2C0AA 3LYEA 1DJYA 1F7BA 4AY8A 3K8MA 4BI6A 1MEIA 1GGOA 1YDNA 2XG9A 1ZPTA 1BTCA 4DYEA 1K9FA 3ARWA 3LBCA 3QFWA 4PFMA 3E0VA 3KEHA 2VDIA 3NJ3A 3MZ2A 4Q7NA 1WZLA 4DY1A 1REQB 2CZFA 2E6DA 2PWGA 3THAA 2JFEX 2FAPA 1JXKA 1J12A 1OF6A 1IEXA 2WJFA 4ORMA 3UESA 4ZS6A 2DG3A 3MJYA 2G3NA 1BTMA 4PUJA 1H0GA 1P43A 4HIBA 4LW7A 3GNPA 1LLOA 4ML9A 2PBCA 2GJRA 1RCQA 3VM7A 1GW1A 3S5YA 3CEPA 2GJXB 5FJTA 3CV6A 1W1VA 2WBKA 4K8EA 1UC5A 3LS9A 1EKOA 5LA2A 1AH0A 3IHZA 1QI3A 5CKSA 1EP3A 1DP0A 2PWVA 3DGBA 1E1CB 3F4VA 4HPNA 2WHMA 1TYGA 5CPSA 4MFDA 3UG5A 2YXXA 4JQ2A 2CFFA 3LCFA 3CWHA 2CU0A 5DQPA 1UG6A 5BXRA 5DIVA 5F4XA 3SCVA 1EB3A 1TRDA 4AD0A 3BMBA 1TR9A 2XPBA 3ARPA 4WUIA 3S9YA 3SCSA 5BOFA 3C52A 4E2BA 5DCDA 1FKFA 3KCEA 2O56A 3S42A 3LLFA 4Q4PA 4W8AA 4AVFA 4OVXA 2DH3A 1MQRA 3D46A 4Q4RA 4G5DA 2YCLB 5AC7A 3BC9A 2HXUA 1O5XA 3BV7A 1XG3A 1GPWA 2RJHA 1CPUA 2JGQA 1PX3A 1U1JA 3QYQA 1GQIA 1BKFA 1OB0A 3PS7A 1QPRA 4H9XA 1OK4A 3NQVA 1AL8A 1UROA 1XW8A 3AWNA 4KEVA 2CESA 4AHQA 4UQ9A 3KOXA 2PMQA 1PIIA 4DAIA 3WF0A 1RD5A 2CHRA 2HMCA 4HCHA 3UWEA 3M47A 3OGSA 1DWGM 3QZAA 3AQUA 3QPYA 2YCKX 2GOKA 4IT4A 1OD0A 3DFQA 3NTPA 2PWFA 1B4EA 1XD1A 4U86A 5ABFB 3E2SA 5KTLA 4N02A 4O53A 1R3SA 1WZAA 3G8EA 3THCA 2O4QA 2E6YA 3O05A 3PBGA 4H6RA 2Z0IA 3QLDA 4DELA 4UTLA 1HN1A 1TCMA 2QV5A 1FKWA 1UB3A 1YYAA 2AQWA 3C0LA 4F4RA 4AC7C 3GQYA 5I7GA 4UQEA 3AMKA 2P3EA 2OYMA 1O5QA 1ONEA 3F1QA 2WW5A 3B9EA 1NAL1 4HMCA 3PJXA 3PA7A 4AFYA 1YE4A 5BRBA 5I23A 4DJEC 1UKQA 1Y65A 3QTGA 2FDMA 3KZPA 4XZHA 4UTWC 4JFIA 4Z42C 3RMJA 4HJWA 3UR8A 3SADA 4MSPA 4AWSA 5FJPA 3O8AA 2IPGA 4KWOA 3IIVA 1JFHA 5L6UA 5XIMA 1TTQA 3LEPA 1Q6RA 4LANA 4JFWA 4O1AA 4M29A 1XD0A 3BE7A 1N8WA 1TCOC 3K1GA 3OO2A 4HNLA 3V1PA 3TN5A 4AEOA 1JCTA 4C7FA 2CZ5A 4IFOA 4XUYA 4NYUA 4O1DA 1TREA 4OV4A 1EWEA 3RRXA 1FP9A 1EJVC 4ZO9A 1PKNA 5KZMA 2D2OA 2XJ7A 1X1OA 4R7OA 5DMYA 4F8XA 3U8GA 1ZBKA 2J13A 3CHFA 1TPUA 3O7UA 4MM1A 3VOJA 1V02E 4DRPA 1C29A 1BYCA 4EWJA 3EWWA 2ZVRA 3L5AA 3AJ7A 4DRIA 1L1PA 2V5LA 3B9DA 3IV8A 1QMLA 2E40A 1SFLA 5KZDA 3SQMA 4D6CA 3L7RA 1FWNA 1JYXA 2SFPA 2QS8A 3EY6A 3F4CA 4PRRA 1AQHA 2YDSA 2X8RA 1TV4A 5D9NA 1UBPC 4ATDA 2OX4A 4IIFA 2PGFA 1CECA 3P62A 5LNUA 2XP6A 2ABBA 3GRIA 4EXBA 3EIPA 2ZIDA 2XP9A 4B5UA 2C14A 3TYEA 1F05A 1Y5WA 1U5HA 2OO0A 3OOBA 3EA1A 1ZAHA 1GG0A 1EL3A 4POCA 2WSKA 3W7HA 1WKFA 3GYCA 2F61A 4NYYA 3S1VA 1FHVA 3FS2A 4PUEA 2OYLA 2CLLA 1RLCL 3N6QA 1W5NA 3NURA 3BG9A 2P8BA 2XDFA 1OC7A 4WKFA 3GKAA 4IM4A 3N2TA 3UZJA 2BOEX 1QDSA 1KCXA 1BG4A 5CLTA 1WDWA 3GZAA 2DGAA 3UWQA 4U3CA 5I3FA 3VKDA 1P1XA 4NVTA 4L6HA 5LIUX 3HZ3A 3NPXA 1TWWA 5AB3A 1KQYA 2UBPC 2V3FA 1V3LA 3VGGA 2D23A 1PL9A 1DEDA 2C79A 1Q2SA 2Z00A 2Z4GA 2CZEA 1KTNA 1H61A 3ZJ7A 3CV2A 4IIHA 4DJDD 3TZNA 4HMNA 1JZ4A 4TX8A 2OLHA 5LIWX 4PC8A 1EYMA 4MJMA 1A0EA 4AIOA 3M0ZA 2GVYA 1PTGA 3VE7A 2E9LA 5M5DA 2WSQA 2MANA 4JTEA 2Q8XA 1ZHAA 3W7KA 1FCUA 4GGHA 4KFOA 2WQPA 4M3PA 2J77A 4UFHA 3WEMA 1BKHA 4LRTA 1QI0A 5BXTA 2DUZA 3NXFA 5D8ZA 1UOKA 2VDHA 3M46A 2P4VA 3IK4A 1UD6A 4CEUC 1EBHA 1T8QA 4G6CA 4XBJA 3UGVA 3F2BA 1XBXA 3EA3A 1HG3A 1AVAA 1EUAA 4BJHA 4PB3A 2YR1A 2XVGA 5A6KA 1JL8A 4H8VA 5TNVA 3CT2A 4EK7A 1H2JA 1YTEA 3UFYA 1XICA 1K7XA 3WJWA 1H7PA 3ISIX 3KP1A 3TLQA 4YVXA 3VKAA 2FYMA 4WVXA 1VR6A 3KDNA 3G77A 1SZNA 2XZ7A 5DXYA 3LQLA 3PZTA 2YYUA 3EZ4A 1KM1A 3TOPA 1EJRC 4L6OA 2CKRA 2PDWA 1LRTA 3QHOA 2QUNA 1JZ7A 3TP4A 2C7FA 4OZOA 1HL9A 2CERA 3GH7A 1RH9A 5DN1A 1F6YA 1WDSA 3T7VA 4HBEA 1D9EA 3C2OA 4Y96A 2OELA 5E0CA 4DBDA 1P1MA 1W54A 2Q3RA 4MDPA 3FAXA 1PINA 3U7BA 2WPBA 2Y5SA 2ISDA 4EIVA 4ECLA 2BY0A 4KETA 2O9TA 2OMAA 1RALA 4GQBA 3WDJA 2W63A 2YX0A 4H6KA 4ACZA 3GKFA 4GG9A 1QPNA 2EPOA 3SIZA 5HANA 4CU7A 5CLWA 2NQ5A 4N7QA 3GK0A 1IWAA 4LAYA 1YXDA 4UFJA 1L0PA 2NQHA 4IPNB 1G4TA 1J93A 2CLPA 5AHNA 2ZXDA 4NX0A 4ADUA 4JICA 3QHMA 2DZUA 1M7XA 3L4XA 3UJSA 2GQ9A 2LKNA 1DVJA 2ATSA 1NH6A 2J9XA 1E4IA 4R7JA 2J74A 1XLHA 5D9OA 3WEZA 3WK3A 3R11A 2ISFA 4PE8A 3UQBA 3BWWA 3SN1A 4QIBA 4IT1A 3UQIA 5LIKX 4AF0B 4GA8A 3MQTA 2VXNA 4JEQA 5FJJA 3Q67A 4AZ6A 3UVAA 3LN3A 1I2OA 1N8FA 2H8XA 1F9CA 2ZUVA 1OD8A 3ARUA 1S2CA 5I3JA 4CQBA 5KITA 1UH2A 1H7OA 2DT3A 5DY2A 1NVMA 4GH3A 3VMNA 3DBNA 1ZJAA 3W01A 4AZGA 3VIGA 4RJEA 1XF0A 2ALRA 4XG1A 1CLKA 2CWNA 3G1AA 2OZ8A 4DHGA 1Q8JA 3SURA 1KBJA 4XVDA 2PTDA 3UQAA 4C90A 1GOIA 5CZSA 4IX0A 3QC0A 3GLCA 1X98A 3L23A 1JCLA 1A5UA 1QO2A 1R87A 4TTGA 3B4UA 4M6UA 2OB3A 4ODNA 3UI6A 3ITCA 3B05A 3M0MA 3NGFA 3DI0A 7CGTA 3S47A 1TV2A 4AZHA 4AY1A 2CITA 1SFJA 5A69A 4U3AA 4DPQA 1T99A 3DXIA 1XDJA 1FKTA 4DRHA 5HOSA 3M5ZA 1RP8A 3S83A 1V77A 3IGSA 1VFHA 5A6JA 3QW4B 1U30A 3BK0A 4GQRA 2PCEA 3CASA