1HKKA

High resoultion crystal structure of human chitinase in complex with allosamidin
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
364
structure length
364
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEQSGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Allosamidin Derivatives in Complex with Human Macrophage Chitinase.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords CHITOTRIOSIDASE-1
total genus 132
structure length 364
sequence length 364
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1hkkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hkkA01
1KXQA 4OUEA 1JZ8A 1TFVA 4IPNB 3PZUA 2ZICA 2WB5A 1UKQA 3WEOA 5A1AA 4PMOA 2J7DA 3PZQA 4AZ7A 1NWUA 3PZGA 3VTRA 3VX0A 4J3VA 3ZJ6A 1UQYA 1GCYA 1BYAA 2JIWA 1KGXA 2V3EA 2BHUA 4AZIA 5A6BA 3WH8A 2ZUUA 2XVKA 4DUVA 2EPMX 1BYCA 1E0WA 1XHGA 1MXGA 1TCMA 2J8GA 2YL5A 3RJYA 1CGYA 1LLOA 3MU7A 4P7LA 4H7VA 4PTXA 1BGAA 3CHEA 1EA9C 1UYQA 2W92A 1E4MM 5E70A 2GJXA 4M8UA 1V3IA 5EB8A 2D0GA 3RPMA 5EBAA 2QF8A 3OGVA 1ECEA 4AD0A 5BYWA 2ZX7A 2E9BA 1CLVA 4KRTA 4RE2A 4CGTA 1K9FA 1B3XA 3CZ8A 3LPGA 1HXJA 1X1NA 4UFKA 1VENA 2V5DA 2BXYA 3AXIA 1XSKA 1ODUA 4BQ3A 1UKSA 1B90A 3BXWA 3W29A 5AYIA 4XV0A 3GXFA 2G4FA 5GNYA 1XCXA 1AVAA 1MQPA 1R87A 3WQ4A 1GORA 2CERA 1PAMA 3IAPA 3B9EA 1JXKA 2XVPA 4B9YA 1H11A 3FNDA 3WIJA 3ARSA 2VNCA 3SCOA 1UZ1A 2RGLA 2XTKA 4K68A 4P8VA 3GXDA 4ZEPA 4DM2A 5A6JA 5D9MA 2JF7A 2OSYA 5BROA 4PCTA 2CNCA 4CKQA 5A8QA 2J7GA 2E8ZA 3K4AA 2WLZA 1FFRA 1JL8A 1KGWA 3W28A 2X09A 2WXDM 3ALGA 3IJ7A 1V3LA 3GDBA 1KFWA 2FHBA 3QHOA 2WK2A 3ARXA 2VCCA 4J27A 3DHUA 4C7GA 1CZ1A 3OB8A 1E43A 3W6MA 2A3EA 4BQ2A 4W8AA 1W32A 3WDJA 1PX3A 3QOMA 1KBBA 2BXZA 1ISXA 1Z32X 4PUEA 2VVNA 1HP5A 1OSEA 1ZJBA 3PZNA 5AY7A 2V5CA 1CGTA 3VOCA 1J0IA 2WYSA 3N13A 3APGA 4HTYA 2WCAA 5CGTA 2WMIB 3PZ9A 1JI2A 2VURA 1UKPA 2NT1A 2EBNA 1CXLA 2WC4A 3VNZA 1G01A 2WZHA 4ZXLA 4YHGA 4LQ1A 5AYBA 5A2CA 4R5EA 1SR0A 2BS9A 4WKHA 4HA3A 1HP4A 1BVZA 4KWUA 3WQVA 5JBEA 2D22A 1UA7A 3WNMA 3L4XA 2WNWA 2V3FA 3DECA 5A6SA 5A8OA 1L0PA 3SURA 1C3FA 5DFAA 3MUAA 4JZ5A 5LA0A 2QV4A 4P8WA 3TA9A 1CXHA 2XG9A 3OLGA 4WLCA 2WMKA 4MJ2A 1B3ZA 3T0DA 2OYLA 1A47A 2J77A 5KEZA 1B3VA 1F4AA 3AS2A 2X0HA 4OBRA 4KMQA 1V02A 4JHOA 1DWGM 1JYVA 1GUVA 3U7BA 1QNRA 1IT0A 3I3BA 2VMFA 1GONA 4PMVA 1B1YA 1CWYA 3TONA 1GOKA 1Q6DA 4CU6A 1ITCA 4JKKA 5DF0A 2NSXA 2WBKA 3ECQA 1E0VA 4DWSB 3ARWA 1KWGA 5LA2A 1H2JA 1KXVA 1TZ7A 1BSIA 3PTQA 4JCMA 4M29A 4PMXA 4P7QA 4U3AA 1LQ0A 1WKYA 5M5DA 2WZEA 1OD0A 4UZSA 3LPFA 2XFYA 1D2KA 2W91A 3ZJ7A 2VZOA 3CBWA 1RP8A 3A4AA 4HA1A 2E9LA 3W27A 5ABFA 3EDFA 3T09A 2VRKA 4HOZA 2E9MA 3SCQA 1NWTA 4MB5A 4W84A 2JF6A 2IXUA 2QPUA 1NOFA 3WY1A 2UY3A 3K8MA 4GIAA 3HMCA 2WLYA 2VCAA 4IPLA 2WKLA 1W1PA 4W93A 3WN6A 1TA3B 4Z2JA 3K4DA 1W3KA 1WE5A 4CCEA 2CKRA 2A3AA 1OT2A 1QI3A 3HN3A 1QHZA 2ZUNA 3RDKA 1TVNA 1NM9A 3DYMA 2Y8VA 2Y5EA 4Z2GA 1TR1A 2GK1A 3AXHA 3G6LA 1E4IA 1B3YA 3BAIA 3WH9A 1OWQA 1Q4NX 1UOKA 1SMDA 4R27A 1HJWA 3GXIA 3T2QA 3VDCA 5I2UA 2E4TA 3MSGA 3ZSTA 2X05A 1KQYA 4W5UA 4MTVA 1FH8A 3MMWA 4MB3A 2XFRA 3MANA 1K6AA 1XSIA 3B8SA 3NUKA 3RCNA 4S3JA 1V03A 2DT1A 4CD7A 2BVDA 2Y8KA 3SUUA 1VEPA 3GYCA 5LA1A 3JUGA 5HOSA 1KGUA 2V3DA 1BLIA 1RH9A 2W66A 2YIHA 2QHAA 1W9UA 2DH3A 1G1YA 4D1JA 3W82A 3LPOA 2W4XA 1JF6A 3BAWA 1BTCA 3O9NA 1XD1A 3CPUA 1OBAA 4M24A 4CU8A 4BF7A 5IDIA 3SEPA 1NOWA 4MB4A 1PX8A 3ARQA 4FF5A 2A3BA 1VJZA 2D0HA 2JEQA 3WDQA 2J4GA 2DQXA 1R7AA 3BAXA 1WCGA 4HPHA 2GUYA 3AMLA 3VMPA 5BCAA 4AEFA 2Q8XA 4AZ6A 2W61A 1JD7A 2D2OA 4PUDA 3WENA 1C93A 2W5FA 4B16A 2OWWA 2J7EA 4L4PA 2VUYA 3RO8A 1W2VA 1KR0A 1HVXA 3NJ3A 4MNJA 7TAAA 4ZE5A 2J7FA 1BG9A 2DSVA 4PMQA 3N11A 4M80A 1MQQA 3NSMA 3GH7A 3ZT6A 4UZUA 3EYPA 1QW9A 1CECA 4X0NA 4JL1A 2NW0A 1CTNA 1EHAA 6A3HA 4KGLA 3SUVA 1OCQA 3M6DA 4DUWA 2DIEA 1XH0A 1GJWA 5IFPA 3N12A 3L4ZA 3NCOA 3AZRA 3W37A 3AHXA 3MO4A 3WL0A 5AC5A 3AHYA 1C7SA 1FP8A 2Y24A 2XVLA 2DGAA 4AY1A 3CZJA 3WF2A 1Q6FA 4HA4A 1C8YA 3OA5A 1DWAM 1YQ2A 4WF7A 2YA0A 1UWQA 5FD0A 4XB3A 2C8NA 4HOXA 3T08A 1W9XA 1XRVA 4WK9A 2XHYA 3MS8A 4ZENA 2JEPA 3W38A 1WO2A 1EDGA 2EJ1A 4D6GA 1JDCA 1HKIA 1V0KA 2XYLA 1W3HA 4UQEA 1W2PA 3QR3A 2VRJA 3VD4A 8CGTA 6CGTA 2D20A 4BS0A 3WDIA 3K8KA 1JFHA 3DC0A 1J0HA 2YKKA 3WEZA 4GKLA 3WELA 1JNDA 4LYRA 5DEZA 3SUTA 3D3AA 2PWGA 4TVCA 3PBGA 1E5NA 5DT5A 1V6YA 1D3CA 4WJXA 1EOKA 3VGDA 4F9JA 4CN6A 2XIIA 1P6WA 3UR7A 2BV9A 1LL7A 1UR1A 2XVNA 4MNLA 5ABHA 2EQDA 3AISA 2WMIA 5DT7A 2W62A 3VPLA 1TE1A 4UR9A 4PMDA 4D6DA 3CTTA 4PSPA 3CMGA 2OWXA 1VB9A 3AICA 4PBGA 2ZXAA 1ZB5A 4UOJA 1WPCA 1VFOA 4D6EA 1E15A 1HNYA 4GXPA 4ZE4A 5AC4A 1E40A 5ABEA 2ZWYA 4TX8A 2D0FA 3WNLA 4PRWA 4NRRA 3GM8A 3GNPA 2JFEX 1JI1A 1CXEA 2WCGA 4UQAA 4GO9A 4UFLA 3VILA 2OSXA 1V08A 2CESA 1UKOA 4ACZA 4JL2A 4EAMA 3WF1A 1TVPA 2YA1A 5A8NA 3ZJ8A 3VMOA 3VVGA 2YDRA 4E4PA 1WDPA 4FLRA 1GQJA 3WUGA 1QNQA 2DDXA 4HZ7A 2VZUA 2XM1A 1MFUA 1J0KA 4JIEA 4W88A 2G8ZA 3U5UA 4MPKA 5A6KA 3OLEA 2OWCA 3VIMA 3SCWA 1TMQA 4JFUA 1WZMA 1BPLB 3SCPA 3AYRA 4FLQA 4GQRA 4OIFA 2FHFA 3BAYA 3MUIA 4KGJA 2E3ZA 4JFVA 2YBUA 1ZS2A 3HU7A 4PTWA 3W6LA 2XWDA 4U5KA 4MAZA 1PBGA 3ARTA 4L4OA 1H49A 3FN9A 2DT3A 3VDHA 1E71M 1WZAA 1JD9A 2C7FA 2C0HA 1ITXA 1W1YA 3W4RA 5CPTA 3A4WA 4UQDA 4TTUA 5JBFA 4W7VA 3CH9A 4J3UA 1LWJA 1EXPA 4OJYA 3ZM8A 2EO7A 4LXFA 3N18A 3DYOA 5I77A 4DWSC 1MW2A 2MANA 3WH5A 1GOQA 1C92A 4UOQA 1KWKA 1H3GA 5A2AA 1H4PA 4CU7A 1RP9A 3VIHA 3EBVA 3OZPA 2WHKA 3T2OA 3T0AA 1E55A 3VM5A 5CLWA 1ESWA 1QBAA 4PTMA 1S46A 3PZMA 5A6LA 5IHSA 3LMYA 1C8QA 1VFUA 3VIOA 3SUWA 3WF0A 2ZUSA 1E1FA 1VF8A 1UZ4A 4W86A 4TUFA 3CUJA 1PX4A 1QNSA 1X6NA 5EMYA 2YL9A 4GI8A 4XUYA 1CGWA 4UQCA 4UNIA 2ZOXA 2EEXA 5LYRA 1V02E 3BCDA 5FL1A 4YPJA 2CITA 2O9OA 4JFSA 3WEMA 2XVGA 3KL0A 1TG7A 3VIFA 4H2CA 1V3JA 1JZ4A 1NWSA 1HVQA 3NSNA 2YA2A 5EFFA 2VVSA 1LG2A 1LWHA 4JFTA 5BXRA 4KH2A 2G3JA 1GNXA 5D4YA 1Q6EA 3NSXA 4U2ZA 1GW1A 3KE0A 1OD8A 4V28A 1OINA 1JGIA 1BG4A 1B31A 2WW5A 4JCLA 2QMKA 2DPEA 2G3IA 4U31A 3GTNA 5HPOA 1PEZA 1O6IA 3VD5A 5JH8A 4FLOA 2XM2A 4X9YA 1ZJAA 2J7CA 2GJXB 2VOTA 3N04A 1N82A 3CZLA 1R7OA 2X0YA 3FXYA 4MJ4A 1NQ6A 4Y7EA 2V3GA 2GJPA 4AMCA 4DUXA 1HJVA 4PMRA 4URIA 1UWRA 4OZOA 1UD6A 1CXIA 3L4TA 3VIPA 3AS0A 4TTGA 4PTVA 3WMBA 1V6WA 1QOXA 3SCNA 3TTSA 2JIEA 1C91A 3VDBA 3W0KA 3EDKA 4BA0A 1MWOA 1EQCA 1M53A 2GJRA 2AAAA 4TXEA 1QI5A 2CBUA 2DH2A 4E8CA 2EPLX 2VR5A 4QAWA 4QP0A 1CXFA 3A4XA 1EQPA 2PWHA 1CDGA 1UR8A 2EPOA 3FAXA 2VTFA 2J47A 2G3MA 3BH4A 1J9YA 2E40A 2IXVA 3AFBA 4EKJA 4GZEA 2J7BA 4C7DA 1XV8A 4X0VA 5A3HA 4AD4A 4B15A 1GVIA 5D9OA 1CNVA 2QMJA 2ZIDA 3AMGA 4E2OA 3NIYA 2CBJA 1NH6A 3O6AA 4PMUA 3B9AA 1JNEA 3WD3A 4GINA 3AHZA 1M04A 4HU0A 1UKTA 4JAWA 3OLDA 2X8RA 4PMZA 5A95A 2HISA 3WL1A 4V27A 1UA3A 2UY2A 1PPIA 4S3KA 2VJXA 4J3TA 3M46A 3M07A 4XX6A 2DEPA 3BSHA 4QLLA 4F66A 1FH7A 3AIVA 1EDQA 3T0BA 3OG2A 4MNMA 4Z2KA 2VQTA 2WAGA 4PN2A 3POCA 2DSWA 4GI9A 1HKMA 2XFFA 1CLXA 2BY2A 3FAWA 5BXSA 1HJQA 5BXTA 4W89A 2JE8A 4D6CA 3BGAA 2DSUA 2CYGA 2PF0A 3F5JA 1W1TA 2DT2A 4OOZA 2WVUA 2O92A 2CCRA 3GNRA 3VGBA 5I6SA 3WD4A 3VU2A 3CZEA 2ZX5A 3VGFA 1TA3A 2GVYA 2A3HA 2O9TA 1DWIM 2J78A 3VIKA 3GZAA 3TP4A 3VNYA 1MW0A 1UG6A 1KR1A 3ZT5A 2WHLA 3FW6A 1OT1A 1ISZA 3L2LA 1SYTA 3VINA 1E1EA 1HL9A 4PMYA 3VIJA 1XH1A 1E72M 4PYSA 1VEOA 5C8BB 2ZUMA 2WMHA 1VAHA 3N17A 3MV01 1ZBCA 1LL4A 4P7NA 4Z2LA 3PTMA 2WHMA 2DIJA 1ISWA 4ACZB 2VX7A 4F79A 1KXHA 3CZKA 1W9BM 3ZJKA 3ZT7A 2UY4A 1JG9A 1WP6A 1D7FA 6TAAA 2XIBA 4UOZA 3IANA 1V0LA 4D71A 1W9PA 1M01A 2QPSA 1VBRA 3BSGA 1K9EA 4AWEA 1E3ZA 5ABFB 1JAEA 3CLWA 2WANA 4BQ5A 4W7WA 4UFJA 1CENA 4EE9A 3VIIA 4Q7NA 1L8NA 5M03A 4GQQA 2W63A 1JZ5A 2WVTA 3WNKA 1JYXA 1C7TA 1WZLA 4UCFA 3DHPA 1WB0A 3ALFA 4CN1A 2XJ7A 1SFSA 3CHFA 3RILA 4AW7A 2BHZA 3GBDA 4TX6A 4JKLA 5D9PA 2GDVA 4NZCA 4P7OA 1EO5A 1GVYA 5GNXA 3GBEA 3WF3A 5IXEA 3ARVA 1JYWA 1UH3A 1JAKA 3EDEA 3RM4A 1NP2A 1UUQA 1XGZA 4HZ8A 1GOIA 4MAVA 2UWFA 3UETA 3AJ7A 3F5KA 1PJ9A 3AIQA 1OGSA 3HJEA 1E70M 3ZMRA 3AI0A 3L4YA 3UG4A 1H41A 4WSJA 3MMUA 5M17A 5A6MA 1UWSA 3KL3A 3SIMA 5HBFA 2JALA 1G0CA 3ZR5A 4TOQA 2VT0A 3OIHA 4XZBA 4HPGA 3WBAA 3MSDA 2XSBA 3K8LA 4PEEA 2F8QA 1DWFM 2WPGA 5IFTA 3ZIZA 1QI2A 4D1IA 1OM0A 1AMYA 2OYMA 1B9ZA 4M82A 2ESCA 1E73M 3THDA 2WVSA 4H8VA 1E6PA 3QHMA 1ZL1A 2ZXDA 4D6FA 3WUBA 3WNNA 4W8BA 4OOUA 1MVYA 4M1RA 4AIEA 4CD4A 4QDMA 3CUIA 1EIBA 2VI0A 1BGGA 3VMNA 2WM0A 2VX6A 1E4NA 5D8WA 1E4LA 3AOFA 1MFVA 3GNOA 3L2MA 2WVVB 1VRXA 5BRPA 2YBTA 3OLIA 4OBSA 4J28A 3L4WA 5CSUA 3KL5A 1JDAA 1U2YA 5I0DA 3AMKA 3IAQA 2ZUVA 3M7SA 3WNOA 3PZTA 1HN1A 3RMEA 2YDQA 4FMVA 4ML4A 4BCEA 4W85A 1JFXA 3W24A 4IUGA 4GZIA 1BVNP 3WDHA 5HXMA 3TOPA 3BCFA 3F4VA 2BY3A 5I78A 4RE3A 4WKFA 1DTUA 3K46A 2VL4A 1SMAA 3BAKA 2VZSA 1KCKA 2WC7A 5FOOA 4UTFA 1G5AA 4MNKA 2CBVA 2WSPA 4B3KA 1XYZA 3WNPA 2XPKA 4P8UA 2J8FA 1HL8A 3AIWA 4JFWA 1XH2A 5A6AA 1HJSA 3I3DA 4H8HA 2PC8A 5CPQA 4AZCA 2ZX9A 3KWXA 1W3LA 4U3CA 1J18A 1VEMA 1GPFA 1CGXA 1QNOA 1KBKA 1MW1A 1FP9A 2BVTA 3IK2A 5GNZA 1XYFA 1K9DA 3GH4A 1NOUA 5CGMA 1CIUA 3EDDA 2V38A 1EGZA 1UR4A 3NYDA 4AYSA 2YL6A 2WZIA 1JIBA 1C8XA 4AIOA 4CCDA 4W5ZA 3CUFA 4Q22A 1J0ZA 1VFFA 2YL8A 1GOWA 3VIGA 1GQKA 4A3YA 1E9LA 3GXMA 1FHLA 3I3EA 1IV8A 5CLTA 2D24A 5DO8A 3PZVA 1TUXA 1IZKA 5CJ5A 1AQHA 2VO5A 1W9VA 3WDPP 1UWUA 4YHEA 5E6ZA 3W25A 1OGBA 2D3NA 5KZ6A 3FY1A 5BXPA 2CHNA 5CSYA 1HKJA 3AIUA 2O9PA 1J0JA 1RPKA 2PBOA 3WMSA 1QPKA 1CYGA 2F61A 2FGLA 2CPUA 1VFMA 3ARUA 1E6QM 5E9AA 1B0IA 1G9HA 1WAWA 1KB3A 5IHRA 5A6BD 2ZX8A 2J7HA 3VGEA 3VD9A 2XGIA 2EPNA 1K9TA 4CD8A 1W3JA 4BQ4A 3MUZ1 1UWTA 1PIFA 1YHTA 5C71A 4Z2IA 3WFZA 2PI6A 1Y7VA 3A3HA 5I24A 2Y2WA 4H41A 1Q6CA 1GJUA 1V6XA 5E0CA 1DP0A 1OIFA 1G94A 1GOOA 3EMQA 1UD5A 1E6RA 4A3HA 4AZGA 1GHSA 3AS1A 2YOCA 3NDZA 4U5IA 4J7RA 1ZBVA 1JZ6A 2D23A 5I79A 1UH2A 1H5VA 2ZXQA 4FK9A 2WMFA 3CZGA 1I1XA 2J74A 3KEHA 3VUPA 1J11A 3VM7A 4UQ9A 1HT6A 3PTKA 1OB0A 3WQWA 3IJ8A 1R86A 1DEDA 4DWSA 3UEQA 2F2HA 3WBEA 3WQ6A 2ZXBA 3QOKA 1J0YA 4U33A 4ATDA 1R85A 5E09A 2W67A 3AMDA 1UD8A 3B9DA 4V2XA 1QW8A 1W9DM 1WDQA 5A94A 1JZ3A 1V3KA 2WBGA 3AZSA 3UCQA 1JYNA 1J01A 4DM1A 1M7XA 3OZOA 3II1A 1MW3A 1JZ7A 3ZSSA 4N42A 2J62A 4GO8A 3ZQ9A 1LJYA 4AXNA 4F9DA 3CO4A 2VZVA 4AEEA 1BYDA 4B9ZA 1H09A 3ZO9A 1GHRA 4W7UA 4AC1X 4NSBA 2O9RA 1UD2A 4ZXOA 1M03A 5CG0A 9CGTA 5FL0A 4HOWA 2E0PA 4AD2A 1NP0A 4IM4A 3W26A 4UQBA 1EDTA 1UD3A 2FDMA 4AD3A 3MUY1 1FHDA 4XZWA 5I3DA 2BHYA 3OBAA 3U5YA 1MYRA 3N1AA 2WWCA 4YN5A 1BAGA 1PZ3A 3A6OA 3A47A 3QHNA 2E8YA 3UR8A 3VO0A 1US3A 2WKGA 3PZOA 4AZ5A 4D72A 1VBUA 4CUCA 1OIMA 2RGMA 1MQRA 2G3NA 1V3HA 3BAJA 1QHPA 1UR0A 1EOMA 1LG1A 5A8PA 2GK1B 2VC9A 5HDRA 1R8LA 2WC3A 2PWDA 2Z1KA 1WDRA 5CPSA 3IJ9A 1WZKA 3FHQA 4WSKA 1OGGA 3W53A 2X2YA 3UG3A 4P7RA 2YLAA 3NDYA 2ZWZA 2CETA 5GPRA 4CN4A 1FFQA 2J75A 5EFDA 3L4VA 2VRQA 2WMJA 1IZJA 1WDSA 3WD0A 2DSKA 2PB1A 1US2A 2GFTA 1UWIA 2OYKA 1B2YA 1E56A 1PZ2A 5A69A 1E5JA 4P8XA 1FH9A 5DMYA 5CQ1A 1BF2A 3SCRA 1CPUA 4AD1A 4QFUA 1F4HA 2BY0A 4PSRA 5M3WA 5GQBA 2PWEA 4F8XA 3CGTA 1I1WA 3ARRA 1BHGA 1ZBKA 1HJUA 4CVWA 2BNJA 2J25A 4JHZA 5JUVA 1H0GA 2VX4A 3THCA 3WKZA 2A3CA 2BY1A 5JIPA 4NF7A 1UHVA 1ISVA 2CXGA 3WH6A 3VGHA 3N15A 3U7VA 1J10A 2YJQA 5HNNA 5A2BA 1CGUA 4MADA 1ZBWA 1C90A 2D1ZA 4M56A 1H0IA 4EANA 2XWEA 5JIWA 3AIEA 5D8ZA 3MKKA 4WIWA 1W91A 2Z1SA 3SCVA 4J3WA 4E8DA 1LL6A 4QCEA 2J79A 3WUEA 3G6MA 3AMCA 3TTOA 3RM8A 3ZR6A 1GZJA 3CMJA 1E3XA 3BLKA 1UQZA 3WF4A 4H8UA 1U33A 1QNPA 1BYBA 2YDSA 1JXJA 3AQUA 3WQ5A 1W1VA 1V3MA 1GQLA 2CBIA 1B30A 5CXPA 3WSUA 3AXXA 2DSZA 4J3SA 4HP5A 1DWHM 1CEOA 1FA2A 3VX1A 1NWRA 1X6LA 3ZOAA 1HKKA 3RJXA 2BVYA 3ARYA 3GH5A 3WMCA 2IUZA 3AIRA 1QVBA 2PBGA 4D6IA 5ABGA 4AISA 5C70A 2XSAA 3QGVA 4HZ6A 1CXKA 4CCCA 3VD7A 4WKAA 3PHAA 1VJSA 3AYSA 1AQMA 4QLKA 4ATWA 1XD0A 3BMWA 3CHDA 4MDOA 4GI6A 7A3HA 3BLPX 2CHOA 4PCSA 2VQUA 3AIBA 4LPCA 5CZKA 1ODZA 2EPKX 3AHTA 3CUHA 4HMEA 1JDDA 3W81A 1QI4A 3WD1A 3SCTA 1DHKA 3L4UA 4ZFMA 4AZHA 4A4AA 3WUFA 1MXDA 3RM9A 3KZSA 3OGRA 5FKYA 4UFMA 4H04A 2G41A 3S6TA 2WMGA 3MMDA 4QLJA 2EXOA 3ARPA 3WH7A 3PN8A 4UFIA 1CGVA 1QBBA 5E0FA 3VGGA 4LGXA 4EK7A 1ZU8A 1HIZA 2FHCA 3AHVA 3SCUA 4HMDA 3F5LA 1EHNA 1UD4A 4AZCB 3U57A 1BFNA 1U30A 3CIVA 3TTYA 4C7FA 1QHOA 4PMNA 1V0NA 2AOSA 1HX0A 2VZTA 1VIWA 2WHJA 3POHA 2D3LA 5FCZA 2XGBA 5BRQA 3UERA 3VD3A 1E6NA 1FOBA 4RL3A 1WNOA 3WD2A 3VKKA 3UESA 4AD5A 4CVUA 2OSWA 8A3HA 1QI0A 4NRSA 2UY5A 3O2LA 3AROA 4GZJA 4CD5A 3CHCA 3RIKA 4B3LA 4M81A 1JZ2A 1CBGA 2Y4SA 3AZTA 4AIUA 2FH6A 5D9NA 2CEQA 2WWDA 4JKMA 3FHAA 1KQZA 3CUGA 3VDAA 4J3XA 1AQ0A 3LPPA 2VR4A 1H1NA 1O7AA 3AS3A 2B31A 1V6UA 4LYPA 4TVDA 4N0RA 4MDPA 1J12A 4D6JA 1V6VA 3PZIA 1E0XA 2PWFA 4U2YA 4BZYA 1XC6A 2YLLA 3MV11 1NARA 3EMZA 3DYPA 1E6ZA 3TTQA 2GDUA 4HU8A 1GQIA 2ZX6A 3SUSA 4OKDA 5E6YA 1DWJM 5BWFA 2QLYA 4W87A 1KCLA 2BFGA 1ISYA 4QCFA 4ACYA 4TVUA 3BMVA 4Z2HA 2TAAA 4FLSA 4DWSD 3OGSA 1EH9A 4RE4A 3E1F1 5JBDA 2VCBA 5ECUA 1JF5A 1A3HA 4AZBA 2WVVA 4W8LA 2CKSA 2NT0A 3EDJA 1RD6A 2XUCA 2ZUTA 2AMGA 2ZUWA 4KRUA 5F7UA 2CIPA 4UFHA 3WQ8A 3J7HA 3N9KA 1V0MA 2GSJA 3D5HA 2DT0A 1E6SM 3T2PA 1E6XM 2FGZA 1HF6A 1B3WA 5HPCA 3ARZA 4LX4A 4ATLA 1XCWA 2WSKA 5A8MA 2ZE0A 1BQCA 3WFLA 2FH8A 1XSJA 2WCSA 4IISA 4CD6A 1EO7A 5TD4A 4D6HA 4MB1A 1LF1A 3BC9A 1UR2A 4HMCA 1I75A 2HVMA 3K1DA 5I5RA 3S2CA 1UH4A 4LYQA 5FIPA 1KXTA 1GOMA 4NI3A 2OLHA 1UR9A 1HJXA 5I23A 2X1IA 7CGTA 1PIGA 1Q6GA 3UG5A 2VX5A 3WDRA 3EMCA 3SCSA 4GPNA
chains in the Genus database with same CATH superfamily
4OUEA 2AWGA 5CZJA 4HHHA 3ZR4A 1RBAA 3BURA 5HT1A 2ZICA 3C2RA 3RRXA 3WEOA 4GX9A 1EF3A 4S23A 3PZQA 1NWUA 4BF5A 3H4XA 4J3VA 4S3BA 3ZJ6A 1UQYA 1BYAA 4TU1A 3OHMB 2BHUA 1OYCA 3HTWA 1G67A 3WH8A 4RK8A 5CBJA 1RQHA 2ZR6A 1UBSA 1ZPTA 2F7FA 1E0WA 1TCMA 2J8GA 3E9AA 3UP8A 4P7LA 4IUOA 3NAVA 3B0UX 5HK4A 1NDVA 4NJHA 4O4VA 1LRNA 1GVSA 4YTTA 2ZRWA 3SW6A 2IQ0A 2XP8A 2AL2A 3GTXA 4AD0A 4XD3A 2VEMA 4K8HA 1TWIA 1VLIA 5D37A 1B3XA 3LPGA 1WQ5A 3O6DA 3LK6A 3PRBA 4BQ3A 4IIHA 1TSIA 1FKKA 4HMNA 3W29A 5AYIA 1XCXA 3INPA 4ORIA 4LAVA 4GI4A 5BMXA 4LOCA 4JIRA 4KKXA 3IAPA 3TZFA 1XIEA 1YDOA 1ZAHA 3PJWA 5D32A 2YXXA 2OKTA 1L6FA 5FEPA 3SCOA 2VNCA 2RGLA 4ZEPA 4L80A 3HO8A 5A6JA 1VPYA 4NJGA 2CNCA 5A8QA 3K4AA 3W28A 3S0CA 3ALGA 3LY0A 5LGZA 3QHOA 2HBXA 4LF1A 3E49A 2VCCA 3L0NA 3UY8A 4IFKB 1CZ1A 1A5LC 2EG8A 4ZR8A 2PPOA 4V33A 3C0QA 3VXGA 2A3EA 3UXIA 1NY1A 4HPNA 2E25A 3GR8A 1W32A 4U4MA 4XWUA 1L6SA 2BXZA 1ISXA 1Z32X 1VBHA 3EWBX 1KA9F 1OSEA 2R24A 3UWWA 3N2OA 4NNAA 3BQ5A 2ZYFA 3VOCA 1MNSA 1FDYA 1TRIA 4HTYA 2WCAA 5CGTA 2REQB 4R88A 1JI2A 4O1AA 3S46A 4O1FA 2WC4A 4ZQRA 4TX0A 4GJ1A 1F3TA 5A2CA 2W79A 2PDFA 4R5EA 1SR0A 2BS9A 1M7PA 2XIJA 3FV9A 1IXPA 4KWUA 4ZQMA 1QWGA 3WQVA 3NR0A 4MYAA 3M0IA 2WNWA 4PC8A 1MRAA 3UYCA 3SURA 1R46A 5DFAA 1X38A 3MUAA 2Y0FA 1O1HA 3PSVA 1CXHA 3DFQA 2J6VA 5EMUA 4H6QA 1FCVA 5D2WA 3T0DA 2OYLA 1GZGA 2X7VA 1GT8A 1XG4A 1OFDA 1A47A 4A8LA 3MPGA 4D2JA 2B7QA 4JHOA 3HG2A 1JYVA 1QNRA 3I3BA 1Y0EA 4YS1A 1H1YA 2GUUA 3ZVHB 4M6UA 3T44A 4ZSUA 2QUVA 5LA2A 4EXQA 3JYJA 1BSIA 1JCYA 4R7WA 1WKYA 4IL0A 3EPMA 1FWWA 2WZEA 1FKJA 1Y0OA 1TV7A 4UZSA 4ICMA 3EOEA 4L4LA 4OU1A 3ZJ7A 5FJTA 2VZOA 3CBWA 1MUCA 1RP8A 2PPGA 5I98A 1WXZA 2E9LA 5AC6A 5ABFA 4RKAA 4LNYA 3SCQA 3QZEA 4Z1BA 2X2GA 3PB2A 4IZGA 1NWTA 4W84A 2IXUA 1EXBA 2QPUA 4DWDA 1NOFA 5DIVA 4MSSA 1XIDA 3WY1A 4GIAA 3HMCA 3NYZA 2WLYA 5AZ1A 3WK3A 5LXEA 4DZIA 4IPLA 4P2VA 5G1MA 3QPYA 4W93A 2QJIA 2A21A 4Z2JA 4GUGA 3SR7A 2FPVA 1OC7A 3Q94A 1J96A 3HN3A 2I5GA 1QHZA 1LDCA 4IP7A 1JUEA 3RDKA 3MYPA 3QH2A 4AB4A 4S3EA 3RHGA 1RBOB 2AL2B 1B3YA 4XIMA 4XZHA 3BAIA 3G1XA 3WH9A 3I10A 1SMDA 4JN6A 1HJWA 4R27A 2E4TA 3ZSTA 3RU8X 3F03K 3N2CA 2XFRA 3GUGA 1XSIA 4C6QA 1RQEA 2VD8A 3NUKA 3RCNA 4H19A 2G3FA 4S3JA 2DZPA 3I65A 3KBSA 1V03A 4LVGA 3QKEA 3TJXA 3DG7A 3SUUA 3GYCA 4J2MA 2HNHA 4FIRA 4MSPA 5LA1A 1T96A 3PUDA 3DEQA 3JUGA 5HOSA 1KGUA 1R0MA 4QR6A 1RH9A 2YW3A 1TIWA 2W4XA 1P0EA 1TPC1 1BTCA 3QMSA 1OFAA 3W7DA 3BLFA 1OBAA 4M24A 4F3HA 3TFCA 4BF7A 4H6RA 2J27A 2CLPA 1Q2RA 1NU5A 3UY7A 1HO4A 1GOXA 1S2WA 4C6BA 2J4GA 3SRDA 2DQXA 2A7PA 4LAZA 1MUMA 2R6OA 1WCGA 1XR2A 1RAKA 2A2IA 2ZRVA 3VMPA 4HJFA 5BCAA 4AEFA 4NZJA 3RR1A 1VCVA 3FDKA 3VKCA 1DJXA 1C93A 3W7KA 4O4WA 2W9MA 2PDKA 1TX2A 1KBLA 2QT3A 2R1PA 3GHTA 4IJCA 4L4PA 2E6FA 3RO8A 4KERA 1W2VA 1KR0A 1HVXA 2J7FA 4L7ZA 3KAGA 3N11A 3FIGA 1LOQA 5D2YA 4GVIA 3QZAA 2MNTA 4JFIA 1CECA 4JL1A 5HW7A 5HWBA 1QPNA 1RLCL 4FB7A 4R53A 2DIEA 3MBDA 3GTHA 1GVQA 3MO4A 4NY2A 5AC5A 3AHYA 4UR7A 1GEHA 4NZ5A 1KCZA 2XVLA 2DGAA 4GUJA 5HWNA 3CZJA 1B4EA 3M0JA 4HU3A 3ZS4A 4HA4A 1C8YA 4ITZA 1MZRA 4J4NA 3P3BA 3T42A 1YQ2A 4LBUA 1F73A 4JFJA 4UR8A 4FXFA 2PTWA 4XB3A 4ZENA 3E96A 2JEPA 4L6HA 3SN4A 3HPAA 3H70A 3KCEA 3QGAC 1W2PA 2Z6IA 3VCCA 4FX8A 4V1XA 3W7IA 2J66A 1O5QA 4RDYA 3R94A 1YNYA 5I3JA 3LN3A 3CYJA 1TCDA 2D20A 4BS0A 2ZRUA 2GQ9A 3IUHA 1J0HA 2YKKA 3WELA 1JNDA 3SUTA 2PWGA 3M0MA 3AJXA 4F9JA 4ZODA 1FKFA 1TJPA 4GJIA 3CWOX 5CSRA 2XVNA 1VFTA 2EQDA 3AISA 2WMIA 1QMLA 4YYCA 1TE1A 4UR9A 1EP3A 3MO7A 1X8FA 3I6TA 3EA2A 1Q7ZA 3PNUA 1V5XA 3WLOA 2GWGA 2ZXAA 1ZB5A 4RDWA 4UOJA 1VFOA 3O5JA 4HD5A 4ZE4A 4I9JA 4N9CA 4FXSA 4DYEA 3KCLA 3MWAA 1E40A 3G1SA 2FVLA 5ABEA 1EYWA 3WG6A 3FA3A 3N4FA 1XC4A 3GNPA 2LKNA 1YDVA 3H55A 2WCGA 4GO9A 3FKKA 3U2ZA 1UKOA 4JL2A 4N4PA 3EEZA 1JUKA 3CTLA 4DH0A 4YCPA 3S47A 1OK6A 3CPRA 3I7RA 1TV4A 2XN1A 1GQJA 4HK7A 3KXQA 4N6FA 2QUNA 1UPMB 2VZUA 1Q7MA 4KPLA 1GVFA 4FALA 1J0KA 3UWZA 2ZDRA 3S2LA 4I8DA 3NQVA 5A6KA 2OWCA 3SCWA 4I5XA 4DO6A 1ZENA 4R7JA 4FXJA 1GVOA 3W85A 4LT9A 3ITOA 4OIFA 4H2HA 4IG2A 4UTMA 2WNZA 3D46A 3EX3A 2CLIA 3BLDA 2PV2A 4OTKA 2NXHA 1C29A 2HV5A 4DJED 3FN9A 1E71M 3M5YA 2ISFA 4HK5A 1PE1A 4CQBA 5CPTA 3GLCA 1QCWA 2HVOA 4NUWA 4MOZA 3N18A 2QCDA 2IPWA 4IPPA 5D03A 1GOQA 2DFAA 5CPNA 3MCOA 1GKRA 3FA4A 1RP9A 2B7OA 1ICQA 2QYGA 1Q66A 3I6CA 1LT8A 2RJGA 3T0AA 1QBAA 1TIMA 4B91A 9XIMA 1S5VA 4N7QA 4FNSA 1T41A 3A21A 4LAKA 4J1OA 2FAPA 4RDVA 5I3GA 2ZUSA 2X1SA 1E1FA 4W9OA 1H7RA 4I7VA 5T9CE 3PG9A 1EZ2A 1PX4A 5SWUA 1PL9A 1DYSA 1X6NA 3E2VA 3N2TA 5CZTA 2BGQA 1CGWA 3RU6A 2ETNA 2FTYA 1NSJA 3VAVA 4K8GA 4IX2A 3L7RA 4TV5A 1PSCA 4JPGA 3ODKA 3GPKA 4QAIA 1D3HA 4JFSA 1X97A 1SFLA 1IWPA 4Q8TA 1JZ4A 4IFOA 4XKMA 2YA2A 2OQYA 3IIZA 4JFTA 3RLHA 5BXRA 1D3GA 2G3JA 3M9YA 3Q58A 3GAKA 1JPIA 3H4GA 2JGQA 4RUBA 2INZA 3E0VA 1BG4A 1B31A 1E9YB 1EKOA 3UXLA 4H3DA 4U31A 4JYDA 5HPOA 3LHZA 2ZADA 3B9NA 3NXFA 3VD5A 5ENLA 3F2CA 4ZO9A 3W7NA 3BOLA 2BGNE 2VOTA 3B05A 3CZLA 3S83A 1O60A 2X0YA 3FXYA 3B0PA 4MJ4A 2V3GA 3CV6A 2V2CA 5E93A 4PMRA 2QQ6A 4OZOA 1UD6A 3S6OA 2OPJA 4MFDA 4DRKA 3JVAA 4PGLA 3SCNA 1YPIA 1NSGA 2OQLA 1C91A 3VDBA 3UPWA 2A5HA 4Y8FA 4EF9A 1VFHA 4IIFA 1D7IA 4JYFA 3SGGA 4FHAA 1MO0A 4UXDA 2VR5A 3W7CA 4RDZA 2PCEA 2VTFA 2QEZA 3W07A 2G3MA 2EKGA 2E40A 3WLLA 2IXVA 3AFBA 4EKJA 5EA9A 4PTNA 3PRDA 1XV8A 1Z42A 3RX4A 5DCEA 1AUSL 2DV0A 5D9OA 3USZA 4I5UA 3MVIA 3A3XA 3W2LA 3GTFA 4E2OA 1NH6A 3VK5A 1TREA 4PMUA 1JNEA 4NAEB 2VCDA 4GINA 4HSOA 2KGJA 3AHZA 4XD5A 1UKTA 3OLDA 3VOJA 2Y7FA 3WL1A 1UA3A 2UY2A 1RZMA 4J3TA 3TN5A 3BANA 2HSAA 3SSZA 3B40A 1ZQ5A 4MNMA 2WAGA 4JTAA 4PN2A 4IL2A 1HKVA 4OE7A 1W5NA 4UCGA 4GI9A 2ZA3A 1HKMA 1G4TA 4NNCA 3B8IA 2BY2A 5AVNA 1G7VA 2PZ0A 5BXTA 2ACUA 1US0A 2PF0A 2BVWA 3LBCA 4WVXA 3AO0A 2O92A 1IQ8A 3VU2A 3DIPA 4UTTA 2O4MA 3VGFA 5L6UA 1JPHA 3JYMA 2GVYA 2FTWA 3LA4A 3B0VC 2O9TA 2FYMA 1MW0A 1X8CA 4ZOCA 3ZT5A 1OT1A 1B57A 3L2LA 1SYTA 1E1EA 2NQJA 1W17A 3STPA 1HL9A 1QK2A 1XIMA 3R7MA 3W1UA 3AALA 2ZUMA 3STFA 3E5PA 3N17A 5JU6A 4ODOA 1K6WA 1KO0A 1A5UA 2M1IA 1LL4A 4MUPA 4P7NA 2ZRZA 3LCIA 4L6OA 2RSEA 4OUIA 1AMKA 2VX7A 3BMXA 3TYUA 4ACZB 1KXHA 4HU4A 1ME9A 3ZT7A 3EWXA 4O53A 2PP3A 5JQ9A 3EIPA 1M6JA 1V0LA 2VHLA 1PDZA 4D71A 3G0SA 2BGSA 2SFPA 1FBAA 1VBRA 3W73A 4DQWA 3GU0A 4D9PA 4GMEA 1K9EA 5C9RA 1G6CA 3CLWA 5FESA 1XUZA 4BQ5A 3KFTA 1NFPA 4HPXA 2ALRA 4Q7NA 1L8NA 5M03A 3R79A 1QPLA 1ALDA 2DG4A 4FNRA 2DJXA 4KT2A 3RMJA 3N2BA 3CQ0A 4YXGA 4DT4A 3AYVA 3GKFA 1WZLA 3UWYA 4QQUA 1VGAA 3DHPA 1QW7A 1SFSA 3CHFA 2V8ZA 1Z7AA 3GVQA 4AVFA 2HK1A 4XAYA 4N02A 1S39A 3OVGA 1EO5A 1IR2A 2A7RA 4QJ3B 5PTDA 3G77A 1R6WA 1UH3A 1YRRA 3TYDA 1XGZA 1GOIA 4CNTA 1AW5A 1OGSA 3HJEA 3ZMRA 1P5QA 1H1ZA 1V7YA 3EX4A 2J9XA 2EGZA 5A6MA 1UWSA 1DTNA 3KL3A 3SIMA 4HSHA 3ZR5A 1IXNA 2VT0A 4XZBA 1B4KA 2XSBA 1GTHA 2OLAA 2F8QA 1ZSXA 3KAIA 1N1AA 3W70A 3TAOA 5ECVA 4Q7IA 4Q4KA 1B9ZA 3V5OA 4LB3A 4JD4A 1E73M 1XIJA 3SO7A 2WVSA 3QHMA 5M2FX 2X30A 4CD4A 4HCHA 1KT0A 1HZYA 4LAOA 2VI0A 3QSTA 3VMNA 3BLOA 3I68A 2VX6A 1E4NA 4QROA 3IJIA 1I2RA 1MFVA 5I7GA 2YBTA 3OLIA 3RK8A 3KL5A 7ODCA 4DPPA 1FCQA 2IKGA 1WUFA 4Q8WA 2UBPC 3EZ4A 3S1VA 2JK2A 1CB7B 4ML4A 4BCEA 4IUGA 4BHYA 3SN0A 1BVNP 3WDHA 5HXMA 3BCFA 4LY8A 5HMDA 1FD9A 3UXAA 4RV8A 3W23A 4WKFA 4HNLA 2DIKA 1QTWA 1S2AA 2WC7A 2Q09A 1G5AA 4B3KA 1XYZA 2OVLA 2OT1A 2XPKA 2B5UB 3P6LA 4ROPA 4PFHA 3O06A 2VDGA 4U3CA 1RUSA 3ITXA 5GJMA 4YJ5A 4A6GA 1KBKA 1YIXA 1FP9A 1XYFA 1PXGA 2C18A 3GKAA 2V0TA 5HJYA 4Q8OA 3HPSA 4Z08A 2ZVIA 1EBGA 2V38A 4ECLA 1PV8A 3RCYA 1UR4A 3NYDA 4DRQA 1DQXA 3ZZ1A 4ERAA 4W5ZA 4Q22A 4G8TA 2YL8A 2WNQA 3HGSA 3CO8A 3VIGA 1GQKA 4I9AA 4XKYA 4D8LA 4XBJA 2V63A 2Z7GA 2ZZ7A 4NNRA 4ZPVR 4AHPA 4S3GA 1AQHA 3LRMA 1R2TA 5E6ZA 3W25A 3RGCA 3HFTA 1POJA 5DMNA 4FNTA 4JQ1A 2CHNA 5CSYA 2P4VA 6ENLA 3M5VA 4Q33A 1QPKA 1K3UA 4DRHA 2CPUA 3QN3A 3UCDA 1YNQA 3FEMA 1I8JA 1G9HA 1S1RA 2E7FA 3GW3A 5FJUA 2VDHA 2XGIA 3WFAA 4WDWA 4CD8A 2KZHA 3TW7A 3O5OA 5C71A 2MLYA 1QFEA 1NF0A 2PI6A 1YDYA 1Q6LA 1GGOA 5I24A 1Q6CA 3R0KA 3P2VA 1GJUA 1V6XA 5E0CA 1ZJIA 1OIFA 1GOOA 3NDZA 4U5IA 4XIAA 1ZBVA 2XP6A 2B81A 3ICJA 2QF7A 3SFWA 3CZGA 4RX0A 2AQWA 3VUPA 3TK7A 4Z17A 3T6CA 3E0IA 3VYLA 1Q1CA 1FCUA 3EY6A 1OB0A 1OK4A 1C9HA 2OFNA 4NXSA 3GFZA 1SJDA 2F2HA 3QYQA 4YVVA 1JGMA 3IIPA 3P82A 5BXJA 4EPEC 4U33A 5E09A 4KCVA 3AMDA 5KZDA 4QIBA 3HURA 1W9DM 3CV2A 1JZ3A 3HGOA 2WBGA 4F40A 1M5WA 1J01A 3VABA 4IFKA 4GO8A 1S5WA 4M5PA 4AXNA 2G4JA 1WV2A 3CO4A 4GGHA 3H53A 2YFOA 4KFPA 2PDHA 1KRMA 1H09A 3TNBA 3P80A 3H2NA 4NSBA 4IIEA 1W5OA 4DLFA 2C1IA 1PYMA 9CGTA 1ICSA 4JNZA 3THAA 5HNUA 1OX4B 4AD2A 4CQ9A 1XDMA 3W26A 3C2VA 1XKJA 4WDUA 3W2MA 4AD3A 3MUY1 1DPMA 4GYPC 4XZWA 3O5KA 1P0DA 2XN2A 1MYRA 3FGCA 4CEUC 1ZCOA 1PZ3A 2G95A 2NUYA 4TMCA 4QQ3A 3ABSA 1H7WA 4H9YA 3UR8A 5HTGA 3HG5A 3T0CA 4ZCWA 4LBSA 4AZ5A 3WBWA 4XSMA 3ZLHA 3BZGA 3BV4A 1R3TA 3QQ0A 1GYMA 4LU0A 4XVEA 3GDTA 5A8PA 4OQVA 1FKBA 3R12A 1R8LA 4I9TA 1QO5A 3IJ9A 3CU2A 5FJRA 2G50A 4RPPA 1WZKA 3MJMA 1BSLA 4ZTYA 1UZHA 1Z89A 2X2YA 2ZWZA 3KTXA 2CETA 4E5TA 3NVTA 4MZYA 1FFQA 3WLSA 3L4VA 3DGRA 2WMJA 3IS4A 5BW6A 4TV6A 2OYKA 2LJ4A 1B2YA 3PJUA 4P8XA 3RITA 2X0SA 1KM3A 1YADA 3LB0A 5CQ1A 2RUDA 1CPUA 4QFUA 1F4HA 1SGJA 5B7YA 2B7PA 5F4WA 1E0UA 1Q65A 4NHVA 1HO1A 1F6YA 3CGTA 1J4EA 1XRSA 2PUZA 3LBOA 5C9WA 1YW1A 1BVWA 1NFGA 2Y1HA 2CXGA 4QSFA 2ZQVA 2PLMA 3VGHA 1O5KA 1LORA 1MZHA 3H8AA 1J10A 1R2RA 3BGGA 4ASTA 4PULA 3LZ3A 3KBVA 1M7OA 1ZBWA 5K9DA 2E5DA 4KW2A 3PR2A 4M56A 1POKA 4CCZA 4IMCA 1TQJA 4XZLX 3AWNA 4WIWA 3MP5A 1VJIA 5D38A 4E8DA 4QT2A 1N8WA 3L5LA 1J2WA 3O15A 3G6MA 3TTOA 1BRLA 1G4SA 1UQZA 1JULA 3VNLA 2GPTA 4MY1A 1V3MA 3IACA 3O7UA 1S3HA 2CBIA 3BO9A 4H7ZA 1DWHM 4HYWA 2A3LA 1SO5A 3RJXA 4RZ4A 2IF4A 3ARYA 3WMCA 3C0JA 1EJSC 3C61A 4HKPA 4D6IA 3GU1A 4AISA 5DLCA 2XSAA 3DZ1A 2F84A 3QGVA 4HA0A 4WDTA 4HZ6A 4PL1A 3DFPA 4CCCA 3NQCA 3M1ZA 2BASA 1VJSA 5KETA 2H9AB 1XD0A 1R3QA 2HS6A 2WZMA 2GGEA 3GB6A 2FIQA 3KVLA 4GI6A 3C4UA 3MI3A 4PCSA 1U5VA 3BVJA 3HZ3A 3GSMA 1GJPA 4GY1A 3CQHA 4C6PA 3ME3A 2EPKX 4I3GA 3WLNA 2BX7A 1IHIA 4G50A 1XRFA 1F76A 3CS2A 3SCTA 3WD1A 1V51A 3APYA 3L4UA 4ZFMA 2FFCA 3W7GA 2Z00A 4UFMA 4QLJA 2W3ZA 2EXOA 3PJXA 5HW6A 3PN8A 5IDZA 1QBBA 5E0FA 4XUGA 1DJZA 3O0KA 3MTWA 3SCUA 3LENA 1WXJA 2ASHA 5CGQA 1XBYA 3G1DA 2JQXA 3CIVA 4GX8A 4MGGA 4RE0A 2QDDA 1OX5A 4K8EA 4PMNA 2IQTA 2AOSA 1F5ZA 3WLPA 4OECA 1R9ZA 3POHA 2D3LA 5FCZA 4MPQA 1PTAA 1AJ0A 3UERA 4PMJA 4FAPA 4RL3A 3R8RA 3RO6A 3QY6A 4CVUA 3A4JA 3W22A 3HG4A 5FEXA 1FKXA 4NRSA 3O2LA 3AROA 3G1YA 3C6CA 3RIKA 4B3LA 4JQ2A 1PS9A 5TNVA 1R47A 3WJZA 1PYFA 2CEQA 5DXYA 4DNHA 3GYEA 3FHAA 2QPXA 3CUGA 4JX5A 3EA1A 1ZGDA 4J3XA 3STGA 1O7AA 3P0XA 2FMOA 3QYSA 1K8ZA 4JYSA 2OEKA 4S38A 2ZE3A 3QTGA 2PRLA 4ODNA 4HYVA 1DIEA 1V6VA 3W02A 3CAVA 4BZYA 3E38A 1LUCB 1E6ZA 3TTQA 4LAWA 4RZ5A 1IXQA 3LQLA 5BWFA 2QLYA 4W87A 3OYXA 1ISYA 4QCFA 1XYLA 3BMVA 4LC8A 3OGSA 4RE4A 5JBDA 3XIMA 1SJCA 2E09A 3P5ZA 1F8MA 1PCWA 3CHVA 3M4HA 2PDNA 3EDJA 1FAPA 2ZUTA 4KRUA 4C6NA 4GVFA 4H9MA 3UZ5A 1OYAA 4BWLA 1V0MA 4O52A 3LZ5A 8TIMA 3O6CA 1EWDA 2XPBA 4RV3A 3T55A 5J5DA 3LYEA 3VOFA 3QQWA 3T2PA 1BQCA 3WFLA 2FH8A 1XSJA 4N9BA 3AXKA 3PUEA 2Y85A 3HPXA 1DJGA 2ZTKA 1LF1A 3U8GA 3BC9A 4ZA0A 4WR3A 3P62A 4L64A 3GVRA 3HQPA 2C15A 1W5MA 1NIUA 4NI3A 4MIMA 2Y7DA 1A3WA 1Z6KA 4IMAA 3KZ7A 2X1IA 4HSNA 7CGTA 3SB0A 3ANUA 1DE6A 3TTEA 3SCSA 1QOPA 1HG3A 2Q71A 5D75A 1EL3A 4LUSA 3H2FA 4US6A 2Y62A 3DESA 1PTGA 1FWBC 1UKQA 4YTQA 3S5SA 3QFWA 4HN8A 4AZ7A 2YXGA 4KWOA 3PZGA 3VTRA 3L65A 4O1EA 3NURA 3DU0A 4XD4A 1GCYA 3EOSA 2V3EA 4M19A 5DBTA 5A6BA 5XINA 4UUIA 3I4EA 2ZUUA 2XVKA 4DUVA 3KX6A 1O66A 2WJFA 1BYCA 1MXGA 4KRZA 2HEJA 1A0DA 3MU7A 3WK2A 1BGAA 1EA9C 5E70A 4LV4A 1V3IA 5EBAA 3LNPA 3OGVA 1T11A 5G4HC 3PFRA 4JOMA 2PD9A 2NWRA 1CLVA 4O54A 4QT3A 1K9FA 1TWSA 5D2VA 1XLGA 3RLGA 4GY7A 4G56A 4NIRA 3AXIA 3M0HA 1XSKA 1Z44A 3BXWA 3PRAA 3CUZA 4XV0A 5GNYA 1THFD 3WLQA 1R87A 4MWAE 1IT7A 2GQ8A 2CERA 2OZ3A 2XH0A 2XVPA 4LALA 1H11A 1X96A 3WIJA 4KQNA 1EJVC 3ARSA 1VHCA 3W9ZA 4K68A 4P8VA 4G1NA 3CEPA 2Z4GA 1NF7A 2OODA 2OSYA 5BROA 3TNOA 4CKQA 5TAOA 2E8ZA 3UQIA 3NQMA 3NTYA 1CI1A 2WLZA 1JL8A 3GG8A 5T26A 2X09A 3MA8A 3IJ7A 1V3LA 1KFWA 3TE9A 2WK2A 3LGDA 5DX7A 4NVTA 4ZPTR 4XKYB 4ZGYA 3DHUA 3UF9A 1H7PA 4O8RA 4EPBC 3W6MA 3MUCA 1KFJA 1PX3A 2GYIA 4IQJA 4PUEA 2VVNA 1HP5A 3UU0A 1IIHA 3A9BA 3KAHA 1A5BA 1CGTA 2ON3A 1GZ1A 3APGA 2WMIB 3HG3A 2PF8A 3B9OA 3B04A 1AJZA 1KTCA 2EBNA 3R4IA 2FVKA 3VNZA 1G01A 4O15A 4GIEA 1PDYA 2WZHA 4ZXLA 2QDHA 1CX9A 3B0XA 1LOLA 4LQ1A 4HNOA 1K1DA 4FAMA 4WKHA 4HA3A 4XD6A 3IPWA 1PKLA 1ADDA 3VNJA 3UJSA 1UA7A 3GY1A 4DVOA 3L4XA 1OCNA 3DECA 5A6SA 9XIAA 5AB3A 2FKPA 2MUCA 2ZZ4A 3EX2A 3CWHA 5LA0A 3L0GA 2QV4A 4P8WA 3TV8A 3TA9A 2XG9A 3OLGA 1BWLA 4H4IA 4WLCA 2J9YA 4MJ2A 3W88A 3WLTA 1B3ZA 2I14A 3M0XA 1YTEA 2J77A 5KEZA 3NZGA 4DLMA 1B3VA 3BG9A 1A4MA 2X0HA 1JRCA 4KMQA 4FIQA 1Y5WA 5XIMA 3CMFA 3B8TA 3TN6A 3U7BA 1R2SA 1ONXA 2HWGA 1B1YA 2CZEA 3TONA 4GABA 4JFMA 1GOKA 1Q6DA 2KFWA 1JDFA 2VGFA 3ECQA 3NQ8A 4GC3A 4DXKA 1ROUA 3K30A 1TRDA 3UGRA 1H2JA 2BOFX 3LD5A 1OC6A 3PTQA 3R6IA 1XDLA 1VYSX 3PBUA 2X16A 4BJHA 4P7QA 3R58A 1EBHA 3FFSA 1EYEA 3N14A 1XLEA 3LPFA 2F6KA 4HK6A 3RG6A 3NQDA 2W91A 1ITQA 1SZNA 4UTTC 3OJGA 1LUCA 3PY2A 4F48A 4LB4A 4R9XA 3W27A 2MLXA 3LU2A 2CLMA 2Z0IA 3OBKA 1GK8A 3ZWTA 3T09A 4HOZA 1JJKA 4B5TA 3QV7A 4XBSA 3M43A 2Y78A 4UTWA 4B4FA 2WKLA 1W1PA 2E5CA 1XQLA 3WN6A 1F05A 3LS9A 1VKFA 3KOWA 2F2DA 4DJDD 5CC3A 1WE5A 1C9WA 3A5VA 1OT2A 1QI3A 1WYIA 2DZXA 4EACA 2ZUNA 4BF9A 2P53A 3SQMA 3V1PA 1TR1A 2GK1A 4BKNA 3VE9A 3CYVA 3FA5A 5I00A 1VYPX 1E4IA 2D69A 2QCEA 1Q4NX 1UOKA 1YBQA 2E28A 3VDCA 3V75A 3MSGA 3PAJA 3SY5A 2DVUA 4L61A 2PCQA 4MTVA 1FH8A 3MANA 8XIMA 3TCSA 4RLIA 3EEGA 4CD7A 3G1RA 2BVDA 1W3IA 4GCXA 1ONRA 4LUTA 2VFDA 1RV8A 3B06A 4DF1A 3EWDA 1L8PA 4Q8PA 2P76A 4DJFA 1XIIA 2PMQA 3O9NA 3CPUA 4C60A 2AL1A 1FXQA 3FYYA 3LXBA 4CU8A 1TJ1A 2YDAA 1Q6IA 1K77A 1PX8A 3ARQA 2A3BA 4ZVJA 2JEQA 3B8WA 2IW0A 3TCEA 3MZNA 4Q6JA 4C1LA 3KW3A 1R7AA 1JVNA 4BI7A 4DRMA 3IVUA 2GUYA 3GQYA 3AMLA 3TYBA 2BDQA 4LUYA 2EHHA 2W5FA 1D7HA 4IQEA 1RY0A 3W7MA 4B16A 3WJXA 2DU2A 3KRBA 5FJJA 1QUMA 3GW0A 4UNLA 7TAAA 1L2UA 3F1QA 1J2BA 3TU9A 4M80A 3EYPA 2V81A 1W0MA 3DFSA 3S5YA 4X0NA 2NW0A 1P6BA 1NEYA 1SM9A 3K2GA 3LRLA 3KTCA 3SUVA 3F2BA 3DENA 3WO8A 1Z9AA 2UZ9A 3RLVA 4MWAC 3EKLA 5AECA 5IFPA 3L4ZA 2C91A 2Y24A 5DRIA 4AY1A 3I6RA 3RFAA 2E68A 2Q6ZA 2R1NA 3WF2A 1Q6FA 1DWAM 4YYFA 2YA0A 2Q8ZA 3QR0A 4PL2A 4HOXA 2J88A 3B4UA 3P14A 4WK9A 4QEHA 5LNSA 4Y8EA 3O5MA 4MHBA 4A8IA 1JDCA 3EWZA 1QPFA 1V0KA 4DHGA 2W0UA 1QXLA 1XL9A 2GGJA 3NPWA 2DQWA 6REQB 3S3GA 8CGTA 1VLWA 1IGSA 3WDIA 4IGMA 2DJLA 3WEZA 1P0NA 1ICPA 1QPOA 3D3AA 4TVCA 2BZNA 1TTPA 1E5NA 3UPMA 2XFWA 1D3CA 3DGBA 5FF3A 3ONCA 5G1YA 2XIIA 2ZC1A 1P6WA 2E1WA 2PSNA 2DW6A 3SI9A 3UGVA 1UR1A 4D8ZA 3DFTA 4PB3A 1B9BA 5KZMA 2REQA 1E9ZB 5BOFA 3VPLA 1KM2A 3W1AA 2OCZA 3GXTA 4PMDA 1WBJA 4GYKA 3N73A 1VB9A 1UMYA 3AICA 4PBGA 1QDSA 1FY6A 1E15A 4GXPA 4B2DD 5AC4A 4DF0A 1V7AA 4JNYA 1MUWA 1B54A 4DXXA 3DFYA 4GK8A 4O11A 5CZ0A 3S2JA 3O5PA 3GM8A 3MYOA 1ME8A 1CXEA 1TKKA 3NZ1A 4UFLA 2H6RA 1V08A 4GVHA 2CESA 3GVGA 1KNWA 2VEPA 3VVGA 2HXUA 1I0DA 2ZFAA 1DVJA 1EC9A 2I7GA 3TROA 3ITVA 3WUGA 2ZQSA 2DDXA 3VKAA 4HZ7A 1FCBA 4AF0B 3VKBA 2XM1A 1MFUA 4W88A 1NVMA 3OP2A 2OZTA 2ISVA 4MPKA 3BWWA 3JZUA 4BI6A 1BPLB 4FLQA 4LC6A 4GQRA 1EPXA 3HPZA 3IUIA 4AAJA 2FHFA 5DO2A 4B2DA 4HB7A 2PRMA 1ZS2A 3G3MA 4PTWA 3W6LA 4DO7A 3SZ8A 2XWDA 1TV3A 4PCNA 3FX4A 3LHUA 3EGJA 4L4OA 3KZPA 4ROQA 1H49A 4AIBA 1WZAA 4ADSA 1W6TA 1JD9A 3IGUA 1SU5A 3NL3A 5D2XA 1J79A 1T7LA 1DJWA 4V1YA 4DRNA 3W7HA 3GX9A 1QOQA 5REQB 5JBFA 4W7VA 4QHRA 1KFBA 3GC5A 1JCXA 2NVAA 3ZM8A 5H8UA 3T40A 1UOZA 4DWSC 1LP6A 3ENLA 1C92A 4NXKA 3C5QA 1H4PA 1YE4A 1XYCA 3IJLA 3L66A 1I9CB 1Z41A 2V2DA 2CWNA 1HW6A 4LBRA 3OZPA 3PP7A 5FEWA 4MJMA 2WHKA 2VENA 3CH0A 3L0KA 3CUXA 3C3UA 3GXNA 4Y9MA 3PZMA 1M5YA 4E3TA 1DXFA 3W1PA 1VFUA 3NL2A 4Q6XA 2OZ0A 3VIOA 3MJYA 3QM3A 3TA6A 4KEUA 1VF8A 2OQHA 3W7JA 1UZ4A 1PKMA 5HKGA 4TW7A 1W8GA 4GIRA 1XKYA 4P61A 4Q4QA 2YL9A 4UQCA 2EEXA 2PWVA 1S1PA 4ZMGA 4FX6M 4JEJA 1QASA 1CCWB 4YPJA 4JDYA 2CITA 2J13A 3TX9A 2O9OA 1A4LA 4ZQOA 3WEMA 1TG7A 3VIFA 4IMGA 1NWSA 4NYUA 2VVSA 1LG2A 1LWHA 4FA3A 4MFEA 5D4YA 1LROA 3NSXA 3KE0A 3GDRA 1OD8A 3Q45A 4C1NA 3WMLA 2F38A 2OFJA 3CXOA 2QMKA 2DPEA 2G3IA 4GUHA 3VE7A 3TC3A 1PEZA 3V0TA 4J4OA 3LHVA 4KBXA 1EFZA 3N25A 4X9YA 2VFHA 1N82A 3U4AA 2R14A 3B8DA 4JNMA 1M7JA 4W9PA 2QJGA 2VKZG 1EJTC 1NTHA 3PAOA 4RZ6A 2ZVRA 3VIPA 1G4PA 4JIHA 1V6WA 3TTSA 2JIEA 2VXNA 3EDKA 1JDEA 1TJ2A 3NQAA 4JTKA 4DAIA 1MWOA 1M53A 3C56A 4TXEA 1QI5A 2CBUA 2DH2A 4E8CA 2EPLX 2BTMA 1CXFA 4QP0A 3ABOA 4HCDA 4WSHA 1VCGA 1P4CA 1EQPA 4DIPA 1TMHA 3ABXA 4AHQA 3TSBA 4Q4SA 5CAKA 1J5SA 2VYOA 3TLQA 1Q13A 1RCXB 1LRQA 3OQ8A 3VFCA 5G1TA 1R3YA 4B15A 3AUOA 4HZMA 1CNVA 2ZIDA 4WJEA 1A5AA 1D9EA 3PPFA 1R38A 1K4GA 3GAYA 3WD3A 2Y63A 4PMZA 4KS0A 3UPBA 1IX5A 5I3IA 4AY7A 1PPIA 4S3KA 3M46A 1VFLA 3SQLA 4EWJA 3H2MA 3M07A 1IEQA 5C54A 2E5BA 1FH7A 3ONBA 3AIVA 1EDQA 1L6WA 1WX0A 3EOOA 5CH9A 3N2XA 2DSWA 3IARA 1V8EA 1OF6A 1HJQA 2JE8A 3BGAA 2WSQA 4OOZA 2WVUA 1ZRQA 4NAEA 2HCVA 4M6VA 2ZX5A 3A5FA 1TA3A 4ZQPA 4MVAA 1ZP4A 1EWEA 2NWSA 1DWIM 2J78A 6TIMA 1J4IA 4OWGA 3TP4A 4WEVX 2PA6A 4O1CA 3N6HA 1XI3A 2XZ9A 3SQSA 3FW6A 1UP0A 3M0KA 4QG9A 2FJUB 3GK0A 2DP3A 2Q5AA 5AHNA 3LX9A 3M44A 1D6OA 4PMYA 3CQJA 4QG8A 4UTWC 2OOFA 4JQAA 1BWKA 2WMHA 1EGMA 4NASA 3RX3A 3M16A 2PGRA 3EXRA 5D33A 1AH0A 4W9TA 2GLKA 1ISWA 4JTDA 4F79A 4QXIA 1Z48A 3ZJKA 2Z28A 3G1HA 2XIBA 3IANA 4ZO7A 4JN7A 1W9PA 4GWEA 3BJSA 3QZ6A 2Z6JA 5ABFB 1O4UA 5LNVA 2WANA 1MRQA 3BDKA 4BEQA 4EE9A 3SM0A 1EYMA 2W63A 2WVTA 1JYXA 4GQBA 3ZYZA 3H24A 1C7TA 3T8LA 3S42A 3IGXA 4UTUA 1WB0A 3S2MA 3BLLA 1QU4A 2XJ7A 4DJFC 1K8CA 3RILA 1M68A 3QV8A 3GBDA 1FKDA 5D9PA 2GDVA 4NZCA 4P7OA 4J9JA 2VR2A 5LNWA 4PB5A 1GVYA 5GNXA 3GBEA 5HULA 4AMAA 5EY5A 1JYWA 3RM4A 4BY3A 1UUQA 4HZ8A 4MAVA 4JTEA 4HBEA 1VIZA 1F9CA 3UETA 5C2XA 2ZZ1A 5CPMA 3AJ7A 2KR7A 4DBUA 4QDPA 1FWRA 2RUSA 3AI0A 2O4QA 3L4YA 3KOXA 1H41A 4WSJA 1J5TA 3M0YA 4B5VA 3EXTA 3BJTA 3QTPA 5AHFA 4F0MA 3KVKA 3OIHA 5M1TA 3R1ZA 3QPEA 1KM6A 4PEEA 3W7EA 1RA5A 2ALDA 4R34A 4GXMA 1HQTA 3P74A 4MWAA 4OVXA 3ZIZA 1XLKA 4M82A 2ESCA 3UJEA 3U0HA 3A3WA 1PTDA 2X1TA 1ZL1A 1X7IA 4D6FA 5E9XA 3WNNA 1FWTA 1A7XA 4OOUA 4AIEA 4M1RA 5BRBA 5KZEA 3B3DA 1ZY9A 2HROA 3CUIA 3R0DA 1BGGA 2WM0A 5CCZA 3PPGA 1SFJA 5BRPA 4OBSA 4AVOA 1U2YA 4F0LA 4DZ5A 3PZTA 1PUDA 1HN1A 1EX1A 2YDQA 4FMVA 2PDGA 1Q63A 2IMRA 3OHIA 4W85A 1JFXA 4GYJA 3S1GA 3REQA 3H2OA 4L1XA 5IOBA 4RE3A 3G18A 3TR2A 3QY7A 3K46A 3GC4A 2VZSA 2D2GA 1U5HA 3GTIA 4MNKA 5EU9A 2P8CA 1ZCCA 2QNEA 4ZB5A 3S4TA 2J8FA 4DN1A 4OBTA 4JFWA 1YW5A 1XH2A 1HJSA 4H8HA 5HQLA 4AZCA 1LWIA 1VEMA 4Z0SA 1BXNA 1CGXA 3TXVA 4N4QA 4XK2A 4LAYA 2BVTA 5GNZA 1K9DA 1NOUA 2ICSA 3ZFHA 1AD4A 1JPKA 1CIUA 2QVNA 1EGZA 3KLLA 2NLYA 4AYSA 2WZIA 3EX6A 1JIBA 4AIOA 4CCDA 2Z2UA 4ZTXA 4NP7A 1PKYA 2YCIX 4ZFCA 3OO2A 1JR1A 2V2HA 1GOWA 2C16A 1CT5A 1E9LA 3QJAA 2RURA 3ABRA 4KCUA 1FHLA 1QJWA 1IV8A 1R9YA 3T81A 5DO8A 3HGJA 1TUXA 1IZKA 3CEUA 2AQOA 5CJ5A 1W9VA 4L4MA 3S5ZA 5KZ6A 1UCWA 4LUJA 2ZZ6A 3QY8A 3JW7A 4DZHA 2O9PA 1J0JA 2PBOA 4HHLA 3TC6A 3LTPA 5FSEC 3YPIA 1B0IA 1WAWA 5A6BD 2ZX8A 1SFTA 3VGEA 1QPRA 1O5XA 4JFLA 1Y65A 4JFKA 4O50A 3VD9A 2BLEA 2YCLA 3MSRA 1XICA 3H12A 4Z2IA 3WFZA 2VOMA 1E44A 1Y7VA 4LW7A 2DW7A 3LM7A 4WXYA 3OA3A 4H41A 2VEGA 5LXXA 5G4WA 1PB0A 2XGZA 3E0WA 3EMQA 1UD5A 4A3HA 2YOCA 3P8IA 1SVDA 3CAKA 1JZ6A 1RALA 1UUOA 1GKPA 5I79A 4FK9A 4L9YA 4MKVA 4LS1A 5FAJA 2WJDA 1K03A 4H9ZA 1HT6A 2GQAA 3PTKA 1QAPA 3FGCB 3IJ8A 3BL3A 1G69A 4WHBA 1YPFA 3WBEA 4Y90A 1P6CA 3QOKA 4RJEA 5AHEA 3IRSA 1XUUA 4V2XA 4K37A 1WDQA 3R10A 3CV7A 2R91A 2HXTA 3P61A 4DM1A 5AC7A 4QNWA 5BU6A 1W1IE 3L9CA 3OZOA 1MW3A 1JZ7A 3ZSSA 3W84A 5JH1A 2J62A 2OMAA 4JHMA 4F9DA 1DXEA 4JYEA 4AEEA 1RK6A 4B9ZA 4FNUA 1ADSA 1LCOA 1GHRA 3GU2A 4ZXOA 4LY4A 1GW9A 3CL6A 5F1UA 1OFPA 2OXNA 4M7SA 4HOWA 4KF1A 1NP0A 1EDTA 2FDMA 3NEHA 2AGKA 3SN1A 3D47A 4H83A 9RUBA 3WLIA 2PU1A 2XN0A 4S1FA 3V36A 5D09A 2ABAA 1SSGA 4XTIA 3N1AA 4YN5A 1JCMP 2YXOA 4G9PA 1SUXA 1BAGA 1GYLA 4REQA 1VYRA 1WOAA 3QHNA 3R89A 2JBMA 2E8YA 1XWYA 4EPDC 3N34A 2WKGA 1UWAA 4D72A 2Z25A 1FWGC 1YBQB 1VBUA 4TIMA 3VKJA 4ADUA 3GRIA 1V3HA 2PPPA 4EPKA 1UR0A 1EOMA 5HR7A 1LG1A 2GK1B 2VC9A 2PWDA 2YYTA 4DY1A 5CPSA 1GTEA 4MWAB 3FHQA 1TCOC 2YLAA 3NDYA 3S1UA 4CN4A 1OFOA 2PLJA 5EFDA 1H63A 3Q37A 4E0CA 3C52A 3UI6A 1UWIA 1E56A 3TR9A 1FWNA 5DMYA 3C2EA 4AQLA 1XLJA 1BF2A 3SCRA 4Q8QA 5A8GA 2HDJA 5K4ZA 5M3WA 5GQBA 2DUAA 2PZNA 1I1WA 2VWTA 2E67A 2J25A 4JHZA 2DY3A 1KRCC 5JUVA 1X1ZA 1MMFA 1F07A 5JIPA 3LCLA 4YMZA 1UHVA 3C3NA 1Q6HA 3WBYA 3PBWA 2YJQA 1RJPA 1XRTA 4NAFB 3LSBA 1BD0A 1CGUA 1D8CA 2H3BA 1C90A 2FFIA 4ES4A 3FK4A 1H0IA 3E3HA 4GBUA 3IGHX 2IPJA 3UA4A 2Y6ZA 1EJ7L 5D8ZA 1Y8BA 1JPMA 1E9IA 1W91A 2F6UA 4J3WA 2K8IA 1LL6A 1HKWA 2QDGA 2QDEA 2R1MA 3NFUA 4RNFA 4X3ZA 3WUEA 2BBFA 3AMCA 1W26A 3AU2A 4Q4RA 3RLUA 1GZJA 3HA1A 4QEEA 3BLKA 3QFEA 2VC7A 3T4CA 2YDSA 1JXJA 4XSLA 2YFNA 4KQZA 1F3WA 4MY8A 3E2QA 4PODA 1XBZA 1TTQA 3U2OA 3OOBA 3AXXA 2DSZA 4J3SA 2XZ7A 1FA2A 1X6LA 3NO1A 2AGTA 1BKFA 4DJDC 1FUYA 3R13A 3RPTA 2G37A 1QVBA 3H2EA 5C70A 2P0OA 3IVSA 1CXKA 4QNEA 4JTQA 4WKAA 3PHAA 1FKRA 1AQMA 2DZWA 2VGGA 2Y5JA 3DDMA 1X39A 3VNKA 1ZZMA 2JZVA 1FKLA 8RUCA 7A3HA 3WJWA 1T40A 3PA7A 3AIBA 3AHTA 3CUHA 3F4WA 2E1DA 1AA1B 1RBLA 2HE8A 1FXPA 1QZ2A 2Z1WA 3GVWA 3W81A 4RNIA 2POTA 3UR2A 2ONEA 3LTSA 4A4AA 1MXDA 4H9VA 4RNHA 5FKYA 4O13A 3MMDA 2ATMA 3BOXA 3B7XA 4QDWA 1CGVA 4L3NA 2A6LA 5CAHA 2QCFA 2Z1VA 3DFOA 1TPDA 1BFNA 1DIOA 3G1VA 4JTFA 3BV7A 2EULA 3FKRA 1BXBA 3TTYA 4C7FA 1TR9A 1V0NA 1OY0A 1F40A 1R3RA 1RK5A 3PWGA 3G3DA 3SECA 3TAKA 1NMWA 1QWKA 5BRQA 3NL5A 4PUJA 1LBFA 2CLHA 3VD3A 1Q45A 3DFHA 3WLKX 5C5YA 1WNOA 3WD2A 4AD5A 3KOYA 3TSDA 3PB0A 5EMMA 8A3HA 3N4EA 2UY5A 4GZJA 4DNMA 2CZDA 3NQ6A 2LPVA 4M81A 1JZ2A 2C3ZA 3NQ7A 3AZTA 2HK0A 2PTXA 1NDZA 4AIUA 4A3QA 2PPNA 2ACRA 1KQZA 1R3SA 4IQ2A 5U4NA 5I03A 3IKDA 1ML1A 3LPPA 3JU2A 4AXKA 2NSOA 2VR4A 1RCQA 4R33A 3O5QA 3TN4A 2O7SA 4TVDA 1DOSA 3CIXA 3W2KA 4N0RA 1W1B1 1SZGA 3W7LA 1Q6RA 1G4EA 4LF2A 4DJEC 1DJYA 2GGIA 3PZIA 1E0XA 3PWAA 1XC6A 2LLEA 2YLLA 2GDUA 1J4HA 1K4HA 4UTLA 3W71A 4OKDA 1DWJM 4WX2A 2QCMA 2H8ZA 2BFGA 5FEZA 1XP3A 3EWUA 1W8SA 5DANA 3QMRA 4LEFA 3UW6A 3SRFA 4FF7A 4PUMA 3E1F1 1DL3A 5ECUA 3ISIX 4W8LA 3SSJA 2R1KA 2NT0A 1JCNA 4QJ1A 1RD6A 3IUDA 2V69A 3GC2A 2TRSA 3CAQA 4C6KA 4CNPA 4KEZA 8XIAA 4UFHA 4DX3A 3N9KA 1UP2A 5CC7A 3FVDA 3DX5A 1RXOB 3QGKC 4QE4A 3ARZA 1XCWA 2GWNA 5A8MA 2ZE0A 4GYFA 4DBEA 3TW9A 4H00A 3WZ0E 1YX1A 5JXQA 2WCSA 4CD6A 2DUZA 4IT6A 4LTSA 4LV9A 5TD4A 4LNCA 4HNVA 3QQ1A 3BPWA 2E77A 2HVMA 3CQIA 2PU0A 3NDOA 1C8VA 4LYQA 4G7EB 3P81A 3C8NA 5FAGA 4C6JA 5FIPA 1KXTA 2PP0A 1AQFA 4GC4A 3P84A 5AHIA 4GNJA 1E1CA 2M08A 4E38A 1Q6GA 1EGVA 2VX5A 3WDRA 2KO7A 2NX1A 1JUBA 4GPNA 2ANUA 1KXQA 1OFRA 1UIOA 2RQSA 1TFVA 5MKGA 4IPNB 4ODLA 6PTDA 4AEOA 3RR4A 4A21A 2WB5A 1O95A 4QITA 2J7DA 1XG3A 2L5HA 4TQTA 4O18A 1KGXA 4AZIA 4MKSA 3LHTA 4ODMA 1PHWA 2EPMX 1SPQA 2ZKMX 4AC7C 1CGYA 4PTXA 4JN8A 5H91A 3LG3A 3CHEA 2W92A 3BE7A 1FHUA 4M8UA 4IIDA 4ZO8A 2D0GA 2QCHA 3CJPA 4EVZA 4QS5A 1ECEA 5HANA 4AG0A 2ZX7A 7REQA 3MQTA 4H6EA 5K3VA 2R82A 4PB4A 4RE2A 4CGTA 4Y9PA 1ADOA 1WUEA 3LCWA 1HXJA 4JTJA 4UFKA 5AHMA 1VENA 2V5DA 1ODUA 4U28A 3GS6A 3DI1A 1F7BA 3BARA 2F23A 3WQ4A 2VEKA 1IEVA 3UJFA 1GORA 1X98A 5G4EA 3GR7A 5HQEA 4AU0A 1PAMA 3B9EA 1JXKA 4UTIA 2ZQ0A 1JCLA 3CL8A 3FNDA 4PUKA 1XFCA 1XLLA 4ZQCA 2EG6A 3GXDA 4KESA 1KTNA 4DM2A 1R3VA 1YE6A 3W2UA 4V15A 1QNVA 5D9MA 2JF7A 4IIBA 1KFCA 4NYYA 4NZFA 2CU0A 2BMBA 2YGYA 2WXDM 3DH7A 3GDBA 2FHBA 1L6GA 3ARXA 4J27A 1RCOB 2EG7A 5G5IA 3OB8A 1E43A 1PWLA 4BQ2A 3QPZA 2Y88A 4W8AA 1KKOA 1KBBA 3RAOA 4PZVA 2CZ5A 3NO3A 3MKCA 1ZJBA 5AY7A 2PDMA 3TC7A 1Q6UA 3SFKA 1J0IA 1S5TA 2WYSA 3N13A 3PZ9A 4S3FA 1UKPA 2NT1A 5EMJA 5LIKX 1A53A 4Q7BA 4YHGA 3W01A 3W2NA 4HCLA 1HP4A 4AX6A 4B5NA 1JCHB 1IF2A 2P3EA 3CASA 5JBEA 2D22A 1Q8JA 3WNMA 4L5ZA 2ZDSA 1H7OA 2I16A 1RJQA 3KDOA 1NDYA 4YWSA 3CK5A 1XLBA 5F2LA 3DOPA 6XIAA 3AWOA 2PDPA 4NJKA 2VD9A 2M2AA 4Z0JA 2QCGA 1YDNA 4WGXA 4GFIA 3PSWA 1E51A 3AS2A 1I4NA 1V02A 1GUVA 4D8AA 3TUUA 3UQBA 2VMFA 4JTRA 4PMVA 1KFKA 4E4FA 3F7JA 4FNQA 4AH7A 4CU6A 5DF0A 3GZ3A 5K9CA 2WBKA 1E0VA 5CEWA 2IPFA 2QR6A 1KWGA 1KXVA 1TZ7A 4K3ZA 4JCMA 4POCA 3R8GA 2VM8A 4PMXA 1LM1A 5M5DA 2KX9A 4B92A 1OD0A 2PDWA 3GIQA 4UWMA 3WQPA 3T7VA 4WD0A 4ZS6A 3BTNA 2HVNA 1D2KA 3GNNA 4DELA 3A4AA 4IQLA 4HA1A 3USBA 1GRJA 5CC5A 3GHRA 3MP4A 5LSMA 3EDFA 3MSYA 4EXBA 1EF2A 2E9MA 4XZ9A 4S2BA 4MB5A 5TQLA 5AYZA 2PDBA 2UY3A 4PUWA 3K8MA 4X60A 3TYZA 4FEZA 1TTJA 4A22A 2G5WA 1TA3B 4FN2A 1XIGA 3K4DA 1W3KA 2PDLA 2CKRA 1FKWA 2DZAA 1K02A 1LLWA 1TVNA 3G8RA 2Y8VA 4Z2GA 3L12A 3AXHA 2IPGA 1VCFA 3G6LA 2FMNA 3JRKA 3VNDA 1F8AB 1L6YA 5TBOA 2YX0A 3MVTA 3D0CA 3T2QA 1YPXA 1BWVA 4PUUA 2F21A 3WQOA 1KQYA 2GOUA 2R1LA 3V1HA 3B8SA 2GJLA 5CSSA 3PG8A 3IJQA 2YCEA 1ELSA 2DT1A 2TSYA 1BLIA 2Z24A 2W66A 5AHLA 3O5LA 2QHAA 1W9UA 2DH3A 1G1YA 5C7HA 3W82A 4IGSA 1JF6A 2QZRA 1C9DA 3PTDA 4HT3A 4HTBA 3BAWA 4PEKA 4DJDA 1RHCA 3D3FA 1N8IA 4QE5A 3G2GA 1XD1A 4MF4A 5CC6A 3A12A 1A5KC 1RSCA 1HXVA 5IDIA 3SEPA 1ZK6A 4MB4A 2C6QA 4FF5A 3VCRA 3WDQA 3BAXA 1PINA 4ZBCA 4HPHA 3E12A 4G7FA 2INFA 4AWUA 4ODPA 1MEIA 2W61A 2D2OA 4PUDA 3WENA 3LCXA 1QRQA 3TLLA 2OWWA 2J7EA 5EMKA 3FSUA 2H90A 3PFMA 4MKNA 4MNJA 2FJKA 3M0VA 4LVAA 2WQPA 1J93A 4NX5A 1BG9A 2DSVA 3Q4DA 4PMQA 3T4WA 3WK0A 1MQQA 3NSMA 3DFNA 1XBVA 1Z3NA 4UZUA 1QW9A 3R11A 2P5NA 3SRKA 4G1KA 4HPJA 2O0TA 1KM0A 2ZBTA 5DCDA 2OZ8A 1CTNA 1Q2SA 3LGGA 3OW1A 3H7VA 1EP1A 1EHAA 2CFFA 4PTDA 4JY8A 1OCQA 4DUWA 1GJWA 3E2RA 3WL0A 5HJXA 1FP8A 1EP2A 4KFNA 4Q8NA 3SGZA 2B0MA 3SJNA 1TELA 3OA5A 3BOFA 2GUBA 2DZBA 3ITGA 1IIGA 2Z26A 3UJRA 1D7KA 2PURA 3KACA 1TO3A 3DXIA 5T91A 1W9XA 1G7UA 1XRVA 2V82A 3TYEA 3W38A 2PWUA 5H8PA 1EDGA 2EJ1A 3ABQA 2MPHA 2A0NA 4Z42C 1HKIA 1IWAA 1W3HA 4UQEA 1T99A 4P5UA 4XO7A 1HGWA 3GHUA 4H7CA 3FAPA 4PFMA 1RA0A 1VPQA 3VD4A 4KCWA 2YBVA 5BZAA 5FF0A 3UFYA 4L56A 3K8KA 2P88A 3DC0A 4GKLA 1HGYA 5DT5A 1EOKA 4C65A 4CNOA 3MDYB 1SJAA 2HRWA 3UR7A 3H2AA 3N9RA 3W72A 4MNLA 3WCZA 2W62A 4UMBA 4D6DA 3NG3A 3CTTA 4PSPA 4ML9A 3CMGA 3NPVA 1WPCA 3FOKA 4JQ3A 1R3WA 3UVIA 2GJNA 3QEZA 2INEA 2ZWYA 4LANA 4TX8A 3VUSA 3WNLA 4F2BA 3EWCA 4NRRA 5CBIA 4AY8A 3ZLFA 4Z1AA 4DEFA 4LJ3A 1KFLA 2BG5A 4UQAA 3WJSA 1R9HA 3IV8A 1AH3A 2OSXA 3KOZA 4L65A 4EAMA 1S5MA 3WF1A 2YA1A 1J6YA 1LTDA 4O19A 5A8NA 3ZJ8A 1BEUA 3TYCA 4TW6A 4YNGA 1XYMA 1VZWA 3LHWA 2RKXA 3KAOA 3BUVA 1QNQA 2AAMA 3AC0A 3OZYA 1DV7A 4M51A 2ZA1A 4JIEA 2G8ZA 3U5UA 4NT0A 3MDUA 3OLEA 3VIMA 3URBA 2PDIA 1WZMA 1SO4A 3SCPA 3AYRA 3HQOA 5JH2A 4KETA 5HWMA 3O0FA 3BAYA 3MUIA 2J8TA 4N2YA 5FJIA 2YBUA 2Q8LA 1WKFA 3VNMA 1RQBA 1WKDA 1PBGA 3ARTA 4E2BA 3M0LA 4IJBA 4CQAA 3VDHA 4WGHA 2C7FA 1ITXA 1W1YA 1X7FA 4JICA 3A4WA 4UQDA 1H50A 5AVHA 5DIUA 3EOUA 2XH4A 1LWJA 1EXPA 2FVMA 4OJYA 3RUBL 4PCPA 4LXFA 3DYOA 4M7TA 3WYZA 2VGBA 4LYKA 1MW2A 1FWSA 3WH5A 4RR4A 1ZCNA 1H3GA 4PCFA 5A2AA 3CT7A 4EIVA 4CU7A 3UCCA 5FF4A 3EBVA 2POZA 3T2OA 3CT2A 3VM5A 5CLWA 3PC0A 1XJBA 1FWHC 4PTMA 1S46A 4I90A 4ERIA 2C1HA 5A6LA 1C8QA 3WF0A 3K1GA 4WY0F 4MLRA 3O5FA 1UMLA 5F4SA 5U7SA 4W86A 3DBNA 4O0KA 1A5CA 1TPH1 2BOGX 3CUJA 4ALDA 3W76A 3KVMA 3M0ZA 4GI8A 2ZOXA 1OZMA 3IVTA 4N6EA 2F2KA 5LYRA 1V02E 3MHFA 2I5IA 1FWJC 3U6WA 4QRNA 3W86A 2XVGA 1YXCA 3FEQA 2Y61A 4W4QA 1HVQA 3NSNA 5EFFA 3A23A 4KH2A 2MF9A 1O94A 1GNXA 1Q6EA 1GW1A 4XZMX 3BLIA 4DZ3A 1JGIA 4LVDA 4XAPA 1AZ2A 4TW8A 2WW5A 1OFQA 4JCLA 1I2OA 3EX1A 2FZ8A 4XAZA 1O6IA 4RCXA 5JH8A 2E6AA 3NL6A 3WQEA 2XM2A 1ME7A 3C86A 4Q8UA 4GOAA 4UTHA 1ZJAA 4IJRA 2QIIA 1K7EA 2RDXA 3HFYA 3KRZA 4E6MA 3C0LA 4C91A 4Y7EA 2GJPA 4AMCA 3U2EA 1UASA 4DUXA 1HJVA 3GDMA 3C2FA 4S3AA 1UWRA 2IS7A 2Z1BA 1YYAA 3TDBA 3W83A 4TTGA 2OJPA 4H6KA 1J8VA 3WMBA 4K1WA 5DELA 3I7QA 1FQ0A 3W0KA