1HKKA

High resoultion crystal structure of human chitinase in complex with allosamidin
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
364
structure length
364
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEQSGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CHITOTRIOSIDASE-1
publication title Crystal Structures of Allosamidin Derivatives in Complex with Human Macrophage Chitinase.
pubmed doi rcsb
total genus 132
structure length 364
sequence length 364
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1hkkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hkkA01
3KZSA 1G5AA 5C8BB 3QHOA 1VEOA 1W32A 3GXFA 2WHKA 1JAEA 4OZOA 3WIJA 1X1NA 1TE1A 3W53A 3NSMA 1DTUA 1C90A 1K9FA 3VPLA 3W24A 4CKQA 4WSKA 3W29A 2OLHA 3HU7A 2GJXB 1JXKA 3WDRA 2BHYA 2X0HA 4WK9A 1B30A 2PWEA 4W88A 1B0IA 3SCQA 1U30A 1VBUA 2WMGA 1V3LA 1OT2A 2G8ZA 3MMUA 1ZBVA 3OGVA 2DT3A 5LA1A 1UWIA 4AIEA 3VTRA 1QW8A 3M07A 1GZJA 2VZVA 2E9BA 3KEHA 1EH9A 3CUFA 5M5DA 1TVNA 1ISXA 2JIWA 2OWCA 1E6SM 1UQZA 4MAZA 5BYWA 1XD1A 2Q8XA 5DEZA 1JZ3A 3BMWA 1TG7A 5E6YA 4UQBA 4OUEA 4HZ6A 1H11A 1HKMA 5CPSA 1LG2A 3T2PA 3GXIA 3FAWA 5HXMA 5CPTA 4WKFA 5A8OA 1BQCA 2E8YA 2TAAA 4C7DA 2E0PA 3AZTA 4J28A 2ZUUA 3SUVA 5IHSA 4HZ8A 3G6MA 2WANA 2XGIA 4UZSA 4AEEA 3TP4A 3SUWA 4MB4A 3WMCA 1QHPA 4CD4A 1KXQA 4PUEA 2QPSA 4TX8A 4P7QA 3OZOA 1XHGA 4NRRA 5JH8A 1WZKA 1RD6A 2ZIDA 4ACYA 2WW5A 1WB0A 2DPEA 3ARTA 1OIMA 3PZNA 2G3MA 4XUYA 2OYLA 4V28A 2JIEA 1BF2A 3BAKA 4U3AA 3AI0A 1KQYA 2W67A 1FP9A 3N17A 5EBAA 3L4YA 1W9PA 3QOKA 2GJXA 1DEDA 4ZEPA 4OOZA 3POHA 1DWGM 2OSYA 1R85A 2NT0A 5HPCA 4UFLA 7A3HA 1H2JA 1LQ0A 2VRJA 1J18A 1J0JA 2XGBA 3GNPA 3L4ZA 4D6JA 2DH3A 1ESWA 1BYDA 3TTOA 2WMIB 2J7FA 1Q6FA 1EQCA 1UUQA 1E73M 1H4PA 1XYZA 4F9JA 1BGAA 5DFAA 4KH2A 6CGTA 3N04A 3LPPA 2DSVA 4HMDA 3THCA 5GQBA 3ZMRA 5AC5A 2DEPA 2XJ7A 2W61A 2GSJA 1W9UA 4L4PA 4UFMA 5D9PA 1NM9A 4HMEA 4F66A 3ZSTA 2PF0A 3WSUA 1VFFA 3MUY1 4ZE4A 3M46A 1E56A 1DWIM 4S3JA 1ISZA 2JEQA 1CZ1A 2CPUA 2XVNA 1V6UA 1E9LA 5KZ6A 4GO9A 4P7NA 4YHEA 2BS9A 2EO7A 5I5RA 3VIPA 3S2CA 5HDRA 1CXLA 1DWJM 3BAIA 1V0KA 3ZJKA 4W86A 1ZJBA 3CMGA 4E2OA 1UWRA 4KRTA 1GVYA 2JEPA 4NI3A 3NIYA 4BQ2A 4FF5A 2YDSA 1E0WA 1EDTA 5BXSA 1W1TA 3VM5A 3VVGA 5A2CA 3JUGA 4J3VA 4ZXLA 2QMKA 9CGTA 2CIPA 3ARWA 5FL1A 3PBGA 2XSAA 2YBTA 2AAAA 5A95A 3DYMA 1HT6A 2WAGA 4CD5A 3K8MA 4FLOA 5AYIA 2XFFA 1XC6A 1M03A 1JI2A 1DWHM 3GBEA 3GNRA 2CNCA 1KBKA 4W89A 2VI0A 4UTFA 4X9YA 1AQHA 3K8KA 2WMHA 2WZHA 4NSBA 2WMIA 4CVUA 2UWFA 4OBRA 4AC1X 1V0MA 2VUYA 1DWAM 1CEOA 1ZS2A 4JHZA 1UR2A 3AS0A 5CGMA 4ZXOA 5ABFB 2WB5A 3N18A 1IV8A 5CG0A 1A47A 1CECA 1V08A 4UCFA 3UG4A 2X05A 1JZ4A 5A6BD 2WSKA 4DWSC 1OB0A 1TUXA 5DMYA 2C7FA 1UG6A 1R86A 1WPCA 2G3JA 3MMDA 1UOKA 4AD3A 3CZJA 2J7HA 4P8VA 2F8QA 4H2CA 2FDMA 3MUZ1 4AISA 5A8QA 1KR0A 1TCMA 3W6LA 4WIWA 3TTYA 2J47A 1PBGA 3AHTA 1B3ZA 1E6QM 5FL0A 1ZU8A 1ITCA 1U2YA 1QNRA 1CNVA 1KGWA 4QLKA 3MKKA 4EAMA 3WL0A 1G0CA 3WNKA 4AYSA 4F9DA 3MANA 3BAXA 1EOKA 1UR0A 1B1YA 1M04A 3SEPA 3FY1A 2DH2A 2AMGA 2ZX5A 2VZSA 1HNYA 2BVYA 4AW7A 1M7XA 4CD8A 1US2A 1CLVA 3AMGA 4M8UA 4D6IA 1QI4A 1QW9A 2YL5A 4M56A 2WVSA 4W7WA 1EDGA 1GHSA 5ABEA 1W1YA 2YLLA 3IK2A 3KL5A 2XM1A 4AD4A 5CQ1A 1OSEA 3W25A 3WF2A 4MNMA 4GO8A 1UKOA 2EPNA 2CYGA 1NWUA 2VRQA 2W63A 4W7VA 3A4XA 3PZIA 1ZBCA 4M82A 3WUBA 1OGSA 1JIBA 2WLYA 1V02A 5GNXA 2A3AA 5BXTA 1B31A 8CGTA 1CGVA 2IXVA 1QI2A 5ABFA 1JZ8A 3WDJA 5JUVA 4PTMA 1J9YA 4MDOA 2GVYA 3WEZA 1FHLA 1MXGA 4B9ZA 3L4VA 1W9XA 2Y8VA 1W2VA 5M17A 5D9MA 1LG1A 4QLLA 4A3YA 4PSRA 4EANA 2J7DA 3ARRA 3MU7A 1GQIA 1HKIA 1BG4A 1E71M 3HMCA 2WHJA 5BROA 3THDA 1K9DA 4W5ZA 4EE9A 5JBFA 2XHYA 1HKJA 2FHBA 5HNNA 2WVTA 3PZOA 3PTMA 1FH7A 2WC7A 2CKSA 4H8UA 4PTVA 4AZ6A 3FAXA 2PI6A 4DUXA 1HL8A 1CGWA 5I24A 3ZOAA 1VFOA 1M53A 1FHDA 5A6KA 4PTWA 4GKLA 3T0DA 2Z1SA 4CCDA 4AZBA 3IJ7A 3UERA 2D22A 3AZRA 4H04A 5CXPA 2J78A 4GPNA 1ZL1A 1NQ6A 3PZQA 4MTVA 1PZ2A 1E5NA 1HP5A 1QNOA 2WZIA 4CN4A 1VRXA 4JKKA 4UOZA 4LPCA 1WDSA 2VVNA 1PX4A 2YJQA 5GNYA 4W84A 3OLGA 1E1FA 1YHTA 1XGZA 3AROA 3QGVA 4TVCA 1H3GA 2OYKA 1HXJA 5HBFA 2D2OA 4MNKA 3BAJA 2D3NA 2J77A 1Q6CA 3A3HA 1O6IA 3AIRA 3BGAA 1BYAA 3WN6A 3QHMA 3BSHA 3N11A 1TMQA 1MVYA 1WKYA 4BF7A 3L4TA 2YL8A 4C7GA 1EOMA 4OJYA 3T0BA 1CXIA 1EXPA 3CH9A 4JKMA 4P7LA 1CIUA 5CJ5A 1KB3A 3OA5A 2O9PA 2CKRA 4JL2A 1FA2A 5A6SA 4JFWA 4W85A 4V2XA 4TX6A 3CGTA 4J3SA 1V6YA 3PTQA 1K9TA 3VIKA 4JCMA 1UD8A 4WKAA 4XV0A 4JFSA 2VOTA 2ZX9A 1H1NA 5A6AA 4PEEA 3EDFA 3EYPA 1KXHA 5I6SA 3AIQA 2ESCA 2ZUSA 1BLIA 1PX3A 3L4XA 3AXHA 3T09A 1E70M 2J25A 1DWFM 3EDEA 5E70A 3SCTA 2V3DA 2WWCA 1KCLA 4KWUA 3WF3A 3WNOA 1GOMA 3NCOA 4JZ5A 3AMCA 3WQWA 3WH7A 2PC8A 1KXTA 2EPLX 4RL3A 4B16A 1IZJA 2GDVA 4QCEA 4QLJA 3FXYA 2PB1A 4PN2A 2G3NA 1B3VA 3WELA 2DQXA 4AZ5A 4UOJA 1GQLA 1D7FA 3BCDA 4Z2IA 3SCSA 2FGZA 2D0HA 1GOIA 3ARZA 3RJYA 4V27A 1TA3B 2PWHA 4AD2A 5GPRA 1VF8A 1H49A 3AYRA 3AHVA 4KGLA 3AJ7A 4UR9A 5FD0A 3CUIA 2JALA 1R7AA 1TZ7A 4HMCA 3ZIZA 3K1DA 4Q22A 1CPUA 3S6TA 2YA2A 1HVXA 3CZLA 1CENA 3VIIA 1QI3A 5IDIA 1J0IA 1E43A 3WDQA 4MADA 1G01A 2QF8A 3AMDA 3VMNA 5FCZA 3BC9A 1JF6A 2G41A 5ABGA 1HIZA 4E8DA 2WKGA 1UD3A 1W91A 4MJ2A 4ZFMA 3BAWA 1UKQA 3AIBA 5IXEA 2J79A 1CTNA 3KE0A 4QFUA 1V03A 4LXFA 4N0RA 1UD5A 1B3WA 1DHKA 2WNWA 2D1ZA 3CPUA 2BHZA 4UQCA 4H41A 1HP4A 5DT5A 5A2BA 5LA2A 4GI9A 2J7CA 2WKLA 1NP0A 1OD8A 1ISYA 5A6LA 2Y2WA 2D23A 2YIHA 4AZIA 4PMYA 4MB5A 3VIMA 4OIFA 3L2MA 4B3KA 1CXKA 1E4MM 3GM8A 1Z32X 4TUFA 1LJYA 1XYFA 5BXPA 4GI8A 3VD7A 4FLRA 5C70A 3ARVA 1E3ZA 3U7VA 3GXMA 1J0ZA 4AEFA 5BCAA 3VDCA 4QP0A 4E8CA 2CBUA 5EB8A 1W1PA 1LLOA 3CIVA 1ITXA 3MS8A 4BQ3A 3RJXA 2BY0A 1UR8A 4XX6A 1BG9A 2B31A 1V02E 3N13A 2Y8KA 3GH7A 2EJ1A 3WQ4A 1JDAA 4MNLA 1GJUA 1CLXA 1HJVA 1FH9A 2YBUA 2FHCA 4URIA 1TA3A 4JIEA 1C92A 1GORA 1JYNA 2GK1B 1JL8A 4AZ7A 4MDPA 3VIFA 1G1YA 4AIOA 5KEZA 4C7FA 3VGFA 1HJXA 1BGGA 1HJSA 3WQ6A 2J75A 3II1A 2ZUTA 3NDZA 4GZIA 3MUAA 3I3DA 2XFYA 1EGZA 4TVDA 4M80A 1SMDA 2UY4A 1FOBA 2J7EA 4S3KA 4D71A 2Y5EA 2W4XA 1Y7VA 3GDBA 2NSXA 2J8FA 2YL6A 4TOQA 3EDJA 1HF6A 5IHRA 2CBJA 2XG9A 3VX1A 5CPQA 2WHLA 3LPOA 2VURA 3VX0A 3GXDA 2PWDA 2GUYA 1SFSA 1VEMA 4Z2HA 3O6AA 4HU8A 1RP8A 3WD3A 1RH9A 2YA1A 2BV9A 3AZSA 3VD3A 3L4UA 4M29A 2J74A 1MW3A 2D3LA 1QHOA 2A3BA 4D6EA 3RDKA 5D9NA 5JBEA 2VQTA 3CUGA 3PZVA 1I1WA 2EXOA 5AYBA 3DHPA 3FW6A 4A3HA 4IPLA 2VRKA 3AS1A 5D8ZA 4CD7A 5IFTA 4J3UA 3GNOA 3EDKA 3PZGA 2ZWZA 3U5UA 3PZMA 1LF1A 1GQKA 4ATLA 4R5EA 3VGGA 1F4HA 4CU8A 1QBAA 1J0KA 1QNPA 1MQQA 3AIUA 3ZJ7A 4MNJA 1GQJA 1CXHA 3VDBA 4HP5A 3VNZA 1C8XA 5FKYA 1GOWA 2VCAA 2BY3A 1JYWA 1SYTA 2WVUA 2J8GA 4ML4A 1OCQA 4PMNA 3WH6A 3ZJ6A 1HN1A 4AWEA 4GXPA 4WF7A 3WFZA 1GOKA 1M01A 2JE8A 1E72M 5ABHA 4J3WA 2GK1A 3B9AA 1WNOA 4P8UA 1C7SA 3LPFA 5CGTA 4AD5A 1E1EA 1W9DM 4J27A 3SURA 2HISA 3CUJA 2PWFA 4UFKA 1NWRA 3RMEA 1QHZA 2QHAA 4OBSA 3NSNA 1NWSA 3J7HA 4AZHA 2WBGA 1SMAA 4GZEA 1UD2A 2VZUA 3MV01 1BTCA 1VJSA 4P7OA 3WD0A 3FNDA 1JGIA 4MB3A 1VJZA 4U33A 3W81A 2CEQA 4IM4A 4W5UA 4CCEA 3ARPA 2GJRA 2XVPA 5A6JA 2XPKA 4JFUA 3WF1A 1PZ3A 1UA7A 2WLZA 4RE4A 5LYRA 3UG3A 1QPKA 4D6CA 7TAAA 1OGBA 3D3AA 3T2OA 5HOSA 1UZ1A 1X6NA 1E40A 2WMFA 2Y24A 4J3TA 2ZX6A 3VOCA 1V3KA 2CBVA 1XSJA 1CGYA 3BLPX 1EIBA 4PRWA 1LL7A 3CHDA 2BVTA 3CZEA 2VX7A 4PMDA 2WCAA 3AS3A 2VVSA 2VMFA 4HOWA 3A6OA 1JNEA 4ACZB 2O9OA 4PCTA 1K9EA 1MQRA 4D72A 1VFUA 4RE2A 2V3FA 1UWTA 3RPMA 2E40A 4P7RA 5F7UA 4Z2GA 5JIWA 1EDQA 1ODZA 1L8NA 2DIEA 2WXDM 2UY2A 3WMBA 4QAWA 3BXWA 3VGHA 8A3HA 3WNMA 2V38A 3CZ8A 1WZMA 4B9YA 1OIFA 3SCOA 2VJXA 3AXIA 3W37A 1QOXA 1KGXA 1PX8A 4LX4A 2EBNA 3AQUA 1BVNP 4H8VA 1JYXA 2NT1A 1H41A 3AHZA 1GVIA 3WD2A 3IANA 1PIFA 3PN8A 3MO4A 3VD5A 1LL6A 2C0HA 3OB8A 2ZXBA 4HOXA 5D8WA 3AIEA 3AMKA 1LWJA 3WD1A 1NP2A 5I3DA 1W3HA 3PZUA 3VNYA 2JF7A 1WDRA 3AIWA 1ISWA 1JG9A 1HKKA 2VX6A 1H5VA 1A3HA 2QLYA 3WMSA 4U2YA 3NUKA 1GJWA 3RM8A 5CZKA 1B3XA 1GHRA 1GONA 2X2YA 3DYOA 1NOWA 1JF5A 5A6BA 2A3CA 4UQAA 2DGAA 3IJ8A 4R27A 1UH4A 1BYBA 1E5JA 1PEZA 3K8LA 2BXYA 4B3LA 1WZAA 3BCFA 2BY1A 2DIJA 3KL3A 4JL1A 4PYSA 4UOQA 3WUEA 3WQVA 2OWXA 3VD9A 3DC0A 1GNXA 4DM2A 4HA3A 1L0PA 5DT7A 4ACZA 1ISVA 3BMVA 4ZE5A 4GQRA 4UQEA 5HPOA 1QI5A 1E4NA 1XH1A 1XCWA 3ARSA 3VKKA 4QCFA 1JFXA 3W28A 3T2QA 1TVPA 2WMJA 2X0YA 2E9MA 2ZUMA 5A8NA 4PBGA 2DSKA 2WBKA 1NOUA 1QNSA 3HJEA 3ALFA 1EHAA 2ZUVA 2QPUA 1XRVA 2DT0A 4PMZA 1VB9A 3WFLA 3W38A 2RGLA 3WY1A 3RO8A 4CN1A 3WEOA 2XVLA 1ZJAA 1JDCA 3E1F1 1UR9A 3POCA 1UR4A 2DT2A 2MANA 4PMVA 1GW1A 1E15A 1E3XA 5FIPA 2BFGA 3VMPA 1R8LA 3MUIA 2QV4A 1NOFA 4J3XA 3EMZA 1WP6A 3WF4A 3GZAA 1JZ6A 4YN5A 3AXXA 1XCXA 1B2YA 2DSZA 1Q6EA 3FHQA 4E4PA 1BVZA 2WPGA 2YA0A 3VM7A 6A3HA 1HL9A 3AISA 3T0AA 2W91A 2E3ZA 1UH3A 4D1IA 1JZ7A 1WE5A 2VR4A 2VTFA 1B9ZA 1V3MA 2VL4A 2YOCA 4GQQA 1C93A 2V5CA 2WM0A 4X0NA 1AMYA 5A2AA 1TR1A 5AC4A 3F5JA 3KL0A 2XVKA 2GJPA 5M3WA 3CHEA 5I0DA 2NW0A 2E8ZA 3WENA 1WCGA 4H7VA 1NH6A 4WLCA 3TONA 3ARQA 1V6VA 2J4GA 5BXRA 3U57A 4BQ5A 2CHNA 4K68A 1WDPA 3VMOA 1JAKA 2J7BA 3A47A 2WWDA 3VIOA 1CBGA 2RGMA 3VD4A 3SCWA 1W3LA 2YLAA 3BH4A 1ZBKA 1BFNA 4LGXA 1EHNA 2BXZA 1KQZA 3QR3A 4HU0A 3I3EA 5E9AA 1ECEA 4RE3A 1VFMA 4ZENA 4P8WA 2XWEA 4D6FA 5FOOA 2OSWA 1HJQA 3OG2A 4JCLA 4JFVA 1TFVA 3WBAA 4IISA 3B8SA 1LL4A 5CSYA 3EMQA 4CU7A 3F4VA 4HA1A 1X6LA 1JZ5A 5BRPA 4Z2JA 2HVMA 3VGBA 2W92A 2JFEX 4NF7A 4IPNB 3ZM8A 1XSKA 3SCRA 3OZPA 4U5IA 4LYPA 1BPLB 1BYCA 3WF0A 3VDHA 3EMCA 5D9OA 3DYPA 4MJ4A 1CYGA 4PCSA 4XZBA 2D20A 2C8NA 2BNJA 2WCSA 2ZXDA 1JYVA 2EPKX 3AS2A 1MFUA 3U5YA 1E6RA 2O92A 1YQ2A 1XH2A 2EQDA 4PTXA 2XFRA 1UKSA 4PUDA 4PMXA 4X0VA 3ZR5A 1V3JA 3IAPA 1JNDA 3OLDA 3VGEA 1H0GA 5I78A 2XVGA 4UNIA 3AOFA 1WAWA 2EPMX 4Z2LA 3BSGA 1Q4NX 3FHAA 2DSWA 1KR1A 2WCGA 3VDAA 3ZT6A 5A8MA 2G3IA 3LMYA 3CBWA 2VR5A 4TTUA 2IXUA 1BAGA 1V0NA 3SIMA 3RIKA 1CXEA 3T08A 4FMVA 4CN6A 1HJWA 3CHFA 5JBDA 1HX0A 1N82A 5JIPA 3OGSA 4HOZA 4U31A 3VIJA 4D6HA 3GYCA 4OKDA 3VO0A 3F5KA 1GOQA 2XWDA 5I23A 4CD6A 1UWQA 1OWQA 3CO4A 1JXJA 2IUZA 4AIUA 3RILA 3UR8A 2WYSA 2XTKA 3ECQA 5AY7A 1OT1A 3ALGA 1HVQA 1I75A 3AIVA 4UQDA 3SUUA 2VX4A 3UETA 1MW1A 2WMKA 4HA4A 2XSBA 4XZWA 3WBEA 1G9HA 2OYMA 3ZQ9A 1J11A 1R7OA 3MMWA 3RM4A 3NDYA 1MW0A 4JKLA 2FGLA 4KMQA 2OSXA 4MB1A 1QVBA 2UY5A 4CVWA 1C91A 2O9TA 1AQMA 4AXNA 4KRUA 3MSGA 2V3GA 4TXEA 1FH8A 2QMJA 4GZJA 1K6AA 4JFTA 2ZWYA 3A4WA 3EDDA 3MV11 2AOSA 1UQYA 4UFIA 3VIGA 3WUGA 2V3EA 5IFPA 3WNPA 3WDHA 4F79A 2ZXAA 1E55A 3UEQA 5E6ZA 2CHOA 4DWSD 1FFRA 1RPKA 4AZGA 1I1XA 3ZO9A 4N42A 2O9RA 3WNLA 3L4WA 3UR7A 3O9NA 3WKZA 4M81A 3K4AA 3A4AA 4GIAA 4UQ9A 4XB3A 3SCNA 1QI0A 3F5LA 3W27A 2A3EA 4PMRA 4AD1A 4U2ZA 4DWSB 2VCCA 4PMUA 3ARUA 1VBRA 2PBGA 1UWUA 3ZJ8A 3B9DA 3VUPA 5GNZA 2CERA 1VIWA 3O2LA 4AZCB 5A1AA 4HPHA 2EEXA 1KGUA 1V3HA 4EK7A 2WC3A 4KGJA 1P6WA 4B15A 1Q6DA 2DT1A 1V0LA 3HN3A 1W9VA 1B3YA 2YDQA 2EPOA 2PBOA 4PSPA 1G94A 2X1IA 3PHAA 2WC4A 3MSDA 4QDMA 1J0HA 2JF6A 2ZE0A 5CLTA 1E4LA 1JDDA 4NRSA 4L4OA 1MYRA 4CU6A 4CUCA 2BVDA 4GINA 3EBVA 2VZOA 5I2UA 2W5FA 2ZUNA 4D6DA 3IJ9A 2ZICA 1CGXA 2VNCA 1EO5A 1EA9C 5TD4A 2D24A 2OWWA 1IZKA 4HPGA 2E4TA 3APGA 1XD0A 1KWKA 4W8AA 1C3FA 3LPGA 1QNQA 3VU2A 4GI6A 3QHNA 2XUCA 1ZB5A 2XIBA 1PAMA 3GH4A 1US3A 2CCRA 1RP9A 2CETA 4TTGA 2W62A 1O7AA 1EO7A 3CZGA 4HTYA 2D0FA 4U5KA 3ZSSA 2ZX7A 1B90A 2VQUA 5EFFA 4YPJA 1JZ2A 7CGTA 4WSJA 1OBAA 4M24A 1OD0A 3N15A 3W26A 3UCQA 3ZR6A 2XYLA 1MFVA 1OINA 2Y4SA 2W66A 1KBBA 1UR1A 1V6XA 3OIHA 3ARXA 4DM1A 3UG5A 3N9KA 5E0FA 1W9BM 2Z1KA 4PMOA 4WJXA 3DHUA 1F4AA 1J12A 5DO8A 3CTTA 4W8BA 2VZTA 3ARYA 2BHUA 4DWSA 1W3KA 4UZUA 4DUWA 5A69A 1KFWA 2ZOXA 3TTSA 2ZX8A 2WVVB 4H8HA 1UD6A 4AZCA 1C8QA 2WK2A 5E09A 3VINA 2D0GA 1KWGA 1S46A 2XIIA 5DF0A 3WQ8A 1HJUA 4PMQA 4Q7NA 3ZT7A 1PIGA 3B9EA 1ZBWA 2G4FA 4WKHA 1W2PA 2VT0A 2BY2A 4M1RA 2VC9A 3GH5A 1WZLA 3DECA 3I3BA 2J62A 2YDRA 2FH8A 1DP0A 3RM9A 1UH2A 1C7TA 3WD4A 3GBDA 4JAWA 5CSUA 5BWFA 3D5HA 4A4AA 5CLWA 1XH0A 2VO5A 3PTKA 4J7RA 2VCBA 5E0CA 4BA0A 4EKJA 5M03A 1MQPA 3IAQA 2CESA 2X09A 2DDXA 1Q6GA 4F8XA 1H0IA 1CWYA 2CXGA 3WNNA 4ATDA 4Y7EA 4P8XA 1E6PA 4D6GA 3N1AA 3PZTA 2CBIA 3CLWA 3OBAA 1BSIA 2GFTA 2WHMA 1FFQA 5D4YA 5I77A 3AFBA 3SUSA 5BRQA 1VENA 2FHFA 1VAHA 2J7GA 3NJ3A 3CMJA 4YHGA 3RCNA 3PZ9A 3FN9A 2DSUA 4TVUA 3GTNA 5C71A 3WDIA 3K4DA 4W93A 3WH8A 1D2KA 1GOOA 1UWSA 4W87A 4D1JA 4LYRA 3L2LA 4U3CA 4FLSA 4BCEA 1W3JA 1C8YA 3AHXA 1CXFA 2PWGA 1J0YA 2X8RA 4DUVA 1UZ4A 3N12A 1GUVA 3CHCA 1R87A 2WVVA 1EQPA 3CZKA 3K46A 4AD0A 2F61A 1GPFA 4MPKA 3W4RA 3TA9A 1H09A 1V3IA 4IUGA 1AQ0A 2FH6A 1J10A 3M6DA 1E0XA 4CGTA 1VEPA 1E0VA 4BS0A 3SUTA 2UY3A 4AY1A 3OLIA 3SCUA 1XSIA 5EFDA 2F2HA 3KWXA 3M7SA 3ZT5A 1E6XM 4NZCA 5A94A 1MW2A 1QBBA 2VX5A 1OGGA 3NYDA 4OOUA 3W0KA 2ZXQA 3WEMA 3G6LA 3NSXA 1NWTA 1W1VA 3AMLA 3WH9A 1MWOA 3WDPP 1SR0A 1GCYA 4ATWA 3AYSA 5LA0A 4FK9A 4UFJA 1D3CA 4Z2KA 3TOPA 3OLEA 4W7UA 3WQ5A 3VIHA 1OM0A 2XM2A 1JD9A 1J01A 1UYQA 6TAAA 1IT0A 5A3HA 1UD4A 1XV8A 1UHVA 2CITA 2V5DA 4LYQA 4FLQA 4LQ1A 2YKKA 1UKPA 3VGDA 2GDUA 2WZEA 3BLKA 3QOMA 1CGUA 1CGTA 3W6MA 1KXVA 5A8PA 1UKTA 1WDQA 4MAVA 1KCKA 3OGRA 1E6NA 1AVAA 4UFHA 5EMYA 1WO2A 3U7BA 2E9LA 5A6MA 2WSPA 3W82A 5ECUA 3BAYA 1UA3A 1NARA 4JHOA 1JFHA 3SCPA 3CUHA 3UESA 1BHGA 1ODUA 2A3HA 4AMCA 1JD7A 1MXDA 4BQ4A 3AHYA 3SCVA 2ZUWA 2YL9A 1E6ZA 3TTQA 3VILA 1PPIA 1LWHA 4W8LA 5I79A 3WH5A 3WL1A 3WUFA 1JI1A 4HZ7A 1V6WA 4CCCA 1U33A 3AICA 1FP8A 1PJ9A 1CDGA 1E4IA 4BZYA
chains in the Genus database with same CATH superfamily
1K8CA 4DJFD 3UVAA 3N34A 3KZSA 4DXKA 1VEOA 4IP7A 1BVWA 1YTDA 3KOWA 3WIJA 2ZZ7A 4LBUA 3GTXA 5IBXC 2Y5SA 1O60A 1DTUA 2W6RA 2ATSA 4G7FA 3W1PA 3GG0A 3W29A 1P6CA 2GJXB 2PWVA 4RZ6A 3O07A 5IBXA 3WDRA 3TC6A 4JYSA 3E96A 2X0HA 1UPPA 4W88A 1U30A 3NQ7A 1KV8A 3ZYZA 2J6XA 1W54A 3OGVA 2DT3A 2Z00A 3QTPA 4AIEA 3G0XA 3WH0A 3PBUA 3OYXA 4I9AA 3LBMA 4B2DD 3SQLA 3MI3A 5H6HA 3CWOX 4AYGA 1GT8A 1FWIC 2DJXA 3MBFA 3GYEA 5M5DA 1TVNA 1X8CA 5I3JA 4IMGA 1UQZA 2Z24A 1KTCA 1S5WA 3V0UA 2Q8XA 1DXIA 3I68A 1FRBA 1QPQA 5DEZA 4YTSA 1TG7A 3HA1A 4QG6A 4YU1A 4UQBA 4OUEA 4Q8UA 2PDNA 3GR4A 5I7GA 4AH7A 5LGXA 2QGHA 5CPTA 3S1VA 1K8YA 5A8OA 3C4UA 2EPHA 3VE9A 1VCGA 4M5PA 4US5A 3M0ZA 2WANA 2ZA3A 4DLMA 4GIRA 1ADDA 2XZ7A 2QXWA 2HXTA 3TP4A 2VOMA 3SUWA 3QN3A 1KXQA 4TX8A 4P7QA 1XLHA 3IUDA 3TQVA 1RD6A 1TJ1A 2WW5A 1UMYA 1WBHA 1G6CA 3NZRA 3PZNA 2G3MA 4BF9A 5GVJA 4DNHA 3XIMA 1W56A 1QCWA 1BF2A 2JIEA 3BAKA 2ZQVA 1K02A 4U3AA 1IE7C 2W67A 3MSRA 4FALA 3GTFA 5AHFA 1G7UA 3E38A 5D38A 3WQOA 1OX4B 2VRJA 3K30A 2G5WA 5CSRA 4DO7A 3IV8A 2XGBA 3GNPA 4JTUA 4ZSUA 5GJNA 2GSEA 1BYDA 1JVNA 2J7FA 4GIYA 1R38A 1XYZA 5DFAA 3HPSA 3LTYA 3THCA 4RDVA 1XLCA 1Z41A 4YWSA 1TPH1 2DEPA 1P43A 2XJ7A 3O7UA 1QUMA 2IQDA 4OBTA 3PG9A 4UFMA 3OP2A 2HS6A 5J5DA 2Q09A 3ZSTA 5EYWA 4EP8C 1F6YA 4GD0A 5HUOA 2Q5AA 3PBMA 1TJRA 3BG9A 3GG8A 1DWIM 4HK5A 1ISZA 4NKCA 2CPUA 3B04A 1V6UA 3RR4A 3P82A 3GNDA 5KZ6A 3UF9A 3QZEA 4P7NA 2YGYA 5EMUA 5I5RA 3NXFA 5F4WA 4GK8A 4XAKA 1DWJM 1OK6A 3TMLA 3S5SA 1FWHC 1S5MA 2OT0A 4WXYA 4E2OA 3LRLA 1UWRA 3CV1A 3FYYA 2JEPA 4NI3A 4WVXA 5REQB 1TCDA 3FK4A 2YDSA 2KGJA 2QJJA 3RLHA 1W1TA 2C3ZA 1PDZA 4ZO6A 3U4AA 3M0XA 5H8UA 1RUSA 4KFOA 9CGTA 2CIPA 1TJPA 1F40A 3EXTA 4L72B 3TW6A 1GVSA 1K70A 2YBTA 2V6AA 3TVAA 1XW8A 3BZJA 2F38A 2WAGA 4CD5A 2L2SA 2XP6A 2XFFA 1ITUA 4C60A 2RSEA 3GNRA 3QSRA 3Q94A 3HTWA 1GYLA 4M0XA 3GVRA 4HJFA 4HQVA 2A5HA 1QW7A 4OBRA 4QXIA 3RLVA 3LHTA 1CEOA 4HK6A 3P6LA 3T05A 2XIOA 2WB5A 4TMCA 2RURA 4R85A 3O5KA 3N19B 1CECA 1V08A 1GKPA 3KTSA 3UG4A 2YW3A 4DWSC 4Q8WA 2C7FA 3CYJA 4K6AA 1W17A 1L9WA 4GJJA 4ODQA 1WPCA 3LHVA 3MMDA 1VFTA 2J7HA 2OFJA 3NGFA 2F8QA 3S9IA 2DQWA 3MUZ1 5A8QA 1TCMA 1V93A 3UI6A 1TV8A 1E1CB 1PBGA 3AHTA 3U3HA 3GPKA 1B3ZA 1KCXA 4S3GA 1E6QM 2INEA 4FR1A 5C9ZA 3CH0A 5FL0A 2ZC1A 1QNRA 1CNVA 4Q8VA 3WL0A 3WNKA 3WQEA 3QYQA 2GVLA 4LNYA 3W02A 4AYSA 3BAXA 1UR0A 3NQAA 3FV9A 3SEPA 2P53A 3QZ6A 1GYMA 2IKIA 3SFWA 3M0KA 3V1PA 1LT8A 2ABBA 2VWSA 3EX4A 2BVYA 4BF5A 4UTLA 4AW7A 1EJ7L 4AWSA 4CD8A 3NNTA 2W9MA 1VHCA 1EZ2A 4PB4A 1GG1A 1QI4A 4NL1A 1QW9A 2YL5A 1F6KA 1GHSA 3IJQA 1BXCA 2V81A 3IK2A 3KL5A 1VCFA 4TO8A 4G7EB 3NZQA 3WF2A 1S5VA 4U10A 4MNMA 1AFSA 1Q6RA 1S2WA 2VRQA 2W63A 5I3GA 2ODOA 4W7VA 4FXJA 4M82A 2HROA 1GKRA 4GXMA 4XVEA 4JX5A 2FFCA 8CGTA 2IXVA 4RJEA 1XLAA 3KRSA 1J9YA 1TVLA 2GVYA 2QS8A 3NDOA 2VEGA 1FHLA 4L5ZA 5I3IA 3A3WA 4V1YA 2CXEA 3L4VA 1W9XA 5FF2A 4WEVX 1W2VA 1ZAIA 4CNPA 3C0LA 3W7OA 1XDLA 4PSRA 1A0EA 1TTQA 5FJIA 4XAYA 1H50A 1G7VA 1HKIA 3W23A 4J9JA 3Q37A 3HMCA 1Q3NA 3NL6A 3M0LA 1UC5A 1XG4A 3O5OA 1HKJA 5DCEA 3KAGA 1SSDA 3VKBA 1Q8JA 2PDKA 2PDMA 3VOHA 4PODA 3PTMA 1FH7A 2WC7A 3UZWA 2CKSA 1WKDA 3FAXA 1ZJIA 1GZGA 4HYWA 1HL8A 4BY3A 2DUZA 4JTFA 5FJUA 5I24A 3NZ1A 4MYXA 4GNVA 1S2AA 4IUOA 3KP0A 4JQ2A 4DZ3A 3HO8A 1KLZA 3N6QA 3EIPA 4ADTA 1TO3A 4E8GA 1Q85A 1ZL1A 1GZ1A 1PZ2A 1E5NA 4DRKA 4IHCA 2ALRA 4DZ5A 3ANYA 1G4EA 4NAEA 2QJNA 3ITLA 2VGBA 2R14A 4BI7A 1E1FA 4PL2A 3QGVA 3HG2A 1H3GA 4WHBA 3EEGA 1I0DA 4KPLA 2OYKA 5HBFA 1F8MA 3BAJA 1Q6CA 3MCNA 5LKYA 3A3HA 1B9BA 2WJZA 1O6IA 5AVHA 3N11A 4DB7A 1OFPA 3OVQA 3L4TA 1EOMA 1EXPA 4JKMA 1L6SA 4N7QA 5CJ5A 4M6UA 4LS1A 2D2HA 3HQPA 2ZRXA 1NMVA 1FA2A 5A6SA 4JFWA 4W85A 4CQ8A 2QUVA 4J3SA 3PTQA 3QZAA 1K9TA 3CWNA 5BZAA 2Q01A 3QW4B 3ABXA 3BJTA 4WKAA 4JFSA 2VOTA 4RE0A 2ZX9A 3QV9A 3EDFA 3I7SA 3AIQA 2ESCA 2ZUSA 5T8GA 4K2SA 1K03A 3L4XA 3T09A 3W2MA 1E70M 2J25A 4EPBC 1PYFA 3GKAA 3FXGA 4NASA 3EDEA 2V3DA 5FJRA 2WWCA 4KWUA 1TQJA 3TSBA 2NUXA 1UP2A 2PLMA 2QJMA 4B16A 2GDVA 3SDOA 5LNRA 3S2LA 2DQXA 3HG5A 4AZ5A 4UOJA 1GQLA 2PD5A 1NF7A 3M7WA 3MSYA 1GOIA 1EA0A 3ARZA 1VF8A 3ES7A 4UR9A 5FD0A 1AJ0A 4PE8A 4DO4A 4BHYA 4LAXA 2GLKA 1RJRA 1XUUA 1EQ3A 4KT2A 2QJIA 2HVNA 3VIIA 1TJ2A 3EEZA 3WDQA 4OECA 4B92A 2EKGA 3KCLA 3VMNA 3GR8A 2G41A 2A7NA 4F2UA 1G4SA 1UD3A 2YFNA 2MF9A 4JYEA 1QT1A 3AIBA 1CTNA 3KE0A 1Q8AA 2HE8A 4LXFA 4N0RA 4LOCA 4EF9A 3CB3A 4BR1A 2D1ZA 3CPUA 4LRSA 4B5NA 2BHZA 4QAIA 1O1ZA 5TQLA 3GD6A 4S1FA 4QGCA 2V0TA 5LA2A 2C71A 4GJIA 4BEQA 4JXCA 1NP0A 3TCEA 1XYAA 3BLFA 5A6LA 3QVQA 3MBDA 1LOLA 2OX4A 1SFJA 3ITTA 4AZIA 2F4EA 2C79A 1FKTA 4DJFC 1PO9A 2F7FA 3I4EA 3PANA 4TUFA 4HSOA 4D8ZA 4LF2A 1B3OA 3VD7A 3P5YA 3WCZA 3N2MA 4MF4A 5BCAA 3ZVHB 4M1BA 4E8CA 2CBUA 4H9YA 3BV7A 3T7VA 4NAFB 5I09A 3P3BA 3P61A 5EMKA 2B31A 1KFEA 4HHLA 1LBMA 3KBSA 3WQ4A 2Q02A 1JDAA 3RMJA 3PRBA 1HJVA 2E1WA 3TW9A 1IWBA 1FH9A 2VC6A 2E6AA 2FHCA 4URIA 2PGFA 4K1GA 4JIEA 4GVIA 1TREA 3P8JA 1G1YA 3FA3A 4C7FA 4LUSB 3VGFA 1HJXA 1IX5A 2NX3A 4C65A 1M65A 1M6JA 3UVIA 1ONWA 1Z7AA 4GZIA 2DY3A 4TX9A 5HT1A 1A5BA 4FI4A 3I3DA 4FPSA 3LOTA 4JY9A 3TTEA 4XVDA 4XIMA 4JBRA 3H55A 4S3KA 5FA5A 4DAIA 1N7KA 1EC9A 4JX6A 1H61A 4XBSA 2J8FA 4M6PA 3EDJA 4M6VA 1EP3A 2XG9A 1FTXA 2PWDA 2GUYA 2B7NA 1SFSA 1ICPA 1VEMA 4Z2HA 4GBDA 5LIWX 4HU8A 2H9AB 3IJLA 3VI2A 2FLIA 3MVIA 2BV9A 1DV7A 4K7VA 3L4UA 2IPFA 3FJ4A 1FKSA 1MW3A 3IJ6A 2IF4A 1VFLA 2D9FA 1DJGA 3IRSA 4D6EA 5D9NA 4YTTA 1J79A 3R8RA 2PTZA 2QAPA 4HN4A 4Y9NA 4A3HA 4IPLA 2Y88A 4LV9A 4JIHA 5D8ZA 4CD7A 4DBDA 3SO7A 3HGSA 4ATLA 4C6CA 3VGGA 1QBAA 1QNPA 5C2XA 4MNJA 4MGGA 2ZA2A 5FKYA 1GOWA 3PUGA 1JYWA 3GHRA 4PZVA 2WVUA 4ML4A 4GYPC 3WK2A 4DROA 4DAFA 4ODRA 4NNAA 4WF7A 4LVFA 1M01A 4GYPA 2RKXA 4NP7A 2F9RA 1E1EA 1W9DM 4HBOA 4MPQA 4A2SA 4POCA 3HG4A 1QHZA 2AKZA 3WZ0E 4QEHA 1US0A 4K39A 2PU0A 3PB0A 5CPNA 1PWLA 3W86A 5CBIA 1Y0EA 1VJSA 3A9IA 5LZLA 3WD0A 4Q4SA 4U33A 3HQOA 1GW9A 3W81A 2CEQA 2GVGA 1JUKA 3EKLA 2WSRA 2OTDA 3GXTA 4Q4MA 4W5UA 3M5YA 4CCEA 3ARPA 3QLDA 1ZFJA 3WJZA 1UA7A 3XINA 4RE4A 3UG3A 1QPKA 3QMTA 4FN2A 4UTKA 1C9DA 3BK0A 1UZ1A 1X6NA 1E40A 4XK2A 3W7JA 2NWSA 2Y24A 1Z3NA 3RHGA 1EJVC 3BLPX 2I5QA 2X2GA 5EL1A 3HURA 3CZEA 4HARA 2VX7A 5BU6A 1W3IA 3LLDA 3PVFA 4O54A 3PBVA 2HJPA 2O9OA 1U1HA 1K9EA 5JQ9A 2V3FA 4DZHA 3PG8A 3RPMA 3SRDA 2E40A 4B5UA 2HPMA 5D37A 4GYJA 3ONBA 2VC7A 3EB3A 1ODZA 3O6CA 4BI5A 2P10A 3WMBA 4QAWA 2ZRVA 5CCZA 2RUCA 3EOEA 4DRNA 3W37A 3DEQA 1XDMA 1KGXA 2J8TA 4LX4A 1FWAC 2VWTA 2QCGA 4PUWA 1BVNP 1JYXA 2NT1A 1JCNA 4NX5A 4EX4A 4CNUA 3MO4A 4ODOA 3VFCA 4BWLC 3KACA 1YXDA 3CAVA 4FAMA 4HNUA 2ZXBA 1KCZA 1LWJA 3DBPA 3WD1A 4GI4A 4A6GA 2G97A 4BWLA 3TKFA 1TV3A 2F84A 3B9NA 3ZZ1A 3EOLA 4L1GA 3L0NA 3GNXA 1A3HA 3A23A 1P0BA 2YBVA 1ZENA 2G3FA 1GJWA 1JRCA 2V5JA 5CZKA 3LHWA 2QEZA 4ONVA 3R6IA 3FA4A 4Q8NA 1H7OA 2A3CA 3KOZA 2QCFA 2DGAA 3IJ8A 4R27A 1BYBA 1E5JA 1PEZA 4IFOA 3SADA 5CZSA 3SECA 2BY1A 4UOQA 1X96A 1RALA 1OFDA 4DM2A 1JCMP 3OA3A 7TIMA 2I56A 1X7FA 1L0PA 3B7XA 3D46A 5DT7A 4ACZA 3BMVA 1BXBA 1QI5A 4H6KA 2DZSA 3S47A 2R8WA 1JFXA 1L6FA 3T2QA 4JQ4A 2MLXA 1J2WA 2PCEA 3THUA 4PBGA 3KVLA 3SGGA 4HK7A 1NOUA 1LOSA 1I2QA 5B8IC 2ZUVA 3EA1A 2QPUA 4I6VA 4XD6A 4F0LA 3KVJA 4LY4A 3A24A 4GE8A 2DVTA 3CAKA 1RBLA 3NM3A 2HRWA 3WEOA 1JDCA 3POCA 3W7MA 2XN0A 2DT2A 1QRQA 4NNBA 2EG7A 3TSMA 4PMVA 1E3XA 3W1QA 2Z4GA 3GVGA 3VMPA 1F6PA 3MUIA 3IVTA 2IMRA 1KFKA 3EMZA 3O5DA 1IF2A 3NQFA 3C8NA 1JZ6A 3AXXA 2CU0A 3TW7A 1B2YA 5C9WA 4ZOEA 5FF4A 5G1MA 4E4PA 1BVZA 2WPGA 3MHFA 3UCCA 3JVAA 4ZB5A 4JX4A 4RW5A 3OZYA 5HWNA 1VFSA 3AISA 1UH3A 2BOFX 3UG8A 4JTCA 1SJCA 1TTIA 2VL4A 2YOCA 4GQQA 1C93A 5A2AA 4DRPA 1FKRA 1TR1A 4LBRA 5M3WA 3CHEA 2UZ5A 4ICCX 3AUOA 3V36A 3L9CA 3L23A 3A22A 4MWAE 4WLCA 3ARQA 3TQ0A 4AQLA 5JVLA 1JAKA 2J7BA 3A47A 1DL3A 3VIOA 3LBCA 2PWUA 5G4EA 3VABA 1TIMA 3P7YA 4H9ZA 3I3EA 1DE5A 4QE1A 3ZLGA 1TMLA 4WY0A 4JTGA 3TN5A 1Y0OA 4XSLA 1LL4A 1UBPC 3EMQA 4CU7A 2LKNA 1X6LA 4Z2JA 2OQLA 2W92A 1DTNA 1KKOA 1YW5A 1RVKA 1WUFA 3C3NA 3OZPA 1BPLB 3OIXA 2QULA 1GTHA 1WXJA 2RDTA 1V5XA 3DH7A 4MJ4A 1EZWA 4XD5A 1CYGA 4F0HA 4LUTB 3T78A 2RJHA 4QIUA 3PJWA 1R30A 3C86A 3FFSA 1FCVA 2EPKX 3MJMA 3U5YA 2O92A 2EQDA 2VHLA 5KTLA 3A9BA 2HXUA 4JNMA 1NEYA 3IAPA 4QDPA 3HF3A 3UQBA 4GBUA 4N9BA 2XVGA 3LCXA 3TN3A 5GJMA 3RITA 5C9RA 1F5ZA 3W7GA 3FHAA 3MKCA 2WCGA 4DJDA 1MRAA 2KAUC 4NZ3A 3QGAC 2G3IA 3W76A 3LMYA 4TTUA 1V0NA 3LQLA 4KCTA 3T08A 3LNMA 2V8ZA 3MCMA 3FEMA 4CN6A 3DHDA 1HJWA 2REQB 2EKCA 4HNVA 3VDGA 3CHFA 1N55A 3EPNA 1EX5A 4D8LA 4M7TA 4RLIA 1CB7B 2EG6A 4FSAA 2BP1A 3P74A 4OKDA 4GFSA 4JDBA 4E3TA 2JK2A 2Q3OA 1UWQA 1I45A 3CO4A 1JXJA 4LUIA 5U7SA 2R94A 2PF8A 4L64A 3M0JA 3PY2A 1VPQA 3ECQA 4TNSA 4GUHA 3H12A 1OT1A 1XIIA 4IT6A 1HVQA 4PULA 1Q6QA 4UQDA 1T6MA 3DFYA 1HGWA 1MW1A 1OZMA 1TYGA 4XZWA 3WBEA 1J11A 3NWRA 2IKHA 3LNPA 4FX6M 4JKLA 2HWGA 4KMQA 5EU9A 2OSXA 4LAWA 3BQ6A 4YIWA 4LS0A 2O9TA 4AXNA 3KRBA 3WLKX 1FH8A 4GZJA 3MQTA 3VAWA 4IFKB 3MV11 4KBXA 4JEJA 3LGGA 3GLCA 3WUGA 3WNPA 4F79A 1SO5A 1E55A 1RV8A 5HW6A 3M0YA 1FKLA 3AYVA 1KLYA 1RPKA 4AZGA 1R47A 3KUMA 3O06A 3ZO9A 5MKGB 3WNLA 1U1JA 4MKSA 1DQXA 3KBNA 3RFWA 1SJDA 3A4AA 4GIAA 4UQ9A 4DI9A 3F5LA 5FEWA 3GIYA 3N9RA 5AB3A 2INZA 4PMRA 3LG3A 4U2ZA 3LGEA 3LENA 3QW3A 3E0IA 3ZJ8A 3C2YA 4U86A 4RUBA 1VIWA 3VNLA 3PPHA 2GL5A 2ETNA 1XDJA 3C2EA 3T6CA 1Z9AA 2GWGA 2CLKA 5DCBA 2E09A 4AWUA 2EF9A 3W7LA 1BRLA 5KZEA 1P6WA 1J6PA 3W73A 1V0LA 2KO7A 3HV9A 3HN3A 3MDWA 4J2PA 3CV7A 3W87A 4WDWA 3EKZA 5EMLA 1G94A 1S3TC 1J0HA 2ZE0A 3R13A 4HJWA 5IOBA 3BV4A 4L3NA 3OBEA 3M0HA 4NQ1A 4I8DA 3W00A 1IEXA 5I2UA 5HINA 4D6DA 1OFAA 3IJ9A 1P0KA 3PM6A 2XPBA 1EA9C 5TD4A 3R0KA 2E4TA 3R5EA 1SR9A 4HPGA 3HIJA 3A5FA 1NFPA 3APGA 2ISWA 3S46A 4ROPA 2PLCA 3WBWA 2IPJA 2VENA 4GZ7A 4O0QA 3U6WA 4MLJA 1I2RA 1MO0A 4O19A 4H00A 2OVLA 3KOFA 5D2VA 1Y65A 3XISA 2W62A 1O7AA 1UOZA 4R9XA 4REQB 2D0FA 5IRPA 3R0DA 4RXGA 2VQUA 1UW9A 1TCOC 3ZR6A 2Z1XA 4HNTA 2VDHA 4DT4A 2Y4SA 1UR1A 4LCSA 3HGJA 3VXGA 2OZTA 1DORA 5E0FA 3B4YA 4LH8A 5DY2A 4O1FA 3WLJA 4MY9A 5CG7A 1F4AA 1D3HA 4W8BA 3L5MA 1J5SA 1JCLA 4E5TA 2ZYFA 1N2VA 1W5QA 1W3KA 4ZQMA 4DUWA 5HMFA 1NQKA 5F1VA 2ZX8A 2WVVB 2R1NA 4AZCA 3P67A 1YYAA 4JEQA 5DRCA 3W7QA 4Q8MA 2IQ0A 3RPTA 1S46A 2XIIA 4PMQA 3E2QA 4F2TA 5FACA 3JU2A 1W2PA 2VT0A 4MKNA 1ZP3A 2VC9A 5CEWA 2X41A 4FIRA 4NZFA 5I98A 3GHTA 1XLEA 2J62A 3OOQA 4G56A 3RM9A 1TWWA 3DUGA 3I7RA 1FWEC 3W1NA 4GHRA 1XISA 5BWFA 3H7VA 4A4AA 4ASTA 1XH0A 3KAHA 2VO5A 3BJFA 3PTKA 4J7RA 5E0CA 3IAQA 3HPFA 1ADSA 4E4UA 1OFQA 2X09A 3CGNA 4F8XA 2Y8UA 4O12A 5G4WA 2CXGA 3WNNA 3PWGA 2CFFA 3SAZA 1E6PA 4D6GA 4Q4OA 1OC7A 3OBAA 1BSIA 3UWZA 1LLWA 2WHMA 3DFQA 1L1PA 1FFQA 5D4YA 1DXFA 2WJEA 5CC5A 3P2VA 3SUSA 4HCLA 5L9FA 1O94A 3UZXA 4NJJA 3NJ3A 1F9CA 1GRJA 3T8LA 1KFBA 4S3EA 3CMJA 1H7PA 5HQMA 3FN9A 3UY8A 1FDZA 5C71A 4DELA 3WH8A 4LT9A 1GVFA 3UWEA 4WOZA 3KW3A 2VFGA 1BWVA 4LYRA 5HMSA 4FLSA 1DKWA 3APTA 4GH1A 1UIOA 1CXFA 1J0YA 4FZIA 1PB0A 4DUVA 3TQKA 1GUVA 1EQPA 3CZKA 4AD0A 2PE4A 2A21A 3NR0A 4GABA 3QF0A 2DV0A 3W4RA 2FH6A 1OEPA 1FUYA 4L6DA 3M6DA 1AUSL 4IOTA 4AY1A 3ZT5A 2XN1A 5D2XA 1WX0A 1TPEA 1QBBA 3LCIA 2E28A 5DMLA 2ZXQA 3PF3A 2G95A 3BTNA 1NWTA 1IZCA 4H2HA 3TC5A 3WDPP 1IEVA 3B0VC 4J40A 3LEPA 3O15A 3TJXA 3VIHA 1OM0A 2QCDB 3NTPA 1JD9A 2VGGA 3GWQA 5H8MA 4PUJA 4KWVA 1KV5A 3A4JA 2PDHA 3KDNA 1XV8A 1UHVA 3NVTA 2OZ3A 3ZVIA 4Q8PA 2V5DA 4FLQA 1DIEA 2GDUA 3H2CA 3BLKA 3GC2A 1SZNA 1WDQA 1R46A 3B8IA 4UFHA 5EMYA 3ZLHA 4KERA 2VD9A 2GGHA 2Z7KA 4ZMGA 4UUIA 3BLIA 4GGQA 3W82A 2DW7A 2XDFA 1JFHA 3SCPA 3CUHA 5F4XA 4ZR8A 4C1KA 4NVTA 4QM1A 4W8LA 8XIMA 3NPVA 3QPYA 4GA8A 3D3FA 2GDQA 4CCCA 3KCEA 3JYMA 3QSTA 2QUNA 2FTYA 3SY1A 4DUOA 4J3ZA 4QDWA 3VZXA 1R9ZA 4Z1AA 3GXFA 2WHKA 4QRNA 1EYWA 1X1NA 3BOLA 1EBHA 1KRAC 2Y1HA 1K3UA 3NM1A 4K37A 1T99A 1C90A 3LQGA 3VPLA 3C0JA 3MUXA 5F4SA 1ZP4A 4F0MA 2ISFA 2E6YA 1B0IA 2VEPA 5E93A 4JTEA 2ADAA 4ZBCA 1OT2A 3MMUA 3QLLA 4NUWA 1JGMA 4HPNA 1W0MA 1N8WA 1ONRA 2VC5A 4B90A 5M2FX 3L67A 2E68A 3GDTA 1GQNA 3KEHA 5AHNA 5D2YA 5BYWA 2W79A 2RFGA 2ZZ2A 1IQ8A 2DORA 3BMWA 1EGMA 5E6YA 1REQA 1SJBA 2E1DA 4HZ6A 2I5IA 1ZZMA 1H11A 1HKMA 4MSSA 1XLKA 1LG2A 3GIQA 5HXMA 4R3UA 1N8IA 4WKFA 3PJUA 1BQCA 6REQB 2TAAA 2D73A 1VD6A 3WQDA 2A1YA 1HL2A 3BW3A 1VRDA 2ZUUA 1JULA 1J4HA 2Y7FA 3UI5A 3SUVA 1OC6A 2QYGA 4I8YA 1ZGDA 1QHPA 4AG0A 4PUEA 3MJYA 5JH8A 1WZKA 2NV2A 3RN6A 2J27A 1OIMA 2PDPA 3DG7A 1ME8A 2X1TA 1GGOA 3EGJA 4MWAD 1GVQA 5IM51 3P5ZA 3UW6A 2XP3A 3DFOA 1KQYA 2VGFA 3W2LA 1XI3A 4JFLA 1W9PA 1DEDA 1OG6A 3G8RA 4KIRA 1FQ0A 2OSYA 3MY9A 1ME7A 5HPCA 3NYZA 4HCHA 2VEMA 3H4WA 3NQCA 1J18A 4H4IA 3EX3A 2PGEA 3WLOA 5K2ZA 4DRMA 1NY1A 3L4ZA 2V63A 4RNIA 1AD1A 3TTOA 1Q7ZA 8XIAA 7ODCA 2WMIB 3LB0A 2ZTJA 1E73M 4IICA 1BGAA 4NILA 4Z0SA 3UA4A 3N04A 3LPPA 3P80A 2VGIA 4J35A 3SRFA 4JQ3A 2WNZA 8TIMA 2QZRA 2OQHA 4HMEA 2C1IA 3LCWA 2E25A 4ZE4A 2OPJA 4A8RA 3M46A 2OB3A 4FXSA 4S3JA 2XVNA 1E9LA 4W9TA 3AJXA 4A29A 2BS9A 1XINA 3KWSA 1PV8A 4S39A 2O7SA 3QV7A 1V0KA 4XKYA 1ZJBA 3FDGA 4I5RA 1GVYA 3PBYA 3QYSA 1ROUA 1EDTA 3V4BA 3M41A 2PFHA 5FI8A 1ZAHA 4F0SA 2Z29A 3ARWA 5FL1A 4Z1DA 3V0TA 2XSAA 1D7JA 5EA9A 2GPTA 4QTGA 2BWGA 5AHIA 1KM6A 3LRKA 3DYMA 4P5UA 1BWLA 1ALDA 4FLOA 5AYIA 4GGHA 1DWHM 1KBKA 3TQPA 2QDEA 1AQHA 3K8KA 1WOBA 3CIXA 4NSBA 4AC1X 1IWAA 1ZS2A 4YTQA 3R0UA 1F7BA 1IV8A 3UXKA 5CG0A 1R3RA 3QPZA 3SR7A 4H8NA 2ZQTA 3U2OA 5KINA 1TMHA 1KW1A 5A6BD 5CPOA 4A3RA 2WSKA 1QDSA 2PP3A 1HUVA 3PSWA 1UG6A 2ATMA 4CCZA 2EG8A 4AD3A 2OCZA 2P3ZA 3UPWA 4H2CA 5AHMA 4XZLX 3OTRA 4AISA 1B4EA 3EA2A 4EAYA 3H54A 3W6LA 1OFEA 3GDLA 4G1KA 3TTYA 3E5PA 4JIPA 2O4QA 3K2GA 3QR1A 4AY7A 1U2YA 4B3ZA 1SM9A 2V2HA 4QLKA 1V51A 3MKKA 1EUNA 1WQ5A 4ZOAA 3WG6A 4F9DA 1DJXA 1EOKA 4JTLA 1FKHA 1J4IA 3TYDA 4UMCA 2A7RA 3WLSA 3UYIA 2DH2A 1XIEA 2AMGA 1EWEA 4H7CA 5AOUA 5CBBA 2ZX5A 4J4KA 1HNYA 2OZ8A 1CLVA 3TOYA 4D6IA 5J8LA 5A8GA 5C5YA 1EDGA 2DVXA 2HTMA 1FDYA 2YLLA 4I5XA 4QNEA 3E0LA 1TPFA 2TMDA 2DG3A 3W25A 2BDQA 4DI8A 1KRBC 2CYGA 3A4XA 2OEKA 3I65A 4MZYA 3WUBA 5IDZA 4J2MA 1JIBA 1TWIA 3EWBX 3KTXA 4TQTA 3LUOA 3NPWA 3P0XA 2POTA 1QI2A 5ABFA 1JZ8A 3APYA 3AXMA 4IJCA 1CCWB 3TFXA 2XU2A 1MXGA 2BASA 8RUCA 3R89A 4WJEA 1P5QA 3TYEA 2XSXA 5M17A 2F6UA 5T9CE 1LG1A 4QLLA 1FWFC 3ARRA 1Y5XA 1BG4A 2ISSA 3OHMB 4GOAA 2WHJA 5BROA 3KLKA 4W5ZA 4EE9A 1R6WA 2XHYA 3DI1A 2OEMA 1KBLA 3W2NA 5HNNA 1YNYA 2HNHA 1PKNA 1TQXA 1O4UA 1TV7A 4PTVA 1WOAA 2VKZG 4JICA 3TWBA 2AQWA 3ZOAA 3VAVA 1EEXA 5LXEA 1VFOA 3C56A 1ADOA 1FHDA 3EX2A 4MZ8A 4GKLA 4CCDA 2XP5A 3EB4A 3T81A 4BJHA 3TR2A 4R7OA 1AH4A 4TV6A 3NEHA 2R1PA 4LF1A 3AZRA 3NQDA 1J2BA 4GPNA 5CPLA 2HPIA 3BOFA 4TIMA 3GUWA 4UTJA 3NQ6A 4CN4A 4JKKA 1F05A 4LPCA 3T07A 1WDSA 2VVNA 3PNUA 1YIXA 3GU9A 2PZNA 2XP7A 1PX4A 5GNYA 1F3WA 4XAFA 1J6OA 1XGZA 2FYMA 4TVCA 2ACSA 3B8VA 4O18A 3FSTA 2D3NA 2J77A 2ZRZA 4WCJA 3AIRA 1ZUAX 3WN6A 2QDHA 2E5DA 3DZ1A 1BSLA 2PPNA 3G1DA 3GC5A 1J93A 2YL8A 2GJLA 4G2PA 3T0BA 4X2RA 3IHZA 4P7LA 4C5YA 1CIUA 1K1DA 4ERAA 4FA3A 3OA5A 3TYUA 2WSQA 4KR0B 4V2XA 3IJDA 1EL3A 3KVKA 4JCMA 1UD8A 5TIMA 4HCDA 4JS3A 4XV0A 2Y89A 3ABOA 4PEEA 5D2WA 3LX9A 3O16A 1QPNA 3DFSA 3T1GA 2X1SA 1PX3A 2XH0A 2E77A 1O1HA 1F07A 3GTIA 4GGBA 1TX2A 2FFIA 3O63A 3KCJA 5E70A 5I3KA 3SCTA 2ZQSA 4WDXA 1QJWA 1SU5A 3L0GA 1GOMA 3NCOA 4JZ5A 1FXPA 1A5SA 4I6KA 2EPLX 4RL3A 4GLEA 1IZJA 4QCEA 3A64A 3TZFA 1KFCA 1B3VA 1LQAA 3WELA 2YB4A 4IZGA 3UT0A 4DF0A 3MT1A 1D7FA 3BCDA 4Z2IA 3SCSA 1B54A 3DG3A 3NQBA 1R9XA 1TA3B 2PWHA 1H49A 1A53A 3AHVA 4KGLA 1VYSX 4DY1A 4I7WA 1DJWA 3CUIA 4E0CA 3M0MA 1N1AA 4PCPA 4HMCA 3ZIZA 1CX9A 4Q22A 2G50A 3S6TA 4C6JA 3CT7A 5EMJA 1CENA 5BXJA 1QWGA 3F4DA 1DJIA 4IPPA 3S1WA 3KTCA 2PTYA 4MADA 1S5NA 3AMDA 3NFUA 1H63A 3BCJA 1VHNA 4E8DA 2WKGA 3MP5A 4N9DA 1EKOA 1NVMA 1PCWA 4E2VA 2C13A 4Q6JA 1FWBC 3SM0A 3VNKA 3CMFA 5LSMA 1T41A 3UJSA 5AZ1A 2KI3A 5CZTA 1VPXA 3MKVA 2MPHA 3IV3A 4GI9A 4I7VA 2FMOA 1MDRA 1OD8A 3THAA 2ICSA 3EAUA 4N6FA 2Y2WA 4GQGA 2F2DA 1L6WA 1G69A 3H2NA 3N14A 2YIHA 1KM3A 3B8TA 2CC0A 4JN8A 4MB5A 4PMYA 4B3KA 1CXKA 3DHFA 1E4MM 2AL2B 5BXPA 4GI8A 4ZQPA 4DO5A 4AEFA 2B5UB 5EB8A 1YNQA 4O15A 4S38A 3LZ5A 1W1PA 1ITXA 1ZY9A 3RJXA 3IWPA 1OF6A 1BG9A 5K4XA 3N13A 3K5XA 4RPPA 4XISA 1HTIA 5HK4A 2YBUA 3QFEA 1C92A 4L9ZA 1GORA 3UJ2A 5KEZA 1WKFA 3LHZA 2X7WA 3NG3A 1HJSA 3WQ6A 3MZ2A 2IQTA 1S2VA 2YFOA 3YPIA 1SMDA 1NTHA 1T11A 2Z2BA 2PRLA 5LIUX 2NSXA 1IR2A 2O56A 2G37A 3L7RA 4X9SA 5D05A 4TOQA 2PUZA 3DIPA 5IHRA 2TSYA 5CPQA 2WHLA 4QG9A 2ZFAA 4NXKA 4C6QA 3O6AA 4LVAA 2GZXA 1RH9A 2GGIA 1ICQA 2YA1A 4LCRA 3WLQA 1HFBA 1YPFA 5HR6A 2EHHA 4O1AA 4FEZA 3O5MA 5JBEA 1X6UA 1YKWA 2VQTA 3PZVA 4LAYA 1EC8A 3DHPA 2W3ZA 5FEPA 5TF0A 3AS1A 1FVPA 5IFTA 3LZ3A 2JZVA 2X16A 3EDKA 5ENLA 3F2CA 2KZHA 2V67A 3B8UA 4R5EA 3H70A 1F4HA 1J0KA 4MWAC 4Q4RA 3VDBA 3OG3A 1I4NA 4MHBA 3O5EA 4ZS6A 4Q8TA 1EJTC 2BY3A 2WM1A 1LTDA 4XO6A 1V4YA 5C7VA 4JTDA 1ZALA 3M44A 4MWAA 2ACQA 4PMNA 3WH6A 2P0IA 3G77A 4GXPA 3G3MA 2JE8A 5ABHA 5HWMA 2GK1A 4DXXA 1LUCB 2LJ4A 3B9AA 1WNOA 4P8UA 1DQUA 5CH9A 5T26A 4DBWA 3SURA 2Y7GA 5JU6A 4NU7A 1PKLA 1W31A 4UFKA 1NWRA 1B5TA 4FXFA 3UWUA 1K77A 3OOBA 1O5RA 4AZHA 1KRCC 2V9DA 1J6YA 1YW1A 4GZEA 1PS9A 4KWSA 5GPGA 3RCMA 1F8IA 3GDRA 5TBOA 2XPAA 1VJZA 4DRJA 4ZQCA 4AXKA 1PZ1A 2BGSA 5A6JA 4ZO8A 2XPKA 5HWBA 1GVOA 3S5YA 1RK5A 4KS0A 2XP4A 3QXBA 1SZEA 1W8GA 1KC7A 4C6KA 5LYRA 7TAAA 1QO5A 5K9CA 4Z08A 4JFMA 3D3AA 3VC5A 3T2OA 1CI1A 5HOSA 5FJOA 2ZADA 2WMFA 1QK0A 4J3TA 3VOCA 1V3KA 4OTKA 4IP5A 2Y5JA 4EPEC 5I07A 4PRWA 1LL7A 1XFBA 2BVTA 1E44A 4PMDA 2WCAA 2PTWA 3AS3A 2VMFA 3W83A 4HOWA 1JNEA 2PPPA 3GX9A 1UWTA 5F7UA 2VM8A 4B5WA 3S6DA 3O5LA 2DIEA 2WXDM 1KBJA 1OX5A 3S9ZA 4PTDA 4PBFA 3CZ8A 1WZMA 4ES4A 4PFHA 2VJXA 3L65A 3LERA 3NGJA 3AXIA 5AN7A 3EKGA 2R6OA 5DLCA 4K8EA 2X1UA 4V15A 2ZVRA 1AA1B 4H8VA 3AALA 3RUBL 1H41A 1IIHA 4F0RA 2Z7GA 2V5KA 1Z89A 1XKJA 3LMZA 2LLEA 1FY6A 1XBYA 1LL6A 3Q65A 2O0TA 5HW8A 3AIEA 3BLLA 4WY0F 5G4HC 5C6MA 1VC4A 2AGTA 1HKWA 3VNYA 5BOEA 2JF7A 1P1XA 4MVAA 1WDRA 1ISWA 4QROA 4YL2A 1HKKA 1MEHA 1FXQA 2VX6A 2FPVA 1TIWA 3IGXA 4C5ZA 1A0CA 1PHWA 1GHRA 4Z0JA 1QO2A 2QW5A 2X2YA 1J4EA 3DYOA 5A6BA 3K4WA 1UH4A 4JFJA 1SO6A 3H21A 4A3UA 4A35A 4C1NA 3KL3A 3DESA 3FVDA 4WX2A 1XYLA 2Y70A 4GFIA 3VD9A 3VCRA 4O28A 4KW2A 4KEZA 4HA3A 3SQSA 2HBXA 4JR5A 1YBQB 3P93A 3M6YA 4O0KA 5I03A 1XICA 2NV9A 1ISVA 4KEUA 1DBTA 4GQRA 4N9CA 4ZE5A 3SY5A 3B06A 1XCWA 2J88A 3VKKA 4IPJA 5CZJA 2DFAA 4QCFA 4JOMA 4EF8A 3IUIA 4HHPA 4DEFA 1W1IE 1TVPA 3ELFA 2X0YA 5J04A 2E9MA 5A8NA 4QS5A 4DLFA 2NVCA 1QMLA 3ALFA 1EHAA 1XRVA 3AXKA 4PMZA 3WY1A 5CAHA 4CN1A 2YYUA 3GR7A 4G6CA 4XIAA 4OE7A 4UTUA 3QY8A 4ZPVR 1GW1A 3M5ZA 1E15A 3QMSA 1KM1A 2BFGA 2QV4A 4ZO9A 2YR1A 1WP6A 3WF4A 3SIZA 6XIMA 1H7NA 1VBHA 4YN5A 4EWJA 1XCXA 1XIGA 2OFNA 3FHQA 3V75A 4FNSA 2OKOA 3H8AA 3PPGA 3W1RA 5D03A 1HL9A 3PB2A 2W91A 3ONCA 3AU6A 1WE5A 2VTFA 1B9ZA 4UTIA 3UNDA 1AMYA 2BTMA 3CASA 2GJPA 1WCGA 4H7VA 1ZRQA 1S3HA 1YX1A 1WYIA 3A12A 1DPMA 2ZC8A 1PDYA 2D2JA 3CQ0A 2BXVA 4HSHA 4C02B 2HNEA 1H7RA 4DYEA 3DN5A 3G5EA 4C91A 1JRBA 2RGMA 1EBGA 2PC4A 3SCWA 1W3LA 4FHAA 2YLAA 3BH4A 3EB2A 3QR3A 1EHNA 2OGYA 4DZAA 4YYCA 4RDYA 3WQCA 1HW6A 4DPQA 3QGKC 2QF7A 2ZR4A 2XWEA 3BURA 1YE6A 4D6FA 1UZHA 4LTSA 3W7HA 2OSWA 3UWVA 4JFVA 3WBAA 4IISA 1XBXA 3DC8A 3VGBA 2OMAA 4G8TA 3WQFA 3B40A 1IXNA 3ZM8A 1XSKA 2V82A 1UASA 2CLOA 1MUMA 1R3YA 3RU8X 1EP1A 3G22A 3TJ4A 1A4MA 3WF0A 3VDHA 4HNLA 3MO7A 5D9OA 3DYPA 3HGRA 1W26A 4HBKA 2E7FA 1R3QA 5DIUA 4K8HA 2HS8A 2BNJA 2WCSA 2ZXDA 4PRRA 4HBEA 4L4LA 1MFUA 1LBLA 1E6RA 5D04C 2XFRA 3JR2A 3V5FA 2PURA 3KP1A 4X0VA 2JKAA 1JNDA 1W3NA 3STPA 2YCLA 3AOFA 1JJKA 2EPMX 2RUQA 3GW0A 3MP3A 3VDAA 4X3ZA 5A8MA 1AMKA 2VR5A 3G1XA 4JQAA 4L1XA 2IXUA 3UP8A 3SIMA 3SN4A 1T8XA 4YNGA 4IQLA 1MEWA 1KRMA 4IP4A 5E9XA 4AB4A 1N82A 4XTIA 3F7JA 4U31A 3LCGA 3VIJA 1PL9A 3F5KA 1K6WA 1GOQA 4LAOA 1OFBA 1OWQA 1OFRA 4AIUA 2QVHA 2ISVA 3PTDA 2CZDA 2XTKA 3ALGA 3D6NA 1I75A 4ERIA 3JRKA 2P8BA 1NFGA 1KD0A 2WMKA 1MRQA 3FDKA 1FX6A 3S8HA 3T4WA 3REQA 3PSVA 3OPSA 3MMWA 5I3FA 3NDYA 1MW0A 2PS2A 2HK0A 2FGLA 5A5WA 3BLDA 3WLMA 4MB1A 2UY5A 4CVWA 4JFIA 1D7KA 4PR4A 1C91A 4WZHA 3UBPC 4DX3A 2V3GA 2JKPA 3N3MA 4RX0A 5D09A 2G0WA 6XIAA 4GNKB 4JFTA 4CNOA 3LCFA 4UXDA 3DOPA 5IFPA 4QS6A 3GTHA 3V5OA 3LM7A 3WJXA 3WDHA 1Y5WA 1Z42A 2ZXAA 1FWDC 2NQHA 4IMEA 1RCQA 2O9RA 2OXNA 5HQEA 1V6TA 3UR7A 3STCA 4M81A 3KZ7A 4XB3A 2CZ5A 1QI0A 3CUZA 3L66A 2E6DA 4X61A 3TYCA 1XJBA 5B80A 5XINA 3TJLA 2VCCA 4PMUA 3ARUA 3E5BA 2Z1VA 1TV2A 4RNFA 4JN7A 1UWUA 3S5NA 3LTPA 4FNRA 3B9DA 2DG4A 5LGZA 2YZ5A 3MWAA 3O2LA 7REQB 5A1AA 3JYJA 2Z1WA 2EEXA 1O5KA 1LLZA 2QNEA 1AL8A 3QRHA 4IXHA 1U5HA 3FGCA 1IR1A 1OY0A 2FZNA 3TNBA 1J4RA 4IQEA 5HWJA 4B5SA 2PBOA 1FKXA 4PSPA 3L68A 1D8WA 3PHAA 4QDMA 1E4LA 1JDDA 4KF1A 1ME9A 3O0KA 1MYRA 3B03A 3WLNA 4CU6A 4CUCA 2BVDA 3Q58A 1SUXA 2XFWA 3GFXA 2VZOA 3PPFA 3NQ2A 1C9HA 2GOUA 4IPIA 2PDIA 1NU5A 2VNCA 5CPMA 1EO5A 3N6HA 3INPA 1U22A 4B5TA 2YXGA 4BF8A 4S23A 2QUMA 2ZZ1A 1WXYA 4GI6A 3QHNA 2XUCA 5HQLA 4C6NA 4N4PA 3R25A 3GH4A 1US3A 3C2VA 1XRSA 2CCRA 5BMWA 3TC3A 3WLTA 2IPWA 1EO7A 4PTNA 4HTYA 3ENLA 4M7SA 5EFFA 4QQ3A 3ODKA 1JZ2A 1OBAA 4M24A 3HQNA 3N15A 5D2TA 4ZVJA 5XIAA 1UUMA 1OINA 3PAJA 2RDWA 3WQGA 1SO3A 3EPOA 3UG5A 1U83A 3AU2A 3N9KA 2Z1KA 1EUAA 3ANVA 2INFA 1TX0A 2C1GA 2Q71A 4IJRA 4WJXA 2VEIA 1J12A 3RX3A 3GXNA 4UIOA 2C1HA 4X63A 2BHUA 4DWSA 1GYNA 2A6NA 1NIUA 3PJXA 2R24A 3FLUA 4LJ3A 2O55A 2B7QA 1KFWA 2Y6ZA 2XISA 4GCXA 4M19A 3NI6A 3I10A 3ID7A 3EXSA 1EJUC 1KWGA 3H2AA 4CLMA 1RQHA 2K8IA 4MLRA 1UCWA 4ORIA 3WQ8A 1HJUA 2VELA 4Q7NA 2NVAA 2QV5A 3WJWA 5G1YA 1ZBWA 4WKHA 5CZ0A 2BY2A 3CL8A 3G1VA 3MUCA 3DECA 4E2DA 1VLIA 4FP1A 1SJAA 3A13A 2ALDA 4XO7A 4LCQA 2D2GA 5TNVA 1OVDA 1UH2A 1C7TA 3W2UA 4RK8A 5CSUA 1AJ2A 4IJBA 3R2GA 1H5YA 3L12A 2X1RA 3WMLA 3W7RA 1DJZA 3B05A 3H7UA 3KVMA 1MQPA 2PV2A 3ORWA 4DRQA 1EJWC 2DDXA 3M64A 2DP3A 1CWYA 5FJTA 1UB3A 2NQ9A 5BNKA 4Y7EA 4P8XA 3ZXWA 5LHFA 2CBIA 3B8WA 1K4GA 4IQDA 3DAQA 1KFJA 3EX6A 4QT2A 1GJPA 2KR7A 2PZ0A 4H9VA 5I77A 5DO2A 4ML9A 4Q3MA 4QE4A 5BRQA 4EVZA 1VENA 3IVUA 1XP3A 5KZMA 3KM8A 1JCYA 3RCNA 4QQUA 4LYKA 4LW7A 3E2VA 4AVFA 2DSUA 2YW4A 3GTNA 3C52A 3WDIA 4PH6A 3K4DA 1R3VA 4E2BA 4W93A 4JD4A 1D2KA 3CNYA 3NVDA 1RR2A 4W87A 1W1ZA 3L2LA 4NZ4A 4PEKA 1C8YA 1RZMA 4LNCA 1VR6A 3N12A 1R87A 3K46A 2F61A 4MPKA 1FJDA 1I2NA 3T0TA 1AQ0A 4IUGA 1H09A 1J10A 4ZSTA 1XYCA 2XH7A 3L0KA 1VEPA 3PWIA 4Y96A 3SUTA 2UY3A 5DIVA 1XSIA 3MHGA 4NZCA 3RK8A 4O17A 2VX5A 4HD5A 2R91A 2NLIA 3W0KA 3GO2A 4AF0A 1CLKA 3HG3A 3WEMA 3G6LA 1EP2A 3AMLA 1MWOA 2I5GA 4JNYA 1H7WA 3AYSA 4HB7A 5LA0A 3OQEA 4UFJA 1D3CA 4Z2KA 1FD9A 4CQCA 2H8XA 1S2TA 1J01A 4GIEA 4HGXA 1U5JA 6TAAA 1UZDA 1LDCA 4LV4A 1OX6A 3S83A 5A3HA 1UD4A 5HUPA 1F8AB 3CQIA 1L6YA 5CC3A 3IVSA 5DMNA 4XZNX 1X1OA 3W6MA 1KXVA 4HPXA 4XSMA 3OGRA 3SGUA 2B7OA 4L6OA 3RX2A 1A5CA 1E6NA 1AVAA 1POJA 1WO2A 1IGSA 1SVDA 4US5D 3RNDA 1M41A 5FAJA 1DJQA 2PD9A 2WSPA 3BAYA 1UA3A 1NARA 1YEYA 1EF2A 4DIAA 4ZTYA 1ODUA 1JD7A 2ACUA 3LSBA 3TR9A 2YL9A 3V5CA 4I9TA 4PMJA 4MG4A 3VILA 3TDBA 3NQ8A 4H9MA 1YNPA 3GRIA 1ZAJA 4A21A 4KEVA 1BKFA 1SW0A 1K8XA 2D69A 3CEPA 1P6BA 3USBA 4EXAA 4O4WA 3AICA 1D3GA 4XD4A 4GNJA 4AFYA 4PUMA 1FP8A 3L2IA 1BKSA 2NV1A 3H2OA 3W72A 1CDGA 4BZYA 2R82A 2FAPA 3NQVA 5C8BB 3QHOA 4HPJA 4N6EA 1Q4WA 1RHCA 1JAEA 3O5IA 4OZOA 2AQVA 4MJZA 4O1EA 3D0CA 3FCPA 1TE1A 3GIPA 3W53A 5T9BG 1V7AA 1K9FA 4CKQA 3V18A 3HU7A 1ZJHA 1JXKA 3FX4A 1RBAA 4F3HA 4WK9A 2PWEA 2WMGA 1DVJA 1SQ7A 3ANUA 3TJIA 1GWJA 4FIQA 5LA1A 1UWIA 1M5YA 5AKQA 1QW8A 2C0AA 2PP0A 2ONEA 2VZVA 2E9BA 4Y90A 3I6EA 4C6BA 2PU1A 1WAUA 3LI1A 2JIWA 3QFWA 4MAZA 1XD1A 1GG0A 2VFDA 4EACA 3QM3A 4A3QA 3MZNA 1B6CA 4IG2A 3CC1A 4UB9A 2YSWA 5CPSA 1X1ZA 4LEQA 3AO0A 3NTYA 4LRTA 5AC8A 4AX6A 3AZTA 3GDKA 3LYEA 2XGIA 1RCOB 2VDIA 3UXDA 3R43A 4Q33A 4TYOA 4DWDA 4UZSA 4ZPWR 3KOXA 5FF3A 3S4TA 4MB4A 3OYZA 3B0XA 2QPSA 4R7WA 4NRRA 1Q45A 4ACYA 1R9YA 1WB0A 3W9ZA 3ARTA 1U79A 4ZQRA 1OF8A 2OYLA 5DBUA 2L5HA 5C0QA 4RXFA 1NELA 3C3UA 3LBOA 1FP9A 4DJFA 5EKYA 3N17A 5EBAA 3L4YA 1Q5MA 3QOKA 2GJXA 4IIDA 3V16A 1N8FA 4OOZA 3POHA 1DWGM 2R9RA 1R85A 4EPDC 7A3HA 1LQ0A 1J0JA 3W1AA 1EC7A 1VLWA 3N4EA 4GX9A 4RV3A 3U9IA 2DH3A 3BICA 1ESWA 5HA7A 1W5NA 2NQLA 1E0TA 1Q6FA 1EQCA 1RQBA 4A8NA 1H4PA 3W84A 4KH2A 6CGTA 3WLIA 3SBFA 4JDYA 2DSVA 1MUCA 2MNRA 4B2DA 1Q2RA 3ZMRA 5AC5A 1KA9F 2BSLA 3BSMA 3W3OA 1TJ0A 4QE5A 4L4PA 5D9PA 1QPFA 5FESA 1YATA 4F66A 3ZWSA 3WSUA 1VFFA 3QC3A 1E56A 1FKIA 1AW2A 3FJ6A 2DG9A 5JXQA 4TW7A 4GO9A 4KESA 4NJKA 2OODA 4YHEA 1AZ2A 2EO7A 1JUEA 2WO5A 3S2CA 3VIPA 4U85A 5HDRA 1CXLA 4QIBA 3BAIA 1NAL1 3CMGA 3CAWA 3KHJA 4KRTA 4IGNA 4RDZA 1J5TA 4BQ2A 1TPC1 4DRSA 2B0MA 4XWUA 2QJHA 1SFLA 4FF5A 1E0WA 4CQAA 3VM5A 3VVGA 5A2CA 3ATZA 4RNHA 1XRTA 5HJYA 4J3VA 1JCHB 2QMKA 3MYOA 3F4CA 1FAPA 4ERGA 3PBGA 3UJRA 1V7YA 3GC4A 5E0KA 1MZHA 2OZ0A 2I14A 1Z6KA 3F1QA 4ICMA 5A95A 1OX4A 4GVGA 4H9TA 2PEVA 3PRAA 3BW4A 3K8MA 3TZNA 1XC6A 1A5LC 1M03A 3W7EA 3GBEA 5H1WA 4W89A 1IEQA 4UTFA 1VBGA 4X9YA 3LXAA 1TWSA 5FSDC 2YXXA 3ITVA 1V0MA 2PDJA 3RG6A 4JHZA 4WXZA 1UR2A 1K8ZA 4XZIA 4ZXOA 3N18A 1ONEA 4AY8A 2X05A 1A4LA 1JZ4A 1KT0A 1ROTA 1OB0A 2X7VA 3EZ4A 1R86A 1S39A 2B7PA 2QUTA 2G3JA 5AC6A 2DUXA 1OCNA 3IIVA 3RGTA 2XIJA 1KR0A 4WIWA 2J47A 2F6XA 5FF7A 2NVDA 5DN1A 4LAMA 1ZU8A 3CIWA 4R9OA 1KGWA 2HQAA 3I7QA 4ZQOA 2X42A 1Q2SA 1B1YA 1V79A 5J5RA 3FY1A 3P62A 4ODNA 2OLSA 4OU1A 4KWOA 4ZL1A 3TV8A 1I2PA 3IGHX 4IF2A 3AWOA 5LIKX 4G50A 1M7XA 1US2A 3HM7A 1Q65A 3AMGA 4QNWA 4M8UA 1TWDA 4XBKA 4M56A 4QBXA 2WVSA 4W7WA 4NAEB 1I0BA 1W1YA 2UV8G 3RPDA 3P81A 2XM1A 3BE7A 2PGRA 4PUKA 1Q7MA 1Q63A 4LVBA 4L7ZA 4NI8A 1UKOA 1NWUA 3RO6A 2HCVA 3PZIA 1XM3A 1XUZA 3CYVA 1OGSA 5GNXA 2A3AA 2FDSA 3DG6A 2QGYA 3S9YA 1ML1A 3WDJA 3PRDA 1OYCA 5BW6A 4PUNA 3WEZA 4YTUA 4B9ZA 1UUOA 1DOSA 4WGXA 4KEMA 1GK8A 1JQXA 2ZZ5A 4A3YA 4EANA 4QJ3B 1SW7A 5LNUA 1GQIA 3GVWA 3RCYA 2PP1A 5AYXA 1E71M 3THDA 1K9DA 1QNVA 2DZAA 3I6CA 1E1CA 1Q1CA 3DBNA 4XKMA 3U0HA 2WVTA 4WD0A 1THFD 3PZOA 1IEWA 3G18A 1BKHA 1DQWA 3O5RA 3WYZA 4FNPA 5EBUA 5I3HA 4H8UA 1ICSA 4AZ6A 3S2NA 3WK3A 5G2HA 3OZMA 3CQJA 3KLLA 1L2QA 1PZ0A 1HZYA 4HKPA 1WV2A 1FKFA 3UERA 1D7IA 2H3BA 1KM5A 4H04A 5CXPA 2J78A 4EXBA 4FOKA 2OGJA 1AQFA 3MI2A 1HP5A 3SQMA 2WZIA 2NLYA 1O95A 4UOZA 3FS2A 4MKVA 3MVTA 3NZGA 3OLGA 1YHTA 4QJ1A 4G7EA 3E9AA 1HXJA 3G1YA 1QWKA 2Z27A 3QHMA 4S3CA 1VZWA 2CZFA 3BSHA 4GUIA 1P1MA 1TMQA 3TE9A 1MVYA 1BTMA 4KWWA 1WKYA 3PULA 1I2OA 4J4OA 4C7GA 3MA8A 4OJYA 2XP8A 5ABTA 1CXIA 3CH9A 4L6HA 3G8EA 1KB3A 1KM4A 4PFMA 2O9PA 2CKRA 4JL2A 2AL1A 4FXRA 4F2BA 4BI6A 1K4HA 3CGTA 2WZTA 5HAOA 3GQYA 1AH3A 3MTWA 4OT7A 4MY8A 3S2MA 3URAA 2Z2UA 4FOJA 4GH3A 1AODA 3BANA 3CV6A 5CJMA 1JCXA 1KXHA 3CT2A 4ODMA 3AC0A 3QKZA 4U4MA 4N9EA 4WSHA 1DWFM 4JTTA 4DZ2A 2ASHA 1LBFA 1QXLA 3UZZA 2OEJA 3HFTA 3MMTA 5C54A 6PTDA 3WH7A 3KAOA 2PC8A 1Z69A 1PTDA 3FXYA 1DJHA 2PB1A 3R8GA 1F73A 2V5LA 5BOFA 2J9XA 3GS6A 1RQEA 4C90A 3F03K 2QCCA 3COTA 4GX8A 2NXIA 2D0HA 3UWQA 1UIPA 1VCVA 3DI0A 3GSMA 5HULA 1P48A 2E67A 3AJ7A 1W1B1 4GISA 2JALA 1R7AA 3FVMA 1TZ7A 4Q6XA 3K1DA 1CPUA 4NY2A 2YA2A 1ZHAA 5G2IA 4O14A 1JPDX 1RAKA 1J0IA 1E43A 1G01A 2QF8A 5BWAA 1YDNA 1AW1A 1JF6A 5ABGA 4JYFA 1EJSC 2XIMA 1UP3A 2WQPA 1UKQA 3BAWA 3GUGA 5C7HA 1A5NC 4QFUA 1S2UA 1YPXA 3OBKA 4PUUA 3CQHA 3TYAA 4O10A 1XLDA 1DHKA 4O1BA 5HW7A 3W1XA 5HJXA 4GKTA 1HP4A 3GU0A 2V2DA 5DT5A 5HATA 4FS9A 1TPWA 5E1QA 3O3RA 1ISYA 2ZQUA 3C0SA 2D23A 3IEBA 1LRTA 4OIFA 3GM8A 4WRHA 1XYFA 1OC5A 1J8VA 5C70A 3EWDA 1EWDA 1E3ZA 5F2IA 3U7VA 3URNA 3EX1A 2JKEA 3GTYX 3VDCA 3TC7A 1JNTA 1QOPA 1YE4A 1FCQA 3GU1A 1ENUA 2F2KA 4ZQNA 3MS8A 4BQ3A 1V02E 2BBFA 1FHVA 2FVKA 3GH7A 2EJ1A 1JDFA 3UR5A 4MNLA 1GJUA 2W27A 1DYSA 4QX4A 2QQ6A 5DRIA 3QKEA 3UQAA 1JYNA 3W7PA 4MDPA 3VIFA 3O6DA 3FOKA 4AIOA 3S5OA 1R0MA 6ALDA 1XPYA 2J75A 3Q45A 3NDZA 4CQ9A 3MUAA 3UY7A 2WSYA 3GAKA 4PC8A 5G1TA 2PCQA 2XFYA 4H6QA 3LXCA 3UWYA 4TVDA 2CLEA 2UY4A 3TLLA 1FOBA 4UC5A 2J7EA 4Y9OA 2W4XA 3S0CA 2WOQA 3H2MA 1QPLA 3CL7A 2YL6A 3UR2A 1HF6A 1FWJC