1HKKA

High resoultion crystal structure of human chitinase in complex with allosamidin
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
364
structure length
364
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEQSGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Allosamidin Derivatives in Complex with Human Macrophage Chitinase.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords CHITOTRIOSIDASE-1
total genus 132
structure length 364
sequence length 364
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1hkkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hkkA01
1R7AA 4MJ4A 1E0VA 6TAAA 3VMPA 4DM1A 3AHXA 1OGGA 4MTVA 1E0XA 1KQZA 3NJ3A 5I24A 4BQ5A 4UOZA 1QNQA 1E5NA 5EFDA 4ACYA 3FN9A 1UWSA 4DUXA 3AMKA 1J01A 3AHZA 2PWEA 3KL0A 2XVNA 1UWTA 4NF7A 4AZ6A 3AYSA 1RP9A 5EMYA 4HPHA 3WNMA 2EEXA 1UQZA 1E4NA 2DQXA 3VIFA 1B3WA 3SCWA 3RIKA 4KRUA 4MPKA 2WSPA 1ISYA 3PBGA 3QR3A 4FMVA 3OG2A 1W2VA 2VJXA 2XGBA 2AOSA 2VCCA 1B3ZA 2QMJA 1FP8A 4KMQA 4ATWA 1XC6A 5A8MA 3QOMA 2WMIB 3VNYA 5DEZA 3ZR6A 4J28A 1JYNA 2A3EA 4OJYA 1UHVA 1JI2A 1ECEA 4UFJA 4X0NA 1KGUA 3EDEA 2MANA 1PAMA 3W25A 3AMDA 3ARYA 3TTSA 3KZSA 3BH4A 3O9NA 5EFFA 1KWKA 1XYFA 1OGBA 4J27A 5DF0A 4Z2GA 4IISA 1JZ5A 1J12A 1CGUA 3AHTA 1HJXA 2QHAA 2YA1A 1G01A 2BXZA 1GVIA 4P8VA 2DSKA 3BAJA 3SCPA 3CMGA 3A4AA 1OT2A 2VURA 2CNCA 1KCLA 4V27A 1JYVA 4GZIA 3S2CA 3WUBA 4M80A 1E6ZA 2VX4A 2DDXA 2NT0A 3WEOA 4E8CA 5CXPA 4WIWA 1VB9A 1W9VA 3GYCA 3WD0A 2WLZA 1C7TA 3QHNA 4U5IA 4Z2JA 1GOMA 2VC9A 4CVWA 1MQRA 2V5DA 1V6UA 3WFZA 4W84A 4OBRA 1V03A 4W8BA 3K8LA 3SUTA 3AJ7A 1CYGA 2CBIA 2OLHA 1HXJA 5CPQA 2D0GA 3RJXA 1NARA 1H41A 3MSGA 1XGZA 3F5LA 4NI3A 3NUKA 1WKYA 1UZ4A 1X6NA 2ZUMA 5HNNA 3EDJA 2DSZA 4C7GA 1EQPA 4KH2A 1EH9A 2YJQA 1HP4A 3WDHA 4CCDA 2O9RA 3VGBA 3CZ8A 5AC5A 2OWCA 3ZT5A 1CXKA 2ZUUA 3QHMA 3EYPA 1UKPA 3VX1A 1XH1A 1UKOA 2WPGA 3AHVA 1HP5A 2XFRA 1WB0A 1CLXA 2JALA 5LA0A 3WD3A 3AIRA 3SUWA 3CHDA 1E70M 1UWUA 3CZGA 2RGLA 3MKKA 2OYMA 3OZPA 3KL5A 2J79A 3W24A 1FA2A 3VD4A 4P8XA 1V0MA 4PBGA 3NDYA 4GO9A 2ZXQA 4AZGA 3BLPX 5AC4A 5E0CA 4PTXA 4UQEA 1WO2A 2BVTA 2G4FA 3B8SA 3B9AA 3T09A 3A4WA 4FK9A 5C71A 4CU7A 4IUGA 2ZUWA 5A8PA 2D3LA 3BSHA 2VUYA 1ITCA 4GZJA 2IUZA 3FW6A 4M8UA 3B9DA 4AEFA 2Z1KA 4UR9A 4PMOA 4PTWA 1K9EA 1ESWA 4UQAA 5E70A 4MAVA 1JFXA 3IJ9A 1UA3A 1UH2A 2GFTA 1OBAA 3WDIA 1H2JA 2QLYA 1MQPA 5A6AA 4UQCA 2WCSA 1NOUA 3AIEA 5AY7A 2G3MA 1QPKA 4C7FA 2WZHA 2JF7A 1TR1A 2JIWA 1H49A 2ZUTA 3UR8A 3WEMA 3LPPA 4CGTA 3EBVA 1VEPA 4HMCA 2VZVA 2XG9A 3VIJA 1W9BM 3GBDA 2XUCA 1PPIA 2BV9A 1TA3B 5M3WA 6A3HA 3WELA 3DHPA 4PTVA 1KFWA 2VX5A 1V02A 2WANA 1X6LA 1V0LA 5LA1A 4PCSA 3CZJA 1QHPA 1UWQA 2VX7A 4TTUA 3TOPA 4UOJA 1V6WA 2PWDA 1LJYA 3TTYA 4QLKA 1B31A 3CPUA 2CXGA 2WKLA 4JKKA 4XV0A 1GPFA 1HVXA 4HOZA 1UYQA 4QDMA 1O6IA 5FL0A 1E43A 3CUHA 1B9ZA 2E9MA 4JAWA 4PSPA 1DP0A 2OSXA 2VZOA 3U57A 1SMDA 4MNJA 5BXTA 2EJ1A 3UETA 3A6OA 2CBJA 3N15A 1CPUA 1K9FA 1A47A 5FIPA 3AMCA 3AIVA 1J0JA 4LPCA 1M53A 8A3HA 2XIIA 3SCQA 4QCFA 4HOXA 2E8YA 2GJXA 3AZTA 3T2PA 4CUCA 3WQVA 2GK1A 4UZUA 1W32A 1ZBCA 2WHMA 4H7VA 1OINA 4AD3A 3D3AA 5D9OA 3GBEA 4PMNA 2VZTA 2ZICA 3CZEA 5KEZA 3ARRA 3OLIA 1CXIA 1W3JA 3NCOA 2QF8A 4ZE4A 1V0KA 1JGIA 4WF7A 3JUGA 1ZJAA 3PZOA 4IM4A 1ISVA 2QPSA 3ARPA 1OB0A 4JFWA 1H5VA 1V02E 3GTNA 4MADA 1JYXA 3GZAA 1DWIM 1R8LA 3PTKA 5A95A 5DMYA 1UR9A 4AD1A 1RD6A 2DGAA 3UR7A 3WQ4A 1Q6GA 3RM4A 5AYBA 1MYRA 3MO4A 4MDOA 4S3JA 3WF3A 4LQ1A 1EQCA 2J7HA 3AZSA 1HKJA 1OD8A 1HF6A 4KGLA 3K46A 4D6GA 1R86A 1WAWA 3BMWA 5BROA 1TVNA 4CU6A 1H4PA 2BS9A 2UY2A 1G0CA 1VEOA 3WMCA 1WP6A 4IPLA 1LLOA 3IAQA 5BYWA 2WLYA 3SCVA 3MV01 2WVUA 1XD1A 1E5JA 3EDDA 1FFQA 4JFSA 1QOXA 1V08A 4MNKA 1VFFA 1BLIA 2WMGA 1WNOA 2CCRA 3N9KA 3T0AA 4DWSD 1CXLA 3WDRA 4WKFA 1HX0A 4MB3A 2HISA 1UD8A 3QHOA 1V6VA 2BFGA 4ZE5A 3WH8A 4CN1A 4B16A 3SCRA 1V3JA 4DWSB 1Q6CA 3EDFA 2VCBA 4D6IA 1E4IA 4CD8A 1K6AA 2RGMA 1QNOA 1W91A 2ZOXA 4Q7NA 4MB1A 4GI9A 1HNYA 5BXSA 1DWGM 3CIVA 3QOKA 3U5UA 2J47A 2EPKX 1V0NA 1H11A 1NH6A 1BG4A 1TA3A 4RL3A 2AAAA 3AOFA 5LA2A 3WIJA 4B3LA 2OWWA 1BHGA 2VT0A 2OSWA 4PRWA 4BQ4A 4UNIA 2YL8A 2WMFA 1D2KA 1EOMA 4WLCA 4OIFA 5A94A 3WNLA 3ARUA 2J7FA 1W1YA 3IJ7A 2W5FA 3FHQA 2D22A 2J8FA 3WDJA 3AROA 1Q6EA 2E4TA 3MMDA 2ESCA 3VD7A 3L4XA 3BAWA 5CQ1A 2XVLA 4CD5A 5CJ5A 1Y7VA 2FHFA 2X1IA 2XM1A 3WNPA 3ZR5A 3VX0A 3BSGA 2W61A 3K8KA 4Z2HA 1FP9A 4D71A 3PTQA 3OIHA 1BFNA 1E4LA 2GDUA 1JZ2A 3N12A 3VOCA 5EB8A 5HPCA 1OWQA 4PCTA 4PN2A 2V5CA 3AS2A 4XX6A 4AEEA 1NM9A 2Y8KA 4J7RA 1W3KA 4PMVA 1KGXA 4OKDA 3VIKA 3BLKA 1MW0A 1E3XA 2XWDA 3OGRA 1Q6FA 1LQ0A 1JL8A 1PZ3A 2WMKA 3UEQA 5GQBA 1NQ6A 4GINA 5CSYA 3THCA 5IDIA 1MWOA 1DHKA 4JL1A 3W29A 4C7DA 3OLDA 3OB8A 1O7AA 2PF0A 1C92A 3AZRA 1QNRA 1TCMA 3N17A 1WCGA 2GJPA 3BAKA 3IK2A 5ABFA 1R87A 3MUZ1 2XFFA 5A6MA 3AS3A 3WUGA 2DSWA 1V3MA 1B3YA 2GVYA 1PZ2A 3A3HA 2WZIA 3W26A 3CUJA 3MUY1 2PBOA 4AW7A 3ZJ6A 4TX8A 4JL2A 1CZ1A 1BYAA 3EMQA 1GQLA 3CTTA 1BYBA 2E8ZA 3KEHA 1QHZA 1BYCA 2ZXBA 1V6XA 1OSEA 4CN4A 1E1EA 1I75A 1E55A 4Z2KA 3BAXA 2JF6A 5IHRA 5E6ZA 2Y2WA 5JBEA 4DWSC 1XCWA 2OWXA 4LYRA 5A8NA 3SCOA 2YBUA 2AMGA 3ZO9A 2WB5A 4R27A 3T0DA 1UD2A 4GQQA 2WYSA 2ZXDA 1ZJBA 1M01A 4HMEA 1WZMA 1C8XA 2ZX5A 4YHEA 1H0IA 2UY4A 3VD3A 1GHSA 1MVYA 2JE8A 1AQ0A 1U33A 1VIWA 3VU2A 4XZBA 3I3EA 4P7RA 4Y7EA 3UERA 2J25A 5M17A 3THDA 2E3ZA 1QI3A 1ZB5A 1ISWA 5FKYA 2ZUSA 1AVAA 4M29A 1HKMA 3WQWA 1JDDA 1LG2A 1VEMA 3WQ5A 1JZ6A 1JZ8A 4JHZA 2CEQA 4CD6A 1LL4A 3A4XA 2D3NA 2WMHA 3LPOA 5IXEA 1OGSA 4QP0A 4JFTA 2PI6A 2G3IA 2A3HA 4W5UA 2ZX6A 5HOSA 3KWXA 1XSIA 4HTYA 2F8QA 1CENA 1HJQA 3UG5A 2JEPA 1B90A 5D9MA 1E6PA 3EMCA 1FH7A 2XIBA 2V3GA 2ZWYA 3O2LA 5I77A 4EANA 4AZCB 5CLTA 1ZU8A 1J9YA 1EHAA 3F5KA 4UFKA 5A8QA 2G3NA 1YHTA 2WBGA 3B9EA 4L4PA 3VGGA 4JZ5A 2J75A 1BYDA 3W4RA 3WD2A 3ARWA 4AZ7A 1J0IA 4W89A 2ZX8A 1W9UA 1E4MM 1XYZA 4OOUA 5C70A 3TTOA 1HL9A 2CBUA 1K9TA 2Y8VA 1QBBA 1B3VA 4U2ZA 1RPKA 4D6JA 1KGWA 1JXKA 5I6SA 2FH6A 4V2XA 3K8MA 3NDZA 3BAYA 3WUFA 1JG9A 2BVDA 2NW0A 5GNYA 4AIOA 2CHOA 3W53A 4AY1A 1W1VA 1KCKA 1HL8A 4AD0A 4K68A 2DT1A 3GH4A 1J0HA 2X0HA 1QNPA 3VO0A 1VBUA 3UCQA 2X2YA 1WPCA 1OCQA 3BCDA 5I23A 4MNLA 3GNOA 3CGTA 1B1YA 3VTRA 3ZMRA 4U2YA 1HJUA 4WKAA 1XH0A 4HPGA 2DT3A 2VVSA 4UQ9A 5CSUA 1QI4A 1E72M 1JNDA 4AIEA 4WSJA 3T2OA 3WD4A 3WMSA 3SCSA 4H41A 1W2PA 2IXUA 4ZXLA 1HJVA 1WDRA 4H8VA 3W82A 1QW8A 2FH8A 1CBGA 2YA2A 3CH9A 3MUAA 4M82A 3BAIA 3ARXA 3J7HA 4UFIA 1CIUA 3PZ9A 2XHYA 4H2CA 2V3DA 2YLLA 2BVYA 2O9TA 3N04A 1CLVA 5A6KA 1C90A 4LYPA 2Y24A 3W28A 3ARQA 4W85A 1XD0A 1NWTA 4W7WA 3AS1A 1GVYA 4ACZA 5I5RA 4PMYA 2WKGA 4RE4A 4AXNA 1E6NA 1GONA 1WE5A 3AFBA 3GXIA 4JFUA 3SURA 4AZCA 1HN1A 2CESA 4XUYA 3AISA 2C0HA 3BMVA 4XZWA 3FHAA 2WWCA 4Z2LA 2G8ZA 1E9LA 3VPLA 1TG7A 3GXDA 1KXVA 1EA9C 3VGEA 3WL1A 4U31A 1WZKA 3ZSTA 2ZX7A 4U3CA 1SFSA 1EDTA 1GCYA 2E40A 2XGIA 3ECQA 4UZSA 3LPGA 2W91A 1OD0A 3WUEA 5A2AA 4D6EA 5ABHA 2A3BA 1H3GA 3GH7A 1E71M 4J3WA 2E0PA 1JNEA 3AXIA 1MXDA 3MANA 4W86A 4L4OA 1UR0A 3MMUA 1CGWA 2O92A 1JDAA 1G5AA 4F79A 1WZAA 4WK9A 3VIHA 1E0WA 2PWFA 2BHUA 3WMBA 5EBAA 3RDKA 3OA5A 1C8YA 5CGMA 1GOIA 3K1DA 3NSMA 3AYRA 3MV11 2Z1SA 3PN8A 1D3CA 2IXVA 3SCNA 3ZT6A 2X0YA 3L4WA 4ZXOA 3CBWA 1NWSA 3AS0A 1VRXA 5A3HA 2E9LA 4W93A 2C8NA 2JFEX 4M81A 1QNSA 1ZS2A 3RM8A 2BY3A 1AQMA 1B30A 4PEEA 1J10A 4UCFA 4W7VA 5TD4A 3W6MA 2J74A 4BS0A 5A6LA 2WC3A 4OUEA 4F66A 5IFTA 3WKZA 1LL7A 1JFHA 4JKMA 4GI6A 2PWGA 1CEOA 3POCA 4UTFA 5JBFA 3GDBA 2J7EA 4GI8A 4IPNB 4N42A 5CPSA 4BZYA 1UH4A 1GJWA 1H1NA 3PZIA 4URIA 1JAKA 3PZGA 1UH3A 2WK2A 4LYQA 2OYLA 1H0GA 1JZ7A 4ATDA 2ZE0A 4EE9A 1U2YA 1UOKA 3L4UA 4GKLA 1DWJM 1US3A 4JCMA 1UD6A 4UQDA 4D6FA 1F4HA 2YIHA 1UA7A 3LMYA 1UR2A 2DEPA 1MQQA 3I3BA 3O6AA 3DYPA 4JFVA 5ABGA 1TMQA 3M7SA 6CGTA 3PZTA 4BQ3A 3AIBA 2BXYA 2YDQA 3ZJKA 3K4DA 2C7FA 5DFAA 2J7DA 1BG9A 1JDCA 3M46A 3WQ6A 2UY3A 2WBKA 4JKLA 1XH2A 2XJ7A 2DT0A 1VFUA 4HZ7A 3T0BA 5A6BA 1US2A 5CZKA 4FLRA 4TX6A 3N13A 1LF1A 3WSUA 1R85A 2VOTA 4P7QA 4YPJA 1RP8A 2NT1A 1PX8A 3VGFA 4LGXA 2WVVA 4HU0A 1C7SA 2YOCA 2ZX9A 2V3EA 3CHEA 1KB3A 4W5ZA 3VDBA 2EQDA 2F61A 3ZQ9A 1R7OA 3CO4A 4KGJA 3WBEA 3GNPA 3CMJA 1OIMA 1X1NA 1JAEA 5JUVA 3L2MA 2BY1A 4HP5A 2G41A 1NP2A 1C91A 1GUVA 5ECUA 3ARVA 4TOQA 1QBAA 2J62A 3APGA 1G94A 3AICA 2J7BA 2CETA 1GW1A 5M03A 4DUWA 1IZKA 2GDVA 1UWRA 4BCEA 3WY1A 3MUIA 1E40A 3VMOA 5JBDA 2D0HA 5ABEA 5FD0A 3SUSA 4PMXA 3ZT7A 2NSXA 5A6JA 1SR0A 3NSXA 1HIZA 2GJRA 3F4VA 3RMEA 1N82A 3FXYA 3VMNA 4AZHA 1QI2A 3G6MA 1G1YA 5HBFA 2D0FA 1JXJA 1Z32X 1FH9A 2EO7A 2WVTA 3FAWA 1IZJA 2GSJA 4JIEA 2CYGA 2WVSA 5GNZA 1WDQA 2VTFA 4HA3A 4W7UA 1LWHA 5A1AA 2BHZA 3AIQA 1NWUA 4ZENA 4AYSA 4B9YA 2EPNA 4AD5A 1CGYA 4AZIA 3VIIA 3RJYA 4U3AA 4RE3A 3M6DA 4NZCA 4EAMA 3VINA 1VFMA 1W3HA 2TAAA 5GPRA 4D72A 2CPUA 2VQUA 5C8BB 3AIUA 2XSBA 2W63A 3DECA 1B2YA 2G3JA 3IJ8A 4Q22A 4FLOA 1UD4A 5D8ZA 4HA1A 3BCFA 3AIWA 3VDAA 2WCAA 1W9DM 4J3SA 4PMZA 3KL3A 1I1WA 2J8GA 5I3DA 1QVBA 4ZEPA 1TUXA 1XSKA 1KQYA 2WWDA 1E1FA 5HXMA 4EKJA 2EPOA 2WZEA 4PMUA 1L8NA 3N11A 5FOOA 4P8UA 1SMAA 3L4VA 7CGTA 4XB3A 2VO5A 4QCEA 1KXQA 1OIFA 3L4ZA 4AZ5A 1V3LA 3N1AA 2WMJA 2WNWA 3W37A 3POHA 4S3KA 5JH8A 4FF5A 4YN5A 2YLAA 2WVVB 1GZJA 4UFHA 3VM7A 1F4AA 4H8UA 3WBAA 2CHNA 1J11A 3WFLA 3WH6A 3AXHA 3L2LA 3SCTA 5A8OA 1FOBA 4NSBA 1CNVA 3N18A 4H8HA 2VX6A 2VNCA 2XM2A 5CPTA 4F8XA 1NWRA 1SYTA 2VR4A 4D6CA 5AYIA 1W1PA 1GJUA 3W81A 3VGDA 2OSYA 4W88A 3G6LA 3ZM8A 2FHBA 1UKTA 2O9PA 1XHGA 4WKHA 1ZBVA 1J0YA 4D6DA 3WN6A 1CGTA 2CIPA 4HMDA 2VRKA 4M24A 3UG3A 1J18A 4PYSA 5FCZA 2F2HA 4OBSA 3WF0A 1LG1A 4AD2A 1XRVA 1KR1A 5M5DA 3ZIZA 5D9NA 3RO8A 5FL1A 2DIJA 4QFUA 1VFOA 4MAZA 1VBRA 3WH9A 1GOOA 1CTNA 2JEQA 4X0VA 3CUFA 3VILA 3TONA 1BSIA 1BAGA 2V3FA 1M03A 3SIMA 5CG0A 3D5HA 1ISZA 2OYKA 4GIAA 3WDPP 1JYWA 3CZLA 4ATLA 1E56A 4HOWA 2DIEA 1GQIA 1UKSA 5D8WA 2WAGA 1K9DA 4GQRA 4ML4A 5JIWA 1VJZA 4YHGA 3U5YA 2XWEA 2HVMA 4LXFA 4TXEA 4TTGA 3E1F1 3ARZA 1ODZA 4ZFMA 3MS8A 3WEZA 3PZQA 3LPFA 3GNRA 3OLEA 3EDKA 4BA0A 3RILA 4TVDA 2FHCA 3T2QA 1C93A 3VNZA 1PBGA 1FH8A 4CU8A 3DC0A 3GXMA 1BGGA 1DWAM 7A3HA 3A47A 1FFRA 1TZ7A 2D23A 2ZUVA 1DWHM 1QW9A 2W4XA 3OZOA 2VCAA 4W87A 1GOQA 2EPMX 4W8LA 1KXTA 3FAXA 2YDRA 4PSRA 4P7OA 5BRQA 2W92A 4J3XA 5KZ6A 4OOZA 4AISA 2FDMA 1CXHA 7TAAA 1MFUA 1VENA 1Q4NX 1UD5A 3PZVA 1EDQA 5F7UA 2VQTA 4AC1X 1KBBA 2A3AA 4PTMA 2FGLA 4M1RA 1JZ3A 1PX3A 3CLWA 1NOWA 1JI1A 3CUGA 9CGTA 3PZUA 3TA9A 1G9HA 2WHKA 1MXGA 2WC7A 2XTKA 2E9BA 2VMFA 3NYDA 2A3CA 3I3DA 3VDHA 2DSVA 1TE1A 1KBKA 4B9ZA 3VIOA 3HN3A 5BWFA 4ACZB 1B0IA 2GJXB 3VDCA 4MDPA 3AMGA 1XV8A 3RPMA 2V38A 4PMQA 4W8AA 3ALGA 3BGAA 4NRRA 4E2OA 2Y4SA 1JD9A 1WZLA 2ZUNA 4CD7A 1Q6DA 2D20A 4QAWA 3T08A 2WSKA 1LL6A 4UFLA 2VI0A 2PB1A 2WM0A 3AXXA 3PZMA 2WMIA 2VVNA 1GNXA 4TVCA 1GOKA 2CKSA 3W27A 3VD9A 3WL0A 3PHAA 1GHRA 1HT6A 4WJXA 2DH3A 4FLQA 3IANA 2JIEA 1MW3A 3WNNA 4DUVA 4BQ2A 3W38A 3CZKA 3SUUA 3GXFA 2EBNA 3HJEA 3DHUA 1H09A 4Z2IA 3VVGA 2ZIDA 4EK7A 3WH7A 2VRJA 3II1A 2EPLX 4FLSA 2Q8XA 3OGSA 2VZSA 1JZ4A 5I2UA 4UFMA 3CUIA 1UUQA 1UKQA 5A6BD 4JHOA 3F5JA 2D24A 4H04A 2VR5A 3TP4A 5CLWA 1E73M 1IV8A 1WDPA 4MJ2A 1ISXA 3TTQA 5E6YA 1DWFM 5D9PA 3WENA 1PIFA 3WF4A 4DM2A 3BC9A 1UD3A 3OLGA 3CHFA 1C8QA 4MB4A 5DO8A 5GNXA 4TVUA 4CCCA 4U33A 3ARTA 2ZXAA 2XVPA 1UWIA 1BVZA 1L0PA 3VIGA 4HZ8A 3IAPA 4E8DA 2WCGA 1CGXA 5D4YA 3RM9A 1W1TA 5IHSA 3VKKA 4B3KA 2YL5A 5A6SA 4TUFA 4J3TA 1QHOA 3OGVA 4J3UA 2EXOA 2QPUA 3SEPA 3U7BA 4GO8A 1LWJA 1GOWA 2WHLA 4HZ6A 2YKKA 5HDRA 3RCNA 2QV4A 1V3KA 2YA0A 1NOFA 2WHJA 2FGZA 2W66A 3AI0A 4KWUA 2PC8A 3AMLA 3WF1A 1ODUA 1HJWA 3AHYA 4HU8A 1EO5A 1NP0A 2GK1B 1PJ9A 1UZ1A 5DT7A 3WQ8A 3VIMA 5CGTA 4D1IA 1CXFA 3WH5A 1D7FA 4PUEA 2CKRA 3MMWA 1YQ2A 4GPNA 4GZEA 2CITA 3WNKA 3NIYA 5BCAA 2W62A 4BF7A 1CDGA 4U5KA 2BY2A 1PIGA 2J7CA 1BPLB 1UG6A 3WNOA 1KR0A 4OZOA 1WDSA 2PBGA 1QI5A 5IFPA 4PUDA 4RE2A 4D1JA 3UG4A 1AQHA 1S46A 4CKQA 3MSDA 2BHYA 3W0KA 2DSUA 3BXWA 1TFVA 5I79A 1E6RA 3VM5A 2O9OA 3K4AA 4P7NA 1E6XM 3WD1A 4PMDA 2GUYA 3DYMA 4GXPA 2X05A 4DWSA 3PTMA 2WW5A 1EGZA 4A3YA 1IT0A 1XSJA 3U7VA 5BXRA 1CECA 2UY5A 3GM8A 3ARSA 1EO7A 4J3VA 3QGVA 1J0ZA 1BVNP 4V28A 8CGTA 1BQCA 1E6SM 2DH2A 2XVKA 3DYOA 2XYLA 1EIBA 1EDGA 5ABFB 4CN6A 1B3XA 1MW1A 2QMKA 3MU7A 1ZL1A 1TVPA 1P6WA 1M7XA 5I0DA 1BF2A 5E0FA 1JF5A 2XSAA 4LX4A 1XCXA 3WF2A 3HU7A 3VIPA 4R5EA 1GQJA 3SCUA 3ZJ8A 3CHCA 1GQKA 3ALFA 3L4YA 1UR8A 2X8RA 4AD4A 4UQBA 5LYRA 4A4AA 3EMZA 1KWGA 2YL9A 3L4TA 5JIPA 3VUPA 2PWHA 1BTCA 1JF6A 4M56A 5A69A 3HMCA 3ZJ7A 1EHNA 4P7LA 2J4GA 1QI0A 2CERA 4D6HA 4B15A 5HPOA 1KXHA 2WC4A 3KE0A 1A3HA 3M07A 5E9AA 1BGAA 2BY0A 4F9DA 1MW2A 2J78A 2J7GA 5A2BA 1HKKA 4X9YA 1VF8A 1HJSA 4AZBA 1MFVA 4HA4A 4AMCA 3UESA 4N0RA 1W9XA 2D2OA 2WXDM 3S6TA 1DEDA 1VJSA 5E09A 1E6QM 1EOKA 3VGHA 4E4PA 4P8WA 2YDSA 3ZOAA 3SUVA 1HVQA 1M04A 5A2CA 1PEZA 2DT2A 1W9PA 1I1XA 2D1ZA 4MB5A 1FHDA 2XVGA 3VD5A 1E15A 4NRSA 2X09A 1ZBWA 3FY1A 4MNMA 3FNDA 3GH5A 4JCLA 4AWEA 1CWYA 1U30A 2BNJA 5BXPA 1E3ZA 1W3LA 1UQYA 2VL4A 3OBAA 4WSKA 3WDQA 1EXPA 4UOQA 1UR4A 1ITXA 1HKIA 1JIBA 2VRQA 3W6LA 1GORA 1V6YA 1OT1A 4AIUA 3ZSSA 1V3IA 4CD4A 3AQUA 4KRTA 5DT5A 4A3HA 1UR1A 1CGVA 1FHLA 1DTUA 1PX4A 2YL6A 4CVUA 1JD7A 4QLJA 2J77A 2W67A 2DPEA 1OM0A 2ZWZA 2Y5EA 5I78A 1V3HA 2VZUA 1ZBKA 2UWFA 2YBTA 1J0KA 2CBVA 2XPKA 1C3FA 1RH9A 3NSNA 1AMYA 4F9JA 4CCEA 2B31A 4QLLA 5BRPA 1CXEA 4PMRA 1VAHA 2XFYA 3PZNA
chains in the Genus database with same CATH superfamily
1TV8A 4WRHA 1JCHB 4MJ4A 2XZ7A 6TAAA 4FP1A 3VMPA 1C9HA 3LTSA 4MTVA 1E0XA 3DC8A 3MKCA 5I24A 5AHFA 3W01A 3UVIA 5EFDA 4R7JA 2QCFA 4AY7A 1XIMA 3EPNA 5I98A 2DJXA 4UMAA 3KL0A 2ACRA 2XVNA 5IBXA 2DUXA 2V81A 5DANA 1W26A 1G4PA 4MLJA 4UTWA 1E4NA 2DQXA 1MEWA 4I5UA 1B3WA 4E2DA 3UXAA 4MPKA 2HDJA 3PUEA 4LC8A 3PBGA 4XVDA 2QW5A 3OG2A 2HXUA 2ALRA 2AOSA 5K9XA 2UZ9A 3S0CA 2E6FA 1B3ZA 2QMJA 1FP8A 1VD6A 5A8MA 3ZR6A 5DEZA 1SFTA 1NFBA 1JYNA 2A3EA 4OJYA 5LNRA 3A64A 4ERAA 2YPIA 2YFNA 3VZXA 1ECEA 2H8XA 4UFJA 4YJ5A 3EDEA 2MANA 1VLWA 4XBSA 1S5MA 3C56A 3ARYA 1QOQA 3ABOA 3L0NA 2QUUA 4RZ5A 3LGGA 4Z2GA 1XINA 5F1VA 1JZ5A 4PGLA 1CGUA 2YCLB 3PB0A 4G50A 4S3DA 2OZ3A 3W7OA 4A21A 1G01A 4ODMA 1AL8A 3NQDA 4P8VA 4K3ZA 4NQ1A 3SCPA 2F9RA 5JQ9A 3CMGA 4AVNA 3A4AA 4ZL1A 6XIAA 2QNEA 1ZENA 2NQ9A 4DXXA 2VURA 3TMLA 3BL3A 3LEPA 1JYVA 1NSGA 3S2CA 3WUBA 4KS0A 1WXYA 4P61A 4E8CA 5CXPA 3KCEA 5EMMA 3W6YA 9XIAA 3UU0A 3MJMA 4EXQA 4J40A 3VK5A 3PBVA 2WLZA 3CUXA 3PG8A 2V5BA 1WBHA 1VR6A 4XZ9A 4Z2JA 3GIQA 3QPEA 2GL5A 2E09A 2V5DA 4W84A 3NURA 2GSHA 3AJ7A 1IGWA 2I57A 4G2PA 5CPQA 2D0GA 3ONCA 3KS6A 3DFSA 4J2PA 3BZGA 2WJFA 4NI3A 3NZGA 4DPPA 1ICPA 2DSZA 3EDJA 4LEQA 2Q09A 1VRDA 2QIWA 2INEA 3DN5A 4C6LA 3KDOA 1B6CA 3O5RA 1ECQA 3QHMA 4PEKA 3IPWA 1UC5A 2PGEA 1TTIA 2BBFA 2XFRA 4ASTA 3VKBA 3QR0A 1E70M 5AN7A 2RGLA 1XKYA 5BNKA 3T7VA 1H51A 4XKYA 1YEYA 4MZYA 1FA2A 2G97A 1V0MA 4A22A 1VP5A 3G1RA 4XAYA 4C6IA 4UQEA 2BVTA 2DUAA 4FK9A 4CU7A 3GNNA 3NO1A 3NL6A 2PRMA 3LY0A 3W76A 1ME7A 1K7FA 1G6CA 3M5XA 3FW6A 4RDYA 1OFPA 3ITTA 4AEFA 1FWTA 1AUSL 1ESWA 4MAVA 2LKNA 3MW7A 1RV8A 1AK5A 1H2JA 1IHIA 4HJFA 4H9TA 1MDRA 4UNKA 4KWOA 1G4SA 7TIMA 4Z17A 2XP9A 2D73A 2G3MA 4CQ9A 3ABRA 3CEUA 3RX2A 2JF7A 4Z1CA 3L0KA 5HUPA 4H01A 3C3UA 5LNWA 1H49A 1DJWA 4CNTA 3P82A 4CGTA 1VEPA 1FDYA 2VZVA 3C0QA 2XUCA 2NX9A 1PPIA 4G1KA 2JQXA 2GGGA 4C6EA 1RPXA 3WELA 4PTVA 1D6OA 1X6LA 1E0UA 3RR4A 3CZJA 1TCDA 4NKCA 4ZB5A 2VX7A 3KVMA 4IGMA 4JX5A 5EMKA 4UOJA 1JCXA 3SGUA 3TTYA 1FWCC 2CXGA 4HOZA 1DJQA 4X9SA 5CPLA 4WY0A 1E43A 2HBXA 3CUHA 4FNRA 4PSPA 1DP0A 1NF0A 1TPWA 1SMDA 4MNJA 1G4TA 3UETA 3I6CA 2FIQA 3BTNA 4Y9OA 1A47A 2BTMA 3P0WA 5FIPA 2R1LA 2HV5A 3VZYA 4HHHA 1M53A 1YTDA 3VNKA 1TTJA 2H90A 3SCQA 1EF3A 2G0WA 2GJXA 4E38A 2PLJA 3EB4A 3QY6A 4V1YA 5HMEA 3GAYA 3LCFA 3PA7A 4G7EB 1ZBCA 4H7VA 2B81A 4JN7A 3D3AA 4R53A 3OLIA 2KZHA 1LLWA 3JUGA 1PS9A 1OF6A 3FA4A 4UB9A 1RVKA 1ISVA 3LHYA 1OB0A 2YXGA 1JYXA 3S4TA 1RK6A 4WQ6A 3PTKA 1B54A 1IIGA 4R85A 1TPDA 1Q6GA 2ZFAA 2ABBA 4C6PA 4BK9A 4K7YA 3MO4A 4S3JA 3AZSA 4G1NA 4DZIA 4D6GA 1WAWA 4JTDA 2XZ9A 5BROA 3EOLA 1IIHA 1TVNA 3HFYA 1H4PA 2BS9A 4DF1A 1VEOA 1EZ2A 3WMCA 2E25A 3IAQA 4G7FA 3CWOX 3SCVA 4E8GA 4LB4A 1FFQA 1QOXA 1MO0A 3SN1A 1ZUAX 5DIVA 3N9KA 4MY1A 4YWIA 1CXLA 4LNCA 4WKFA 3CEPA 3QHOA 3RCMA 4MZ1A 4U84A 4JTHA 4PRRA 3PRBA 2BFGA 3NQGA 4CN1A 2PP3A 3SCRA 1SSDA 3JS3A 3N4EA 4DWSB 3TYEA 2RUSA 3PNZA 3EDFA 1E4IA 3QGKC 1K6AA 2RGMA 4YTRA 5EKYA 4N9EA 4NVTA 3EB3A 4MB1A 2Q3RA 2PAJA 1DWGM 3VKAA 3ITVA 1V0NA 1H11A 3D0CA 5DY3A 3ABSA 1QJWA 4TW8A 2EJAA 3VA8A 1K77A 3HO8A 4B3LA 4I5XA 2PCQA 2F21A 3LHZA 2OSWA 1GG1A 5DMLA 3OG3A 4F4RA 3OZYA 4MKSA 3M64A 2ZKMX 3N2CA 5G1YA 4FS9A 2PDGA 2XN2A 3GXPA 1K8YA 3WNLA 1FWRA 3CO8A 3RYSA 2J7FA 4L1WA 1MNSA 2V9DA 5G4EA 2W5FA 3FHQA 3HTWA 4F0RA 2J8FA 3WDJA 3E0LA 4FIRA 1YPFA 4EACA 3AJXA 3UZWA 3MP3A 2ESCA 3KBSA 4GIRA 3BAWA 5LSMA 3RU6A 5KTLA 4CD5A 4GYFA 3ID7A 4YL2A 1Y7VA 2X1IA 3W71A 1R3SA 3N34A 4LC6A 3C2RA 5D2VA 3WNPA 3ZR5A 2V5LA 3HQOA 1IF2A 3BSGA 1GKQA 2PTDA 2W61A 3K8KA 4D71A 5AKQA 1MZHA 3PTQA 2IMRA 1BFNA 2GDUA 1JZ2A 2GWGA 5EB8A 3C2OA 2RKXA 2V5CA 4OHQA 1EUAA 1NM9A 2Y8KA 4HBOA 1W3KA 4KCUA 4O1BA 4QDWA 3WLHA 4UNLA 1E3XA 4MPQA 3UEQA 5GQBA 4GINA 1MWOA 1DHKA 4JL1A 5CG7A 3AZRA 2WKJA 1QNRA 1VH7A 3DGRA 4R9OA 4QROA 4ZR8A 2IPJA 2RURA 4FHAA 5H8UA 2NUWA 2RUDA 2CLKA 3MUZ1 4DRHA 3CGNA 2XFFA 4O0KA 5LGZA 3BPWA 4LAVA 1J4RA 3QLDA 3W1QA 1UMLA 2WZIA 4FXSA 3E0IA 2PLKA 3MUY1 4AW7A 4TX8A 1JCTA 3DFPA 4ZVJA 1FKKA 1CZ1A 1Q8JA 3OBKA 4W9PA 2PRHA 2HQAA 3DKJA 1ZCCA 3KEHA 4IGSA 2ZXBA 1V6XA 1XBVA 2YZRA 1U1JA 1I75A 3WK2A 3BAXA 5HJLA 4YCOA 4K37A 1BWLA 2Y2WA 4YXGA 3GU9A 4WHBA 3UFYA 2AMGA 5A6TC 5REQA 3V18A 4TV5A 5FSEC 4HMEA 1MDLA 1C8XA 2ZX5A 3QW3A 2NV1A 1RBLA 4CQDA 3VU2A 3L5MA 4Y7EA 2QCDB 1T6MA 2J25A 4XTIA 5M17A 4I5RA 4O0ZA 1LL4A 1RJRA 2VEIA 5M2FX 1UP3A 2Y62A 1AW2A 1JDFA 4JFTA 3A5FA 5C2GA 4O11A 4F0MA 3LZ5A 2ZX6A 2HE8A 3M4HA 5LIWX 1TPFA 4O8AA 3ZVIA 1PINA 2DZAA 3EXRA 4LUSA 4GVIA 4QHRA 3KP0A 2V3GA 3O2LA 2BZNA 3KCOA 3W3OA 1ZU8A 1J9YA 4NJKA 4UFKA 4GISA 3NQVA 5A8QA 2G3NA 1H1YA 3MC5A 3E9AA 1XG3A 4L4PA 3VGGA 4JZ5A 2J75A 1NMWA 3W4RA 3ARWA 3HB9A 4C90A 2Q6ZA 3L5LA 3IVUA 4JGDA 1XI3A 4JYSA 1XYZA 4OOUA 1HL9A 2Y8VA 4NXSA 3TJXA 3QYSA 3SY1A 4NZ5A 5J5RA 1UROA 1JXKA 5I6SA 3R10A 3REQB 3E2VA 3MB9A 3W53A 4AY1A 3BARA 2F7FA 4ZS6A 1HL8A 4CQ8A 4AD0A 2DT1A 1FKDA 2C1HA 3MCNA 3VO0A 5EYWA 3UCQA 1GEQA 4H9ZA 3GNOA 4KRZA 2Z27A 1JPKA 1ZLPA 5CSSA 4UUIA 1HJUA 2P3ZA 5U7SA 1ITUA 4M1BA 5I06A 1A5AA 5MKGB 2VVSA 1F8IA 5CSUA 2QCGA 3SQSA 1JNDA 5AHMA 3KRZA 3NL2A 3S9IA 1KNWA 3WD4A 3N6JA 3SCSA 1FWGC 1JVWA 1R3WA 1HL2A 4H8VA 1QW8A 3DFNA 3W22A 1CBGA 1FDJA 1B9BA 5F4WA 4LCSA 4M82A 3BAIA 3W7NA 1IR2A 3PZ9A 3ODKA 3SFWA 4JTSA 1EC8A 4DBEA 5LGXA 3SJ3A 1C90A 3W28A 3ARQA 1LUCB 4KFNA 3C86A 4NJHA 2ANUA 3OJGA 4C6FA 3AS1A 1GVYA 3MBFA 1N55A 5EA9A 3M16A 1J2WA 3O3RA 3H53A 2ISWA 1M6JA 1WXZA 3KRBA 1PWLA 4AXNA 3QKZA 4AZCA 1YXCA 4NJJA 1OC5A 2C0HA 3FHAA 1EUNA 1S39A 2E1DA 3OU8A 4FX7A 3P6LA 1E9LA 3HPAA 4ROPA 3GXDA 5BRBA 1ELSA 4U31A 5BOOA 2O4QA 1QT1A 3MHUA 2O55A 5KZDA 1EDTA 2E40A 3SGGA 1HGYA 3WYZA 1TB3A 4D6EA 4LAZA 1XRSA 3CPRA 5I3FA 1LBFA 2GGJA 4Q8UA 2QYGA 1JNEA 3MANA 3I65A 4L4OA 4W86A 4E6MA 4UTTA 1MEIA 1TPB1 2O92A 3BLIA 1G5AA 4PTNA 3VIHA 3ITLA 2BHUA 3URQA 3CL8A 1C8YA 5CGMA 4YS1A 3K1DA 5CPMA 1B5TA 3G8EA 3MV11 3PN8A 1D3CA 2WJZA 3CBWA 1NWSA 3AS0A 1VRXA 2QZRA 5FEXA 3D47A 3BQ5A 5A3HA 2E9LA 1RJPA 4HD5A 1P0NA 1QNSA 1ZS2A 1RAKA 4IX0A 5CAKA 1B30A 4W7VA 1TJ1A 1N1AA 3QV7A 2J74A 3RGTA 4BS0A 3BQ6A 3QR1A 4QIUA 1K8CA 1PVNA 2B7QA 3LCIA 3R0UA 4IIFA 1MXSA 4RX0A 3R25A 1CEOA 3TKFA 5JBFA 1R9ZA 4N42A 4BZYA 1GJWA 1H1NA 2V67A 3JRKA 5G1TA 4L56A 3IACA 1JZ7A 5CCZA 2HTMA 2ZE0A 1XQLA 1TE6A 4GKLA 1US3A 4HNUA 4JCMA 3LMYA 1EJWC 1MQQA 2XN0A 4JFVA 4I90A 3M7SA 2BXYA 1E44A 3LYEA 2C7FA 3GC2A 1YDOA 2UY3A 3AC0A 5M1TA 1VFUA 4HZ7A 3T0BA 1C29A 4FLRA 4IL0A 4TX6A 4MMWA 1LF1A 4YLWA 4P7QA 3VGFA 1C7SA 3M5YA 4GVFA 3PF3A 4JX6A 4W5ZA 3GG0A 3UJEA 5EBUA 3HMJG 2A2IA 2EQDA 3I6TA 3O5KA 3RU8X 2WPBA 3CB8A 3YPIA 4LBSA 3CMJA 1JAEA 3UZJA 3HQ1A 1A5MC 3L2MA 1D8WA 3LG3A 4KPLA 1NP2A 2PEVA 2Q5AA 1EJVC 3ARVA 3GE7A 3BG5A 1QBAA 3IIVA 2J13A 4MVAA 4JFJA 1TX0A 1YMYA 2C14A 3NVTA 4QJ3B 5M03A 1X7FA 4DUWA 4MWAB 2GDVA 3SW6A 1SGJA 4IOTA 2DFAA 4IH3A 5F4XA 3GY1A 1GYLA 5FD0A 5ABEA 4PMXA 3UF8A 2VGBA 2W27A 4LEFA 2ZQUA 4XD3A 2OLSA 1SR0A 1HIZA 3VNMA 5BOEA 1KRMA 2R91A 4DEFA 1HZYA 2P50A 3G6MA 1D7IA 4O13A 1JPDX 1EIXA 5HBFA 1JXJA 1TYGA 1A5BA 2QCDA 3RLUA 2EULA 3RX4A 3P3BA 2WVTA 3FAWA 2XH4A 2R1PA 4RPQA 5GNZA 4L6HA 1WDQA 2GVEA 5A1AA 1EP1A 2BHZA 3ICJA 2ZZ1A 4AYSA 4B9YA 1H7NA 3RJYA 4RE3A 3M6DA 3E0WA 4NZCA 3TV8A 1TELA 4NAFA 5GPRA 3SQLA 1R3TA 1GVSA 2V30A 2VQUA 2C6QA 1YNQA 3KOZA 4FNPA 1PCKA 4HU4A 5T8GA 1OYCA 4H4IA 4JXCA 3T81A 3WLRA 4NZ3A 4GGHA 3B0YA 3AIWA 2WCAA 3FLUA 3KL3A 1I1WA 1J6PA 4ZEPA 1F9CA 1XSKA 1KQYA 3LRKA 3GS6A 4LVDA 3IIPA 4EKJA 2WZEA 5FOOA 4PULA 3L4VA 7CGTA 1Q1CA 1FWAC 2B7OA 2I9EA 4MY9A 1OIFA 1V3LA 4DRIA 3HIJA 4GY0A 4JIHA 2POTA 3N1AA 2WNWA 5EU9A 1XICA 4FF5A 2WVVB 1SZEA 3BSMA 2PU0A 1GZJA 1WOBA 1P5BA 2BVWA 2ETNA 4NNAA 3T55A 5DY2A 4XKMA 4Y9AA 4M6QA 1JGMA 3AXHA 3SCTA 5EY5A 3LHWA 3QTGA 3TSBA 1SYTA 2A3LA 5AYIA 1GJUA 4GD0A 1VGAA 5D02A 3HQPA 4WOQA 2O9PA 1DV7A 4WKHA 1ZBVA 2Q8LA 3WN6A 1UZHA 1KRBC 2CIPA 4K6AA 2PZNA 1J18A 2F2HA 3F1QA 4EXAA 4G2DA 4XKYB 4C6MA 1WUEA 1YX1A 4KESA 4L61A 5K3VA 1NFGA 2PS2A 4UR7A 4QFUA 1VFOA 4KIRA 4LV9A 5B7YA 3S2NA 1GOOA 4O0QA 5D2XA 2JEQA 2PDPA 3DG7A 4X0VA 2R6OA 3R6IA 1MUMA 3HBLA 4IQ2A 5DX7A 1M03A 3VE9A 1XFCA 1ISZA 2YX0A 3NEHA 5LIKX 3WDPP 4N9CA 4LANA 4Y8EA 1JYWA 3CZLA 1M7JA 3GUGA 4IZGA 2WAGA 1W5OA 3UJRA 1R46A 1R6WA 4Q7BA 2HVMA 2VEMA 4HIBA 1F40A 3PWAA 3ARZA 1ODZA 3WEZA 3PZQA 3LPFA 2ZADA 3TJLA 3EDKA 4BA0A 3S1WA 1AW1A 1P7TA 2Z1XA 3T2QA 1C93A 1PBGA 4HARA 1FH8A 4DUOA 1XFBA 3PP7A 1BGGA 2A4AA 4IT1A 1DWHM 1ONEA 4A3QA 5DQPA 5KMYA 4F0LA 1VHCA 3TYUA 2M2AA 2GSEA 4K1GA 4NJIA 5BRQA 4IWWA 4X61A 2W92A 5KZ6A 2I14A 3E74A 4QGCA 3QF0A 4NZ4A 1L6WA 2ZYFA 1EDQA 5F7UA 2FZ9A 2XIMA 3NXLA 5CBBA 1JUEA 2VQTA 1AMKA 1BKSA 1DKWA 1OFEA 1KBBA 1JZ3A 2CC0A 1UPMB 3GYEA 3A4JA 3ITXA 3MWAA 2QJGA 1G9HA 2WHKA 1MXGA 2XTKA 3EKZA 5CJNA 5TIMA 3NM3A 2VMFA 3MCOA 4L6OA 2LGOA 1I4NA 2OZ0A 3I3DA 3VDHA 3F4DA 2FVMA 3V75A 1WQ5A 2ZE3A 1XWYA 2QUVA 4F40A 3W7HA 3MWCA 4JEQA 3SB0A 1XV8A 3MJYA 4PMQA 1PYMA 2VWTA 4NRRA 4E2OA 2Y4SA 2HNEA 2MLYA 3HM7A 3I4KA 4CD7A 3T08A 1FCQA 4HGXA 4C1NB 4UFLA 2PTZA 2RHGA 1XJBA 2B7NA 1VBHA 1GOKA 3TZFA 3VD9A 3DENA 3PHAA 3QPYA 4K39A 1BKHA 2DORA 1MW3A 4JTGA 3WNNA 3CZKA 5U4NA 1Q6LA 3U0HA 2ZIDA 4EK7A 1LCOA 3II1A 2AL2A 1Q7ZA 2VZSA 2QAPA 5I2UA 1Q2SA 3E0VA 2RAGA 1RA5A 4H8NA 4H3DA 3AUJA 3IRSA 2D24A 4H04A 2OU4A 4JIQA 1WDPA 5D9PA 4EX4A 2VHLA 1F6YA 1UD3A 4MM1A 3C2EA 1K02A 1O12A 4TVUA 4AHQA 1JPIA 1S2AA 1Z42A 3ARTA 1ICQA 3QLLA 3M6YA 4US6A 3OW1A 1KFKA 3TN6A 5E93A 3VIGA 1X1ZA 3SAZA 2PUZA 1KW1A 4HZ8A 4E8DA 2WCGA 3MPGA 2E6DA 5TBOA 4C6DA 2PLMA 3FKRA 3VKKA 3EX6A 3TQVA 5C9WA 3MHGA 1QHOA 2DUZA 1TO3A 4AF0A 3PJTA 3BOFA 4DZAA 4QEEA 1EF2A 4GO8A 2YKKA 4Q4PA 3JW7A 3UQNA 4PBEA 3RCNA 4HPNA 1NOFA 2FGZA 4CNPA 2W66A 3GG1A 4KWUA 2PC8A 3AMLA 1S5VA 3AHYA 4LBRA 3W1LA 2KI3A 1UZ1A 1P0DA 1CXFA 1KBLA 1BWKA 4PUEA 4DNHA 1VHNA 2VGFA 2CKRA 3MMWA 5TQLA 4TNSA 1XLGA 2Y5JA 3C0SA 2W62A 1O5QA 1I2QA 2EKGA 2PLCA 4DRMA 4K2SA 1U1UA 5E1QA 2J7CA 4OZOA 1FJDA 3GTXA 3OOQA 1EA0A 1EQ3A 3UXLA 4RE2A 3GKFA 3CNYA 4CKQA 1EJRC 2DSUA 5I79A 1E6RA 5DN1A 1TREA 4F0SA 1FWJC 2O9OA 3WJYA 2R9RA 3K4AA 1E6XM 3QFWA 3LV6A 1Q5MA 1F6PA 3ZZ1A 4WUIA 3PTMA 1K3UA 1RCOB 2WW5A 5LHFA 3CYJA 4EF9A 4O14A 3U7VA 5BXRA 3T42A 3C0JA 4A3UA 4WXZA 1EO7A 4J3VA 4OTKA 3S47A 1T0OA 1D7KA 1ONRA 1BD0A 1BQCA 2PDHA 3ATZA 3DUGA 4DZHA 2QDDA 1BVWA 1TQJA 2OO0A 4ICCX 4FXRA 5ABFB 3MZ2A 1RZMA 3M41A 2QMKA 4X3ZA 3SY5A 1HFBA 1ZL1A 1GT8A 2NZLA 4HHMA 1M7XA 1L6YA 2P8CA 4H6KA 1BF2A 5E0FA 3EZ4A 4H6RA 2RUCA 4PUJA 4LX4A 3WF2A 3HU7A 3VIPA 2X1RA 3VUSA 8XIAA 5C0QA 3ALFA 1UCWA 1XLIA 4UQBA 3GTFA 4HBEA 1KWGA 2YL9A 4GY1A 2PWHA 3G1SA 2QCLA 2FTYA 3BK0A 4M56A 1FY6A 3T44A 3GXTA 1Z8AA 1QI0A 2CERA 3B8IA 3EXTA 4FALA 1KXHA 4LF2A 2WC4A 4QT3A 1A3HA 1IXOA 2HROA 5BWAA 1GVRA 2BY0A 1MUCA 1MW2A 2J7GA 2PDQA 4YTTA 4Q4QA 2OEJA 3BLEA 4HA4A 1W6TA 4IFKB 4UTUA 2D2OA 2XISA 4O17A 3RHGA 1SFLA 1EOKA 2YXXA 4JOMA 3A9BA 4GGQA 3TH6A 4E4PA 1I0BA 5HMFA 2YDSA 3ZOAA 3BOXA 1HVQA 3NAVA 1M04A 4V33A 1PEZA 1YNYA 4YVPA 1I1XA 4GBDA 1FHDA 2EKCA 1IEIA 3ME3A 1ZZMA 4W9TA 4A3RA 3R2GA 1L2UA 1E15A 5HATA 2ZTKA 3FNDA 4XTDA 4NAFB 3BLLA 3F2CA 2VL4A 1GRJA 3U6WA 4UOQA 1MZRA 3SO7A 3WX7A 1DIOA 1GORA 1AJ0A 1H7OA 1FKWA 4KRTA 4A3HA 1OZMA 1YPXA 4GIYA 1FHLA 5HAOA 2I7GA 1JD7A 3JVAA 3NO3A 2J77A 3GVQA 3R7MA 1JQVA 4I9TA 2DY3A 5I78A 3ABQA 3W7MA 2VZUA 3KS5A 1PWMA 2YBTA 1D7HA 2H3DA 2PWVA 3H4XA 2CLFA 1C3FA 2RDWA 1NJJA 4NY2A 1A0DA 4Y90A 4O4VA 4ZO6A 4F9JA 4CCEA 4QZVB 2B31A 4QLLA 5BRPA 3CB3A 4R7OA 3R0DA 2PPGA 1VAHA 1H1ZA 3JZUA 2DVTA 4AAJA 5CZSA 3LV5A 4DM1A 1Q4WA 3PBWA 3TSDA 4GQBA 4NYUA 3NJ3A 2QGYA 4KWWA 1QNQA 2DZPA 1ZP3A 1XG4A 1E5NA 4ACYA 1W8GA 1UWSA 3AHZA 2PWEA 4LS0A 2GVLA 2OQLA 3GU0A 2J9YA 3LZ3A 1RP9A 1ZJHA 3GAKA 1XQKA 5EMYA 4HPHA 2EEXA 1UQZA 1CB2A 4DYKA 1FWSA 2PURA 4A8LA 3VIFA 1V93A 3BDKA 3SCWA 4EWND 4KR0B 1LORA 3W7RA 4R7WA 1RALA 1FXQA 4FMVA 3UCDA 5HQMA 3UWZA 4DI9A 3O5IA 3PUOA 3M0MA 2QF7A 3O6YX 3KTXA 4DO6A 4LS1A 2QAFA 1XC6A 3ZWSA 1W56A 2XDFA 4J28A 4WOZA 1W1A1 3DKLA 3TQ0A 3NPVA 1XIGA 3G5EA 3VXGA 1PAMA 4I7VA 4Q8QA 1KWKA 1OGBA 4J27A 3S2MA 1J12A 1OK4A 3GTYX 4KEVA 3KTSA 3AHTA 1MUWA 3OIXA 2YA1A 3FDGA 1GVIA 3GSMA 3MDWA 1XYBA 3KLKA 2CNCA 4V27A 1IEXA 3DDMA 4JTCA 4GZIA 3LX9A 1WV2A 2VX4A 2ZA2A 3E38A 4QS6A 3USBA 3KXQA 1XKJA 4H7CA 4WIWA 4IGHA 3TFXA 3WG6A 1DIEA 2QUTA 3C4UA 4U5IA 2ZC1A 2X41A 1MQRA 3K2GA 2ZQ0A 1RQBA 3BJFA 2P0IA 2FZDA 5HWMA 3QVQA 1QPFA 2DG9A 1V03A 2YR1A 3GDTA 3K8LA 2E28A 1CYGA 3LDVA 1NARA 2ON3A 4UWMA 3RFWA 4IG2A 4NAEA 3NUKA 2IS7A 2ZUMA 3APTA 1IEWA 3CASA 4KH2A 1EH9A 3HG2A 4C6OA 4ZPWR 2YJQA 2VP8A 1HP4A 3VGBA 3CZ8A 4UTWC 2OWCA 3GU2A 2IKJA 1W0MA 1E9ZB 4WY0F 3UWEA 4R34A 4NYYA 3IIZA 2WPGA 4Q8VA 2I5QA 1SZGA 3EKGA 3WD3A 1PV8A 3EY6A 3AIRA 5AYZA 3CHDA 2MLZA 1OFOA 1QXLA 1UWUA 2QCHA 2CW6A 3N4AA 3MKKA 2OYMA 4PUKA 3RITA 4J2MA 1XIBA 3W24A 2VN1A 3BV7A 4W9OA 4H6QA 3CIXA 2ZXQA 2G4FA 3B8SA 3A4WA 3FOKA 3BUVA 2W79A 2ZUWA 3KUMA 5D04C 4HPJA 5A8PA 2D3LA 3BSHA 4PC8A 1K8ZA 4GZJA 3VCCA 3TU9A 3NRKA 2R82A 4M8UA 5I03A 2PGRA 1BKFA 1QR7A 4HK5A 4ZO8A 3HPSA 4UQAA 1XM3A 1V6TA 4UIOA 1Y5VA 1JFXA 2F38A 5E70A 2FVLA 3SECA 1XDMA 3DIPA 1OBAA 1K4GA 4HZMA 1U1HA 3WDIA 2QLYA 1Y65A 2VWSA 2ISFA 5A6AA 1VQTA 4QISA 4UQCA 3ITCA 3JR2A 5C2CA 2WCSA 3WFAA 4YVXA 2OR2A 2QCNA 3G18A 1QPKA 4C7FA 3WQOA 4FX8A 4UTJA 2WZHA 5HWNA 2JIWA 1OYAA 3QV9A 4ZO7A 3UR8A 3PM6A 4ORMA 3LPPA 3EBVA 1AQFA 3VOIA 1QPLA 1LM1A 5M3WA 4AFYA 6A3HA 5D2WA 3UT0A 1X96A 3I7QA 3DHPA 2RJHA 4QAIA 1MI3A 1V02A 5FEPA 1V0LA 1DXEA 1EYMA 1PTAA 1QHPA 1UWQA 1E1CB 1H63A 5LXXA 3JU2A 3TOPA 3PPCA 1EJXC 4XUGA 1WDWA 4JKKA 1ZSXA 1JNSA 4WDTA 4QDMA 1QK0A 1GVEA 1B9ZA 4JAWA 5HW8A 3AXMA 5DIUA 3EIPA 2VZOA 4CEXC 3U57A 5BXTA 4ECLA 3OEXA 3N15A 3T40A 2GZXA 5HK4A 2GUUA 5D2TA 3AMCA 1VPXA 2REQB 3P8JA 8A3HA 2XIIA 3A12A 4QCFA 3HGRA 3T2PA 3WQVA 3W7QA 1DE6A 1ONXA 1WAUA 2GK1A 2FLIA 3V1PA 2WHMA 4CNNA 3NQ8A 1OINA 3APYA 3NXFA 4AD3A 2GQAA 5KEZA 3ARRA 4GYKA 4OWGA 4DZ5A 1CXIA 1W3JA 3KW3A 4S38A 1V0KA 4LF1A 4MGVA 4IM4A 4WDWA 1H5VA 4AVFA 3GTNA 3G1AA 1DWIM 5A95A 1UR9A 4AD1A 3CV7A 5F2LA 1EJUC 4IUOA 2VENA 3W2MA 3URAA 4LQ1A 4HHPA 1HKJA 4KGLA 3QZEA 2HNHA 1GVOA 3UJ2A 2Z1WA 1VFLA 3W2JA 3IKDA 4CU6A 3TA6A 4XZHA 2F6XA 1G0CA 2WLYA 3MV01 3EDDA 1E5JA 4JFSA 2EG8A 1V08A 4CQBA 3B0XA 1WNOA 4CNSA 3NQMA 3BGGA 2CCRA 4GQ0A 3T0AA 4DWSD 1ZQ5A 3WDRA 4AF0B 2A6NA 1V6VA 3O5FA 2GVGA 5AVNA 2AKMA 1V3JA 1Q6CA 3BJSA 4NNRA 1XBXA 1M65A 4IL2A 4UTLA 1W91A 4XAPA 3N3MA 1D8CA 3E5PA 7PTDA 4DNMA 1HNYA 5BXSA 3NNTA 4ERIA 4PB3A 4ZPTR 2EPKX 3B4UA 1I0DA 3NZ1A 1TX2A 1NH6A 1EJTC 2INZA 3OVQA 1TA3A 4O19A 3WIJA 2Z2BA 4DB7A 2VFHA 2OWWA 2R94A 1ZAIA 2YYTA 3NEVA 4US5A 1EOMA 4WLCA 4C1KA 1CLKA 3M0VA 4HNVA 2ZDRA 3TQPA 3GDKA 2QGHA 4NXKA 4JTLA 3IJ7A 1Q6HA 4KWVA 3RF9A 3UWWA 1XW8A 2D22A 1EPXA 4OU1A 3SN0A 1Z41A 3AROA 1F8MA 2E4TA 3MMDA 5LNUA 1VFHA 3VD7A 4QSHA 4R3UA 5CQ1A 1Q2RA 1Q6QA 2FB2A 5CJ5A 3FA5A 4TV6A 4DAIA 5ABTA 2E5CA 2FHFA 1LP6A 2XM1A 8XIMA 2PBCA 2UBPC 1R38A 3VX0A 4JX4A 3B97A 3AO0A 1E4LA 3PTDA 3VOCA 5HPCA 3UYCA 4JNYA 4ZBCA 5I3KA 3EEGA 3P14A 4PN2A 4XX6A 3AS2A 1TV7A 1Y0EA 4GZ7A 5GVJA 3PR9A 1EX5A 2VC5A 4OKDA 3BLKA 5FJUA 2XWDA 3JZEA 3PPFA 1PKNA 2H9AA 1LQ0A 1JL8A 4M6UA 2H6RA 4H9XA 5CSYA 3THCA 2GOKA 4TW7A 2OX1A 3OB8A 1VYRA 1O7AA 2PF0A 3HF3A 1C9DA 3ANYA 4NL1A 3M9YA 3N2XA 3IK2A 5ABFA 1R87A 3VOGA 1QPQA 1TZZA 4ALDA 2VELA 2PC4A 3AS3A 3RK8A 2Z24A 1FKGA 3NPWA 5L9FA 5C9UA 2JKAA 3PR2A 3W26A 3MDYB 3GVGA 4FI4A 1NIUA 1BYAA 2XP7A 3LA4A 1U83A 3DFYA 4HK7A 2E8ZA 3KCJA 2PTXA 2DG3A 3TW6A 3W7CA 3O5OA 4TQTA 5IHRA 4ZOEA 2WNZA 4PFHA 3E12A 1OCNA 5F2GA 2OWXA 4LYRA 3FX4A 5A8NA 3A21A 3K4WA 3QH2A 1CCWB 3LI0A 3QM3A 4GQQA 2JGYA 1VBGA 4L1GA 1M01A 2BODX 1WZMA 2P4VA 2I16A 4QXIA 4YHEA 1H0IA 3VD3A 1MVYA 1M3UA 3UXDA 1U33A 5K4XA 3IWPA 3I3EA 2OX4A 1KT0A 3UERA 4QTGA 1OFBA 4XIAA 3THDA 1ZB5A 4N2YA 5CPOA 3F4WA 3MVIA 4JHZA 4HA0A 4JY8A 9XIMA 4CD6A 1Q66A 1PTDA 2D3NA 4BHYA 3LPOA 3NGJA 4QP0A 4TMCA 3EXSA 1XSIA 3TIMA 2F8QA 3FXGA 1B90A 3EMCA 1FH7A 1JEZA 4GUIA 5FSDC 1Z48A 2VFDA 4DJDA 5I77A 1XIEA 3UI6A 4AZCB 1JUKA 3IGUA 4UTMA 1TPVA 4K7VA 3PUGA 1EHAA 1RXOB 3UWUA 4AX6A 1YHTA 1KKRA 3B9EA 2ZTJA 5FF3A 1K1DA 1DQXA 1PO9A 2A85A 1D3GA 2ZQVA 3VOFA 1OCJA 3DG3A 1W9UA 1E4MM 4OVXA 3TTOA 1K9TA 3GK0A 3UJSA 1QBBA 3PG9A 3THUA 2GUBA 1NFPA 3H24A 3I10A 2OMAA 3ENLA 3IJ6A 3GDRA 3NDZA 3BAYA 3TROA 2RH9A 3S42A 3WUFA 5CC7A 2BVDA 3S5NA 1PZ0A 3S3GA 5HANA 3V7PA 1R3YA 1P7TB 1YTKA 2POZA 3O5PA 5FJTA 1T99A 3O05A 3GH4A 2VKZG 2Z2UA 1J0HA 2NXHA 2X0HA 2HVOA 1W3TA 1QNPA 2P1FA 4O1AA 3VYLA 4QJ1A 1S38A 1WPCA 2FDSA 5I09A 2DVUA 2I56A 4KQZA 3V36A 4IXXA 4U28A 3TN3A 5KINA 4HK6A 4XQ6A 4HPGA 4UQ9A 1PZ1A 1QI4A 5AECA 1N8FA 4WSJA 2IKHA 5BMWA 3PPHA 2EG7A 4H41A 3IVSA 3LXCA 1EP2A 3KACA 4O57A 1IXNA 4OECA 1GVQA 2FH8A 3WCZA 2YA2A 2Y7DA 2ZQSA 1BRLA 3PWGA 3HA1A 3UBPC 3J7HA 1CIUA 3K5XA 2XHYA 4PA8A 3GHSA 4EWJA 3N04A 2V68A 2O0TA 2NQ5A 3UZYA 4W85A 2P5NA 5C9ZA 1N7KA 4G9PA 4WDXA 3NL3A 2P3EA 3PWIA 3KAOA 1IWPA 1PHQA 1VPQA 2QJJA 4Q6XA 1GGOA 4RE4A 1S2CA 3SSJA 1X97A 3GXIA 3AFBA 1RCQA 3PY2A 4KCTA 3G1VA 1HN1A 2CESA 3S6OA 2QUNA 2WWCA 4V1XA 1TWSA 3FJ4A 3VGEA 2BGSA 1WZKA 1QTWA 1UW9A 4U3CA 3ECQA 5CZJA 4FZIA 1R9HA 1Y8BA 5ABHA 1GYNA 4KQNA 1NF7A 3GH7A 2PP0A 1E71M 2E0PA 1OJXA 2JZVA 3AXIA 1V4YA 1CGWA 5HULA 1EWDA 1NSJA 5D38A 1E0WA 4H9VA 3DERA 4BEQA 2PWFA 3BURA 5EBAA 3RDKA 3GLCA 4HU3A 3A3XA 1F7BA 1GOIA 3AYRA 2Z1SA 2BP1A 3W88A 3MSYA 4IMEA 2C8NA 2F4EA 2JFEX 4Q33A 1UZDA 1J10A 1XUZA 3FV9A 5G1MA 3SSZA 2WC3A 1YIXA 4OUEA 3UPBA 1JFHA 4EOUA 2G4JA 4C65A 2GJLA 3GDBA 5LXEA 1X39A 2FVKA 2R1MA 1JJKA 1UH3A 2WK2A 1FWDC 4LYQA 4ATDA 3VKCA 2Y5SA 1U2YA 1FKIA 3N73A 1UOKA 3L4UA 3UPWA 4D6FA 1REQA 1UR2A 4AC7C 2NLIA 3NDOA 1J2BA 2BG5A 3O6AA 3C2YA 3DYPA 1Q6OA 1DJGA 1UB3A 5E5CA 6CGTA 4BQ3A 2ZR5A 3AIBA 4EAYA 5HW6A 5DFAA 3T4WA 3L12A 2XP8A 3HOJA 1BG9A 3CL7A 4JKLA 2WBKA 4DHGA 2A0NA 2XJ7A 1PKYA 5IDZA 2DT0A 3EKLA 2A7RA 1F3WA 3MUCA 4DROA 1HW6A 2NT1A 5CC6A 5MF5A 1PX8A 1WYIA 2VEKA 2WVVA 3OODA 3WQPA 2YOCA 2ZX9A 3U4FA 2YB1A 3H2AA 4K8HA 1PSCA 4QS5A 4Z0JA 3V5FA 3TW9A 3BLFA 2MLXA 4L4LA 3WBYA 3WBEA 4DO4A 2WOQA 1OX5A 1X1NA 3LB0A 5JUVA 2BY1A 2O4MA 1C91A 4JEJA 2PV2A 1VJIA 5FF2A 2J62A 3APGA 2C15A 1G94A 4S1FA 4ICNA 2C1GA 3WQDA 1UWRA 2GGEA 4BCEA 3MUIA 2D0HA 2FQIA 4F2UA 2HS8A 4LTSA 3GR4A 4GOAA 4DJFC 2Z1VA 3DH7A 1OQFA 2D0FA 3V4BA 4PTDA 1QCWA 1GK8A 4IIHA 4DRQA 3QTPA 2BMBA 4WD0A 2Y7FA 4C5YA 1TJPA 3O0KA 3KAFA 1PCWA 2WVSA 2VTFA 3EX2A 1QU4A 4W7UA 1EJSC 2AL1A 3EPMA 2EPNA 4AZIA 3VIIA 4U3AA 3N6QA 3H4GA 3VINA 2Z25A 1Z44A 5C8BB 3UXKA 3M44A 3AIUA 4XZLX 3W2UA 3UGRA 4BF8A 1WKEA 2FKEA 2X42A 5C5YA 3G0UA 1KM1A 2NUXA 4FLOA 4LT9A 5D8ZA 4HA1A 2HWGA 2GGIA 3LUTA 4C6JA 5SWUA 1BF6A 1R2TA 3LHUA 3P5YA 4UDMA 1QVBA 4GJIA 3O63A 4EF8A 3KCLA 1E1FA 5HXMA 3AWOA 1RBOB 1VBJA 2ZRWA 2ACQA 1L8NA 1NDVA 1TQXA 3HV9A 3N11A 2PDFA 4P8UA 3BW3A 4HT3A 4XB3A 4JTFA 2PP1A 3T78A 4M0XA 2PGFA 2WMJA 3MTWA 3POHA 3R11A 4S3KA 3CPGA 3IS4A 4Q4OA 4RDWA 3Q4DA 1VC4A 3W1UA 4ZSTA 4Q4RA 4MWAA 3NQ6A 3VM7A 2GPTA 2X16A 2CXEA 4H8UA 1UMYA 1W37A 4U86A 3WBAA 1W3NA 2CHNA 1EP3A 1J11A 2MF9A 4L6DA 2CWNA 3HURA 3O5LA 3E49A 3WH6A 2AKZA 3L2LA 4Q8PA 2OXNA 5CPTA 1NWRA 2VR4A 4D6CA 4S3AA 2INFA 4FOKA 4DIPA 3VGDA 2OSYA 4W88A 1TV3A 4JN6A 3FEMA 1GJPA 3MI3A 4A2RA 1J0YA 2C0AA 2PPNA 1OYBA 4C5ZA 4LAMA 3MA8A 2VRKA 2I5GA 2FYMA 5FCZA 3I7RA 2ZQTA 3W7PA 3C2FA 2ZA3A 1XRVA 1KRCC 1KBJA 4ZTXA 7REQB 1TPC1 3BLDA 3LENA 4MAZA 3EPOA 1X7IA 3WH9A 5AC8A 1CTNA 3IVTA 4ZTYA 4ZZ9A 3M1ZA 3LI1A 2PDCA 4AWTA 2J24A 4LH8A 5D75A 2YFOA 2XP3A 1XLKA 5CG0A 4HSNA 4JQ1A 3KAHA 4HOWA 1UR3M 2NQJA 1TV4A 1FX6A 4S3FA 4GQRA 1J6YA 3V5OA 3U5YA 2XWEA 4TXEA 4TTGA 3INPA 3AU6A 4OV4A 3MS8A 4B4HA 3DFHA 5FEZA 2YCEA 3LLXA 4RXGA 1YDNA 1EFZA 3O5JA 3KHDA 1IXPA 4B5UA 1RLCL 3CAQA 1EEXA 4TVDA 4CCZA 2E5BA 4CU8A 3DC0A 4N6FA 4Y6GA 4WCJA 5AYYA 5HUOA 1SW3A 1DWAM 2WNNA 4KKXA 3F4NA 2ACSA 1TZ7A 2D23A 1QW9A 2W4XA 3LN3A 5K9DA 1H7XA 4NNBA 2XN1A 5FJOA 2VCAA 4W87A 1GOQA 1J79A 3TMQA 3EWZA 1KXTA 3FAXA 3HGJA 4PSRA 2YDRA 3HQNA 4OUIA 1R2SA 3M0KA 1Z7AA 4ML9A 2MPHA 1NU5A 4OOZA 1Z3NA 4AISA 2FDMA 1CXHA 7TAAA 1JQXA 1VFSA 3S8HA 4IQCA 4IHCA 1UD5A 4F0HA 1WOAA 3GPKA 4NI8A 3W7JA 4RDVA 4JTQA 3DGBA 5CGQA 3O16A 2FGLA 4M1RA 3QJAA 2CU0A 5I3JA 4B5NA 3KBWA 1NOWA 5G2IA 1JI1A 3CUGA 3IARA 9CGTA 2QVHA 2X2GA 1UWAA 1B57A 3CUZA 3LSBA 2D9FA 1LRTA 2DSVA 5I07A 1TE1A 1KBKA 3NVDA 4N9BA 4NIRA 3HN3A 1ADSA 1B0IA 2GJXB 2E67A 2VDHA 3QFEA 4NZ1A 2JK2A 3GR7A 3LM3A 4W8AA 4AG0A 4D8AA 2FZBA 3VZZA 1JD9A 2M08A 1WZLA 2ZUNA 1KRAC 1YXYA 4AWUA 1Q6DA 4MJMA 3UWYA 1WDDA 4YTUA 3W70A 1SPQA 4AVOA 5L6UA 3PZMA 5CEWA 3W27A 4ODLA 3WL0A 1S3TC 3PAJA 4LCQA 1GHRA 1HT6A 2VD9A 2Z2AA 2E77A 1XP3A 2ZZ2A 5K4ZA 4B5WA 3GXFA 1QWKA 3TC5A 2G3FA 1H09A 5C6MA 1M7OA 1PE1A 5CAHA 3WH7A 3F2DA 4FLSA 4K1WA 5FJJA 4ADUA 4UFMA 1UKQA 1F3XA 2XP5A 5C54A 1IEVA 2VR5A 3VKDA 1E73M 5EMLA 1KTCA 5E6YA 3CHVA 1DWFM 3B3DA 4DM2A 3BC9A 2FPYA 2ISVA 3CHFA 4MB4A 4XD5A 3HPZA 5GNXA 4MIMA 4U33A 5HQLA 2J9ZA 1FKRA 3GC4A 3NQEA 2ZXAA 4GC4A 1SU5A 3LLFA 3TJIA 2PF8A 3AALA 3ANUA 1BVZA 4Q8NA 4KWSA 3H2OA 4GK8A 1RJQA 2E6AA 2P8BA 3KBMA 5IHSA 3TTEA 1VCGA 2YL5A 3TJ4A 4J3TA 3N19B 3N6HA 3OGVA 4J3UA 1ZTVA 1LWJA 2WHLA 4IT6A 5HDRA 4HNCA 4HYRA 3SADA 4Q8OA 5RUBA 4POCA 2Z00A 3UNTA 4YIWA 1ZNNA 6REQA 3UZZA 3B03A 3L21A 1DTNA 1NP0A 1R30A 2GK1B 3VIMA 5CGTA 1BEUA 3ES7A 3OVRA 4KCVA 3UYIA 4GPNA 3TAOA 4GZEA 1XIFA 2CITA 1X1OA 2HJPA 3NIYA 1EJ7L 3CQKA 1XLJA 5CZTA 5BCAA 1CI1A 4U5KA 3WJZA 2BY2A 1X8CA 2ZZ5A 1I2NA 1KR0A 4PFMA 1R5YA 2PBGA 3PAOA 1S2TA 2OKTA 5HNUA 1ZJIA 4P2VA 3KABA 1O94A 1EBHA 3BXWA 2Z7KA 3N2OA 4LALA 3VM5A 2A5HA 5J04A 1A5UA 1E1CA 4ODKA 4P7NA 2DJLA 2AQVA 4AY8A 4ZODA 4DJFD 4M6PA 1XSJA 4O2TA 4CNOA 1DE5A 2OPJA 3T0TA 3KWSA 3RXZA 4O8RA 3ARSA 2HXTA 4QE4A 5CKSA 1J0ZA 1K7EA 8CGTA 3O6DA 4XD6A 2PDYA 1E6SM 4OV9A 3SIZA 2C19A 1ML1A 3DYOA 3U8GA 2V2DA 1EDGA 1WBJA 2VCDA 2NXIA 3I7SA 3UR5A 1T41A 1M41A 1DQUA 2PSNA 2VM8A 1DJIA 3NQCA 3CWNA 1TVPA 5I0DA 1MMFA 5DXYA 2XSAA 4N4PA 4IPJA 4BI7A 3EWYA 3BJTA 3SCUA 3W7LA 1GQKA 3L4YA 1UR8A 5BU6A 5LYRA 4A4AA 3CQ0A 1A49A 3EMZA 3L4TA 1ADOA 4XZMX 3VUPA 1BTCA 3D46A 4XAGA 1I9CB 1FKHA 3HMCA 1EHNA 2J4GA 1D7JA 1L6FA 4B15A 4D6HA 1U79A 5CZ0A 4F9DA 3PK7A 1HKKA 3PNUA 3USZA 1VF8A 1HJSA 3LHVA 4X22A 1TMHA 2GWNA 5H8PA 1PDZA 2F6KA 4N0RA 4FR1A 3H7RA 1W9XA 2WXDM 5G4HC 4AB4A 4IP4A 4GIVA 1E6QM 4MUZA 1YBQB 4LS2A 1KFEA 3C5QA 3L7RA 3QQ0A 4DAFA 4P8WA 2IKIA 3N2TA 4UTKA 3SUVA 5A2CA 4G7EA 4O52A 3SJNA 2XVGA 4KIEA 2DP3A 1O1HA 2VC6A 1HGWA 3FY1A 1BQGA 3UJFA 3N9SA 1E3ZA 4DRPA 3OBAA 3WDQA 5FF0A 4Z0SA 1W3IA 1ITXA 3DX5A 2AGKA 2PN0A 4ZCWA 3EWCA 1DJYA 4Z1DA 3AU2A 1OT1A 4AIUA 3ZXWA 3SFKA 2OQHA 2CLHA 4ZFCA 1IQ8A 3FJNA 2NV2A 1DTUA 3VOJA 2PCEA 4NX5A 5T9CE 3FYYA 4FNSA 3N25A 4QLJA 2W67A 2ZWZA 4O28A 2Y5EA 1R3RA 2WSQA 4HBKA 1V3HA 4J4OA 1MEHA 3CXOA 4AEOA 2DW7A 1J0KA 4YYFA 3UP8A 4TO8A 3LU2A 3GVRA 3NSNA 3M7WA 1S1RA 2Q71A 3DEQA 2QS8A 1CXEA 5AHNA 5FJIA 3HPFA 3CIWA 2XFYA 4DIAA 4L3NA 1EZWA 1TJ0A 1E0VA 3KVKA 3FA3A 1OGGA 3MHFA 3W74A 1KQZA 3MT1A 4BQ5A 4UOZA 3FSUA 1QW7A 3FN9A 1SSGA 5XINA 3GZ3A 4TX9A 1UJPA 1Q65A 1A5LC 4MHBA 4ZQNA 1UWTA 4W4QA 4I6VA 3QMRA 4AZ6A 2XH2A 3JXVA 3K1GA 3W7GA 2NQZA 2ASHA 3WNMA 3TZNA 3S1GA 4O4WA 3BMBA 3NM1A 3HGSA 1Q13A 2J9XA 3RIKA 4KRUA 3OOBA 2Q02A 4XSLA 3V16A 1FD9A 3MMTA 5HUAA 5AZ1A 4AXKA 2VJXA 3ATYA 4D2JA 2XGBA 2QCMA 1P1XA 4CLMA 2WMIB 3VNYA 5J8LA 5KSWA 4S23A 1T11A 3ABZA 3KVLA 1UHVA 1JI2A 5K2ZA 3HV8A 4GRSA 3E6EA 3R58A 1ME8A 4X0NA 1C8VA 2YZ5A 1KV8A 3W25A 2GYIA 2BGNE 3BH4A 3O9NA 5EFFA 2DQWA 3GIYA 4IISA 4GVGA 4XG1A 1HJXA 2QHAA 4UXDA 2DSKA 3TDFA 3E96A 4ODNA 3O0FA 3G8RA 3UPMA 3B7XA 4M6VA 6XIMA 4L65A 4RV8A 1OX4B 4M80A 3KRSA 3AYVA 4Q4MA 1TRIA 1KC7A 3E2RA 3WEOA 3GYCA 3WD0A 1A4MA 1C7TA 4C6QA 2OODA 1GOMA 1V8EA 3KZ7A 5CJMA 2OGJA 1V6UA 3WFZA 4XZNX 2PDXA 2C13A 2Y6ZA 1EYWA 2ZCGA 3VCNA 1JDEA 3LRMA 1KV5A 4GH3A 3C8NA 4OBRA 3GHRA 4W8BA 3SUTA 4IIEA 1YW5A 4R88A 1HXJA 3LBMA 3RJXA 5I3GA 1H41A 3MSGA 3LCGA 1XGZA 3F5LA 2PE4A 1WKYA 3LS9A 3OA3A 1UZ4A 3ANVA 5HNNA 3W85A 4MOZA 4U4MA 4B5TA 1EQPA 1HKWA 3WJSA 1JCNA 4CCDA 2O9RA 4FA3A 3C0LA 1KM6A 3T9PA 3ZT5A 2ZUUA 3SRKA 3EYPA 1IEQA 1UKPA 3VX1A 1XH1A 1UKOA 3AHVA 1WB0A 3GW0A 1ZY9A 4JNZA 5LA0A 5AHEA 2G96A 5CC5A 3SUWA 2DZSA 1NELA 3NQ2A 2HPMA 3KOFA 2HZGA 2LLEA 2GQ8A 1QOPA 3BWWA 2QEZA 3REQA 1WKDA 3VD4A 4YMZA 3TXVA 2V82A 4AZGA 4RV3A 1Q6RA 3CS2A 2HRWA 4PTXA 3WLPA 4H6EA 4KCWA 5C71A 5IM51 4S3CA 4PUNA 2X30A 3KOXA 5H2ZA 2JKPA 2VUYA 1ITCA 3B05A 4L7ZA 4A8RA 4MWAC 3K13A 3LMZA 2Z1KA 4PMOA 4PTWA 1K9EA 4JQ2A 3TYBA 1YTEA 3IJ9A 2A79A 4ZQCA 4AHPA 5AZ0A 1UH2A 4B90A 2GFTA 3WJWA 4MFEA 2BOEX 5B8IC 1PXGA 1MQPA 3WBXA 2IPGA 3CK5A 4RLIA 1I2PA 5AY7A 3N9RA 4JTKA 1XLAA 1IZCA 1FDZA 5C7HA 5LNVA 1IE7C 1TR1A 2ZUTA 4OT7A 3EWUA 3WEMA 3EWXA 8RUCA 3TFCA 4QBXA 4GXWA 4GCXA 1W9BM 4JIPA 3TE9A 1O68A 2WSYA 1KFWA 2VX5A 4Z1BA 5LA1A 3AXKA 2PDLA 3H2MA 3ZVHB 4O16A 5FF4A 2XH7A 3O6CA 4TTUA 3EOOA 5GJNA 2PWDA 4S39A 5REQB 4HVXA 4P5UA 3GVWA 2CLLA 2IKGA 1B31A 1SVDA 3CPUA 4DLMA 3FJ6A 3S9ZA 2WKLA 5FJPA 1GPFA 1UYQA 4GH1A 2W6RA 2OSXA 2CLEA 3UG8A 3VNJA 2J8TA 1CPUA 1DIKA 1K9FA 4IFOA 2RUQA 3AIVA 4E2BA 3DHFA 1R3QA 3M0XA 3R94A 4HOXA 1QPOA 1T5AA 2Z0IA 1B3OA 2XGZA 1J5SA 1I2OA 3R79A 4BWLC 3W23A 5BW6A 3EAUA 5D9OA 3GBEA 4PMNA 2VZTA 2ZICA 3CZEA 4PL2A 1I8JA 3TR2A 1MSSA 1G7UA 4EXBA 2QF8A 3C52A 5EMJA 4WF7A 1M1BA 4DYJA 2WQPA 3PZOA 3I68A 4C1NA 2G37A 1V02E 4HSHA 4MADA 4YCPA 3NA8A 1LOLA 4DRKA 2RSEA 5C2XA 5K9CA 1RD6A 2DGAA 3BICA 3LLDA 5BXJA 3WQ4A 2PPOA 2Z29A 2IQTA 3R13A 1AJ2A 2R24A 3RM4A 5AYBA 1XL9A 1MYRA 4MDOA 4EPKA 3WF3A 1EQCA 2CHRA 3T6CA 1Y0OA 2REQA 1OD8A 4LOCA 3LBOA 4UMCA 1EKOA 4O1FA 4IICA 1Z89A 3TNOA 3BMWA 4RR4A 2QDHA 2D2JA 2QDGA 4ZQOA 1WP6A 4IPLA 1DJXA 5BYWA 5MHBA 1RY0A 2QJHA 2DZWA 1XD1A 4MNKA 3NFUA 2CZFA 3UZ5A 1R47A 4LAOA 4GQGA 3SM0A 1A5OC 5CSRA 1HX0A 4MB3A 2FPVA 1PHWA 1GKRA 3NZPA 5H6HA 4QSFA 1XS2A 2F2KA 3DBPA 4B16A 1TMLA 1SJDA 3FSTA 1EPVA 1Z9AA 2VCBA 3P62A 2ZOXA 3OYXA 3STPA 4RW3A 4C60A 1OFQA 2OOGA 4GI9A 4RZ6A 3SI9A 3PJXA 5HR7A 3F7JA 2V2HA 4GIEA 4TW6A 4GX8A 4ODOA 1BG4A 4RL3A 2BDQA 3AOFA 4H2HA 1M5WA 1YNPA 3P2VA 2QV5A 1FTXA 4N19A 4XAKA 4PRWA 4BQ4A 4UNIA 1TIMA 2V2CA 3D6NA 2VGIA 2WMFA 1D2KA 4KFPA 4IFRA 1OC6A 4E4FA 3IKGA 4DX3A 3O5QA 3BV4A 4XBJA 3SQMA 3BG9A 3ARUA 2VXNA 3FJLA 4YVVA 1W1YA 3PPGA 4MWAE 4NP7A 1EGMA 2DIKA 4LRSA 3LM7A 3QC3A 4ZMGA 2ZZ6A 4D9PA 1D3HA 4ZA0A 4GFIA 4J4KA 1XC4A 1QK2A 4DYEA 3H7UA 1KM4A 1FP9A 2NVAA 3CU2A 2P0OA 3OIHA 3N12A 2P10A 2Y1HA 1QNVA 5LZLA 4O10A 3W9ZA 4AEEA 5EMUA 4ZSUA 2L5HA 3LQLA 1KGXA 1MW0A 5AC7A 1RQEA 3OGRA 1PZ3A 2WMKA 7ENLA 2AWGA 3UZXA 2NX3A 1LT8A 4UMBA 1TCMA 3EOUA 3N17A 5H1WA 4OBTA 1UOZA 1WCGA 1H7PA 2GJPA 3MBDA 1VYPX 3BAKA 2NVCA 1RSCA 4PUMA 5TAOA 1FCVA 5A6MA 1DQWA 3TN5A 1B3YA 2GVYA 3A3HA 4XVEA 3CUJA 1SJBA 2PBOA 3WZ0E 4E5TA 4GXMA 4DPQA 4JFLA 3EMQA 3EB2A 1F73A 3THAA 1BYBA 3L68A 1QHZA 1BYCA 4HMNA 4XAFA 2XSXA 3M0HA 4CN4A 1E1EA 3ZR4A 2ISSA 4L5ZA 2FB3A 4W9QA 3SY8A 2TPSA 2LJ4A 5JBEA 1A5KC 1XCWA 3SCOA 2YBUA 4R27A 1F05A 3B4YA 4BFAA 3T0DA 2WYSA 2ZXDA 1ZJBA 1OHLA 2UY4A 4IIGA 4H1ZA 1VIWA 4P7RA 2ISDA 6PTDA 4FNTA 1KCZA 1ZCOA 2E3ZA 1QI3A 1ISWA 1UP0A 5FKYA 2ZUSA 4M29A 3WQ5A 1VEMA 1OADA 4JTRA 3GTIA 5IOBA 3IUHA 4C02B 1EXBA 5HKGA 3FYPA 1OGSA 5IXEA 2XFWA 2EPHA 2PI6A 2A3HA 4W5UA 1W1IE 5HOSA 3KWXA 2PDIA 4MSPA 4LAXA 4HTYA 1CENA 4LAWA 2HVNA 3UG5A 2JEPA 3AYTA 1E6PA 4G6CA 5I7GA 2HK1A 2XIBA 1QO5A 4TYOA 2ZWYA 3PJUA 4EANA 4FN2A 4NX0A 3WLLA 3F5KA 1KTNA 2WBGA 1BYDA 4I7WA 4KW2A 2Y63A 4AZ7A 1J0IA 1EX1A 2ZX8A 1Q45A 4BJHA 3PFRA 3CT7A 5C70A 1SW0A 3L67A 2CBUA 3FGCA 2VEGA 1QRQA 4PB4A 4KETA 3EWDA 2P53A 4D6JA 5AHLA 3CT2A 2FH6A 2QCEA 3K8MA 5FI8A 1F2JA 4GVHA 2NW0A 5GNYA 4AIOA 1EB3A 3DESA 3THQA 1W1VA 3CV2A 3QW4B 1I2RA 3RGCA 2QUMA 2C1IA 1YDYA 4K68A 1A50A 1VBUA 4RKAA 4GY7A 2X2YA 5HQEA 1OCQA 3BCDA 4MNLA 5HR6A 4JFKA 3W75A 1B1YA 4M7TA 3ZMRA 2Y85A 5K7JA 3QGAC 4RPPA 4U2YA 3W00A 3A13A 3GFYA 2YCJA 1XH0A 3C61A 4HNTA 1E72M 1O66A 4AIEA 6TIMA 2GLKA 1XYLA 1W2PA