1HKKA

High resoultion crystal structure of human chitinase in complex with allosamidin
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
364
structure length
364
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEQSGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHITOTRIOSIDASE-1
publication title Crystal Structures of Allosamidin Derivatives in Complex with Human Macrophage Chitinase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 132
structure length 364
sequence length 364
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1hkkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hkkA01
2GK1A 4BS0A 1TA3B 2CBIA 3BAWA 3W53A 1NP2A 3WH9A 3AIEA 2XTKA 2WC4A 3SUUA 4Q22A 3BCDA 3ARYA 5BXPA 4J7RA 4AY1A 1KXHA 4M1RA 3MUAA 2VX5A 1BG4A 1QNSA 2J8GA 5HDRA 2DT1A 5A6BD 2GDUA 3TTSA 3WH6A 5A8OA 1CGVA 2VX7A 1NWRA 4W89A 4NF7A 3WDJA 5D4YA 1C93A 4HU8A 3ZQ9A 1PX3A 2J7HA 1TR1A 3M7SA 3OGRA 1LLOA 2JE8A 1HT6A 3EBVA 3L4VA 2CEQA 2FHBA 1WCGA 1IV8A 1QHZA 3L2MA 4WK9A 2CXGA 4URIA 1TVPA 2EPNA 3FHAA 5JIWA 5JBFA 2DPEA 2Z1KA 4L4PA 1MXGA 4MB5A 1ZB5A 3WNOA 3WUGA 2ZXQA 1GOIA 2VTFA 5BROA 4X0NA 2VZSA 1XH1A 1JZ2A 3N15A 3ARWA 3UR8A 4JFWA 1G1YA 3AIBA 3AFBA 3WNKA 5CSUA 4P7QA 4MADA 3SUVA 3WNLA 2IXUA 3ZJKA 3FN9A 4XZBA 3EMZA 3OLDA 1MW3A 3AYSA 4E8CA 3ZJ8A 4J28A 4U33A 1BHGA 3U7VA 1J18A 2JALA 2VQUA 1PIFA 3U5YA 5A6JA 5IHRA 3DHPA 2PB1A 4GO8A 1R87A 2PWDA 1QW8A 4W5UA 5DF0A 2BY0A 4H04A 1E3ZA 3UETA 5A8NA 1KQYA 5A6LA 3AXIA 3MSGA 6CGTA 4WJXA 1JD9A 2D0HA 4AC1X 4U2YA 2UY5A 2V38A 4RE3A 1S46A 4BZYA 4Z2LA 3THDA 4Y7EA 2FH6A 1J0KA 4TX6A 1NWTA 1U33A 4WF7A 1V0MA 3LPOA 1M01A 2PBGA 1QVBA 4B15A 3DHUA 1OGGA 2VO5A 1H3GA 2EPOA 3EYPA 4KGLA 4P7OA 2YA2A 1WPCA 5AY7A 3NCOA 2HVMA 1JD7A 3W0KA 5HNNA 4C7GA 3POHA 1GOWA 3F5KA 3QOKA 3CHFA 2WMHA 3PZNA 2VRKA 2W5FA 5I0DA 2ZUNA 4ZENA 5A2AA 2CHNA 1OM0A 4JL2A 4AZHA 2VC9A 1K6AA 5CG0A 1QI2A 1J11A 4UFHA 4KRTA 2XVPA 1DWAM 5LYRA 5DEZA 3PZTA 3I3EA 1EH9A 2OSXA 4W5ZA 1GQIA 1B9ZA 2V5CA 2ZWZA 3MKKA 4MJ2A 1NOWA 2E40A 1KGUA 4JKMA 3WELA 1GOKA 2XIIA 1FOBA 1OBAA 1CPUA 7A3HA 2GJXB 3T2PA 1V6WA 4HOZA 1BFNA 3VIKA 3CMGA 1US3A 3EDFA 3QHOA 3J7HA 3T08A 3N18A 1PIGA 4WLCA 4LQ1A 1E4MM 1E6ZA 4D6EA 3AXHA 2WMKA 4UOQA 1E5JA 4EKJA 1R86A 4QFUA 4ZE5A 4AMCA 2DT2A 1FA2A 2YA1A 1JZ8A 2BY2A 2OYKA 4DWSC 1GVYA 4UTFA 3BSHA 1EQCA 5C8BB 1H0IA 4CGTA 4GZIA 1C91A 2X2YA 2XM2A 3ALGA 1KXVA 3U7BA 4HMEA 2J8FA 3O2LA 1J01A 3WNMA 4D6HA 1VEPA 4H8VA 1B30A 5M3WA 1C7TA 2ZX5A 4W93A 2EO7A 3VGFA 4CN4A 2YOCA 5F7UA 2QLYA 1HIZA 1E0VA 1B31A 1BSIA 3GTNA 4ATWA 5I23A 6TAAA 2A3BA 4W86A 5CPSA 1ZBWA 3AZRA 2YDRA 2W66A 1KGWA 4D6DA 3BSGA 4XV0A 1ITXA 4W87A 2D0GA 4PTWA 8CGTA 2WC3A 3PZMA 3FAWA 2YL8A 5I78A 3VU2A 4GPNA 4M24A 1JYNA 4HZ7A 4H2CA 4UOZA 2QPUA 5D8ZA 1ISXA 1LJYA 1P6WA 1RD6A 1UD3A 1FP9A 2X09A 3OGSA 1V3KA 1J0ZA 4AD4A 2J7FA 2ZXBA 3TOPA 1PZ2A 1Q6DA 3SCPA 1QI4A 3F5LA 1UD4A 3OLIA 1H1NA 3VM5A 4D6FA 1JYXA 4JFUA 3PZ9A 1B3WA 1O6IA 2WPGA 4V28A 3ZT7A 1EIBA 4JZ5A 3VMNA 1W3JA 4GO9A 1V02E 3RILA 2GJPA 1UZ4A 2OWXA 1GVIA 4FLQA 1XH0A 4UQEA 2CBJA 4PUDA 1MVYA 3WF4A 4NRRA 3CZ8A 2GDVA 3MUIA 1E70M 2YL6A 3GXFA 3BAYA 1LL4A 3SCQA 1JZ3A 2OYMA 1WDPA 3VNYA 1JNEA 1PJ9A 4AZ7A 3PBGA 1E6SM 2E8ZA 1J0YA 3L4ZA 3CUJA 1E1EA 1CXFA 4AZGA 1KFWA 2ESCA 1V0KA 1XSJA 2VRJA 2WAGA 2WWDA 2VX4A 1H09A 3FXYA 4TXEA 5D8WA 1WB0A 2EQDA 2PWFA 5ECUA 4D6GA 4TVCA 3B9DA 1EDQA 2VUYA 1HVXA 1H4PA 4HOXA 1ISYA 2WSKA 2XUCA 3I3DA 3VGDA 4HMDA 3CZGA 4TVDA 1E71M 4E4PA 1UKSA 1UG6A 2FHFA 1EQPA 4CU8A 1CXIA 2D24A 2JIEA 3VDCA 1GONA 5AC5A 4AD2A 4AD0A 1QPKA 4H7VA 1R8LA 3WD4A 3G6MA 1Q4NX 3GH4A 3AISA 5I3DA 4HOWA 1GOMA 2G3JA 2GVYA 3F5JA 3OIHA 2F8QA 3PZGA 3SCTA 3CZKA 2FGZA 3PTQA 1VBRA 2O9OA 3W4RA 1H41A 1QW9A 1NP0A 1XCWA 4OJYA 3WF2A 3AMCA 2VR4A 1ODZA 2J77A 4MNMA 5A8QA 2C7FA 1XV8A 4JHOA 3SIMA 4JHZA 2GFTA 3UG4A 1XRVA 3VINA 3VIMA 1H49A 5BRPA 1PZ3A 3RJXA 4P8UA 3T2QA 1E6NA 4QP0A 4NI3A 4AIOA 2ZUMA 4X0VA 3N04A 3K46A 1PEZA 1R85A 4TVUA 5E70A 1BVZA 5BXTA 3ZMRA 1M03A 4UFIA 1BQCA 1MXDA 3GBEA 4CCEA 2WKLA 4CD7A 1QNRA 3T0BA 1TMQA 4TTUA 2HISA 1E0XA 4HTYA 1C92A 1BGAA 1W3KA 2WVVA 1OGSA 1NH6A 3BH4A 1EO7A 2D2OA 1XD0A 3TP4A 4QCEA 1M7XA 2WVUA 1TCMA 3A4WA 3UR7A 4J3VA 1UH2A 3T2OA 1N82A 1WZKA 3B9EA 5D9OA 2XFRA 5BCAA 4ACZA 3WQ8A 1V3LA 1V6UA 3N9KA 2WYSA 3PZOA 4JFTA 3PZUA 1E56A 4BF7A 2AOSA 4DUWA 3A4AA 1GQLA 3VX0A 3WSUA 4MNKA 1TA3A 3EDKA 1MYRA 1XHGA 4HA4A 4U2ZA 3SCSA 1BF2A 1SR0A 3HMCA 3AYRA 4PEEA 3VGEA 2XVLA 5A6MA 5KZ6A 5I6SA 4BQ4A 4AZBA 3AIVA 2J78A 2VZTA 5IDIA 3TONA 2XVKA 1V3JA 2E9BA 1JXKA 3N13A 5ABFA 4TUFA 2J25A 3W6MA 3LPGA 2PWHA 1XYZA 3MSDA 1G5AA 3W37A 5I24A 4AISA 3CHCA 3VD7A 2UY4A 3WEMA 1QNOA 1E3XA 1W2PA 3VD9A 1C90A 2UY3A 3D5HA 2A3EA 1EDGA 3GH5A 1D2KA 1G9HA 3AZTA 4J27A 4OZOA 3AS3A 1UKPA 5GQBA 2G3IA 5E6YA 3VMPA 2D1ZA 4ACYA 5I77A 2BVTA 3CUHA 1E4NA 4JKKA 4RL3A 1F4AA 3QHMA 4OBSA 4UQCA 4W7VA 2GUYA 1EHAA 4PMOA 3CUIA 4TTGA 3W6LA 1US2A 3VM7A 1RH9A 1PBGA 1B3ZA 4FLSA 4Z2HA 1DP0A 1PAMA 4FK9A 2PF0A 1V6XA 1B3VA 2Z1SA 3LMYA 1PX4A 2W67A 3SEPA 1ZU8A 4CCCA 2ZUVA 1DWFM 3BAIA 5A2BA 3DECA 1C8QA 2CIPA 4M29A 3I3BA 4K68A 1GHSA 3RJYA 1U30A 3VD3A 2VI0A 2W91A 3RM4A 5E6ZA 4QCFA 1MWOA 2V3DA 3GYCA 3CZJA 4J3UA 4NZCA 1ESWA 1QBBA 1M04A 4XZWA 3PZVA 4AZCB 3VO0A 2ZE0A 4B3LA 1JIBA 3AHTA 3GXIA 2J7EA 2VCBA 1GUVA 3WNNA 2J4GA 2D0FA 2D3NA 2WMIB 5A69A 1BYCA 4LXFA 5A6SA 1X6LA 5EBAA 1UQZA 4W8LA 3VILA 1JAKA 2BHUA 2EPKX 1AQHA 2E9LA 5DT5A 4F66A 3WN6A 3CIVA 1SMAA 1H2JA 3U5UA 4PMZA 3PTKA 5JH8A 4PTXA 2X05A 3W26A 2EEXA 2DSZA 4WKHA 3ZR6A 4D1IA 4LYPA 3CTTA 6A3HA 3WKZA 4IPNB 2GK1B 2WB5A 2YBUA 2DSKA 3FHQA 1H5VA 5LA0A 1EOMA 3K8KA 1VFFA 1LWJA 3FNDA 2QF8A 1JZ4A 1JYVA 4UQBA 2JFEX 3WIJA 4HA1A 5IFPA 1VIWA 1HP4A 1VFMA 4EK7A 1VFOA 3W27A 4B9YA 4ATDA 4ZEPA 3SCOA 5E0CA 3ARRA 2ZUWA 4RE2A 4TX8A 3ARXA 4J3XA 3JUGA 4IM4A 1UKQA 1V3IA 3F4VA 2GJXA 3VDHA 4UQDA 4KGJA 1DWGM 1JDDA 2IUZA 3L4UA 4QLLA 2V5DA 3SCNA 3QHNA 4FMVA 1UKOA 5I79A 4B9ZA 2E8YA 1SFSA 3MUZ1 3OLGA 4UR9A 4QLJA 4UQAA 3WDPP 1VB9A 5BXRA 3OG2A 1JXJA 3BLKA 1W9BM 1AMYA 1BVNP 3EMQA 1FH9A 2VX6A 3PN8A 1BYDA 3PZQA 3TA9A 5FIPA 1JDCA 3RIKA 2E9MA 2CBUA 4UFLA 3ZR5A 2DGAA 4DM2A 3VIOA 3WFLA 2ZX8A 3AHYA 3PZIA 1UWIA 2J47A 2AAAA 4PCTA 5FOOA 1J9YA 2YL9A 2YLAA 1CXLA 3HJEA 3SCRA 2UWFA 3IK2A 3L4YA 3GZAA 3MANA 4AWEA 5GNXA 3N1AA 4DWSD 1HXJA 3VKKA 5CXPA 5DMYA 3CUFA 1WZLA 2YBTA 2WNWA 4JKLA 2OSYA 4H41A 2XSAA 1BG9A 5ABHA 2A3CA 2O9TA 3UERA 3WMBA 4OIFA 1UD6A 3UG3A 1LL7A 3W24A 2BXYA 2E3ZA 3VIGA 4W8BA 2QV4A 2VURA 1FFQA 4AW7A 2D20A 4BQ3A 4LYRA 2X1IA 1LL6A 1W1VA 8A3HA 1JG9A 4AYSA 1UR9A 5CGTA 3MMWA 1ODUA 1CXKA 1HKJA 1DEDA 3ZJ7A 1I1XA 5CLWA 2Y24A 3RM9A 2J75A 4ML4A 2DQXA 1E4LA 4CU7A 1HL8A 2YKKA 1BGGA 2FHCA 2GSJA 4N42A 3AHXA 4W7UA 2AMGA 5CZKA 1E6QM 5FCZA 2V3GA 2BVYA 2PBOA 4P8VA 1I75A 2PWEA 1ZJAA 4PMNA 4FF5A 3IAQA 5A6KA 1UYQA 2WLYA 2WCAA 9CGTA 1ZJBA 3VTRA 4Q7NA 2XVGA 3WDRA 3ZSTA 4HZ8A 1MFUA 2F2HA 1DTUA 2VMFA 4XB3A 2FDMA 1DWHM 2EBNA 3OLEA 3OZOA 3NSXA 1UA3A 4AIUA 1NQ6A 2WHMA 3DYMA 2B31A 2ZUSA 1KCKA 2J7BA 4LX4A 1CLXA 1E5NA 1PPIA 4H8HA 1W1YA 1XCXA 1J0JA 2DH3A 1OSEA 1KXTA 4ZXOA 4A3HA 3BAKA 3WFZA 3WQWA 2QMKA 5JBDA 3ARTA 1HNYA 3RDKA 5BWFA 1V0NA 3NSNA 1JZ7A 4B3KA 1FFRA 1ZBVA 4DWSA 4MB1A 2WHKA 4AXNA 3ZM8A 3U57A 3AMGA 2WMGA 4B16A 1MQRA 3DYPA 4D71A 1QBAA 3O9NA 5I5RA 4V2XA 2ZICA 5FL1A 3W82A 1J0IA 4OUEA 5CSYA 3OA5A 1XD1A 3SUWA 4CVUA 5DFAA 1QI0A 3GXDA 3HN3A 3RO8A 1FHLA 1D3CA 2YDSA 5EMYA 2XHYA 3A47A 4M56A 4UZSA 2PWGA 2WWCA 5A2CA 1GORA 4WIWA 2EXOA 3WD1A 1V08A 2XFFA 1ECEA 3DYOA 2NT0A 2QMJA 3GDBA 3NSMA 1BAGA 3IAPA 1HJWA 5FL0A 5JBEA 5HXMA 2XWEA 1XSKA 3EMCA 1EHNA 2XPKA 1UHVA 3BMVA 3ZJ6A 5C71A 4GKLA 3TTOA 1W1TA 1GNXA 2DIJA 3UESA 2E0PA 3QR3A 2WZIA 1JF5A 1MW0A 1CGWA 3CBWA 4D6CA 2DT3A 1QI5A 3WQ4A 5E09A 2VQTA 4X9YA 1JZ6A 1BLIA 1EGZA 1CWYA 1VEMA 1G94A 3W25A 3LPPA 4GI6A 4GQQA 4JCLA 3KEHA 4DUVA 3ARZA 1LQ0A 3AHZA 1NWUA 4QDMA 4MDOA 4JAWA 4AD1A 3CMJA 3T0AA 3AS0A 2BXZA 1JDAA 1UR4A 2VZVA 1EDTA 3KZSA 1X6NA 1OWQA 1B90A 3G6LA 1HKKA 1VENA 4PMUA 3WUEA 4FLRA 5GPRA 1E15A 5JUVA 1WE5A 4LYQA 1HF6A 1C7SA 3IJ7A 4HZ6A 4D6JA 4MTVA 4MDPA 1M53A 4UQ9A 2XG9A 3K8LA 3AZSA 2XM1A 3CO4A 3DC0A 1KWKA 1C3FA 4UFJA 1UD8A 3BCFA 4GI8A 3SCUA 1GJWA 3BAXA 3WNPA 4PUEA 4A4AA 2XWDA 2WK2A 1OT1A 3VIJA 1E55A 3SURA 4YHGA 1HJVA 1WZAA 5LA1A 5M5DA 1YQ2A 4PTMA 2XYLA 1AQ0A 1CENA 3VMOA 4P8WA 2E4TA 5D9NA 3VOCA 1W9DM 2VL4A 3ARUA 3KL5A 4CD8A 3RPMA 1FH8A 2ZX6A 2W61A 2VZOA 1W3LA 4YPJA 3WQ5A 5BYWA 3ZIZA 1ZS2A 1Q6EA 2W4XA 5A94A 1E6RA 2UY2A 5HOSA 3WQ6A 1V0LA 1AVAA 1FH7A 3WH8A 1E43A 4MNLA 1LG2A 1UUQA 2WSPA 1DWIM 4NRSA 3N12A 2XIBA 1VAHA 1QI3A 2BS9A 4F9JA 2CKRA 4JFVA 4M8UA 2ZX7A 1UWUA 1V6VA 2OWCA 2VJXA 1JFXA 2OYLA 4J3TA 3NDYA 1B0IA 3AHVA 3N11A 1WP6A 3L4TA 1CLVA 3SCVA 3BC9A 2ZXDA 4GZJA 3WMCA 2BVDA 1R7AA 1WDRA 2G3MA 3S6TA 4AZIA 3EDJA 2VCAA 4TOQA 3L2LA 4AZCA 2OLHA 3POCA 2BFGA 4J3SA 2WVVB 1FHDA 1GQJA 1G01A 1A47A 1W1PA 1W32A 2YIHA 1Z32X 4CUCA 4HPHA 1KWGA 2WMIA 3AIQA 4V27A 1KB3A 2F61A 4NSBA 5HBFA 4C7DA 4BCEA 2WMJA 1W9PA 1NARA 2BV9A 1CBGA 3MUY1 3WL0A 1E1FA 3KL3A 1XC6A 1CTNA 1LWHA 1VFUA 4ACZB 1V6YA 2VT0A 1CGXA 2G3NA 2WVTA 2WXDM 2PC8A 3SUSA 1BPLB 2CPUA 1JNDA 3W29A 3IJ9A 1UD5A 1R7OA 2FGLA 5ABGA 2XFYA 3WF3A 1OIFA 1CXEA 3L4XA 4EANA 3VD4A 1ZBCA 2ZXAA 1CYGA 3CLWA 1UR8A 3FW6A 4AIEA 3CUGA 2A3HA 2BHYA 3VGHA 2QPSA 3SCWA 1GPFA 1QHPA 3BXWA 3AIRA 4OOZA 4CD4A 5ABFB 1OD0A 4UFMA 4U5KA 4W88A 5IXEA 4QLKA 1V3MA 5HPCA 3OBAA 2JIWA 1XYFA 4HA3A 4PMRA 3MV11 3AS1A 3WF0A 2DEPA 3WDQA 5D9PA 1FP8A 2TAAA 4N0RA 4PMXA 3ARQA 2BY1A 2V3EA 1HKMA 5A1AA 1XGZA 1E6PA 1U2YA 3K4AA 1GHRA 2O92A 5IHSA 4CD5A 3WH5A 1E0WA 1MQQA 1HJQA 4JFSA 1E40A 5A3HA 5EB8A 4Z2IA 1VRXA 5A95A 1AQMA 1EOKA 1VJSA 1OT2A 1K9EA 2WCSA 1HJXA 5A6AA 5ABEA 3VIHA 3CHEA 1LF1A 2D22A 3WL1A 4OBRA 1Q6CA 1UOKA 1GQKA 1HJUA 1UH4A 4P7LA 4PSPA 3RM8A 1HKIA 2WHJA 1DHKA 3NIYA 1VEOA 3BMWA 4DM1A 3UCQA 4AEEA 1ISVA 3W38A 4WSKA 4LGXA 4RE4A 1IZJA 1J0HA 3O6AA 4XX6A 1W9VA 1IT0A 3RCNA 2WC7A 4MB4A 1UZ1A 2YDQA 5AC4A 1EA9C 4U5IA 3MO4A 3K1DA 1CDGA 4F9DA 1H0GA 4IUGA 4PYSA 4CKQA 2WANA 2CITA 1Q6GA 4OOUA 4CD6A 3VDAA 2RGLA 4P7RA 3VIFA 5A6BA 1JZ5A 2Y8VA 2DDXA 4EAMA 1VJZA 3WBAA 1UWTA 4U3AA 2ZUTA 4JL1A 5EFDA 4UCFA 1KGXA 3ARSA 2J79A 1Q6FA 3ZOAA 2J62A 4UFKA 4GZEA 1CECA 1NOUA 4WKAA 1Y7VA 1WO2A 2W62A 4M81A 1K9DA 1TVNA 1TUXA 1JYWA 4A3YA 4D6IA 4PMYA 1CGYA 5C70A 4PMDA 4JCMA 4J3WA 4W7WA 3WH7A 1UR2A 4L4OA 3WF1A 3GNRA 1KBKA 3GBDA 7TAAA 4GXPA 5CLTA 3OGVA 1LG1A 2XJ7A 4QAWA 1RPKA 1CIUA 3WMSA 1K9TA 3MMUA 3NJ3A 4BQ2A 1IZKA 5EFFA 5DO8A 4EE9A 5I2UA 4PMVA 2ZX9A 3OZPA 2Y8KA 5AYIA 2YLLA 2VRQA 2NSXA 1NM9A 1KQZA 2VVSA 4M80A 2WLZA 4W85A 3APGA 3GH7A 3M6DA 3AXXA 4HP5A 3VNZA 5CJ5A 4LPCA 1GW1A 2CESA 5AYBA 2VZUA 3UEQA 3PTMA 1W9XA 4M82A 2DIEA 3W81A 1TG7A 3KL0A 2WVSA 5E9AA 2WCGA 5GNYA 1ISZA 2OWWA 2Y4SA 3VIPA 3VX1A 2WW5A 1GZJA 1E4IA 1GOQA 1J12A 4UNIA 2JEQA 5A8MA 4PBGA 2NW0A 1CZ1A 3WDHA 4HPGA 3T0DA 1GJUA 2VOTA 3AROA 5D9MA 1UKTA 4W84A 3RMEA 2EPMX 2ZIDA 4KMQA 4MPKA 1WDSA 2X0HA 3AJ7A 1OCQA 3MMDA 3WD0A 2ZWYA 1BTCA 2CBVA 1MW1A 3VGGA 2J74A 2WBGA 5GNZA 3EDDA 1UQYA 4PRWA 4XUYA 4AD3A 4S3JA 2CNCA 3SUTA 3CZLA 5M03A 1ZL1A 3N17A 4U3CA 2YJQA 4MAZA 3AIWA 2CERA 1UA7A 3IJ8A 4ZFMA 2G8ZA 1OIMA 2CKSA 5CGMA 3WD3A 3NDZA 1JF6A 3ZSSA 1CGTA 2DSWA 5JIPA 2WM0A 2XVNA 1K9FA 3GM8A 4CCDA 1C8YA 3AQUA 2IXVA 3K8MA 1GOOA 3WD2A 3WQVA 2X8RA 3AMDA 4P7NA 2PI6A 1SYTA 1G0CA 3L4WA 1OD8A 1O7AA 1YHTA 1JL8A 3VDBA 2WBKA 3WUBA 1HN1A 4GINA 3MU7A 2W63A 3KE0A 2J7DA 1ZBKA 2BNJA 2J7CA 3UG5A 1SMDA 4CU6A 4C7FA 1XH2A 4YHEA 5FD0A 1V02A 4FLOA 3VGBA 4F8XA 2QHAA 1VBUA 1E6XM 3HU7A 4ZXLA 4AD5A 2DT0A 4R27A 4AZ5A 3W28A 4MAVA 5M17A 3AICA 3WENA 2BHZA 3VUPA 1V03A 4Z2KA 1MFVA 1J10A 1HP5A 3K4DA 3TTYA 2DSUA 3IANA 4D1JA 1ISWA 1ITCA 5CPTA 3VIIA 1KR0A 1W3HA 3MV01 2Y2WA 1OGBA 4GIAA 2W92A 4E8DA 4AEFA 1RP9A 1KCLA 1UR1A 3A6OA 2Q8XA 3MS8A 1OINA 3QGVA 3CZEA 3ZT5A 2C8NA 2X0YA 1WKYA 2D3LA 4CN1A 3QOMA 3FAXA 4S3KA 1B3YA 4GQRA 1HJSA 1VF8A 1C8XA 3PHAA 3S2CA 4JIEA 4HU0A 3BGAA 2CCRA 4DWSB 4E2OA 1JI2A 3AOFA 1QNQA 1WAWA 1B3XA 3VPLA 2O9PA 1E72M 3ARPA 5FKYA 2XGIA 5KEZA 5LA2A 1CNVA 3BAJA 4CVWA 1UWQA 3M46A 4IPLA 4ZE4A 2G41A 4F79A 1F4HA 4WKFA 3LPFA 3II1A 5BRQA 3WUFA 1NWSA 2J7GA 4U31A 2DSVA 3CGTA 1BYAA 1H11A 2ZUUA 4CN6A 2WHLA 1PX8A 1D7FA 4UOJA 2CYGA 4D72A 3CH9A 3AIUA 1CXHA 2NT1A 3GNOA 4MNJA 2CHOA 5E0FA 1UWRA 3D3AA 1RP8A 2FH8A 2WMFA 2EJ1A 5HPOA 4MB3A 1MQPA 4ATLA 1A3HA 3B8SA 2G4FA 1TZ7A 5BXSA 2GJRA 1B1YA 2XGBA 4OKDA 3VD5A 1E73M 2VR5A 4KWUA 4PMQA 3ARVA 3WDIA 3GNPA 4DUXA 5DT7A 3GXMA 2ZOXA 1W2VA 2YA0A 1QOXA 4GI9A 3B9AA 1E9LA 4BA0A 2D23A 1GCYA 1MW2A 2JEPA 4R5EA 4Z2GA 3T09A 1UR0A 1KR1A 1JI1A 1UD2A 4AZ6A 3BLPX 3AI0A 1QHOA 4H8UA 1BYBA 5A8PA 1L8NA 3NYDA 3VVGA 2WKGA 1TE1A 1W9UA 1XSIA 4W8AA 4PN2A 3ECQA 4HMCA 1B2YA 2YL5A 2VCCA 3CPUA 3ZO9A 4BQ5A 2CETA 2O9RA 1KXQA 4WSJA 1UWSA 1L0PA 1WZMA 3A4XA 5IFTA 3CHDA 1QNPA 2WZHA 1W91A 2JF7A 1NOFA 1DWJM 3AMLA 1HL9A 5CQ1A 3AS2A 3OB8A 1OB0A 3NUKA 2MANA 2Y5EA 4YN5A 2VNCA 2VVNA 3WEZA 1JFHA 3E1F1 4PCSA 1JAEA 3ZT6A 3M07A 1TFVA 1V3HA 3AMKA 4UZUA 3KWXA 7CGTA 2RGMA 3WEOA 4PTVA 3EDEA 1WDQA 4KRUA 2XSBA 1I1WA 1X1NA 2DH2A 1CGUA 1CEOA 1EXPA 2JF6A 3A3HA 1KBBA 2WZEA 3WBEA 4PSRA 4P8XA 1EO5A 5CPQA 4IISA 2A3AA 1JGIA 1HVQA 1HX0A 1UH3A 4Z2JA 3ALFA 4MJ4A 3TTQA 2BY3A 2EPLX 2V3FA 4KH2A 5TD4A 2OSWA 3FY1A 2C0HA 3THCA 3WY1A 1WNOA
chains in the Genus database with same CATH superfamily
4DBWA 2DZWA 4EVZA 2GK1A 2CBIA 1F7BA 3WH9A 3QR0A 2BTMA 1X7FA 2XTKA 1KM1A 3BCDA 3UPMA 3OQ8A 4AY1A 4S3FA 2GDUA 4W89A 3E49A 3EB4A 4NQ1A 1C93A 4HU8A 3ZQ9A 3LHWA 3O0KA 3NRKA 1TR1A 1FKFA 3OGRA 4GMEA 1HT6A 3EBVA 4DIAA 1IV8A 4WK9A 1OFDA 5HR7A 2BZNA 1OYBA 2Y70A 1U5JA 1NFGA 3N6HA 1XLAA 3IVTA 2XH7A 4LAKA 2DZUA 1XLIA 3R8GA 2QGHA 1Z6KA 2P8CA 2ZXQA 3DFNA 3TN6A 5BROA 1T96A 2J88A 4KR0B 3TLLA 1H51A 2HZGA 1XLJA 4NZ3A 1JZ2A 3N15A 3ARWA 3UR8A 2Z4GA 1G1YA 1O66A 4V33A 3AIBA 3WNKA 1VQTA 5CSUA 4MADA 2QR6A 3U2OA 3GU2A 4XZBA 2I9EA 3EMZA 2P53A 4DJEA 4B90A 4PUMA 3ZJ8A 3U7VA 1PCKA 2ASHA 2GVLA 3MI2A 2ZRWA 3U5YA 3DHPA 2PB1A 3GK0A 1FKIA 4PCPA 1BRLB 1YBQB 3NYZA 3PBWA 5DF0A 1GYMA 1HUVA 1QPFA 2VDGA 3CQHA 1VHNA 2QEZA 1ROUA 4WJXA 2PP3A 2Y7GA 4I9AA 3QRHA 2DZVA 4Z2LA 3GU0A 2BB0A 4Y7EA 1FAPA 3UP8A 5HMSA 3T44A 1GW9A 5GPGA 1I45A 3DUGA 2PBGA 4Y90A 3IRSA 3DHUA 1SJBA 3H26A 1AFSA 5D03A 2YA2A 1HTIA 1VHCA 2C1HA 5AY7A 4N9BA 1H61A 1JD7A 4RZBA 3W0KA 2WMHA 3PZNA 2W5FA 2OJPA 2NQJA 2CHNA 2VELA 2ATMA 1OM0A 4JL2A 3S3GA 4NJGA 3NGJA 2VC9A 1VLWA 1U5HA 1M5YA 3NQBA 4UFHA 3N2CA 4ZSUA 5BOEA 4KRTA 1KFEA 5HWMA 3DFSA 3I3EA 1GQIA 4NZ4A 3QV9A 2V5CA 1U1JA 2TPSA 2Y0FA 2AGKA 4L6OA 4JN7A 2ZA1A 3TWAA 3P93A 2JKEA 3FLUA 4R7JA 2ZZ1A 5AHFA 1R5YA 2NZLA 4O53A 3BK0A 3SSZA 2QCCA 3LQLA 1BFNA 2GYIA 3VIKA 4NJHA 3CV2A 3EDFA 3J7HA 3T08A 3PJTA 3OZYA 3HGRA 4LQ1A 1UBSA 1E4MM 4XQ6A 3O06A 4D6EA 2WMKA 4QFUA 1XYCA 3G0UA 3L5MA 2OYKA 4DWSC 4UTFA 3BSHA 1EEPA 1EQCA 4NNBA 5T91A 3B0UX 3IGUA 3U7BA 4HMEA 3O2LA 3WNMA 1J01A 1VEPA 3U4AA 1UIPA 4NIRA 2QCEA 1ITUA 1C7TA 2AKMA 1LRQA 4CN4A 3SFWA 2YOCA 1OCNA 2FDSA 4ATWA 5I23A 4DQWA 5C5YA 1WQ5A 2V30A 5CPSA 4JQ4A 6PTDA 3IVUA 2W66A 1TIWA 2C1GA 4KWVA 1KGWA 3I7QA 3R2GA 2XP5A 4PTWA 2FFIA 1EP2A 2K8IA 3PZMA 3SY8A 3TK7A 3GE7A 2YL8A 5I78A 5D04C 4HZ7A 4UOZA 2PZ0A 4JEJA 2PURA 3BJTA 5D75A 1LORA 3OGSA 1V79A 2J7FA 2DZXA 2YW3A 2ZXBA 5AC8A 4C60A 3UPBA 1O68A 2VFEA 1QI4A 3F5LA 2J13A 1TCOC 4M0XA 5EMKA 3W1PA 1KRBC 4RDYA 1AL8A 3G1YA 3L0GA 2GGIA 3DGBA 5C6MA 3HQ1A 4V28A 3ZT7A 3QY6A 3KAFA 7TIMA 4N9CA 4PGLA 2PTZA 3NM1A 4ZB2A 3PAJA 1R0MA 4X60A 1R2TA 1KTNA 1XQKA 3IIZA 1DQXA 5I3FA 4UQEA 2CBJA 2J9ZA 1PE1A 4YVXA 4FIQA 2OGJA 3LX9A 2QQ6A 1XL9A 1L6SA 1W5OA 3VNYA 3FEQA 4DXVA 4H9TA 3PBGA 1B3OA 1E6SM 4PC8A 3JZUA 5F4WA 3INPA 2WAGA 2E5CA 1H09A 3PWAA 4OV4A 4TXEA 4GWEA 2EQDA 1IT8A 2Y7EA 2VFHA 1NF0A 3W1QA 3B9DA 4E4FA 4L61A 2VUYA 1DE6A 4X3ZA 2GGEA 2ZA2A 3VGDA 3CZGA 3ZWTA 3GXNA 3SN4A 5AVNA 1TUFA 4O1CA 1EQPA 5CBIA 1K70A 2QIIA 3CH0A 4F48A 5LNWA 4LAWA 1KBIA 1S5VA 2PDKA 4UCGA 3FDKA 3VDCA 4US5A 1GONA 4DZ5A 4AD0A 1H63A 1Q4NX 5I3DA 3BURA 1GOMA 2GVYA 3F5JA 3VOHA 3MT1A 3CUXA 4JOMA 3SCTA 3CZKA 1XCWA 1NP0A 4HBKA 4IH3A 1T8QA 5CBJA 1W6TA 3AC0A 2QIWA 3TJLA 2NUXA 4KIEA 1VFTA 5A8QA 2WNZA 4DROA 3UG4A 3N2MA 1Q5MA 4UTHA 1R3SA 1H49A 3V1PA 2QXWA 1PZ3A 3RJXA 4P8UA 1SR9A 1FDYA 1UZDA 1G7VA 4NI3A 3N3MA 2ZUMA 4X0VA 5EGRA 2DP3A 3EXRA 2F4EA 5E70A 3GW0A 5BXTA 1XBZA 3W00A 3ZMRA 1EJVC 4YCPA 1BQCA 1G4EA 2Z1WA 2VEIA 4CCEA 2GUBA 2P0IA 4JFKA 1QNRA 4TTUA 4HTYA 1YX1A 3TP4A 3KDOA 2OT0A 4GABA 4QCEA 3I7RA 3BLDA 4RDWA 3AALA 1UH2A 3UA4A 4LVDA 3T2OA 2BSLA 4IQCA 5D9OA 3WZ0E 3VA8A 5BCAA 4ACZA 3UZZA 1V3LA 1V6UA 3QPZA 1P48A 3N4AA 1UZHA 2PGEA 3HGSA 3PZUA 4GFSA 3A4AA 1F3XA 1GQLA 3VX0A 2JQXA 1FKBA 1J4RA 1MZHA 4MNKA 1SW7A 1J96A 1MYRA 2NVAA 1JVWA 4HA4A 4XUGA 2INEA 3WLPA 3ZLGA 3QKZA 1D8CA 4FXRA 1BF2A 2WSQA 5DRCA 3HBLA 4UTUA 3KBJA 1XLLA 4PEEA 3VGEA 4AVFA 1BKSA 4KEMA 5A6MA 8XIMA 5KZ6A 1GVRA 3P74A 3HQOA 4AZBA 2YB1A 2NUWA 2J78A 2PPPA 3FJ6A 5IDIA 1V3JA 7REQA 4N6EA 1ONRA 4Y2WA 3N13A 1IGWA 2CU0A 4TUFA 3W6MA 3H53A 3UQIA 1QTWA 3I4EA 2DUZA 2DZPA 4DRMA 1M7PA 2R6OA 4AISA 5I24A 5XIMA 5DCEA 4C6NA 1P0DA 4RZ4A 1O94A 3FVDA 5H1WA 3IKGA 1G9HA 3LQGA 1ADOA 4UTWA 1HGWA 4HHPA 3AS3A 2G3IA 1WBJA 3VCCA 4LEQA 1JPIA 5HR6A 5DBUA 4RL3A 3QHMA 3V5FA 3NQ8A 4AXKA 1EHAA 2DVUA 1D8WA 1PBGA 1B3ZA 5J04A 4Z2HA 2X1TA 4FK9A 2ZC1A 3KW3A 3CWHA 3IWPA 4HSNA 1PX4A 2W67A 4DBSA 5T8GA 5CC3A 1ZU8A 1DWFM 4GC4A 3P67A 4REQA 3DECA 1C8QA 4M29A 4X61A 1BVWA 1QUMA 4K68A 3DFOA 1MRAA 4C6MA 5CC5A 2VI0A 3TOYA 2HDJA 3L66A 3CZJA 2BODX 3TW6A 4DRJA 1QBBA 5MKGA 3MZ2A 1R2SA 3VO0A 2BOEX 3PNZA 3NOYA 4B3LA 3GXIA 3BZGA 2WNNA 1BQGA 4YIWA 2J4GA 2D3NA 1A5UA 5A6SA 1OFOA 2Y5JA 3GNNA 1Q2SA 5J5DA 4HD5A 3VILA 1F3WA 4GXMA 1AQHA 3QR1A 3VE7A 4G9PA 4DRNA 3WN6A 4LYKA 1H2JA 3U5UA 4PMZA 1Z89A 2AGTA 1O4UA 3GR8A 2TRSA 3TNBA 2DSZA 5D09A 4FX6M 3CTTA 4LYPA 3VYLA 3KOWA 5I02A 3ABOA 4E3TA 2WB5A 1TPWA 4GIEA 5DY3A 3QTPA 1LWJA 3GRIA 1LCOA 1P43A 1EEXA 4JTGA 4AH7A 1V8EA 2JFEX 5HNRA 3CL8A 4RE0A 1TV5A 4BF5A 3W7KA 3LLFA 1J4HA 2YR1A 3G24A 3SCOA 3C2FA 5FF4A 1YXDA 1WBHA 2ZUWA 4TX8A 1V3IA 3TYUA 3PBYA 3M0KA 4UQDA 1EIXA 4L4LA 4XKMA 3GB6A 3SCNA 1CLKA 4BI5A 4B9ZA 3MUZ1 2HXUA 4ITZA 2ADAA 1W3NA 3P14A 1BVNP 2I5GA 3EMQA 1JRBA 3BVJA 3BMXA 5C2XA 5G1TA 1BYDA 3UG8A 3PZQA 5FIPA 3CS2A 1AL7A 1FWEC 4GYJA 2RDTA 2R82A 4HGXA 1OQFA 3RIKA 2E9MA 3O05A 1D6OA 4UFLA 3G3DA 2XP6A 3S42A 2DGAA 4IPJA 1ZUAX 4D8LA 3GG7A 3AU2A 2ZX8A 3RITA 3PZIA 1UWIA 4WX2A 2AAAA 4N4QA 4OECA 3C5QA 4C90A 2YLAA 4P61A 4QT3A 3RCMA 1D7JA 1EWEA 5BWAA 2IKGA 2C16A 4W9PA 2EPHA 3KOFA 4QROA 1QNVA 3OP2A 4DWSD 1UC5A 4OVXA 1QPLA 4H1ZA 5CJNA 3TMQA 5DMYA 1WZLA 4FNTA 2OSYA 1H50A 4H41A 2O9TA 3WMBA 3KRZA 4IJBA 1UD6A 5K4XA 1LL7A 2BXYA 2GGGA 2NV9A 1XIHA 1EYMA 2VURA 5GJMA 1OFAA 1ZP3A 2D20A 1Y5WA 1NQKA 4ECLA 3Q67A 4LYRA 3L7RA 5AZ0A 4M6PA 3K1GA 4AAJA 1JG9A 4AYSA 4KFOA 3EWBX 3SFKA 2Y24A 4MY8A 3RM9A 4CU7A 1ONWA 2QUTA 4O28A 3HV8A 3EPOA 1S2AA 4G5DA 2BDQA 5JH1A 3NL3A 4RZ5A 4AY8A 4N42A 2OQHA 5CZKA 2RSEA 3DU0A 4P8VA 1I75A 3R79A 4DJFA 2DW6A 4PMNA 4GJ1A 4IL2A 2H3DA 4Q7NA 2IQTA 4IIDA 3HGOA 7ENLA 2OFNA 1VR6A 4C6CA 3GR7A 1MUMA 3PK7A 3WLHA 4DJDA 3GIYA 3DYMA 2J7BA 1CLXA 5I03A 3VC6A 1E5NA 1A5BA 2H90A 2VD9A 4H8HA 4UTLA 1J0JA 2DH3A 3HB9A 1KXTA 4HKPA 4A3HA 3DFTA 3WFZA 2FZBA 1XIMA 2QMKA 4DZ2A 4WY0F 5JBDA 3ARTA 5I98A 5BWFA 2OEMA 3NSNA 1KM6A 4TMCA 4B3KA 1UMYA 3KOYA 4MB1A 3MP3A 4AXNA 3C6CA 3L68A 3MQTA 4LVBA 2Y8UA 3DYPA 3W86A 4O1DA 1QBAA 1KM0A 3RPTA 3S9YA 2ZICA 3DZ1A 1Q6LA 4HK6A 4PCNA 3SUWA 5DFAA 2ZRUA 1QI0A 3HN3A 3CB3A 1KRAC 1TWDA 3RO8A 1D3CA 2SFPA 2YDSA 2OZTA 3A47A 4M56A 4QEHA 3NPWA 1Q6IA 1K7XA 4RW3A 2RDWA 1IQ8A 1T5AA 3WD1A 3UYCA 1V08A 1YDVA 3EX3A 5CPMA 3MCOA 2PS2A 1QASA 1QPNA 2QMJA 3GDBA 1MRQA 1BAGA 3LTYA 1XRFA 5FL0A 2QDGA 2E1WA 1XSKA 3EMCA 2XPKA 3C61A 1F8MA 3ZJ6A 2HMCA 3KS6A 1D7KA 3QR3A 3CJPA 5JMUA 1CGWA 4R9OA 3C2YA 4HVXA 3CBWA 3GC2A 2BX7A 4Z0SA 4F0SA 3RNDA 4Z17A 3TN5A 1QZ2A 1XUZA 3GFXA 3NNTA 3W25A 1PWLA 1A5NC 4JCLA 3KEHA 4NXSA 4S23A 3ARZA 3IV8A 4DUVA 4HNLA 3CQJA 4U28A 4AWUA 4IQ2A 4QDMA 4LAXA 4MDOA 2F7FA 4JAWA 1DJQA 3T0AA 4U85A 1LUCA 2BXZA 1JDAA 1UR4A 3KZSA 4QT2A 5HWNA 3V3WA 1B90A 2Z27A 3TX9A 4GFIA 4QSHA 1UJPA 2WM1A 1VENA 4Q4KA 4PMUA 1MDLA 4FLRA 5JUVA 1QPOA 4LYQA 3STPA 3P2VA 4HZ6A 3LCHA 4UQ9A 2XG9A 2B4GA 2Z7KA 1C3FA 1EJRC 4WSHA 4LUJA 5IBXC 2ZRZA 3WNPA 5C2CA 3G18A 5HW8A 4JTIA 5AHNA 3UA3A 4L5ZA 3MVTA 3THUA 4XVDA 3FJLA 1WZAA 5M5DA 3AXKA 4DRIA 2PFHA 4L7ZA 2X42A 1OFRA 3LLDA 5D9NA 3VOCA 1W9DM 3RUBL 2PP0A 3ARUA 1W31A 4TQTA 1Q6UA 4PE8A 4YVVA 2R24A 4YPJA 4AEOA 1ZS2A 1P7TA 2FKPA 1X38A 3FK4A 5HOSA 3QEZA 1FH7A 1E43A 4JX6A 1H62A 1R3WA 4C1NB 3HV9A 4NRSA 3N12A 2OR2A 2BS9A 1GTEA 2ZX7A 4XZ9A 1V6VA 1YTEA 3BO9A 2FVLA 3DESA 4X2RA 4MJZA 1R9HA 3MHGA 3NQ2A 3L4TA 3LXCA 1RAKA 3WMCA 5FF2A 3N29A 3O5IA 1BTMA 3VKDA 1IEIA 4J3SA 3VZYA 2WVVB 1FHDA 1GQJA 6ALDA 2YIHA 2GOUA 4OE7A 3F2BA 5HBFA 1EYWA 3MKVA 4B4HA 2HV5A 4GIRA 3TZNA 1W9PA 4FS9A 1CBGA 3MUY1 1E1FA 3UZ5A 2XPBA 3PANA 1TPUA 1XM3A 3GW3A 2H9AB 4GUJA 3B8TA 1F2JA 1MXSA 4E2VA 2PC8A 2GQAA 3LD5A 3MCMA 3T42A 5GVJA 1XFBA 5CKSA 1FKKA 5KITA 3O6CA 2DJLA 3E2SA 3WF3A 4C6BA 1VH7A 2V68A 4EANA 3VD4A 4JTCA 1ZBCA 2PGRA 3FW6A 4NAFB 2D2JA 3SCWA 2PRLA 4JTQA 4CD4A 5EBUA 1OD0A 4W88A 1TTPA 1XYFA 2R1NA 4HA3A 3MV11 2RQSA 2DEPA 3MWCA 4PMXA 2RUCA 2GDQA 4BI7A 5A1AA 1E6PA 4N2YA 1I9CB 4UMAA 4Z1BA 2FTWA 4ILSA 3WH5A 1MQQA 3M7WA 1HJQA 4JFSA 3EWYA 2YCLB 4LUTB 5EB8A 5HATA 1AQMA 5EMMA 2QUMA 4TV5A 1EOKA 4J5NA 1P0BA 2OTDA 2YSWA 4QNWA 1K9EA 2EKCA 2J6VA 3B8DA 2ACRA 4PBFA 4XTDA 1LZOA 4FF7A 3V5CA 3CHEA 1LF1A 2D22A 4OBRA 3GX9A 5C9ZA 4GI4A 5LSMA 1UOKA 1GQKA 1RVGA 2Y61A 1C9WA 2QUUA 3Q2DA 3N6JA 4JX4A 2I14A 4P7LA 1DHKA 1QT1A 3WYZA 3VFLA 1DJYA 4ODLA 2QJMA 5KTLA 1IE7C 3GTHA 3W38A 4WSKA 3BICA 3E0IA 4LB3A 3O6AA 3CUZA 3NZGA 3TC3A 1IT0A 3RCNA 2HTMA 4GNVA 3SO7A 3CQ0A 3UZWA 3PR2A 1CDGA 2M2AA 4IUGA 4CKQA 1SFLA 5FEPA 2QCGA 2RGLA 2ZVRA 4QXIA 3VIFA 2Y8VA 1S5NA 2FAPA 7ODCA 4JR5A 1B57A 2DDXA 1A53A 1THFD 2PCEA 4RK8A 3WBAA 4U3AA 1GEHA 2ZUTA 2O7SA 3CO8A 2B7NA 1KGXA 3KRBA 1NOUA 1WO2A 4M81A 1FWDC 1TVNA 2QYGA 3QH2A 3CQKA 2X1SA 3AJXA 4PMYA 1CGYA 5C70A 4J3WA 1VCVA 1E51A 1LOSA 5D2VA 2R1PA 4L4OA 3WF1A 1KBKA 1Z69A 4IIEA 3IGSA 4GXPA 3OGVA 4F2BA 2XJ7A 5MF5A 4QAWA 1CIUA 3PPCA 2G50A 3C8FA 4Q8QA 4JTUA 3MMUA 1IZKA 9RUBA 3T8QA 2Q6ZA 4B5VA 1MNZA 5EFFA 5U7SA 5I2UA 4IWWA 4PMVA 1EJUC 2YLLA 3ONBA 3PG8A 2C71A 1KQZA 1L1PA 2VVSA 4MZYA 3WO8A 4EPDC 1FHVA 2OLSA 1HFBA 1TPFA 2PPNA 4O0KA 1ZALA 5LNSA 3GH7A 2MUCA 4FAMA 3NZRA 1WV2A 3W7NA 1BF6A 4IMAA 5CJ5A 3SGZA 3O63A 4AC7C 2NQZA 2INZA 2RDUA 2D69A 1W9XA 1TG7A 3KL0A 4NG3A 1ISZA 3VIPA 5FF7A 3NL2A 1XS2A 2QZRA 4EIVA 1TTIA 2KFWA 2ZE3A 1MEHA 2HWGA 5A8MA 2NW0A 3KFTA 2KR7A 1CZ1A 4HPGA 4QJ1A 5G4HC 2Z26A 2ZIDA 4HTBA 3UQBA 4KMQA 2HRWA 1IYXA 1NFPA 3UI6A 4FNUA 4KCUA 2C79A 1OCQA 4R7OA 3WD0A 4WXYA 1BTCA 1VYPX 2CBVA 4MUPA 2WBGA 3CT7A 5GNZA 2PDMA 3W2NA 4PRWA 2E25A 2CNCA 3SUTA 5GJPA 3E2VA 1UJQA 1KRMA 2OCZA 5M03A 3IK8A 1DXFA 3NL6A 3BV4A 1YXYA 4HSHA 4WVXA 4QS5A 2CERA 3IJ8A 1TPVA 4ZFMA 2WNQA 3SQLA 3WD3A 2KGJA 1JF6A 4IMGA 3ZSSA 2DSWA 4MMWA 2XVNA 3GM8A 1C8YA 2IXVA 3MDWA 1RALA 1D7HA 3LG3A 3WD2A 3WQVA 3GHTA 2Q5AA 4BJHA 1SW0A 1G0CA 3UF9A 3NPUA 2PDXA 3BLEA 1YHTA 4KESA 3VDBA 3P7YA 4ADUA 5HUOA 1HN1A 2QDHA 4J1OA 1SSDA 3B97A 4GINA 3MU7A 4WRHA 4K39A 3PRBA 3HIJA 4C6FA 2GSHA 1EXBA 3R25A 1XH2A 5FD0A 1V02A 1KV8A 4HYVA 3GU1A 4F8XA 5H91A 3HU7A 4ZXLA 4DO7A 3RLHA 1F73A 3W28A 3XISA 1O1ZA 4H6RA 2PGWA 5M17A 5F4SA 4Z2KA 5HNUA 1EF3A 3BLIA 1QK0A 4IMDA 4E4UA 4JGDA 1X39A 3RR4A 4IP4A 2DSUA 4JDYA 3ZXWA 2CLEA 4D1JA 4I7UA 1ITCA 1AZ1A 1A5SA 1BXNA 2PU1A 3WQGA 1I2OA 1FKRA 2ZR5A 2Y2WA 4GIAA 4AF0B 1JPHA 2HXTA 1YDNA 4R34A 5KZMA 3N2OA 2I17A 2V2CA 2Q8XA 3DKLA 1OINA 2C8NA 1WA3A 1WKEA 2P10A 3F2DA 3BQ5A 1VF8A 3S2CA 3LI0A 2WJFA 5ECVA 1K6WA 3VPLA 1LLWA 4AWSA 4O0QA 5FKYA 3KBVA 1CNVA 3T55A 4CVWA 4NKCA 4QQ3A 4Z1CA 4H9XA 1Z9AA 3RRXA 1VGAA 4ZE4A 2G41A 3HFTA 4QIUA 1K4HA 3WUFA 4LOCA 1NWSA 2FZ8A 2FPYA 3V4BA 2ZUUA 3AWNA 4C1KA 4CN6A 3C0SA 3CXOA 3S1UA 3CH9A 3AIUA 3KAGA 1W1B1 1O95A 3TFXA 2ZVIA 4JYEA 3PFMA 4MNJA 4U84A 3IUDA 4LTSA 5G2HA 5LZLA 5D2WA 2FH8A 2OZ3A 3S6OA 2WMFA 4RV3A 2OO0A 1A3HA 3LCGA 3JU2A 3APTA 2XGBA 3QM3A 3V0SA 3VD5A 4UTWC 2V81A 4GC3A 3OU8A 3ARVA 3W7IA 3QPEA 3GNPA 4JIPA 4H00A 4ZMGA 2ZOXA 1MEWA 2YA0A 1R38A 1C9HA 1C8VA 3G0SA 1I6NA 3I6CA 4MOZA 3VUSA 3NL5A 2P1FA 2R1KA 1UR0A 1POKA 4IMEA 1JI1A 1UD2A 4AZ6A 4DYEA 1WUEA 2CW6A 2PD5A 1SGJA 4NZJA 3DX5A 4G7FA 4A2SA 3GG0A 2OGYA 2KI3A 3B3DA 4IQEA 1W9UA 2AQOA 1LDCA 4QJ4B 3CPUA 4LAVA 1YDYA 1KXQA 4HHLA 2QUNA 3M0VA 5IFTA 8RUCA 4ZB5A 1QNPA 2WZHA 4MWAA 2XZ7A 3AMLA 3M47A 3UWZA 1Y0EA 2ISSA 3M9YA 5C7HA 1D3HA 2PDLA 2CLFA 4ODNA 3ZT6A 1ADSA 1V3HA 3SQMA 5AVHA 5AHMA 2HS8A 1WDQA 3B0YA 1K7FA 4Q8MA 3K4WA 3E0FA 2PDYA 1P0EA 4DJED 3KUMA 1XYMA 2DH2A 2QCNA 4F40A 5TBOA 4BR1A 2PDJA 1CGUA 3GZ3A 2XISA 1REQB 2WZEA 3FVMA 4PSRA 4AWTA 3GVGA 1ZAHA 1YNYA 1JGIA 1KKOA 2Q3RA 3NM3A 1HX0A 2X41A 1UH3A 3MY9A 2Y7DA 4KH2A 2O56A 4B2DD 5T9BG 3LCFA 1KT1A 2C0HA 2Y7FA 3WY1A 2F6XA 4DXKA 1Q66A 2RUDA 5JXQA 2OFJA 3W53A 2Q8LA 1NP2A 4O11A 3SUUA 4Q22A 2QDDA 4IFKB 4J7RA 3MUAA 3OPSA 2J8GA 1GJPA 1DIDA 4B4FA 1CGVA 3VABA 4WEVX 4PB4A 1XYAA 4WQ6A 4H4IA 3LYEA 4GCXA 4KEZA 5BXJA 2NXGA 4XAPA 1LLOA 2JE8A 3IIOA 3G1SA 3REQA 2FHBA 1WCGA 1IF2A 2V2DA 3M43A 1QHZA 2YYTA 3W7HA 1EF2A 3MJYA 3HQNA 4URIA 1TVPA 2EPNA 2AAMA 5JIWA 5JBFA 1XIGA 5HQEA 2VYOA 2HNHA 4QEEA 3S47A 2E77A 3L0KA 5FI8A 5I3KA 1GOIA 4NX0A 4DRQA 2CLLA 4GOAA 3KOXA 4ZGYA 3F4CA 4ZQPA 1D7IA 1XH1A 2E28A 1H7WA 3U0HA 1P1XA 3GSMA 1FKJA 5AC6A 3VKAA 3LRMA 2IXUA 3FN9A 4LAMA 3HFYA 3LHYA 3NOEA 4U33A 1BHGA 1UR3M 3LS9A 5IHRA 3EOEA 1RA0A 1QW8A 4W5UA 3NQCA 1E3ZA 2DG3A 4Q4SA 1T0OA 5A8NA 2NV1A 3APYA 7PTDA 1XISA 1JD9A 4AC1X 4U2YA 2ONEA 2UY5A 2V38A 3SM0A 4RE3A 2YDAA 4MPQA 3B40A 3TROA 4O4WA 3C2EA 4TX6A 2ZKMX 1IEVA 2ZDRA 4ERAA 3QGKC 3DFQA 3O1NA 1TB3A 1EJTC 3C56A 1M01A 3R7MA 1OC6A 3ITLA 5CCZA 1H3GA 2EPOA 4PUNA 4KGLA 1FCVA 6TIMA 3GAKA 3HURA 1LLZA 4IFRA 3OTRA 2Y5SA 4C7GA 1GOWA 1F74A 2ZUNA 4ZENA 5EPDA 2V5BA 4GH1A 4JX5A 3QKEA 4L3NA 1Z42A 1QI2A 3B06A 5ABTA 3I4KA 2JKPA 3WBYA 2XVPA 1DWAM 3QW4B 1EH9A 2XH2A 4ODRA 4DRPA 1YYAA 5C54A 3MKKA 3NZ1A 1SZNA 1LOQA 4MJ2A 2E40A 1MUCA 3ME3A 2O7QA 4WDWA 5J5RA 1OFEA 3B8UA 3OVPA 3EWUA 5KSWA 1W0MA 3VNDA 1OBAA 1CPUA 1V6WA 4HOZA 4M7SA 4ZQCA 1US3A 4LY8A 3C2VA 1TX2A 4LS0A 1X8CA 3TSBA 2ZZ7A 3W70A 3VKCA 1ICQA 3DKJA 3TXZA 4AMCA 3VC5A 2DT2A 4JIQA 4L1XA 3CMFA 4L80A 5C8BB 4LC8A 3DIPA 3TCSA 2XM2A 3ALGA 3O3RA 3O5QA 2TYSA 1B30A 5DCBA 4KWOA 5M3WA 1LRTA 4W93A 2EO7A 5F2MA 3TN3A 2IKJA 2QLYA 1HIZA 3TSMA 1E0VA 1ZZMA 2ABAA 3A23A 4JIRA 2A3BA 4W86A 1KM3A 2DORA 3AZRA 3GIPA 2WQDA 4G8TA 4D6DA 4XV0A 3OJGA 2D0GA 3WFAA 3OHIA 4US5D 5F2GA 4G1NA 3VU2A 3RLUA 2XINA 3H6OA 4H2CA 5D8ZA 1ISXA 3BUVA 1JDFA 1P6WA 9XIMA 2GUUA 1UD3A 1EB3A 1PZ2A 4FXJA 1J4IA 3CWOX 5CJMA 1UD4A 1YATA 3MI6A 3U6WA 4JIIX 3PTDA 4QZVB 4TW6A 4NAEA 5D02A 4AUBA 3UWYA 2PV1A 1K1DA 2A4AA 2PU0A 1O12A 2GJPA 4ZS6A 4GD0A 3IGHX 3LNPA 3WX7A 1XH0A 4PUDA 2XP4A 1YNPA 4GYPA 2PRMA 3WF4A 3MUIA 4FAPA 2IF4A 3S5NA 2O55A 1JNEA 4IMCA 1PJ9A 4AZ7A 4D2JA 1L6GA 5LHEA 4FOKA 3L4ZA 3CUJA 3DBNA 4AZGA 1EQ3A 5E93A 3H12A 1XSJA 3FXYA 2FLIA 1RK6A 1WB0A 3VOJA 3DH7A 4TVCA 3T4WA 4DF0A 3R12A 4S38A 3QFEA 3P3BA 1RQEA 2DG9A 5D2TA 1UG6A 3UYIA 1V5XA 4OBTA 2C3ZA 4R3UA 2PV3A 2P76A 4GUIA 1Q7MA 1CXIA 3QFWA 2D24A 2JIEA 4LF2A 2C0AA 4K37A 1VD6A 4RDZA 4FP1A 3M0XA 4RX0A 2NXIA 1C29A 2PPOA 5AC5A 4UTIA 1QPKA 4BY3A 2XPAA 3OG3A 3PUGA 3WD4A 1XKJA 3AISA 4JNMA 1BKHA 4NJJA 1RR2A 1R9YA 3WJYA 2FGZA 3PTQA 2ODOA 1T40A 3AO0A 4M19A 4WDUA 2PDHA 2VR4A 1OX4B 4YLWA 3EX2A 4HYWA 3S83A 1XWYA 1XDJA 3RG6A 3B9OA 3P8JA 2YCEA 3VINA 3VIMA 4O8AA 2VP8A 4GACA 4IQJA 1YADA 1E6NA 2RKXA 2PP1A 3MYPA 4I6KA 3K46A 4TVUA 1BVZA 3CTLA 3XIMA 1MMFA 1M03A 3PR9A 4UFIA 5LIXX 1B4EA 4H2HA 2YGYA 1MXDA 1JCXA 1EPXA 2WKLA 4E3VA 1FWTA 3T0BA 3DG3A 4G2PA 1S2UA 2V6AA 1TQXA 1CB7B 4UIOA 1EO7A 3W2LA 2D2OA 2PRHA 1VFSA 4UBPC 3TXVA 1TCMA 3UR7A 4J3VA 1WZKA 4GQGA 3A24A 3QZAA 1XIBA 3DDMA 3N9KA 2J9YA 2WYSA 3PZOA 2OVLA 4Q4QA 1Q7QA 2AOSA 1QMLA 3WSUA 3QY7A 2W0UA 3NQ7A 1XHGA 3P84A 5B8IC 4U2ZA 5D2XA 1YEYA 5DQPA 2OOGA 1XLMA 4JBRA 4EPKA 5I6SA 2NLYA 5F4XA 1RY0A 4BQ4A 3TR2A 3TONA 4JN6A 2XVKA 3LPGA 2PWHA 4ZODA 3A3XA 4ZO9A 3KBNA 1B5TA 2QVNA 1N8IA 4HCDA 1OC7A 3MI3A 5BU6A 3NQGA 1QNOA 1DORA 1E3XA 4MZ8A 1W2PA 4RXGA 3E0LA 3D5HA 3VZXA 2A3EA 3TYZA 4E38A 4BHYA 3AZTA 4G56A 4GH3A 2PDQA 2XGZA 3WLIA 1R47A 1O5RA 5GQBA 3WK1A 1Q7ZA 3ANUA 2D1ZA 4ACYA 4H9YA 4Y9MA 1FDZA 3CUHA 4NY2A 1F4AA 4JYSA 3CUIA 3CL6A 3JZEA 1XINA 2ANUA 2DJXA 1PAMA 4IMFA 3UWUA 5F2IA 3GVRA 1FTXA 5BOFA 1IR1A 1B3VA 1J5SA 4MG4A 3E96A 4KERA 1YIXA 2CIPA 3H4WA 3I3BA 2ZQ0A 1GHSA 3LXAA 3LI1A 4K7VA 4HA0A 1FWGC 4JTRA 5E6ZA 4QCFA 1F6YA 2V5KA 3B8WA 4R53A 2E6FA 4XZWA 3PZVA 3B04A 1G4TA 3AHTA 5HNTA 1EP1A 3PWGA 2J7EA 2VCBA 3RGTA 1T7LA 1XYBA 4LCSA 1JEZA 2FZMA 5CC7A 2XP9A 1DJXA 3KZPA 4GQ0A 4C65A 2E9LA 4KQNA 3T40A 2H8XA 1KM4A 3Q58A 3W84A 5JH8A 3WMLA 4O57A 5HUPA 1LP6A 3L23A 1GVEA 6A3HA 3WKZA 3ELFA 4IPNB 2YBUA 4QM1A 2DSKA 5LIYX 1H5VA 3PFRA 4YNGA 3WJXA 3PJWA 3NR0A 3ANVA 1JYVA 4CQBA 1YPFA 3C8NA 5TF0A 3UWEA 2VXNA 1VIWA 1HKVA 4B3ZA 3C2OA 3KLKA 4EK7A 2Z6JA 1VFOA 3W27A 3TV8A 4ZEPA 4ATDA 2BVWA 5E0CA 5EMLA 2R9RA 3ARXA 1TCDA 1W1A1 1UKQA 2GJXA 1F9CA 2YXXA 3VDHA 4KGJA 1JDDA 2IUZA 3GTFA 3W2MA 2PLMA 1ROTA 2G37A 2LLEA 2OOFA 4FMVA 4KT2A 4Q8WA 5I79A 2E8YA 3IUHA 3CC1A 2X1RA 2WJDA 1NY1A 4QLJA 4UR7A 3RX3A 5BXRA 3ODKA 4DJFD 3BLKA 3O8AA 3W6YA 5EMUA 3UJ2A 5E9XA 1W5QA 4PFMA 1JDCA 3EOLA 2DUAA 4DJDD 1XKYA 1OCBA 4LFYA 2PZNA 1PCWA 3FIGA 5DXYA 3WFLA 3LCXA 3H24A 3UWQA 2XN0A 4KBXA 4PCTA 1R6WA 3BW4A 5EMJA 1J9YA 2ZFAA 1CXLA 2ZZ4A 2UWFA 5CAKA 1UB3A 3GZAA 1LROA 3R58A 4AWEA 4DELA 1D3GA 3BTNA 1TZZA 3LRLA 4Y6GA 2ITKA 3CUFA 4JKLA 4O1AA 2A3CA 3V16A 5EKYA 3GHUA 1S2CA 3W7OA 4AW7A 5C0QA 5XIAA 3L5LA 3JRKA 1W1VA 4GLEA 1I2PA 1FKWA 4ODOA 3PF3A 4LNYA 4L9ZA 3ZJ7A 4OGZA 2IPGA 3B05A 2J75A 1E4LA 4XAFA 2J66A 4FOJA 4FR1A 3RMJA 2G4JA 4R7WA 3WK3A 1JCJA 3N9RA 5FCZA 2MLYA 4NL1A 1EX5A 2V3GA 2BVYA 1MNSA 5TNVA 1K4GA 1ZJAA 3K30A 3CYJA 5A6KA 1S5MA 1H5YA 9CGTA 1ZJBA 3B0XA 3UJEA 3VTRA 4NVTA 3WDRA 2I9UA 3ZSTA 2G3FA 3KWSA 3M0HA 2F2HA 2VMFA 4XB3A 2EBNA 3OLEA 3OZOA 3LCWA 4MKNA 4AIUA 3QSRA 3C52A 2GL5A 3IVSA 4XAYA 1KCKA 2GQ9A 2NX9A 4LX4A 1ME8A 3N4FA 3IK4A 3UWVA 3NO5A 1PPIA 3CEPA 3YPIA 1M3UA 2XDFA 2PUZA 1OSEA 4WD0A 1TJ1A 3KLLA 2YZ5A 3A9IA 2JK2A 3ANYA 2EULA 1JZ7A 2DUXA 4LH8A 1FFRA 4IP5A 1LYXA 5LXEA 2IKIA 1OYCA 3AYVA 1NIUA 5I5RA 3CAKA 1ZQ5A 5FL1A 5K9CA 4IUOA 4XZIA 1G7UA 1L6WA 1VPXA 4B92A 3STGA 4XG1A 1XGEA 1S1RA 2ACSA 4AYGA 1FHLA 3GG1A 4I9JA 4DRKA 2XHYA 3NWRA 3MMTA 3RFAA 4UZSA 3RLVA 1K8CA 4AMAA 2WWCA 1A80A 4IIFA 4GUGA 1RLCL 3IJLA 1GORA 1ITQA 1UCWA 2NT0A 4G7EA 1I2RA 3NSMA 3FYPA 1WKFA 1XICA 3IAPA 5D32A 1DJZA 4KEUA 1QO2A 1H60A 1VJIA 4YMZA 3KTSA 1UHVA 3PNUA 5C71A 1A5OC 3TTOA 1W1TA 1GNXA 2IMRA 3UESA 2PDIA 2E0PA 5BOOA 1JF5A 1MW0A 5M1TA 4J40A 2ZTKA 3DHDA 3B03A 2DT3A 1VRDA 2M08A 1UUOA 5E09A 2VQTA 3TAKA 3EXTA 2QCFA 3C2RA 2A79A 2ABBA 3LUTA 4ODMA 1GKPA 1VEMA 1Q6OA 1ENUA 3DFHA 4IIGA 3NQEA 4XZMX 4JTEA 2H6RA 1LQ0A 3LCLA 4MWAC 3WLKX 4JTHA 4Y9OA 3NQ6A 3S8HA 4NU7A 4AD1A 3CMJA 4C6EA 1OWQA 4NZ1A 4O52A 4EPEC 3TVAA 1F05A 2QCDA 2B81A 3WUEA 3ZVIA 3SI9A 5GPRA 1E15A 5JQ9A 3IJIA 1HF6A 4IGSA 1C7SA 3IJ7A 4MDPA 2MPHA 4HU4A 4R85A 3W1MA 3CAVA 1JGMA 3L67A 2D2HA 1UD8A 3R6IA 3SCUA 4HN8A 4ZQMA 2XWDA 2YZRA 3G1FA 2O4MA 3VIJA 2E68A 4PEKA 3ZFHA 4ICCX 2GSEA 3W85A 3ZLHA 1YQ2A 4PTMA 3RU6A 4PUJA 1PO9A 4EP8C 3VMOA 4P8WA 3A5VA 3NGFA 4PMJA 2A6NA 2VL4A 3K2GA 2Z2AA 3MTWA 2YYUA 1BD0A 3WQ5A 5HTGA 1SJAA 1Q6EA 2W4XA 3G3MA 2UZ5A 3WQ6A 1AVAA 4RLIA 1SZFA 4C91A 3B7XA 4ZBCA 2XIBA 4QE1A 1VAHA 1VCGA 1JDEA 2CKRA 3IEBA 4M8UA 3KCEA 3PB0A 2PLJA 1TJRA 1R30A 4J3TA 3AHVA 3N11A 1WP6A 4A22A 1JCMP 3SCVA 1ZGDA 1RLDA 4ODKA 2BVDA 1Q65A 4AZIA 1HXVA 3P0WA 4QG8A 3L2LA 4AZCA 4Z0JA 3POCA 2BFGA 1IXQA 1N1AA 1ICPA 3K13A 1RVKA 4CUCA 4UTJA 1XFCA 1KWGA 2X0SA 4W9QA 2WMIA 4V27A 2F61A 4LUSA 3BG3A 2QV5A 1MO0A 2BV9A 4ZTYA 4H7CA 3GKFA 3KL3A 4RZ6A 1ZP4A 1CTNA 1VFUA 4JFJA 5DY2A 1V6YA 1EUNA 3NPXA 5F1UA 4LAYA 2VKZG 2PEVA 1BWLA 2AQVA 3VKJA 1TJ2A 3GIQA 3SSJA 1OG6A 1UD5A 1BRLA 1R7OA 4QG6A 5ABGA 1YBQA 4YWIA 4XBSA 4DBEA 4MWAB 3L4XA 4RNFA 4BWLA 3CLWA 1UR8A 3N2TA 4FX8A 3DN5A 3EB2A 4RDVA 1WAUA 1AODA 2QPSA 3HPAA 1GPFA 1QHPA 3BXWA 3CV6A 4OOZA 1PB0A 1W3TA 5IOBA 5ABFB 4U5KA 5IXEA 4FXSA 3OBAA 1PZ1A 2B0MA 2JIWA 4PMRA 3KCJA 3AS1A 1X8FA 1FP8A 4FALA 4PR4A 3ARQA 1HKMA 4DEFA 3V0TA 1XGZA 3K4AA 1AJ0A 2QNEA 1E40A 4PULA 3T81A 2I57A 2QJJA 4LBRA 5TQLA 4IF2A 5FJRA 1OK6A 1ZJHA 3EEZA 1XIDA 3VIHA 5BW6A 2P88A 1Q6CA 4ZR8A 4ML9A 4JEQA 2IPFA 1OK4A 4NASA 3L5AA 1JUBA 1GGOA 2NVDA 5EY5A 3BMWA 1S39A 5C9XA 4YXGA 2EF9A 3UCQA 1X6UA 4AEEA 4NNRA 1IZJA 3FDGA 4B2DA 4XX6A 2XIQA 3M4HA 1W9VA 5LIUX 3LZ3A 1O60A 2XU2A 2KO7A 5LIKX 2YDQA 4B91A 2BOFX 4QAIA 3T05A 1JCLA 3MO4A 3W1LA 5I7GA 4F9DA 1DYSA 4K1WA 1TQJA 2JBMA 4PYSA 3S2JA 3W7JA 2WANA 2CITA 3A5FA 1Q6GA 4DY1A 4P7RA 1JZ5A 3T0TA 4IG2A 1SO6A 1H7RA 2NWSA 3O5DA 3KVLA 1U83A 3ZOAA 1XLDA 2REQB 4GZEA 3KTCA 1HW6A 1Y7VA 2W62A 3BMBA 1MDRA 1HZYA 4A3YA 3GTYX 1DV7A 4PMDA 3WH7A 1UR2A 4GNKB 3E9AA 3W7PA 4O18A 4WJ8A 1RPKA 2J27A 1Q8AA 3WMSA 2VFGA 2XH4A 4WOZA 2FQIA 3DC8A 3A64A 1RXOB 3H2CA 1TMLA 4EE9A 1IEQA 4AB4A 1ZENA 2ZX9A 3OZPA 4I8YA 5AYIA 2PPGA 4L56A 1XP3A 3GWQA 3H2FA 4NX5A 3KCLA 2WZMA 1E9ZB 3RAOA 2FPVA 1TPC1 1EJXC 1PHQA 4GIYA 3G77A 1XGDA 3ZVHB 3BWWA 3AXXA 4HP5A 2CESA 3M64A 4GJIA 1SW3A 3UEQA 3PTMA 4RR4A 4GYPC 2WSYA 3I10A 3T6CA 2H3BA 2QKFA 4XD3A 5DRIA 2F6KA 2WVSA 5E9AA 2WCGA 2XSXA 4YCOA 5GNYA 4O0ZA 1JULA 3IJDA 4H9UA 1E4IA 2Y85A 4DAIA 4UNIA 2JEQA 4PBGA 3WDHA 1NDVA 4Z1YA 3LEPA 5D9MA 1UKTA 2EPMX 1FWBC 1XRTA 5HW7A 3C0QA 3MMDA 2ZWYA 1KM2A 3VGGA 3SR7A 1OF6A 4HCHA 3O5RA 2FTPA 1OY0A 4TW8A 1Z8AA 2OEJA 4AD3A 4S3JA 3ATZA 4ROQA 3CZLA 2PV2A 1Q6RA 1ZL1A 2EAWA 1DJHA 3N17A 1GK8A 3CEUA 4U3CA 1NTHA 1KFKA 4IT1A 4LCRA 4A2RA 3UCDA 4LC6A 3AIWA 4Q4RA 1UA7A 1OIMA 4XAZA 3I6EA 4GY7A 1SJDA 2OKTA 1CGTA 1X1OA 4O13A 2OEKA 3TTEA 1RZMA 3GHRA 4W9OA 3K8MA 3W1NA 1GOOA 4H01A 4N6FA 1PINA 4P7NA 2PI6A 4QJ3B 4IIBA 3G2GA 3ATYA 3KM8A 3PPFA 2WBKA 1L6YA 2BGSA 4TNSA 1XDMA 5C2GA 1XYLA 2W63A 3KE0A 2J7DA 2RHGA 2BNJA 3UG5A 4CU6A 1EZ2A 1R9ZA 4YHEA 3VGBA 4LS1A 5FJOA 4HBOA 4AD5A 2Z1XA 4MY1A 4Q33A 1DJWA 3R43A 1V7YA 3HG4A 4MAVA 3TFCA 3TQKA 1S5WA 1W37A 1V03A 4AQLA 2WOQA 1RPXA 3HG5A 3O5OA 4ADSA 4XSMA 2EG6A 1IGSA 3RF9A 1ISWA 2B7OA 2ZQSA 4AFYA 4XO6A 1W3HA 3NQFA 4CCZA 5G1YA 2HPIA 3IARA 1YE4A 1E0TA 4NAEB 3LB0A 3FGCB 2J9XA 4S39A 4X9SA 1A0DA 3D3FA 3PG9A 3MKCA 3WLRA 5KZEA 1RA5A 3CZEA 4OU1A 3GR4A 1VKFA 4CN1A 3QOMA 3FAXA 1I60A 3LRKA 4QITA 4GQRA 4MWAD 1ZNNA 3BGAA 5CPOA 2CCRA 3EX1A 4DWSB 4E2OA 2NUYA 1JI2A 2GVJA 1D9EA 3ARPA 2HVNA 4Y9NA 2XGIA 2EJAA 5LA2A 4A05A 1XXXA 3ABZA 1RY8A 4UMBA 3T1GA 3HPFA 4Y9PA 1J93A 1QRQA 3BSMA 3P61A 3HGJA 4WKFA 2RAGA 3II1A 1AW2A 2J7GA 2DSVA 1H11A 3HQPA 2WHLA 3LTSA 1D7FA 3HG3A 3MCNA 4O17A 1EC8A 2EKGA 3MDUA 1CXHA 5LNVA 3GNOA 1KFBA 2VM8A 3ZYZA 2CHOA 5DCDA 3EKZA 2XP3A 2DG4A 1TWZA 1VIZA 2PTWA 2EJ1A 3DBPA 1OX6A 2G4FA 5BXSA 2GJRA 4OKDA 4KWUA 4ADTA 4DPPA 4YTUA 4OWGA 3WK2A 5DT7A 1H7XA 1W2VA 1R3VA 1A5KC 3B9AA 4BA0A 2D23A 1GCYA 1MW2A 1W5PA 2JEPA 3IACA 4TX9A 1BSLA 3CLMA 3PVFA 1KR1A 3KP1A 4BF9A 4HPNA 1FKTA 4PCFA 3GG8A 4H8UA 3GFYA 1BYBA 2F23A 1L8NA 3BLOA 1XSIA 4KCWA 1KA9F 2GJNA 4W8AA 4PN2A 3ECQA 5DANA 2P8BA 2VCCA 3ZO9A 2A2IA 2G95A 3OB8A 4KFNA 3TLQA 2MANA 4XBKA 5CGQA 4JTKA 4YU1A 1JFHA 3E1F1 3L12A 4PCSA 3W01A 3VOFA 3M07A 1T11A 1AH3A 3AMKA 4Y8EA 4UZUA 1LTDA 3LERA 7CGTA 4RXFA 3RRAA 3WEOA 2V82A 4J2PA 1GZ1A 3PS7A 5B80A 4LWWA 2PDPA 2XSBA 1X1NA 5H8MA 3CAQA 5I3GA 1P5BA 1NSGA 1TTJA 1EXPA 4H19A 3A3HA 1DXEA 4K7YA 3WBEA 3V5OA 1K3UA 3IV3A 4P8XA 1MSSA 3QV8A 5CPQA 3UJSA 2A3AA 4J4KA 3DENA 1F76A 5AHEA 2Z2UA 2DZTA 4MJ4A 3HJZA 2V3FA 1OVDA 5TD4A 1MZRA 3U8GA 4HK5A 3ABXA 1PUDA 4BS0A 4JDBA 3BAWA 2CLHA 4DNMA 3RX2A 1N8WA 3ARYA 1HGYA 1KXHA 4M1RA 1TO3A 2VX5A 1QNSA 2JZVA 4N19A 5HDRA 2DT1A 3QJAA 5A6BD 3WH6A 5A8OA 2VX7A 3TQVA 1FWAC 3BG9A 1NWRA 5REQB 1AD1A 2J7HA 3DG6A 3KVKA 1LBMA 2ZADA 5DBTA 2CEQA 2IQDA 3L2MA 5DN1A 2CXGA 4C6JA 1SSGA 3PSWA 4MUZA 1MXGA 4MB5A 1ZB5A 3WNOA 1YTDA 3WUGA 3AWOA 2XN2A 3LMZA 1NJJA 4HK7A 2ZA3A 2ZZ2A 4X0NA 4NYYA 2YCIX 3FFSA 4TU1A 2OO6A 1J79A 4LBSA 3D0CA 4P7QA 2WSRA 4QDPA 5AFDA 3ISIX 1TR9A 4L9YA 1MW3A 4ES4A 2DW7A 3AYSA 2DV0A 4J28A 1J18A 2VQUA 5A6JA 4F2UA 5D37A 1Z41A 4MVAA 3ENLA 3PBUA 3UETA 1M41A 1XLCA 3ORWA 3R13A 3MSGA 1OZMA 2D0HA 3GDLA 5CPNA 3ES7A 4RW5A 1P5QA 4TW7A 4BZYA 3THDA 4CNOA 1HKWA 4ORIA 1J0KA 2ZZ5A 4LSBA 1FKGA 3W1XA 1NWTA 1U33A 4JY9A 4JTAA 2Q09A 3H2MA 1AJ2A 3UY8A 3OVQA 1FJDA 1OGGA 3BJSA 4JYDA 1W3IA 2VO5A 2ZDSA 3EYPA 4P7OA 4S2CA 5AYXA 3NQAA 3NCOA 3GVVA 2HVMA 5HNNA 5AB3A 1J6OA 3POHA 4ENLA 3QOKA 3CHFA 4FR6A 3B0VC 4BEQA 2VRKA 3Q45A 4HN4A 2Q71A 4AZHA 1TPB1 1K6AA 3W72A 3URBA 4JTSA 2G96A 1J11A 2FZNA 1FD9A 4GUHA 4S1FA 2Z6IA 3W02A 5DEZA 3PZTA 2OSXA 1A3WA 1L2UA 3O5KA 3NZPA 2ZWZA 1NOWA 3SADA 1UOZA 1JPMA 1KGUA 4JKMA 3WELA 1I4NA 3TR9A 1FOBA 1K8XA 2ZCGA 1JCYA 1KW1A 4J3ZA 2GJXB 1R3YA 3T2PA 5FESA 3PJUA 2ZBTA 1XC4A 3N18A 3TYCA 1X96A 2P4VA 3AXHA 1E5JA 3GLCA 1VFLA 1ZFJA 3ITTA 2W27A 3M0IA 2YA1A 1JZ8A 2BY2A 4LS2A 1GYNA 2QCMA 4LBUA 1H0IA 4CGTA 4GZIA 1GOXA 2BLEA 2X2YA 1X1ZA 1FY6A 2J8FA 4D6HA 4H8VA 3NEHA 2NQ5A 3TC5A 5F7UA 1BSIA 3GTNA 3B9NA 6TAAA 1DQWA 4U10A 4Q3MA 3KAIA 2YDRA 2FJKA 1IT7A 3BSGA 1F6KA 1NSJA 1KT0A 1DVJA 1KD0A 1FCBA 5C55A 1XF0A 1PXGA 3C3UA 4GPNA 3UWWA 3QSTA 2QPUA 2A7RA 1FP9A 3PSVA 3M16A 2X09A 4AD4A 2LKNA 4JFMA 4N02A 4K3ZA 5DMMA 2PWUA 4TIMA 1Q6DA 3SCPA 1KV5A 3OLIA 2E09A 3LLXA 3QC3A 3HM7A 4XVEA 3VM5A 4D6FA 4INFA 3PZ9A 4IT6A 1O6IA 1EIBA 4JZ5A 5C9RA 3VMNA 4HNVA 4Z42C 4GO9A 3LK6A 3LBCA 3UI5A 3THAA 1DE5A 3RILA 1UZ4A 1GVIA 1KBJA 3GAYA 2PN0A 2GJLA 5U4NA 3HO8A 4NRRA 1XIJA 3V7PA 2GDVA 3BAYA 3SCQA 3O6DA 3C0JA 5HJYA 4XBJA 1TWIA 4QGCA 2E8ZA 4I7WA 3LOTA 8XIAA 1J0YA 4A8LA 1PZ0A 2DZAA 1CXFA 2OQLA 2IQ0A 1KFWA 2ESCA 2XIOA 1VBGA 2WWDA 1WXZA 3N4EA 2A1YA 3GVWA 2QAFA 1A4MA 2FPTA 4H6EA 2PWFA 1OX5A 3S9ZA 3WLOA 4IP7A 1EDQA 1TV7A 1H4PA 4HOXA 2VN1A 1PV8A 2CLMA 3I3DA 1AW5A 3BQ6A 5JU6A 3GTIA 2ZYFA 1SFTA 4E4PA 5LGZA 1UKSA 3RU8X 1XIFA 3RXZA 3SN1A 1G6CA 3PBMA 4KFPA 4R88A 4WZHA 5AKQA 3E2QA 3G0XA 2DQWA 4Q8PA 3TA6A 4AD2A 1R8LA 1XLBA 1PKMA 1ZPTA 3LHTA 3GH4A 2G3JA 3PZGA 5FJPA 1WOAA 4N9EA 1VBRA 4DAFA 3MW7A 4WY0B 4ZOEA 4MNMA 4GX9A 4JHMA 4C1NA 1XV8A 1IXPA 4JHOA 3SIMA 2GFTA 4XIMA 4W4QA 1XRVA 3WLTA 3IHZA 3GC5A 4GVFA 4HARA 2R1MA 4WOQA 2X7WA 5I07A 3T2QA 4QP0A 3W22A 5B7ZA 1T41A 4LUIA 1R85A 1F40A 4L6HA 5LXXA 3FXGA 5IDZA 3OO2A 3KOZA 4Q4MA 4IPIA 4GK8A 4H6QA 1OJXA 2PDCA 2FVKA 3GBEA 4IJCA 2HSAA 4Q4OA 3PM6A 4B5UA 3GS6A 1O5KA 4EWJA 3VFCA 3KHDA 1KRCC 3TYEA 2HISA 1W8SA 1E0XA 1C92A 1BGAA 1W3KA 2WVVA 1NH6A 3T4CA 3BH4A 3UGVA 4ZQOA 1AG1O 1GT8A 1UW9A 2GLKA 1XD0A 1CT5A 4GJJA 2WVUA 4FPSA 5HMFA 1V77A 3A4WA 5BMWA 3O5FA 4OHQA 4JPGA 4EX4A 4LT9A 4IZGA 3B9EA 4UTTC 4JICA 2XFRA 4K8GA 2H9AA 3UXDA 3WQ8A 1DXIA 4JFTA 3EA3A 1E56A 2E6DA 3MWAA 1ML1A 1ME7A 4DUWA 1KM5A 2BASA 4O10A 5DMLA 3T07A 1TA3A 5CZJA 1CCWB 3QXBA 2FIQA 1P1MA 2G0WA 3UJFA 1SR0A 3H4GA 3AYRA 3QMRA 3AIVA 2VZTA 1A7XA 3V75A 5SWUA 4NAFA 4N4PA 1YE6A 1JXKA 1VCFA 4CNNA 5A6TC 2EHHA 2NWRA 2J25A 3GY1A 4GGBA 1G5AA 3SBFA 4H9MA 3W37A 2Y6ZA 3CHCA 3VD7A 3GFZA 3CV7A 3PRAA 3VD9A 5IBXA 1XDLA 1EDGA 4JN8A 4CNUA 5K3VA 1UP3A 4J27A 2I7GA 1WXJA 1GKRA 2A21A 2YCLA 5E6YA 1W1IE 4ONVA 5I77A 1W8GA 1A5AA 4DJEC 4DH0A 4RNHA 4W7VA 2ETNA 4TTGA 3W6LA 1US2A 3VM7A 4MIMA 1RH9A 1TIMA 3CAWA 3CNYA 3ONCA 4XZHA 1DP0A 1E9YB 4L6DA 5EL1A 1V6XA 2P50A 3R0KA 2Z1SA 3SAZA 4A8IA 5CZSA 4UWMA 3O5MA 1S2VA 4CCCA 3BAIA 1GKQA 1H7OA 2POZA 2VOMA 5H8UA 1FX6A 4S3DA 1QFEA 3W88A 3VD3A 1WDDA 3ITCA 2Z29A 4J3UA 1ESWA 4BF8A 4HSOA 1FKLA 1K02A 1XW8A 3AXMA 3WLQA 1DOSA 2Y88A 4AZCB 2DZSA 3UZJA 3M0ZA 2HQAA 1JIBA 3CIWA 2VC6A 1GUVA 4DUOA 1QO5A 3WNNA 1RCOB 2WMIB 4KW2A 4LUSB 1FWCC 2XFWA 4LXFA 5G1MA 1X6LA 2DVTA 4HJFA 1F8AB 1QPRA 1JAKA 3QYSA 2BHUA 5IM51 3CIVA 2YBVA 1WX0A 3OA3A 4ZFCA 3ABQA 3TU9A 2E6AA 3UR5A 4PTXA 3SJ3A 1V51A 2X05A 4MHBA 2C18A 1HQTA 4WKHA 3ZR6A 4D1IA 2GK1B 5AHIA 2FKEA 2R94A 3FHQA 1VFFA 3NFUA 3FNDA 2QF8A 1UMLA 4HA1A 5KMYA 1UP2A 4I7VA 1HP4A 2X1UA 1JQXA 5I3JA 1QK2A 3VOGA 2RFGA 4B9YA 3U3HA 4DI9A 2YFNA 2ACQA 4LW7A 1JPKA 5FEZA 3S5YA 4IM4A 4KEVA 1JCHB 2V63A 3F4VA 3LM7A 3D47A 1R3TA 1K03A 4QLLA 2V5DA 3QHNA 4XWUA 1S5TA 3EA2A 3VAWA 4F0RA 1E9IA 3VAVA 3WDPP 3CHVA 2POTA 3JR2A 4KWSA 2OMAA 2OODA 1JXJA 2LGOA 1W9BM 4IICA 1GTHA 1AMYA 2LJ4A 2XZ9A 1DBTA 1FH9A 4S3CA 2VX6A 1TKKA 3SGUA 3PN8A 3W87A 3KRSA 3TA9A 4JQ3A 4MGGA 3CT2A 3HPSA 2OZ0A 4OUIA 3FJNA 3EY6A 1DJNA 5HK4A 4DZ3A 4A3RA 4F2TA 3VIOA 4AVOA 4GGHA 1EGVA 3AHYA 4D8ZA 5CSRA 2WV8A 3L0NA 2J47A 2PTXA 2A7NA 2ZC8A 2GWGA 3EPMA 3KHJA 4I8DA 5FOOA 2Z0IA 2YL9A 3SJNA 2BBFA 1U1UA 2GQ3A 3HJEA 1K77A 1TREA 3SCRA 4CQAA 2A85A 1VYSX 2CXEA 3FYYA 5CSSA 3KAHA 4MLRA 3N1AA 3THQA 2A5HA 3W7LA 1NU5A 1HXJA 3VKKA 1I0DA 2YBTA 1W54A 5G5IA 2Z1BA 4FO4A 3UERA 4FHAA 3WQDA 4FNQA 3SRKA 3VIGA 1SU5A 4IG2B 1FFQA 2ON3A 4BQ3A 3NQMA 2CLOA 2X1IA 1PYMA 2CZFA 2I56A 4L4MA 1UR9A 1FWWA 5C