1HKKA

High resoultion crystal structure of human chitinase in complex with allosamidin
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
364
structure length
364
Chain Sequence
b'AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEQSGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHITOTRIOSIDASE-1
publication title Crystal Structures of Allosamidin Derivatives in Complex with Human Macrophage Chitinase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 132
structure length 364
sequence length 364
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1hkkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hkkA01
2YL5A 2GDVA 1HKMA 2CCRA 1V08A 3VMNA 4AY1A 1HP5A 4WKAA 2VX6A 3VIMA 5I6SA 3NDZA 3ZOAA 4CUCA 4UNIA 1CXHA 2W92A 5A6BD 3SCUA 1J12A 3QR3A 1C8YA 3F5JA 1PIGA 9CGTA 4W7UA 4WK9A 1UD3A 3PTMA 3ALFA 2YL8A 1LWHA 1C92A 2VCBA 4L4OA 2VOTA 3RCNA 3IJ7A 1W9UA 1UKQA 1TZ7A 3WNMA 1V6UA 1GJWA 2MANA 4TVDA 4MB1A 4D1IA 3SCOA 2DIEA 2DDXA 2WMIA 4HZ6A 3W27A 1JAKA 3AISA 4GPNA 2HISA 1WDRA 4A3YA 1UKOA 4OIFA 3BSGA 2D22A 1GHSA 3EMQA 3WF2A 5EBAA 1QBBA 3WN6A 2J7FA 2YIHA 5CSYA 3WL1A 3B9EA 1LQ0A 4HP5A 1O7AA 4PSRA 3KE0A 2DPEA 3ZO9A 1Q6CA 3NCOA 3M46A 2WMIB 5ABFA 4PBGA 4PRWA 3VDHA 4BA0A 1YHTA 1OCQA 2CKRA 3MMWA 3GNPA 1VFMA 3PN8A 3U5UA 3D5HA 4KGLA 2DT3A 4CVWA 5AC5A 3NYDA 1R7AA 3UERA 1EOMA 2XVKA 5E09A 1QHOA 1WZAA 3T2PA 1PX3A 5BRQA 4AD0A 1SFSA 1U2YA 2PBGA 4M80A 2ZUMA 4Y7EA 3O6AA 1JFXA 5ABFB 1QVBA 1VFFA 3MKKA 1ESWA 3A4AA 3EYPA 1TFVA 2WXDM 2D0GA 3GZAA 4GI8A 2YLLA 1UH4A 2BVYA 2EPKX 3W6MA 1ZL1A 3IAQA 4PMQA 1F4HA 5ECUA 1KGXA 2VJXA 2ZXDA 1X1NA 2BXZA 2ZXAA 2YL9A 4P8UA 2WVSA 1QNRA 1SYTA 4MNKA 4D6EA 1RPKA 5HBFA 1VF8A 5A69A 3MUZ1 2WCAA 5D8WA 1V6YA 4D6GA 7TAAA 2QF8A 1V3JA 3KL0A 3VNYA 3SUWA 3UR8A 4ZENA 1FP9A 3W53A 4AIUA 4ZE4A 3VD5A 5LA1A 3AJ7A 3K8LA 3EMZA 2V3GA 1GQJA 2VX4A 2WKLA 2V5CA 5A6BA 3G6LA 5GPRA 1R8LA 1ECEA 4PUEA 1BAGA 1JL8A 4BF7A 1G0CA 1W32A 1GVYA 2BHZA 3OZPA 2DT1A 3WNKA 3BC9A 4ML4A 3MMUA 2VR5A 5D9MA 3MSGA 1Y7VA 3W4RA 3MV11 5A95A 5HPCA 1TR1A 5BYWA 2GJXA 4UOZA 2ZUWA 1EQCA 4QCFA 4Q7NA 5DT7A 3BXWA 3O9NA 1EO5A 3RDKA 3VDBA 4DM2A 5CG0A 1E4MM 3W81A 4QFUA 2GFTA 2WHJA 2X09A 4U2YA 1US2A 1V0MA 3WEMA 3FAWA 5DF0A 2J77A 2D2OA 3BAKA 4PTMA 3U7BA 4JFVA 4FLOA 1BG4A 1GJUA 3WH5A 3IK2A 5KZ6A 1XD0A 3ARSA 3VIKA 2NW0A 1H41A 4W84A 2VCAA 2GJXB 2UY5A 4PEEA 3WH6A 4CD7A 2HVMA 1UYQA 2W62A 5LA0A 2VVNA 4V2XA 4QLJA 3ARTA 3ZT6A 1V3LA 4KH2A 1OM0A 5I77A 4IM4A 4MADA 3RM8A 3RM9A 2W91A 1HN1A 1M04A 5JIWA 2IXUA 2XVPA 1W3LA 2WLYA 5BWFA 1H11A 1KXHA 2PWDA 1VJSA 4UFLA 4PMYA 3CUJA 1G94A 2W61A 1JYVA 3WL0A 3PHAA 1QNSA 2G3MA 1E71M 1E4LA 1VBUA 1V3KA 2OSWA 4HU8A 3VIIA 2V3DA 2XTKA 4QDMA 3NJ3A 4RE3A 1OT2A 2ZXQA 3OIHA 5HDRA 4P7LA 2ESCA 2BHYA 1PIFA 1V6XA 1ISWA 2J8GA 4AIEA 3VMOA 2WHMA 3MO4A 2DSKA 1GORA 4MB3A 1HKKA 3TOPA 5JBDA 1BYBA 3PZNA 1ISXA 5I79A 4E8CA 1V02E 3PZIA 1NP2A 2ZE0A 1WDPA 1JDCA 5A3HA 5IHRA 4GO9A 1OINA 3PZQA 4UQCA 2DEPA 3DYPA 2Y8KA 2VI0A 3IJ9A 5HXMA 1UHVA 1HJWA 2EQDA 3WF1A 1AQ0A 1TE1A 4P8VA 2AAAA 1E3ZA 2GSJA 2DSVA 3K4AA 3KZSA 4J3VA 4HOZA 4WF7A 1VRXA 3L4UA 1QI5A 2XM2A 3W29A 1LJYA 1JI2A 3ARQA 1MW3A 1W1TA 1XH1A 4JHZA 3SCTA 2OWWA 3NSXA 1PX4A 2NT1A 2J7GA 4ATLA 2WK2A 2E40A 3W0KA 1J01A 4DM1A 1H0GA 3CLWA 3AZRA 2WAGA 4H04A 1KWKA 2J47A 1E0VA 3ARVA 3ZR6A 3VGGA 4B15A 1XSJA 4AEEA 2WPGA 3VPLA 4U31A 3WF3A 2VVSA 4F66A 3OLIA 5A8MA 1UR2A 3K4DA 2VR4A 3CUFA 1GCYA 4LQ1A 4UFKA 1CGUA 4AZGA 4W87A 1JFHA 1MVYA 4U5IA 4YPJA 5CGMA 4Z2KA 2QPSA 1NWRA 2XFFA 1NH6A 1UUQA 3PTKA 3WD1A 4D6IA 2GUYA 2Y24A 3AYSA 4C7FA 5AYIA 2WVVA 1V3HA 2EO7A 4D6DA 1B3YA 1E55A 3ZT7A 5FIPA 1G5AA 3WFLA 1AQHA 2WWCA 3UCQA 3K8KA 1DWAM 1TCMA 1X6LA 3OLGA 1UR1A 1XH0A 2FGLA 5A2AA 4J28A 4PTVA 1EGZA 5BXPA 1XYZA 1H5VA 1K9DA 1Q6DA 1V3MA 4DWSB 5BXSA 1DEDA 3HN3A 1U30A 1LL7A 3WD4A 2YDSA 3L4YA 3O2LA 3ZM8A 2AOSA 1GOKA 4M8UA 1J0JA 4CVUA 4R5EA 1H49A 2XG9A 2E9BA 2WC7A 3L4TA 2WSPA 2DH2A 3VIFA 1NOFA 5E9AA 1HNYA 1QPKA 4UQ9A 5HNNA 1NQ6A 5A8QA 4JIEA 3WH7A 3VM7A 2YLAA 1JXKA 4W93A 2XWEA 2CHNA 2ZWYA 2QMKA 1C93A 2Q8XA 3WF4A 2RGLA 2WC3A 1UD2A 2VT0A 1FP8A 2YBTA 4J7RA 3OGSA 4Z2JA 4LYPA 4M29A 2VZSA 3SCVA 4NSBA 1PZ3A 1XYFA 4H8HA 1GVIA 4W8BA 3A6OA 1QI4A 2EPMX 5A6LA 2ZX8A 3ALGA 1E6NA 2GK1B 5A2CA 2PBOA 1A3HA 3GDBA 3PBGA 3AXIA 5AC4A 3CMGA 2D3NA 4KMQA 1DP0A 2V3FA 3EDEA 5CGTA 3AIEA 1UWUA 2XJ7A 1HJUA 4H7VA 4FF5A 1PBGA 1WZMA 2Y8VA 2WMJA 2CEQA 1UR0A 1YQ2A 2XGBA 2JF6A 4MTVA 1E0XA 3L4XA 3RPMA 3T0DA 4B9YA 1CENA 4JHOA 3T08A 1AVAA 3PZMA 1CXIA 2YA0A 2JFEX 3FW6A 3CZJA 1JZ2A 2J74A 3ZT5A 1WZKA 3ZIZA 3EBVA 1UR8A 2QPUA 1W3HA 3OLEA 3LMYA 4W5ZA 1TUXA 3FAXA 1EDGA 1E5NA 5JUVA 2ZUSA 4URIA 1XHGA 3WNNA 2DQXA 2WBKA 3N15A 2J7DA 3T0AA 4HOWA 2VMFA 1CDGA 2CETA 3RO8A 3G6MA 2G3NA 2A3AA 1JGIA 3NUKA 3RMEA 1CWYA 1HXJA 3GNOA 3AIRA 4XX6A 1FH9A 5ABHA 1JZ7A 4HPHA 1KQYA 3GXIA 4ZFMA 2JALA 1PPIA 4WJXA 1LL4A 4D6FA 1Z32X 3CZEA 4B3KA 3VX0A 2J8FA 5HOSA 4RE2A 1DWIM 7CGTA 4MNJA 4XZWA 4TVCA 4D6CA 1NOWA 4D71A 1W2PA 4IPLA 3OGVA 3RILA 2X2YA 2BNJA 1BQCA 3CGTA 3BCFA 1CLXA 4FMVA 4LXFA 5A2BA 5I3DA 1OIFA 3OB8A 4Q22A 4XV0A 4GI6A 1MQRA 4ACZB 4PUDA 1VEPA 4BQ4A 2F61A 4NI3A 1L8NA 1RP8A 5A1AA 3U57A 2ZICA 3W28A 3WMCA 4AZ6A 1VFOA 1UH3A 6A3HA 5A8PA 4FK9A 1W9VA 2OYLA 1UA3A 4KRUA 3D3AA 5IDIA 1HL8A 1ZS2A 4AEFA 4JKKA 1XSIA 4M82A 1LG1A 1AQMA 1FFRA 4JFUA 4QLLA 5DMYA 4U2ZA 1UD5A 3RJXA 4DUVA 4WSJA 3VVGA 4QLKA 3WD0A 2E9MA 3TTSA 1J0KA 4OJYA 1OGGA 3ZJ7A 1GPFA 1JF6A 2D0HA 4X9YA 1VEOA 5HPOA 1WNOA 4MDOA 5D9OA 1K9FA 4QAWA 2WMGA 1SMAA 1XSKA 3I3EA 3FXYA 4P7QA 5FD0A 1WB0A 1ODUA 2WHKA 4RL3A 2WW5A 1GW1A 4CD5A 3NSNA 5D9NA 5EFFA 3VGEA 1WPCA 1E40A 2BY1A 5IHSA 3ARPA 1UD4A 1I1XA 4QCEA 2VZVA 1MYRA 3A3HA 4W5UA 3MU7A 1KBBA 5A8NA 4EAMA 3LPGA 1C7SA 2QLYA 1B3XA 1JG9A 2X0YA 1H09A 4E2OA 1EA9C 4UQAA 4M24A 2VQUA 2JIWA 4TXEA 1W3KA 5JBEA 3TP4A 3QHMA 2D3LA 3AIBA 5TD4A 2J25A 1KXQA 1E1FA 2CESA 1EDTA 1ITCA 1JZ6A 2WBGA 1E5JA 3ARYA 4Z2HA 3VD3A 1CXEA 3AS2A 4ZXLA 5D4YA 4D1JA 1TG7A 4AIOA 3FN9A 2E8ZA 4BQ2A 1RH9A 1DTUA 1I75A 3POCA 1ISZA 4MPKA 4XUYA 3W6LA 3N11A 2E4TA 4FLRA 3WMBA 2ZX6A 4CN1A 3CZKA 1CGVA 3CMJA 3WDHA 2C8NA 3BH4A 4MNLA 1VEMA 2XVNA 3THDA 3BMWA 1IV8A 2OYMA 4GO8A 4F9JA 4DWSC 2EBNA 3CHFA 2X0HA 3AS0A 3MUIA 2BVTA 4PSPA 3VUPA 2DSUA 3WNPA 3M07A 4WSKA 1TA3B 2PF0A 1KWGA 4AZ5A 4IUGA 1B30A 1M03A 1DWHM 1ODZA 1HJXA 4AC1X 5CZKA 4H8UA 2CYGA 1CPUA 3CH9A 4UCFA 3PZTA 2QMJA 1TMQA 3RIKA 1HVQA 4OBRA 4PMXA 3LPOA 1UWTA 4HOXA 3N04A 1C8QA 1O6IA 4KGJA 3F5KA 1IZJA 1QI2A 1MQPA 3W38A 1E72M 3EDFA 3L2MA 5GQBA 4JAWA 3B8SA 3NSMA 3WD3A 4AISA 1TVNA 4CU6A 3CHEA 2WC4A 2G3JA 2CBIA 5DEZA 1J9YA 2J78A 5A6KA 4GI9A 5BXRA 3TONA 4F8XA 2J7BA 5CLTA 3M6DA 5IFPA 1BVZA 3CZ8A 1JYNA 3UESA 3GXMA 3AHZA 4HMCA 1KGUA 3TTOA 4DWSD 1ISYA 2WZHA 3FHQA 5JBFA 4AYSA 1PX8A 1CXKA 5I2UA 3UR7A 4V28A 2F2HA 2UY4A 4L4PA 3AMCA 1US3A 1J0HA 4ATWA 5JIPA 1DHKA 1E9LA 1BTCA 4UZSA 3AHTA 1N82A 3GH4A 1OD8A 4MAZA 1G01A 2CXGA 3CBWA 3WQ4A 4EANA 3VGFA 1KFWA 1PAMA 4XB3A 4S3JA 3VD7A 3AIVA 4NF7A 3RJYA 3TTYA 4GIAA 2ZOXA 3DYMA 3B9AA 2Y4SA 3QOKA 4B9ZA 3BLPX 2V38A 2JEPA 4JKMA 4GINA 2PWEA 4X0NA 2GDUA 2ZUUA 3VTRA 1R85A 3AFBA 4J27A 1BHGA 1V3IA 3GBEA 2XUCA 1GOOA 1PZ2A 3GM8A 4UFJA 1K6AA 5CLWA 3WQ8A 4OZOA 1DWGM 1HF6A 2V5DA 2WMHA 4D6HA 4KRTA 1B3ZA 3TTQA 5M03A 2A3CA 2D24A 2UY3A 1EHNA 1HKJA 4AD1A 1CTNA 3ECQA 4D72A 1BYDA 1JDAA 4OBSA 4F9DA 3GXFA 1MW2A 3VNZA 1H0IA 3SCQA 1UWSA 1J0IA 4CD6A 5E6YA 5GNYA 4S3KA 3MS8A 1EHAA 5FOOA 2YA1A 2WWDA 4N0RA 1JI1A 3W26A 1H2JA 3NIYA 4CU7A 4OOZA 1XCWA 2BS9A 2BY2A 4M1RA 3ZJ8A 2B31A 3WMSA 3U5YA 1JAEA 1DWFM 2EPLX 3FY1A 2O92A 4HMDA 4JL2A 3CHCA 3WH8A 1UR4A 3PTQA 5M17A 3AS1A 2NT0A 3GH5A 3QGVA 2UY2A 1XD1A 1G9HA 3AIWA 1NWTA 1HJQA 3IAPA 4HA4A 1QOXA 1PEZA 3WQWA 1D3CA 3MUY1 1OGSA 4J3UA 4GKLA 1CNVA 1H4PA 4PMZA 4AZ7A 3VIHA 5CSUA 4CCCA 3CUGA 3SCWA 1GOMA 3MUAA 1EQPA 1QW8A 2YOCA 1QHPA 2GVYA 4DWSA 1LWJA 2E9LA 3AXXA 4LX4A 3WDPP 1UA7A 2G8ZA 1WZLA 4CD8A 4E8DA 3CUHA 2XFYA 3ZSTA 1E6QM 3F4VA 5BXTA 2GJPA 4WKFA 2WVTA 3POHA 1E6XM 2NSXA 4JKLA 4X0VA 2OYKA 2ZX9A 4W85A 2W67A 2XM1A 1GOIA 3VMPA 3K8MA 5JH8A 3WSUA 2WZIA 2YDQA 1M53A 2CKSA 3TA9A 1KXTA 4W88A 1ZJBA 4A3HA 1QW9A 1BVNP 3BSHA 2DH3A 4AZCB 4ZE5A 1HVXA 4TOQA 2G41A 1SMDA 2JIEA 3AIQA 2ZX7A 1K9TA 3AS3A 4H41A 4ACYA 2BHUA 4PCSA 2OSXA 5D8ZA 1ZB5A 2GK1A 4MAVA 1C91A 2J7CA 4W86A 1FH8A 4N42A 1Q4NX 1Q6FA 2A3BA 4ZXOA 1FFQA 4HPGA 3BMVA 4W89A 3BGAA 3A4XA 4TTUA 3CO4A 4AD2A 3PZVA 2GJRA 3N17A 3WF0A 1V03A 4PTXA 3BAIA 3WUBA 4AXNA 4GZEA 1V6VA 4YHGA 2C0HA 4UR9A 1CGXA 3A4WA 1VIWA 2BY3A 1EIBA 4UZUA 7A3HA 1SR0A 1WO2A 1B9ZA 4D6JA 3WDIA 2FDMA 4GQQA 1GZJA 2DSZA 1E56A 3SUVA 1ISVA 3N9KA 1VFUA 2ZWZA 2J4GA 2WMKA 4UTFA 3E1F1 5EMYA 1S46A 1JZ8A 2JE8A 3AQUA 1UR9A 1E4NA 2XIIA 3ZMRA 1QI0A 4AZIA 5M3WA 5CXPA 2WHLA 3ARRA 1B1YA 2VZOA 1LL6A 4P7RA 4WLCA 1JNEA 1J0YA 4TTGA 4Z2LA 2CIPA 1ZBCA 3W82A 2IUZA 1F4AA 1B90A 4J3XA 4PYSA 4HU0A 2WCSA 5AY7A 3GNRA 1CLVA 4W8LA 4BZYA 3B9DA 1JD7A 4JCLA 4U33A 1E15A 5F7UA 4EKJA 1V0KA 2G3IA 3DECA 1XRVA 3AMLA 3LPPA 2CPUA 2DGAA 2ZX5A 3MANA 4DUWA 2CNCA 4ACZA 4J3TA 2BFGA 4W7VA 2OWCA 1BFNA 4UFIA 1BGGA 4P7NA 2YA2A 3KL3A 2E3ZA 4NRRA 2PWGA 3EDDA 3VGDA 2IXVA 2EPNA 2XWDA 3AZTA 1G1YA 3VGHA 4PMDA 1KCKA 5IFTA 3WY1A 1OSEA 4CN6A 5C8BB 1E3XA 4C7GA 3CPUA 1UZ1A 2J62A 2XSBA 3GXDA 3MSDA 2CHOA 4K68A 3VDCA 1GQKA 1B3VA 1NWSA 2A3EA 2EPOA 3IANA 2E0PA 1CGWA 3UG4A 1UQZA 3VIJA 1CXFA 3AYRA 5FKYA 4JZ5A 2CBJA 2D1ZA 4LYQA 1AMYA 1E6RA 1OBAA 1E6SM 3T2QA 5C70A 1WDQA 1J11A 3FNDA 3ZQ9A 3WUEA 3K46A 1EO7A 5FCZA 1MW1A 3VDAA 4W7WA 4NRSA 1E6ZA 4MDPA 4UOJA 1HP4A 2CBVA 4TX6A 1B2YA 3GH7A 1JZ5A 4P8XA 3DHUA 2BVDA 1QI3A 4U3CA 1W3JA 1NWUA 4UQDA 1CECA 1W91A 3U7VA 5EB8A 4R27A 1FOBA 3AMKA 1OB0A 3S2CA 3HMCA 3BLKA 2Z1SA 1CIUA 2D23A 4JFWA 3II1A 1ZJAA 4AD4A 1UKPA 4F79A 3AICA 5C71A 2J7EA 4CCDA 1CZ1A 3CUIA 1UH2A 3AMDA 2WSKA 3A47A 4CGTA 1LLOA 2VNCA 3W25A 2ZUNA 4CKQA 1MXDA 4CD4A 2C7FA 2VL4A 2D0FA 3AZSA 2XVLA 3BAXA 3AIUA 1JIBA 5FL1A 1L0PA 4GXPA 3BAJA 5I78A 3PZGA 2O9TA 8A3HA 4WIWA 1XCXA 3UETA 5I5RA 1EH9A 1UWQA 5E0FA 5E70A 2CERA 1E73M 3ARXA 5A6JA 1XC6A 2VRKA 1W1YA 5DT5A 4PMOA 3VILA 5IXEA 3QOMA 1EDQA 1QNOA 1QNPA 2VX7A 1GONA 5BROA 4HA1A 1WKYA 2JF7A 1UOKA 2DT0A 3BAYA 3I3DA 1UG6A 4E4PA 5GNZA 1OIMA 1J0ZA 1FA2A 2RGMA 3L2LA 4UOQA 1XH2A 3AHXA 2W4XA 3AOFA 4FLQA 2UWFA 2VZTA 1V6WA 1TA3A 1D7FA 1C3FA 4W8AA 1NP0A 1ZBKA 3WFZA 3JUGA 3WNOA 1H1NA 4LYRA 1OD0A 3QHNA 5ABGA 1UWIA 2CBUA 3DC0A 1UD8A 4UQEA 1JZ3A 4MB5A 4AZHA 2WNWA 1J10A 5I23A 4B16A 1GHRA 5LA2A 3VX1A 3RM4A 1EXPA 2VC9A 4OUEA 1HKIA 1VJZA 4AD5A 2A3HA 1KQZA 3SUTA 1CGYA 1VBRA 5CPSA 3VD9A 3N12A 1I1WA 3WD2A 1LG2A 4UFHA 5A6SA 1MQQA 3BAWA 4PMUA 1BGAA 1W2VA 2EEXA 1KXVA 2X8RA 3PZUA 3S6TA 3VU2A 1VENA 2FH6A 2WM0A 3AMGA 1WCGA 3WELA 5I0DA 3CHDA 1IZKA 1XGZA 3CZGA 3WKZA 3FHAA 5CQ1A 3ZR5A 3WUFA 1JNDA 2FHCA 3VKKA 1W9BM 1M7XA 5A6AA 4JL1A 3WQ6A 5CJ5A 1KGWA 5D9PA 2WLZA 1M01A 1VB9A 3ARWA 4ZEPA 6TAAA 2XPKA 4J3SA 2Z1KA 1Q6EA 4M56A 1NM9A 3VIOA 3UEQA 3DHPA 1TVPA 2QHAA 1UD6A 4UFMA 4Z2GA 1BYAA 2FHBA 1V02A 4AW7A 1D2KA 2O9PA 1ZU8A 1FHDA 4V27A 1VAHA 5AYBA 2J79A 3OA5A 1IT0A 1LF1A 4TX8A 4HZ7A 5CPTA 1GNXA 1Q6GA 2VX5A 2V3EA 2EXOA 3GBDA 1P6WA 1JXJA 2EJ1A 1CEOA 3W37A 1MFVA 2XHYA 1W1VA 3PZOA 2FGZA 3UG5A 4MNMA 1XV8A 2J75A 2Y5EA 1JF5A 1R7OA 3ZJKA 5LYRA 4J3WA 1JZ4A 3VIPA 2JEQA 2O9OA 1CYGA 4NZCA 8CGTA 1QHZA 1K9EA 2VCCA 2ZIDA 3HU7A 1J18A 1B31A 2VZUA 2W66A 4QP0A 1WP6A 3WDJA 1KR0A 4AMCA 1HT6A 6CGTA 2O9RA 1UQYA 1UKSA 3EMCA 1OWQA 3N18A 2VTFA 5A8OA 3KWXA 1MWOA 3EDJA 5A6MA 3WDQA 2BXYA 5BCAA 3L4WA 3VO0A 4PTWA 4PMNA 4EE9A 4JFTA 5CPQA 4A4AA 5KEZA 1CGTA 1ZBVA 4PMVA 1V0NA 3VGBA 2OWXA 4AD3A 2CITA 4UQBA 2YBUA 2YL6A 1R86A 2WVUA 1MFUA 1BF2A 2WB5A 2PC8A 2PB1A 1MW0A 3WQVA 1C90A 1KR1A 3VIGA 3T2OA 1OGBA 2YJQA 4MB4A 2D20A 3VM5A 1DWJM 1BYCA 1WDSA 3I3BA 1FH7A 4JCMA 3APGA 4HZ8A 3OG2A 3VD4A 2OSYA 1GQLA 3WBAA 3WNLA 4IISA 3CZLA 2QV4A 3BCDA 1B3WA 2WCGA 2XGIA 1E4IA 1C7TA 4CCEA 2W63A 4MJ4A 2VQTA 1A47A 1HL9A 4AZCA 2WANA 2ZUTA 2X05A 4KWUA 1B0IA 4HTYA 4YN5A 3AHYA 1E6PA 3N1AA 1W1PA 3PZ9A 5I24A 1GQIA 2VO5A 1KB3A 3GTNA 3WDRA 3AHVA 1X6NA 3WBEA 1U33A 2BV9A 5E0CA 2G4FA 3T0BA 3J7HA 4LPCA 1W9XA 1OT1A 1W9PA 1RD6A 1H3GA 1BPLB 4U5KA 4TVUA 1QNQA 2YKKA 4BS0A 3WENA 4AZBA 4JFSA 2XIBA 1E70M 1JDDA 3DYOA 3L4VA 2WVVB 5GNXA 4WKHA 4P7OA 4YHEA 3SCRA 1JD9A 2FH8A 2Y2WA 5FL0A 1HX0A 5E6ZA 1BLIA 4M81A 3OZOA 4PMRA 2DIJA 1V0LA 3UG3A 3NDYA 1GOQA 4B3LA 1E43A 4GZIA 3ARZA 3K1DA 3F5LA 3CTTA 1FHLA 1HIZA 3SIMA 3LPFA 4BCEA 2TAAA 1MXGA 4BQ5A 5EFDA 3N13A 4XZBA 1BSIA 3MV01 1CBGA 1HJVA 1UWRA 3W24A 2E8YA 2VUYA 2WMFA 3SCSA 2J7HA 3ZJ6A 3VINA 2PWFA 2WZEA 3ZSSA 5DFAA 5ABEA 2ZUVA 3EDKA 2AMGA 3OGRA 4GZJA 5M5DA 3AROA 4PN2A 1GUVA 4P8WA 1HJSA 2VURA 3WQ5A 1GOWA 1C8XA 2BY0A 3SUUA 1NOUA 1R87A 3SCNA 4C7DA 2VRJA 3SCPA 3AXHA 2X1IA 3SEPA 1KCLA 4CU8A 4HMEA 1JYXA 2XFRA 2WKGA 2XVGA 3WH9A 2VRQA 4ATDA 4TUFA 1RP9A 3IJ8A 1W9DM 2FHFA 3QHOA 2ZXBA 4OKDA 1NARA 2DT2A 1CXLA 4MJ2A 3AI0A 3OLDA 1UZ4A 3WEOA 3L4ZA 4GQRA 4U3AA 3THCA 3SURA 3WEZA 3WUGA 2W5FA 4Z2IA 1PJ9A 1BG9A 5BRPA 4H2CA 1E0WA 2PWHA 4FLSA 2WYSA 3T09A 1KBKA 1EOKA 1ITXA 3VOCA 5DO8A 4LGXA 4HA3A 3M7SA 1JYWA 3HJEA 3WIJA 4OOUA 1ZBWA 3CIVA 3OBAA 3GYCA 1WE5A 3ARUA 1E1EA 4PCTA 5A94A 2YDRA 4EK7A 4BQ3A 4CN4A 1UKTA 4RE4A 3MMDA 4H8VA 4DUXA 3KEHA 4IPNB 3SUSA 2DSWA 2XYLA 2OLHA 2PI6A 2F8QA 4AWEA 2XSAA 3KL5A 1QBAA 1WAWA
chains in the Genus database with same CATH superfamily
3KBNA 2IKIA 2HPIA 5HNUA 2VX6A 1Z3NA 1UP2A 3OJGA 4JTAA 1PB0A 4HJFA 1ZJIA 5A6BD 4Q8OA 4ILSA 4GISA 4UTIA 9CGTA 4ZFCA 4LEQA 2E68A 2INZA 1GKPA 5CBBA 3ALFA 2YL8A 1LWHA 4GZ7A 2PDIA 1V6UA 5CSSA 1P43A 4TVDA 4XAFA 3SJNA 3O63A 5HULA 2HS8A 1ECQA 3WK1A 1Z42A 1H50A 3TR2A 4C1KA 5LKYA 3VNIA 2DDXA 4HZ6A 2MLZA 4GPNA 4XAPA 4JFJA 1TJ2A 2YR1A 3R1ZA 4OIFA 1TV2A 3BSGA 2D22A 3EMQA 1W5NA 3N6QA 3WN6A 2J7FA 2QKFA 3M64A 2PPPA 4O0ZA 1FWEC 3E38A 4HP5A 4PSRA 2B7QA 2FVLA 5LNRA 1YRRA 5DRIA 1XYBA 3NCOA 1XC4A 2WMIB 5ABFA 3VDHA 2YB1A 1XISA 3HPSA 3MMWA 3VCRA 3KLLA 4LVDA 1KRMA 2NV1A 3QQWA 1NU5A 3HG2A 3MVIA 4DO5A 1EOMA 4CNOA 1PX3A 4ZQPA 3SQLA 4AD0A 4W9TA 1N8IA 2ZDSA 1BRLA 3G1VA 1VFFA 2EF9A 5H2ZA 4CQDA 1ESWA 4LBUA 4LTSA 1MDLA 2WXDM 2YLLA 4BI6A 3IAQA 4PMQA 3LENA 2E5CA 3RLGA 1XBXA 2QNEA 2ZXAA 2WVSA 3UQNA 1QNRA 1GQNA 4D6EA 1M7OA 1RPKA 5HBFA 3AXMA 4JTEA 1QTWA 3W71A 3W7IA 4KCVA 4OHQA 3S5ZA 4ES4A 3EPNA 4DJEA 1V3JA 1SSGA 3KL0A 3UR8A 2LJ4A 4IWWA 4AIUA 5GJPA 2ZZ6A 1SW7A 1A49A 4FX7A 5J5DA 3VD5A 2NUXA 4DJDC 1SJCA 3K8LA 3UQIA 3DG7A 3KWSA 1GEQA 3T42A 3OOBA 4A8LA 2VX4A 1XIDA 2V5CA 5A6BA 4F40A 2YW3A 3NQFA 4K7YA 4PUEA 2QCEA 1JL8A 4W4QA 1JVWA 1IR2A 1GVYA 3BC9A 1IIHA 9XIMA 3MSGA 1KCXA 3MV11 4H6QA 3LHZA 1EYEA 1Q6UA 3NOEA 1AH3A 3NL5A 4NAEA 4DPPA 3CU2A 5CJMA 4DM2A 2GVLA 5CG0A 3W81A 1US2A 3EOSA 4TW8A 1V0MA 1ITUA 2J77A 2ZQTA 4DZHA 3E5BA 3T55A 3WH5A 3IK2A 3QTPA 5KZ6A 4L5ZA 5CZJA 2UY5A 4PEEA 3WH6A 1BWKA 3BJFA 4LCQA 5AHNA 4QLJA 3HFYA 1XIHA 4G9PA 1V3LA 4UWMA 4MADA 2WKJA 1HN1A 1M04A 2IXUA 2QCGA 3TAKA 1W3LA 3FS2A 1E0TA 1Q45A 2OB3A 1G94A 1Q6LA 2RH9A 3O07A 1QNSA 3W74A 2R1NA 3P0WA 1E71M 3BTNA 3IWPA 4LUJA 1V3KA 2OSWA 4HU8A 3LERA 2XTKA 4RE3A 4H01A 1OT2A 5AZ0A 4P7LA 1OX4A 3RHGA 5GVJA 2TODA 2WJDA 3TOPA 5F2GA 3QM3A 3BMXA 1DPMA 2OQHA 5FJPA 1ZGDA 3LRLA 5C7HA 3EOOA 4JEJA 1ZFJA 5A3HA 4NNRA 4UQCA 4H00A 4IJCA 4XAYA 2QJMA 4LNCA 3VDGA 2MLXA 4IMAA 5EU9A 1HJWA 4TV6A 3CV2A 1J96A 2DSVA 2GSJA 4IFKB 4IL0A 3H7RA 2ZQ0A 3L4UA 3QZ6A 3PWGA 1JI2A 4GUJA 1Q8AA 2ON3A 4AWSA 4JHZA 1H61A 4J40A 3SCTA 1PX4A 1DKWA 2NT1A 4PC8A 4RNIA 3BURA 4JQ2A 3UR5A 2E40A 2LLEA 3W0KA 3TQ0A 4PUKA 3AZRA 1FXPA 2J47A 4XVDA 2CWNA 4AMAA 3VPLA 2ASHA 2VVSA 2VGFA 3W7CA 5A8MA 1UR2A 3K4DA 2QS8A 2VR4A 2AKMA 2V2HA 2ETNA 1CGUA 1MXSA 4WQ6A 1MVYA 1XP3A 1NEYA 1Q2RA 3ABOA 3PTKA 1GZ1A 3K5XA 2XP9A 3WD1A 2GUYA 1M7PA 4ODRA 3LXBA 4Z17A 2WVVA 2EO7A 1F6KA 1Q65A 3DKJA 3OBEA 3R5EA 2QJJA 4KWWA 3UF9A 2F23A 1AUSL 5BMXA 4JTFA 2HCVA 4A3RA 1X6LA 1UR1A 2FGLA 4GC4A 5A2AA 1FKJA 3ES7A 5BXPA 1EPXA 1K9DA 4JIQA 5BXSA 1IR1A 1U30A 3WD4A 2P76A 3L4YA 4HKPA 1RJPA 4M8UA 1J0JA 1TPDA 4R5EA 2PF8A 4K3ZA 4DBDA 2WC7A 3L4TA 1F3XA 1VJIA 3QY6A 4JQAA 4RKAA 4QS6A 1LRQA 2OOFA 4JIEA 1YMYA 3VM7A 2EG7A 3IJ6A 4W93A 2CHNA 2QMKA 1UD2A 1XINA 1U5JA 3LSBA 4LF2A 4H3DA 2MPHA 1FP8A 4IPIA 1JRCA 3IHZA 5H8MA 3ATZA 4KF1A 3LQLA 1IYXA 4HU3A 1XYFA 2G4JA 5HANA 3NZGA 4YYCA 1QI4A 4EPDC 4L61A 4AF0B 2GK1B 3GUGA 3W75A 3E0VA 1ZALA 3G18A 4PODA 3GDBA 3PBGA 2BGQA 3QMSA 3O5IA 2QPXA 4MZYA 3AIEA 2DZAA 1UWUA 1GTEA 3C2RA 5FI8A 4WZHA 1K8ZA 2E6FA 3GB6A 4ORIA 1WZMA 2WMJA 1LRNA 2ZTKA 2CEQA 1UR0A 5G2WA 4PBFA 4GX9A 3TAOA 4DBUA 2XGBA 2JF6A 1E0XA 3GAKA 3RPMA 1FHVA 2NWRA 2FKEA 3T08A 1CXIA 2Y89A 4AHOA 4O4VA 3FW6A 2BXVA 1UR8A 2QPUA 3LMYA 4M6VA 1QJWA 1E5NA 1TRIA 4ZOAA 3IJIA 1DXIA 3TW6A 2ZUSA 1IT7A 3WNNA 4NYUA 3O6DA 4O1AA 2C91A 4DBEA 2DG4A 4WVXA 4FNRA 1TTJA 2W6RA 2A3AA 5HW8A 1CWYA 4YMZA 4XX6A 4N9DA 5FEWA 4Q4PA 3O16A 2JALA 4ODQA 1JCTA 4KEUA 4B90A 1IX5A 1Q7MA 1WXYA 4O11A 3DI0A 4UDMA 4KRZA 1DQXA 4WOZA 2TYSA 4MNJA 1W0MA 4TVCA 2VCDA 3SI9A 1W2PA 3CAVA 1BQCA 1JPMA 4ZQRA 1H5YA 2Z26A 2M1IA 3MVTA 3F03K 3NNTA 2VWTA 2ZQUA 2JK2A 2GYIA 4PE8A 4F48A 3U57A 2ZICA 4ZZ9A 3VKCA 2OJPA 4AHQA 4L1GA 1W54A 1UA3A 3SY8A 4WCJA 1HGWA 2KFWA 2XP6A 2HXUA 4O1CA 4JKKA 3BOLA 4DYEA 4M82A 3ICJA 3DZ1A 1MNSA 1R9ZA 4DUVA 5CCZA 7PTDA 4YL2A 1OX6A 3GIPA 4IT6A 8XIAA 3MCOA 4AWUA 3ZJ7A 1A7XA 1ADDA 4N9EA 5T9BG 4ZTXA 2ZCGA 3QYSA 1XSKA 3KTCA 3VOHA 4FS9A 1WB0A 5DRCA 3RMJA 4RL3A 5EPDA 1IT8A 3H4XA 3NSNA 5AHFA 2PUZA 5EFFA 3O05A 1YIXA 4FOJA 3LQGA 2BY1A 5DMNA 5IHSA 3GVRA 3ARPA 1IWAA 1UD4A 2YDAA 2P8BA 4FF7A 5HNTA 3AU6A 1KBBA 2HBXA 3KAOA 4OU1A 5K3VA 4YTRA 2O55A 1NFGA 3UPBA 4FX6M 3CJPA 4O16A 4MY8A 5JBEA 2Y62A 3TP4A 1FWIC 5EMJA 4YIWA 3AIBA 1YDYA 2J25A 1KXQA 1JZ6A 1E5JA 4Z2HA 4S3DA 2BB0A 4K1GA 1CXEA 3AS2A 4ICNA 1PDZA 3QGAC 1TG7A 4AIOA 2E8ZA 1DTUA 1UZHA 3LEPA 3V5FA 2FMNA 3ZWSA 1YXDA 4N4PA 4XZLX 1VPYA 3N6HA 1FKXA 2C1GA 3EX1A 4X2RA 2INFA 4Q8NA 4K37A 4LUIA 3FVMA 2BVTA 3HGRA 3VUPA 3W7MA 2DZUA 1OCNA 3MPGA 2I57A 2PF0A 4AZ5A 4IUGA 1B30A 1M03A 1QK2A 3QSTA 3D3FA 1KD0A 2CYGA 1YE6A 3URAA 4UCFA 5F2MA 1MEWA 2EG6A 2QMJA 3ZLFA 3RIKA 3UNTA 4OBRA 4PMXA 4LS0A 3TQKA 1UWTA 4AHPA 1NY1A 5HK4A 4KGJA 1VBGA 5AYZA 4KFOA 2E7FA 4IGMA 2ZRUA 3L2MA 4HA0A 3NSMA 1DJWA 1W37A 4AISA 2VENA 1WAUA 2VUNA 1FKDA 1JR1A 3CL7A 5A6KA 2BVWA 3TONA 4DN1A 1LP6A 3VCNA 3TEVA 5D2TA 3AHZA 3XIMA 3WJXA 4AVFA 3DESA 4F0LA 1GT8A 2EKCA 1KGUA 2G95A 3EA3A 4Q3MA 5PTDA 3FHQA 4MKNA 1JRBA 4ONVA 4NX5A 1UC5A 3HB9A 3WO8A 5D05A 5CPMA 4V28A 3UJSA 4L4PA 3RX3A 5C9WA 4XAKA 1AMKA 2OEMA 3TWAA 3M9YA 5JIPA 3W2JA 1DHKA 3RYSA 4AY7A 1VFTA 1BTCA 4UZSA 5IM51 3VK5A 3STCA 4KIEA 1N82A 1OD8A 4MAZA 1G01A 3CBWA 4BWLA 3Q94A 3K30A 4XB3A 3SM0A 2E1WA 4YU1A 4S3JA 1XRSA 4EPBC 4I7WA 3DOPA 3P61A 3S2JA 4NF7A 4IGNA 5DY3A 4IMDA 5C0QA 2ZOXA 3DYMA 5C6MA 2NX3A 3MUCA 4IFKA 1EYMA 4CNUA 3ERPA 4Q8TA 1F3WA 5E93A 3P5ZA 2PWEA 4O19A 4O0QA 2ZUUA 1V3IA 3IVSA 4R9OA 4ODMA 1WDWA 2WSRA 1EP2A 3WLRA 1K6AA 4LV9A 5CLWA 1SZEA 1XGDA 1DWGM 1OJXA 5HUAA 3W2MA 2KAUC 1BEUA 2WMHA 3GG0A 1XIJA 1B3ZA 3TTQA 3W22A 4K2SA 3MDWA 1T8QA 3O0KA 1HKJA 2GGJA 4D72A 1BYDA 6ALDA 3GXFA 2ZADA 1UWSA 1J0IA 2Z1VA 4B3ZA 5GNYA 4ZPVR 1RBOB 2H8XA 4DZ5A 5FOOA 1RBLA 4FALA 2YX0A 5HMFA 2YA1A 2TMDA 1UIPA 3MJMA 1JI1A 3VOIA 2WQPA 4CU7A 4B4FA 2BY2A 3ZJ8A 2B31A 5I7GA 3U5YA 4JTDA 4Q8QA 1TIWA 4ODLA 3FY1A 1RZMA 2O92A 2HK1A 3GW0A 3PTQA 3AS1A 4M19A 3KLKA 1HJQA 3IAPA 1AZ2A 4RDZA 3W7EA 4E3TA 1K7XA 1JCMP 4JDBA 1OGSA 1XLKA 5G4EA 4PMZA 3LMZA 4R0XA 1VYPX 3CUGA 5D75A 5AB3A 3B8WA 3NEHA 1ZENA 2I17A 4BJHA 2HBVA 5DCEA 3S46A 1MUCA 1XLLA 5FF3A 2DZTA 4XZHA 3WLJA 1HXVA 1AW1A 1RJRA 3F4VA 5BXTA 1R46A 4PFMA 2Z28A 1E6XM 2NSXA 2ZX9A 4W85A 2ABAA 4GC3A 4NJKA 2XM1A 1GOIA 3VMPA 1XJBA 4WJEA 2BZNA 2CZEA 3K8MA 5JH8A 5KZMA 3CGMA 2WZIA 5TQLA 3WLPA 1VPXA 1KXTA 4A3HA 4XZIA 2PU0A 1QW9A 1EFZA 1JGMA 2DH3A 3CNYA 3CQJA 2JIEA 1WKDA 3GNDA 3C52A 1B57A 2BHUA 1FWFC 2PDCA 4AF0A 1PYMA 2GK1A 3HFTA 1RQEA 4XBSA 1FH8A 1W5MA 3LHTA 4LY4A 1Q6FA 2A3BA 1GYLA 1FCBA 1I6NA 3A4XA 3W7JA 3A12A 4WXZA 6PTDA 4AD2A 1R9YA 2GDQA 3WLTA 3BAIA 3P67A 1D7HA 4C6FA 4UR9A 3M5ZA 3I65A 3GAYA 3A4WA 2PDMA 1LYXA 1EIBA 2DZWA 1WO2A 3U4AA 4F2TA 4NZJA 4D6JA 2I5IA 4PA8A 4YS1A 1E56A 4MG4A 3SUVA 1NDVA 1OYAA 4WDXA 1Q6OA 4F0KA 2VC5A 1XG3A 1OG0A 4KESA 4MHBA 4QBXA 4OV4A 1S46A 4HNUA 1EKOA 1UR9A 3ZMRA 1QI0A 4TV5A 1NTHA 1LL6A 1BSLA 1ONRA 3PRBA 4GK8A 4JN8A 1NFBA 2IUZA 3JU2A 4XBJA 1T40A 2IS7A 4PYSA 4HU0A 2WCSA 1T96A 5AY7A 3GNRA 4Y6GA 1XBVA 2J88A 3BLEA 4F0HA 5FJTA 1X97A 3NTYA 4JCLA 1A5NC 3MYPA 2G3IA 3WMLA 2XP5A 3RGCA 3VNJA 4RPQA 3FAPA 3AXKA 2BFGA 3QSRA 1PSCA 3OP2A 1BFNA 2A79A 3ISIX 2PLJA 3KL3A 1FRBA 5HUOA 1F3EA 2YW4A 2IXVA 3M5XA 4PMDA 1R3VA 3O8AA 4CN6A 3GTFA 1R3YA 1YATA 3CPUA 3MSRA 1YX1A 2PBCA 4OV9A 4TW6A 5D2VA 4PTDA 3GXDA 1P0KA 1A4LA 3LGEA 4ZGYA 3C8FA 1YBQB 2EPOA 2E0PA 1CGWA 3LHVA 3IIZA 3VIJA 5D03A 4I9MA 3MBFA 3QEZA 1F3TA 1QNVA 2P8CA 1J11A 3WUEA 3W86A 5M2FX 1J6YA 3HM7A 4XZ9A 4W7WA 2DIKA 4MWAD 4DXKA 2XIOA 3ZZ1A 4S3AA 1HP4A 2I5GA 3GH7A 1R2SA 4POCA 2QGYA 2BODX 1VYRA 1DXFA 4Q8UA 4UQDA 4GYJA 5EB8A 3HPXA 4DELA 1D6OA 3BLKA 2Z1SA 1CIUA 4HK7A 1ZJAA 2VYOA 1A5SA 3P93A 1UKPA 3AICA 1YADA 4A8RA 3RG6A 1CZ1A 2E67A 4NZ3A 1UH2A 3TC6A 4C6QA 1HZYA 2HS6A 3DU0A 3GVWA 4LVGA 4ALDA 1MXDA 1XLEA 2X1TA 1HKVA 4CD4A 1PHQA 5FF0A 2OX1A 4EP8C 3AZSA 4Z42C 2BTMA 1AQFA 4ZCWA 2XVLA 1TR9A 3BAXA 1ZHAA 3N2XA 3XISA 2GLKA 3TYUA 2VELA 4HMNA 3APYA 1XCXA 5TNVA 3CWNA 4J2PA 5BW6A 2P1FA 4GY7A 5B80A 3BGGA 2Z2BA 1XC6A 4O10A 3G8EA 3OYXA 5DT5A 3VILA 1CT5A 5IXEA 1EDQA 2SFPA 4V1XA 2VX7A 3TJXA 4C60A 4N6EA 3E12A 2VN1A 2B81A 4UIOA 1VLWA 4FIQA 4ERGA 3S9IA 2DT0A 2OFNA 5CZTA 1LLWA 4LAKA 1R3QA 1OIMA 4LAWA 3M43A 1JPIA 1JCYA 1XH2A 3AHXA 4FLQA 1QDSA 2HNEA 1KM0A 2QR6A 1HGYA 3BW4A 1D7FA 3CYJA 3EIPA 4LV4A 3W2LA 3S47A 4GYFA 1S2UA 3WNOA 1EWDA 3CM4A 2EULA 4DZ2A 4LWWA 4DEFA 3G24A 4EF8A 2CBUA 4UQEA 4MB5A 4F3HA 1H7OA 1WOBA 3UZXA 3O5KA 2OU4A 3NEVA 5LA2A 4FPSA 2CLHA 3UR2A 4MM1A 1U79A 2VC9A 2C16A 2D2JA 2F7FA 5CPSA 4ENLA 5DMLA 1LM1A 1KV8A 1ZRQA 3G3DA 4IH3A 5A6SA 3KUMA 1L1PA 4KPLA 3OA3A 4BEUA 2Z6JA 1BGAA 4PB3A 5G2HA 1X7IA 1VENA 4S38A 4GA8A 5I0DA 4NY2A 4ZPWR 1H51A 4KEMA 3ZR5A 2FHCA 1M7XA 4JL1A 3SRKA 4PUMA 3URQA 2FZBA 1TKKA 3LGGA 3PFRA 4TR9A 3ARWA 4GABA 3KVKA 4ZEPA 3P8JA 4DLMA 4J3SA 1S5MA 2D73A 1Q6EA 1GZGA 3BG3A 2PV2A 3OOQA 3CEPA 2X42A 3DHPA 1OG6A 3GHTA 4QDWA 3KRUA 1UD6A 4G7EB 2O9PA 1O68A 1ZU8A 1GKRA 5FEPA 1FHDA 1LBMA 5AYBA 3R8HA 1F8MA 1A3WA 1LF1A 4O4WA 1S5WA 5CPTA 1GNXA 4Q32A 1Q6GA 3DUGA 3A5FA 5D02A 3W70A 1AL8A 4O1EA 1T11A 3EB2A 4YJ5A 4ZOCA 3W37A 1MFVA 1XLIA 3WQCA 3B9OA 2E5DA 5HT1A 1F6PA 2FGZA 3UG5A 3L67A 2MUCA 2FZNA 1VYSX 3PR9A 4YTTA 4MZ8A 4J35A 1TPWA 4GY0A 2JEQA 1Y8BA 1GRJA 2VCCA 2ZIDA 4ZODA 1DBTA 1EJWC 2GVJA 3C8NA 2VZUA 3WQEA 2W66A 1WP6A 1NDYA 1EWEA 6CGTA 1UQYA 3QRHA 3R0DA 3EMCA 5A8OA 4CNNA 2OXNA 2Y7EA 2IKGA 5BCAA 2ZRXA 1QCWA 1EJSC 1UMLA 2X40A 3PF3A 4DROA 4ZB5A 3LM3A 3PBWA 3A24A 1Z69A 1ONXA 1XCFA 1RQHA 3W76A 5HKGA 1V93A 2WPBA 4ORMA 4REQB 3H6OA 3WQFA 2YL6A 3IK4A 2WVUA 1MFUA 3SY1A 2ACSA 3GU2A 5D32A 2ODOA 3REQB 2CC0A 4MY1A 2PGFA 3HPFA 5KSWA 4XTIA 1OYBA 1J2WA 3M5VA 3QW3A 1WDSA 3HQPA 2XN0A 1R38A 3W2UA 2GGHA 3APGA 2OSYA 4Q33A 3WBAA 4U85A 5I3FA 3M0LA 2VEMA 2WCGA 1DJYA 2XGIA 1E4IA 3HTWA 1C7TA 1J4RA 2H8ZA 2WANA 1QPLA 4GVGA 2ZUTA 2X05A 4HNNA 2C18A 2RDTA 3LCLA 4GUHA 5MKGB 3M0XA 4CQ8A 1E6PA 3W7OA 3GUWA 1D8WA 3L9CA 3WBEA 3U9IA 5CEWA 1O95A 1A5MC 2BV9A 2G4FA 3Q65A 1GOXA 4ROQA 4LPCA 3GZ3A 1RD6A 4TVUA 1RA0A 3TFCA 4E0CA 2KX9A 2A0NA 3IGUA 4ZSTA 5ABTA 4F0MA 4JFSA 3THQA 3TK7A 3E3HA 4UC5A 1D7KA 2FTWA 4W9OA 4WKHA 1FQ0A 2NV9A 3T8LA 3SCRA 4LAVA 1WOAA 2A6LA 2RUCA 3UWWA 1KTBA 2YZ5A 3GSMA 1GG0A 1ZSXA 2ZC1A 4PEKA 3GC5A 4QG9A 2YYUA 3OZOA 5CAKA 4PMRA 4AG0A 1E43A 2I16A 1FKKA 4GRSA 5B7ZA 3SIMA 2G37A 3H70A 1THFD 2OX4A 1XICA 4DRNA 4HSNA 4BCEA 3CAQA 4GFIA 4DHGA 1HJVA 3L7RA 2I14A 3W24A 2E8YA 1ME9A 3SCSA 3U2CA 3TDBA 3MKCA 3WBWA 3ZJ6A 1FWNA 1DJQA 3OQ8A 2RURA 3E74A 1NF0A 3MYOA 4IGSA 3A5VA 4EIVA 2AQVA 1F76A 1GUVA 3SO7A 1HJSA 4C1NB 1GOWA 4DRJA 3EEGA 3SCPA 3TVAA 3EXSA 4UTMA 3KBSA 4IL2A 3SEPA 1KCLA 3E5PA 4HMEA 3RFWA 2WOQA 4DJEC 1XLDA 1OZMA 1XIBA 3B40A 3JZEA 4ADUA 2VGGA 5EMLA 1NARA 2DT2A 2R82A 3WEOA 2ONEA 4U3AA 1KA9F 3C86A 3E0WA 4OECA 3ONCA 3WEZA 2W5FA 3NPXA 2IKJA 3PULA 5BRPA 1XYAA 3MW7A 2WYSA 3GPKA 1ITXA 1YBQA 4HA3A 3UZJA 5AECA 4OOUA 1ZBWA 3KP1A 4HBEA 1H62A 1AH0A 2ZZ5A 4JOMA 1O1ZA 4MF4A 1WE5A 2Y5JA 2WJZA 2NVDA 3ORWA 1S39A 1UKTA 1RCQA 1XS2A 4I9AA 4UNKA 2AQOA 3TW7A 1IEVA 2F8QA 4AWEA 2GWGA 1XI3A 1A3XA 1WAWA 3RR1A 4AY1A 1HP5A 4WKAA 3E49A 4I6KA 3VE9A 5I6SA 3NDZA 1W3IA 3SSZA 5KTLA 4UNIA 2W92A 3SCUA 2VM8A 7REQB 1C8YA 3F5JA 1PIGA 3TJLA 1NQKA 1QFEA 4W7UA 3B0PA 1A5UA 2PDXA 1UD3A 1SQ7A 1NSJA 4JNYA 4Z0JA 3TXZA 3WG6A 1YPXA 3IJ7A 1AD4A 3WNMA 3C0SA 4OVXA 2MANA 3DXIA 4MB1A 4D1IA 3SCOA 2X2GA 1LQAA 2J6XA 3B03A 1KTCA 3W27A 5LGZA 3AISA 2W79A 4R3UA 1KFKA 3TYEA 3NR0A 2VOMA 4WDTA 1WDRA 3UA4A 3TLLA 3C2VA 3M44A 2YIHA 2R8WA 3H4WA 3WL1A 3B9EA 1UPPA 4QM1A 4NAFB 5K4ZA 2I9EA 3ITGA 1YHTA 4A29A 1S2AA 2B7OA 2JKAA 3SSJA 1SU5A 3NRKA 1VFMA 2A7PA 3C2YA 3PN8A 3H26A 2Q8ZA 5AC5A 3SIZA 3WQGA 2YXXA 2X1SA 3A23A 1WZAA 3HG5A 2E1DA 5BRQA 3AJXA 3KTXA 1SFSA 1U2YA 2NWSA 2Y5SA 1MEIA 3D47A 1GYMA 2OG9A 1JFXA 1QVBA 2PPOA 1QO5A 2FAPA 3T44A 5FF7A 1S1PA 3C56A 3HV9A 4D9PA 4RZBA 3KVMA 5FSEC 5ECUA 3G0UA 1OY0A 2OKTA 2ZXDA 1GKQA 2BXZA 2XFWA 2YL9A 4P8UA 3VKDA 3PAJA 4KEZA 4IF2A 4WY0B 3JVAA 1VF8A 4HBOA 3S6OA 3GY1A 3T81A 4XKMA 4GFSA 4QTGA 4CEUC 4DF1A 3INPA 4D6GA 3EB3A 4X63A 1JQVA 1NDZA 4LJ3A 3SUWA 4GIEA 5XIMA 1XF0A 5REQB 5FEZA 4GQBA 3NQCA 4XZNX 3ZVHB 1G4TA 4MLJA 4IIGA 5LA1A 1PDYA 4DUOA 4A6GA 4L9XA 4J2MA 1GQJA 1DQUA 2WKLA 5GPRA 3CLMA 1XIGA 5G1TA 1R8LA 1BAGA 1G0CA 4NNBA 1W32A 5MF5A 3PRDA 5D38A 4ZVJA 3NL6A 3CEUA 4FNSA 5E1QA 4Z1BA 3W4RA 1TR1A 5CG7A 5BYWA 3R0UA 4UOZA 2ZUWA 5DT7A 3KZ7A 3O9NA 1LRTA 3RDKA 1YW1A 2XZ9A 3TYBA 3TYAA 1P0NA 3V1PA 3LGDA 4DXXA 2HROA 4JTLA 2GFTA 3FAWA 5DF0A 3GHRA 3UXDA 4MOZA 3MDYB 2D2OA 3T4WA 1NDWA 2QEZA 1QZ2A 4PTMA 2P53A 4XUGA 4US6A 1KRAC 4L56A 1J2BA 1OABA 2NW0A 2PDBA 2GJXB 5HQLA 2Z27A 5KZDA 5LA0A 2VVNA 4V2XA 4EOUA 5C2GA 2Y78A 3LRMA 1Q63A 2P50A 4ITZA 1FWCC 5JIWA 2XVPA 3TE9A 1H11A 2PWDA 4UFLA 3O0FA 4PMYA 3CUJA 3IPWA 5HATA 2A4AA 4YVXA 3BICA 3E0IA 1YPFA 1ZY9A 1K3UA 4L4LA 2V3DA 4QDMA 4Y9NA 3I6RA 3DFYA 5HDRA 3C2EA 1LROA 3QV6A 4L72B 2J66A 1PIFA 1V6XA 1ISWA 2XH7A 2NLIA 2RAGA 5DCDA 2FZ8A 4O18A 4FB7A 5IBXA 4MB3A 3TSDA 1VZWA 3V5CA 1ISXA 3PWAA 5L9FA 1V02E 7TIMA 4RXGA 1NP2A 3EOEA 1N7KA 1LQ2A 3VFLA 2KZHA 1OF8A 3GU1A 1BWVA 2W0UA 1WDPA 3BANA 3UJEA 4C6LA 1DE6A 3MJYA 1LUCB 1OINA 1UBSA 4REQA 3DYPA 5G5IA 3M0YA 4NASA 3IJ9A 4JR5A 3PWIA 1TE1A 4P8VA 3REQA 2AKZA 4KWVA 3UWQA 3A3WA 4DT4A 1QWKA 4ZO8A 2XM2A 4BHYA 4E38A 1TPH1 3THUA 1O5XA 3N29A 1MW3A 1ZAIA 3CV6A 4L7ZA 1R2TA 4AFYA 4LU0A 4ATLA 2WK2A 1G6CA 3H7VA 2R1MA 1J01A 1M65A 4W9QA 3M7WA 1C9WA 4NJIA 1RR2A 3B0UX 5D2YA 2INEA 1I2NA 3O5PA 3C2OA 3KAFA 1I60A 4O12A 4QQ3A 1E0VA 2GJNA 3VGGA 4B15A 3RAOA 5MKGA 4AEEA 4U31A 3WF3A 4YYFA 3ID7A 4HD5A 4QAIA 4GCXA 4GBDA 4DBWA 4AZGA 1W17A 4YPJA 5CGMA 2QPSA 1SZGA 3BG5A 3GLCA 5CC5A 1NH6A 4HK5A 1EJRC 5LNUA 1KLZA 4D6IA 3U4FA 1FJDA 2OO6A 3CK5A 1V3HA 1F9CA 1XIIA 2PZ0A 4D6DA 1B3YA 1E55A 3P3BA 3ZT7A 1E51A 3WFLA 5ECVA 1F61A 4K1WA 5MHBA 3UCQA 4XD5A 4NQ1A 5CPLA 1DWAM 3OLGA 1B5TA 2V5LA 4M6QA 4NNAA 1W1B1 1HKWA 4CLMA 2OTDA 2VFIA 4ZB2A 3V5OA 3FFSA 3QPYA 4JYEA 1RY8A 1A0EA 1GOKA 2FMOA 5HMSA 2QCFA 4NI8A 2R9RA 3S1UA 3B9NA 1OVDA 2WSPA 3VIFA 1NOFA 1QPKA 4UQ9A 2HRWA 3GXTA 2PFHA 4DBSA 3UXLA 1JXKA 2QDDA 4HN8A 3R11A 4F0RA 3VUSA 3M5YA 3IRDA 1C93A 4JY9A 4ZA0A 3WF4A 2RGLA 3MUXA 4C1NA 3G1XA 1KM1A 4DZ3A 1UJQA 3I68A 3OGSA 1H1ZA 3MSYA 1MUMA 1FWSA 3PG8A 2ISFA 1W5OA 1OFRA 4H8HA 2WZTA 3F2DA 1YDNA 2ZX8A 3UCDA 4GGHA 5A2CA 3UFYA 3KRSA 5BOOA 3O5EA 3MI6A 1A4MA 3CMGA 4L6OA 8XIMA 3DDMA 4IQJA 2LGOA 2V3FA 3WK2A 1X8CA 1CB7B 1IXQA 1JDEA 4N7QA 4H7VA 5FAGA 3W1UA 2Y8VA 4RXFA 2VFFA 1PL9A 1YQ2A 3OVQA 3FEMA 3G1HA 4MTVA 4EWND 3I4EA 3L4XA 4MLRA 3FXGA 2MF9A 1I2PA 4JHOA 1AVAA 3PZMA 3CZJA 3EWWA 1JZ2A 3GR8A 1UROA 5C2CA 4FX8A 1W3HA 3GK0A 3BLIA 1Z9AA 2DORA 3LV5A 1XXXA 3CAWA 3S3GA 2DQXA 3G1RA 5E0KA 2WBKA 2J7DA 4QDPA 3FJ6A 1JGIA 3IV3A 3NUKA 3GNOA 3W1PA 3AIRA 4RZ4A 3T8QA 2F84A 3H2NA 3GXIA 4ZFMA 3B97A 1LL4A 5JVLA 3T7VA 2H90A 3A21A 4B3KA 2ZDRA 5CKSA 2J8FA 4FXSA 2JZVA 1O12A 7REQA 1EPVA 4XZWA 4D6CA 1NOWA 4RE0A 3R7MA 2ATSA 3OGVA 4XQ6A 5HTGA 3W2KA 4XKYB 3BCFA 2YFNA 1QAPA 1DIEA 1FDJA 3HV8A 1X38A 1ZTVA 3V0TA 4C6DA 4Q22A 4GI6A 4PUDA 5D2WA 5A6TC 1VEPA 2ZE3A 2F61A 4NI3A 3AYVA 1RP8A 1SO3A 1TB3A 4DJFD 1F40A 3L65A 5L6UA 3HG4A 2E25A 2CFFA 4HNOA 3BCJA 5A8PA 4MSSA 4RW3A 3D3AA 4IPPA 1LBFA 1HL8A 1V4YA 4M51A 4P5UA 5CBJA 4AEFA 5I3KA 4FXJA 1J93A 3JW7A 1OX5A 1LG1A 1QW7A 4NAFA 4U2ZA 1FKRA 3GS6A 4BWLC 3P74A 3N25A 2IQDA 2WZMA 3GTIA 1VIZA 4HU4A 2V30A 1GPFA 3GG7A 3MHUA 2D0HA 1VEOA 3R6IA 4BEQA 4MDOA 3TROA 2EGZA 5D9OA 3CPRA 2WMGA 1GWJA 3I3EA 1S3TC 4P7QA 5HA7A 3WLHA 1LOQA 1X1OA 4I7VA 4DH0A 4O15A 1GW1A 2LPVA 4CD5A 3KCEA 4HYWA 4QX4A 1E40A 2G50A 4QCEA 4MUPA 4W5UA 4GE8A 5A8NA 1H7WA 2OEKA 1UC4A 3SGZA 3MP3A 4KQZA 1YEYA 3VZYA 1B3OA 4IX0A 4YTQA 3W87A 1JPKA 3NQ6A 4ML9A 3NG3A 3GIYA 1FUYA 3U0HA 3S2LA 4HPJA 1W26A 1GVOA 2EHHA 4LT9A 7XIMA 3M0ZA 2G97A 3QHMA 5I00A 3GD6A 3NXFA 3ANYA 3LNPA 4S2CA 2ICSA 1E1FA 2XIJA 1EDTA 5REQA 2WBGA 4BFAA 3ARYA 3LCXA 3ZVHA 4DRQA 1POJA 4XAZA 1G7UA 3OO2A 4O57A 3SGGA 4BQ2A 4DRHA 3POCA 3T78A 1ISZA 1TSIA 3W6LA 1K6WA 4GVHA 4AUBA 3SGUA 3EPMA 1EIXA 4US5D 1OFDA 2C8NA 4MUZA 4DF2A 1VEMA 1Z8AA 2NVAA 2XVNA 4O54A 3THDA 2YBVA 4DI8A 4F9JA 3CHFA 4RDYA 3UU0A 2D2HA 4DJFA 4KS0A 1MDRA 2DSUA 3EA1A 1W5PA 5I98A 2RKXA 3EWZA 1KWGA 1AH4A 4G8TA 4AC1X 5CZKA 4H8UA 2Z2UA 1QK0A 3CH9A 3GX9A 3MZNA 3PZTA 5T26A 5EKYA 3PJUA 1I0BA 3BL3A 4O2TA 2PV1A 3V75A 4C6BA 1C8QA 1O6IA 4E2VA 3GTYX 3F5KA 1IZJA 5J6EA 1SW0A 2PA6A 4JTSA 1E72M 2BOGX 3EDFA 4Y96A 4JAWA 4O53A 4CU6A 3CHEA 2WC4A 3ABZA 3QQ0A 4LUTB 3WJZA 5CPNA 3EXTA 3EKLA 5BXRA 2E77A 3EWCA 2C1IA 4HHLA 3NPWA 4GVFA 3GR7A 4K38A 1JYNA 3UESA 1OQFA 1ZCNA 4HMCA 2OZ8A 2HE8A 3UCCA 4AEOA 1QT1A 3RLHA 5JBFA 4AYSA 3F4DA 5I2UA 2F2HA 2UY4A 4INFA 4L9ZA 1TTIA 4I6VA 1US3A 1FWDC 4ATWA 4EAYA 4TU1A 1S5VA 1E9LA 4JEQA 4BF8A 4JQ4A 1FWBC 3WQ4A 1ZCOA 1KFWA 1SJAA 4NU7A 3CAKA 1GEHA 3NL2A 4UTJA 1D7IA 4TX0A 4S3GA 3AIVA 1EQ3A 1VQTA 3RJYA 3BW3A 4GIAA 2NVCA 3ABQA 2Y4SA 3QOKA 1PKMA 1XYCA 2V38A 2JEPA 1EGMA 3KRZA 3LA4A 2QCDB 2ZA1A 3GTHA 2JGYA 3SRDA 4J27A 1TPFA 3R43A 3GBEA 3WK3A 3C61A 4F4RA 1GOOA 4N19A 1H7NA 1PZ2A 4UFJA 1P6BA 1GGOA 3O5MA 3WH0A 3LHYA 5HW6A 1RAKA 4DO7A 4US5A 1TO3A 1XGEA 1M1BA 3OVRA 3W7NA 2UY3A 1EHNA 1RCXB 4O52A 1L6GA 1PTDA 4AD1A 4EX4A 3R8RA 4TNSA 1JDAA 1MW2A 2ACRA 5E6YA 1PBKA 4S3KA 5DXYA 3TDFA 4F2UA 4N0RA 5J8LA 1RALA 4H9YA 1H2JA 3FVDA 2BS9A 4R33A 4M1RA 1O66A 1W8GA 3WMSA 5G1YA 5GJNA 1VCGA 3SZ8A 3WLOA 4FO4A 3FKKA 1UR4A 5M17A 3QGVA 1XD1A 5HQMA 1G9HA 1T5AA 1RBAA 2ZVIA 1SFJA 2IW0A 4HA4A 1M41A 3VNMA 4UCGA 3N3MA 2AMXA 3HQOA 1XUZA 4J3UA 4GKLA 2NV2A 3V35A 4AZ7A 1VC4A 2XISA 5CSUA 2HTMA 2Z24A 3MUAA 1QW8A 2XH4A 5B7YA 3W1NA 1LWJA 2HEJA 4LX4A 4X61A 4FEZA 1J5TA 1NIUA 2QCLA 3CUHA 1YTEA 3MQTA 5LIKX 1FCVA 2GJPA 3POHA 3VC6A 4X0VA 4ASTA 2W67A 5D33A 2C0AA 4IJRA 3BZGA 4B5NA 2R1PA 4C6OA 2YDQA 2X30A 3U48A 2NX1A 4W88A 4Q4RA 1UB3A 4Q8VA 5FJIA 3NPUA 1SO6A 1WKEA 1UCWA 1HVXA 3K13A 3LRKA 3LV6A 4TOQA 4QT3A 3AIQA 4H9XA 3E2VA 3K2GA 3AS3A 4AVNA 4B2DD 5AC6A 4H41A 4K8HA 4GNKB 3CASA 5D8ZA 2DG9A 1X98A 3U3HA 3R25A 4N42A 3GG8A 1Q4NX 2L2SA 4ZXOA 1FFQA 2P10A 2PGEA 4W89A 5TAOA 5KMYA 4QIUA 2C6QA 3DX5A 3PZVA 2GJRA 3WF0A 1V03A 4PTXA 2A3LA 3OTRA 4AVOA 1V6VA 4LAUA 1GJPA 2CZVA 4HYVA 4GI4A 2C0HA 2Z6IA 4PCNA 4UZUA 1SR0A 1BKHA 1UPMB 3WDIA 2YCEA 5HNRA 2E6AA 1ONEA 5AHIA 3U2EA 1EJVC 1VFUA 2ZWZA 4B92A 2J6VA 4HIBA 4UTFA 4U10A 2CLKA 1JUBA 3E0FA 5EMYA 3AQUA 4LAXA 2XIIA 4AZIA 1VRDA 5M3WA 2WHLA 3ARRA 2VZOA 1P6CA 4IGHA 4P7RA 1J0YA 4TTGA 4Z2LA 1SJDA 3QPZA 3W82A 3EXRA 1F4AA 1B90A 5TF0A 3F2CA 4J3XA 3T05A 3TSBA 1FCUA 3PM6A 4U33A 3D6NA 1E15A 5LGXA 4M0XA 3WLSA 3AMLA 1TQJA 1TJPA 2OQYA 2CPUA 3PTDA 1JNTA 2HVNA 3MANA 2VXNA 4WDWA 4GCAA 4I9JA 4R7OA 1EGVA 2YA2A 4O50A 3LTPA 2E3ZA 4U28A 2E5BA 3PNUA 3VGDA 2POTA 2EPNA 3PBUA 3TFXA 1G1YA 4LS2A 3URNA 1TWZA 2Y63A 5C8BB 1E3XA 1MEHA 3GDMA 3SDOA 1YTKA 4QJ3B 1EZWA 5J04A 2FIQA 5I09A 3PBYA 3C3UA 3CV7A 1A0DA 3VDCA 3WJWA 2A3EA 1YNYA 3IANA 1XBZA 4B2DA 1SM9A 2CLPA 1PXGA 3W07A 4JFIA 3PAOA 4LFYA 4IP5A 2DV0A 4GH3A 4LVAA 1OBAA 3T2QA 2NXGA 1EO7A 3HGSA 1I2QA 4NRSA 1E6ZA 6REQA 2PDHA 4TX6A 1TWIA 3ANVA 3N4AA 4P8XA 3DHUA 1QI3A 4U3CA 1R3WA 1W3JA 1NWUA 2YB4A 3KRBA 1W91A 3U7VA 1OB0A 3HMCA 1ZP4A 3II1A 4F79A 3BLFA 5C71A 3PANA 3PUDA 1QPFA 3A47A 3TNOA 2OGJA 2CHRA 1LLOA 2ZUNA 1PS9A 4CKQA 2AAMA 3WQPA 2D9FA 4JICA 1DE5A 4JYDA 4IUOA 4GQGA 2D0FA 1KFBA 3KX6A 3QPEA 3ITTA 2PSNA 5F2IA 1KFEA 1HQTA 4ZQOA 1PWLA 1J5SA 4N02A 3UETA 3UXKA 5I5RA 2CERA 1V79A 1W1YA 3W1AA 2GZXA 4L6DA 1YTDA 4RNJA 1GONA 4LANA 1Q6RA 3KHJA 2F4EA 3NO1A 4IP7A 4WHBA 4QJ5B 3I3DA 4UTTA 5BU6A 4OTKA 3T0TA 3W7RA 4MVAA 2RGMA 2F6KA 3KACA 2OLAA 4XTDA 4Z1AA 3F1QA 3R8GA 2FDSA 3W72A 2UWFA 2VZTA 4RW5A 4UMCA 2A85A 3CQHA 5KETA 3W7GA 2H3DA 4W8AA 1KKOA 1VFHA 1H1NA 2PGRA 1W1ZA 4IXHA 3DC0A 2UZ5A 4Q8PA 3L0KA 3EKZA 3P62A 3ZS4A 1RVKA 5I23A 4S39A 1GHRA 3N19B 2YFOA 3E2RA 4LUTA 2YCLA 1LOSA 2J8TA 2OPJA 1K03A 4H6KA 1EXPA 4OUEA 4UBPC 1KQZA 1V5XA 1C9HA 1VBRA 5CPOA 4LS1A 3N12A 3L12A 3KZPA 4DX3A 1G67A 3WD2A 1ZLPA 1W2VA 4GH1A 3VU2A 2P3ZA 3H4GA 2FH6A 2W27A 1WCGA 1IZKA 3CZGA 3FHAA 4H9VA 3WUFA 1JNDA 1G4EA 2GGGA 1W9BM 2CLEA 3FYYA 3A64A 2MNTA 4JQ3A 3WQ6A 1KGWA 5K9DA 5D9PA 2WLZA 4U4MA 3NXLA 2REQB 1P0BA 3BO9A 9XIAA 3DHFA 2C3ZA 2VFGA 3QTGA 2ZYFA 3APTA 3NO3A 4GACA 1EA0A 2B0MA 3MMTA 4M56A 2N87A 1VPQA 2QCDA 2QJGA 3VIOA 3NQVA 5AN7A 2QHAA 2Z1XA 4UFMA 1IQ8A 2FHBA 1V02A 4G50A 3HPZA 4V27A 1IT0A 2OQLA 4HZ7A 1MRAA 2FJUB 2O0TA 3CXOA 2QULA 2EXOA 3GBDA 1JXJA 2EJ1A 3R12A 2QQ6A 3PZOA 1VFLA 1XV8A 4ZQCA 2J75A 1R7OA 3V1HA 1Y0OA 2FFCA 4E3VA 2BOFX 1TELA 4A22A 3MB9A 3HU7A 1OC6A 4C6JA 1JPHA 3PVFA 4QP0A 4AMCA 2YCJA 1UZDA 3N18A 3KWXA 1T99A 5BOFA 1AA1B 1SUXA 1MWOA 1TV3A 2VEFA 5LNSA 5H1WA 4XBKA 4PMNA 3UY8A 4V15A 4JFTA 4I3GA 1CGTA 2KI3A 3MZ2A 4L1XA 4NL1A 4IT4A 1UUMA 4AD3A 4RR4A 3GFZA 3TW9A 3PB2A 1VKFA 1IWPA 1IIGA 4U84A 3FYOA 2CLIA 1PV8A 4MB4A 4BY3A 3G1YA 1BYCA 2F6UA 3BOFA 4KR0B 1LORA 4UTKA 3VXGA 3OG2A 3VD4A 1GQLA 1OFBA 4LCRA 5C9XA 4IISA 3CZLA 4AX7A 1B3WA 1H1YA 1TPVA 2W63A 4MJ4A 2VQTA 1HL9A 3FLUA 1BWLA 3P7YA 2RJGA 1B0IA 3U2OA 2XN2A 2VC7A 4Y8EA 3S1VA 4HHPA 5IRPA 4XVEA 1F05A 3N1AA 1W1PA 3GDKA 4KQNA 2PU1A 3NQMA 3WDRA 4JTGA 4A8IA 4HNLA 3CL8A 7ENLA 2CWXA 4FZIA 4O1BA 3LI0A 3O7UA 3O6YX 3PSWA 4U5KA 4B5TA 2YKKA 3F2BA 2QUNA 1Z48A 2HDJA 3WENA 4HNCA 4ZOBA 2XIBA 1VR6A 3W1XA 3L4VA 3MY9A 5GNXA 1DIDA 1W56A 3R79A 4YHEA 4RLIA 3JS3A 1O5QA 4ODNA 2Y2WA 3OHMB 2Z7KA 2PV3A 4NX0A 2ZR5A 1A5CA 3AUOA 5AHEA 3UG3A 3BV4A 1VP5A 3W01A 1TV8A 2B7NA 2ZZ2A 3K1DA 3N2OA 3F5LA 3CTTA 1HIZA 2QV5A 1E9IA 1K4GA 2YXGA 3NPVA 4BQ5A 4E2BA 3N13A 1ZP3A 3S0CA 1BSIA 3S2MA 4DB7A 3RU8X 1VCFA 2VUYA 1ZQ5A 3TQPA 1PWMA 3GE7A 2OODA 2WMFA 2J7HA 3BARA 4B91A 2WZEA 2PE4A 1I2OA 2ZUVA 3BQ6A 2VDHA 1EJXC 2OELA 2PDLA 4Z1DA 3VYLA 3OVGA 4EPKA 3N9RA 4DAFA 3WQ5A 4C7DA 2X7WA 2BBFA 5J5RA 2X1IA 4CU8A 5F2LA 4QQUA 3S1GA 1SFLA 1JCNA 2C71A 4RZ6A 1W9DM 3GDTA 4XK2A 3H9RB 2I5QA 4GMEA 4OKDA 3H21A 1OFEA 3OLDA 4JYFA 4C6IA 1I4NA 3SURA 2PDGA 3WUGA 1BG9A 2Z0IA 4H2CA 1E0WA 2FZ9A 3VOCA 4YWIA 3BJSA 1JYWA 3RGTA 2ACQA 2VR2A 3WIJA 3Q2DA 2DU2A 3H2OA 1J4IA 3CIVA 3JXVA 4GXWA 3E0LA 3IIPA 3ARUA 1E1EA 2TSYA 4EK7A 2ITKA 5F1VA 3KEHA 4DQWA 3TN4A 3DC8A 1PIIA 4IPNB 1E9YB 2BLEA 5HMEA 5HWBA 2PI6A 4EWJA 1QBAA 1W3NA 2YL5A 2GDVA 2OLSA 1HKMA 1YNQA 5G2IA 2EAWA 3S5NA 3KOYA 4ZO9A 2CCRA 3VMNA 3FOKA 3VIMA 4PUNA 4CUCA 1ZUAX 1K8XA 2V5BA 1CXHA 1J12A 3QR3A 3FEQA 4HHMA 3UPMA 1TMHA 3WFAA 4WK9A 3PTMA 1L6YA 1S2WA 1C92A 1A80A 1VHCA 2P4VA 2DZVA 4L4OA 2PTYA 1AK5A 2VOTA 3RCNA 3RU6A 4C5ZA 1W9UA 2L5HA 5F4WA 3H24A 1QPNA 3QF0A 3TNBA 2A21A 1FKWA 4H9UA 2DIEA 2WMIA 2PODA 2X1RA 4G2DA 3CWHA 3CB8A 2J24A 3H53A 1JAKA 2HPMA 4ZSUA 1Q6HA 4HPNA 3LD5A 4A3YA 4KCTA 5LIYX 3IKDA 3WF2A 5EBAA 2PLCA 3A9IA 5CSYA 5IBXC 5I3GA 3LOTA 3TYCA 1LQ0A 3LCFA 1O7AA 4CQCA 3ZO9A 1Q6CA 1YPIA 5C54A 4O1DA 4DF0A 2ZA3A 3M46A 4PBGA 4PRWA 4BA0A 3P14A 5HWJA 2CKRA 2CZDA 4IIDA 3GNPA 3U5UA 3UW6A 1E9ZB 3D5HA 3UZ5A 3A4JA 4CVWA 1G7VA 1NJJA 3NYDA 4KCWA 1XLCA 4JFMA 3UERA 1LTDA 2XVKA 5E09A 2BX7A 3QV7A 1QHOA 2DQWA 3W1TA 4LUYA 3P2VA 1FKHA 4ODOA 2ZUMA 2DVUA 4Y7EA 3O6AA 5ABFB 1BVWA 1BQGA 3A4AA 3EYPA 3XINA 4QRNA 2OVLA 3GZAA 1KM6A 3W6MA 2Q3OA 3S42A 3TA6A 3UNDA 1L8PA 1U1UA 4N9CA 1F4HA 3GWQA 3P81A 4DLFA 1UUOA 3SW6A 3AO0A 1SYTA 4MNKA 4LRSA 1I0DA 5A69A 4IIFA 3B0XA 4DRKA 3TKFA 2PMQA 5D8WA 1R3RA 2NUYA 3NQAA 5HJXA 1JCXA 3VNYA 3LCIA 4WEVX 1OK6A 1FP9A 3W53A 4ZE4A 4LY8A 4QJ1A 3AJ7A 1QMLA 3EMZA 2FKPA 3W9ZA 3G6LA 5CZSA 4QSHA 1ECEA 3UJRA 4O28A 3PPHA 2FJKA 1KRCC 2BHZA 3OZPA 2DT1A 3WNKA 4ML4A 3MMUA 1TZ9A 3KOXA 2REQA 2G0WA 2FGBA 3TXVA 1VLIA 1EQCA 2OT0A 4QCFA 4Q7NA 2Z4GA 4Q8WA 1W1IE 2IPJA 2PRHA 3S1XA 4GUIA 5F1UA 1K8CA 3WEMA 3GVVA 3MC5A 3U7BA 2QVHA 2I9UA 1BG4A 1BXBA 3ARSA 3VIKA 4W84A 2VCAA 4JNZA 4CD7A 2ISVA 2QDHA 3WYZA 3W1RA 2HVMA 2UZ9A 5H8UA 1EBHA 2I7GA 5C55A 3ZT6A 1M6JA 3CGNA 1OM0A 5I77A 1JCHB 4IM4A 3MTWA 4CNSA 3RCMA 4G56A 5EGRA 2J9YA 4NJHA 4ZQMA 2R1KA 1A5KC 4YCOA 2WLYA 3O5GA 3MKVA 5BWFA 1NELA 1KXHA 1IEXA 2ATMA 1VJSA 5AYXA 5I03A 1SSDA 2W61A 2R6OA 1Q7ZA 3W1QA 2ZKMX 3LS9A 3WL0A 3PHAA 3BE7A 3L5MA 3NO5A 2IPWA 4HB7A 3NJ3A 3S5OA 3UGVA 2ZXQA 4H9TA 2OT1A 1Q7QA 3N2BA 5KZEA 2C15A 5GJMA 3DERA 4AIEA 3VMOA 5CAHA 2ZQSA 3HZ3A 1GORA 4FOKA 2YYTA 1HKKA 2OGYA 1BYBA 1PYFA 5I79A 4E8CA 3PZIA 3L66A 3LCHA 4EPEC 4O13A 2ZE0A 1Y5VA 4Q7IA 1EEXA 5JU6A 3TCEA 1WX0A 2Z00A 1JDCA 2ZFAA 5IHRA 4YNGA 4GO9A 3QJAA 2Y8UA 3PZQA 2OZTA 3RITA 3K1GA 5LNVA 2Y8KA 5HXMA 1UHVA 4GY1A 3WF1A 2PURA 3ITLA 2AGTA 4WF7A 3K4AA 5LSMA 1VRXA 3AUJA 1QI5A 1KKRA 4WJ8A 2DY3A 3QFEA 2EPHA 1KM5A 4K36A 3W29A 1LJYA 1EZ2A 3EOLA 3BV7A 3MDUA 2QCCA 1W1TA 1EX5A 1L6FA 3W88A 2OWWA 1MO0A 3W73A 2E6YA 3WJSA 5FJRA 2J7GA 1IXPA 5XIAA 1Z41A 4WSHA 5HWCA 1H0GA 3VNDA 2WAGA 2PWVA 1QU4A 4IOTA 3CWOX 3ARVA 1WYIA 3ONBA 1XSJA 2FFIA 2WPGA 1B9BA 3UJFA 3NI6A 3OLIA 4GGBA 4FOUA 2EG8A 2O4MA 3CUFA 4UFKA 4ODPA 1JFHA 4LAOA 4U5IA 2WNNA 3RO6A 3TWBA 4Z2KA 1OZQA 1NWRA 2XFFA 3IJLA 1UUQA 1FKIA 4OWGA 4XAGA 3USZA 1IGWA 3E2SA 3UP8A 3AYSA 4C7FA 5AYIA 4Y90A 4K39A 3EWDA 1K02A 4ZPTR 2A2IA 4O8AA 5AC8A 1G5AA 3V4BA 1TRDA 4EF9A 2F9RA 4AAJA 3DFPA 3OVPA 2KGJA 1IEIA 1TCMA 1YW5A 1XH0A 2YXOA 2JGQA 3T9PA 4J28A 3O5LA 4IIBA 4LUSB 1EGZA 1Q6DA 3LUOA 1V3MA 4DWSB 3HN3A 3LCGA 4NYYA 1VS1A 1FWTA 3O2LA 3ZM8A 1XX1A 1PCKA 2V5JA 4CVUA 2XG9A 4DO4A 3IIVA 5M1TA 1DJNA 2DH2A 3NOYA 1NQ6A 5A8QA 1Q6IA 4XZMX 3WH7A 4GJIA 3SADA 3UXAA 2Q8XA 5I3IA 3GIQA 1HO4A 1BKSA 1JNSA 3O5FA 1FKTA 3MCMA 4J7RA 4L65A 4Z2JA 3FX4A 2DVTA 2V8ZA 2VZSA 3G8RA 4NSBA 1AODA 1PZ3A 4A05A 1R9HA 2RUQA 3C4UA 3MA8A 4GIRA 5AFDA 3M0IA 1OEPA 3LU2A 2FYMA 1F74A 2PBOA 5KITA 1A3HA 2VEPA 4IFRA 3AXIA 2D3NA 1IEQA 3IUHA 4KMQA 3EAUA 5CGTA 4L64A 4O0KA 2XJ7A 3HURA 3IJDA 1U1HA 1VHNA 4MJMA 3VAVA 1P0EA 2CLLA 3TOYA 5K2ZA 3U8GA 3GVGA 3DI1A 3T0DA 1E44A 1CENA 3LLDA 2YA0A 3W7PA 2Z25A 2JFEX 2J74A 1WZKA 4JQ1A 3DN5A 4O8RA 4QE5A 4W5ZA 3UVAA 3FAXA 1EDGA 4I5UA 4DJFC 4KETA 3NM3A 4URIA 4I7UA 1W1A1 4MGGA 1KTNA 4JTQA 5DO2A 3QYQA 3PPFA 4HOWA 2VMFA 1CDGA 2CETA 3BMBA 3G6MA 2G3NA 3RMEA 3WLNA 2ZBTA 1FH9A 4PRTA 1PPIA 4WJXA 4C5YA 1SFTA 2PDNA 5FAJA 2VP8A 1Z32X 4GXMA 3M4HA 5HOSA 1G4SA 1KT1A 4RE2A 1DWIM 1P5QA 1FDZA 4IMCA 1AZ1A 1XQLA 4DNHA 5IDZA 2PAJA 2VD8A 1J6PA 1XDMA 3KTSA 1CCWB 2V0TA 3HQ1A 3BQ5A 1QO2A 1CLXA 4LSBA 4GQ0A 1XYMA 4XV0A 3OB8A 1QPOA 3PPGA 3O6CA 3L5LA 3STEA 1E0UA 3G5EA 5CH9A 3WMCA 6A3HA 1VFOA 3IKGA 1BXNA 3PY2A 3H2MA 1YLVA 4ZL1A 4FK9A 1W9VA 5SWUA 3P84A 5IDIA 5FSDC 1P48A 1JEZA 1T41A 1NMVA 1Q85A 4QLLA 1FFRA 5DMYA 4MYAA 1UD5A 3RJXA 2JKEA 3QV8A 3WD0A 2PTDA 3ITVA 1DHPA 1PZ0A 1J0KA 3VA8A 5TBOA 1OGGA 4H7ZA 4X9YA 3STFA 1LT8A 1RXOB 1REQB 1EUAA 1K9FA 4HPXA 4QAWA 3PSVA 3FXYA 6XIMA 5FD0A 3M41A 1ODUA 2WHKA 4NNCA 3GHUA 4GIVA 5HJYA 2WW5A 2V2CA 1VFSA 2DP3A 2F38A 3CH0A 1WPCA 3CO8A 1I1XA 1ME8A 1MYRA 4LAYA 3BWWA 4H4IA 3MU7A 2FB3A 1WXZA 3H12A 4EAMA 3LPGA 1C7SA 2PDPA 4QEEA 2QLYA 1B3XA 1OC5A 1EA9C 5FJOA 5DY2A 2VQUA 2JIWA 1P4CA 1W3KA 4FSAA 2Z29A 3G2GA 1XDJA 5EA9A 4JTUA 2D3LA 5TD4A 3T6CA 3BLLA 3TUUA 5A8GA 4IMGA 1A5AA 2CESA 1ITCA 1KM2A 4GIYA 1PKYA 2OEJA 4I5XA 3G0SA 4ROPA 3VD3A 4LAZA 3BW2A 5D4YA 4XISA 4PUJA 3LZ3A 1WQ5A 1RH9A 3NZRA 5LIWX 1POKA 4MPKA 4U86A 4XUYA 4FAMA 4HK6A 3PUEA 2A6NA 3FSUA 1DL3A 3WMBA 4HGXA 5H91A 3T0CA 4UTWA 1CGVA 3C2FA 3CMJA 4TMBA 4DYJA 2QUTA 4UR7A 1A5BA 3BH4A 4GUGA 2OYMA 4GO8A 3EX2A 4R53A 2X0HA 3AS0A 3MUIA 3WNPA 1A50A 3CB3A 3W7QA 1DWHM 1ODZA 1HJXA 1AFSA 3W7DA 4ZO6A 5HINA 1SZRA 3N4FA 2V5KA 3B4UA 3ITXA 1HVQA 3IV8A 4J3ZA 2FTYA 1P1XA 4IPXA 4R9XA 4A8NA 3N04A 4MJZA 4KCUA 4XIMA 3FSTA 1VBHA 3VCCA 1ME7A 1WDDA 2OZ3A 1Q3NA 1MQPA 2DJXA 4MWAE 3W38A 1AD1A 1JUKA 3WD3A 4LC8A 3UI5A 1TVNA 4UR8A 3AYTA 4G7FA 3FGCB 4IT1A 3YPIA 3UG8A 1J9YA 4GI9A 3M6DA 3LYEA 3GXMA 4J1OA 2F6XA 3TC3A 1R30A 3TTOA 4DWSD 2WZHA 5CC7A 2R1LA