1HKKA

High resoultion crystal structure of human chitinase in complex with allosamidin
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
364
structure length
364
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEQSGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHITOTRIOSIDASE-1
publication title Crystal Structures of Allosamidin Derivatives in Complex with Human Macrophage Chitinase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 132
structure length 364
sequence length 364
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1hkkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hkkA01
1OIFA 1MW1A 2UWFA 4RE3A 4UFHA 1J0KA 2PBOA 3CO4A 5D9MA 1NWSA 3MUAA 1MVYA 1V3JA 3QHMA 5ABEA 2FH6A 1JFXA 4AZHA 3WMBA 2YA1A 1ZBWA 2DEPA 1KB3A 1KCLA 2E9LA 2D2OA 3B9EA 4CCDA 3OZPA 5CPTA 4UQEA 3F5KA 4H7VA 3RCNA 2VX7A 5BRPA 2W92A 5A6KA 4PMOA 1B2YA 3QOMA 4JL1A 3OG2A 1GOKA 3EBVA 5HBFA 5IHSA 2BS9A 4MNKA 5A6BD 2W91A 1JDAA 2BY3A 4PUDA 4U3AA 4U33A 2CERA 3ZMRA 1LL7A 5A94A 3BH4A 4DWSB 4B3KA 4PCSA 1E6QM 2E0PA 5IDIA 2J7HA 3F5JA 3GNOA 3NDZA 3MSGA 1E40A 3CPUA 4LX4A 1KWGA 1GJWA 1MW2A 5HXMA 3TTOA 1J9YA 1ITXA 3EDEA 2WMJA 3BCFA 5BYWA 1JZ8A 3TOPA 4BQ5A 3BSHA 3AHVA 3N18A 1UR8A 4PMYA 1HNYA 3POHA 4J27A 2E40A 1XCXA 1MXDA 1EHNA 4PMUA 3S6TA 2Q8XA 1OT2A 4WK9A 2PWDA 2WSPA 4W8BA 3MV01 1HJUA 1E0XA 1X6LA 3PZNA 1WZKA 3WDPP 1EIBA 1HKKA 4PMDA 1ISYA 5DO8A 3WH6A 3NYDA 4BCEA 1V0NA 1E4NA 3ARZA 1QI0A 1QI5A 1XD0A 1IV8A 1CIUA 1GOQA 2JIWA 3ZQ9A 3WF1A 1KXVA 3CZGA 5ABHA 2DT3A 2GFTA 4QCEA 2CESA 3BMWA 2WC7A 1E55A 3L4VA 3UEQA 1G5AA 1E73M 5LA0A 1EGZA 4X0NA 4GI9A 1JYWA 1JXKA 2EQDA 2DSWA 2G4FA 4LGXA 1U2YA 4J3WA 2BVDA 3FHQA 3RILA 1OWQA 1IZJA 8CGTA 4HZ8A 4JZ5A 4AISA 2E3ZA 1CEOA 2J7DA 3D5HA 4FK9A 3LPPA 4U3CA 3WD4A 3M7SA 1UR1A 5A6AA 4H8UA 3NSMA 2XGIA 1WDRA 2ZOXA 3VGGA 3ARPA 4NSBA 2ZXAA 4AXNA 4IUGA 2VX6A 1MW3A 1BPLB 2VZUA 1VB9A 4P7RA 3I3BA 4PTVA 4AMCA 1CNVA 1JYVA 3VGDA 4GINA 5FL0A 3IJ9A 1PZ3A 2XIBA 3K1DA 3PN8A 1UH4A 2FHBA 1UD4A 1JI2A 2ZXDA 3ECQA 5CQ1A 3VGEA 3AIEA 4NRRA 1B31A 3FHAA 3VD4A 1D3CA 3KZSA 4C7GA 1JZ4A 2XGBA 3MU7A 3IJ7A 4H04A 1VJSA 3GXMA 3NIYA 3WENA 2V3FA 3AXHA 1W1PA 4ML4A 1WKYA 4HMEA 3VDAA 3CH9A 2CBVA 1UR4A 2J47A 1MW0A 5HNNA 3KL0A 4M80A 4ATWA 1UWRA 6CGTA 3PZQA 4TXEA 3N9KA 4HTYA 4H2CA 1B9ZA 1VEOA 1MFVA 2BHUA 2GJXA 5JBFA 3G6MA 4JFTA 3AOFA 1FP9A 2G3MA 1C7SA 2GJXB 1VRXA 2WMHA 4ACZB 1V0LA 4LQ1A 1GZJA 3AXIA 4PRWA 4Z2GA 3VM5A 1R7AA 4DUVA 4UQAA 4XUYA 1GQJA 4MB3A 1QI2A 2WVUA 1TUXA 2WHKA 3CUIA 4D6FA 4HPHA 1I1WA 2Y8VA 4QCFA 5CJ5A 4IM4A 5A8MA 4JHOA 1QBAA 3ZJ7A 5M17A 3VD7A 4WF7A 1G9HA 5CLTA 1CXKA 1LQ0A 1G0CA 3WQ4A 1EOKA 4D6HA 1VFUA 4S3KA 3N12A 5C71A 2CHOA 4GO9A 1UKQA 3BCDA 3FN9A 3NSXA 5KEZA 4W8LA 2G3IA 2CIPA 5BXPA 1UD3A 1B3WA 1M03A 2CHNA 1CYGA 4MB1A 3GNPA 1K9TA 2G8ZA 1UOKA 1W9BM 2VRQA 4C7DA 3M6DA 3EMZA 1E4IA 3QR3A 5EB8A 4CCEA 2CBIA 3VDCA 4MNMA 3T09A 2YJQA 4GI6A 1QNRA 4CCCA 5HDRA 4UFMA 1V3KA 2YL5A 3W38A 1W2PA 3MKKA 2YL6A 2UY3A 3WD1A 4HA3A 5BXSA 5A2AA 4W7WA 2WMFA 4WKFA 4ZXLA 3WELA 3PTKA 1QW8A 4J28A 3WNLA 3GXFA 2ZWZA 4GXPA 2VRKA 3WQ5A 3RM4A 4LYRA 2BFGA 4RL3A 3ZSTA 3WNMA 1HF6A 1C93A 2BXYA 1J0ZA 4CVUA 1J12A 3S2CA 1RD6A 4NRSA 4FLRA 4UOZA 3W81A 1PIGA 2AMGA 3OLGA 1ESWA 5E0FA 1W1YA 3EMCA 4N42A 5GNXA 5CSUA 3TTSA 3ZSSA 1VEMA 5ECUA 1ZU8A 1H1NA 1GPFA 1RP8A 4X9YA 1W9UA 2Z1KA 4KMQA 4ZFMA 3CIVA 2WCSA 3ARRA 1HXJA 1UKPA 2A3HA 1PAMA 1C92A 3VIGA 1V6UA 2D0FA 4WLCA 1JYNA 3LPGA 3AMLA 1XH2A 3VUPA 2WXDM 5BROA 2ZXQA 2WCGA 2V5CA 3EDDA 2YDRA 4HOZA 3WD3A 4HZ7A 1FFQA 2J62A 4QLJA 1Q6CA 5A6MA 1BAGA 2V3DA 5IHRA 3DYMA 2ZX9A 2Y8KA 2UY5A 4K68A 2XHYA 5CSYA 4L4OA 3SEPA 2XFRA 1L0PA 2JIEA 1TA3B 3OGVA 4Z2KA 1IT0A 1ODUA 2RGLA 5D4YA 2VQTA 1GCYA 1NP2A 2WM0A 1HP5A 3WEMA 3MUY1 1J18A 5E09A 2XWDA 4UOQA 1YQ2A 2NW0A 3PZTA 2WZIA 3O9NA 1QBBA 1XYZA 2QMKA 5EFDA 2YL8A 2XTKA 4TOQA 1CLXA 1ISWA 3GYCA 1W3LA 3T2OA 4RE4A 4QFUA 5M03A 1LL6A 4F8XA 2D20A 3ZR5A 1G1YA 3LPFA 4WSJA 3W28A 1FHDA 2WC4A 1E6RA 1JYXA 3ZOAA 1UH2A 2X0HA 1C8XA 1PZ2A 1C91A 1B30A 2VR5A 3OA5A 4PBGA 3PZOA 2ZUWA 2GK1A 1B3ZA 4PMNA 3CZEA 2J8FA 4AD5A 1XC6A 1F4AA 3AIRA 4KRUA 4MTVA 2GK1B 4BQ2A 1UZ4A 3RJYA 4DWSC 3VMOA 5I6SA 5IXEA 3WDHA 4CU7A 2QPSA 1KGXA 3WFZA 1OGBA 3VGBA 5FKYA 4FMVA 1FP8A 1HVQA 2J7GA 5JH8A 3THDA 5HOSA 3L2MA 1D7FA 3N04A 2WK2A 3RM9A 2JF7A 1BYBA 3EDFA 4DWSD 1CGWA 3AS2A 3IANA 2O9OA 3D3AA 5GQBA 4AD4A 3L4YA 2CBUA 4GPNA 1E71M 1Q6GA 2OWXA 2VZSA 1E6SM 2YIHA 4FLQA 2E9MA 2HISA 4W93A 3W29A 4D6GA 3WFLA 2YLLA 1MQRA 3WQ6A 1DWFM 1CXLA 3PTMA 1ISZA 2VZOA 1CGTA 4D6EA 1NM9A 1JNDA 3UERA 4M24A 4XB3A 2D1ZA 1TVNA 1V6VA 5GPRA 1V3MA 3MMUA 3ARWA 1UKTA 3AHXA 1Z32X 3VKKA 1JG9A 2AOSA 3W6MA 4B9ZA 2RGMA 3A3HA 2DIJA 4UQBA 1HJQA 2A3EA 4FF5A 1JD9A 3A4WA 5BWFA 1CPUA 1AVAA 5BRQA 2WHMA 4OOUA 4P8WA 5E6YA 2VNCA 1R86A 4F79A 4TX6A 1NWUA 2WMIA 5AC4A 1HVXA 1UD6A 2Y2WA 4JFSA 3AYSA 4BZYA 2Y4SA 2VR4A 5EMYA 1PJ9A 2WMIB 4Z2HA 4W86A 3ZO9A 1E1FA 4WJXA 4S3JA 5CLWA 2C8NA 1ZBKA 2J74A 2XVGA 2YDSA 1NP0A 5A69A 4H8HA 1LG1A 2FDMA 1MWOA 1GQLA 2V3EA 2J25A 1JZ3A 4TVCA 2UY2A 1TZ7A 1CBGA 4UTFA 3WEZA 3CHEA 1UHVA 3N13A 4F9DA 2PWHA 3SIMA 1KGUA 3ZJ6A 4W88A 2PWFA 4D6DA 3SUSA 4AZCA 5BXRA 1EH9A 4W5ZA 4HU8A 3WNOA 1KFWA 2WZEA 2XM1A 3BMVA 3SUTA 2DT1A 3GH4A 3T2PA 4HPGA 1XH0A 3UR8A 3W4RA 3NJ3A 1DWJM 3BAIA 2DPEA 4MADA 3GXIA 1KCKA 4AIOA 1VBUA 3IK2A 4UCFA 4GO8A 1RP9A 3WUBA 4Y7EA 2ZWYA 3AIBA 3AYRA 3A6OA 2CETA 3ARQA 1QNPA 3BC9A 3CUFA 3AIWA 1QI3A 2WC3A 4CU6A 3AISA 2VZTA 1GNXA 5D9NA 3ZT7A 2MANA 1B3VA 4MNLA 2BNJA 5IFPA 1XSJA 3VILA 3SCQA 4D6CA 1R7OA 3A4XA 4JL2A 4OOZA 5JUVA 3ARXA 4AZ5A 2VRJA 4AZ6A 3NUKA 1V3LA 3PZVA 3B9AA 3OB8A 2W5FA 1GW1A 1OIMA 2QF8A 4HOWA 4FLOA 2EPLX 3CMGA 2ZUNA 7CGTA 2VVSA 5AY7A 1L8NA 3DYOA 4JKLA 2EPKX 1HJXA 1AQMA 2VQUA 3SUVA 1NWRA 2D0GA 3SCTA 2Y24A 3PZMA 3T0BA 2X2YA 4YHGA 3WD0A 4LXFA 5I0DA 1JFHA 1LL4A 1JIBA 3OLDA 1JZ6A 2BHZA 1OCQA 2DT2A 1E70M 2DH2A 2WW5A 3SCWA 3A4AA 5KZ6A 5CZKA 4AW7A 4V2XA 1V3IA 4TTUA 4PEEA 1UWTA 3VD3A 4Z2IA 1OINA 4UZUA 4ATLA 4E8DA 1BG4A 1W91A 5A6BA 3K8LA 5FIPA 4PYSA 3CGTA 3VIHA 3WMSA 3KWXA 1BVNP 2C7FA 1UWSA 2YBUA 4CVWA 3OZOA 4AD1A 4PTXA 3VGHA 4PMVA 3T0DA 2VUYA 4C7FA 4Q22A 3F4VA 1LJYA 4U2ZA 1W1VA 1TR1A 2ZUMA 2GJPA 3SCVA 4D71A 3VTRA 1QNOA 3WKZA 3N1AA 4IPNB 4P7QA 3U5UA 2NSXA 3ZIZA 2WVVA 2BY1A 1WO2A 3CLWA 4CKQA 5A8NA 4PMQA 3WNPA 2WVVB 4HP5A 2PF0A 4AEEA 1O6IA 3POCA 3WDQA 1MYRA 1GOWA 4P8XA 3ARTA 5F7UA 3SUWA 1VBRA 4D1JA 2CITA 5D8WA 5HPCA 4D6JA 4UOJA 3WDJA 4E4PA 5GNZA 2IXUA 1B3YA 1DEDA 3WUFA 2XVPA 3WUGA 1DWIM 2YL9A 3ARYA 1YHTA 4XZBA 4F9JA 3WIJA 1R8LA 3RIKA 1E56A 2FH8A 1O7AA 3WN6A 1NARA 2EO7A 4J7RA 2NT1A 3K4DA 2ZUTA 1WE5A 3AMGA 1JZ5A 2EPMX 1UH3A 1H2JA 1QW9A 1W2VA 2BVTA 1QI4A 4MB5A 4HOXA 2DSUA 1LG2A 1DHKA 1FH7A 1TCMA 3WBEA 2PI6A 2D24A 3WY1A 1NQ6A 2YOCA 4GZIA 4EAMA 1J0YA 1PX8A 2F8QA 4M56A 2OYLA 2A3AA 1TFVA 4KGJA 2BY0A 5A2BA 2W63A 4EANA 1GQIA 2W66A 1SMAA 3QGVA 5A1AA 4PTMA 3CHDA 2J78A 4UFJA 3WF3A 9CGTA 3T2QA 3BGAA 1WP6A 1LLOA 1FFRA 2O9RA 3VIIA 2DDXA 3FNDA 5A8PA 4TUFA 2FGLA 1XSKA 1EO5A 2CEQA 2XVKA 1UWUA 5CPQA 1UA3A 2FHCA 4M29A 7A3HA 1DWAM 5GNYA 4XV0A 2JFEX 3N15A 4OZOA 3O2LA 3WH8A 1SR0A 4PN2A 2VC9A 3CZ8A 1HJVA 3RO8A 1E4LA 2QV4A 1MQQA 2ZX6A 3BAYA 5ABFA 1AQHA 1BHGA 1OBAA 1WB0A 1V08A 3WD2A 2WVTA 4IPLA 4BS0A 2ZUVA 3MUZ1 5ABFB 4MPKA 3GBDA 4AZBA 1RPKA 1BYCA 3EDKA 3VD9A 4JFUA 4OBRA 1JGIA 1V02A 3W24A 4W87A 4AD2A 5D9OA 4AZGA 2WMKA 3VX0A 5A6SA 2YBTA 1SFSA 5JBEA 3DYPA 3NSNA 4U2YA 1R87A 4BF7A 3F5LA 4HA1A 1OD8A 4AWEA 3AZTA 4MNJA 2XVNA 2J4GA 3APGA 1ZL1A 3AIVA 4GKLA 1K9DA 2NT0A 2DIEA 1PEZA 4ZENA 1W1TA 3UR7A 1M01A 1CLVA 1UA7A 3GNRA 3WF4A 3WL1A 1E72M 2WAGA 5LA2A 3WQWA 1Q6DA 1W32A 1HJSA 5EFFA 4Q7NA 3SUUA 4JHZA 2OYKA 4M82A 3CTTA 1C7TA 2WHLA 1ISXA 1V6XA 2XUCA 3SCOA 3G6LA 3J7HA 2G3NA 1H11A 3L4ZA 1CXHA 2WLYA 5JIWA 3CBWA 4UFLA 3PBGA 4JIEA 4P8UA 3B9DA 5ABGA 1KXHA 3UESA 1FH8A 2CKSA 1EQPA 1HT6A 4X0VA 1F4HA 2EEXA 4OUEA 5AYIA 4TX8A 1X6NA 3WDRA 1J0HA 3OBAA 1CZ1A 3HMCA 5A3HA 1PX4A 1HL8A 1CGYA 2JEQA 1WDQA 2F61A 2WZHA 1B3XA 2JF6A 2WBGA 4U5KA 3PZ9A 1E43A 4WKHA 3AHZA 3MANA 1EA9C 1WZMA 3L4TA 1E15A 3TA9A 1CWYA 1VIWA 1GUVA 3VDBA 1HIZA 1UKSA 2BHYA 1X1NA 5IFTA 4CUCA 1UR2A 1BGAA 3ZM8A 3KL5A 1UG6A 3UCQA 2V5DA 1BFNA 1RH9A 1OM0A 2VMFA 2ZXBA 1VFMA 2G3JA 1G01A 3VMPA 5CPSA 1JXJA 2J79A 2OYMA 2WHJA 3VMNA 1UWQA 4QDMA 1VEPA 2EPNA 2YA2A 4MJ4A 4N0RA 1VAHA 2CYGA 1TG7A 4ZE5A 1I75A 4LYQA 5A6JA 1KGWA 1OD0A 2VJXA 5FCZA 1Q6EA 4H41A 4W5UA 3EMQA 4PMXA 3HU7A 3CZJA 4ZXOA 1ZBVA 2ZX8A 1AMYA 2J77A 5D8ZA 1AQ0A 1LF1A 1ISVA 4E8CA 4BA0A 1FOBA 1FH9A 3RM8A 4UZSA 1QOXA 5LYRA 3WF2A 3MMDA 3AMKA 4MB4A 3VPLA 4A4AA 1CDGA 3E1F1 2GUYA 4NF7A 4TVDA 2W4XA 1KXTA 2VCAA 1E6NA 4GZEA 1EXPA 8A3HA 3WSUA 1Q6FA 4HZ6A 2EBNA 3L4XA 3JUGA 1EO7A 4JFWA 2JE8A 3LPOA 4UR9A 3CZLA 2BXZA 2WKGA 3AZRA 4J3UA 2O92A 5I2UA 2WB5A 2F2HA 2VURA 2XSBA 2VX5A 5TD4A 1JD7A 5HPOA 3FY1A 3BLPX 1GJUA 1HN1A 4JFVA 3WQVA 3FW6A 1E6XM 3DHUA 4M8UA 1B90A 1W3JA 4UFIA 3GDBA 3HN3A 4AZ7A 3VIFA 3WBAA 1BQCA 3ZT6A 4CN1A 3ALFA 4MJ2A 2GJRA 1I1XA 3GZAA 3BAJA 2W61A 2DSKA 1UQZA 1PX3A 2QHAA 4HU0A 2XVLA 4BQ4A 2WWDA 1HKJA 5I5RA 3WQ8A 1XH1A 3W27A 2WNWA 1XHGA 2Y5EA 3VIOA 2V3GA 1EDTA 1EOMA 1CENA 1J0IA 3CHFA 1ZJAA 5I23A 1XV8A 4W84A 1BSIA 4EKJA 2ESCA 1GHRA 3IJ8A 1IZKA 3PZGA 4AYSA 5I78A 2VVNA 2X05A 1BG9A 3AROA 4JKMA 1EQCA 3RMEA 4KRTA 3VOCA 2CXGA 3OLEA 4AZIA 4UNIA 5I3DA 4MAVA 2WANA 4DUXA 3MO4A 4LYPA 2XWEA 3MUIA 2VZVA 2YLAA 2VCCA 1DTUA 1JL8A 2A3CA 1CGUA 1KQYA 2OLHA 2J7BA 4CD6A 4L4PA 1XD1A 1HJWA 4H8VA 2X1IA 3M07A 2W67A 2ZICA 4PSPA 4QLLA 3PTQA 3VD5A 1V6YA 3AZSA 4OKDA 7TAAA 2JALA 1JI1A 2DSZA 1QPKA 3KEHA 3GXDA 3WDIA 1SMDA 3WMCA 2VT0A 4A3HA 2CKRA 2XJ7A 4AZCB 3UG4A 1ITCA 1DP0A 3VIPA 3VU2A 4DWSA 2OWWA 4B16A 1UUQA 4B9YA 3FAXA 3VINA 1UWIA 1U33A 5I24A 3OGSA 1E6ZA 2CPUA 1J01A 1KR1A 4AC1X 3QHNA 4CD7A 1PPIA 3W82A 3SCNA 5I77A 2IUZA 5C8BB 2GDUA 1EDQA 1WCGA 1J0JA 5I79A 4M81A 4KGLA 4PMRA 1C3FA 2WKLA 2VCBA 1M04A 3VDHA 3MMWA 3TP4A 4U5IA 4DM2A 2VO5A 3PHAA 1H41A 2V38A 4EE9A 1V0KA 4KH2A 1GQKA 3W37A 1B1YA 1MXGA 1FA2A 1K6AA 6A3HA 3CUGA 1BYDA 1GOOA 1CTNA 5BCAA 1V6WA 3AMCA 2PC8A 3GBEA 1WNOA 1VF8A 3AS0A 1E0WA 2TAAA 4JAWA 2FHFA 3U57A 4GZJA 1JF5A 4TTGA 3KL3A 3VIMA 3W0KA 1CGXA 3DHPA 1E3ZA 5A2CA 4P7LA 4QAWA 3U7BA 3BSGA 1OGGA 4D72A 3W25A 1V02E 1XGZA 2YKKA 3M46A 1VJZA 3TTQA 4CN6A 3ZJKA 3A47A 5CGTA 1BGGA 1M7XA 4U31A 1NOWA 1XRVA 1QVBA 3U5YA 1VFFA 4W7UA 1W9DM 3SCSA 4W89A 3GM8A 4PCTA 4OBSA 4GQRA 3N11A 1TMQA 2J7FA 1N82A 2HVMA 3CZKA 4DM1A 4JCLA 4PSRA 4PUEA 5E9AA 1PBGA 2D0HA 2E9BA 4J3TA 3BLKA 4QP0A 3OIHA 2VL4A 1US2A 3CHCA 4GI8A 3GH7A 3BAKA 4UQCA 4ZEPA 2OSWA 2OWCA 3RPMA 2FGZA 5EBAA 1P6WA 3NDYA 1V0MA 5FD0A 1US3A 2XG9A 1NOFA 1OT1A 3AQUA 4V27A 4MDPA 4JCMA 1DWGM 1W3KA 2PBGA 3MSDA 4XX6A 4P8VA 2BY2A 2D23A 3ARSA 5DFAA 1XCWA 1JAEA 5JBDA 1NWTA 3MV11 4PMZA 1WPCA 5DT7A 1CECA 2WPGA 2EPOA 3RJXA 2D3NA 4D6IA 2XIIA 5E0CA 3GTNA 5DF0A 1HKIA 2J7CA 3AHTA 4UFKA 3L4UA 2BVYA 4HMCA 3AHYA 2XPKA 1QHZA 3ARUA 2WSKA 1JZ7A 1SYTA 2CNCA 4URIA 4DUWA 6TAAA 2W62A 2WMGA 1MFUA 2E4TA 5DEZA 4PTWA 1ZS2A 4WKAA 1WDPA 2ZUUA 1W9VA 1K9FA 4CD5A 2DSVA 3II1A 5E6ZA 4IISA 1HP4A 3CUJA 3WEOA 3NCOA 1XYFA 3DECA 4CGTA 4ACZA 4YHEA 4JKKA 3KE0A 2DGAA 1H0GA 1ZB5A 1UD8A 1JDDA 3FAWA 4B15A 1KBKA 3B8SA 1CXEA 1D2KA 2A3BA 4FLSA 1PIFA 2VI0A 2D3LA 4J3VA 3TTYA 4ATDA 2GVYA 1UD2A 1QHOA 5A8OA 3ZJ8A 1DWHM 1WZAA 3LMYA 2YDQA 3VGFA 1UR0A 2WCAA 1R85A 1LWHA 1BTCA 3AICA 1KBBA 4UQ9A 4QLKA 1UKOA 2WLZA 3EDJA 3WH7A 4R27A 1ZJBA 5DT5A 1GOMA 3AS1A 3GH5A 1LWJA 1HL9A 3AJ7A 3PZUA 2XFYA 3K8KA 4Z2LA 1UD5A 3AI0A 2X09A 4R5EA 1MQPA 2EXOA 3AIQA 3VVGA 1UQYA 1NH6A 1KQZA 1G94A 2Z1SA 1GOIA 1J11A 1GHSA 4CD4A 2X0YA 1EDGA 2GSJA 2VX4A 2OSXA 4NI3A 3VIKA 1JNEA 4NZCA 2O9TA 4AD3A 4W8AA 3L2LA 2DT0A 1A3HA 3SCRA 2ZIDA 3CMJA 1ODZA 2XYLA 4ACYA 1HKMA 5LA1A 4E2OA 4J3XA 3FXYA 2DQXA 3DC0A 2J7EA 1XSIA 3QOKA 1E6PA 4W7VA 1M53A 2XFFA 1J10A 1E5JA 3W26A 3K46A 2PWGA 3RDKA 1A47A 5M5DA 4AIEA 1C8YA 5CGMA 4V28A 3AS3A 3QHOA 3WNNA 5FOOA 3ZT5A 1TVPA 4AIUA 3I3EA 4CN4A 2XSAA 4A3YA 4OJYA 1ZBCA 3UG5A 2WVSA 3WF0A 2C0HA 4RE2A 4HA4A 2E8YA 4P7NA 1QNSA 5JIPA 3O6AA 4F66A 2VOTA 1JZ2A 2OSYA 4J3SA 1CGVA 4WSKA 1OB0A 4EK7A 1OSEA 1TE1A 1NOUA 3AXXA 3IAQA 1BVZA 5AC5A 2ZE0A 3ALGA 4XZWA 1W9PA 2ZX7A 1UZ1A 1GVYA 4YN5A 3CUHA 1C90A 1E9LA 1VFOA 1FHLA 3T0AA 4GIAA 3WUEA 4Z2JA 3VM7A 1KWKA 3ZR6A 1BYAA 5A6LA 4AY1A 1H3GA 1TA3A 2ZUSA 2G41A 1E1EA 3HJEA 4CU8A 1BF2A 4MDOA 5E70A 4ZE4A 3N17A 2UY4A 3I3DA 1K9EA 3VNYA 3AMDA 4YPJA 1CXFA 1GONA 3WH5A 2B31A 2JEPA 1GORA 3K8MA 4M1RA 4TVUA 3MS8A 2IXVA 2QMJA 1V03A 3W6LA 1EHAA 1E5NA 3BAXA 4BQ3A 5M3WA 2D22A 2YA0A 2XM2A 2QLYA 4W85A 4AEFA 3SURA 3VO0A 1UR9A 3OLIA 1U30A 3PZIA 5AYBA 3BXWA 1GVIA 2X8RA 1H5VA 1HX0A 2E8ZA 4GQQA 5C70A 1ECEA 4KWUA 3U7VA 5A8QA 3IAPA 3EYPA 3BAWA 1KXQA 4OIFA 4UQDA 1E0VA 3W53A 2J75A 1E3XA 3T08A 3VIJA 3AFBA 4B3LA 1H09A 1UYQA 2AAAA 4D1IA 1VENA 2VTFA 3VX1A 1WZLA 4HMDA 2PB1A 5D9PA 1S46A 1E4MM 1WDSA 1H4PA 3AIUA 1Y7VA 4LPCA 2GDVA 2WYSA 2QPUA 4P7OA 3SCPA 1QHPA 2WBKA 3TONA 3L4WA 3THCA 3OGRA 2BV9A 4MAZA 3UG3A 3VNZA 4AD0A 1W3HA 1V3HA 5CXPA 1QNQA 1KR0A 2DH3A 3K4AA 4WIWA 2ZX5A 5FL1A 5BXTA 1C8QA 1W9XA 2O9PA 3UETA 1Q4NX 2CBJA 1JAKA 3SCUA 1WAWA 2EJ1A 1H0IA 3WL0A 2PWEA 5DMYA 4CD8A 1B0IA 2CCRA 5CG0A 2J8GA 1CXIA 1BLIA 3WH9A 3WNKA 2WWCA 1H49A 3ARVA 5A95A 1JF6A 1JDCA 1OGSA
chains in the Genus database with same CATH superfamily
4HHLA 2VN1A 3GXPA 4YYCA 2XH7A 2UWFA 4RE3A 1J0KA 3CO4A 3W2KA 3MUAA 3GUGA 1MVYA 3M6YA 4HB7A 5ABEA 3LCLA 2PDIA 3WMBA 1XLJA 2D2OA 3PG8A 3GVWA 3OZPA 4RNJA 4UQEA 3F7JA 1NSJA 2ACQA 4ZPTR 1PE1A 1VZWA 4UMBA 1I60A 2FJUB 3PBYA 4PMOA 1IQ8A 3M0YA 1B2YA 3QOMA 3UBPC 3A3XA 4NZJA 2A7PA 4YTSA 2BGQA 2CERA 3IUIA 3ZMRA 4O16A 4KCWA 1MRAA 3V7PA 4DWSB 2E0PA 7ODCA 2HROA 2J7HA 1TQXA 3MI6A 4GXWA 1XKJA 5K9DA 4FA3A 4C6IA 3TU9A 4H8NA 4AF0A 1MW2A 1J9YA 4Z1BA 2YYUA 5BMWA 1ZAHA 3C5QA 1PDZA 3BSHA 3WH0A 1UR8A 1EC7A 4PMUA 3W2MA 1OT2A 3AXMA 1TRIA 3MV01 3FJ6A 3SY8A 1HJUA 2R1KA 1X6LA 1EIBA 2F6UA 2ABBA 3V0SA 4Y9MA 1OG0A 1XIDA 1TPWA 1ZJHA 1XD0A 3R5EA 3ZVHA 3GFZA 4XZIA 2X0SA 2Z1VA 2XP7A 5ABHA 4QCEA 3V0TA 4AVOA 1LOSA 3O15A 3RFWA 4IMGA 1V93A 3TYEA 1R3TA 2WJZA 3W7RA 3ONBA 3PUDA 4X0NA 5FEWA 1JYWA 4Q8NA 1P7TA 3TQKA 2DSWA 4A8IA 1VYRA 1Q7ZA 1IWAA 3H7RA 3T6CA 2QZRA 3MKVA 4QS6A 1OWQA 1IZJA 4AISA 1CEOA 2J7DA 1XIMA 3S1WA 4UTLA 4C6EA 1BEUA 3WD4A 1UR1A 4PCFA 4H8UA 1UJPA 1E1CB 2HJPA 4J3ZA 1WDRA 2ZOXA 4YVPA 1K8XA 4NSBA 1R38A 4E6MA 4EPBC 1Q85A 3R13A 4IGHA 2H8ZA 4CNPA 3TXVA 1K8ZA 1VBGA 4GCAA 3I6RA 3I3BA 4PTVA 2R24A 4H7CA 4GINA 5FL0A 1TJ1A 3IJ9A 2E7FA 3MWCA 1Y5VA 3L68A 4RPQA 5CQ1A 2IS7A 3PWGA 1VCVA 3DKLA 4RLIA 1D3CA 3KZSA 3HFTA 2XGBA 1ML1A 2BTMA 2GQ9A 3DG7A 3H21A 3B9OA 4ZODA 1O5RA 3CH9A 1KFJA 4DIPA 1FUYA 4M80A 4ATWA 4CQDA 6CGTA 1C29A 3GUWA 1VHCA 4LAKA 2OO6A 1OYAA 1MFVA 5JBFA 1VYPX 3CQIA 2E6AA 4O0QA 2QVNA 2G3MA 4QIBA 1C7SA 3WJWA 4JTEA 4BHYA 1R7AA 4DUVA 3WLPA 2GGJA 2OR2A 4MB3A 2P4VA 2WVUA 4AX7A 2WHKA 3G1FA 4WX2A 3FA4A 3UU0A 2OCZA 3QZEA 1G9HA 1QO5A 1G0CA 3R2GA 1EOKA 4D6HA 4FB7A 3C0QA 1VFUA 4S3KA 3N12A 2DZXA 1EX1A 5TIMA 1UKQA 4FALA 2G3IA 4I7VA 1PZ0A 3GDRA 3NQEA 2V68A 3ZFHA 4S39A 4JIPA 2BZNA 2GPTA 1XDMA 4HMNA 2OO0A 1TTJA 3QKEA 2C79A 1C9DA 4C7DA 5EB8A 3L9CA 1JULA 3H7VA 3GIQA 1JPIA 2VGFA 5HDRA 4ZQOA 2YL5A 2J6VA 2PSNA 3WD1A 3GQYA 4W7WA 2H3BA 2XH4A 2H3DA 2WQDA 3WJSA 2G37A 3GIYA 3QQ0A 4HIBA 3N9RA 1K8CA 4ERGA 3RM4A 4MJMA 1GW9A 1A5UA 4RW3A 3FJ4A 1C93A 1J0ZA 1M6JA 3W75A 3QJAA 1TV2A 5C54A 3HTWA 4UCGA 4CNOA 3LCIA 4GFSA 2QCNA 3EMCA 3RGCA 1H61A 8RUCA 1W9UA 4JS3A 4KMQA 4WVXA 3I7QA 3CIVA 2WCSA 4IQDA 1UKPA 4C02B 5IOBA 3EXSA 4WLCA 1JYNA 2QPXA 1XH2A 3VUPA 1NY1A 3GK0A 3CC1A 1PCKA 1QDSA 2YDRA 4HOZA 3KBWA 3E74A 4JQ4A 4GJ1A 3OBKA 4A35A 5KMYA 1SZGA 3FA5A 1FKTA 2ZQTA 1BWVA 4LAWA 5LNRA 1KM4A 3ME3A 3B97A 5AVNA 5TAOA 3SEPA 6XIMA 1TA3B 2VGIA 5EMKA 3N2CA 2EAWA 3LCXA 4HNCA 4DO4A 2DZAA 4QRNA 1YTEA 4MY9A 1LZOA 2ACUA 3T4WA 2NW0A 3TSDA 3C86A 2J66A 1FWAC 3WQGA 4LNYA 3JU2A 2OZTA 1V51A 1LLWA 2XTKA 4UR7A 1FDYA 5IRPA 1W3LA 3RU6A 3W7KA 2UZ5A 5LIKX 1FKJA 1D3GA 1DJWA 3W28A 1E6RA 4EF8A 4JX6A 2ACSA 4IGNA 4KFPA 5LGXA 1C8XA 4Q8QA 1PZ2A 1AD1A 4R9OA 3UCDA 1AJ2A 3Q58A 4WSHA 1KBIA 4AAJA 4ODRA 4JTUA 3PZOA 1JVNA 2BB0A 1B3ZA 3KX6A 3NXLA 4RDWA 4AD5A 4ICCX 1F4AA 2EPHA 4MTVA 4FF7A 1PYMA 4M6PA 2PV2A 3VMOA 3LSCA 5IXEA 3WDHA 3W7DA 4FPSA 2QPSA 2NXHA 4GUFA 3S6OA 3WFZA 4FMVA 1N1AA 1FP8A 1SFTA 3JR2A 3G1AA 3JXVA 2PDMA 4M51A 3QW3A 5HOSA 4GYPC 1D7FA 2GSEA 3NG3A 5JU6A 2PCEA 3UA4A 3AS2A 3M43A 4GNJA 1RQHA 1A0DA 2WSRA 1CT5A 3EWCA 5J8LA 3H12A 1MXSA 3KABA 4GPNA 3STGA 1SO3A 1XLMA 4WCJA 2VZSA 3HMJG 2YIHA 1YRRA 3GG7A 3MCOA 2YLLA 1OEPA 3PTMA 2VZOA 2X2GA 1QOPA 1WOBA 1TVNA 1V6VA 3ARWA 1UKTA 1SFJA 3VKKA 2IKIA 1QUMA 4AFYA 1JG9A 3M64A 3LSBA 2DIJA 4UQBA 5GVJA 4Z42C 2LGOA 5T8GA 3TC5A 5BRQA 4OOUA 3REQB 2DZVA 2FYMA 4F79A 1QPNA 2WMIA 3CB3A 4JGDA 1W5PA 5AC4A 1HVXA 1UD6A 2Y2WA 3TVAA 3WMLA 4BZYA 4FAMA 5EMYA 4RJEA 5BU6A 1XLDA 3KLKA 3S1GA 4KBXA 1E1FA 3SY1A 4S3JA 3SW6A 2BWGA 4ZOBA 4IUOA 3UZJA 4QE1A 5H6HA 1DQUA 3NZGA 1M9HA 3RGTA 3DGRA 2PPOA 2J25A 3EOEA 1AW1A 2UY2A 2YFOA 1CBGA 3CHEA 3T8LA 1YW1A 3MP4A 3DIPA 4HU8A 4GIEA 2WZEA 2XM1A 1RLDA 3VCCA 1TWWA 3GH4A 3T2PA 1JVWA 3JZEA 3UR8A 1T8QA 3BAIA 2UZ9A 4JQ1A 5C7VA 2DPEA 4L80A 1PTGA 2P10A 3IK2A 4KEZA 2QW5A 3AIBA 4NJIA 1J4HA 1IEVA 2D2JA 5F4SA 1DPMA 1JUBA 1WQ5A 3AISA 3ZT7A 1MRQA 3VABA 4KW2A 4O13A 4QGCA 3STFA 1J4RA 3P3BA 3VILA 2FB2A 1NEYA 3CHVA 4QS5A 2Z00A 3JYJA 6REQA 4ADTA 4FXFA 4OWGA 4OOZA 3C0SA 4YNGA 4I5XA 3NUKA 5U4NA 1V3LA 3IJDA 1XLAA 4HOWA 4FLOA 4FP1A 4O52A 4ZL1A 2EPKX 3FJNA 1AQMA 2VQUA 4I7WA 3N25A 3MI3A 5I0DA 1SGJA 2BG5A 3CAQA 5EGRA 2P1FA 1JZ6A 1L6WA 2ZVIA 1E70M 2WW5A 3FLUA 1P0DA 3A4AA 3S5YA 4QT2A 2A4AA 3NPVA 4DI8A 1R9YA 2P50A 3TWAA 5IM51 2PTXA 4IICA 4FAPA 4UZUA 1KV5A 5AN7A 3E2RA 1Z3NA 2E5CA 3H4WA 5C5YA 2F2KA 4DVOA 4JTDA 2I1OA 3L2IA 2AGTA 3OZOA 3VGHA 4I8YA 3T0DA 4GBDA 3IACA 4IX0A 5HMFA 4D71A 5LZLA 1QNOA 1JDFA 4P7QA 3O5PA 1J5TA 4PUMA 2NSXA 3ZIZA 2CZDA 1SM9A 4GX9A 4GFIA 4ZO9A 4CKQA 3O5IA 4PMQA 5A8NA 3UXDA 3CUXA 4PFHA 3IIOA 4H6EA 1UR3M 3SUWA 4H2HA 3IGXA 3HGRA 5HPCA 4ZS6A 3TXZA 3KTCA 4E4PA 4HU3A 1B3YA 3WUFA 3WUGA 1DTNA 1XYBA 4DXVA 3HM7A 4XZBA 3JVAA 4F9JA 3UXAA 4LS0A 5DX7A 3CAVA 3WIJA 4KESA 1HTIA 1XDLA 1VPYA 5CBIA 2IPJA 5BU9A 1UZDA 5D04C 2NT1A 2ZUTA 5G4WA 3AMGA 3L67A 1RZMA 1H2JA 1W2VA 4GISA 4FX7A 2V63A 1LG2A 3URAA 2A6NA 2D24A 4GZIA 1DXFA 7TIMA 2V6AA 1EF3A 2X40A 1UROA 2ZE3A 1DIOA 2XPBA 2PPNA 1L6FA 1TFVA 4UR8A 2XH2A 4KGJA 5A2BA 4EANA 1AJ0A 2W66A 3W76A 4WDUA 4ZO7A 5A1AA 3BGAA 1XBYA 1FFRA 2O9RA 2ZTKA 3CM4A 3VZXA 2INFA 1EGVA 1RA0A 1EP3A 5IBXA 1XSKA 1EO5A 5D03A 3UG8A 4BF5A 3KCOA 1XWYA 1RQBA 2CEQA 2B4GA 1R3SA 5CPQA 2FHCA 3KS6A 1DWAM 4XV0A 3LCWA 3N15A 5HT1A 3MHUA 1WXYA 3T0CA 1Q1CA 3QTPA 3UPMA 3IV8A 2VFGA 1E4LA 2N87A 4REQB 1DV7A 1ONEA 3IK4A 3KRBA 1BHGA 1XX1A 3RLGA 1OBAA 4Z0JA 1WB0A 1V08A 2QUVA 3QSTA 3S42A 4ERAA 3U48A 1JUEA 4ES4A 3VD9A 1JGIA 1V02A 4JIHA 1DJXA 1XLBA 3QC0A 4AD2A 3ABRA 4WY0F 1DIEA 5JBEA 1GKRA 1W5NA 3HB9A 3DN5A 1F3WA 2VEIA 4ZGYA 3R11A 3IWPA 1ZL1A 3AIVA 2Y7GA 4LB3A 3P5ZA 2G4JA 3GAKA 4ZENA 4JN8A 1W1TA 4LS1A 1M01A 1CLVA 4DYEA 1KTNA 1XYAA 3WF4A 1YBQA 3SUUA 4Q7NA 4N6FA 3GXNA 2TMDA 1C7TA 2NWRA 3TIMA 2WHLA 1ISXA 1V6XA 2XUCA 4YJ5A 1S5TA 4QE4A 1FWJC 3OYXA 1S38A 1CXHA 3KBNA 4Q8OA 2DZUA 1DJNA 5ABGA 5DXXA 4XBKA 4GJJA 4O57A 3OYZA 3GY1A 4AIBA 1EQPA 1HT6A 1BKFA 4X0VA 1F4HA 2EEXA 4OUEA 4Q4RA 4FX8A 2PPPA 4NHVA 1PX4A 4XZLX 1RXOB 1WDQA 2F61A 4GD0A 4ADSA 2WNZA 3BVJA 4U5KA 4R7WA 1E43A 2ZRUA 1SW7A 1TTQA 3AHZA 2ATMA 4JQ3A 4IH3A 5IDZA 1EA9C 1WZMA 4QDWA 3TFCA 2PU1A 2CLEA 1GUVA 3VDBA 1REQB 1RAKA 1UKSA 3WBYA 4HNUA 5CC7A 1BGAA 5D02A 4A29A 3UF8A 3UZXA 4HVXA 1P48A 5ABTA 2VMFA 3VDGA 4MWAE 4TQTA 1PTAA 1RD5A 3VMPA 4TNSA 3DDMA 2OYMA 3VMNA 1FX6A 4MJ4A 3QRHA 1HKWA 1OD0A 2FTPA 1D7HA 2OU4A 3E5BA 3QPZA 5CPMA 1X96A 5TQLA 5J5RA 4PTDA 4DNHA 2V0TA 4EIVA 1LF1A 3QY7A 4DBWA 4PUNA 4N9DA 3WFAA 1WDWA 3TCSA 5FEPA 2GGIA 4IHCA 1ADOA 3RM8A 1QOXA 3WF2A 3AMKA 1YTDA 4A6GA 1EZWA 1IT8A 4EWND 5AOUA 4TVDA 1IR1A 3LN3A 3SADA 1YPFA 3MUXA 4ZO6A 5K3VA 2PODA 3WSUA 3KXQA 4DAFA 4LAMA 3BGJA 1Q6FA 4HZ6A 2KX9A 2EBNA 2Q02A 3JUGA 1EO7A 3UYIA 5E93A 1THFD 3L7RA 3CZLA 3OO2A 3DHDA 5DY3A 5I2UA 2F2HA 5T26A 4LB4A 1JD7A 3W1XA 3NO1A 3BLPX 3LCHA 4JFVA 1E6XM 3DHUA 1QPFA 1W3JA 3GDBA 3HN3A 8XIAA 2OMAA 2PDUA 2C15A 1XLIA 3ZXWA 1BQCA 3GZAA 3RCYA 1O4UA 3BAJA 3O5DA 1UQZA 4BQ4A 1HKJA 2QJMA 5DXYA 4DI9A 4XO7A 3QPEA 1XHGA 1MEWA 4IQLA 4JTHA 3VIOA 1EDTA 1EOMA 1CENA 1J0IA 3EA2A 3GNXA 4ZOCA 2F38A 2Z24A 2E67A 2YZ5A 1YNQA 4W84A 1PHWA 5CBBA 2D2GA 1BG9A 1NF7A 1XIEA 4JKMA 5EMJA 2Y85A 4Q4KA 4KRTA 4N9BA 2CXGA 3F03K 1V7YA 4HSOA 4UNIA 2WANA 3DAQA 3P6LA 4DUXA 5H8MA 1SR9A 3DESA 2PCQA 4LYKA 1D9EA 2J24A 1KKRA 1IXQA 2YLAA 4WY0A 3LHVA 5HMEA 2A3CA 4LCSA 3QSRA 2J7BA 2Y5SA 1XD1A 2X1IA 2EG8A 2NXGA 4DIAA 3PTQA 3V1HA 3VD5A 4D9PA 4QE5A 5HMSA 3KAIA 3PWIA 2JALA 2QUUA 1QPKA 3TNBA 3T4CA 3K1GA 3DG6A 3R1ZA 3DZ1A 3O6YX 3WMCA 1VHNA 4A3HA 1TV3A 5A8GA 4UXDA 1DP0A 4X3ZA 2WZTA 2OWWA 4J40A 3P74A 1OQFA 3SGGA 2QV5A 3RF9A 4Z0SA 5HR7A 1QR7A 1XL9A 4S3CA 1E6ZA 4BI6A 1OX4A 1KR1A 4GWEA 2VFHA 5CAKA 4AEOA 2GL5A 3H9RB 2IUZA 2GDUA 1H50A 1XYMA 4KGLA 4S1FA 3S2MA 1RBOB 4O4VA 1M04A 4ORMA 3VDHA 3T40A 2QUTA 3S5SA 3LHUA 4DM2A 2BOEX 2VO5A 4DBEA 4C6KA 4IIEA 4EE9A 5D33A 4J5NA 4V33A 1V0KA 4H6QA 6REQB 2IKJA 1FA2A 5F2MA 1CTNA 1Q6UA 3GBEA 1WNOA 3LNPA 3O5KA 3U57A 5EMUA 1JF5A 1SSDA 4CQCA 3VNKA 2EKGA 3ES7A 1TR9A 2ZRZA 1ZCCA 4D72A 3M0KA 3T42A 3E0IA 5FSEC 2YKKA 1JPMA 3FA3A 1QTWA 3KCEA 3OPSA 4CN6A 3MKCA 5CGTA 1M7XA 4JTQA 4W89A 3OA3A 4OBSA 2KFWA 3BDKA 1Z42A 1LCOA 5AHIA 1N82A 3FFSA 4KQNA 3TN6A 4UMCA 1EJRC 2IW0A 3AU6A 4KKXA 4H4IA 4JCLA 1EEXA 2M1IA 4NJHA 2H8XA 5I02A 5E9AA 4NNCA 1KFKA 3TLQA 4PRRA 2E9BA 2WJDA 2XZ7A 3BLKA 4QP0A 1QNVA 2DW6A 5JH1A 4G5DA 3GH7A 5HW6A 4UQCA 3IKGA 2OSWA 3BOFA 4FR1A 3RX4A 1V0MA 3K4WA 3R0UA 3TN5A 3VNDA 2DUAA 3LHWA 1R2TA 3N9SA 3IVUA 3W1AA 3SR7A 2D23A 2O56A 3HG4A 1ZPTA 3T44A 1JAEA 1WPCA 3KFTA 1GK8A 1R47A 4K8HA 1CECA 2P8BA 3S9ZA 4RW5A 2WPGA 1FWEC 2D3NA 4D6IA 3TNOA 1EJWC 1EC8A 5DF0A 3BW4A 1RY8A 1J6OA 3C3NA 2Y70A 3EA1A 4A8NA 1SYTA 2PRLA 3O5FA 4FOJA 4RV3A 5DEZA 4TV6A 4B5XA 2PWVA 1RPXA 1W9VA 3QV6A 5E6ZA 1HP4A 1PWLA 3CUJA 4G8TA 5CG7A 4IQCA 4Q8UA 3DECA 1F05A 4ACZA 1TRDA 2DGAA 1YPXA 4US5D 1UD8A 1JDDA 1SUXA 3B8SA 5H1WA 1CXEA 3C0JA 4GY1A 1PIFA 3URNA 4ZTXA 1RUSA 3TTYA 2OODA 4DROA 4JDBA 1EJTC 2HEJA 2V8ZA 3HG5A 3UPWA 2I16A 3GHSA 3KBVA 1W31A 5G2IA 1VGAA 2YDQA 3MDYB 1LWHA 2O7SA 3AICA 1KBBA 4C6PA 2WLZA 3EDJA 3WH7A 1ZJBA 3FYOA 1YNYA 3ODKA 1Q63A 3MZ2A 3GH5A 2ACRA 1GVSA 2OXNA 2D9FA 1X8CA 4LVBA 3UQIA 2FIQA 1NH6A 3KVLA 3KS5A 3NZQA 4FNQA 1A5MC 4ZSTA 2GSJA 1PS9A 2VX4A 1X1ZA 4XBSA 2BMBA 2ETNA 4DH0A 1F74A 2GQ3A 5AYXA 2O9TA 3ES8A 3IGHX 4M3PA 3L2LA 2DT0A 1ZENA 5TBOA 3CMJA 3GU1A 4E2OA 2C71A 3T1GA 1HG3A 1XSIA 1E6PA 3LNMA 4ZPVR 1F3XA 1M7JA 1JCTA 3WQEA 3DCPA 3EOUA 3RDKA 1A47A 4AIEA 4JFIA 1OGSA 4C6CA 3QHOA 3ZT5A 4XIMA 1AODA 3OIXA 2A7NA 3TKFA 3IJIA 1PSCA 1ZBCA 2HQAA 2Y7DA 4QBXA 3W3OA 5HK4A 1EUNA 1QWKA 3UG5A 3WF0A 1TV7A 1J96A 3NXFA 2F23A 4U85A 1QNSA 5JIPA 3WLSA 2OSYA 4J3SA 1CGVA 4AMAA 3VCNA 4RNIA 3AXXA 3LU2A 2NSOA 2TSYA 3N2XA 2H6RA 5BWAA 3ALGA 3M5YA 4XZWA 1V79A 4R34A 2ZX7A 1AQFA 4IWWA 4I6VA 3S46A 3CT7A 1C90A 1E9LA 1VFOA 4DBDA 4GIAA 4XSMA 4HJWA 3VM7A 3ZR6A 6PTDA 4N19A 2ZUSA 3PAOA 1LBFA 2Z26A 4UTUA 3ABSA 1BF2A 4MDOA 2X41A 3GDTA 5AZ0A 3N17A 4I9MA 5BNKA 4LEQA 1X39A 3SGUA 4L6OA 3VNYA 3R94A 2R91A 1E0UA 3IJ6A 2ZR4A 1D7JA 1GORA 4TVUA 4MFDA 4DHGA 3QMSA 2Z2AA 4GVIA 5C9ZA 4F2UA 1V03A 3W6LA 2WPBA 1EHAA 1A49A 1F8AB 1E5NA 3HPAA 4DXKA 3BAXA 3B40A 4AX6A 4QX4A 1TV8A 4C5YA 4F48A 3VO0A 3OLIA 4XKYA 5AYBA 3NWRA 3BXWA 1QWGA 3GG0A 2RUCA 2PZ0A 1ECEA 1G67A 1QO2A 2OKTA 2AKZA 4GCXA 5A8QA 1VCFA 1XC4A 3LHYA 4BR1A 4GQ0A 4PUWA 1TWZA 3VIJA 1KTBA 2Z6IA 4AWUA 1UYQA 2CLFA 4Z08A 4D1IA 4WXZA 4Q8PA 2ZTJA 5D2XA 1A5LC 1KFCA 5HMDA 5L9FA 1Y7VA 3B9NA 3QV7A 3L66A 4IP5A 1PINA 4B92A 3L4WA 3B4UA 2GWNA 3VNZA 2WNQA 4CEXC 1EP1A 3HIJA 1W3HA 4HU4A 5D2VA 4Q3MA 4N9CA 5CXPA 1QNQA 2DH3A 3TE9A 2R6OA 5BXTA 4OUIA 1Q4NX 4RUBA 1LORA 2PWEA 3W74A 2CCRA 2V2CA 2J8GA 2E6DA 1YDVA 3LMZA 4X60A 3UR2A 2Y61A 1BXCA 4NY2A 2C16A 1ME7A 1JDCA 4HNNA 5BXJA 3KDOA 4DJEC 1Q6IA 4A21A 1TCDA 3BO9A 5FF7A 2M2AA 3SM0A 3CUZA 4AZHA 1GKPA 1ZBWA 1KCLA 2VFIA 4CCDA 2X1SA 4CNTA 2CLHA 4IMFA 1SVDA 4H7VA 2I14A 2VX7A 3ZLHA 3BG9A 1UP0A 4R0XA 1Z89A 3OG2A 3U2EA 2R9RA 5IHSA 2BS9A 4Y8FA 4K1GA 4PUDA 2BY3A 4XAZA 4U33A 4ZB2A 4YU1A 3N34A 2PF8A 5C2CA 3KAFA 4QDPA 4B3KA 1E6QM 4JYFA 3INPA 4BEUA 1Y5WA 3GNOA 3MSGA 2F84A 1KWGA 3ITOA 1GT8A 2QS8A 3TTOA 3EDEA 3HV9A 2P88A 3B8VA 3TOPA 4BQ5A 1Y0EA 3AHVA 3GB6A 4PMYA 3POHA 3V3WA 4IP4A 3QQ1A 1XCXA 2Q8ZA 3S6TA 3PSVA 5H8UA 3TQVA 1NDVA 1MDLA 1E0XA 3WDPP 1ISYA 3NA8A 1UJQA 3WH6A 3NYDA 1V0NA 2WM1A 1E4NA 1QI0A 4FOKA 2HV5A 1ZP3A 1E9YB 1Y0OA 2G96A 1GOQA 3ZQ9A 3GWQA 1KXVA 3PP7A 2DT3A 4Y2WA 4B5VA 1SPQA 3PVFA 2WC7A 4NG3A 3UEQA 1DJQA 1E73M 5LA0A 1GVEA 1H7NA 3THUA 4H83A 3TUUA 1FKKA 2PLJA 4CQAA 5H2ZA 1K70A 2E5BA 4MZ8A 3O63A 2G4FA 2ICSA 3G5EA 1G4TA 1U2YA 4O28A 2Z6JA 5HQMA 3STPA 1IF2A 4J3WA 1G69A 1QW7A 2BVDA 1V5XA 4FO4A 3P8JA 2E3ZA 4MJZA 3KOYA 4O1FA 4JYDA 3PR2A 2ODOA 3MB9A 1PWMA 1ZJIA 3M7SA 3KOZA 1H63A 4JD4A 3IS4A 3CU2A 5F2IA 1VBHA 1WV2A 3CAKA 2XGIA 3ARPA 2DVTA 3TYAA 1B6CA 1DL3A 4IUGA 3IIZA 2VX6A 2VZUA 1FCBA 1IGWA 1W56A 1D7KA 2E68A 1A80A 1PZ3A 1XUUA 3PN8A 3M44A 2FHBA 4AHQA 2E5DA 3S6DA 1TX2A 3FHAA 3VD4A 1JZ4A 3NQVA 3MU7A 1EP2A 1XF0A 2A21A 1VJSA 2V3FA 3GC4A 1BVWA 3AXHA 1W1PA 3CGNA 3W7PA 1WKYA 3ISIX 3VDAA 4C91A 3VAWA 3THQA 5I07A 1TTPA 2VEPA 1UIPA 4ZCWA 1ZLPA 3GFXA 3KL0A 4OGZA 1UWRA 2PDYA 4HZMA 1BRLA 5LGZA 3BG5A 4ERIA 3TN4A 4DPPA 4HTYA 2C91A 2ITKA 2BHUA 3EWDA 2GJXA 1JCLA 3EWBX 1KT0A 3AOFA 5CAHA 3H6OA 4ACZB 1EPVA 3M0IA 4Z1AA 1V0LA 3UJEA 3R4IA 3AXIA 4PRWA 4Z2GA 4UTWA 1DORA 4UQAA 3GVGA 3VE9A 4D6FA 4HPHA 2R14A 1K4GA 3RAOA 3AXKA 3R0DA 1VPXA 4IM4A 4MMWA 4JHOA 1R5YA 1QBAA 5M17A 3VD7A 4EPDC 4WJ8A 1H5YA 4AY7A 1T0OA 1OJXA 5DCDA 1LQ0A 7REQA 4ALDA 5HULA 1I2OA 4X61A 5C71A 1F8IA 1TPVA 2ZADA 2PGEA 3FN9A 5KEZA 5ENLA 4Q4SA 5BXPA 2OQLA 4ICNA 2C13A 4TMCA 1B3WA 2CHNA 1BKHA 1CYGA 1XGDA 3W1RA 3CLMA 1W9BM 3LB0A 3GIPA 3SRFA 1ICPA 1W6TA 1E4IA 3QR3A 4GY0A 4CCEA 2ZKMX 3NI6A 1TUFA 3RHGA 2OX4A 4R3UA 4GI6A 4CCCA 4Y6GA 3HPZA 2CWXA 3SO7A 2YL6A 2I7GA 4HA3A 5BXSA 5A2AA 2RUQA 4E38A 3M0XA 4L3NA 2WMFA 4WKFA 2VUNA 1QAPA 3PTKA 2HE5A 4J28A 3GXFA 2Q8LA 3RX2A 1EX5A 3R0KA 3L5MA 4LYRA 5G1TA 3G1YA 2BFGA 3H70A 4RL3A 1S5WA 2REQA 1HF6A 3N4AA 1AH0A 4CVUA 3S2CA 3LERA 3VXGA 2E77A 5C55A 2NQZA 5FAJA 4UOZA 4AC7C 5EU9A 1EB3A 3BLIA 3OLGA 2BVWA 3G1XA 3EWYA 3KZ7A 5GNXA 2H9AA 3ZSSA 1OCJA 1ZU8A 2F7FA 2CLKA 1H1NA 2Z1KA 5F4WA 3UI4A 3ARRA 3KM8A 1V7AA 2CLLA 1C92A 2Y89A 1V6UA 3DI1A 3VIGA 4X9SA 3U2ZA 2VCDA 1O1HA 3LUOA 3EDDA 2RKXA 2ZQUA 4QLJA 1Q6CA 1RLCL 4G6CA 3EIPA 5IHRA 5EA9A 4ODLA 4LUSB 2OJPA 5KZEA 1R3WA 2ZZ1A 2ISDA 3LLFA 4L4OA 2V81A 4GYJA 4FX6M 2JIEA 1SQ7A 3NQ8A 3EWZA 5D4YA 3WQOA 1D8WA 4Q8WA 1NP2A 3CTLA 3MUY1 1J18A 2XIJA 3UWZA 5E09A 2XWDA 3KBSA 1ADDA 3PZTA 1QBBA 3HQ1A 4AQLA 1XYZA 2POZA 5EFDA 3GYCA 3NOEA 3ITLA 3T2OA 1KW1A 4QFUA 3PA7A 1XIHA 4XD4A 3N3MA 4GRSA 3UVIA 1GG0A 1YADA 1JYXA 2X0HA 3P62A 4UTTC 1C91A 3BGGA 4HHHA 2V67A 2VR5A 1AL8A 1DIDA 1U5HA 2C19A 4E3TA 1R30A 2GK1A 2V5LA 3MJYA 1LROA 1XC6A 3W1LA 3AIRA 4HBOA 4DWSC 2MLZA 5G2WA 5I6SA 4S2BA 1A53A 3AAMA 3P82A 4YCPA 1YYAA 3IARA 1NDZA 4RZ4A 2C3ZA 5JH8A 2DQWA 4M6VA 4L6HA 3N04A 2WK2A 3RM9A 1ZHAA 4MSPA 4DWSD 1KTCA 4HN8A 2O9OA 4ZFCA 4A8LA 4BEQA 4UC5A 1E71M 2A1YA 1IWPA 1E6SM 2PFHA 2HISA 3Q67A 2QULA 4D6GA 3WFLA 1VP5A 1QOQA 1ISZA 2WZMA 4XO6A 4C1NB 1IIHA 4D6EA 1ZCNA 2YYTA 3RFAA 4IGMA 1V3MA 3TCZA 5LXEA 1EYWA 1P1XA 1Z32X 3CJPA 3P60A 1OADA 2AOSA 4QJ5B 4XWUA 3UQNA 4ZQNA 3QYSA 3LD5A 1EBHA 2A3EA 1JD9A 3A4WA 1CPUA 2QCFA 4R88A 1AVAA 1NJJA 1NVMA 3MQTA 4PRTA 4NAEA 1RJPA 2VNCA 2B0MA 2SFPA 1N2VA 1R86A 4GVHA 3ABOA 4FIQA 4NU7A 3AYSA 3GG1A 2Y4SA 2VR4A 4H01A 3ZO9A 5HNTA 4WJXA 5CLWA 3CWNA 2C8NA 1ZBKA 2J74A 2YDSA 3HF3A 1GKQA 4F0RA 4F0MA 5LKYA 1PKLA 2YCLB 3LDVA 4UTFA 4C6DA 2WOQA 4DJDD 3W2NA 4DX3A 1HW6A 1XINA 3QH2A 2PWFA 4AZCA 1PB0A 2HWGA 4WXYA 3FIGA 3IIXA 5J04A 1XH0A 1NDWA 3T07A 1J4IA 1S5VA 3P93A 3Q45A 1J6PA 9XIMA 4FXRA 1YXCA 4MADA 2GLKA 3NQAA 3RO6A 4AIOA 3Q37A 4DZ2A 1W17A 1UASA 2P8CA 5XINA 4GO8A 1RP9A 4AHPA 3GX9A 2CETA 3WLRA 1QNPA 3GTFA 1TPB1 2BOGX 3CUFA 1IIGA 3AIWA 1QI3A 5HW7A 3LX9A 4OU1A 2ADAA 5D9NA 1GNXA 4R7OA 2NV1A 3CQJA 4IFKA 5IFPA 1XSJA 4S3DA 3SCQA 1W5QA 2AKMA 3W70A 3F4CA 3W85A 1XLLA 3W7LA 5JUVA 4KQZA 2VRJA 2YXOA 3OZYA 1YLVA 4Q8VA 4ROPA 4ZR8A 3RN6A 1AW2A 3PZVA 3OHMB 2W5FA 3QXBA 4CEUC 4PH6A 2QCHA 3CMGA 7CGTA 2DW7A 4W9TA 2VVSA 1SU5A 3UWUA 4DRIA 3N2TA 4K2SA 3QZAA 4S38A 4TV5A 3SCTA 2Y24A 3UP8A 1Q8JA 3VE7A 2X2YA 2ON3A 1LL4A 3OLDA 3S4TA 1B54A 4M7TA 2DH2A 3SCWA 2QDHA 5CSRA 5KZ6A 3KOFA 4AW7A 2XFWA 3W71A 4TTUA 1UW9A 4XZHA 4Z2IA 1N8WA 2HRWA 4E8DA 5A6BA 4IX2A 5FIPA 2ZRXA 4PYSA 3V5OA 3CGTA 3ANUA 2QT3A 5AHNA 3VIHA 4K36A 5LNVA 3ID7A 3KWXA 1EGMA 4NILA 2YBUA 4AD1A 4PMVA 1XLKA 1K7XA 3F4VA 1LJYA 2QJJA 4GYFA 4U2ZA 1W1VA 2ZUMA 1VRDA 3VTRA 1KM6A 4LAZA 3N1AA 2Z27A 4IPNB 4HK5A 2FVKA 3ZLFA 5DY2A 4PC8A 1EEPA 2WVVB 4HPXA 4HP5A 5I3JA 1O6IA 4L7ZA 3WDQA 3E12A 3XINA 4DBSA 3IGSA 1WAUA 4UOJA 4IMEA 1W3TA 5GNZA 3NQGA 1DEDA 2YL9A 3QFWA 1JJKA 3BQ5A 3MP5A 3ZS4A 3BANA 5KZMA 2ZRYA 1K7EA 4IJRA 2R8WA 3RIKA 1VPQA 1E56A 1NARA 3HQPA 2KO7A 1HKVA 3DBPA 4E5TA 1BSLA 3PAJA 1BRLB 4MB5A 1VCGA 3S1VA 1TCMA 2PI6A 4LVAA 3WY1A 1NQ6A 3PBUA 4ZQPA 3P0XA 4JTIA 3USZA 2TYSA 4M56A 2XDFA 2OYLA 4DZ3A 1VKFA 2XP6A 2W63A 4L4LA 4PTMA 3CHDA 3T2QA 1WP6A 1LLOA 3VIIA 2AMXA 1DJIA 4NX0A 5A8PA 1IXOA 4W9OA 5DELA 4BWLC 2BSLA 1UWUA 5LIWX 4XQ6A 4NAFA 1A3XA 3BMXA 4KCVA 3O16A 2QJIA 1D3HA 2UV8G 3RRXA 2Z1BA 4LC6A 5HWJA 2RAGA 1UBPC 3RO8A 1ZY9A 2QV4A 4L4MA 3TMLA 3T05A 4XZNX 1MQQA 1JCYA 2ZX6A 5ABFA 2BASA 1AQHA 1QZ2A 1YKWA 3E2QA 1LTDA 2HXTA 3PM6A 2PGFA 3M7WA 4IPLA 2ZUVA 3FYYA 3NQFA 3S47A 4E2DA 4O54A 3SECA 3EDKA 1Q6LA 5E5CA 3W24A 3NRKA 1Q45A 1ZK6A 3ERPA 5E9XA 1SFSA 1O12A 4OV9A 4L1XA 3ZWSA 3HURA 3DYPA 3CAWA 1D8CA 4BF7A 2PEVA 2BLEA 3F5LA 4GBUA 4JTSA 1OD8A 4E4UA 3NM1A 4AWEA 1MUCA 2REQB 2XVNA 3AZTA 3SDOA 2PGRA 3CYJA 3EKGA 2VENA 2DG3A 2I5GA 2P5NA 4US5A 2DIEA 2L2SA 5DQPA 3V1PA 3RXZA 3LBOA 4XTDA 4MSSA 4DF0A 3R8RA 3USBA 5B8IC 2NX3A 3UR7A 1UA7A 5GJPA 2WAGA 5LA2A 3WQWA 2PS2A 3CT2A 1OF6A 1IX5A 5EFFA 4AB4A 1R9HA 4DN1A 3CTTA 3BLEA 1XRSA 5D2WA 5JVLA 4RV8A 3L4ZA 1JCHB 3TOYA 5JIWA 4UFLA 2KGJA 1YPIA 2PMQA 2OLSA 2PC4A 4JIEA 5TNVA 3GVVA 2ALDA 1KXHA 1Q2RA 5F1UA 1SZFA 4K8EA 5JH2A 2XZ9A 3O5GA 3K30A 3WDRA 1KFLA 5A3HA 4FEZA 3HPFA 2JF6A 3IUDA 3L5AA 2P0OA 1S2CA 4Q4OA 4KEVA 4DRJA 1E15A 3S83A 3TA9A 4QNWA 2MLXA 3RCMA 1X1NA 3THAA 1KM0A 3FDGA 3JYMA 4CUCA 1UR2A 1M3UA 3ZM8A 1UG6A 3UCQA 2NQJA 4Z17A 4LRSA 4G9PA 1OM0A 4OFCA 3QY8A 3VC5A 1K77A 2WHJA 1VEPA 4QR6A 3N2OA 1SJBA 1VAHA 3C6CA 1WKFA 4OQVA 3QBUA 4LYQA 4YTQA 5A6JA 2VJXA 2HK0A 4XAYA 2HDJA 4GI4A 1Q6EA 4H41A 3MBDA 3EMQA 4PMXA 3WLLA 3N19B 1KRMA 3CZJA 4ZXOA 2R82A 2ZX8A 3W7GA 4LBUA 1AQ0A 2GUBA 4DLFA 3B0YA 2XN0A 3COTA 4IPIA 3SN4A 3LXCA 4N4PA 4INFA 5LYRA 1CCWB 4JQ2A 2A79A 1OFRA 2QVHA 3KVKA 4V1XA 2YFNA 1PKMA 2GUYA 3K13A 2VCAA 4GUGA 1XPGA 5LIYX 2PLKA 1E6NA 2FKEA 1EXPA 2HBVA 2WSQA 4K39A 3GPKA 4WD0A 5CJMA 1AA1B 3D47A 4PULA 2WKJA 2P3EA 4NT0A 3FK4A 1PO9A 3T81A 4ODQA 5D38A 5HPOA 1UOZA 1VLIA 1U5VA 4GQGA 1HFBA 4DJFC 3SIZA 4M8UA 1B90A 4L72B 3TAOA 5FJJA 3VIFA 3D3FA 4MJ2A 3O5RA 4HU0A 1ONRA 1PX3A 2OGJA 2XVLA 4JYEA 3WQ8A 1XH1A 4ENLA 5FSDC 1WBJA 4GIRA 2V3GA 1XIGA 4DJFD 2MPHA 1IXNA 3CHFA 4XD6A 1XM3A 5I23A 4ZB0A 4EKJA 1IZKA 3PZGA 4AYSA 3HGSA 5I78A 2VVNA 4Q4QA 5CJNA 3EWXA 3AROA 4Q33A 3RUBL 3UXLA 3V18A 1S1PA 4KR0B 4JX4A 4ZQMA 5T9BG 4NAEB 5C0QA 4AZIA 1QK2A 3PUEA 4MM1A 1A5AA 4U4MA 3CH0A 4S3FA 2VZVA 4BKNA 1GVQA 1EPXA 3ONCA 3SQSA 1SJAA 1CGUA 4CD6A 2OLHA 4HARA 1TWSA 1TV5A 3LCGA 2ZICA 4PSPA 1A5OC 4MUPA 4LBRA 1XP3A 1LUCA 2PAJA 4R85A 2DSZA 5CC3A 1AG1O 2G95A 1Q2SA 3DFTA 3EOOA 2VT0A 4M5PA 4AZCB 3STCA 3VIPA 2C0AA 1UUQA 4B9YA 3FAXA 5I24A 1W1B1 3OGSA 1LDCA 2CPUA 4GC3A 1XKYA 4YWSA 3W82A 3C3UA 5C8BB 3TDFA 4KCTA 2QDGA 4ROQA 3I68A 4MWAB 3AJXA 4C1LA 4PMRA 2WKLA 4I90A 1NF0A 3SY5A 4U5IA 3UJRA 3PG9A 2E6FA 5EL1A 1GQKA 1MXGA 1K6AA 6A3HA 3CUGA 1GOOA 5BCAA 4D8ZA 1V6WA 4GE8A 3KAOA 4O14A 1VF8A 3NPUA 2I5QA 4IG2A 2TAAA 2R1PA 4IIBA 3VIMA 3W9ZA 3W0KA 1XFCA 1AL7A 4UB9A 5A2CA 4P7LA 5HJLA 5FF3A 2QR6A 2DUZA 1PKYA 5F2LA 3W25A 5EKYA 4D8LA 1XGZA 2PRHA 1VJZA 1S5NA 3QYQA 2BP1A 2VFFA 1ALDA 1NOWA 2JKEA 3VAVA 3WJYA 1Q6OA 1VFFA 3C0LA 2ZQSA 4FN2A 1W9DM 4PCTA 4EOUA 4GYKA 2CLMA 2DP3A 1TMQA 3W86A 1GG1A 5FEZA 3TJ4A 3NL5A 5J6EA 3VUSA 2R1NA 2W0UA 4F2BA 4HNVA 3W2JA 2JK2A 3BZGA 1X97A 1GEQA 1FHVA 1FKSA 3OHIA 4HBEA 3O8AA 5MF5A 1A0EA 1M68A 3R25A 2NX9A 3BL3A 3H8AA 4OV4A 2FMOA 3OIHA 1US2A 1M7PA 1KM2A 3BAKA 1VBJA 4XVDA 1S2UA 2OWCA 3N29A 4UTJA 2YGYA 1P6WA 3NDYA 1US3A 1TPC1 1OT1A 2PDLA 3GDKA 4IL2A 4V27A 4JCMA 1DWGM 4P8VA 3QPYA 4KWOA 2BY2A 1KRBC 5DFAA 1XCWA 1Q7MA 1NWTA 3Q65A 2ZVRA 4L65A 4MF4A 1IR2A 2QIWA 4KS0A 4DRHA 1JPKA 3RJXA 2XIIA 2FPTA 3F4NA 3VA8A 2CZVA 2J7CA 1A4LA 1A5CA 4MZ1A 4W9PA 5BZAA 1FCVA 4YTRA 2WSKA 4M6UA 4IPJA 1TE6A 1U22A 4LC8A 3OZMA 6TIMA 4URIA 4NXSA 3NPXA 2WMGA 3MUCA 4ZO8A 2ZUUA 1K9FA 4CNNA 3OEXA 4CD5A 2DSVA 1Z48A 3MCNA 3NPWA 1XIJA 3RNDA 3KZPA 4CGTA 2GQAA 2AQVA 3KE0A 2OFNA 1ZB5A 3EWWA 4B4HA 1V77A 2ZDRA 3FAWA 1KBKA 3NZRA 3AWNA 1TIMA 2A3BA 5D2YA 1DXIA 4FLSA 3CIWA 4GY7A 2VI0A 1PXGA 4XVEA 4J3VA 3HV8A 1FDJA 4LANA 2GVYA 5A8OA 2OT1A 4NNRA 1O94A 4DELA 4B5TA 3LMYA 4D2JA 3NFUA 4DRPA 5AKQA 1US0A 4K6AA 1R85A 4RCXA 3MSYA 5CZ0A 4TMBA 4NAFB 3R12A 4PBEA 3EA3A 3UCCA 3W00A 4QLKA 3VC6A 4HK7A 3CO8A 1JQVA 1HL9A 3PZUA 2XFYA 1K3UA 1UD5A 3AI0A 4L1GA 1H7WA 1D6OA 5BW6A 3EX2A 1MQPA 3BLFA 3HFYA 2TPSA 2PGWA 3AIQA 3UR5A 3VVGA 2Y88A 1UQYA 1KQZA 1T40A 2QYGA 4IMDA 2Z1SA 3G1SA 1GHSA 4CD4A 2ZQVA 1DOSA 1NFGA 2X0YA 4D8AA 5HUAA 1YEYA 4NI3A 5REQB 1RK6A 1JNEA 3WX7A 1UC4A 3P14A 4KF1A 4NZCA 3SRDA 4AD3A 4W8AA 4QG6A 3C4UA 3WO8A 4RNHA 5B7YA 1FKDA 1ODZA 1F73A 3CV2A 1HKMA 1CLKA 1BD0A 4GH3A 4J3XA 4A8RA 4AG0A 1HXVA 3H24A 2XFFA 4UTHA 4AH7A 5KETA 1C8YA 5CGMA 3S2NA 3AS3A 1UP3A 3A13A 4M7SA 3MBFA 4U28A 3I3EA 2XIMA 4WJEA 2ZA2A 4S3GA 4A3YA 3STEA 3EOLA 2BODX 3VOHA 2C0HA 1SZNA 4P7NA 4ZMGA 4F66A 3VFCA 2VOTA 1JZ2A 3T0TA 1PBKA 2ONEA 4F3HA 5DBTA 4EK7A 2UBPC 4LT9A 4NZ3A 4RXFA 1OSEA 4YXGA 3NTPA 1NOUA 3APYA 3GVRA 4XAKA 1JCMP 3S0CA 4GLEA 4QISA 1H62A 1O95A 2B7OA 3I6EA 1TO3A 4J2MA 1C9HA 2VDIA 3C8FA 1F7BA 3RPDA 2X1RA 2FZDA 2CFFA 2WJFA 3LI0A 3CUHA 3PPHA 1P5QA 2A3LA 4LAYA 4NUWA 2JGQA 1PCWA 4NX5A 3WUEA 1UUOA 4H9VA 4M0XA 2PDXA 1U83A 2E25A 5A6LA 1BYAA 3FGCB 4YVXA 4B2DA 3HBLA 4ZOEA 1H3GA 1UPPA 2F6XA 5FF0A 3SN1A 3HJEA 3C2EA 4DZHA 2NLYA 5GJMA 2E1DA 4ZE4A 2UY4A 2O7QA 4GVFA 3I3DA 4QTGA 2PV1A 3CV7A 4YPJA 3WH5A 2OT0A 5D30A 2JEPA 5FJPA 2OEMA 3MS8A 2HBXA 4QHRA 4PL1A 2OTDA 1R2SA 2QMJA 1KKOA 3CEUA 2YW3A 3KHDA 4DWDA 4BQ3A 3AU2A 5DITA 2XM2A 2QLYA 4W85A 4K7VA 2ZCGA 3SURA 1CX9A 4IZGA 3PZIA 3PJWA 4E2VA 2X8RA 5DMMA 5XIMA 1H5VA 2ZR6A 2E09A 5C70A 4HHPA 3NQ7A 3IAPA 3TDBA 3EYPA 4I3GA 3BAWA 4KPLA 1E44A 3O5QA 3EB4A 1E3XA 1S2WA 3TWBA 2GVGA 3AFBA 5C9UA 1SJDA 4HSHA 2AAAA 1VENA 2VTFA 3EB3A 1VFHA 1WZLA 3N6QA 2PBCA 3C56A 1XG3A 3FX4A 2VEKA 3B7XA 3T8QA 5FEXA 1E51A 4NP7A 3CEPA 2FQIA 5CKSA 4RZ5A 4X2RA 3SCPA 2VEMA 2PD9A 2NVDA 3TONA 3OGRA 3MDWA 1JQXA 3MTWA 4MAZA 1BKSA 3IGUA 3H2AA 1F8MA 2NX1A 1LM1A 4HNTA 4UTIA 4N9EA 3BLOA 3AUOA 1I0DA 1KR0A 4ADUA 4JDYA 1DYSA 1H1YA 3QF0A 5KINA 2ZQ0A 2ISSA 1JAKA 1WAWA 8XIMA 3BK0A 2WSYA 4NZ4A 1H0IA 3WL0A 4CD8A 2CXEA 1B0IA 2GVJA 4GGBA 1EJVC 1BLIA 1H49A 3GU9A 4O1BA 4I9JA 2AQOA 4JN7A 2AAMA 1OIFA 4RR4A 1MW1A 2AGKA 2D69A 4EACA 2NV2A 2PBOA 1S2TA 5D9MA 2VGGA 2EKCA 3WK2A 3BPWA 4O4WA 3QHMA 3APTA 2EG6A 2FH6A 4M6QA 1B9BA 4RK8A 1XLHA 5DANA 1FWCC 2YA1A 4QEHA 3B9EA 4GIYA 4WUIA 3F5KA 3RCNA 3W73A 5BRPA 3HOJA 1LUCB 4GIVA 4H9XA 4MHBA 5A6KA 2YW4A 4JL1A 4QQUA 5HBFA 1EXBA 4MNKA 4U3AA 1MNZA 5AC6A 5FJOA 2Y8UA 3BQ6A 1LL7A 5A94A 1W54A 3BH4A 4AYGA 4EVZA 3W1UA 5LHEA 1NIUA 5FESA 4LEFA 1W3NA 3N4FA 4LW7A 3UD6A 2JZVA 3UQBA 3NDZA 2NLIA 3I4EA 3CPUA 4LX4A 2ZZ3A 3TR9A 4JY8A 3M16A 4XK2A 2PU0A 3FKKA 3FVDA 3W2UA 1RCXB 4F0KA 1J6YA 3SB0A 1ITXA 2XINA 3SFWA 2IKGA 2WMJA 3BCFA 4AF0B 5BYWA 4IP7A 3QVQA 1HNYA 2E40A 2QGHA 4Y90A 1MXDA 5C6MA 4WK9A 3BTNA 2PWDA 3VNMA 4KERA 2WSPA 2IF4A 4H7ZA 1WZKA 1HKKA 3EPOA 3G0SA 1A50A 4UDMA 4XBJA 4Q4PA 4IG2B 3ARZA 3ITCA 4HNOA 3S2JA 3IVSA 3S2LA 3UXIA 3OVGA 1IV8A 3P0WA 4PMJA 4UWMA 3WF1A 3ZVHB 3CZGA 2GFTA 1M1BA 2CESA 3BMWA 3QLLA 4NNAA 2QJNA 4GNVA 3E5PA 4OE7A 1E55A 1RBLA 2DG9A 1ENUA 4CLMA 4DAIA 1EGZA 3ITGA 1FKXA 3IIPA 4GI9A 2PWUA 1JXKA 4MZYA 3C2YA 4I5UA 2V5KA 3MCMA 4OT7A 1P7TB 3AUJA 3QGAC 2QAPA 4DJDA 4F0LA 4HT3A 3FHQA 2VXNA 2QNEA 1OCNA 1KA9F 4FR6A 4FK9A 4ODPA 1NTHA 3LPPA 2PDCA 3IPWA 1E1CA 4QG8A 4Q32A 3NQ6A 3F4WA 3NSMA 3WLQA 3IJLA 3VGGA 3PPFA 3WLJA 3TTEA 1EWDA 3FKRA 4AXNA 2YDAA 3GHRA 5D37A 4YWIA 1BPLB 4EPKA 5CZJA 2I17A 1VB9A 5FJTA 4QJ4B 5HNUA 4RZBA 3VGDA 3RPTA 4DRKA 4R33A 3DX5A 2XIBA 2ZRWA 5AHLA 3K1DA 1UH4A 1UD4A 1JI2A 1BXBA 1CW2A 3ECQA 1F40A 2P53A 3AIEA 4NRRA 1B31A 4GHRA 3BZJA 4NZ5A 3H2CA 3EX4A 1U5JA 1FY6A 5KTLA 1OC6A 4RXGA 4RX0A 1ZNNA 3MSRA 4EP8C 2RDTA 3RRAA 3H55A 3ITVA 4HMEA 1XQKA 1UR4A 2J47A 1MW0A 3ABQA 3NEVA 4OECA 5HNNA 3NAVA 2Y1HA 4RZ6A 4WDWA 1DBTA 3B03A 1X98A 3FAPA 5HQEA 3M5ZA 3PZQA 4DZ5A 2INEA 4G1KA 4O0ZA 3DUGA 1I9CB 1F61A 1B9ZA 3AYVA 1VEOA 2VGBA 3E49A 5I03A 4ZPWR 3G6MA 1AD4A 4GABA 1FP9A 2OGYA 4A3UA 2WMHA 3HG2A 4LQ1A 3NO5A 4KCUA 1OG6A 1IEIA 4XUYA 1QI2A 3CUIA 2BDQA 3MA8A 2QDEA 2Y8VA 4QCFA 2RH9A 1X38A 2NUWA 1NELA 2I9EA 1M65A 2FVLA 5CCZA 3W22A 3ZJ7A 4WF7A 1MO0A 4NJJA 1IYXA 2F2DA 1FRBA 1TELA 4C6BA 1CXKA 4GQBA 1JNTA 3L0KA 4EAYA 2VP8A 4Q6XA 4GO9A 3SQMA 3H54A 3BCDA 2CIPA 5DMNA 4EF9A 2PP1A 1ZZMA 3LG3A 1K9TA 1UIOA 4L9YA 3EMZA 1FDZA 9RUBA 3FSUA 3GW0A 4MNMA 2WO5A 4TYOA 3TYCA 4MYXA 4GA8A 2YJQA 4S3AA 1GQNA 1QNRA 4PCPA 1K6WA 4LCRA 4ORIA 4UFMA 1V3KA 1O1ZA 3W38A 1EUAA 1W2PA 2UY3A 3HZ3A 1R3YA 1Z6KA 5AHEA 3WNLA 5XIAA 3KACA 3L0NA 2ZWZA 3GKAA 4B5NA 4KFOA 2VRKA 3WQ5A 5FF4A 1JNSA 3ZSTA 3MWAA 4ZB5A 3WNMA 5C9WA 1Q3NA 1KFEA 2BXYA 1F6KA 1XLGA 1RD6A 1ZAJA 2EGZA 2DIKA 1XICA 4FLRA 2PTDA 1PIGA 2NQ9A 2AMGA 1I2PA 1PV8A 2JKPA 1ESWA 5E0FA 4JTLA 4K3ZA 1TSIA 4JIQA 4WR3A 5FJRA 5CSUA 2CU0A 1ECQA 3LBMA 5ECUA 2ANUA 4X9YA 2QEZA 2V2HA 3MMTA 1TJ0A 2OLAA 3URQA 1IZCA 3B8WA 4U10A 3DFNA 1TB3A 3WZ0E 5HWMA 3B0VC 2D0FA 3G1VA 1GYMA 1FCQA 3AMLA 1WUEA 3QFEA 2V5CA 2PP3A 2X7VA 4BFAA 3VNLA 3WD3A 4HZ7A 3A4JA 2J62A 2DORA 2MNRA 3NVTA 1WOAA 1BAGA 4N4QA 2VD9A 2NXIA 3QQWA 3GSMA 3EPMA 2XHYA 5CSYA 2D73A 4LAUA 2Z29A 3TK7A 3TN3A 2XFRA 4QIUA 3M1ZA 2B7PA 3OGVA 4Z2KA 1IT0A 2ZZ7A 3LTYA 1L8PA 1ODUA 3E2VA 1FWHC 1O5QA 3LA4A 1FWNA 5G4EA 3BJSA 2WM0A 1HP5A 3WEMA 3NQMA 2F6KA 4QROA 1YQ2A 2WZIA 2EF9A 2OFJA 2QMKA 2YL8A 4LVGA 4A2RA 3LEPA 3TR2A 1ISWA 1KV8A 5HJYA 1TMHA 4QXIA 2VELA 3S3GA 1W1A1 2D20A 3S9IA 1FHDA 3QR0A 4LV4A 2CZ5A 4LRTA 3OA5A 3O0FA 4PBGA 2XIOA 2KZHA 4PMNA 3O05A 1P4CA 1YDYA 3ELFA 1V6TA 1K8YA 4KRUA 3NL2A 4DYKA 4Q8MA 4CU7A 2O4MA 1KGXA 3VGBA 2QGYA 5FKYA 4JNMA 1HVQA 4YMZA 4DO5A 3CWOX 3THDA 3FCPA 3L2MA 3UQAA 1VFLA 2JF7A 2B7QA 2PDNA 3GFYA 5GQBA 3VOJA 4JY9A 3L4YA 2CBUA 3O0KA 2FZ8A 1Q6GA 2OWXA 1T96A 4FLQA 2E9MA 4WOZA 1SW3A 2HNHA 1GEHA 5A5WA 3WK1A 3GS6A 1MQRA 1QJWA 1DWFM 1CXLA 5E1QA 3NQCA 4G1NA 4EXQA 1OFDA 1CGTA 3B0UX 4M24A 4XB3A 5GPRA 1SZRA 3FXGA 3CQHA 3AHXA 4GUJA 1ROUA 3W6MA 3REQA 2VM8A 2Q71A 1FKRA 4UNLA 1ZUAX 4L9ZA 5E6YA 2HE8A 2RFGA 4DO7A 2PUZA 4TX6A 4FSAA 4JFSA 5AYYA 4PUUA 5EPDA 2WMIB 3PF3A 1HUVA 1FKBA 2KAUC 3LUTA 3LXBA 1OX5A 4AVFA 2ZZ5A 2XVGA 1NP0A 2Z0IA 5A69A 4H8HA 2FDMA 1MWOA 4YYFA 1FWFC 3UNTA 2V3EA 1JZ3A 1TX0A 4TVCA 1W1ZA 4RKAA 1NQKA 1TJPA 1TZ7A 3WEZA 1UHVA 3EB2A 3N13A 2PWHA 4F9DA 1RHCA 2NVAA 3W7JA 1ROTA 1BWKA 4D6DA 3SUSA 4X2PA 5K2ZA 3M9YA 3FVMA 4W5ZA 3WNOA 3BMVA 3SUTA 4UMAA 3M0JA 3TAKA 2DT1A 3LHZA 2RDWA 2OX1A 3NJ3A 3H26A 3PRBA 3GVQA 3U4AA 3G0UA 4JTAA 3A23A 5HWBA 3GXIA 3I65A 3WUBA 4Y7EA 2ZWYA 1RSCA 5F2GA 3LGEA 1W5OA 4XAPA 4CU6A 4DJFA 2VZTA 5BOEA 4LVDA 2R94A 3L0GA 4S2CA 3QV8A 3A4XA 3IUHA 4ML9A 2HNEA 3W7QA 3ARXA 4AZ5A 4V1YA 3BJFA 2RURA 5T9CE 3OB8A 1NFPA 3E3HA 1HQTA 2PDPA 1GW1A 1OIMA 2QF8A 4TX9A 2ZUNA 4IOTA 4L6DA 4GKTA 2CZEA 1L8NA 5AYZA 3DOPA 1HJXA 3SUVA 1NWRA 3T0BA 3FDKA 2O4QA 2INZA 4JTRA 1ADSA 4NJKA 1P0EA 2BHZA 4L61A 3WJXA 5CBJA 2VEFA 4Z1DA 2ALRA 3GO2A 2QCDA 4PEEA 3VD3A 1OINA 4ATLA 4ZTYA 1W91A 4KRZA 5RUBA 5FJUA 3LY0A 3W1TA 4X22A 4JN6A 2EJAA 4PTXA 1L9WA 4Q22A 4JTJA 3E2SA 2GJPA 4B5WA 3SCVA 3UFYA 3KCLA 4LBSA 2A6LA 1OHLA 1JPDX 2BY1A 5LXXA 2IPGA 3H2NA 1WO2A 1OK6A 3VNJA 3N2MA 3WNPA 2VC6A 4AEEA 2NVCA 3O06A 3LV5A 4J2PA 2CITA 3RLUA 3G1RA 1S2AA 1V4YA 4KEMA 2QJGA 3WDJA 4IL0A 2BOFX 3ARYA 1YHTA 2QJHA 3DG3A 2FH8A 4LUJA 2W27A 3L12A 2EO7A 1J2WA 4JX5A 2A0NA 4DRMA 3LENA 1WE5A 3TV8A 1JZ5A 1DXEA 1GYNA 2EPMX 1QW9A 1L6GA 2K8IA 1F3TA 4PEKA 1QI4A 4MLRA 2PDJA 1DHKA 5FA5A 3VK5A 2W6RA 3WBEA 2Z7GA 3TH6A 4GGQA 2YOCA 4OTKA 2J9ZA 1FWDC 2ISVA 3RITA 3EAUA 4O15A 4B91A 3KBMA 2A3AA 4GXMA 4UBPC 2BY0A 3N73A 1KCZA 3UF9A 1G