5HW6A

Candida albicans fkbp12 apo protein in c2 space group
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
120
structure length
120
Chain Sequence
EELPQIEIVQEGDNTTFAKPGDTVTIHYDGKLTNGKEFDSSRKRGKPFTCTVGVGQVIKGWDISLTNNYGKGGANLPKISKGTKAILTIPPNLAYGPRGIPPIIGPNETLVFEVELLGVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida albicans (strain sc5314 / atcc mya-2876)
molecule tags Isomerase
molecule keywords FK506-binding protein 1
total genus 25
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5hw6A00
1NMVA 3RFWA 5I98A 3KAFA 2ZQSA 3O5LA 4LAXA 3KADA 1FJDA 1BL4A 1QZ2A 1TCOC 4J4OA 1J4HA 2ZR4A 4ODRA 2ZQTA 4DRPA 4W9PA 3PA7A 2KGJA 1FKLA 2PBCA 2XP3A 4JFIA 1FKIA 2M08A 5HW7A 5BXJA 3ODKA 2XPAA 3O5PA 4QIBA 5HTGA 1ROTA 2F2DA 2FAPA 2IF4A 3O5MA 5HT1A 4R0XA 4DH0A 3UI4A 1Q6UA 2KE0A 3UQIA 2AWGA 2XP9A 2Y78A 3VAWA 2ZQUA 3JYMA 4FN2A 4NNRA 1ROUA 1Q1CA 3UQBA 3GPKA 3KAHA 1FKSA 2MLZA 3NRKA 4TW7A 2LPVA 4G2PA 2F4EA 4DT4A 2UZ5A 1JVWA 2RQSA 1BKFA 1J4IA 4TW8A 2RURA 3O5EA 4MSPA 1FKFA 4TNSA 3FAPA 3TDBA 4ODKA 3TC5A 4DZ2A 5HKGA 3NTPA 4JYSA 1EQ3A 2K8IA 2KFWA 3RGCA 4N19A 5DIVA 2RSEA 2MLXA 2D9FA 1FKGA 4TYOA 4DZ3A 2RUDA 3JXVA 3O5FA 3PRBA 4DIPA 2FKEA 4BF8A 4IQCA 2MF9A 3PRDA 3IK8A 1D6OA 2MNTA 1L1PA 4ODOA 2PPPA 2RUCA 2PV2A 1NMWA 2JZVA 5HW6A 3B7XA 5DITA 2M1IA 3H9RB 1ZK6A 3KABA 3CGNA 5GPGA 5HW8A 3JYJA 4W9OA 2VN1A 4DRKA 4DRQA 5J6EA 2L2SA 1ZCNA 1U79A 1FKRA 3IKDA 2LKNA 4ODQA 3IHZA 2RUQA 4DROA 1Q6IA 5HWCA 1Y0OA 4FAPA 4LAWA 2XP5A 5B8IC 4DRIA 1A7XA 2PV1A 4C02B 1EYMA 4JFKA 1FKJA 1FKDA 4IQ2A 4ODLA 1PINA 3UI5A 4LAVA 4ODNA 2ITKA 1D7JA 5HWBA 2XP4A 4G50A 3O5QA 1M5YA 4JFLA 2PV3A 3LUOA 4ITZA 3WH0A 2DG3A 3I6CA 3TCZA 2MLYA 3O5OA 3UQAA 4J4NA 4W9QA 1F8AB 3O5JA 4DRHA 1NSGA 2LGOA 4U86A 4DRNA 1JNSA 1FKBA 3O5KA 3KZ7A 1Q6HA 1FD9A 5D75A 1N1AA 2OFNA 2Q5AA 3O5DA 3OOBA 1FAPA 4U84A 2DG4A 3IKGA 3O5RA 4U85A 1T11A 1FKHA 2KO7A 2VCDA 3UF8A 3NI6A 1P5QA 1F40A 1FKKA 1YW5A 4ODPA 1YATA 3O5GA 1R9HA 2ZR5A 1PBKA 4JFMA 1KT1A 2PPNA 4TX0A 4DRMA 4MGVA 1D7IA 1KT0A 2XP8A 3CGMA 1JNTA 3KAIA 2F21A 1C9HA 2XPBA 3KAGA 4GIVA 4JFJA 5HUAA 1HXVA 2XP6A 1FKTA 2ZQVA 3O5IA 4IPXA 1D7HA 4LAYA 4DRJA 2MPHA 4QT2A 4TW6A 2PPOA 3KACA 3MDYB 4GGQA 3KCEA 4O2TA 1B6CA 1QPLA 3UI6A 1J6YA 2LJ4A 2KI3A 2XP7A 2KR7A 4ODMA 1J4RA 2N87A 2ZR6A 1QPFA 5DIUA 4QT3A 3EY6A 1W26A 2M2AA 2DG9A
chains in the Genus database with same CATH superfamily
5I98A 3KAFA 4LAXA 3O5LA 3KADA 3ARZA 1BL4A 1LL4A 1FJDA 3AS1A 4J4OA 1J4HA 2A3CA 3W4RA 3AQUA 3PA7A 4W9PA 2KGJA 4NSBA 1FKIA 4ZPTR 2DSZA 4P8VA 1ZB5A 4DH0A 3WD3A 2KE0A 1HJWA 2Y78A 2P4VA 4WIWA 3AS0A 1ROUA 3WL0A 3UQBA 4PTMA 4TW8A 1LQ0A 4Z2GA 3TDBA 1E9LA 1E6RA 1EQ3A 3RGCA 1X6LA 4N19A 5DIVA 1E6NA 1FKGA 3JXVA 3O5FA 4DIPA 3CHEA 1EHNA 2MNTA 1HJVA 2PPPA 4DWSD 2JZVA 3H9RB 3B9DA 5GPGA 5J6EA 1EDQA 3IHZA 2RUQA 4DROA 1OGGA 3WD1A 2WLYA 4LAWA 5B8IC 1NWRA 4C02B 1FKJA 1PINA 4LAVA 3ARTA 2A3BA 2XP4A 4AY1A 2PV3A 3LUOA 3TCZA 3G6LA 4DRHA 1RD6A 2DT3A 3O5KA 1FD9A 1N1AA 2OFNA 1NWUA 3O5DA 3RMEA 3WD2A 3OA5A 4Z2JA 2WK2A 2DG4A 1W1TA 4U85A 3G6MA 3ALGA 5JH8A 1E44A 1GRJA 3ARPA 2O92A 1R9HA 2ZR5A 1PBKA 4TX0A 1D7IA 2XP8A 3KAIA 3BXWA 4HBEA 4JFJA 2XP6A 1FKTA 4WJXA 4DRJA 2A3AA 4O2TA 1QPLA 2LJ4A 2DSUA 2DT1A 1J4RA 2N87A 2M2AA 2DG9A 2ZQSA 1HKJA 1TCOC 2ZQTA 1FKLA 2XP3A 3PR9A 4UDMA 4ML4A 4IT4A 4P8WA 3O5PA 1ROTA 2F2DA 3O5MA 5HT1A 3UI4A 2XP9A 3VAWA 2ZQUA 4FN2A 4WKAA 4NNRA 3ALFA 1LL7A 3GPKA 2A3EA 3NRKA 4TW7A 3WIJA 2F4EA 3FAPA 4WK9A 1E15A 3NTPA 2K8IA 2RSEA 2B31A 4TYOA 2FKEA 4IQCA 5DO2A 4ODOA 3ARWA 3RM8A 5DITA 3GU0A 1HKKA 1ZK6A 4MAVA 3CGNA 3JYJA 2VN1A 4DRQA 3BMBA 2LKNA 4FAPA 1A7XA 1EYMA 4JFKA 1FKDA 5DEZA 1W9PA 4L72B 5GPRA 2DSVA 4G50A 1M5YA 4JFLA 4P8UA 2MLYA 4S3JA 1WNOA 3UQAA 4P8XA 2LGOA 4U86A 1LG2A 4DRNA 1FKBA 4U84A 3QOKA 3NI6A 1F40A 1GUVA 2PPNA 3ARYA 4MNMA 4ZS6A 1KT0A 4QT2A 2F21A 1C9HA 2XPBA 3KAGA 5HUAA 3RM9A 2DSWA 1E6ZA 5HBFA 4Z2LA 2PPOA 3MDYB 1ITXA 1HJXA 2XP7A 4ODMA 1JNEA 2AOSA 5DIUA 3CH9A 1EIBA 1XHGA 3EY6A 1H0IA 4G2PA 1NMVA 1ZBVA 1O6IA 2ZR4A 4DRPA 4WKFA 1FFQA 2M08A 3CHDA 5HW7A 4MTVA 2XPAA 3CZ8A 4QIBA 5HTGA 2FAPA 4Q22A 4NZCA 3WKZA 3UQIA 3B9AA 3JYMA 2IUZA 2F23A 1FKSA 2YBUA 3CHCA 4R5EA 4DT4A 2UZ5A 1JVWA 2RQSA 1J4IA 2RURA 3O5EA 4TNSA 2G41A 1LJYA 3GTYX 3TC5A 1FFRA 1NWTA 5HKGA 1GPFA 2D9FA 3ARUA 4S3KA 4DZ3A 3PRBA 4BF8A 3PRDA 1CTNA 1D6OA 1L1PA 2RUCA 2PV2A 1ZL1A 1NMWA 4LGXA 5HW8A 1UR8A 3ARQA 1U79A 1Y0OA 2PV1A 4ODLA 1VF8A 4ODNA 1D7JA 3WL1A 1HKIA 2QF8A 1ZBCA 2DG3A 1NWSA 1OWQA 4J4NA 1F8AB 2ETNA 4ZPVR 3KZ7A 1Q6HA 3WD4A 5D75A 5DF0A 3ARXA 3IKGA 3O5RA 1ZBKA 1JNDA 1FKHA 1T11A 2KO7A 2VCDA 1LL6A 1P5QA 1FKKA 4ODPA 4JFMA 1KT1A 3FXYA 4MGVA 3CGMA 2WLZA 2YBTA 3ARVA 1HXVA 2ZQVA 1IX5A 4IPXA 1D7HA 1W1YA 4URIA 1KFWA 4TW6A 3KACA 4GGQA 3UI6A 1B6CA 3AROA 2KI3A 2ESCA 2ZR6A 1SR0A 4QT3A 1XRVA 1SYTA 3RFWA 1WB0A 2OLHA 3ARRA 4DWSC 3WQVA 1QZ2A 4Q7NA 1TFVA 4ODRA 3EIPA 2PBCA 2DPEA 4JFIA 4KQZA 5BXJA 3ODKA 2IF4A 4Z2KA 4R0XA 3AS3A 1Q6UA 2AWGA 4HARA 2O9OA 2EULA 4W5UA 1H0GA 1Q1CA 3KAHA 2MLZA 2LPVA 3B9EA 4DWSB 1BKFA 3AS2A 4MSPA 1FKFA 4DZ2A 4ODKA 2DT2A 4JYSA 3WD0A 2KFWA 4Z2IA 1X6NA 1E6PA 2MLXA 1D2KA 2RUDA 1W9UA 4L3NA 1HKMA 2MF9A 3IK8A 1K9TA 4XAKA 5HW6A 3B7XA 2M1IA 2WM0A 3KABA 4W9OA 2PI6A 4DRKA 2PN0A 2L2SA 1ZCNA 1FKRA 3IKDA 4ODQA 1ZBWA 1ZU8A 1Q6IA 5HWCA 2XP5A 4WKHA 4DRIA 1W9VA 3UI5A 4IQ2A 2ITKA 5HWBA 1LG1A 3FY1A 3O5QA 4KR0B 4MNKA 1OGBA 4QZVB 4ITZA 3WH0A 3I6CA 1GOIA 1W1PA 3O5OA 4W9QA 3O5JA 1NSGA 1JNSA 2Q5AA 5GQBA 1UR9A 3OOBA 1FAPA 4HBOA 4ZPWR 4Z2HA 3UF8A 3RM4A 1YW5A 1YATA 2B5UB 3O5GA 3B8SA 1NH6A 2FDMA 4DRMA 1W1VA 1JNTA 4DWSA 4GIVA 4IT6A 3PRAA 3O5IA 4LAYA 4MNLA 1WAWA 2MPHA 1JCHB 1J6YA 3ARSA 3KCEA 4MNJA 2DT0A 2KR7A 4MPKA 1QPFA 2G8ZA 3CHFA 3WQWA 1W26A
chains in the Genus database with same CATH topology
5I98A 3KAFA 4LAXA 3O5LA 3KADA 3ARZA 1BL4A 1LL4A 1FJDA 3AS1A 4J4OA 1J4HA 2A3CA 3W4RA 3AQUA 3PA7A 4W9PA 2KGJA 4NSBA 1FKIA 4ZPTR 2DSZA 4P8VA 1ZB5A 4DH0A 3WD3A 2KE0A 1HJWA 2Y78A 4WIWA 3AS0A 1ROUA 3WL0A 3UQBA 4PTMA 4TW8A 1LQ0A 4Z2GA 3TDBA 1E9LA 1E6RA 1EQ3A 3RGCA 1X6LA 4N19A 5DIVA 1E6NA 1FKGA 3JXVA 3O5FA 4DIPA 3CHEA 1EHNA 2MNTA 1HJVA 2PPPA 4DWSD 2JZVA 3H9RB 3B9DA 5GPGA 5J6EA 1EDQA 3IHZA 2RUQA 4DROA 1OGGA 3WD1A 2WLYA 4LAWA 5B8IC 1NWRA 4C02B 1FKJA 1PINA 4LAVA 3ARTA 2A3BA 2XP4A 4AY1A 2PV3A 3LUOA 3TCZA 3G6LA 4DRHA 1RD6A 2DT3A 3O5KA 1FD9A 1N1AA 2OFNA 1NWUA 3O5DA 3RMEA 3WD2A 3OA5A 4Z2JA 2WK2A 2DG4A 1W1TA 4U85A 3G6MA 3ALGA 5JH8A 3ARPA 2O92A 1R9HA 2ZR5A 1PBKA 4TX0A 1D7IA 2XP8A 3KAIA 3BXWA 4HBEA 4JFJA 2XP6A 1FKTA 4WJXA 4DRJA 2A3AA 4O2TA 1QPLA 2LJ4A 2DSUA 2DT1A 1J4RA 2N87A 2M2AA 2DG9A 2ZQSA 1HKJA 1TCOC 2ZQTA 1FKLA 2XP3A 3PR9A 4ML4A 4IT4A 4P8WA 3O5PA 1ROTA 2F2DA 3O5MA 5HT1A 3UI4A 2XP9A 3VAWA 2ZQUA 4FN2A 4WKAA 4NNRA 3ALFA 1LL7A 3GPKA 2A3EA 3NRKA 4TW7A 3WIJA 2F4EA 3FAPA 4WK9A 1E15A 3NTPA 2K8IA 2RSEA 2B31A 4TYOA 2FKEA 4IQCA 5DO2A 4ODOA 3ARWA 3RM8A 5DITA 1HKKA 1ZK6A 4MAVA 3CGNA 3JYJA 2VN1A 4DRQA 2LKNA 4FAPA 1A7XA 1EYMA 4JFKA 1FKDA 5DEZA 1W9PA 4L72B 5GPRA 2DSVA 4G50A 1M5YA 4JFLA 4P8UA 2MLYA 4S3JA 1WNOA 3UQAA 4P8XA 2LGOA 4U86A 1LG2A 4DRNA 1FKBA 4U84A 3QOKA 3NI6A 1F40A 1GUVA 2PPNA 3ARYA 4MNMA 4ZS6A 1KT0A 4QT2A 2F21A 1C9HA 2XPBA 3KAGA 5HUAA 3RM9A 2DSWA 1E6ZA 5HBFA 4Z2LA 2PPOA 3MDYB 1ITXA 1HJXA 2XP7A 4ODMA 1JNEA 2AOSA 5DIUA 3CH9A 1EIBA 1XHGA 3EY6A 1H0IA 4G2PA 1NMVA 1ZBVA 1O6IA 2ZR4A 4DRPA 4WKFA 1FFQA 2M08A 3CHDA 5HW7A 4MTVA 2XPAA 3CZ8A 4QIBA 5HTGA 2FAPA 4Q22A 4NZCA 3WKZA 3UQIA 3B9AA 3JYMA 2IUZA 1FKSA 2YBUA 3CHCA 4R5EA 4DT4A 2UZ5A 1JVWA 2RQSA 1J4IA 2RURA 3O5EA 4TNSA 2G41A 1LJYA 3TC5A 5HKGA 1FFRA 1NWTA 1GPFA 2D9FA 3ARUA 4S3KA 4DZ3A 3PRBA 4BF8A 3PRDA 1CTNA 1D6OA 1L1PA 2RUCA 2PV2A 1ZL1A 1NMWA 4LGXA 5HW8A 1UR8A 3ARQA 1U79A 1Y0OA 2PV1A 4ODLA 1VF8A 4ODNA 1D7JA 3WL1A 1HKIA 2QF8A 1ZBCA 2DG3A 1NWSA 1OWQA 4J4NA 1F8AB 4ZPVR 3KZ7A 1Q6HA 3WD4A 5D75A 5DF0A 3ARXA 3IKGA 3O5RA 1ZBKA 1JNDA 1FKHA 1T11A 2KO7A 2VCDA 1LL6A 1P5QA 1FKKA 4ODPA 4JFMA 1KT1A 3FXYA 4MGVA 3CGMA 2WLZA 2YBTA 3ARVA 1HXVA 2ZQVA 1IX5A 4IPXA 1D7HA 1W1YA 4URIA 1KFWA 4TW6A 3KACA 4GGQA 3UI6A 1B6CA 3AROA 2KI3A 2ESCA 2ZR6A 1SR0A 4QT3A 1XRVA 1SYTA 3RFWA 1WB0A 2OLHA 3ARRA 4DWSC 3WQVA 1QZ2A 4Q7NA 1TFVA 4ODRA 2PBCA 2DPEA 4JFIA 4KQZA 5BXJA 3ODKA 2IF4A 4Z2KA 4R0XA 3AS3A 1Q6UA 2AWGA 4HARA 2O9OA 4W5UA 1H0GA 1Q1CA 3KAHA 2MLZA 2LPVA 3B9EA 4DWSB 1BKFA 3AS2A 4MSPA 1FKFA 4DZ2A 4ODKA 2DT2A 4JYSA 3WD0A 2KFWA 4Z2IA 1X6NA 1E6PA 2MLXA 1D2KA 2RUDA 1W9UA 4L3NA 1HKMA 2MF9A 3IK8A 1K9TA 4XAKA 5HW6A 3B7XA 2M1IA 2WM0A 3KABA 4W9OA 2PI6A 4DRKA 2L2SA 1ZCNA 1FKRA 3IKDA 4ODQA 1ZBWA 1ZU8A 1Q6IA 5HWCA 2XP5A 4WKHA 4DRIA 1W9VA 3UI5A 4IQ2A 2ITKA 5HWBA 1LG1A 3FY1A 3O5QA 4KR0B 4MNKA 1OGBA 4QZVB 4ITZA 3WH0A 3I6CA 1GOIA 1W1PA 3O5OA 4W9QA 3O5JA 1NSGA 1JNSA 2Q5AA 5GQBA 1UR9A 3OOBA 1FAPA 4HBOA 4ZPWR 4Z2HA 3UF8A 3RM4A 1YW5A 1YATA 3O5GA 3B8SA 1NH6A 2FDMA 4DRMA 1W1VA 1JNTA 4DWSA 4GIVA 4IT6A 3PRAA 3O5IA 4LAYA 4MNLA 1WAWA 2MPHA 1J6YA 3ARSA 3KCEA 4MNJA 2DT0A 2KR7A 4MPKA 1QPFA 2G8ZA 3CHFA 3WQWA 1W26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NMV A;  3RFW A;  5I98 A;  3KAF A;  2ZQS A;  3O5L A;  4LAX A;  3KAD A;  1FJD A;  1BL4 A;  1QZ2 A;  1TCO C;  4J4O A;  1J4H A;  2ZR4 A;  4ODR A;  2ZQT A;  4DRP A;  4W9P A;  3PA7 A;  2KGJ A;  1FKL A;  2PBC A;  2XP3 A;  4JFI A;  1FKI A;  2M08 A;  5HW7 A;  5BXJ A;  3ODK A;  2XPA A;  3O5P A;  4QIB A;  5HTG A;  1ROT A;  2F2D A;  2FAP A;  2IF4 A;  3O5M A;  5HT1 A;  4R0X A;  4DH0 A;  3UI4 A;  1Q6U A;  2KE0 A;  3UQI A;  2AWG A;  2XP9 A;  2Y78 A;  3VAW A;  2ZQU A;  3JYM A;  4FN2 A;  4NNR A;  1ROU A;  1Q1C A;  3UQB A;  3GPK A;  3KAH A;  1FKS A;  2MLZ A;  3NRK A;  4TW7 A;  2LPV A;  4G2P A;  2F4E A;  4DT4 A;  2UZ5 A;  1JVW A;  2RQS A;  1BKF A;  1J4I A;  4TW8 A;  2RUR A;  3O5E A;  4MSP A;  1FKF A;  4TNS A;  3FAP A;  3TDB A;  4ODK A;  3TC5 A;  4DZ2 A;  5HKG A;  3NTP A;  4JYS A;  1EQ3 A;  2K8I A;  2KFW A;  3RGC A;  4N19 A;  5DIV A;  2RSE A;  2MLX A;  2D9F A;  1FKG A;  4TYO A;  4DZ3 A;  2RUD A;  3JXV A;  3O5F A;  3PRB A;  4DIP A;  2FKE A;  4BF8 A;  4IQC A;  2MF9 A;  3PRD A;  3IK8 A;  1D6O A;  2MNT A;  1L1P A;  4ODO A;  2PPP A;  2RUC A;  2PV2 A;  1NMW A;  2JZV A;  5HW6 A;  3B7X A;  5DIT A;  2M1I A;  3H9R B;  1ZK6 A;  3KAB A;  3CGN A;  5GPG A;  5HW8 A;  3JYJ A;  4W9O A;  2VN1 A;  4DRK A;  4DRQ A;  5J6E A;  2L2S A;  1ZCN A;  1U79 A;  1FKR A;  3IKD A;  2LKN A;  4ODQ A;  3IHZ A;  2RUQ A;  4DRO A;  1Q6I A;  5HWC A;  1Y0O A;  4FAP A;  4LAW A;  2XP5 A;  5B8I C;  4DRI A;  1A7X A;  2PV1 A;  4C02 B;  1EYM A;  4JFK A;  1FKJ A;  1FKD A;  4IQ2 A;  4ODL A;  1PIN A;  3UI5 A;  4LAV A;  4ODN A;  2ITK A;  1D7J A;  5HWB A;  2XP4 A;  4G50 A;  3O5Q A;  1M5Y A;  4JFL A;  2PV3 A;  3LUO A;  4ITZ A;  3WH0 A;  2DG3 A;  3I6C A;  3TCZ A;  2MLY A;  3O5O A;  3UQA A;  4J4N A;  4W9Q A;  1F8A B;  3O5J A;  4DRH A;  1NSG A;  2LGO A;  4U86 A;  4DRN A;  1JNS A;  1FKB A;  3O5K A;  3KZ7 A;  1Q6H A;  1FD9 A;  5D75 A;  1N1A A;  2OFN A;  2Q5A A;  3O5D A;  3OOB A;  1FAP A;  4U84 A;  2DG4 A;  3IKG A;  3O5R A;  4U85 A;  1T11 A;  1FKH A;  2KO7 A;  2VCD A;  3UF8 A;  3NI6 A;  1P5Q A;  1F40 A;  1FKK A;  1YW5 A;  4ODP A;  1YAT A;  3O5G A;  1R9H A;  2ZR5 A;  1PBK A;  4JFM A;  1KT1 A;  2PPN A;  4TX0 A;  4DRM A;  4MGV A;  1D7I A;  1KT0 A;  2XP8 A;  3CGM A;  1JNT A;  3KAI A;  2F21 A;  1C9H A;  2XPB A;  3KAG A;  4GIV A;  4JFJ A;  5HUA A;  1HXV A;  2XP6 A;  1FKT A;  2ZQV A;  3O5I A;  4IPX A;  1D7H A;  4LAY A;  4DRJ A;  2MPH A;  4QT2 A;  4TW6 A;  2PPO A;  3KAC A;  3MDY B;  4GGQ A;  3KCE A;  4O2T A;  1B6C A;  1QPL A;  3UI6 A;  1J6Y A;  2LJ4 A;  2KI3 A;  2XP7 A;  2KR7 A;  4ODM A;  1J4R A;  2N87 A;  2ZR6 A;  1QPF A;  5DIU A;  4QT3 A;  3EY6 A;  1W26 A;  2M2A A;  2DG9 A; 
#chains in the Genus database with same CATH topology
 5I98 A;  3KAF A;  4LAX A;  3O5L A;  3KAD A;  3ARZ A;  1BL4 A;  1LL4 A;  1FJD A;  3AS1 A;  4J4O A;  1J4H A;  2A3C A;  3W4R A;  3AQU A;  3PA7 A;  4W9P A;  2KGJ A;  4NSB A;  1FKI A;  4ZPT R;  2DSZ A;  4P8V A;  1ZB5 A;  4DH0 A;  3WD3 A;  2KE0 A;  1HJW A;  2Y78 A;  2P4V A;  4WIW A;  3AS0 A;  1ROU A;  3WL0 A;  3UQB A;  4PTM A;  4TW8 A;  1LQ0 A;  4Z2G A;  3TDB A;  1E9L A;  1E6R A;  1EQ3 A;  3RGC A;  1X6L A;  4N19 A;  5DIV A;  1E6N A;  1FKG A;  3JXV A;  3O5F A;  4DIP A;  3CHE A;  1EHN A;  2MNT A;  1HJV A;  2PPP A;  4DWS D;  2JZV A;  3H9R B;  3B9D A;  5GPG A;  5J6E A;  1EDQ A;  3IHZ A;  2RUQ A;  4DRO A;  1OGG A;  3WD1 A;  2WLY A;  4LAW A;  5B8I C;  1NWR A;  4C02 B;  1FKJ A;  1PIN A;  4LAV A;  3ART A;  2A3B A;  2XP4 A;  4AY1 A;  2PV3 A;  3LUO A;  3TCZ A;  3G6L A;  4DRH A;  1RD6 A;  2DT3 A;  3O5K A;  1FD9 A;  1N1A A;  2OFN A;  1NWU A;  3O5D A;  3RME A;  3WD2 A;  3OA5 A;  4Z2J A;  2WK2 A;  2DG4 A;  1W1T A;  4U85 A;  3G6M A;  3ALG A;  5JH8 A;  1E44 A;  1GRJ A;  3ARP A;  2O92 A;  1R9H A;  2ZR5 A;  1PBK A;  4TX0 A;  1D7I A;  2XP8 A;  3KAI A;  3BXW A;  4HBE A;  4JFJ A;  2XP6 A;  1FKT A;  4WJX A;  4DRJ A;  2A3A A;  4O2T A;  1QPL A;  2LJ4 A;  2DSU A;  2DT1 A;  1J4R A;  2N87 A;  2M2A A;  2DG9 A;  2ZQS A;  1HKJ A;  1TCO C;  2ZQT A;  1FKL A;  2XP3 A;  3PR9 A;  4UDM A;  4ML4 A;  4IT4 A;  4P8W A;  3O5P A;  1ROT A;  2F2D A;  3O5M A;  5HT1 A;  3UI4 A;  2XP9 A;  3VAW A;  2ZQU A;  4FN2 A;  4WKA A;  4NNR A;  3ALF A;  1LL7 A;  3GPK A;  2A3E A;  3NRK A;  4TW7 A;  3WIJ A;  2F4E A;  3FAP A;  4WK9 A;  1E15 A;  3NTP A;  2K8I A;  2RSE A;  2B31 A;  4TYO A;  2FKE A;  4IQC A;  5DO2 A;  4ODO A;  3ARW A;  3RM8 A;  5DIT A;  3GU0 A;  1HKK A;  1ZK6 A;  4MAV A;  3CGN A;  3JYJ A;  2VN1 A;  4DRQ A;  3BMB A;  2LKN A;  4FAP A;  1A7X A;  1EYM A;  4JFK A;  1FKD A;  5DEZ A;  1W9P A;  4L72 B;  5GPR A;  2DSV A;  4G50 A;  1M5Y A;  4JFL A;  4P8U A;  2MLY A;  4S3J A;  1WNO A;  3UQA A;  4P8X A;  2LGO A;  4U86 A;  1LG2 A;  4DRN A;  1FKB A;  4U84 A;  3QOK A;  3NI6 A;  1F40 A;  1GUV A;  2PPN A;  3ARY A;  4MNM A;  4ZS6 A;  1KT0 A;  4QT2 A;  2F21 A;  1C9H A;  2XPB A;  3KAG A;  5HUA A;  3RM9 A;  2DSW A;  1E6Z A;  5HBF A;  4Z2L A;  2PPO A;  3MDY B;  1ITX A;  1HJX A;  2XP7 A;  4ODM A;  1JNE A;  2AOS A;  5DIU A;  3CH9 A;  1EIB A;  1XHG A;  3EY6 A;  1H0I A;  4G2P A;  1NMV A;  1ZBV A;  1O6I A;  2ZR4 A;  4DRP A;  4WKF A;  1FFQ A;  2M08 A;  3CHD A;  5HW7 A;  4MTV A;  2XPA A;  3CZ8 A;  4QIB A;  5HTG A;  2FAP A;  4Q22 A;  4NZC A;  3WKZ A;  3UQI A;  3B9A A;  3JYM A;  2IUZ A;  2F23 A;  1FKS A;  2YBU A;  3CHC A;  4R5E A;  4DT4 A;  2UZ5 A;  1JVW A;  2RQS A;  1J4I A;  2RUR A;  3O5E A;  4TNS A;  2G41 A;  1LJY A;  3GTY X;  3TC5 A;  1FFR A;  1NWT A;  5HKG A;  1GPF A;  2D9F A;  3ARU A;  4S3K A;  4DZ3 A;  3PRB A;  4BF8 A;  3PRD A;  1CTN A;  1D6O A;  1L1P A;  2RUC A;  2PV2 A;  1ZL1 A;  1NMW A;  4LGX A;  5HW8 A;  1UR8 A;  3ARQ A;  1U79 A;  1Y0O A;  2PV1 A;  4ODL A;  1VF8 A;  4ODN A;  1D7J A;  3WL1 A;  1HKI A;  2QF8 A;  1ZBC A;  2DG3 A;  1NWS A;  1OWQ A;  4J4N A;  1F8A B;  2ETN A;  4ZPV R;  3KZ7 A;  1Q6H A;  3WD4 A;  5D75 A;  5DF0 A;  3ARX A;  3IKG A;  3O5R A;  1ZBK A;  1JND A;  1FKH A;  1T11 A;  2KO7 A;  2VCD A;  1LL6 A;  1P5Q A;  1FKK A;  4ODP A;  4JFM A;  1KT1 A;  3FXY A;  4MGV A;  3CGM A;  2WLZ A;  2YBT A;  3ARV A;  1HXV A;  2ZQV A;  1IX5 A;  4IPX A;  1D7H A;  1W1Y A;  4URI A;  1KFW A;  4TW6 A;  3KAC A;  4GGQ A;  3UI6 A;  1B6C A;  3ARO A;  2KI3 A;  2ESC A;  2ZR6 A;  1SR0 A;  4QT3 A;  1XRV A;  1SYT A;  3RFW A;  1WB0 A;  2OLH A;  3ARR A;  4DWS C;  3WQV A;  1QZ2 A;  4Q7N A;  1TFV A;  4ODR A;  3EIP A;  2PBC A;  2DPE A;  4JFI A;  4KQZ A;  5BXJ A;  3ODK A;  2IF4 A;  4Z2K A;  4R0X A;  3AS3 A;  1Q6U A;  2AWG A;  4HAR A;  2O9O A;  2EUL A;  4W5U A;  1H0G A;  1Q1C A;  3KAH A;  2MLZ A;  2LPV A;  3B9E A;  4DWS B;  1BKF A;  3AS2 A;  4MSP A;  1FKF A;  4DZ2 A;  4ODK A;  2DT2 A;  4JYS A;  3WD0 A;  2KFW A;  4Z2I A;  1X6N A;  1E6P A;  2MLX A;  1D2K A;  2RUD A;  1W9U A;  4L3N A;  1HKM A;  2MF9 A;  3IK8 A;  1K9T A;  4XAK A;  5HW6 A;  3B7X A;  2M1I A;  2WM0 A;  3KAB A;  4W9O A;  2PI6 A;  4DRK A;  2PN0 A;  2L2S A;  1ZCN A;  1FKR A;  3IKD A;  4ODQ A;  1ZBW A;  1ZU8 A;  1Q6I A;  5HWC A;  2XP5 A;  4WKH A;  4DRI A;  1W9V A;  3UI5 A;  4IQ2 A;  2ITK A;  5HWB A;  1LG1 A;  3FY1 A;  3O5Q A;  4KR0 B;  4MNK A;  1OGB A;  4QZV B;  4ITZ A;  3WH0 A;  3I6C A;  1GOI A;  1W1P A;  3O5O A;  4W9Q A;  3O5J A;  1NSG A;  1JNS A;  2Q5A A;  5GQB A;  1UR9 A;  3OOB A;  1FAP A;  4HBO A;  4ZPW R;  4Z2H A;  3UF8 A;  3RM4 A;  1YW5 A;  1YAT A;  2B5U B;  3O5G A;  3B8S A;  1NH6 A;  2FDM A;  4DRM A;  1W1V A;  1JNT A;  4DWS A;  4GIV A;  4IT6 A;  3PRA A;  3O5I A;  4LAY A;  4MNL A;  1WAW A;  2MPH A;  1JCH B;  1J6Y A;  3ARS A;  3KCE A;  4MNJ A;  2DT0 A;  2KR7 A;  4MPK A;  1QPF A;  2G8Z A;  3CHF A;  3WQW A;  1W26 A; 
#chains in the Genus database with same CATH homology
 5I98 A;  3KAF A;  4LAX A;  3O5L A;  3KAD A;  3ARZ A;  1BL4 A;  1LL4 A;  1FJD A;  3AS1 A;  4J4O A;  1J4H A;  2A3C A;  3W4R A;  3AQU A;  3PA7 A;  4W9P A;  2KGJ A;  4NSB A;  1FKI A;  4ZPT R;  2DSZ A;  4P8V A;  1ZB5 A;  4DH0 A;  3WD3 A;  2KE0 A;  1HJW A;  2Y78 A;  4WIW A;  3AS0 A;  1ROU A;  3WL0 A;  3UQB A;  4PTM A;  4TW8 A;  1LQ0 A;  4Z2G A;  3TDB A;  1E9L A;  1E6R A;  1EQ3 A;  3RGC A;  1X6L A;  4N19 A;  5DIV A;  1E6N A;  1FKG A;  3JXV A;  3O5F A;  4DIP A;  3CHE A;  1EHN A;  2MNT A;  1HJV A;  2PPP A;  4DWS D;  2JZV A;  3H9R B;  3B9D A;  5GPG A;  5J6E A;  1EDQ A;  3IHZ A;  2RUQ A;  4DRO A;  1OGG A;  3WD1 A;  2WLY A;  4LAW A;  5B8I C;  1NWR A;  4C02 B;  1FKJ A;  1PIN A;  4LAV A;  3ART A;  2A3B A;  2XP4 A;  4AY1 A;  2PV3 A;  3LUO A;  3TCZ A;  3G6L A;  4DRH A;  1RD6 A;  2DT3 A;  3O5K A;  1FD9 A;  1N1A A;  2OFN A;  1NWU A;  3O5D A;  3RME A;  3WD2 A;  3OA5 A;  4Z2J A;  2WK2 A;  2DG4 A;  1W1T A;  4U85 A;  3G6M A;  3ALG A;  5JH8 A;  3ARP A;  2O92 A;  1R9H A;  2ZR5 A;  1PBK A;  4TX0 A;  1D7I A;  2XP8 A;  3KAI A;  3BXW A;  4HBE A;  4JFJ A;  2XP6 A;  1FKT A;  4WJX A;  4DRJ A;  2A3A A;  4O2T A;  1QPL A;  2LJ4 A;  2DSU A;  2DT1 A;  1J4R A;  2N87 A;  2M2A A;  2DG9 A;  2ZQS A;  1HKJ A;  1TCO C;  2ZQT A;  1FKL A;  2XP3 A;  3PR9 A;  4ML4 A;  4IT4 A;  4P8W A;  3O5P A;  1ROT A;  2F2D A;  3O5M A;  5HT1 A;  3UI4 A;  2XP9 A;  3VAW A;  2ZQU A;  4FN2 A;  4WKA A;  4NNR A;  3ALF A;  1LL7 A;  3GPK A;  2A3E A;  3NRK A;  4TW7 A;  3WIJ A;  2F4E A;  3FAP A;  4WK9 A;  1E15 A;  3NTP A;  2K8I A;  2RSE A;  2B31 A;  4TYO A;  2FKE A;  4IQC A;  5DO2 A;  4ODO A;  3ARW A;  3RM8 A;  5DIT A;  1HKK A;  1ZK6 A;  4MAV A;  3CGN A;  3JYJ A;  2VN1 A;  4DRQ A;  2LKN A;  4FAP A;  1A7X A;  1EYM A;  4JFK A;  1FKD A;  5DEZ A;  1W9P A;  4L72 B;  5GPR A;  2DSV A;  4G50 A;  1M5Y A;  4JFL A;  4P8U A;  2MLY A;  4S3J A;  1WNO A;  3UQA A;  4P8X A;  2LGO A;  4U86 A;  1LG2 A;  4DRN A;  1FKB A;  4U84 A;  3QOK A;  3NI6 A;  1F40 A;  1GUV A;  2PPN A;  3ARY A;  4MNM A;  4ZS6 A;  1KT0 A;  4QT2 A;  2F21 A;  1C9H A;  2XPB A;  3KAG A;  5HUA A;  3RM9 A;  2DSW A;  1E6Z A;  5HBF A;  4Z2L A;  2PPO A;  3MDY B;  1ITX A;  1HJX A;  2XP7 A;  4ODM A;  1JNE A;  2AOS A;  5DIU A;  3CH9 A;  1EIB A;  1XHG A;  3EY6 A;  1H0I A;  4G2P A;  1NMV A;  1ZBV A;  1O6I A;  2ZR4 A;  4DRP A;  4WKF A;  1FFQ A;  2M08 A;  3CHD A;  5HW7 A;  4MTV A;  2XPA A;  3CZ8 A;  4QIB A;  5HTG A;  2FAP A;  4Q22 A;  4NZC A;  3WKZ A;  3UQI A;  3B9A A;  3JYM A;  2IUZ A;  1FKS A;  2YBU A;  3CHC A;  4R5E A;  4DT4 A;  2UZ5 A;  1JVW A;  2RQS A;  1J4I A;  2RUR A;  3O5E A;  4TNS A;  2G41 A;  1LJY A;  3TC5 A;  5HKG A;  1FFR A;  1NWT A;  1GPF A;  2D9F A;  3ARU A;  4S3K A;  4DZ3 A;  3PRB A;  4BF8 A;  3PRD A;  1CTN A;  1D6O A;  1L1P A;  2RUC A;  2PV2 A;  1ZL1 A;  1NMW A;  4LGX A;  5HW8 A;  1UR8 A;  3ARQ A;  1U79 A;  1Y0O A;  2PV1 A;  4ODL A;  1VF8 A;  4ODN A;  1D7J A;  3WL1 A;  1HKI A;  2QF8 A;  1ZBC A;  2DG3 A;  1NWS A;  1OWQ A;  4J4N A;  1F8A B;  4ZPV R;  3KZ7 A;  1Q6H A;  3WD4 A;  5D75 A;  5DF0 A;  3ARX A;  3IKG A;  3O5R A;  1ZBK A;  1JND A;  1FKH A;  1T11 A;  2KO7 A;  2VCD A;  1LL6 A;  1P5Q A;  1FKK A;  4ODP A;  4JFM A;  1KT1 A;  3FXY A;  4MGV A;  3CGM A;  2WLZ A;  2YBT A;  3ARV A;  1HXV A;  2ZQV A;  1IX5 A;  4IPX A;  1D7H A;  1W1Y A;  4URI A;  1KFW A;  4TW6 A;  3KAC A;  4GGQ A;  3UI6 A;  1B6C A;  3ARO A;  2KI3 A;  2ESC A;  2ZR6 A;  1SR0 A;  4QT3 A;  1XRV A;  1SYT A;  3RFW A;  1WB0 A;  2OLH A;  3ARR A;  4DWS C;  3WQV A;  1QZ2 A;  4Q7N A;  1TFV A;  4ODR A;  2PBC A;  2DPE A;  4JFI A;  4KQZ A;  5BXJ A;  3ODK A;  2IF4 A;  4Z2K A;  4R0X A;  3AS3 A;  1Q6U A;  2AWG A;  4HAR A;  2O9O A;  4W5U A;  1H0G A;  1Q1C A;  3KAH A;  2MLZ A;  2LPV A;  3B9E A;  4DWS B;  1BKF A;  3AS2 A;  4MSP A;  1FKF A;  4DZ2 A;  4ODK A;  2DT2 A;  4JYS A;  3WD0 A;  2KFW A;  4Z2I A;  1X6N A;  1E6P A;  2MLX A;  1D2K A;  2RUD A;  1W9U A;  4L3N A;  1HKM A;  2MF9 A;  3IK8 A;  1K9T A;  4XAK A;  5HW6 A;  3B7X A;  2M1I A;  2WM0 A;  3KAB A;  4W9O A;  2PI6 A;  4DRK A;  2L2S A;  1ZCN A;  1FKR A;  3IKD A;  4ODQ A;  1ZBW A;  1ZU8 A;  1Q6I A;  5HWC A;  2XP5 A;  4WKH A;  4DRI A;  1W9V A;  3UI5 A;  4IQ2 A;  2ITK A;  5HWB A;  1LG1 A;  3FY1 A;  3O5Q A;  4KR0 B;  4MNK A;  1OGB A;  4QZV B;  4ITZ A;  3WH0 A;  3I6C A;  1GOI A;  1W1P A;  3O5O A;  4W9Q A;  3O5J A;  1NSG A;  1JNS A;  2Q5A A;  5GQB A;  1UR9 A;  3OOB A;  1FAP A;  4HBO A;  4ZPW R;  4Z2H A;  3UF8 A;  3RM4 A;  1YW5 A;  1YAT A;  3O5G A;  3B8S A;  1NH6 A;  2FDM A;  4DRM A;  1W1V A;  1JNT A;  4DWS A;  4GIV A;  4IT6 A;  3PRA A;  3O5I A;  4LAY A;  4MNL A;  1WAW A;  2MPH A;  1J6Y A;  3ARS A;  3KCE A;  4MNJ A;  2DT0 A;  2KR7 A;  4MPK A;  1QPF A;  2G8Z A;  3CHF A;  3WQW A;  1W26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...