5HW6A

Candida albicans fkbp12 apo protein in c2 space group
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
120
structure length
120
Chain Sequence
EELPQIEIVQEGDNTTFAKPGDTVTIHYDGKLTNGKEFDSSRKRGKPFTCTVGVGQVIKGWDISLTNNYGKGGANLPKISKGTKAILTIPPNLAYGPRGIPPIIGPNETLVFEVELLGVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FK506-binding protein 1
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida albicans (strain sc5314 / atcc mya-2876)
total genus 25
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5hw6A00
2KGJA 5HUAA 1QPFA 5HTGA 1FKHA 4IPXA 2AWGA 1W26A 1D6OA 5I98A 1A7XA 1J4IA 1C9HA 4DRKA 4DT4A 4DZ3A 4DZ2A 4FAPA 1ROUA 2MPHA 4DRHA 3JXVA 3PRDA 4DRIA 3IHZA 5HW6A 5HW7A 3VAWA 3O5MA 1FKGA 1NMVA 2Q5AA 1YW5A 4TX0A 1BL4A 4U85A 2MNTA 2PV2A 2UZ5A 2XP6A 1QPLA 1FAPA 2N87A 1Q6UA 2LKNA 4BF8A 4ITZA 2PV1A 1J4RA 1Q6HA 2PPNA 4JFKA 2XP4A 3PRBA 5HWBA 5DIVA 2M1IA 2XP8A 4DRMA 4DRNA 5GPGA 2ZQTA 4QIBA 3H9RB 4LAXA 1D7IA 3KADA 3O5KA 4LAVA 2M2AA 2RQSA 3CGMA 2D9FA 2F2DA 1JVWA 1NMWA 1D7HA 2KR7A 4ODKA 3UF8A 2K8IA 4ODNA 4J4NA 4U84A 3TDBA 5D75A 2M08A 5BXJA 3UQBA 4R0XA 4O2TA 2XP9A 4W9OA 2PPPA 5DITA 3UI4A 3UQAA 3O5DA 2MLZA 1HXVA 1FKBA 2FKEA 3JYJA 3KCEA 3NTPA 1PINA 4U86A 1KT0A 4DRQA 2PPOA 1JNSA 1Q1CA 1D7JA 2KFWA 1J6YA 4DRPA 2PV3A 2ITKA 2KI3A 2FAPA 1J4HA 4MSPA 4LAYA 4DIPA 2IF4A 2KE0A 4QT2A 5J6EA 2RUQA 1FKLA 2OFNA 2MLYA 2LPVA 2VN1A 4ODPA 4ODQA 5B8IC 3B7XA 3CGNA 3O5GA 3TC5A 2ZQVA 3NRKA 3O5RA 1B6CA 3O5IA 2DG4A 4TW8A 2RUCA 1Y0OA 5HWCA 4MGVA 5HT1A 2XPAA 1YATA 2KO7A 2XP7A 1EQ3A 1L1PA 4JFJA 1NSGA 4NNRA 3I6CA 3NI6A 4G50A 4GGQA 3UQIA 2RURA 5HW8A 3KAFA 2PBCA 2RUDA 3O5QA 1JNTA 2F4EA 4IQ2A 3UI5A 3IKGA 4ODRA 3O5OA 2LJ4A 3O5LA 1F40A 1FKKA 3ODKA 3OOBA 1FKIA 1ROTA 3TCZA 4LAWA 1FD9A 1Q6IA 1QZ2A 2XP3A 3MDYB 1FKSA 1R9HA 2L2SA 3GPKA 3KABA 2RSEA 3KAHA 3FAPA 1TCOC 2DG9A 3KAGA 4TNSA 1PBKA 4TW6A 3LUOA 4DH0A 3O5PA 2MF9A 4DRJA 3O5JA 3UI6A 3KZ7A 1KT1A 4JFIA 3KACA 3IKDA 3WH0A 1P5QA 4G2PA 4JFMA 3O5EA 2ZR4A 1T11A 3IK8A 3KAIA 1EYMA 1N1AA 2XP5A 4C02B 1FKRA 3O5FA 3RFWA 2LGOA 1FKJA 3RGCA 4JFLA 2DG3A 2MLXA 3PA7A 4JYSA 4ODMA 3EY6A 4W9QA 1BKFA 4ODLA 1FKTA 1F8AB 2Y78A 2XPBA 2ZQUA 2ZR5A 1M5YA 3JYMA 4FN2A 4IQCA 4ODOA 4TYOA 5DIUA 2ZR6A 1FKDA 4N19A 1ZCNA 4J4OA 4GIVA 4QT3A 4DROA 5HKGA 2JZVA 4W9PA 2VCDA 4TW7A 1FJDA 1U79A 1ZK6A 1FKFA 2F21A 2ZQSA
chains in the Genus database with same CATH superfamily
3CH9A 3ARZA 1UR9A 3GU0A 4DT4A 3B9EA 4DWSA 1ROUA 1LQ0A 2WM0A 2MNTA 2YBTA 2N87A 3ARXA 3PR9A 1J4RA 4JFKA 4R5EA 1WAWA 5HWBA 3ARPA 5DIVA 3AS3A 2ZQTA 1D7IA 1H0IA 4IT4A 3ARUA 4KQZA 4Z2LA 1JNEA 3AS0A 4R0XA 1FFRA 4S3KA 1NWSA 1PINA 2A3CA 2O9OA 1Q1CA 3BMBA 2KFWA 2FAPA 2KE0A 5J6EA 1W1PA 2DT2A 2ZQVA 3NRKA 1CTNA 1B6CA 1ZB5A 4TW8A 5HT1A 1W9PA 4L3NA 1EQ3A 1EHNA 4JFJA 4NNRA 3QOKA 4UDMA 2RURA 3KAFA 2DT0A 4P8UA 3O5QA 1JNTA 3UI5A 1XRVA 4ODRA 3OOBA 1ZBWA 2L2SA 3KABA 3ARTA 3KAHA 2DG9A 4MNLA 4ZPVR 1LL4A 4DRJA 3IKDA 3RM4A 3WH0A 1JNDA 1P5QA 4G2PA 4JFMA 1EYMA 4L72B 3RFWA 2LGOA 1FKJA 3WKZA 1E6ZA 5JH8A 1X6LA 4ODLA 1FKTA 2Y78A 4TYOA 1W1YA 4ODOA 4GIVA 4ZPTR 4DWSB 2JZVA 4URIA 4WK9A 1ZK6A 4Q7NA 4W9OA 2F21A 2KGJA 1QPFA 1UR8A 2AWGA 1W26A 1D6OA 5GQBA 4Z2HA 2DSWA 4HBEA 3RMEA 1C9HA 3EIPA 4DZ2A 2MPHA 2DT3A 1OGBA 3WQVA 1YW5A 4U85A 1NH6A 1VF8A 3FY1A 1ZU8A 5DF0A 3ALGA 1E6RA 1NWUA 3AROA 1H0GA 3PRBA 4WKAA 2XP8A 1HKIA 5DEZA 5GPGA 4DRNA 3H9RB 4LAXA 4MNMA 3KADA 2PN0A 2M2AA 2A3AA 3AQUA 3CGMA 2D9FA 1NMWA 1WNOA 4ODKA 3UF8A 2K8IA 3G6MA 4ODNA 4J4NA 5D75A 5BXJA 3UQBA 2XP9A 2PI6A 2YBUA 1OGGA 1FKBA 3JYJA 3NTPA 1E9LA 4KR0B 3WL0A 3ALFA 3ARVA 2AOSA 3AS1A 1JNSA 4P8VA 1J6YA 2PV3A 1EIBA 1J4HA 4LAYA 2IF4A 3GTYX 1GPFA 4ODPA 4ODQA 1K9TA 5HWCA 1NSGA 4ZPWR 4HBOA 3I6CA 3NI6A 2WLYA 4GGQA 2DSUA 2PBCA 1W9UA 1ZBKA 2IUZA 3WD2A 3IKGA 4MNJA 2B31A 2LJ4A 3O5OA 1O6IA 1F40A 1ROTA 1FD9A 2XP3A 3WD1A 1FKSA 3KAGA 3LUOA 3PRAA 1JCHB 3O5PA 1E6PA 2MF9A 3O5JA 4JFIA 2A3EA 1E15A 3WD4A 3O5EA 2ETNA 1D2KA 3IK8A 4C02B 4NSBA 4JYSA 1BKFA 2ZQUA 2XPBA 2ZR5A 2A3BA 3JYMA 4IQCA 1FKDA 1ZCNA 4J4OA 2VCDA 4ML4A 1LL7A 1HKJA 2G41A 3CZ8A 1FKHA 1W9VA 4IPXA 1HJWA 1NWTA 4Z2KA 3B9AA 2DSZA 1J4IA 4DRKA 4DZ3A 4DRHA 3JXVA 1ZBVA 3IHZA 1FKGA 1NMVA 4TX0A 1BL4A 1RD6A 2XP6A 1QPLA 1FAPA 1SR0A 2EULA 4XAKA 4BF8A 4ITZA 1Q6HA 1HJVA 4P8XA 1SYTA 4DRMA 3CHCA 4MTVA 1NWRA 2F23A 2RQSA 1ZL1A 1D7HA 2DT1A 2KR7A 4U84A 3G6LA 4Z2GA 1HKMA 3UI4A 4P8WA 2WLZA 3O5DA 2FKEA 3KCEA 2DSVA 4U86A 4DRQA 3ARSA 3CHEA 4AY1A 2WK2A 2KI3A 4MSPA 4QT2A 4MPKA 2OFNA 4DWSD 2VN1A 5B8IC 3B7XA 3CGNA 3O5GA 3TC5A 3WQWA 3O5IA 2DG4A 2RUCA 1GUVA 4MGVA 1OWQA 1WB0A 2XPAA 1L1PA 3UQIA 3WIJA 2FDMA 5HW8A 4DWSC 4WKFA 2F4EA 2P4VA 2DPEA 3O5LA 3ODKA 4WIWA 3ARQA 1FKIA 1LG1A 4LAWA 3MDYB 1Q6IA 4N19A 3GPKA 1R9HA 2RSEA 4TNSA 1TCOC 3UI6A 1KT1A 3KACA 3WD0A 2QF8A 4W5UA 1ITXA 4ZS6A 2XP5A 3W4RA 2OLHA 2ESCA 4W9PA 4ODMA 3PA7A 4MNKA 5DO2A 4W9QA 1EDQA 1FJDA 1F8AB 4FN2A 5DIUA 2G8ZA 4TW7A 1LG2A 1U79A 3RM9A 5HUAA 1LJYA 5HTGA 4Q22A 2O92A 3WD3A 5I98A 2B5UB 1FFQA 1A7XA 3ARYA 4FAPA 5HW7A 3PRDA 4DRIA 5HW6A 3VAWA 3O5MA 2Q5AA 4PTMA 3AS2A 2PV2A 2UZ5A 3WL1A 1Q6UA 2LKNA 2PV1A 2PPNA 2XP4A 1E44A 2M1IA 4QIBA 4NZCA 3O5KA 4LAVA 2F2DA 1JVWA 4Z2JA 1GOIA 5GPRA 1HJXA 3TDBA 2M08A 4O2TA 5DITA 1KFWA 2PPPA 3UQAA 2MLZA 1HXVA 4HARA 1KT0A 2PPOA 1HKKA 1XHGA 1D7JA 4QZVB 4DRPA 2ITKA 1E6NA 3OA5A 4DIPA 2RUQA 1FKLA 5HBFA 2MLYA 2LPVA 1LL6A 3RM8A 3O5RA 1Y0OA 1YATA 2KO7A 2XP7A 1W1VA 3FXYA 4G50A 4WKHA 1TFVA 2RUDA 4WJXA 4IQ2A 1FKKA 1GRJA 3TCZA 1IX5A 1QZ2A 3FAPA 4MAVA 4TW6A 1PBKA 3ARRA 3CHFA 4DH0A 3KZ7A 1W1TA 4LGXA 3B8SA 3CHDA 4Z2IA 1X6NA 3BXWA 2ZR4A 4IT6A 1T11A 3KAIA 1N1AA 1FKRA 3O5FA 4JFLA 2DG3A 2MLXA 3EY6A 3B9DA 4S3JA 3RGCA 1M5YA 1ZBCA 2ZR6A 4QT3A 3ARWA 4DROA 5HKGA 1FKFA 2ZQSA
chains in the Genus database with same CATH topology
3CH9A 3ARZA 1UR9A 4DT4A 3B9EA 4DWSA 1ROUA 1LQ0A 2WM0A 2MNTA 2YBTA 2N87A 3ARXA 3PR9A 1J4RA 4JFKA 4R5EA 1WAWA 5HWBA 3ARPA 5DIVA 3AS3A 2ZQTA 1D7IA 1H0IA 4IT4A 3ARUA 4KQZA 4Z2LA 1JNEA 3AS0A 4R0XA 1FFRA 4S3KA 1NWSA 1PINA 2A3CA 2O9OA 1Q1CA 2KFWA 2FAPA 2KE0A 5J6EA 1W1PA 2DT2A 2ZQVA 3NRKA 1CTNA 1B6CA 1ZB5A 4TW8A 5HT1A 1W9PA 4L3NA 1EQ3A 1EHNA 4JFJA 4NNRA 3QOKA 2RURA 3KAFA 2DT0A 4P8UA 3O5QA 1JNTA 3UI5A 1XRVA 4ODRA 3OOBA 1ZBWA 2L2SA 3KABA 3ARTA 3KAHA 2DG9A 4MNLA 4ZPVR 1LL4A 4DRJA 3IKDA 3RM4A 3WH0A 1JNDA 1P5QA 4G2PA 4JFMA 1EYMA 4L72B 3RFWA 2LGOA 1FKJA 3WKZA 1E6ZA 5JH8A 1X6LA 4ODLA 1FKTA 2Y78A 4TYOA 1W1YA 4ODOA 4GIVA 4ZPTR 4DWSB 2JZVA 4URIA 4WK9A 1ZK6A 4Q7NA 4W9OA 2F21A 2KGJA 1QPFA 1UR8A 2AWGA 1W26A 1D6OA 5GQBA 4Z2HA 2DSWA 4HBEA 3RMEA 1C9HA 4DZ2A 2MPHA 2DT3A 1OGBA 3WQVA 1YW5A 4U85A 1NH6A 1VF8A 3FY1A 1ZU8A 5DF0A 3ALGA 1E6RA 1NWUA 3AROA 1H0GA 3PRBA 4WKAA 2XP8A 1HKIA 5DEZA 5GPGA 4DRNA 3H9RB 4LAXA 4MNMA 3KADA 2M2AA 2A3AA 3AQUA 3CGMA 2D9FA 1NMWA 1WNOA 4ODKA 3UF8A 2K8IA 3G6MA 4ODNA 4J4NA 5D75A 5BXJA 3UQBA 2XP9A 2PI6A 2YBUA 1OGGA 1FKBA 3JYJA 3NTPA 1E9LA 4KR0B 3WL0A 3ALFA 3ARVA 2AOSA 3AS1A 1JNSA 4P8VA 1J6YA 2PV3A 1EIBA 1J4HA 4LAYA 2IF4A 1GPFA 4ODPA 4ODQA 1K9TA 5HWCA 1NSGA 4ZPWR 4HBOA 3I6CA 3NI6A 2WLYA 4GGQA 2DSUA 2PBCA 1W9UA 1ZBKA 2IUZA 3WD2A 3IKGA 4MNJA 2B31A 2LJ4A 3O5OA 1O6IA 1F40A 1ROTA 1FD9A 2XP3A 3WD1A 1FKSA 3KAGA 3LUOA 3PRAA 3O5PA 1E6PA 2MF9A 3O5JA 4JFIA 2A3EA 1E15A 3WD4A 3O5EA 1D2KA 3IK8A 4C02B 4NSBA 4JYSA 1BKFA 2ZQUA 2XPBA 2ZR5A 2A3BA 3JYMA 4IQCA 1FKDA 1ZCNA 4J4OA 2VCDA 4ML4A 1LL7A 1HKJA 2G41A 3CZ8A 1FKHA 1W9VA 4IPXA 1HJWA 1NWTA 4Z2KA 3B9AA 2DSZA 1J4IA 4DRKA 4DZ3A 4DRHA 3JXVA 1ZBVA 3IHZA 1FKGA 1NMVA 4TX0A 1BL4A 1RD6A 2XP6A 1QPLA 1FAPA 1SR0A 4XAKA 4BF8A 4ITZA 1Q6HA 1HJVA 4P8XA 1SYTA 4DRMA 3CHCA 4MTVA 1NWRA 2RQSA 1ZL1A 1D7HA 2DT1A 2KR7A 4U84A 3G6LA 4Z2GA 1HKMA 3UI4A 4P8WA 2WLZA 3O5DA 2FKEA 3KCEA 2DSVA 4U86A 4DRQA 3ARSA 3CHEA 4AY1A 2WK2A 2KI3A 4MSPA 4QT2A 4MPKA 2OFNA 4DWSD 2VN1A 5B8IC 3B7XA 3CGNA 3O5GA 3TC5A 3WQWA 3O5IA 2DG4A 2RUCA 1GUVA 4MGVA 1OWQA 1WB0A 2XPAA 1L1PA 3UQIA 3WIJA 2FDMA 5HW8A 4DWSC 4WKFA 2F4EA 2DPEA 3O5LA 3ODKA 4WIWA 3ARQA 1FKIA 1LG1A 4LAWA 3MDYB 1Q6IA 4N19A 3GPKA 1R9HA 2RSEA 4TNSA 1TCOC 3UI6A 1KT1A 3KACA 3WD0A 2QF8A 4W5UA 1ITXA 4ZS6A 2XP5A 3W4RA 2OLHA 2ESCA 4W9PA 4ODMA 3PA7A 4MNKA 5DO2A 4W9QA 1EDQA 1FJDA 1F8AB 4FN2A 5DIUA 2G8ZA 4TW7A 1LG2A 1U79A 3RM9A 5HUAA 1LJYA 5HTGA 4Q22A 2O92A 3WD3A 5I98A 1FFQA 1A7XA 3ARYA 4FAPA 5HW7A 3PRDA 4DRIA 5HW6A 3VAWA 3O5MA 2Q5AA 4PTMA 3AS2A 2PV2A 2UZ5A 3WL1A 1Q6UA 2LKNA 2PV1A 2PPNA 2XP4A 2M1IA 4QIBA 4NZCA 3O5KA 4LAVA 2F2DA 1JVWA 4Z2JA 1GOIA 5GPRA 1HJXA 3TDBA 2M08A 4O2TA 5DITA 1KFWA 2PPPA 3UQAA 2MLZA 1HXVA 4HARA 1KT0A 2PPOA 1HKKA 1XHGA 1D7JA 4QZVB 4DRPA 2ITKA 1E6NA 3OA5A 4DIPA 2RUQA 1FKLA 5HBFA 2MLYA 2LPVA 1LL6A 3RM8A 3O5RA 1Y0OA 1YATA 2KO7A 2XP7A 1W1VA 3FXYA 4G50A 4WKHA 1TFVA 2RUDA 4WJXA 4IQ2A 1FKKA 3TCZA 1IX5A 1QZ2A 3FAPA 4MAVA 4TW6A 1PBKA 3ARRA 3CHFA 4DH0A 3KZ7A 1W1TA 4LGXA 3B8SA 3CHDA 4Z2IA 1X6NA 3BXWA 2ZR4A 4IT6A 1T11A 3KAIA 1N1AA 1FKRA 3O5FA 4JFLA 2DG3A 2MLXA 3EY6A 3B9DA 4S3JA 3RGCA 1M5YA 1ZBCA 2ZR6A 4QT3A 3ARWA 4DROA 5HKGA 1FKFA 2ZQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGJ A;  5HUA A;  1QPF A;  5HTG A;  1FKH A;  4IPX A;  2AWG A;  1W26 A;  1D6O A;  5I98 A;  1A7X A;  1J4I A;  1C9H A;  4DRK A;  4DT4 A;  4DZ3 A;  4DZ2 A;  4FAP A;  1ROU A;  2MPH A;  4DRH A;  3JXV A;  3PRD A;  4DRI A;  3IHZ A;  5HW6 A;  5HW7 A;  3VAW A;  3O5M A;  1FKG A;  1NMV A;  2Q5A A;  1YW5 A;  4TX0 A;  1BL4 A;  4U85 A;  2MNT A;  2PV2 A;  2UZ5 A;  2XP6 A;  1QPL A;  1FAP A;  2N87 A;  1Q6U A;  2LKN A;  4BF8 A;  4ITZ A;  2PV1 A;  1J4R A;  1Q6H A;  2PPN A;  4JFK A;  2XP4 A;  3PRB A;  5HWB A;  5DIV A;  2M1I A;  2XP8 A;  4DRM A;  4DRN A;  5GPG A;  2ZQT A;  4QIB A;  3H9R B;  4LAX A;  1D7I A;  3KAD A;  3O5K A;  4LAV A;  2M2A A;  2RQS A;  3CGM A;  2D9F A;  2F2D A;  1JVW A;  1NMW A;  1D7H A;  2KR7 A;  4ODK A;  3UF8 A;  2K8I A;  4ODN A;  4J4N A;  4U84 A;  3TDB A;  5D75 A;  2M08 A;  5BXJ A;  3UQB A;  4R0X A;  4O2T A;  2XP9 A;  4W9O A;  2PPP A;  5DIT A;  3UI4 A;  3UQA A;  3O5D A;  2MLZ A;  1HXV A;  1FKB A;  2FKE A;  3JYJ A;  3KCE A;  3NTP A;  1PIN A;  4U86 A;  1KT0 A;  4DRQ A;  2PPO A;  1JNS A;  1Q1C A;  1D7J A;  2KFW A;  1J6Y A;  4DRP A;  2PV3 A;  2ITK A;  2KI3 A;  2FAP A;  1J4H A;  4MSP A;  4LAY A;  4DIP A;  2IF4 A;  2KE0 A;  4QT2 A;  5J6E A;  2RUQ A;  1FKL A;  2OFN A;  2MLY A;  2LPV A;  2VN1 A;  4ODP A;  4ODQ A;  5B8I C;  3B7X A;  3CGN A;  3O5G A;  3TC5 A;  2ZQV A;  3NRK A;  3O5R A;  1B6C A;  3O5I A;  2DG4 A;  4TW8 A;  2RUC A;  1Y0O A;  5HWC A;  4MGV A;  5HT1 A;  2XPA A;  1YAT A;  2KO7 A;  2XP7 A;  1EQ3 A;  1L1P A;  4JFJ A;  1NSG A;  4NNR A;  3I6C A;  3NI6 A;  4G50 A;  4GGQ A;  3UQI A;  2RUR A;  5HW8 A;  3KAF A;  2PBC A;  2RUD A;  3O5Q A;  1JNT A;  2F4E A;  4IQ2 A;  3UI5 A;  3IKG A;  4ODR A;  3O5O A;  2LJ4 A;  3O5L A;  1F40 A;  1FKK A;  3ODK A;  3OOB A;  1FKI A;  1ROT A;  3TCZ A;  4LAW A;  1FD9 A;  1Q6I A;  1QZ2 A;  2XP3 A;  3MDY B;  1FKS A;  1R9H A;  2L2S A;  3GPK A;  3KAB A;  2RSE A;  3KAH A;  3FAP A;  1TCO C;  2DG9 A;  3KAG A;  4TNS A;  1PBK A;  4TW6 A;  3LUO A;  4DH0 A;  3O5P A;  2MF9 A;  4DRJ A;  3O5J A;  3UI6 A;  3KZ7 A;  1KT1 A;  4JFI A;  3KAC A;  3IKD A;  3WH0 A;  1P5Q A;  4G2P A;  4JFM A;  3O5E A;  2ZR4 A;  1T11 A;  3IK8 A;  3KAI A;  1EYM A;  1N1A A;  2XP5 A;  4C02 B;  1FKR A;  3O5F A;  3RFW A;  2LGO A;  1FKJ A;  3RGC A;  4JFL A;  2DG3 A;  2MLX A;  3PA7 A;  4JYS A;  4ODM A;  3EY6 A;  4W9Q A;  1BKF A;  4ODL A;  1FKT A;  1F8A B;  2Y78 A;  2XPB A;  2ZQU A;  2ZR5 A;  1M5Y A;  3JYM A;  4FN2 A;  4IQC A;  4ODO A;  4TYO A;  5DIU A;  2ZR6 A;  1FKD A;  4N19 A;  1ZCN A;  4J4O A;  4GIV A;  4QT3 A;  4DRO A;  5HKG A;  2JZV A;  4W9P A;  2VCD A;  4TW7 A;  1FJD A;  1U79 A;  1ZK6 A;  1FKF A;  2F21 A;  2ZQS A; 
#chains in the Genus database with same CATH topology
 3CH9 A;  3ARZ A;  1UR9 A;  3GU0 A;  4DT4 A;  3B9E A;  4DWS A;  1ROU A;  1LQ0 A;  2WM0 A;  2MNT A;  2YBT A;  2N87 A;  3ARX A;  3PR9 A;  1J4R A;  4JFK A;  4R5E A;  1WAW A;  5HWB A;  3ARP A;  5DIV A;  3AS3 A;  2ZQT A;  1D7I A;  1H0I A;  4IT4 A;  3ARU A;  4KQZ A;  4Z2L A;  1JNE A;  3AS0 A;  4R0X A;  1FFR A;  4S3K A;  1NWS A;  1PIN A;  2A3C A;  2O9O A;  1Q1C A;  3BMB A;  2KFW A;  2FAP A;  2KE0 A;  5J6E A;  1W1P A;  2DT2 A;  2ZQV A;  3NRK A;  1CTN A;  1B6C A;  1ZB5 A;  4TW8 A;  5HT1 A;  1W9P A;  4L3N A;  1EQ3 A;  1EHN A;  4JFJ A;  4NNR A;  3QOK A;  4UDM A;  2RUR A;  3KAF A;  2DT0 A;  4P8U A;  3O5Q A;  1JNT A;  3UI5 A;  1XRV A;  4ODR A;  3OOB A;  1ZBW A;  2L2S A;  3KAB A;  3ART A;  3KAH A;  2DG9 A;  4MNL A;  4ZPV R;  1LL4 A;  4DRJ A;  3IKD A;  3RM4 A;  3WH0 A;  1JND A;  1P5Q A;  4G2P A;  4JFM A;  1EYM A;  4L72 B;  3RFW A;  2LGO A;  1FKJ A;  3WKZ A;  1E6Z A;  5JH8 A;  1X6L A;  4ODL A;  1FKT A;  2Y78 A;  4TYO A;  1W1Y A;  4ODO A;  4GIV A;  4ZPT R;  4DWS B;  2JZV A;  4URI A;  4WK9 A;  1ZK6 A;  4Q7N A;  4W9O A;  2F21 A;  2KGJ A;  1QPF A;  1UR8 A;  2AWG A;  1W26 A;  1D6O A;  5GQB A;  4Z2H A;  2DSW A;  4HBE A;  3RME A;  1C9H A;  3EIP A;  4DZ2 A;  2MPH A;  2DT3 A;  1OGB A;  3WQV A;  1YW5 A;  4U85 A;  1NH6 A;  1VF8 A;  3FY1 A;  1ZU8 A;  5DF0 A;  3ALG A;  1E6R A;  1NWU A;  3ARO A;  1H0G A;  3PRB A;  4WKA A;  2XP8 A;  1HKI A;  5DEZ A;  5GPG A;  4DRN A;  3H9R B;  4LAX A;  4MNM A;  3KAD A;  2PN0 A;  2M2A A;  2A3A A;  3AQU A;  3CGM A;  2D9F A;  1NMW A;  1WNO A;  4ODK A;  3UF8 A;  2K8I A;  3G6M A;  4ODN A;  4J4N A;  5D75 A;  5BXJ A;  3UQB A;  2XP9 A;  2PI6 A;  2YBU A;  1OGG A;  1FKB A;  3JYJ A;  3NTP A;  1E9L A;  4KR0 B;  3WL0 A;  3ALF A;  3ARV A;  2AOS A;  3AS1 A;  1JNS A;  4P8V A;  1J6Y A;  2PV3 A;  1EIB A;  1J4H A;  4LAY A;  2IF4 A;  3GTY X;  1GPF A;  4ODP A;  4ODQ A;  1K9T A;  5HWC A;  1NSG A;  4ZPW R;  4HBO A;  3I6C A;  3NI6 A;  2WLY A;  4GGQ A;  2DSU A;  2PBC A;  1W9U A;  1ZBK A;  2IUZ A;  3WD2 A;  3IKG A;  4MNJ A;  2B31 A;  2LJ4 A;  3O5O A;  1O6I A;  1F40 A;  1ROT A;  1FD9 A;  2XP3 A;  3WD1 A;  1FKS A;  3KAG A;  3LUO A;  3PRA A;  1JCH B;  3O5P A;  1E6P A;  2MF9 A;  3O5J A;  4JFI A;  2A3E A;  1E15 A;  3WD4 A;  3O5E A;  2ETN A;  1D2K A;  3IK8 A;  4C02 B;  4NSB A;  4JYS A;  1BKF A;  2ZQU A;  2XPB A;  2ZR5 A;  2A3B A;  3JYM A;  4IQC A;  1FKD A;  1ZCN A;  4J4O A;  2VCD A;  4ML4 A;  1LL7 A;  1HKJ A;  2G41 A;  3CZ8 A;  1FKH A;  1W9V A;  4IPX A;  1HJW A;  1NWT A;  4Z2K A;  3B9A A;  2DSZ A;  1J4I A;  4DRK A;  4DZ3 A;  4DRH A;  3JXV A;  1ZBV A;  3IHZ A;  1FKG A;  1NMV A;  4TX0 A;  1BL4 A;  1RD6 A;  2XP6 A;  1QPL A;  1FAP A;  1SR0 A;  2EUL A;  4XAK A;  4BF8 A;  4ITZ A;  1Q6H A;  1HJV A;  4P8X A;  1SYT A;  4DRM A;  3CHC A;  4MTV A;  1NWR A;  2F23 A;  2RQS A;  1ZL1 A;  1D7H A;  2DT1 A;  2KR7 A;  4U84 A;  3G6L A;  4Z2G A;  1HKM A;  3UI4 A;  4P8W A;  2WLZ A;  3O5D A;  2FKE A;  3KCE A;  2DSV A;  4U86 A;  4DRQ A;  3ARS A;  3CHE A;  4AY1 A;  2WK2 A;  2KI3 A;  4MSP A;  4QT2 A;  4MPK A;  2OFN A;  4DWS D;  2VN1 A;  5B8I C;  3B7X A;  3CGN A;  3O5G A;  3TC5 A;  3WQW A;  3O5I A;  2DG4 A;  2RUC A;  1GUV A;  4MGV A;  1OWQ A;  1WB0 A;  2XPA A;  1L1P A;  3UQI A;  3WIJ A;  2FDM A;  5HW8 A;  4DWS C;  4WKF A;  2F4E A;  2P4V A;  2DPE A;  3O5L A;  3ODK A;  4WIW A;  3ARQ A;  1FKI A;  1LG1 A;  4LAW A;  3MDY B;  1Q6I A;  4N19 A;  3GPK A;  1R9H A;  2RSE A;  4TNS A;  1TCO C;  3UI6 A;  1KT1 A;  3KAC A;  3WD0 A;  2QF8 A;  4W5U A;  1ITX A;  4ZS6 A;  2XP5 A;  3W4R A;  2OLH A;  2ESC A;  4W9P A;  4ODM A;  3PA7 A;  4MNK A;  5DO2 A;  4W9Q A;  1EDQ A;  1FJD A;  1F8A B;  4FN2 A;  5DIU A;  2G8Z A;  4TW7 A;  1LG2 A;  1U79 A;  3RM9 A;  5HUA A;  1LJY A;  5HTG A;  4Q22 A;  2O92 A;  3WD3 A;  5I98 A;  2B5U B;  1FFQ A;  1A7X A;  3ARY A;  4FAP A;  5HW7 A;  3PRD A;  4DRI A;  5HW6 A;  3VAW A;  3O5M A;  2Q5A A;  4PTM A;  3AS2 A;  2PV2 A;  2UZ5 A;  3WL1 A;  1Q6U A;  2LKN A;  2PV1 A;  2PPN A;  2XP4 A;  1E44 A;  2M1I A;  4QIB A;  4NZC A;  3O5K A;  4LAV A;  2F2D A;  1JVW A;  4Z2J A;  1GOI A;  5GPR A;  1HJX A;  3TDB A;  2M08 A;  4O2T A;  5DIT A;  1KFW A;  2PPP A;  3UQA A;  2MLZ A;  1HXV A;  4HAR A;  1KT0 A;  2PPO A;  1HKK A;  1XHG A;  1D7J A;  4QZV B;  4DRP A;  2ITK A;  1E6N A;  3OA5 A;  4DIP A;  2RUQ A;  1FKL A;  5HBF A;  2MLY A;  2LPV A;  1LL6 A;  3RM8 A;  3O5R A;  1Y0O A;  1YAT A;  2KO7 A;  2XP7 A;  1W1V A;  3FXY A;  4G50 A;  4WKH A;  1TFV A;  2RUD A;  4WJX A;  4IQ2 A;  1FKK A;  1GRJ A;  3TCZ A;  1IX5 A;  1QZ2 A;  3FAP A;  4MAV A;  4TW6 A;  1PBK A;  3ARR A;  3CHF A;  4DH0 A;  3KZ7 A;  1W1T A;  4LGX A;  3B8S A;  3CHD A;  4Z2I A;  1X6N A;  3BXW A;  2ZR4 A;  4IT6 A;  1T11 A;  3KAI A;  1N1A A;  1FKR A;  3O5F A;  4JFL A;  2DG3 A;  2MLX A;  3EY6 A;  3B9D A;  4S3J A;  3RGC A;  1M5Y A;  1ZBC A;  2ZR6 A;  4QT3 A;  3ARW A;  4DRO A;  5HKG A;  1FKF A;  2ZQS A; 
#chains in the Genus database with same CATH homology
 3CH9 A;  3ARZ A;  1UR9 A;  4DT4 A;  3B9E A;  4DWS A;  1ROU A;  1LQ0 A;  2WM0 A;  2MNT A;  2YBT A;  2N87 A;  3ARX A;  3PR9 A;  1J4R A;  4JFK A;  4R5E A;  1WAW A;  5HWB A;  3ARP A;  5DIV A;  3AS3 A;  2ZQT A;  1D7I A;  1H0I A;  4IT4 A;  3ARU A;  4KQZ A;  4Z2L A;  1JNE A;  3AS0 A;  4R0X A;  1FFR A;  4S3K A;  1NWS A;  1PIN A;  2A3C A;  2O9O A;  1Q1C A;  2KFW A;  2FAP A;  2KE0 A;  5J6E A;  1W1P A;  2DT2 A;  2ZQV A;  3NRK A;  1CTN A;  1B6C A;  1ZB5 A;  4TW8 A;  5HT1 A;  1W9P A;  4L3N A;  1EQ3 A;  1EHN A;  4JFJ A;  4NNR A;  3QOK A;  2RUR A;  3KAF A;  2DT0 A;  4P8U A;  3O5Q A;  1JNT A;  3UI5 A;  1XRV A;  4ODR A;  3OOB A;  1ZBW A;  2L2S A;  3KAB A;  3ART A;  3KAH A;  2DG9 A;  4MNL A;  4ZPV R;  1LL4 A;  4DRJ A;  3IKD A;  3RM4 A;  3WH0 A;  1JND A;  1P5Q A;  4G2P A;  4JFM A;  1EYM A;  4L72 B;  3RFW A;  2LGO A;  1FKJ A;  3WKZ A;  1E6Z A;  5JH8 A;  1X6L A;  4ODL A;  1FKT A;  2Y78 A;  4TYO A;  1W1Y A;  4ODO A;  4GIV A;  4ZPT R;  4DWS B;  2JZV A;  4URI A;  4WK9 A;  1ZK6 A;  4Q7N A;  4W9O A;  2F21 A;  2KGJ A;  1QPF A;  1UR8 A;  2AWG A;  1W26 A;  1D6O A;  5GQB A;  4Z2H A;  2DSW A;  4HBE A;  3RME A;  1C9H A;  4DZ2 A;  2MPH A;  2DT3 A;  1OGB A;  3WQV A;  1YW5 A;  4U85 A;  1NH6 A;  1VF8 A;  3FY1 A;  1ZU8 A;  5DF0 A;  3ALG A;  1E6R A;  1NWU A;  3ARO A;  1H0G A;  3PRB A;  4WKA A;  2XP8 A;  1HKI A;  5DEZ A;  5GPG A;  4DRN A;  3H9R B;  4LAX A;  4MNM A;  3KAD A;  2M2A A;  2A3A A;  3AQU A;  3CGM A;  2D9F A;  1NMW A;  1WNO A;  4ODK A;  3UF8 A;  2K8I A;  3G6M A;  4ODN A;  4J4N A;  5D75 A;  5BXJ A;  3UQB A;  2XP9 A;  2PI6 A;  2YBU A;  1OGG A;  1FKB A;  3JYJ A;  3NTP A;  1E9L A;  4KR0 B;  3WL0 A;  3ALF A;  3ARV A;  2AOS A;  3AS1 A;  1JNS A;  4P8V A;  1J6Y A;  2PV3 A;  1EIB A;  1J4H A;  4LAY A;  2IF4 A;  1GPF A;  4ODP A;  4ODQ A;  1K9T A;  5HWC A;  1NSG A;  4ZPW R;  4HBO A;  3I6C A;  3NI6 A;  2WLY A;  4GGQ A;  2DSU A;  2PBC A;  1W9U A;  1ZBK A;  2IUZ A;  3WD2 A;  3IKG A;  4MNJ A;  2B31 A;  2LJ4 A;  3O5O A;  1O6I A;  1F40 A;  1ROT A;  1FD9 A;  2XP3 A;  3WD1 A;  1FKS A;  3KAG A;  3LUO A;  3PRA A;  3O5P A;  1E6P A;  2MF9 A;  3O5J A;  4JFI A;  2A3E A;  1E15 A;  3WD4 A;  3O5E A;  1D2K A;  3IK8 A;  4C02 B;  4NSB A;  4JYS A;  1BKF A;  2ZQU A;  2XPB A;  2ZR5 A;  2A3B A;  3JYM A;  4IQC A;  1FKD A;  1ZCN A;  4J4O A;  2VCD A;  4ML4 A;  1LL7 A;  1HKJ A;  2G41 A;  3CZ8 A;  1FKH A;  1W9V A;  4IPX A;  1HJW A;  1NWT A;  4Z2K A;  3B9A A;  2DSZ A;  1J4I A;  4DRK A;  4DZ3 A;  4DRH A;  3JXV A;  1ZBV A;  3IHZ A;  1FKG A;  1NMV A;  4TX0 A;  1BL4 A;  1RD6 A;  2XP6 A;  1QPL A;  1FAP A;  1SR0 A;  4XAK A;  4BF8 A;  4ITZ A;  1Q6H A;  1HJV A;  4P8X A;  1SYT A;  4DRM A;  3CHC A;  4MTV A;  1NWR A;  2RQS A;  1ZL1 A;  1D7H A;  2DT1 A;  2KR7 A;  4U84 A;  3G6L A;  4Z2G A;  1HKM A;  3UI4 A;  4P8W A;  2WLZ A;  3O5D A;  2FKE A;  3KCE A;  2DSV A;  4U86 A;  4DRQ A;  3ARS A;  3CHE A;  4AY1 A;  2WK2 A;  2KI3 A;  4MSP A;  4QT2 A;  4MPK A;  2OFN A;  4DWS D;  2VN1 A;  5B8I C;  3B7X A;  3CGN A;  3O5G A;  3TC5 A;  3WQW A;  3O5I A;  2DG4 A;  2RUC A;  1GUV A;  4MGV A;  1OWQ A;  1WB0 A;  2XPA A;  1L1P A;  3UQI A;  3WIJ A;  2FDM A;  5HW8 A;  4DWS C;  4WKF A;  2F4E A;  2DPE A;  3O5L A;  3ODK A;  4WIW A;  3ARQ A;  1FKI A;  1LG1 A;  4LAW A;  3MDY B;  1Q6I A;  4N19 A;  3GPK A;  1R9H A;  2RSE A;  4TNS A;  1TCO C;  3UI6 A;  1KT1 A;  3KAC A;  3WD0 A;  2QF8 A;  4W5U A;  1ITX A;  4ZS6 A;  2XP5 A;  3W4R A;  2OLH A;  2ESC A;  4W9P A;  4ODM A;  3PA7 A;  4MNK A;  5DO2 A;  4W9Q A;  1EDQ A;  1FJD A;  1F8A B;  4FN2 A;  5DIU A;  2G8Z A;  4TW7 A;  1LG2 A;  1U79 A;  3RM9 A;  5HUA A;  1LJY A;  5HTG A;  4Q22 A;  2O92 A;  3WD3 A;  5I98 A;  1FFQ A;  1A7X A;  3ARY A;  4FAP A;  5HW7 A;  3PRD A;  4DRI A;  5HW6 A;  3VAW A;  3O5M A;  2Q5A A;  4PTM A;  3AS2 A;  2PV2 A;  2UZ5 A;  3WL1 A;  1Q6U A;  2LKN A;  2PV1 A;  2PPN A;  2XP4 A;  2M1I A;  4QIB A;  4NZC A;  3O5K A;  4LAV A;  2F2D A;  1JVW A;  4Z2J A;  1GOI A;  5GPR A;  1HJX A;  3TDB A;  2M08 A;  4O2T A;  5DIT A;  1KFW A;  2PPP A;  3UQA A;  2MLZ A;  1HXV A;  4HAR A;  1KT0 A;  2PPO A;  1HKK A;  1XHG A;  1D7J A;  4QZV B;  4DRP A;  2ITK A;  1E6N A;  3OA5 A;  4DIP A;  2RUQ A;  1FKL A;  5HBF A;  2MLY A;  2LPV A;  1LL6 A;  3RM8 A;  3O5R A;  1Y0O A;  1YAT A;  2KO7 A;  2XP7 A;  1W1V A;  3FXY A;  4G50 A;  4WKH A;  1TFV A;  2RUD A;  4WJX A;  4IQ2 A;  1FKK A;  3TCZ A;  1IX5 A;  1QZ2 A;  3FAP A;  4MAV A;  4TW6 A;  1PBK A;  3ARR A;  3CHF A;  4DH0 A;  3KZ7 A;  1W1T A;  4LGX A;  3B8S A;  3CHD A;  4Z2I A;  1X6N A;  3BXW A;  2ZR4 A;  4IT6 A;  1T11 A;  3KAI A;  1N1A A;  1FKR A;  3O5F A;  4JFL A;  2DG3 A;  2MLX A;  3EY6 A;  3B9D A;  4S3J A;  3RGC A;  1M5Y A;  1ZBC A;  2ZR6 A;  4QT3 A;  3ARW A;  4DRO A;  5HKG A;  1FKF A;  2ZQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...