1HKKA

High resoultion crystal structure of human chitinase in complex with allosamidin
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
364
structure length
364
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEQSGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Allosamidin Derivatives in Complex with Human Macrophage Chitinase.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords CHITOTRIOSIDASE-1
total genus 132
structure length 364
sequence length 364
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1hkkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hkkA01
2ZIDA 3CHFA 4UOZA 1H1NA 1RP8A 2D2OA 2EXOA 5BRPA 2XWDA 3L4ZA 2CITA 4W7UA 4UQEA 3SUWA 3MS8A 4BA0A 1H2JA 3CGTA 1MW1A 1NOFA 1XCXA 1GOQA 3BCFA 2J62A 4LXFA 1J18A 2XFRA 4E4PA 1R8LA 2CXGA 4W7VA 1KR1A 5I78A 1JAKA 1JZ7A 1XYZA 5DFAA 5A6LA 4P8WA 3QHMA 1BYBA 4OJYA 4BQ2A 3CZGA 3EMQA 4W8LA 5DMYA 1KQZA 4AZCA 1HJQA 2XUCA 3GBEA 3WBAA 1CXHA 1SMAA 1DP0A 2WKGA 2ZUMA 2WSPA 3AIVA 5D9NA 3SCSA 1UKOA 1VF8A 4QAWA 5A8QA 1UD6A 1HXJA 1UD4A 5A3HA 1EDTA 2VO5A 4TXEA 3CZ8A 1TA3B 4LGXA 2XHYA 2PI6A 4PEEA 2PWDA 1E0VA 3PN8A 4JCMA 3ARYA 2WVUA 3QR3A 4AIUA 3ZJ6A 1OINA 2V5CA 1GVIA 1VEOA 5FCZA 2O92A 3VU2A 4GXPA 1C7SA 1D3CA 5EB8A 4B3KA 1IV8A 2WMFA 2E8ZA 1JFXA 5E6ZA 1G01A 4MB1A 1UD3A 2WZIA 2XIIA 4DUVA 1OT1A 3WL0A 3K4AA 2GK1B 3TONA 1HL9A 2EJ1A 2X8RA 3RCNA 2CEQA 1V3JA 1JZ6A 3LPGA 2ZX6A 4FLSA 2WPGA 1G5AA 3PZNA 3VIKA 2DSWA 1ZBKA 1UQZA 2CESA 2VI0A 1ZBVA 1EHAA 3I3BA 4EE9A 1JDDA 4Z2KA 2V3EA 2J74A 4HU0A 3WQ4A 4W5ZA 3VGBA 3DYMA 2O9PA 4X0NA 3MMUA 2OLHA 1XD1A 3FN9A 3L4WA 8CGTA 4DWSB 4D6JA 4AD3A 2XM1A 2FGZA 4WJXA 1C90A 2VCBA 1JZ3A 2JE8A 3FNDA 1B30A 4D1JA 3AIUA 4FK9A 2VQUA 4DWSC 4GI8A 3AMGA 2VR4A 2X09A 4D6IA 3EYPA 1WNOA 1CIUA 1JF5A 1W9PA 3LPOA 2PB1A 2DT1A 1VEMA 3AOFA 3LPPA 3U5UA 1SR0A 1CGXA 1WO2A 2W63A 5CXPA 4Z2JA 4PTXA 3LPFA 3UG3A 1CXLA 2YA1A 2WMHA 3T08A 3AYRA 4AD4A 4J7RA 1HJSA 2WMKA 2A3BA 1VFOA 1LL4A 3N04A 1ZB5A 1B0IA 3IJ9A 5E0CA 2DSVA 3F5KA 3VD4A 3VIMA 1E5JA 1UYQA 1B90A 2FGLA 5FL1A 4RE4A 3RJYA 4BF7A 3WDQA 4D1IA 2YJQA 4HMCA 1OSEA 3WMCA 3OB8A 1BG9A 3WF3A 4H04A 2G41A 4JKMA 4U33A 1QBBA 4XUYA 1GZJA 3L4UA 3F4VA 5CG0A 2JIEA 5JIWA 2GJXA 1UD8A 5FKYA 4AYSA 1HJVA 3OGVA 1CNVA 4Z2GA 1ITXA 2VNCA 1E6PA 4JHZA 4D71A 2WHMA 4N42A 3RDKA 1KBBA 3L4XA 3GTNA 2UY5A 2WWCA 5E70A 1MQRA 1NP0A 4OUEA 3ZIZA 4HMDA 3SUSA 2GK1A 1HT6A 2F2HA 4J3WA 1QNPA 2CPUA 1GCYA 1US2A 5AYBA 1IT0A 1UR9A 4GPNA 1I1XA 3BAWA 2ZXAA 3T2QA 3W29A 1E0WA 2OYLA 3MMDA 2XYLA 3B9EA 2WMIB 1RP9A 2WMIA 1GORA 1V3MA 3PTMA 1R87A 4U5IA 1UUQA 4W85A 3U7VA 5I23A 3FXYA 4WKHA 1UR0A 3GXFA 2A3AA 1LF1A 1WZMA 1DWGM 4HMEA 1HL8A 1ODZA 4AZ5A 5JH8A 5A6SA 2ZUTA 1UR2A 4PCTA 4C7DA 4HTYA 5A1AA 3AICA 2EPLX 4UR9A 2ZX8A 4D6HA 1Q6CA 3WMSA 1ISXA 3BXWA 3W81A 1FOBA 1F4HA 4PCSA 1CBGA 2Y8KA 4FLRA 2G3MA 4JFUA 2DH3A 2XFYA 2ZX5A 4JZ5A 1BAGA 3VMPA 1R7OA 2QMJA 3VGFA 4MNJA 1UG6A 4A3HA 3WNLA 1ISVA 1G94A 1QVBA 2WC4A 3WH9A 1A47A 2EPMX 2WHJA 5BWFA 4AZ7A 3VX1A 1D2KA 1KGUA 3GYCA 1CXKA 3VM7A 1EDGA 1E1EA 1BG4A 1G1YA 1C8QA 2WBKA 4LPCA 5IXEA 4P7LA 4ZE5A 3WH6A 2BY3A 1LJYA 3N17A 1HKKA 3PHAA 1H0IA 3PTKA 4NI3A 1FH9A 2DSKA 1DTUA 4CN6A 1E43A 1JD9A 3CPUA 1CXEA 4CU7A 3WKZA 3CHDA 1FHDA 2PF0A 3OZPA 2C8NA 3DHUA 5HOSA 6A3HA 3W25A 5BCAA 3QHNA 2MANA 3VIIA 5FIPA 1KB3A 1V02A 4ATDA 4CD7A 1FFRA 1HJXA 3WELA 1BF2A 2YDSA 4A4AA 1BYDA 2YLAA 5BYWA 4CGTA 2ZUWA 5LA1A 1NH6A 1J0YA 1ISZA 3GDBA 1HKJA 5FOOA 3SCUA 3GXIA 2XVGA 1UWIA 4TVUA 2YDQA 3APGA 1CLVA 2CBIA 1ISYA 3T2OA 1LLOA 1BVZA 1OM0A 2WXDM 5CGTA 3CHEA 2BY0A 2DDXA 1P6WA 3NCOA 5D4YA 2XSBA 3EMZA 1HJWA 4WKFA 3BLKA 3SIMA 1EOKA 2TAAA 3WENA 2WC7A 3AYSA 5DO8A 4MPKA 4PTMA 3IAQA 4UCFA 1DWAM 5HBFA 3MKKA 3AQUA 4QCFA 1OGBA 5D8WA 2XGBA 1NWSA 3VVGA 2VZVA 3AIQA 5A6KA 4KRUA 3N9KA 1D7FA 2EO7A 1W1YA 2E9MA 1E6ZA 2C0HA 1MYRA 1W32A 3UESA 3FW6A 3WD2A 4HOZA 3PZTA 3WL1A 4KMQA 3FY1A 1WCGA 3WEZA 3PBGA 3W28A 3M7SA 2G3JA 3CUJA 3ZOAA 1UH3A 1UH4A 4B15A 1HX0A 4UQBA 1JZ4A 2XPKA 1C7TA 3AS2A 3AHVA 5FL0A 3VIHA 4U2YA 1E6QM 1GJUA 1JFHA 2HISA 4MAZA 5BXTA 2X1IA 5HXMA 1WZKA 5KZ6A 1B3ZA 3WF1A 5A6JA 2WANA 1DHKA 3UG5A 2EPNA 4GZEA 4EK7A 2CERA 3VGHA 2WCAA 3MUZ1 3CUHA 4HU8A 1CYGA 4PYSA 1QHPA 3POCA 4AXNA 3CLWA 2ZXQA 3KWXA 2W92A 3ARTA 5A2CA 4QFUA 1W2PA 3BH4A 4U2ZA 3VO0A 4M1RA 4ZXOA 1E0XA 1UKPA 2QV4A 3A6OA 1UA7A 4GO8A 2WZEA 1DWJM 1M53A 1WE5A 3PZIA 3OLEA 4RE2A 5KEZA 3MU7A 3WSUA 2VX6A 3OG2A 1PX4A 2J25A 2QPUA 4PMOA 4AW7A 3BAKA 3HU7A 1L0PA 2IXUA 4JFTA 5CPQA 2G3NA 1QHOA 3NDYA 2BVDA 1GPFA 1ESWA 2XVNA 1GQJA 1LG1A 1H41A 3K8MA 3TOPA 4BCEA 2WYSA 3PZGA 1V6VA 5A6BD 3WEMA 3F5LA 1HP5A 2QPSA 1HNYA 1BYAA 4ATLA 1KXHA 4K68A 4CN4A 2D0FA 7TAAA 1MFVA 3ZSSA 4KH2A 4TUFA 2VRQA 1EH9A 1NARA 4E8DA 4KRTA 3IAPA 1E4LA 1B2YA 2Y8VA 3KZSA 1R86A 1JAEA 1JZ2A 5CSUA 5I79A 4ACZA 2ESCA 2J75A 2GJPA 1NWTA 1EXPA 2J8GA 4F9JA 3UERA 1HN1A 3PTQA 5AC5A 3CMGA 3OA5A 3WFZA 1E6NA 1Z32X 3VD5A 1V0NA 5A2BA 2ZWZA 3SUVA 4H2CA 1IZKA 2YL6A 1VIWA 3FHAA 5IHSA 4JCLA 2DT0A 1H11A 4QCEA 5C70A 2FHFA 4F9DA 4D72A 3BSGA 3WFLA 3ARQA 4ML4A 1C3FA 5LA0A 4JIEA 3PZ9A 3OZOA 2WVVB 1JGIA 3ZT5A 3EDEA 1UR1A 4MNMA 4CCEA 4BZYA 2BV9A 3L2LA 2WMJA 4P7OA 3VPLA 1QBAA 2VL4A 4YN5A 5I2UA 2ZOXA 3WQVA 1NWRA 4DWSA 2ZX7A 2G3IA 3CZEA 3VMNA 5A6AA 1CGWA 2O9TA 1ECEA 3DC0A 2EPOA 5DEZA 5ABEA 4CUCA 5DT7A 1TCMA 3KE0A 1TVPA 4P7NA 4UOQA 1TUXA 1HVXA 3ZSTA 3WY1A 2JF7A 5I5RA 5D9OA 5FD0A 2W66A 2PBGA 2OYMA 3SURA 2D23A 2DT2A 4LQ1A 1NWUA 2BHZA 4ACYA 4PMZA 4HPGA 1UWSA 1RH9A 1GUVA 3RJXA 1K9FA 2OWXA 1LQ0A 2X0HA 2C7FA 4B9YA 3WNNA 3ZO9A 4M56A 3TTSA 2A3HA 4PSRA 1CTNA 1UWUA 3ZT7A 1KWKA 1KQYA 4Y7EA 5GNXA 4ZEPA 4MB5A 1UZ4A 4ZFMA 3W37A 3QOKA 3GNRA 2WCGA 3RM4A 2BVTA 4AZGA 2Y5EA 2ZUSA 5ABHA 5CPSA 4UZUA 4W8AA 3AXHA 1KGXA 2J7BA 3CHCA 1Y7VA 3WF4A 1GVYA 3SCVA 2WB5A 1A3HA 2D0GA 4W7WA 3N11A 3T0DA 3K8LA 2CBJA 2FHCA 2VZSA 4UZSA 1BFNA 4CN1A 2WBGA 3WQWA 5EFDA 3ARSA 3WDJA 1WZAA 1GOIA 4DUWA 2UWFA 1EDQA 1W1VA 2JEPA 4NSBA 3RO8A 4M8UA 1BHGA 4OKDA 2WHKA 2F61A 1V0LA 1WZLA 5A8MA 2G4FA 3SCRA 5A6BA 3THCA 3GXDA 4GKLA 4CVWA 1KWGA 2D3LA 4XZWA 1MW3A 5ABFB 2E9LA 2XWEA 5HPOA 5M5DA 2OWWA 5M03A 5HPCA 1H4PA 2ZXBA 1PX3A 2XVPA 4HZ7A 5A8NA 4WK9A 3EBVA 5F7UA 1LWJA 1MW0A 1PJ9A 1QOXA 2WW5A 1MVYA 3SCTA 3S2CA 1E4NA 2AAAA 4J3SA 1VBUA 3BAIA 2YLLA 5A69A 1S46A 2ZWYA 3FAXA 1V03A 1EHNA 4PMVA 3ARRA 1TFVA 2J78A 1H49A 1UKTA 2W61A 3MUY1 4QDMA 4YHEA 2WZHA 2WK2A 2GVYA 2XIBA 1VAHA 2CETA 4H41A 2WM0A 1EO5A 3VIGA 4PUDA 2QMKA 3K8KA 1RD6A 1JXJA 2O9RA 3E1F1 3IANA 4UFLA 4UTFA 3ARVA 2FH8A 1JYWA 3SUUA 1E3XA 1XYFA 4PMNA 3WIJA 2VRKA 1E72M 2EBNA 1J0JA 1SFSA 2D24A 4F79A 3CZKA 5E0FA 4ACZB 1WP6A 3DYPA 4JHOA 1X1NA 4AEFA 2AMGA 1OT2A 4AD1A 2GFTA 2PWGA 2E0PA 1FFQA 1EO7A 5AC4A 3MO4A 3EDFA 5BXPA 1J9YA 4AC1X 2JALA 1FP9A 5A8PA 2CIPA 1NQ6A 3PZMA 2VT0A 2WKLA 3AZSA 4PTVA 5TD4A 4MNLA 1ITCA 2J7GA 4RE3A 2RGLA 9CGTA 3EDDA 1XSKA 3QOMA 4TX6A 8A3HA 3LMYA 1QI2A 2QF8A 2GUYA 1OBAA 4TOQA 1WAWA 4OOZA 1JDAA 1CGVA 1JI2A 3J7HA 4AD0A 4IPNB 3IK2A 2VX5A 3B8SA 3VOCA 2W67A 2J4GA 3W0KA 1QHZA 2VTFA 4HZ6A 1QW8A 3SCQA 4WSKA 1V3KA 2EPKX 3HN3A 4ZENA 2PWHA 1E55A 1CGYA 2VR5A 3GNPA 5D9PA 5DT5A 4W89A 1UQYA 1V6YA 2DSZA 4H7VA 1C8XA 2G8ZA 6CGTA 5M3WA 3AFBA 5GNZA 3T09A 1GQIA 3F5JA 4D6DA 1H0GA 1OCQA 3U7BA 4AIEA 3UG4A 3CBWA 1LWHA 2EQDA 1GW1A 2WCSA 4XB3A 4B9ZA 1OIMA 4PMUA 3TTQA 2A3EA 1E4IA 1W3JA 3GBDA 1X6LA 1KGWA 5IFPA 4BQ5A 4W86A 2XJ7A 4JFVA 4CVUA 4FLOA 1EIBA 3W38A 1CXIA 2A3CA 2BFGA 1KXQA 3A4WA 3VDHA 3OLGA 1AVAA 2X05A 1J10A 3WNOA 2WWDA 1TMQA 7A3HA 1JZ8A 2BY1A 1BGAA 4URIA 1UR4A 4QLKA 3AHYA 4PUEA 1V3HA 4JKKA 5LA2A 3PZUA 3AMLA 1OD8A 1KCKA 1K9EA 4WF7A 1XC6A 4L4PA 1BYCA 1BGGA 4GIAA 3CUIA 1K6AA 3CUFA 3O9NA 4W88A 4X0VA 5I77A 1E56A 1SMDA 4X9YA 3GH7A 4LYPA 4B16A 1TZ7A 2OYKA 2VUYA 1H09A 1E6XM 2V5DA 2Z1KA 4BQ4A 1TG7A 1YHTA 1J0HA 4AMCA 4XZBA 2BNJA 1M03A 1DWFM 2VC9A 3AIWA 4PTWA 1W3LA 1YQ2A 3BAJA 1W3KA 3W4RA 5BXRA 4C7GA 1E9LA 4RL3A 3W53A 2DSUA 3W26A 3UETA 1MXGA 3ARWA 1Q4NX 5D8ZA 3VGDA 2FH6A 2CKSA 2WC3A 3AS1A 3AHXA 4HOXA 3AISA 3WH5A 1BPLB 1QNQA 1M04A 2E40A 1CPUA 2VOTA 4MJ2A 4CU6A 1WKYA 4S3KA 1VENA 2X2YA 4CD8A 4Q22A 4D6GA 2CYGA 3AMCA 4UQ9A 4JL1A 4M82A 2IUZA 2F8QA 2W62A 1K9DA 2E8YA 5CSYA 3I3DA 1GOWA 2DEPA 1QI5A 3O2LA 3I3EA 3WBEA 2PBOA 3FAWA 1BVNP 1V0KA 1FH8A 1GHRA 1B9ZA 3VGGA 5A8OA 1O6IA 1VB9A 3THDA 3KL5A 3GXMA 4EANA 1BQCA 1NOUA 1VFFA 1UOKA 4HP5A 1TR1A 2XM2A 2XSAA 2J47A 4UFKA 3N18A 2VX4A 5ABGA 1AQHA 1V6UA 2VZOA 2GJRA 3CMJA 2D3NA 1QNSA 2J79A 4HA4A 2JFEX 3A4AA 5BXSA 2B31A 3ZJ7A 4UNIA 3W27A 2WAGA 5CPTA 4TTUA 1US3A 3VD3A 1N82A 2VVSA 3AHTA 1QI3A 1PIGA 2YDRA 3W24A 3ZMRA 1C93A 1GOKA 6TAAA 4W87A 4AY1A 3MANA 2CHOA 1J0KA 1R7AA 4M81A 4BQ3A 1G9HA 1NP2A 4W84A 1BSIA 3T0BA 2VURA 4V27A 1HKIA 3IJ8A 4WLCA 1VJZA 2Z1SA 3GM8A 1V02E 5HDRA 4Q7NA 2VZTA 2VCCA 4BS0A 1JI1A 4U31A 3WQ5A 3WUGA 2J7HA 4MNKA 1XH0A 2CBVA 1WB0A 1J11A 3AXXA 2VZUA 4R27A 1C92A 2WVVA 2BHYA 1UKQA 3AIBA 3NJ3A 3VINA 1B1YA 1WPCA 4OIFA 4B3LA 3SCOA 5GQBA 3G6LA 4ZXLA 1CGUA 1V08A 3VIFA 3WDPP 4PMRA 2FDMA 4AZBA 3NSNA 1W9DM 4HPHA 4UQAA 1OD0A 3BLPX 3VILA 2ZE0A 1WDQA 1W9UA 2RGMA 2E4TA 4NZCA 2QHAA 4P8VA 2BXYA 2CKRA 1FA2A 1W9XA 3RM9A 1J0IA 4AZCB 5EBAA 3VNYA 2V3DA 5I6SA 4L4OA 4M29A 2WVTA 4EAMA 3MSDA 2ZUUA 1I75A 1VRXA 2JF6A 4W93A 3ALFA 4EKJA 2YKKA 4U3CA 4IUGA 3VDAA 2DIJA 5AY7A 3M07A 1E5NA 5JBFA 3CUGA 2VCAA 3WMBA 3WNMA 4W8BA 5DF0A 2GJXB 1CDGA 1DEDA 5LYRA 1C8YA 1B3YA 3EMCA 1OWQA 1W9BM 4JKLA 4LX4A 3WD0A 1VJSA 3A3HA 5I0DA 3ZT6A 3QGVA 3K4DA 2VX7A 4MB4A 3TA9A 3D5HA 3MUIA 5I3DA 2WLYA 1W2VA 3GZAA 1VBRA 1UR8A 1QNRA 2E3ZA 4MAVA 1XSIA 4M80A 1E15A 3ARPA 2DPEA 2DQXA 2VMFA 3DECA 4QLJA 3UR7A 1E70M 2DIEA 3HJEA 2PWFA 1AQMA 4UQDA 4H8VA 3K1DA 2CCRA 3RILA 3T0AA 4J28A 1JXKA 1GQLA 3W82A 3WNPA 5BRQA 1QPKA 3AIEA 3BCDA 3AZRA 1WDSA 1TVNA 3RM8A 1CLXA 3RMEA 2YBTA 3PZOA 4CD4A 5GPRA 4IPLA 3ZJKA 4FMVA 4QLLA 1E40A 2WHLA 1H5VA 3N13A 5JBDA 1UA3A 5ABFA 1FHLA 1DWHM 1LG2A 3VDCA 4FLQA 2GDVA 3ZJ8A 3U5YA 2D1ZA 3AZTA 3AHZA 1OGGA 1NM9A 2XGIA 3VIJA 3ECQA 3N12A 3OBAA 1V6XA 4PMYA 4TVCA 1V3LA 2JEQA 4S3JA 1JYVA 2UY4A 2WLZA 1J01A 1ZBCA 2W5FA 5D9MA 1ZU8A 1W1TA 1HVQA 3AIRA 5A2AA 3AS3A 4E2OA 4ATWA 2BVYA 3VNZA 2OSXA 1AQ0A 2YA0A 3WNKA 3IJ7A 2DGAA 4CD6A 1FP8A 3W6MA 4JFWA 2CBUA 4CKQA 4WSJA 1LL6A 1U30A 1PEZA 4J27A 1TE1A 4CCCA 1BTCA 1JYXA 4PSPA 4M24A 4OOUA 3VMOA 1I1WA 4D6CA 4AWEA 3NIYA 3WQ8A 1CECA 1E6RA 3MMWA 3WUEA 3VIOA 2YIHA 3EDJA 4H8HA 1C91A 3VIPA 2JIWA 1QW9A 2AOSA 3WUFA 4ZE4A 1JF6A 3TTYA 1CZ1A 1UH2A 1VFMA 3BAXA 4V28A 4TX8A 1CXFA 2OWCA 2XVKA 2ZXDA 3WDHA 1VFUA 2J77A 4AEEA 1ZL1A 5EFFA 4GQQA 2VRJA 4MB3A 1WDPA 3WQ6A 1R85A 1JYNA 3CH9A 3WF2A 1DWIM 1H3GA 1PX8A 2UY2A 1ZJBA 3OIHA 1LL7A 3II1A 3K46A 2WNWA 1JZ5A 3WD4A 4DWSD 4J3XA 3VDBA 3ZR6A 1EGZA 4AISA 3AXIA 2DH2A 5IFTA 1GONA 2EEXA 3OLDA 1XRVA 5A95A 3B9AA 1B3XA 1GNXA 4E8CA 5IDIA 3WH7A 3M46A 1KFWA 1JDCA 4UFIA 4FF5A 5HNNA 1MWOA 2UY3A 4DM2A 1G0CA 2ZUVA 3NDZA 3WN6A 2D22A 1M01A 1CGTA 1MQPA 1E6SM 2D20A 5C71A 4P7QA 4HA1A 1ZS2A 3A4XA 3NSMA 3KL0A 2WVSA 4UOJA 4UFMA 1QNOA 5CGMA 1HKMA 1XH1A 2E9BA 3L4YA 4U5KA 3GH5A 4HZ8A 1SYTA 2ZX9A 4KWUA 4JAWA 4C7FA 3B9DA 5BROA 1ZBWA 1EQCA 4XV0A 2CHNA 3S6TA 1UKSA 1JL8A 4PBGA 4WKAA 4JL2A 3CTTA 3ZM8A 1HF6A 4AD2A 1JIBA 3ARXA 4CD5A 3D3AA 1XD0A 4HOWA 4OBSA 2VVNA 2GSJA 4H8UA 1IZJA 4PMXA 1PPIA 4P7RA 1KBKA 5GNYA 3CIVA 3QHOA 4F8XA 1M7XA 2CNCA 2X0YA 3WH8A 1CENA 2IXVA 2W4XA 4J3UA 3KEHA 1XSJA 3OGRA 4A3YA 1ZJAA 2D0HA 1HP4A 4Z2HA 1QI0A 4OZOA 4F66A 1MW2A 2NW0A 5CQ1A 3A47A 5EMYA 2XVLA 3AJ7A 3VTRA 2BHUA 1PIFA 5I24A 3JUGA 3NYDA 4OBRA 2YL9A 3KL3A 3BMWA 5E6YA 3WD1A 4GO9A 4D6EA 3WD3A 1B3VA 5A94A 1J12A 1Q6GA 4PMQA 1E3ZA 4J3VA 3BMVA 1V6WA 2VQTA 2J7DA 3L4VA 4AZ6A 4PRWA 1K9TA 1RPKA 2VJXA 4YHGA 1BLIA 4GINA 4NF7A 4UQCA 5CLWA 2BXZA 1EA9C 4MJ4A 3DHPA 1JD7A 4V2XA 5JBEA 3NSXA 4U3AA 3BGAA 3VX0A 3FHQA 1Q6DA 1U2YA 2WMGA 1JG9A 4MDOA 3MV01 2WSKA 1XHGA 2J7FA 1EOMA 3UEQA 2YA2A 4Z2LA 4WIWA 1UWTA 3UR8A 2YBUA 4DM1A 3OLIA 3GNOA 2OSWA 3WDIA 4TTGA 1F4AA 4GZJA 1TA3A 4UFJA 2NSXA 3TTOA 3SCNA 3T2PA 3O6AA 3W6LA 1QI4A 3UCQA 1AMYA 4IISA 3HMCA 3TP4A 3BC9A 1E71M 2OSYA 1W9VA 1Q6FA 3MSGA 1CEOA 2W91A 1FH7A 4MDPA 4LYRA 1MXDA 5CLTA 2O9OA 1E1FA 2ZUNA 1X6NA 3PZQA 4MADA 2GDUA 2XTKA 3ZQ9A 1XGZA 1GJWA 5E09A 2J7EA 4AIOA 1GQKA 4J3TA 3U57A 5M17A 5AYIA 4NRRA 1GHSA 1PZ2A 4PMDA 2NT0A 3N15A 3AS0A 1XH2A 3ALGA 1XV8A 1W1PA 1B3WA 1W3HA 1MQQA 5E9AA 2NT1A 2J8FA 3VM5A 3WDRA 1U33A 3SCPA 2YL5A 3PZVA 2XG9A 3G6MA 5C8BB 3SCWA 2DT3A 3POHA 4P8UA 3VKKA 3CZLA 1MFUA 3AROA 5CJ5A 3ARUA 3MV11 1PBGA 2XFFA 5IHRA 4PN2A 4GQRA 4JFSA 4DUXA 1OIFA 2Y2WA 3NUKA 4KGJA 1HIZA 2FHBA 3M6DA 3ARZA 1JNDA 2ZICA 1Q6EA 4TVDA 3L2MA 5JUVA 4KGLA 1PAMA 1ODUA 1V0MA 2BS9A 2J7CA 3VD9A 1GOMA 1L8NA 1OGSA 3GH4A 4YPJA 4NRSA 5A6MA 1E73M 4N0RA 1GOOA 1UWRA 4AD5A 1WDRA 3RPMA 2Y4SA 1O7AA 4HA3A 2V3FA 4UFHA 1JNEA 3SEPA 3VGEA 4IM4A 1ISWA 2YL8A 2PWEA 1UHVA 1HJUA 1OB0A 3AMKA 4XX6A 2V3GA 4AZHA 4GZIA 4CCDA 4R5EA 3MUAA 1UD2A 1NOWA 3WEOA 5JIPA 3BSHA 5ECUA 1E4MM 1J0ZA 4P8XA 1UZ1A 3N1AA 2Q8XA 1KXVA 5CZKA 3SUTA 2BY2A 1VEPA 1XCWA 1UWQA 2V38A 3ZR5A 4W5UA 1UD5A 1PZ3A 3L4TA 3VUPA 3EDKA 1CWYA 2HVMA 4LYQA 1B31A 1KXTA 3WUBA 4D6FA 3BAYA 4AZIA 4CU8A 3VD7A 2YOCA 4GI9A 3DYOA 4MTVA 3WF0A 7CGTA 1KR0A 3OGSA 3AMDA 4GI6A 1KCLA 2PC8A 3AI0A 1W91A 2Y24A 1EQPA 2QLYA 3CZJA 1V3IA 3RIKA 4QP0A 4Z2IA 3CO4A
chains in the Genus database with same CATH superfamily
3U48A 4UOZA 1H1NA 1RP8A 3LD5A 3W7MA 2ACSA 2XWDA 3L4ZA 4W7UA 1OQFA 4UQEA 3SUWA 1O5XA 4XBSA 4BA0A 4BR1A 4IQEA 1XCXA 4PB3A 3BCFA 1JVWA 3LI1A 2BB0A 3VNIA 3DKLA 1Q6IA 1J18A 2XFRA 4DVOA 5I78A 3AALA 1JAKA 5HWBA 1GG1A 5DFAA 3QHMA 1AL7A 1JGMA 4QSHA 4OJYA 4BQ2A 3TQKA 1W17A 5I09A 2V82A 3TA6A 3IGUA 4JGDA 4AZCA 4O4VA 3GDLA 3GBEA 3WBAA 1I8JA 1SMAA 3DENA 1AW5A 3SCSA 1UKOA 1VF8A 4QAWA 4O17A 1THFD 1UD4A 3KBMA 2PODA 1EDTA 2VO5A 3CZ8A 4Y2WA 4OFCA 3TJLA 4BEUA 2DIKA 1OK4A 1KD0A 4XZHA 3AJXA 1VEOA 1RR2A 4O1BA 1S5NA 2PV2A 1JFXA 3PJUA 4I5XA 5E6ZA 1U1JA 4QXIA 5EYWA 2LPVA 4C6MA 4MF4A 2OU4A 3NL3A 1OT1A 3MVTA 3EKZA 4A3RA 2XN1A 3K4AA 3LCIA 2GK1B 3TIMA 4Q8WA 1H63A 3MZ2A 3GDKA 1OVDA 2X8RA 3COTA 4O13A 4AF0B 1MMFA 1TZ9A 2ZE3A 3OVQA 4JYDA 4BF9A 1JZ6A 1OFQA 2OO0A 3LPGA 2ZX6A 1PKNA 2M2AA 2WPGA 3R0UA 2INEA 2YSWA 1E1CA 2VI0A 4DIPA 3KAIA 2E67A 4Z2KA 3CL6A 1ZALA 4KFNA 3VNLA 1AODA 3L4WA 5DXXA 4S3FA 4IIEA 1ME7A 3PNZA 3PBYA 8CGTA 3W86A 4AD3A 4WJXA 4YL2A 2JE8A 4B5TA 4D1JA 3P14A 2PDCA 4FK9A 3D46A 2X09A 4Q6JA 1WNOA 2PU1A 1CIUA 1JF5A 1WAUA 2DZTA 1BWVA 3CS2A 3NAVA 3NTYA 4J35A 3AOFA 1YX1A 2PZNA 1CGXA 2W63A 5CXPA 4ZPWR 1UW9A 3CH0A 2WOQA 2YA1A 2Q02A 2Z24A 1HJSA 2WMKA 3KVMA 2V2DA 5H8MA 4IOTA 3N04A 3PSVA 3NPVA 1ZB5A 1TMHA 4X60A 4HJWA 5FJIA 3F5KA 2J66A 3VIMA 1E5JA 3GFXA 1B90A 1BWKA 3P60A 4MLJA 4A29A 4BF7A 1FHUA 1GEQA 1OSEA 2WSRA 3ABXA 3TW7A 1QBBA 4XUYA 3STPA 3W00A 2CXEA 4MUPA 2JIEA 2GJXA 4G7EA 5FKYA 3F2DA 3SRDA 4KETA 4QJ1A 1CB7B 1ITXA 1XGEA 4OECA 2FZ8A 2Y7FA 3CV6A 2CLHA 1FCVA 2YB1A 3INPA 2WWCA 7REQA 2INZA 4OUEA 3ZIZA 4HMDA 1I2OA 3QMRA 3ITOA 3HPZA 3LLXA 1GCYA 1US2A 4IG2A 3T4WA 1SQ7A 1ENUA 2ZXAA 3T2QA 3W29A 3GAKA 2OYLA 3WLMA 5CAHA 2PD5A 3B9EA 3R5EA 4KERA 4TW7A 3MWCA 1BEUA 1M1BA 1V3MA 3PTMA 1VPXA 4NJKA 5G1TA 3IVTA 4JICA 4W85A 1A5NC 3FXYA 1HL8A 2BGQA 1LBLA 1OX4B 1FCQA 4WOZA 1M7JA 4PCTA 4PMJA 4QQ3A 1SSDA 3HJZA 4HTYA 2RFGA 2EPLX 3TWAA 3GD6A 3EX4A 1LRNA 3HPSA 1Q6CA 3KABA 3WMSA 4D9PA 3FXGA 4HB7A 3JS3A 4IP4A 5TBOA 1SU5A 1L1PA 3APTA 2F23A 2E6DA 3NR0A 3P0XA 1OF6A 4LRSA 4JFUA 2ZX5A 1UIOA 1Q13A 3U3HA 3W1TA 2PGRA 1G94A 1QVBA 3GXPA 1O66A 2VEIA 3LHUA 4JTGA 1Q3NA 1A47A 1D8WA 1I2PA 3R13A 1R9HA 1FWIC 3UJEA 1D2KA 3GYCA 1CXKA 5MF5A 1OG0A 4IFKB 3EXRA 1E1EA 3BQ6A 3EY6A 2QUTA 3A12A 4LPCA 4KW2A 2XP8A 5IXEA 4Y90A 4X2RA 2BY3A 1HKKA 4FOJA 4IGNA 2YZ5A 1XG4A 4JTCA 4F0SA 1B3OA 4CN6A 4Q8PA 3BJSA 3HFYA 4S3GA 2PDLA 1FJDA 1IWBA 1H62A 3DHUA 4E3VA 4E4UA 2VELA 4FXFA 4JFMA 1VJIA 5BCAA 3QHNA 3VIIA 1VYSX 4CD7A 4CNPA 1HJXA 2J8TA 1BF2A 2VXNA 2H9AB 1XIJA 3O5KA 5LA1A 5E9XA 1N55A 6XIAA 1NH6A 1J0YA 3WLTA 5FOOA 3OVRA 2XVGA 4TVUA 2R6OA 4R9XA 3CT2A 3T2OA 1BVZA 1H51A 2R14A 2WXDM 4DXVA 4H6EA 3HG5A 3WLJA 4C5YA 1ZNNA 2KI3A 4YCPA 5D4YA 2B7PA 3BLKA 2NQ9A 3VYLA 4Z42C 2TAAA 3LCWA 2I17A 3IAQA 5HBFA 4HK6A 3AQUA 3N9RA 1JRBA 1M3UA 1NWSA 3RO6A 3VVGA 1KCXA 5FEXA 1TMLA 4KRUA 5AKQA 2OLAA 3WQGA 1W1YA 3G77A 3KTXA 2H9AA 3TU9A 1AH3A 3ABRA 4GK8A 3FY1A 3WEZA 3O5DA 3M7SA 2C3ZA 1UH4A 4RV3A 1XCFA 3CUZA 1X1ZA 2XPKA 3AS2A 3EB3A 4AWUA 1E6QM 4LCSA 3HV8A 4GVIA 5FF7A 2CC0A 5HXMA 4DF0A 3WF1A 5A6JA 3C2FA 2WANA 3TVAA 3UG5A 3O6YX 3BLEA 3WG6A 1FWSA 3PB0A 2R82A 2ZXQA 1IXNA 2W92A 3ARTA 3TYEA 3V5CA 1GYLA 4N2YA 1DIKA 1B9BA 2YBVA 1W2PA 3ITGA 4ZXOA 1UKPA 2Y7DA 3A6OA 1UA7A 3CAWA 1J4RA 2WNNA 3AWNA 4RE2A 3OLEA 4XZMX 3MU7A 3WSUA 4ZO7A 3FA3A 3KW3A 4LEQA 3G18A 3HU7A 3KCEA 1QHOA 1EUNA 2OEMA 3G0UA 3H4XA 1ESWA 2XVNA 4CCZA 4MUZA 4ODNA 2BWGA 3G1FA 1H41A 3TOPA 4BCEA 2ONEA 1ZQ5A 1DJXA 2BOFX 3FDGA 3F5LA 1HP5A 4RCXA 3QY8A 3VAWA 4L7ZA 1BYAA 4XZLX 5G2HA 3B7XA 3ANVA 3PNUA 7TAAA 3ZSSA 2PDPA 2VRQA 4E8DA 1R0MA 1B2YA 4JTHA 1JAEA 2PA6A 1OFPA 2ESCA 2LGOA 4FR1A 1HZYA 1US0A 3C2RA 1ICQA 1W1B1 2J8GA 4WJ8A 1RCOB 2ON3A 3GHUA 4TO8A 3GS6A 3UNTA 1QTWA 5C6MA 3OA5A 4O11A 1RAKA 1W5OA 1E6NA 1FWFC 1Z32X 3VD5A 3FSTA 1K77A 2XP5A 1F3TA 4PFMA 4JCLA 5LZLA 1WDWA 3WJXA 1H11A 2PLCA 4KPLA 1P7TB 2EF9A 1CCWB 4F9DA 4Q8NA 4KEUA 5LGZA 2G3FA 4K8GA 3ARQA 4H19A 4KCTA 3FVMA 5AECA 5LA0A 1UR1A 4HVXA 2NV2A 4CCEA 3QBUA 2G50A 3QMSA 1RCXB 1W8GA 3L2LA 2RJGA 5GJNA 1MEIA 4DWSA 4ITZA 3CZEA 3PC0A 3VMNA 5ENLA 3EKGA 4PRTA 1KBJA 4CUCA 1Z7AA 2HK1A 2V5JA 1QMLA 1HVXA 3ZSTA 3WY1A 2JF7A 5DANA 5I5RA 3V16A 2FIQA 5FD0A 5C7HA 4OT7A 1TYGA 3WLQA 3P61A 3A23A 1ONEA 2XPBA 1PDZA 4S3DA 4EPDC 1LQ0A 3ZVHB 1KM2A 1LORA 3SBFA 2FKEA 4MFEA 3LHYA 3OA3A 1XLFA 3RG6A 4UTLA 2A3HA 1CTNA 4OV4A 2DVTA 2GVLA 1O1HA 3RF9A 4LALA 2YFNA 3LUTA 1WBJA 4R53A 4ZFMA 1WYIA 3QOKA 1F9CA 3GNRA 1J2WA 2F7FA 1P48A 1EXBA 3W01A 1IEVA 2J7BA 3CHCA 1JCTA 5DCDA 1R5YA 5D04C 1A3HA 4W7WA 1QR7A 3T05A 2CBJA 2FHCA 4QJ3B 4H9VA 1EP1A 3IUDA 3PK7A 3WQWA 2Y7GA 5HQMA 2OZ0A 5FESA 3GC4A 4DZ3A 4Z1CA 4D8LA 4MWAB 4NSBA 4RUBA 4IHCA 4M8UA 1BHGA 2CWNA 2HQAA 1V0LA 2G4FA 4Q8QA 2MLXA 3HB9A 4Q4RA 4XZ9A 2QIIA 5BMXA 1TTQA 3L5AA 1KRCC 6XIMA 3F4NA 5HPOA 3TMQA 4RZBA 1H4PA 1PX3A 4XK2A 2Z27A 3UXLA 3Q94A 4HZ7A 1QU4A 3TJIA 5D2TA 3EBVA 5F7UA 1MW0A 3S42A 1QOXA 1W5MA 2WW5A 1NFGA 4QG9A 3UQBA 5CGQA 1REQA 3L68A 2CU0A 3KUMA 4K7VA 1VBUA 1PXGA 5A69A 3FAXA 3R11A 3ZWTA 1FKRA 3ARRA 2YYTA 2J78A 2PDUA 3HG3A 1JUEA 3C2EA 4YHEA 3LCFA 2KGJA 1XRSA 4Y8FA 2GVYA 4XD3A 1GVSA 1F07A 4PUDA 2QMKA 1I60A 3GHSA 4RXFA 4UFLA 1R3WA 1IE7C 4UTFA 1FQ0A 3VNKA 2FH8A 3ZVIA 1XYFA 1Y5WA 4NILA 1E72M 4LVDA 3CZKA 3S1VA 3VC5A 4D8AA 5FJPA 4JHOA 4N6EA 4AD1A 1BWLA 3OBKA 5EMMA 1EO7A 2TSYA 1SO5A 1V6TA 1KKRA 3DERA 3EDFA 1J9YA 5A8PA 1NQ6A 1VR6A 2EJAA 1QRQA 5CPLA 5TD4A 3QOMA 4UTTC 5AHEA 3S2NA 4D2JA 2GDQA 1QI2A 4KIEA 2QF8A 4B5SA 4YTTA 1FKSA 1EYWA 2CHRA 2OEKA 3W7DA 1CGVA 1JI2A 4DNHA 4N4QA 3F2CA 1IEQA 2V69A 1QHZA 4JTEA 2P53A 2VTFA 1VCGA 3UBPC 4ERGA 1LROA 4GY1A 3NA8A 4HQVA 2R24A 2X7WA 1K8CA 4ZENA 1O5KA 4GUHA 3ZLHA 2C1GA 1E55A 3UXKA 1CGYA 4S39A 4FPSA 3STFA 4A8NA 1TJ2A 3GNPA 4A3UA 4C02B 2ZZ1A 1UQYA 1V6YA 3WK3A 4LY8A 3FIGA 3KBNA 3AFBA 5GNZA 1GQIA 1N2VA 2OKTA 3MQTA 5DBUA 3ABSA 3DC8A 3UG4A 3CBWA 4AAJA 3SECA 3LYEA 1GW1A 1YPXA 2WCSA 1OX4A 2WKJA 4V1YA 1OIMA 4RNFA 1W3JA 1JRCA 1S2VA 1YXCA 5C2GA 3AUOA 1AW1A 1AK5A 1IIHA 4C6QA 3TN4A 3W38A 2J6XA 2BFGA 1PWMA 4GX8A 3A4WA 1KFBA 3OLGA 1A5KC 4DBEA 4JTFA 3PTDA 3T0TA 1JZ8A 1BGAA 3L67A 4CQ8A 1OZQA 4U84A 2O4QA 3PZUA 2XSXA 1OD8A 1KCKA 4E38A 1U83A 2RUCA 2O7SA 1F6YA 3DESA 5I77A 1K6AA 2ZZ2A 1I2QA 2PTDA 4X9YA 4JTIA 1YE4A 2VGBA 5CKSA 3PRDA 3ME3A 4LUSA 4DRQA 3RLHA 3GG8A 2VGFA 1QWGA 1TG7A 2ZADA 3FFSA 2BNJA 3QM3A 1IF2A 1W3LA 1YQ2A 4C7GA 4PA8A 3TYZA 4IT4A 4H1ZA 4DRPA 4AEOA 2YW3A 5K4ZA 1FKHA 3UETA 5D8ZA 4H8NA 3TC6A 3W7RA 4CNOA 5JMUA 2Z00A 4H01A 3IRSA 4DRIA 4IJBA 2HNHA 3GB6A 3KHDA 4NY2A 4CU6A 1WKYA 2X2YA 4CD8A 4UBPC 2Z26A 3KBJA 2CYGA 5HWNA 2PGWA 3FYYA 1VYRA 2CLFA 5C5YA 5HJLA 1K9DA 1TWIA 3OJGA 3LHWA 1DBTA 1GOWA 3VZXA 3I3EA 3U9IA 1ELSA 3FAWA 3C4UA 1V0KA 1FH8A 1GHRA 3EWDA 5A8OA 3WK2A 2XU2A 3G1XA 1BQCA 1IWPA 2Q09A 2R1KA 1OFEA 1QOPA 1IT8A 2XM2A 3LNMA 4TV5A 2J47A 1UC5A 4ENLA 4P5UA 7TIMA 1V6UA 3VE9A 2DUZA 1O5RA 2J79A 4HA4A 2B31A 4YWSA 4ASTA 5HJXA 2WAGA 3IARA 3I4EA 1PIGA 3W24A 3QV8A 1GOKA 1OX6A 6TAAA 3ABZA 3KRSA 2CHOA 3H22A 3W7PA 1G4PA 4LANA 1WKFA 2PDWA 1R9ZA 4PULA 4WY0F 3QZEA 4IIBA 3S5SA 2ZQ0A 1VJZA 3M6YA 4GCAA 2Z1SA 4ODPA 1TWDA 4S3BA 3SB0A 4PUUA 3RRXA 3RLGA 5I00A 3OQ8A 4ROPA 3WUGA 4CQ9A 2P5NA 2J7HA 1XH0A 3AXXA 3SQLA 4MZ8A 2BHYA 1UKQA 1A53A 3NZPA 4LFYA 3SCOA 5GQBA 4ZODA 1CGUA 3M5YA 3VIFA 3WDPP 1NEYA 3DZ1A 2OR2A 2PDIA 3Q58A 3NSNA 3V1PA 3BLPX 1XIIA 1O1ZA 2QUVA 1W9UA 3R8GA 3H55A 4NJJA 3VAVA 4DIAA 2CKRA 1W9XA 3UWZA 3RM9A 1K02A 2AGTA 3H2OA 3B0UX 4AZCB 4H6QA 2HROA 5EBAA 3VNYA 3KP1A 2HBXA 2WVTA 1UJPA 2OELA 2ZUUA 3EA3A 3H8AA 4BI5A 5TAOA 4A6GA 4IIFA 3VDAA 4IUGA 3M07A 1PTAA 5T91A 4LV4A 2V6AA 3N14A 3V4BA 3WNMA 1KRAC 3QKZA 4HARA 1IT7A 5LYRA 5DY3A 1B3YA 2AL1A 3N29A 4JKLA 3EWZA 3E0VA 3RLVA 2AGKA 3HGSA 3EWYA 1MNZA 5I3DA 3MUIA 2WLYA 4MAVA 2GJNA 2V67A 2KO7A 3ARPA 2DPEA 4LUJA 4QLJA 1E70M 3HJEA 1H7RA 1S39A 3K1DA 1IYXA 4E8GA 4N9EA 5DMMA 1GQLA 3W82A 4XAKA 2PLKA 2RKXA 3GU1A 3HQNA 2YBTA 3PZOA 3NPUA 1E40A 2YGYA 1H5VA 5JBDA 4EF9A 1UR3M 5ABFA 3UT0A 3CB8A 3DFOA 3LMZA 1H1YA 3ZJ8A 1A3XA 5BZAA 1NDYA 3S5YA 4GLEA 3QZAA 4LT9A 3WX7A 1OGGA 1NM9A 3VIJA 4RNHA 3OBAA 1YTEA 1UZDA 2JEQA 2H90A 3V0UA 2DP3A 1ZBCA 5FJOA 2W5FA 5D9MA 1ZU8A 1H61A 4AFYA 1VFSA 1XICA 1YKWA 4HHPA 4NZFA 4FEZA 1PDYA 1PKMA 2DW7A 3UZZA 3VNZA 3Q65A 4EF8A 2YA0A 3W7IA 3WNKA 2QW5A 5LNRA 4AWSA 3W6MA 3BZGA 4CKQA 4GJIA 4GY0A 3MBDA 2HXUA 3GRIA 5LIUX 5K9DA 3WLPA 2A2IA 1PIIA 4PSPA 4M24A 3B06A 2GQ8A 3DN5A 5LSMA 1XG3A 5M2FX 1ZAJA 1XKYA 1VFTA 1DIDA 3EOUA 4FA3A 2Q6ZA 4DJFD 3SN4A 5E5CA 2QF7A 1JF6A 3VFCA 3W23A 1UH2A 2OWCA 1GG0A 3CV1A 3GKAA 1MUCA 2J77A 3BW3A 2E5BA 4Q32A 1QJWA 3W3OA 4MB3A 4LAOA 3P8JA 1Q6RA 4L9ZA 3CL8A 3UD6A 5K3VA 2O55A 5J04A 3EX3A 1LL7A 1MDRA 4NNAA 1JZ5A 4IL0A 4DWSD 2Y7EA 5G1YA 3TDBA 1V7AA 1GONA 2EEXA 2YCJA 1QATA 2PP3A 5F4WA 1B3XA 3OYXA 3CIWA 4E8CA 3EKLA 3GR4A 3PAJA 1P6CA 1Q6LA 3M46A 1JDCA 3KZPA 2C16A 1S3HA 4LUSB 4FF5A 5HNNA 1C8VA 2NWRA 2EKCA 3BICA 1G0CA 2VEPA 3WN6A 2E5CA 3IACA 1A80A 4YWIA 3SY1A 5LIKX 4HA1A 1P0EA 4HBOA 3NSMA 4O1FA 4UFMA 1GVQA 4REQA 1HKMA 2E9BA 3FYPA 4HZ8A 2ZX9A 1GKPA 2PAJA 4GACA 1JL8A 2PDMA 4HN4A 3AYTA 5KZDA 4WKAA 1F8AB 4JX4A 3CTTA 1R2RA 4RJEA 2ZTKA 4M51A 4NHVA 3NOYA 4OBSA 4B92A 3HPXA 5AFDA 4XAGA 4OVXA 4ODOA 5LIXX 1ZENA 3E2QA 2CNCA 1OC6A 4IP5A 3KEHA 4WXZA 4REQB 3UQAA 4DH0A 2R91A 4A3YA 3SN0A 3O6CA 5C9UA 4Z2HA 1MW2A 1J4EA 3A47A 5EMYA 5CC7A 5D33A 3UWYA 3VTRA 2Y0FA 1VYPX 3ZLFA 4GI4A 2KZHA 3UCCA 1JUKA 4GD0A 3SFKA 1JPIA 3BMWA 3EX2A 2OODA 1F74A 3M0XA 3IKGA 3WD1A 2J6VA 4GO9A 2VEFA 4D6EA 1K8XA 3WD3A 1B3VA 4IFRA 1V5XA 1J12A 1Q6GA 1P5BA 1V6WA 4PRWA 4IQCA 4YYFA 3M16A 2OGYA 3A5FA 4UTIA 4Z0SA 4GKTA 5CLWA 5BOEA 5J5DA 1FWBC 2AKZA 3DHPA 4CLMA 4V1XA 3EOSA 5JBEA 1H7XA 3BGAA 5HW6A 1U2YA 2WMGA 1JG9A 3MKCA 3MV01 1XGDA 1XHGA 1D7KA 1EOMA 3E2SA 3H2MA 4Z2LA 4WIWA 1S2CA 3GVGA 3OLIA 3PG8A 2OSWA 5A8GA 1EWDA 2GWGA 4A05A 3SCNA 5C55A 2NUXA 3GTFA 3E0WA 3DFNA 1EEXA 2GSHA 3UCQA 2PP0A 3IEBA 3TP4A 3BC9A 2OSYA 1Q6FA 4JNZA 4RR4A 4MDPA 2A21A 2BMBA 2GSEA 2NX9A 5CLTA 1K7FA 3PZQA 2F84A 1G4EA 3PBVA 2ZR4A 3T55A 4FP1A 3ZQ9A 5CC6A 1TPC1 1GJWA 2J7EA 2ABAA 2Z7GA 3WK1A 4H83A 4X9SA 2QJHA 4BKNA 4DELA 3N15A 1XH2A 1W1PA 5G2WA 3S3GA 4EPEC 3U2ZA 3UWVA 3HG2A 4G9PA 3WLRA 5KITA 3G6MA 1SSGA 3WZ0E 5AOUA 3SCWA 3RGCA 3POHA 4XWUA 3VOFA 3NQBA 3CZLA 1A5OC 1SW0A 4RK8A 3GW3A 1Y5VA 5CJ5A 2Y62A 3ARUA 3RITA 4U4MA 3U2CA 2PTWA 2IS7A 5FA5A 4RKAA 5C2CA 4LVAA 4NZ4A 4GQRA 4R9OA 4NZ5A 4KGJA 1HIZA 4OHQA 1JNDA 4AVNA 2WPBA 4O8AA 3G0SA 1RZMA 1I2NA 5IBXA 4YXGA 3QYQA 2CLEA 4KCWA 4KF1A 3MDUA 7REQB 3GH4A 4YPJA 4B5WA 3ZLGA 4CNTA 5A6MA 1FWRA 2LJ4A 1AMKA 2PEVA 4FS9A 2XZ9A 4RE0A 3LV6A 1ZFJA 3M0MA 3A3WA 3OZYA 2V3FA 4UFHA 1JNEA 2AWGA 1XYAA 2QJJA 3VGEA 3HURA 5BNKA 3QEZA 2YL8A 2CZFA 1UHVA 1TV7A 3AMKA 4GGBA 4XX6A 4ZVJA 3PUOA 3S2LA 3VOGA 1DQXA 3VFLA 3WEOA 4CNSA 4IIDA 1MRAA 1J93A 4ZQPA 4P8XA 3TV8A 1DJWA 1KXVA 3LQLA 4ZO6A 2BY2A 4MPQA 3CYVA 3ES7A 1VEPA 4NG3A 1VRDA 3FOKA 4FNQA 3T7VA 3TC5A 1PZ3A 3LHZA 1NSGA 4H3DA 4MOZA 3R2GA 5I06A 3KAGA 2HPIA 1KXTA 4AZIA 1ITUA 4CU8A 3QH2A 3DYOA 1TPFA 4MKSA 1KFEA 1KR0A 1LCOA 1KCLA 3IUHA 1W91A 1YBQA 4GH3A 5HWCA 5U4NA 1JNSA 4IXHA 4I6KA 1LRQA 3CZJA 1V3IA 3I65A 1L2UA 4DLFA 1SGJA 1A50A 2QDEA 3CHFA 2BODX 2FTYA 1FWWA 2EXOA 1XBVA 3BV7A 5BRPA 1EC7A 2CITA 3B40A 1QPRA 1ZAHA 3CGTA 2PDYA 3SM0A 1NOFA 1GOQA 1GTHA 2J62A 4L4MA 1JQVA 1QAPA 1XF0A 5M1TA 3MDYB 2PURA 5KETA 5J5RA 4PZVA 4RPQA 1XLEA 4K8HA 2AL2A 1RJPA 4WY0B 5CZSA 3UW6A 2XUCA 1X1OA 2I5QA 2ZQUA 3M44A 1UBSA 1CXHA 2WKGA 3GC2A 5LNUA 5D9NA 4O16A 5A8QA 1UD6A 1HXJA 5A3HA 3USZA 3LTPA 2KE0A 2XHYA 4PEEA 5G4HC 4AVOA 1RA5A 2IW0A 1OINA 3ZJ6A 2VCDA 1Q6UA 1TRIA 4BF5A 4FOKA 3CL7A 4GXPA 4C91A 1C7SA 4IX2A 3WCZA 2E8ZA 3L0KA 4MB1A 3VK5A 1UD3A 1J2BA 4LBRA 1GKQA 4EX4A 5DRCA 3T0CA 3HM7A 3OVGA 2ZVRA 3PRAA 2CEQA 1AZ2A 1V3JA 1X7IA 3VNJA 1XDMA 1AG1O 1EJ7L 4FLSA 1KW1A 1LTDA 3PZNA 4DAFA 2D69A 1ICSA 1ZBVA 3I3BA 1JDDA 2V3EA 1JCHB 4WR3A 4HU0A 4W5ZA 2O9PA 3MMUA 1XD1A 3FN9A 3B4UA 3OW1A 5BOOA 5XINA 4DWSB 3JVAA 3WBWA 1XISA 5G5IA 4D6JA 3O5GA 1K8YA 1C90A 5D2VA 2ZZ3A 2V2HA 4LJ3A 5D32A 3IRDA 3CASA 3E0FA 3IVSA 4Y9AA 5CPOA 3EEZA 3AIUA 4TR9A 1V79A 2VQUA 1R46A 2VR4A 1BXCA 2WM1A 4D6IA 4WDTA 5T9CE 3K13A 2DT1A 3CEUA 5F2IA 1L2QA 3H9RB 4AG0A 3QKEA 3LPPA 1QPLA 1SR0A 2GUBA 3KOXA 1WO2A 2POTA 5CPNA 3UG3A 1FWAC 1KFCA 1IWAA 2NSOA 3IUIA 4AHPA 2XZ7A 3T08A 3AYRA 4K1GA 4J7RA 2A0NA 1AD4A 4I7WA 1VFOA 5HTGA 2B5UB 3E5BA 1UROA 3IJ9A 5E0CA 3VD4A 4GRSA 1UYQA 2FGLA 5LXEA 1T0OA 5MKGB 5HAOA 3RJYA 2Y6ZA 3BGJA 4HMCA 4ML9A 2QCFA 4MVAA 2G41A 1YYAA 1QPFA 4KEZA 4AQLA 5JIWA 2BSLA 4PH6A 3WLOA 2I7GA 1R3VA 4AUBA 5KMYA 4AYSA 4H9UA 3OGVA 2DQWA 3NQEA 3UJFA 2VNCA 1KBBA 1ONWA 3GW0A 1NDZA 1MQRA 1GW9A 3GNXA 5FSDC 3SUSA 2Y70A 4J3WA 3JYJA 4A8LA 2X1RA 3AU6A 1PBKA 3ODKA 3LSBA 3GZ3A 4ZSUA 2WMIB 1RP9A 2WMIA 4XUGA 1GORA 3QC3A 3UJSA 1GVFA 2XINA 2IPWA 2V2CA 3CV7A 3U7VA 4WKHA 1UR0A 1LF1A 1DWGM 4HMEA 1NIUA 1XRTA 3T8QA 1RY0A 5A6SA 1TSIA 3B8DA 4UR9A 1SFLA 4YVXA 2JGYA 4F40A 1LRTA 3E02A 3MWAA 1M68A 3TYAA 3HTWA 4DZAA 1CBGA 3R4IA 2RDXA 2Y8KA 4FLRA 2G3MA 3I6CA 3RN6A 1PINA 4MYAA 1R7OA 3H4GA 4M7SA 4ZOBA 3P80A 4FHAA 3WH9A 1YDYA 2EPMX 2FTPA 1IR1A 2JKPA 2WHJA 5BWFA 3URNA 4AZ7A 3O5FA 1KGUA 4Q3MA 4GUIA 2C79A 1SVDA 1BG4A 2P0OA 2WBKA 4KWVA 5DIVA 1R47A 3S46A 3D6NA 2PPGA 4ZE5A 4X61A 3NQ6A 2P88A 3N17A 2ZRVA 1H50A 2ZCGA 2EULA 3EOOA 3PHAA 1H0IA 2VM8A 1EZ2A 3UZXA 5GJMA 3F7JA 4PE8A 1BD0A 8XIMA 3M41A 2ZDRA 3ITVA 1H7OA 1QW7A 3EWWA 3H7RA 1FHDA 2PF0A 2PCEA 1P7TA 4H9YA 3TCZA 4POCA 4C6BA 1SW7A 2PLJA 3W9ZA 4JTJA 3EWUA 3TFCA 2MANA 5FIPA 3ITCA 3WELA 4UMAA 1BYDA 4JTLA 2CW6A 2QJIA 4V33A 4CGTA 1FRBA 2HMCA 3W22A 1HKJA 2XN0A 3SCUA 3GXIA 2FFIA 3LV5A 3APGA 1CLVA 1A5AA 1JPKA 3CHEA 2BGSA 4UNKA 1P6WA 3IJLA 6REQA 3DEQA 5CZ0A 1VD6A 3V35A 3SRHA 3S8HA 4L64A 1L6WA 3NGFA 4X63A 3GTHA 1EC9A 3I7SA 3FCPA 3URAA 2FJUB 1LDCA 1DWAM 2L5HA 1OGBA 3NYZA 3AIQA 3N9KA 4TW6A 5BXJA 1UCWA 1K4HA 4FXSA 4TMCA 3PZTA 3DI0A 1WCGA 2JKAA 3TAKA 4GIRA 2VD8A 1HX0A 5REQA 1JZ4A 4DBDA 1C7TA 3VIHA 2YCKX 3C0LA 4DO6A 5ABTA 2CLIA 1RVKA 1GJUA 1JFHA 3NG3A 1IEIA 3B0VC 3B9NA 2V5BA 2EPNA 1DPMA 1KV5A 3GXTA 3BG5A 4PUKA 3CUHA 4LC6A 4DJEC 2C1IA 2F21A 3W7QA 3N73A 4I8DA 4QFUA 4ODQA 3FJ4A 3TW9A 4U2ZA 4M1RA 2XH7A 3I6EA 2QV4A 3C52A 2QCNA 3C0QA 3S6OA 4XKYB 6TIMA 3UPWA 5KEZA 2PN0A 1EIXA 2VX6A 4FNUA 3QVQA 1PX4A 2QPUA 5MHBA 1L0PA 2G3NA 5CZJA 4NZ1A 3MKVA 2GGIA 1ZCCA 1GQJA 3SGUA 4N19A 3K8MA 5FF0A 1SJAA 3PZGA 5A6BD 2Y5SA 2QCDA 4HSOA 4NNBA 1EF3A 2LKNA 4H7ZA 2QPSA 4PB5A 2ZA2A 3BZJA 4ATLA 3CQJA 3GIPA 3LB0A 4CN4A 1MFVA 1QK0A 4KH2A 4NYYA 4TUFA 1NARA 4M6QA 1E4LA 4J4NA 2Y8VA 4YTQA 1FKIA 4O19A 4F0KA 3KZSA 4WJEA 2P0IA 2J75A 3TJ4A 1NWTA 3LI0A 1XIEA 5I3GA 1EKOA 2OQHA 3UERA 3CMGA 1WKEA 2QIWA 5D2XA 3Q2DA 3WFZA 1F76A 2XH2A 4L4LA 5A2BA 2ZWZA 4HU4A 1IZKA 2GVJA 1VIWA 3FHAA 4H9MA 3V5OA 2DT0A 4WUIA 5C70A 1XLJA 2B7NA 5CH9A 4XTDA 3DHFA 4ML4A 4PODA 3TR9A 4C5ZA 1Y0EA 4JIEA 3OZOA 1XQKA 2WVVB 1DJQA 4B90A 1AL8A 3S83A 3ZT5A 4Q8OA 2G37A 2HPMA 1VZWA 4XVDA 5D02A 4O0QA 4MNMA 3L21A 2XIOA 4BZYA 3ONCA 4AXKA 4P7OA 1TTPA 1Y8BA 2E6FA 3FDKA 4QSFA 1JJKA 3GY1A 2ZOXA 1NWRA 3UY7A 1NELA 2G3IA 3JR2A 5A6AA 2O9TA 3DC0A 1MSSA 3KE0A 5MKGA 1ALDA 2OO6A 2PTYA 3KVJA 2F6UA 1TUXA 2BBFA 1JEZA 3B03A 5D9OA 1R30A 1DHPA 5E1QA 1Q7MA 2OYMA 1EJSC 4HK5A 5AHFA 1Z89A 4UCGA 1NWUA 4ACYA 2E68A 4PUMA 3T07A 5LKYA 3WNNA 1DXIA 3ZO9A 4IMFA 3TTSA 3LGEA 3ABQA 1M5WA 4W9OA 4RDWA 4JS3A 1A0CA 4JIRA 1KT1A 1WKDA 1KWKA 5AB3A 1KQYA 3JRKA 3N2BA 4Y7EA 1UB3A 3IK8A 4ZEPA 3P7YA 4GUGA 1UZ4A 4J2MA 1XJBA 2DU2A 3B8IA 3T1GA 1J8VA 4EP8C 1X8FA 4UZUA 4LF1A 4GYPA 1RCQA 4DUOA 1KGXA 5HNTA 1W37A 1BKFA 3WF4A 4I7VA 3KDOA 1TR9A 2TMDA 4UZSA 4CN1A 5EFDA 3ARSA 2CZVA 1GOIA 2UWFA 2JEPA 1NFPA 4JEQA 4LAKA 4DBSA 2F61A 3SCRA 3TWBA 3WQOA 4GKLA 4CVWA 1KWGA 3O7UA 3U6WA 3PB2A 1Z44A 4GG9A 1FCBA 2Z6JA 2NQLA 1NDWA 1DKWA 3HA1A 5HPCA 2ZXBA 4DO4A 3HMJG 5G2IA 4WK9A 3A21A 1OFAA 3TLQA 2CFFA 1VC4A 3FS2A 5HQLA 3N4EA 3S2CA 1PL9A 1E4NA 2AAAA 3IIOA 3BAIA 4C1KA 2YLLA 5HULA 4EXBA 2PS2A 2ZWYA 4RDZA 4O8RA 4PMVA 1TFVA 1H49A 1IXPA 1UKTA 2W61A 3MUY1 1TRDA 3G5EA 1PCWA 2WK2A 2XIBA 1VAHA 4I5UA 1EEPA 2WM0A 2YB4A 1NF0A 1B4KA 1JXJA 2O9RA 3CPRA 3WJSA 2GQ9A 3LHTA 1QPNA 1E3XA 3NZQA 1YNQA 4LS2A 3HV9A 2D24A 3RYSA 1P5QA 5E0FA 1P0DA 2OOFA 5HINA 4XQ6A 2PGEA 4DZHA 1R3QA 1XS2A 3PWIA 1EUAA 5SWUA 1WXZA 2C71A 3KDNA 3PZMA 2WKLA 3AZSA 1SZGA 3CEPA 1Z9AA 4QR6A 4G5DA 3U4AA 1ITCA 2J7GA 4RE3A 3EDDA 1XSKA 2NZLA 1DJHA 4B91A 1O4UA 3VZYA 1WAWA 3KP0A 1K6WA 4FALA 3O5IA 4JTSA 4F4RA 1JDAA 2ODOA 3SRFA 3UP8A 3EXSA 3W84A 1IEXA 2JK2A 1NF7A 3KBSA 1XYCA 4FAPA 3D0CA 3B8SA 3GVWA 4FI4A 3O0KA 3W0KA 4UXDA 1N8IA 4QE1A 1QW8A 5G1MA 3SCQA 4WSKA 1XQLA 4C6OA 3QTGA 1A0EA 4QIUA 3S1XA 1M9HA 2PWHA 4JFJA 1T96A 2PCQA 1FKJA 3GXNA 2VR5A 5D9PA 3URBA 5AZ1A 3BLOA 2OFJA 1AUSL 4I90A 1C8XA 4O52A 2DUXA 5HMFA 4KIRA 4D6DA 1OCQA 1S2UA 5CSSA 3LDVA 3TXZA 3ITLA 4NVTA 4PMUA 3TTQA 4L65A 1HFBA 4O1CA 3GBDA 2WV8A 5FJJA 1X6LA 4NAFB 1KGWA 3NOEA 4XAFA 4GQBA 1EIBA 4NZ3A 2A3CA 3VDHA 2B4GA 4GE8A 5HW7A 3WNOA 1J10A 2WWDA 1TMQA 4GFSA 3GG7A 3A4JA 2O4MA 7A3HA 4URIA 1UR4A 3AHYA 4GYPC 4Z1DA 3BLLA 4PUEA 3AMLA 3F4WA 4KEVA 4L4PA 4GIAA 3CUIA 3CUFA 3GE7A 3RFWA 1OFDA 3W1AA 1E56A 1TTIA 1SMDA 4JX6A 3W85A 3GO2A 4IPJA 4JFLA 3GH7A 1F7BA 1Q7ZA 2OYKA 4NUWA 3UQNA 1H7NA 4XO6A 2Z1KA 2VR2A 3FX4A 4PRRA 3UYIA 3W7KA 5J6EA 3EWXA 4PGLA 4AMCA 3EGJA 1KM4A 2HRWA 2ZZ6A 3DBNA 1PS9A 1PKLA 2ZA3A 1W3KA 5AHLA 3L0NA 3W4RA 5BXRA 1LT8A 2MPHA 4JQ1A 4RL3A 2R1MA 3W53A 3PUDA 1NTHA 2CLMA 3N3TA 3W26A 3LCLA 3IPWA 3ARWA 2G95A 3N4AA 4XD6A 3GNNA 3ERPA 2A79A 2FH6A 2CKSA 3AS1A 1OG6A 3O15A 1VFHA 4HOXA 4GJJA 1T99A 1M04A 1CPUA 4QTGA 2ZZ4A 2ZTJA 4G7FA 3W75A 1P1XA 1N7KA 2RHGA 2E8YA 5CSYA 2R1PA 3KADA 3O2LA 2EAWA 3WBEA 2PBOA 2PTXA 5T8GA 1GWJA 3THDA 4EANA 1TJRA 2IKIA 4BI7A 1UOKA 1X97A 1N1AA 2I5GA 4DJDD 3E6EA 4ADUA 1AJ2A 1EJTC 4ERAA 1IGWA 5ABGA 1AQHA 1IGSA 2DG9A 1OABA 3GLCA 2VZOA 3W83A 2D3NA 3DFPA 1Q45A 1QNSA 2JFEX 4HD5A 5I07A 3ZJ7A 1W3IA 5IBXC 4GY7A 3TX9A 5JH1A 4ICMA 3NVTA 3TQVA 1US3A 1ZJIA 2Z7KA 1PUDA 5JQ9A 2NWSA 2J88A 3ZMRA 1C93A 4GBDA 2PRHA 3UPBA 4W87A 1D7IA 3MANA 2CZEA 4KT2A 2QQ6A 5KZMA 3W2NA 1J0KA 4BQ3A 3JXVA 2I56A 1FDJA 4LAZA 4HKPA 4XIMA 3K1GA 2YCEA 3A13A 3ITTA 1DIOA 4F0RA 5HK4A 2JGQA 3VNMA 4J5NA 1V02E 3NVDA 5HDRA 4WX2A 1H7PA 1UBPC 3PBUA 2Y89A 2OPJA 3TZNA 4B5NA 4BS0A 2IF4A 3IIXA 1G7UA 5LNWA 4MNKA 2CBVA 3GVRA 3S9ZA 1WB0A 1EQ3A 3RR1A 1SW3A 4R27A 1EF2A 1Q65A 3OP2A 3NQ8A 3NJ3A 4EVZA 3H24A 4B3LA 1PYFA 4JOMA 3IJQA 3G6LA 3SY5A 3DGRA 2UZ9A 1XIHA 2AAMA 1W9DM 4HPHA 4ILSA 4UMCA 1XLHA 2TPSA 2ZZ5A 1AH0A 1Q7QA 3AXMA 3DFYA 3G1HA 2E4TA 3G1VA 1DJIA 2QHAA 3G1DA 2BXYA 2W3ZA 4XBKA 4LEFA 5CCZA 2C19A 4OU1A 1J0IA 2QXWA 3S9YA 3C0JA 5CG7A 1GK8A 4AIBA 1I0BA 4P61A 1I75A 4I9MA 4C1NA 1SUXA 3W1NA 2DIJA 5AY7A 1RSCA 2GGGA 4Z1AA 4AWTA 3UI4A 3CUGA 3SO7A 4W8BA 4Y9NA 1Z48A 5DF0A 1R9YA 4Y8EA 1CDGA 1C8YA 3AXKA 3EMCA 1OWQA 2OTDA 4KCUA 3YPIA 1OCBA 2D2HA 2VGIA 5CBIA 3QC0A 4OGZA 3K4DA 1LLZA 3D5HA 3OPSA 4JIPA 3ES8A 1W2VA 4HZMA 1UR8A 2XP7A 1QNRA 2E3ZA 1X96A 3EOLA 1NY1A 3O0FA 2OZ8A 3WK0A 4Y96A 1GT8A 2BOGX 2PWFA 4GXMA 4LY4A 5E0KA 3VDGA 3RILA 3T0AA 3LZ3A 2PDQA 3OQEA 3VXGA 1XLLA 3TYCA 4DJFC 4K37A 3WNPA 5BRQA 3TN3A 3UY8A 5C7VA 3QSTA 2A5HA 1TVNA 3B3DA 1CLXA 2DZAA 3NQ2A 4LUYA 5J8LA 4IPLA 5FJUA 2QT3A 3ZJKA 3SQSA 1UA3A 4RW5A 1DWHM 4JIHA 2VENA 3FA4A 1A7XA 2OG9A 4O14A 4EXAA 1VHNA 3K30A 5DMLA 1FBAA 3AZTA 2FZ9A 2XGIA 4JQ3A 3SR7A 1GVRA 1XWYA 1V6XA 2WJFA 1OHLA 4TVCA 4LB3A 4BWLC 1V3LA 3C2YA 3KCOA 2UY4A 3BL3A 1J01A 1HVQA 3NPXA 2C13A 4MG4A 2ZRWA 2ZBTA 4ATWA 5CC3A 1D7HA 2BVYA 3O5OA 4US5A 4HCHA 4XAZA 1B57A 4E5TA 3M0VA 4HYWA 3GTYX 2Z4GA 4Q4MA 5F1UA 4LF2A 1SJBA 4CCCA 4UIOA 2FPVA 1BTCA 1D3HA 5HKGA 4OOUA 2ALRA 1FKDA 5CPMA 4ROQA 4D6CA 4O1AA 2R8WA 3QZ6A 3P5YA 1E6RA 2UBPC 4MIMA 3PBMA 1RV8A 3N6HA 3G8EA 3NO3A 5H1WA 3VIOA 1C91A 2JIWA 4CQDA 1QW9A 4XTIA 3G1RA 4RDYA 3UI6A 1KM5A 3TTYA 3QQWA 1VFMA 1WA3A 3GDTA 4V28A 4TX8A 3VA8A 2IKGA 3OG3A 3I6RA 4RW3A 3ATZA 3STGA 5EFFA 4ZMGA 4GQQA 3GUGA 1F05A 2VRJA 4I9TA 4LS1A 4WGHA 4ADSA 2OFNA 3WQ6A 1OCNA 4ZTYA 1YNPA 9XIAA 1BF6A 3QR1A 1TV8A 1PX8A 4D8ZA 2UY2A 1DJGA 2G96A 1YIXA 4HJFA 2WNWA 3UFYA 1EGZA 4AISA 1W1A1 3AXIA 1M7PA 3JW7A 4BF8A 2YW4A 2DZXA 3L66A 4Y9MA 2ISWA 4US5D 4UFIA 4LBUA 4TX9A 1MWOA 3EX1A 3VOIA 2NUWA 1JPMA 2F9RA 1CGTA 3QQ1A 1HO4A 1T40A 4OUIA 1MQPA 4DO7A 2PDJA 5HMSA 3HGRA 2WJDA 3A4XA 3MDWA 5F2GA 3KL0A 2WVSA 4G1KA 1QNOA 5CGMA 3KS6A 3O5EA 3GIYA 4FNPA 1W3TA 1SYTA 3LNPA 5BROA 2FZNA 5EGRA 2CHNA 3S6TA 4R7WA 2F6KA 4DX3A 3U2EA 4PCFA 4NU7A 2XGZA 4PBGA 3TE9A 4AVFA 1XFCA 1HF6A 4AD2A 1JIBA 4CD5A 2WNZA 3KBWA 2QDHA 4HTBA 4B4HA 4DYEA 3QGAC 4ZA0A 2V8ZA 3PANA 2V9DA 2O7QA 3QHOA 2X0YA 1CENA 3A3XA 4J3UA 2ZA1A 4B3ZA 3OGRA 2OQYA 4JY9A 3UA3A 1DQUA 1ZJAA 3H6OA 5FSEC 2E7FA 1JCLA 1U79A 5CQ1A 3R25A 2XVLA 5H8UA 4QROA 2A7RA 4AX6A 1YEYA 3TCEA 2BHUA 1PIFA 4MJMA 1XIMA 3JUGA 4OBRA 2YL9A 1E1CB 3KL3A 3W1XA 1LBFA 3MHUA 4WHBA 4PMQA 3BMVA 3CYJA 2ZDSA 3L4VA 3O6DA 1K9TA 1RPKA 3QYSA 4JTTA 2OX4A 2VJXA 3MZNA 4YHGA 1PSCA 1BLIA 4H2HA 4NF7A 3R43A 5D75A 1C9DA 1PB0A 1EA9C 2FTWA 3QFEA 1AZ1A 1M7OA 3T4CA 1L6FA 3UPMA 1RK5A 1SO3A 3VX0A 1FWEC 1Q6DA 4Q4KA 2RDUA 3HPAA 3KXQA 2NX3A 4I9JA 4JYFA 3UR8A 3HG4A 1SZNA 3LM7A 3TKFA 2YBUA 1HG3A 4Z1BA 3GNOA 3WDIA 4UTWC 2WQDA 4ZQOA 1TA3A 4UFJA 2NSXA 1EJVC 2E6YA 3LBOA 3SW6A 4WXYA 4LAVA 3BJTA 3W6LA 1QI4A 4K38A 4JQ4A 3QV6A 4I8YA 1E71M 3I68A 3MVIA 2W91A 4L61A 4HGXA 1LQAA 1MXDA 5CJNA 5H6HA 1IR2A 2O9OA 1X6NA 2GDUA 3GR8A 1X7FA 1XGZA 2HE5A 1XLAA 1M5YA 1TE6A 2DV0A 1KV8A 4M0XA 1WV2A 4R0XA 3VUSA 4DJFA 1VIZA 1PZ2A 4LU0A 1XV8A 3ALGA 5E9AA 3MYOA 4AB4A 1U33A 3SCPA 2YL5A 3PZVA 1OADA 5C8BB 2DT3A 1SZRA 4P8UA 1Z69A 4EWND 4I7UA 1WBHA 3GWQA 3EZ4A 3TW6A 4Z17A 4EOUA 5IHRA 4NQ1A 4PN2A 2F4EA 5CJMA 1OIFA 2B81A 4IGHA 3ARZA 2P50A 1X38A 3H2FA 3L2MA 3W7GA 5JUVA 1PAMA 3CXOA 4QITA 2J7CA 3VD9A 4A21A 1OGSA 5FF4A 2OKOA 1ZJHA 4DRMA 7ENLA 1R3RA 3QW4B 3L23A 3UWUA 3U2OA 1GOOA 3N2MA 1LWIA 1IQ8A 5BU6A 1WDRA 2Y4SA 4M6UA 3FGCA 4ZR8A 4A3QA 3MTWA 2WZMA 2Y5JA 4H6RA 3SEPA 3Q67A 1OFOA 1ADOA 1PVNA 3M1ZA 4GX9A 4GJ1A 2V3GA 3KVKA 4GZIA 4DT4A 4CCDA 3P6LA 4ZO9A 4R5EA 1TUFA 3NL5A 1UD2A 1YW1A 1DOSA 4JN8A 2ZFAA 5JIPA 5ECUA 4PTNA 1IXOA 1E4MM 1J0ZA 3N1AA 4M19A 4IIHA 1P0BA 2Q8XA 1R9XA 1J6PA 1XCWA 1OFRA 1POJA 1UWQA 3ZR5A 3EDKA 4FZIA 1CWYA 5DBTA 2FB2A 4LYQA 2V0TA 4D6FA 2OX1A 4FSAA 1GQNA 5L6UA 3NTPA 3VD7A 4TW8A 2YOCA 4GI9A 1LM1A 3UWQA 4MTVA 1PTGA 7CGTA 2YR1A 4QIBA 1XI3A 4GI6A 3RPDA 4DRKA 3AI0A 3VKAA 3G1SA 4NZJA 4DF2A 3WFAA 1HKVA 3SZ8A 2QLYA 3ZS4A 1KT0A 3RIKA 4QP0A 1L9WA 2BLEA 4DRSA 2ZIDA 4GWEA 4MY1A 1A5UA 2D2OA 1QWKA 2X1SA 4DO5A 1TWWA 3MS8A 1OFBA 4K1WA 1JCJA 3A9IA 4UTJA 4L9YA 4LXFA 4AY8A 4E4PA 1KR1A 3M5VA 1XYZA 3IWPA 5A6LA 4P8WA 1CLKA 4X2PA 1BYBA 3HGJA 1TPH1 3EMQA 4W8LA 3VCRA 4ZBCA 4QEHA 1DV7A 4OWGA 1QXLA 4S3AA 2IPFA 2WSPA 1D7JA 1TTJA 3FYOA 2Y88A 4I6VA 4TXEA 3LBCA 4ZCWA 1TA3B 3PPFA 4LGXA 2PWDA 1E0VA 2PP1A 4JCMA 2WVUA 4AIUA 5GJPA 2V5CA 5FCZA 3VU2A 2PDHA 1D3CA 2VC5A 1YDVA 5LNSA 3A9BA 2WMFA 1G01A 2XIIA 2IMRA 4Q8VA 2BDQA 1U5HA 4PL1A 4C6FA 2PE4A 3EWBX 4IIGA 3THUA 3T81A 4FF7A 3TONA 4HCDA 1S1RA 9XIMA 2EJ1A 3RCNA 5H2ZA 3V0SA 5T9BG 1G5AA 3VIKA 3RFAA 3G24A 3KAOA 1UQZA 3WQCA 4JFKA 4EE9A 3G1YA 3VGBA 3GU9A 3DYMA 4FIQA 4B5VA 5D09A 4GNVA 5HATA 4S1FA 4IZGA 1JDFA 2RAGA 1Q6QA 4N4PA 4GC4A 2AKMA 3LU2A 2VCBA 1Q66A 4RZ5A 4DN1A 3RU8X 1F8IA 4LH8A 3BW4A 4GI8A 3EYPA 4HN8A 4MJZA 1ZCNA 4E2DA 1Q6OA 1RXOB 4ZTXA 3PS7A 2QAFA 4H9XA 1G69A 1XYBA 5LIWX 4S2BA 4Z2JA 3ITXA 4UNLA 4PTXA 3LPFA 3B04A 3P8IA 1CXLA 3FV9A 2WMHA 3L9CA 1ME8A 4HHHA 4AD4A 4X22A 3W73A 4C1LA 5EL1A 3BURA 2A3BA 1LL4A 2DSVA 3LM3A 1TQJA 2PRLA 4KFPA 3Q45A 2DVXA 5AHIA 4RE4A 4YYCA 2R9RA 3WDQA 2VFHA 2WQPA 3STEA 1EBGA 4H04A 5HNRA 1KRBC 1XRFA 3TC7A 1R6WA 5AZ0A 3WLKX 2A3LA 4IX0A 1UD8A 4MYXA 3TDFA 1CNVA 1RHCA 4Z2GA 4C65A 4LB4A 1E6PA 4D71A 2WHMA 4N42A 3W1RA 4MMWA 3O5JA 2ZC8A 5DQPA 1T41A 4RZ6A 4UDMA 2Y85A 2GK1A 1HT6A 2F2HA 4AYGA 4GIYA 1QNPA 2CPUA 1IT0A 1UR9A 4GPNA 3KM8A 3NL6A 1PHQA 3MMDA 3H4WA 4K6AA 2XYLA 3DBPA 3RXZA 2A85A 2D73A 3NQAA 3AAMA 1R87A 1XDLA 4U5IA 3VKBA 3GHRA 5I23A 5D2WA 1XLMA 1WZMA 3SADA 3W7CA 2GWNA 1FKTA 4M6PA 3N2CA 2ZUTA 1UR2A 1Y65A 4L1WA 2YCIX 2W6RA 4C7DA 5A1AA 2JBMA 3AICA 3HF3A 2AQOA 4XKYA 1KTNA 4YNGA 2ZX8A 3P74A 4D6HA 1DYSA 2WJEA 1ISXA 3BXWA 1BXBA 3W81A 4E6MA 2PBCA 2XPAA 3F1QA 3I10A 2O0TA 1ML1A 2QJMA 2KR7A 1XUUA 1BRLA 2CLPA 2DH3A 3TYUA 3WLHA 4JZ5A 4LNCA 1BAGA 4W9PA 2QMJA 1UIPA 3VGFA 2HVOA 1VGAA 1Z42A 1VLWA 3HQ1A 4A3HA 4BFAA 1ISVA 4JEJA 2WC4A 5I3IA 5D37A 2QDDA 1FKKA 3VX1A 1A4LA 2DZUA 4BK9A 3DX5A 1TKKA 1EDGA 3GAYA 1MZHA 1C8QA 2VYOA 3KVLA 4RLIA 3M0KA 5KSWA 4JNMA 3QLLA 3T8LA 3RX4A 3PTKA 3PR2A 4H9ZA 4NI3A 4XO7A 2G97A 3VZZA 1W5PA 1DTUA 1E43A 1JD9A 2PLMA 4CU7A 4AX7A 3WKZA 3OZPA 4L1XA 4IQ2A 4JPGA 4XAPA 5HOSA 6A3HA 2Z1XA 2ACQA 4F3HA 1NAL1 3L12A 2ACUA 1Q1CA 1YMYA 4J40A 1V02A 1FFRA 4NIRA 3LQGA 2YDSA 2YLAA 2OVLA 4Q7BA 3PFRA 3OODA 1ISZA 3GDBA 4ICNA 1Q2SA 4NASA 2V68A 1UWIA 2YDQA 3FJNA 3BOLA 2CBIA 3CWNA 1ISYA 1RVGA 1LT7A 2QVHA 2BY0A 2DDXA 3IKDA 3H70A 4QM1A 3W1MA 3S0CA 3P62A 4QT2A 2XSBA 1VCVA 1HJWA 4WKFA 2OT0A 1SZFA 2HBVA 1NVMA 2WC7A 3AYSA 4MPKA 3DI1A 5I03A 3P5ZA 3IIZA 1RBOB 5D8WA 1V51A 2XGBA 1TJ0A 2VZVA 2PF8A 4Z08A 5A6KA 2EO7A 1E6ZA 2C0HA 3EOEA 1W32A 1EGMA 3M0ZA 3ZZ1A 3WD2A 4DWDA 2PUZA 3O1NA 4HOZA 3SSJA 3WL1A 4KMQA 2Z1BA 3NXFA 3UQIA 1GZGA 5LNVA 1EGVA 3PBGA 2HV5A 1UH3A 3FSUA 2KX9A 3B0XA 3R89A 3LGDA 4O57A 3UZYA 1GYNA 4U2YA 3W2LA 1KTCA 2HISA 3KRBA 4LAWA 1P0KA 5KZ6A 5EA9A 2RJHA 1XIBA 4GZEA 1VFLA 1PTDA 2CERA 4EK7A 3VGHA 8RUCA 4LRTA 4JTRA 3UJRA 4HU8A 4AXNA 1P43A 5DO2A 4BY3A 5A2CA 4YVVA 2RDWA 3BH4A 3VO0A 1E0XA 2DUAA 4N9BA 3M5ZA 2VFIA 1M53A 1WE5A 4W4QA 1YADA 3P0WA 2J25A 2Y63A 3IV8A 3OYZA 3SGZA 4AW7A 3GHTA 3BAKA 5EMLA 4JFTA 3MJMA 4PTDA 2X1TA 3GPKA 1GPFA 4YU1A 4R7JA 4WDWA 5HUPA 3V18A 4EWJA 3RUBL 1LG1A 4C6IA 3O5QA 3PR9A 1TVLA 2WYSA 1V6VA 2QZRA 2QYGA 1RLCL 5EBUA 5F2LA 1HNYA 3H12A 1KXHA 4JN6A 1TX0A 4XIAA 3AYVA 3U0HA 3MSRA 1EH9A 4FX7A 3IAPA 4Q33A 1J6OA 3SJNA 5D2YA 1HXVA 1JZ2A 5CSUA 2G5WA 5I79A 4Z1YA 3PWAA 2GJPA 2WNQA 1KFLA 2Z28A 4GVGA 1HN1A 3EX6A 3CNYA 1B54A 3CAVA 5AC5A 3L0GA 3MHGA 5C0QA 4IPPA 2ABBA 4LS0A 1W1IE 3BV4A 3SUVA 5C9XA 1OYBA 2D9FA 4H2CA 1E9IA 4IXXA 2PMQA 5IHSA 4JYSA 3S1UA 3NQFA 3L2IA 3BTNA 2P1FA 1BTMA 2FHFA 4FO4A 4D72A 1J4HA 3FGCB 3WFLA 1C3FA 4NXSA 3PZ9A 4XG1A 4AHQA 1JGIA 1V8EA 1FKWA 3WBXA 3EDEA 3T40A 3GFZA 2NVAA 2Y61A 4GNKB 2VDIA 1LUCB 1RPXA 4QEEA 4ONVA 3H7UA 1A5CA 2WMJA 1LBMA 3VPLA 1QBAA 2VL4A 3HQPA 1ZUAX 2GLKA 3PPCA 4N9CA 5I2UA 3WQVA 1K1DA 1QFEA 3W7EA 2YXGA 3VC6A 1ECEA 2EPOA 5ABEA 2QJGA 4QE4A 5DT7A 1TCMA 4ODMA 3NM1A 1TVPA 4P7NA 2XIJA 3DOPA 1ADSA 3C56A 4XBJA 1U5JA 4Q6XA 2ZRXA 4NJIA 2F2KA 2PBGA 4F2BA 1F3EA 3RX2A 3SURA 2I5IA 2MF9A 3UGRA 3G3DA 2Z29A 4PMZA 1YW5A 3RJXA 2H3DA 2OWXA 2X0HA 3APYA 3I6TA 4B9YA 3C3UA 3V5FA 2E1WA 4M56A 4QDWA 3MCMA 4O2TA 4PSRA 1BXNA 2FYMA 1PYMA 3V1HA 1R3SA 3ZT7A 4OQVA 4WEVX 5G4EA 3W7JA 3ITYA 3TEVA 5GNXA 3VKJA 4JFIA 1YTDA 3W37A 4C6LA 3OHIA 2WCGA 2QCHA 3NM3A 4XISA 3RM4A 1O95A 4AZGA 1FWGC 2ZUSA 4L6DA 5CPSA 4W8AA 5FF2A 2V30A 4A8IA 3AXHA 3P81A 1Y7VA 3C61A 3WO8A 1UUOA 2PV1A 4ADTA 1N8FA 2D2JA 3N11A 3K8LA 3T0DA 4ALDA 2OB3A 4HNOA 4UMBA 3NURA 1VHCA 2HZGA 2FVMA 4A35A 5HW8A 3O63A 1S5WA 4W9QA 3JZUA 1WZAA 5C2XA 3O5PA 1EDQA 3TQ0A 2GGEA 4YCOA 4OKDA 2WHKA 1WZLA 5A8MA 2MLYA 5A6BA 2ISFA 3LCGA 3LXCA 3GXDA 5TNVA 3LN3A 1GVOA 4XZWA 5ABFB 4GYFA 3I7RA 2XWEA 1YPIA 2C14A 1ZHAA 3VI2A 4HNUA 2OWWA 3QPEA 5DY2A 3B8WA 3TXVA 1UP2A 3WMLA 4PBFA 2GQ3A 1GEHA 4L3NA 2OJPA 1LWJA 3RLUA 1PJ9A 4DQWA 3SCTA 2MNTA 3S5ZA 3M4HA 3S47A 3UWWA 2OGJA 4DRNA 1EHNA 4JDBA 1HO1A 3BOFA 2XN2A 3ANUA 1SO4A 3CC1A 3DAQA 3N9SA 3CTLA 3G22A 3B8UA 3QV9A 4H41A 1EO5A 1TELA 4JR5A 3K8KA 1OF8A 4LVGA 3IANA 2E6AA