5HW6A

Candida albicans fkbp12 apo protein in c2 space group
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
120
structure length
120
Chain Sequence
EELPQIEIVQEGDNTTFAKPGDTVTIHYDGKLTNGKEFDSSRKRGKPFTCTVGVGQVIKGWDISLTNNYGKGGANLPKISKGTKAILTIPPNLAYGPRGIPPIIGPNETLVFEVELLGVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 1
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida albicans (strain sc5314 / atcc mya-2876)
molecule tags Isomerase
total genus 25
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5hw6A00
5HW8A 2AWGA 4IQ2A 4U84A 4JFKA 4IQCA 1W26A 4ODOA 2FAPA 5HWBA 4DRMA 4ODMA 2F4EA 1TCOC 3IK8A 2KE0A 3O5KA 4W9QA 3O5FA 2UZ5A 2IF4A 2KO7A 2LJ4A 3O5IA 2KFWA 1FKBA 1J4RA 3KACA 3O5QA 4DZ3A 1FAPA 2RSEA 1NMVA 3ODKA 5I98A 2XPAA 3GPKA 4DRPA 2DG4A 2PPPA 4LAVA 3KABA 1U79A 2ZR4A 1PINA 2RUDA 2VN1A 3KCEA 4TW7A 4DRHA 1Q6HA 4C02B 3VAWA 1J4IA 4BF8A 5DIUA 2PPOA 5HTGA 1FKGA 1JVWA 1HXVA 2MPHA 4J4NA 1ROTA 1N1AA 3KAGA 3B7XA 1EQ3A 2KGJA 2OFNA 4GGQA 4JFJA 1PBKA 3KADA 3O5PA 4TX0A 1FJDA 3NI6A 2PV1A 1JNTA 3KAFA 2PPNA 1J6YA 1FKSA 1Q1CA 1FKJA 2MF9A 2VCDA 4W9PA 5B8IC 4DRKA 4FN2A 1M5YA 2RUQA 2F21A 2F2DA 2DG9A 4ODNA 1NSGA 2JZVA 4DROA 1FKHA 2MLXA 2Q5AA 4DRJA 4TW6A 4DH0A 1QPLA 4QT3A 2MLYA 5J6EA 1D7HA 3IKDA 1QZ2A 4G50A 4IPXA 5HW7A 2PV2A 4LAXA 1Q6UA 2ZQUA 2XP3A 2ZQTA 5DITA 1A7XA 1FKFA 1ZK6A 2RQSA 3KAHA 4JYSA 4R0XA 2XP8A 1J4HA 1BKFA 4LAWA 2ITKA 3TCZA 1EYMA 3MDYB 1YATA 3O5GA 5D75A 1ZCNA 2PV3A 4ODRA 3JYMA 3PRBA 3RFWA 3OOBA 1KT1A 1BL4A 4DZ2A 3O5LA 3EY6A 4NNRA 3TC5A 1FKRA 2M2AA 4GIVA 1Y0OA 3UQAA 2DG3A 4DT4A 2XP5A 1T11A 1JNSA 4U86A 5HUAA 3IKGA 1D6OA 2XP7A 1R9HA 3NRKA 4J4OA 4ODLA 1FKDA 4ODKA 4QIBA 2FKEA 3O5EA 2LGOA 5HWCA 3O5MA 3PRDA 1Q6IA 1FKIA 2MLZA 4G2PA 1C9HA 3CGMA 4N19A 4DIPA 4U85A 4JFMA 1FD9A 2RUCA 5DIVA 1P5QA 4JFLA 1FKLA 3KZ7A 1NMWA 3KAIA 3O5DA 5GPGA 3WH0A 4ODQA 1F40A 3UQIA 2L2SA 1D7JA 3JYJA 3NTPA 4QT2A 3RGCA 1YW5A 3O5RA 4MSPA 4DRQA 1QPFA 2M1IA 3H9RB 1L1PA 3UF8A 2XP4A 3UQBA 3O5JA 2ZR5A 3PA7A 5HKGA 3JXVA 4TW8A 2ZQSA 2MNTA 3IHZA 1D7IA 2K8IA 3LUOA 4JFIA 1FKTA 3CGNA 4TYOA 3UI5A 2XP9A 1B6CA 3UI4A 2KI3A 2LKNA 4DRIA 4W9OA 4LAYA 1KT0A 2PBCA 5HW6A 2Y78A 2ZR6A 2XPBA 4ITZA 4DRNA 2D9FA 3FAPA 3I6CA 1ROUA 2KR7A 3UI6A 5HT1A 1FKKA 5BXJA 2LPVA 2XP6A 2M08A 3TDBA 2ZQVA 3O5OA 4ODPA 4FAPA 1F8AB 2RURA 4TNSA 2N87A 4MGVA 4O2TA
chains in the Genus database with same CATH superfamily
2ESCA 4U84A 4JFKA 3WD1A 1UR9A 3B9DA 4DRMA 1TCOC 2KE0A 2KO7A 4P8VA 2FDMA 2LJ4A 1W9PA 1WAWA 4DRPA 1JNEA 1KFWA 3B9EA 4BF8A 2DSUA 5DIUA 5HTGA 1JVWA 1E9LA 2MPHA 3KAGA 3OA5A 4JFJA 1W9UA 3NI6A 3KAFA 1E6NA 2PPNA 1J6YA 3WD0A 1FKJA 2O9OA 4FN2A 1M5YA 1GPFA 4ODNA 2DSWA 4L3NA 2WLYA 2MLXA 1ZBWA 4TW6A 4DH0A 4QT3A 1EIBA 5J6EA 3CHDA 1QZ2A 1ZBCA 3KAHA 3AQUA 4UDMA 4ML4A 3O5GA 4Z2GA 4P8XA 3PRBA 3RFWA 1KT1A 4DZ2A 4L72B 4DWSD 1ZBVA 1FKRA 4GIVA 2XP5A 4R5EA 2XP7A 3NRKA 1R9HA 4J4OA 4QIBA 1FKIA 1C9HA 3CGMA 1WB0A 3CH9A 3PRAA 4N19A 4JFMA 1FD9A 5DIVA 1W1TA 3KAIA 2A3AA 4NZCA 1D7JA 3JYJA 3WD2A 3O5RA 1HKIA 1SYTA 2M1IA 2B5UB 1ZU8A 2ZR5A 1IX5A 1D7IA 4WKAA 3LUOA 3UI5A 1OWQA 4S3KA 1VF8A 2LKNA 1O6IA 2ZR6A 3FY1A 3ARUA 2D9FA 4W5UA 5HT1A 3AS1A 2M08A 4IT6A 4FAPA 2G41A 5DO2A 5HW8A 4IQ2A 4S3JA 1W26A 2F23A 2DSVA 2PI6A 3WL0A 4W9QA 3ARWA 3AS3A 3O5IA 2KFWA 1FFRA 1FFQA 3O5QA 5I98A 1FAPA 2XPAA 4ZS6A 3GPKA 1U79A 4KR0B 1Q6HA 4Z2LA 2PPOA 1LL7A 1ROTA 1N1AA 2WM0A 3B7XA 3W4RA 1FJDA 4P8UA 2PV1A 2AOSA 2MF9A 2RUQA 2F2DA 2DG9A 4AY1A 2JZVA 4DRJA 4G50A 4LAXA 1Q6UA 2ZQUA 1A7XA 1J4HA 5D75A 3AS2A 1ZCNA 1LJYA 4ODRA 1BL4A 4NNRA 3TC5A 4MAVA 2QF8A 3RM9A 4U86A 5HUAA 1FKDA 3O5MA 3WD4A 3CHFA 3PRDA 4DIPA 1EHNA 4MPKA 4U85A 2RUCA 1P5QA 1NMWA 4HBOA 3EIPA 5GPGA 1F40A 1ITXA 2L2SA 3NTPA 4DRQA 1YW5A 4MSPA 1QPFA 1HKKA 2XP4A 2ZQSA 4Q7NA 2K8IA 1XHGA 1UR8A 1NWUA 3ARYA 2XP9A 4W9OA 3WQWA 1KT0A 4Z2KA 1NWRA 2XPBA 1ZB5A 3FAPA 1ROUA 2KR7A 1FKKA 3ARPA 2DT1A 2LPVA 4P8WA 5JH8A 3B8SA 4ODPA 4MGVA 3WL1A 4O2TA 2AWGA 3AS0A 2DPEA 4ODOA 1NWSA 1W1PA 1W1YA 2F4EA 3ALGA 3IK8A 4ODMA 3O5FA 2IF4A 1W9VA 1J4RA 1FKBA 4DZ3A 2RSEA 3ODKA 1NMVA 1RD6A 2OLHA 1GOIA 2DG4A 2A3BA 2PPPA 4LAVA 3KABA 3RMEA 2EULA 3ARQA 2RUDA 2VN1A 3KCEA 4TW7A 4MNMA 4DRHA 1NH6A 4C02B 1J4IA 4DWSA 2O92A 2WLZA 1HXVA 4J4NA 1WNOA 1EQ3A 2OFNA 1PBKA 3O5PA 1FKSA 2VCDA 5B8IC 4DRKA 3ALFA 2G8ZA 4NSBA 1FKHA 3ARSA 5GQBA 1QPLA 1HKMA 2MLYA 1D7HA 3AROA 3IKDA 2A3EA 2XP3A 2ZQTA 5DITA 2RQSA 1FKFA 4JYSA 4R0XA 2XP8A 3WIJA 1BKFA 3TCZA 3MDYB 1JCHB 1YATA 2PV3A 3RM8A 3JYMA 3O5LA 3EY6A 4DWSC 1E15A 3ARTA 1Y0OA 1CTNA 1T11A 3ARXA 1K9TA 3IKGA 1OGGA 1LL6A 4ZPVR 4ODKA 2FKEA 2DT2A 3O5EA 1NWTA 3WKZA 4Z2JA 2MLZA 2ETNA 4JFLA 1FKLA 1SR0A 3WD3A 4IT4A 1LG2A 3WH0A 1E6ZA 3UQIA 2DT3A 1OGBA 1HJWA 5DF0A 2A3CA 2PN0A 4Z2IA 2IUZA 3UF8A 1E44A 3O5JA 1E6RA 1ZL1A 2MNTA 3IHZA 2YBUA 4TYOA 3CGNA 3WQVA 3G6LA 4XAKA 2KI3A 4ZPWR 4LAYA 2PBCA 2Y78A 4WJXA 4DRNA 4ITZA 2P4VA 3I6CA 3BXWA 1JNDA 5BXJA 3TDBA 3O5OA 4TNSA 2N87A 4IQCA 2FAPA 5HWBA 3O5KA 2UZ5A 5GPRA 3PR9A 4KQZA 3KACA 4MNKA 4MNJA 4LGXA 2B31A 2ZR4A 1PINA 3CHCA 3VAWA 1X6LA 4DWSB 1FKGA 1LL4A 2KGJA 4GGQA 3KADA 4TX0A 1JNTA 1Q1CA 4W9PA 1E6PA 2F21A 1NSGA 3RM4A 4DROA 2Q5AA 1HKJA 4WK9A 4IPXA 5HW7A 2PV2A 1ZK6A 3CZ8A 1LQ0A 4LAWA 2ITKA 1EYMA 3OOBA 1ZBKA 4HARA 2M2AA 3GTYX 3UQAA 4URIA 1GRJA 2DG3A 1LG1A 4DT4A 4PTMA 1JNSA 5HBFA 1D6OA 4ODLA 1TFVA 1H0IA 1W1VA 1XRVA 2LGOA 2DT0A 5HWCA 1Q6IA 4G2PA 3BMBA 2DSZA 3KZ7A 4Z2HA 3O5DA 1D2KA 4ODQA 4WIWA 1HJVA 2YBTA 4MNLA 3GU0A 3RGCA 4QT2A 1L1PA 4WKHA 3H9RB 3ARRA 4WKFA 4QZVB 3UQBA 1HJXA 3PA7A 5HKGA 3JXVA 4Q22A 4TW8A 4JFIA 1FKTA 4HBEA 1B6CA 3B9AA 5DEZA 3UI4A 1X6NA 1GUVA 3G6MA 4DRIA 5HW6A 2WK2A 4ZPTR 3UI6A 3ARVA 2XP6A 3CHEA 4MTVA 1EDQA 2ZQVA 3FXYA 1F8AB 2RURA 1H0GA 3ARZA 3QOKA
chains in the Genus database with same CATH topology
2ESCA 4U84A 4JFKA 3WD1A 1UR9A 3B9DA 4DRMA 1TCOC 2KE0A 2KO7A 4P8VA 2FDMA 2LJ4A 1W9PA 1WAWA 4DRPA 1JNEA 1KFWA 3B9EA 4BF8A 2DSUA 5DIUA 5HTGA 1JVWA 1E9LA 2MPHA 3KAGA 3OA5A 4JFJA 1W9UA 3NI6A 3KAFA 1E6NA 2PPNA 1J6YA 3WD0A 1FKJA 2O9OA 4FN2A 1M5YA 1GPFA 4ODNA 2DSWA 4L3NA 2WLYA 2MLXA 1ZBWA 4TW6A 4DH0A 4QT3A 1EIBA 5J6EA 3CHDA 1QZ2A 1ZBCA 3KAHA 3AQUA 4ML4A 3O5GA 4Z2GA 4P8XA 3PRBA 3RFWA 1KT1A 4DZ2A 4L72B 4DWSD 1ZBVA 1FKRA 4GIVA 2XP5A 4R5EA 2XP7A 3NRKA 1R9HA 4J4OA 4QIBA 1FKIA 1C9HA 3CGMA 1WB0A 3CH9A 3PRAA 4N19A 4JFMA 1FD9A 5DIVA 1W1TA 3KAIA 2A3AA 4NZCA 1D7JA 3JYJA 3WD2A 3O5RA 1HKIA 1SYTA 2M1IA 1ZU8A 2ZR5A 1IX5A 1D7IA 4WKAA 3LUOA 3UI5A 1OWQA 4S3KA 1VF8A 2LKNA 1O6IA 2ZR6A 3FY1A 3ARUA 2D9FA 4W5UA 5HT1A 3AS1A 2M08A 4IT6A 4FAPA 2G41A 5DO2A 5HW8A 4IQ2A 4S3JA 1W26A 2DSVA 2PI6A 3WL0A 4W9QA 3ARWA 3AS3A 3O5IA 2KFWA 1FFRA 1FFQA 3O5QA 5I98A 1FAPA 2XPAA 4ZS6A 3GPKA 1U79A 4KR0B 1Q6HA 4Z2LA 2PPOA 1LL7A 1ROTA 1N1AA 2WM0A 3B7XA 3W4RA 1FJDA 4P8UA 2PV1A 2AOSA 2MF9A 2RUQA 2F2DA 2DG9A 4AY1A 2JZVA 4DRJA 4G50A 4LAXA 1Q6UA 2ZQUA 1A7XA 1J4HA 5D75A 3AS2A 1ZCNA 1LJYA 4ODRA 1BL4A 4NNRA 3TC5A 4MAVA 2QF8A 3RM9A 4U86A 5HUAA 1FKDA 3O5MA 3WD4A 3CHFA 3PRDA 4DIPA 1EHNA 4MPKA 4U85A 2RUCA 1P5QA 1NMWA 4HBOA 5GPGA 1F40A 1ITXA 2L2SA 3NTPA 4DRQA 1YW5A 4MSPA 1QPFA 1HKKA 2XP4A 2ZQSA 4Q7NA 2K8IA 1XHGA 1UR8A 1NWUA 3ARYA 2XP9A 4W9OA 3WQWA 1KT0A 4Z2KA 1NWRA 2XPBA 1ZB5A 3FAPA 1ROUA 2KR7A 1FKKA 3ARPA 2DT1A 2LPVA 4P8WA 5JH8A 3B8SA 4ODPA 4MGVA 3WL1A 4O2TA 2AWGA 3AS0A 2DPEA 4ODOA 1NWSA 1W1PA 1W1YA 2F4EA 3ALGA 3IK8A 4ODMA 3O5FA 2IF4A 1W9VA 1J4RA 1FKBA 4DZ3A 2RSEA 3ODKA 1NMVA 1RD6A 2OLHA 1GOIA 2DG4A 2A3BA 2PPPA 4LAVA 3KABA 3RMEA 3ARQA 2RUDA 2VN1A 3KCEA 4TW7A 4MNMA 4DRHA 1NH6A 4C02B 1J4IA 4DWSA 2O92A 2WLZA 1HXVA 4J4NA 1WNOA 1EQ3A 2OFNA 1PBKA 3O5PA 1FKSA 2VCDA 5B8IC 4DRKA 3ALFA 2G8ZA 4NSBA 1FKHA 3ARSA 5GQBA 1QPLA 1HKMA 2MLYA 1D7HA 3AROA 3IKDA 2A3EA 2XP3A 2ZQTA 5DITA 2RQSA 1FKFA 4JYSA 4R0XA 2XP8A 3WIJA 1BKFA 3TCZA 3MDYB 1YATA 2PV3A 3RM8A 3JYMA 3O5LA 3EY6A 4DWSC 1E15A 3ARTA 1Y0OA 1CTNA 1T11A 3ARXA 1K9TA 3IKGA 1OGGA 1LL6A 4ZPVR 4ODKA 2FKEA 2DT2A 3O5EA 1NWTA 3WKZA 4Z2JA 2MLZA 4JFLA 1FKLA 1SR0A 3WD3A 4IT4A 1LG2A 3WH0A 1E6ZA 3UQIA 2DT3A 1OGBA 1HJWA 5DF0A 2A3CA 4Z2IA 2IUZA 3UF8A 3O5JA 1E6RA 1ZL1A 2MNTA 3IHZA 2YBUA 4TYOA 3CGNA 3WQVA 3G6LA 4XAKA 2KI3A 4ZPWR 4LAYA 2PBCA 2Y78A 4WJXA 4DRNA 4ITZA 3I6CA 3BXWA 1JNDA 5BXJA 3TDBA 3O5OA 4TNSA 2N87A 4IQCA 2FAPA 5HWBA 3O5KA 2UZ5A 5GPRA 3PR9A 4KQZA 3KACA 4MNKA 4MNJA 4LGXA 2B31A 2ZR4A 1PINA 3CHCA 3VAWA 1X6LA 4DWSB 1FKGA 1LL4A 2KGJA 4GGQA 3KADA 4TX0A 1JNTA 1Q1CA 4W9PA 1E6PA 2F21A 1NSGA 3RM4A 4DROA 2Q5AA 1HKJA 4WK9A 4IPXA 5HW7A 2PV2A 1ZK6A 3CZ8A 1LQ0A 4LAWA 2ITKA 1EYMA 3OOBA 1ZBKA 4HARA 2M2AA 3UQAA 4URIA 2DG3A 1LG1A 4DT4A 4PTMA 1JNSA 5HBFA 1D6OA 4ODLA 1TFVA 1H0IA 1W1VA 1XRVA 2LGOA 2DT0A 5HWCA 1Q6IA 4G2PA 2DSZA 3KZ7A 4Z2HA 3O5DA 1D2KA 4ODQA 4WIWA 1HJVA 2YBTA 4MNLA 3RGCA 4QT2A 1L1PA 4WKHA 3H9RB 3ARRA 4WKFA 4QZVB 3UQBA 1HJXA 3PA7A 5HKGA 3JXVA 4Q22A 4TW8A 4JFIA 1FKTA 4HBEA 1B6CA 3B9AA 5DEZA 3UI4A 1X6NA 1GUVA 3G6MA 4DRIA 5HW6A 2WK2A 4ZPTR 3UI6A 3ARVA 2XP6A 3CHEA 4MTVA 1EDQA 2ZQVA 3FXYA 1F8AB 2RURA 1H0GA 3ARZA 3QOKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HW8 A;  2AWG A;  4IQ2 A;  4U84 A;  4JFK A;  4IQC A;  1W26 A;  4ODO A;  2FAP A;  5HWB A;  4DRM A;  4ODM A;  2F4E A;  1TCO C;  3IK8 A;  2KE0 A;  3O5K A;  4W9Q A;  3O5F A;  2UZ5 A;  2IF4 A;  2KO7 A;  2LJ4 A;  3O5I A;  2KFW A;  1FKB A;  1J4R A;  3KAC A;  3O5Q A;  4DZ3 A;  1FAP A;  2RSE A;  1NMV A;  3ODK A;  5I98 A;  2XPA A;  3GPK A;  4DRP A;  2DG4 A;  2PPP A;  4LAV A;  3KAB A;  1U79 A;  2ZR4 A;  1PIN A;  2RUD A;  2VN1 A;  3KCE A;  4TW7 A;  4DRH A;  1Q6H A;  4C02 B;  3VAW A;  1J4I A;  4BF8 A;  5DIU A;  2PPO A;  5HTG A;  1FKG A;  1JVW A;  1HXV A;  2MPH A;  4J4N A;  1ROT A;  1N1A A;  3KAG A;  3B7X A;  1EQ3 A;  2KGJ A;  2OFN A;  4GGQ A;  4JFJ A;  1PBK A;  3KAD A;  3O5P A;  4TX0 A;  1FJD A;  3NI6 A;  2PV1 A;  1JNT A;  3KAF A;  2PPN A;  1J6Y A;  1FKS A;  1Q1C A;  1FKJ A;  2MF9 A;  2VCD A;  4W9P A;  5B8I C;  4DRK A;  4FN2 A;  1M5Y A;  2RUQ A;  2F21 A;  2F2D A;  2DG9 A;  4ODN A;  1NSG A;  2JZV A;  4DRO A;  1FKH A;  2MLX A;  2Q5A A;  4DRJ A;  4TW6 A;  4DH0 A;  1QPL A;  4QT3 A;  2MLY A;  5J6E A;  1D7H A;  3IKD A;  1QZ2 A;  4G50 A;  4IPX A;  5HW7 A;  2PV2 A;  4LAX A;  1Q6U A;  2ZQU A;  2XP3 A;  2ZQT A;  5DIT A;  1A7X A;  1FKF A;  1ZK6 A;  2RQS A;  3KAH A;  4JYS A;  4R0X A;  2XP8 A;  1J4H A;  1BKF A;  4LAW A;  2ITK A;  3TCZ A;  1EYM A;  3MDY B;  1YAT A;  3O5G A;  5D75 A;  1ZCN A;  2PV3 A;  4ODR A;  3JYM A;  3PRB A;  3RFW A;  3OOB A;  1KT1 A;  1BL4 A;  4DZ2 A;  3O5L A;  3EY6 A;  4NNR A;  3TC5 A;  1FKR A;  2M2A A;  4GIV A;  1Y0O A;  3UQA A;  2DG3 A;  4DT4 A;  2XP5 A;  1T11 A;  1JNS A;  4U86 A;  5HUA A;  3IKG A;  1D6O A;  2XP7 A;  1R9H A;  3NRK A;  4J4O A;  4ODL A;  1FKD A;  4ODK A;  4QIB A;  2FKE A;  3O5E A;  2LGO A;  5HWC A;  3O5M A;  3PRD A;  1Q6I A;  1FKI A;  2MLZ A;  4G2P A;  1C9H A;  3CGM A;  4N19 A;  4DIP A;  4U85 A;  4JFM A;  1FD9 A;  2RUC A;  5DIV A;  1P5Q A;  4JFL A;  1FKL A;  3KZ7 A;  1NMW A;  3KAI A;  3O5D A;  5GPG A;  3WH0 A;  4ODQ A;  1F40 A;  3UQI A;  2L2S A;  1D7J A;  3JYJ A;  3NTP A;  4QT2 A;  3RGC A;  1YW5 A;  3O5R A;  4MSP A;  4DRQ A;  1QPF A;  2M1I A;  3H9R B;  1L1P A;  3UF8 A;  2XP4 A;  3UQB A;  3O5J A;  2ZR5 A;  3PA7 A;  5HKG A;  3JXV A;  4TW8 A;  2ZQS A;  2MNT A;  3IHZ A;  1D7I A;  2K8I A;  3LUO A;  4JFI A;  1FKT A;  3CGN A;  4TYO A;  3UI5 A;  2XP9 A;  1B6C A;  3UI4 A;  2KI3 A;  2LKN A;  4DRI A;  4W9O A;  4LAY A;  1KT0 A;  2PBC A;  5HW6 A;  2Y78 A;  2ZR6 A;  2XPB A;  4ITZ A;  4DRN A;  2D9F A;  3FAP A;  3I6C A;  1ROU A;  2KR7 A;  3UI6 A;  5HT1 A;  1FKK A;  5BXJ A;  2LPV A;  2XP6 A;  2M08 A;  3TDB A;  2ZQV A;  3O5O A;  4ODP A;  4FAP A;  1F8A B;  2RUR A;  4TNS A;  2N87 A;  4MGV A;  4O2T A; 
#chains in the Genus database with same CATH topology
 2ESC A;  4U84 A;  4JFK A;  3WD1 A;  1UR9 A;  3B9D A;  4DRM A;  1TCO C;  2KE0 A;  2KO7 A;  4P8V A;  2FDM A;  2LJ4 A;  1W9P A;  1WAW A;  4DRP A;  1JNE A;  1KFW A;  3B9E A;  4BF8 A;  2DSU A;  5DIU A;  5HTG A;  1JVW A;  1E9L A;  2MPH A;  3KAG A;  3OA5 A;  4JFJ A;  1W9U A;  3NI6 A;  3KAF A;  1E6N A;  2PPN A;  1J6Y A;  3WD0 A;  1FKJ A;  2O9O A;  4FN2 A;  1M5Y A;  1GPF A;  4ODN A;  2DSW A;  4L3N A;  2WLY A;  2MLX A;  1ZBW A;  4TW6 A;  4DH0 A;  4QT3 A;  1EIB A;  5J6E A;  3CHD A;  1QZ2 A;  1ZBC A;  3KAH A;  3AQU A;  4UDM A;  4ML4 A;  3O5G A;  4Z2G A;  4P8X A;  3PRB A;  3RFW A;  1KT1 A;  4DZ2 A;  4L72 B;  4DWS D;  1ZBV A;  1FKR A;  4GIV A;  2XP5 A;  4R5E A;  2XP7 A;  3NRK A;  1R9H A;  4J4O A;  4QIB A;  1FKI A;  1C9H A;  3CGM A;  1WB0 A;  3CH9 A;  3PRA A;  4N19 A;  4JFM A;  1FD9 A;  5DIV A;  1W1T A;  3KAI A;  2A3A A;  4NZC A;  1D7J A;  3JYJ A;  3WD2 A;  3O5R A;  1HKI A;  1SYT A;  2M1I A;  2B5U B;  1ZU8 A;  2ZR5 A;  1IX5 A;  1D7I A;  4WKA A;  3LUO A;  3UI5 A;  1OWQ A;  4S3K A;  1VF8 A;  2LKN A;  1O6I A;  2ZR6 A;  3FY1 A;  3ARU A;  2D9F A;  4W5U A;  5HT1 A;  3AS1 A;  2M08 A;  4IT6 A;  4FAP A;  2G41 A;  5DO2 A;  5HW8 A;  4IQ2 A;  4S3J A;  1W26 A;  2F23 A;  2DSV A;  2PI6 A;  3WL0 A;  4W9Q A;  3ARW A;  3AS3 A;  3O5I A;  2KFW A;  1FFR A;  1FFQ A;  3O5Q A;  5I98 A;  1FAP A;  2XPA A;  4ZS6 A;  3GPK A;  1U79 A;  4KR0 B;  1Q6H A;  4Z2L A;  2PPO A;  1LL7 A;  1ROT A;  1N1A A;  2WM0 A;  3B7X A;  3W4R A;  1FJD A;  4P8U A;  2PV1 A;  2AOS A;  2MF9 A;  2RUQ A;  2F2D A;  2DG9 A;  4AY1 A;  2JZV A;  4DRJ A;  4G50 A;  4LAX A;  1Q6U A;  2ZQU A;  1A7X A;  1J4H A;  5D75 A;  3AS2 A;  1ZCN A;  1LJY A;  4ODR A;  1BL4 A;  4NNR A;  3TC5 A;  4MAV A;  2QF8 A;  3RM9 A;  4U86 A;  5HUA A;  1FKD A;  3O5M A;  3WD4 A;  3CHF A;  3PRD A;  4DIP A;  1EHN A;  4MPK A;  4U85 A;  2RUC A;  1P5Q A;  1NMW A;  4HBO A;  3EIP A;  5GPG A;  1F40 A;  1ITX A;  2L2S A;  3NTP A;  4DRQ A;  1YW5 A;  4MSP A;  1QPF A;  1HKK A;  2XP4 A;  2ZQS A;  4Q7N A;  2K8I A;  1XHG A;  1UR8 A;  1NWU A;  3ARY A;  2XP9 A;  4W9O A;  3WQW A;  1KT0 A;  4Z2K A;  1NWR A;  2XPB A;  1ZB5 A;  3FAP A;  1ROU A;  2KR7 A;  1FKK A;  3ARP A;  2DT1 A;  2LPV A;  4P8W A;  5JH8 A;  3B8S A;  4ODP A;  4MGV A;  3WL1 A;  4O2T A;  2AWG A;  3AS0 A;  2DPE A;  4ODO A;  1NWS A;  1W1P A;  1W1Y A;  2F4E A;  3ALG A;  3IK8 A;  4ODM A;  3O5F A;  2IF4 A;  1W9V A;  1J4R A;  1FKB A;  4DZ3 A;  2RSE A;  3ODK A;  1NMV A;  1RD6 A;  2OLH A;  1GOI A;  2DG4 A;  2A3B A;  2PPP A;  4LAV A;  3KAB A;  3RME A;  2EUL A;  3ARQ A;  2RUD A;  2VN1 A;  3KCE A;  4TW7 A;  4MNM A;  4DRH A;  1NH6 A;  4C02 B;  1J4I A;  4DWS A;  2O92 A;  2WLZ A;  1HXV A;  4J4N A;  1WNO A;  1EQ3 A;  2OFN A;  1PBK A;  3O5P A;  1FKS A;  2VCD A;  5B8I C;  4DRK A;  3ALF A;  2G8Z A;  4NSB A;  1FKH A;  3ARS A;  5GQB A;  1QPL A;  1HKM A;  2MLY A;  1D7H A;  3ARO A;  3IKD A;  2A3E A;  2XP3 A;  2ZQT A;  5DIT A;  2RQS A;  1FKF A;  4JYS A;  4R0X A;  2XP8 A;  3WIJ A;  1BKF A;  3TCZ A;  3MDY B;  1JCH B;  1YAT A;  2PV3 A;  3RM8 A;  3JYM A;  3O5L A;  3EY6 A;  4DWS C;  1E15 A;  3ART A;  1Y0O A;  1CTN A;  1T11 A;  3ARX A;  1K9T A;  3IKG A;  1OGG A;  1LL6 A;  4ZPV R;  4ODK A;  2FKE A;  2DT2 A;  3O5E A;  1NWT A;  3WKZ A;  4Z2J A;  2MLZ A;  2ETN A;  4JFL A;  1FKL A;  1SR0 A;  3WD3 A;  4IT4 A;  1LG2 A;  3WH0 A;  1E6Z A;  3UQI A;  2DT3 A;  1OGB A;  1HJW A;  5DF0 A;  2A3C A;  2PN0 A;  4Z2I A;  2IUZ A;  3UF8 A;  1E44 A;  3O5J A;  1E6R A;  1ZL1 A;  2MNT A;  3IHZ A;  2YBU A;  4TYO A;  3CGN A;  3WQV A;  3G6L A;  4XAK A;  2KI3 A;  4ZPW R;  4LAY A;  2PBC A;  2Y78 A;  4WJX A;  4DRN A;  4ITZ A;  2P4V A;  3I6C A;  3BXW A;  1JND A;  5BXJ A;  3TDB A;  3O5O A;  4TNS A;  2N87 A;  4IQC A;  2FAP A;  5HWB A;  3O5K A;  2UZ5 A;  5GPR A;  3PR9 A;  4KQZ A;  3KAC A;  4MNK A;  4MNJ A;  4LGX A;  2B31 A;  2ZR4 A;  1PIN A;  3CHC A;  3VAW A;  1X6L A;  4DWS B;  1FKG A;  1LL4 A;  2KGJ A;  4GGQ A;  3KAD A;  4TX0 A;  1JNT A;  1Q1C A;  4W9P A;  1E6P A;  2F21 A;  1NSG A;  3RM4 A;  4DRO A;  2Q5A A;  1HKJ A;  4WK9 A;  4IPX A;  5HW7 A;  2PV2 A;  1ZK6 A;  3CZ8 A;  1LQ0 A;  4LAW A;  2ITK A;  1EYM A;  3OOB A;  1ZBK A;  4HAR A;  2M2A A;  3GTY X;  3UQA A;  4URI A;  1GRJ A;  2DG3 A;  1LG1 A;  4DT4 A;  4PTM A;  1JNS A;  5HBF A;  1D6O A;  4ODL A;  1TFV A;  1H0I A;  1W1V A;  1XRV A;  2LGO A;  2DT0 A;  5HWC A;  1Q6I A;  4G2P A;  3BMB A;  2DSZ A;  3KZ7 A;  4Z2H A;  3O5D A;  1D2K A;  4ODQ A;  4WIW A;  1HJV A;  2YBT A;  4MNL A;  3GU0 A;  3RGC A;  4QT2 A;  1L1P A;  4WKH A;  3H9R B;  3ARR A;  4WKF A;  4QZV B;  3UQB A;  1HJX A;  3PA7 A;  5HKG A;  3JXV A;  4Q22 A;  4TW8 A;  4JFI A;  1FKT A;  4HBE A;  1B6C A;  3B9A A;  5DEZ A;  3UI4 A;  1X6N A;  1GUV A;  3G6M A;  4DRI A;  5HW6 A;  2WK2 A;  4ZPT R;  3UI6 A;  3ARV A;  2XP6 A;  3CHE A;  4MTV A;  1EDQ A;  2ZQV A;  3FXY A;  1F8A B;  2RUR A;  1H0G A;  3ARZ A;  3QOK A; 
#chains in the Genus database with same CATH homology
 2ESC A;  4U84 A;  4JFK A;  3WD1 A;  1UR9 A;  3B9D A;  4DRM A;  1TCO C;  2KE0 A;  2KO7 A;  4P8V A;  2FDM A;  2LJ4 A;  1W9P A;  1WAW A;  4DRP A;  1JNE A;  1KFW A;  3B9E A;  4BF8 A;  2DSU A;  5DIU A;  5HTG A;  1JVW A;  1E9L A;  2MPH A;  3KAG A;  3OA5 A;  4JFJ A;  1W9U A;  3NI6 A;  3KAF A;  1E6N A;  2PPN A;  1J6Y A;  3WD0 A;  1FKJ A;  2O9O A;  4FN2 A;  1M5Y A;  1GPF A;  4ODN A;  2DSW A;  4L3N A;  2WLY A;  2MLX A;  1ZBW A;  4TW6 A;  4DH0 A;  4QT3 A;  1EIB A;  5J6E A;  3CHD A;  1QZ2 A;  1ZBC A;  3KAH A;  3AQU A;  4ML4 A;  3O5G A;  4Z2G A;  4P8X A;  3PRB A;  3RFW A;  1KT1 A;  4DZ2 A;  4L72 B;  4DWS D;  1ZBV A;  1FKR A;  4GIV A;  2XP5 A;  4R5E A;  2XP7 A;  3NRK A;  1R9H A;  4J4O A;  4QIB A;  1FKI A;  1C9H A;  3CGM A;  1WB0 A;  3CH9 A;  3PRA A;  4N19 A;  4JFM A;  1FD9 A;  5DIV A;  1W1T A;  3KAI A;  2A3A A;  4NZC A;  1D7J A;  3JYJ A;  3WD2 A;  3O5R A;  1HKI A;  1SYT A;  2M1I A;  1ZU8 A;  2ZR5 A;  1IX5 A;  1D7I A;  4WKA A;  3LUO A;  3UI5 A;  1OWQ A;  4S3K A;  1VF8 A;  2LKN A;  1O6I A;  2ZR6 A;  3FY1 A;  3ARU A;  2D9F A;  4W5U A;  5HT1 A;  3AS1 A;  2M08 A;  4IT6 A;  4FAP A;  2G41 A;  5DO2 A;  5HW8 A;  4IQ2 A;  4S3J A;  1W26 A;  2DSV A;  2PI6 A;  3WL0 A;  4W9Q A;  3ARW A;  3AS3 A;  3O5I A;  2KFW A;  1FFR A;  1FFQ A;  3O5Q A;  5I98 A;  1FAP A;  2XPA A;  4ZS6 A;  3GPK A;  1U79 A;  4KR0 B;  1Q6H A;  4Z2L A;  2PPO A;  1LL7 A;  1ROT A;  1N1A A;  2WM0 A;  3B7X A;  3W4R A;  1FJD A;  4P8U A;  2PV1 A;  2AOS A;  2MF9 A;  2RUQ A;  2F2D A;  2DG9 A;  4AY1 A;  2JZV A;  4DRJ A;  4G50 A;  4LAX A;  1Q6U A;  2ZQU A;  1A7X A;  1J4H A;  5D75 A;  3AS2 A;  1ZCN A;  1LJY A;  4ODR A;  1BL4 A;  4NNR A;  3TC5 A;  4MAV A;  2QF8 A;  3RM9 A;  4U86 A;  5HUA A;  1FKD A;  3O5M A;  3WD4 A;  3CHF A;  3PRD A;  4DIP A;  1EHN A;  4MPK A;  4U85 A;  2RUC A;  1P5Q A;  1NMW A;  4HBO A;  5GPG A;  1F40 A;  1ITX A;  2L2S A;  3NTP A;  4DRQ A;  1YW5 A;  4MSP A;  1QPF A;  1HKK A;  2XP4 A;  2ZQS A;  4Q7N A;  2K8I A;  1XHG A;  1UR8 A;  1NWU A;  3ARY A;  2XP9 A;  4W9O A;  3WQW A;  1KT0 A;  4Z2K A;  1NWR A;  2XPB A;  1ZB5 A;  3FAP A;  1ROU A;  2KR7 A;  1FKK A;  3ARP A;  2DT1 A;  2LPV A;  4P8W A;  5JH8 A;  3B8S A;  4ODP A;  4MGV A;  3WL1 A;  4O2T A;  2AWG A;  3AS0 A;  2DPE A;  4ODO A;  1NWS A;  1W1P A;  1W1Y A;  2F4E A;  3ALG A;  3IK8 A;  4ODM A;  3O5F A;  2IF4 A;  1W9V A;  1J4R A;  1FKB A;  4DZ3 A;  2RSE A;  3ODK A;  1NMV A;  1RD6 A;  2OLH A;  1GOI A;  2DG4 A;  2A3B A;  2PPP A;  4LAV A;  3KAB A;  3RME A;  3ARQ A;  2RUD A;  2VN1 A;  3KCE A;  4TW7 A;  4MNM A;  4DRH A;  1NH6 A;  4C02 B;  1J4I A;  4DWS A;  2O92 A;  2WLZ A;  1HXV A;  4J4N A;  1WNO A;  1EQ3 A;  2OFN A;  1PBK A;  3O5P A;  1FKS A;  2VCD A;  5B8I C;  4DRK A;  3ALF A;  2G8Z A;  4NSB A;  1FKH A;  3ARS A;  5GQB A;  1QPL A;  1HKM A;  2MLY A;  1D7H A;  3ARO A;  3IKD A;  2A3E A;  2XP3 A;  2ZQT A;  5DIT A;  2RQS A;  1FKF A;  4JYS A;  4R0X A;  2XP8 A;  3WIJ A;  1BKF A;  3TCZ A;  3MDY B;  1YAT A;  2PV3 A;  3RM8 A;  3JYM A;  3O5L A;  3EY6 A;  4DWS C;  1E15 A;  3ART A;  1Y0O A;  1CTN A;  1T11 A;  3ARX A;  1K9T A;  3IKG A;  1OGG A;  1LL6 A;  4ZPV R;  4ODK A;  2FKE A;  2DT2 A;  3O5E A;  1NWT A;  3WKZ A;  4Z2J A;  2MLZ A;  4JFL A;  1FKL A;  1SR0 A;  3WD3 A;  4IT4 A;  1LG2 A;  3WH0 A;  1E6Z A;  3UQI A;  2DT3 A;  1OGB A;  1HJW A;  5DF0 A;  2A3C A;  4Z2I A;  2IUZ A;  3UF8 A;  3O5J A;  1E6R A;  1ZL1 A;  2MNT A;  3IHZ A;  2YBU A;  4TYO A;  3CGN A;  3WQV A;  3G6L A;  4XAK A;  2KI3 A;  4ZPW R;  4LAY A;  2PBC A;  2Y78 A;  4WJX A;  4DRN A;  4ITZ A;  3I6C A;  3BXW A;  1JND A;  5BXJ A;  3TDB A;  3O5O A;  4TNS A;  2N87 A;  4IQC A;  2FAP A;  5HWB A;  3O5K A;  2UZ5 A;  5GPR A;  3PR9 A;  4KQZ A;  3KAC A;  4MNK A;  4MNJ A;  4LGX A;  2B31 A;  2ZR4 A;  1PIN A;  3CHC A;  3VAW A;  1X6L A;  4DWS B;  1FKG A;  1LL4 A;  2KGJ A;  4GGQ A;  3KAD A;  4TX0 A;  1JNT A;  1Q1C A;  4W9P A;  1E6P A;  2F21 A;  1NSG A;  3RM4 A;  4DRO A;  2Q5A A;  1HKJ A;  4WK9 A;  4IPX A;  5HW7 A;  2PV2 A;  1ZK6 A;  3CZ8 A;  1LQ0 A;  4LAW A;  2ITK A;  1EYM A;  3OOB A;  1ZBK A;  4HAR A;  2M2A A;  3UQA A;  4URI A;  2DG3 A;  1LG1 A;  4DT4 A;  4PTM A;  1JNS A;  5HBF A;  1D6O A;  4ODL A;  1TFV A;  1H0I A;  1W1V A;  1XRV A;  2LGO A;  2DT0 A;  5HWC A;  1Q6I A;  4G2P A;  2DSZ A;  3KZ7 A;  4Z2H A;  3O5D A;  1D2K A;  4ODQ A;  4WIW A;  1HJV A;  2YBT A;  4MNL A;  3RGC A;  4QT2 A;  1L1P A;  4WKH A;  3H9R B;  3ARR A;  4WKF A;  4QZV B;  3UQB A;  1HJX A;  3PA7 A;  5HKG A;  3JXV A;  4Q22 A;  4TW8 A;  4JFI A;  1FKT A;  4HBE A;  1B6C A;  3B9A A;  5DEZ A;  3UI4 A;  1X6N A;  1GUV A;  3G6M A;  4DRI A;  5HW6 A;  2WK2 A;  4ZPT R;  3UI6 A;  3ARV A;  2XP6 A;  3CHE A;  4MTV A;  1EDQ A;  2ZQV A;  3FXY A;  1F8A B;  2RUR A;  1H0G A;  3ARZ A;  3QOK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...