5HW6A

Candida albicans fkbp12 apo protein in c2 space group
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
120
structure length
120
Chain Sequence
EELPQIEIVQEGDNTTFAKPGDTVTIHYDGKLTNGKEFDSSRKRGKPFTCTVGVGQVIKGWDISLTNNYGKGGANLPKISKGTKAILTIPPNLAYGPRGIPPIIGPNETLVFEVELLGVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 1
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida albicans (strain sc5314 / atcc mya-2876)
molecule tags Isomerase
total genus 25
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5hw6A00
4DRQA 1D7IA 2F21A 3VAWA 2MNTA 4MSPA 2XP9A 1FKTA 4ODPA 4G2PA 1Q6HA 1D7JA 1W26A 3O5FA 4W9QA 3CGMA 3O5KA 1QPFA 2PPNA 4W9PA 4QT2A 3RFWA 1U79A 2KFWA 4FN2A 5GPGA 4IPXA 1KT0A 1Q6IA 4ITZA 2ZQVA 1YW5A 2PBCA 2XP3A 2MLZA 4TX0A 3UQAA 3O5MA 1QZ2A 3O5LA 1ROUA 3O5PA 4U86A 4JFKA 4FAPA 3PRDA 1HXVA 1FKRA 2M08A 2XPBA 2ZQUA 4DRKA 3NTPA 4IQCA 2RUDA 3KAIA 4TNSA 1NSGA 3CGNA 4ODKA 4TW8A 1C9HA 1FKKA 3RGCA 1EQ3A 2FAPA 2RURA 4GGQA 1FKJA 2DG3A 1ZK6A 4MGVA 1TCOC 2DG4A 3KAHA 3PA7A 1L1PA 3JXVA 3B7XA 4JFJA 1J4IA 2D9FA 3NI6A 4LAVA 4DRHA 4LAWA 4C02B 3KACA 4IQ2A 2KR7A 3TC5A 3O5JA 2N87A 5BXJA 4ODQA 3JYMA 2OFNA 2ZR4A 3ODKA 1FJDA 1PINA 4LAXA 1T11A 2RSEA 3MDYB 1R9HA 1EYMA 5HW6A 5HWCA 2KE0A 3KZ7A 4DZ3A 3O5OA 5DITA 1P5QA 2FKEA 3KADA 1FAPA 4DRPA 2ZQTA 3IKDA 1YATA 3FAPA 1NMWA 4DRIA 4DROA 2F2DA 2PPOA 1BKFA 1FKGA 4DRNA 2XP5A 1FD9A 2VN1A 2XPAA 3IKGA 5HW7A 1JVWA 2Q5AA 4TW6A 5HTGA 3IHZA 5I98A 1D6OA 2PV2A 3TCZA 1Q1CA 2RUCA 2M1IA 4JFIA 3EY6A 3KCEA 2KI3A 1NMVA 2ITKA 3LUOA 3KAGA 1B6CA 4QT3A 5D75A 3JYJA 2AWGA 1ROTA 3O5GA 5HUAA 1ZCNA 3UI4A 2RQSA 1A7XA 4R0XA 1J4RA 4ODOA 2MF9A 1Q6UA 2LGOA 2VCDA 2XP8A 3O5EA 3KABA 2LPVA 2XP7A 3O5QA 4G50A 3IK8A 4QIBA 3UQIA 5J6EA 1F40A 2M2AA 2KGJA 4TYOA 3UF8A 2LKNA 4NNRA 2LJ4A 2DG9A 4TW7A 1F8AB 5DIVA 4JFMA 1FKDA 3WH0A 3I6CA 4BF8A 3KAFA 3OOBA 4ODNA 2RUQA 3UQBA 5HKGA 2PV1A 2KO7A 2L2SA 3TDBA 3O5DA 2ZQSA 4JYSA 4GIVA 5B8IC 4DT4A 1FKHA 3UI5A 2ZR5A 2MPHA 3H9RB 1Y0OA 2IF4A 1N1AA 4LAYA 1KT1A 3UI6A 4DRMA 2ZR6A 4DH0A 2JZVA 2XP6A 4O2TA 5HW8A 1J6YA 1FKFA 4N19A 3NRKA 3O5RA 4DRJA 4J4OA 1JNTA 2PPPA 4J4NA 4ODMA 4W9OA 2UZ5A 4DIPA 5HWBA 2PV3A 2Y78A 1FKLA 5DIUA 1FKSA 1QPLA 1BL4A 4U85A 1PBKA 2MLYA 2K8IA 4ODRA 2XP4A 2MLXA 3PRBA 1J4HA 1FKBA 4ODLA 1M5YA 5HT1A 4DZ2A 4U84A 1D7HA 1FKIA 4JFLA 3GPKA 3O5IA 1JNSA 2F4EA
chains in the Genus database with same CATH superfamily
4NZCA 2MNTA 4MSPA 1FKTA 4ODPA 1Q6HA 2B5UB 3BXWA 4ZPWR 2PPNA 4R5EA 4W9PA 1KT0A 1YW5A 4TX0A 1ZBKA 2MLZA 3AS0A 3GU0A 4MNJA 4U86A 4IQCA 2RUDA 3WQWA 1NWRA 3ARUA 3ARXA 4WKHA 2DSWA 4HARA 3WQVA 1H0GA 3KAHA 3PA7A 3ALGA 1GOIA 4DWSB 4LAVA 1J4IA 1WAWA 2D9FA 4MNLA 1LQ0A 3KACA 2YBUA 3WD2A 2N87A 5BXJA 2FDMA 2F23A 1X6LA 1EYMA 2O9OA 2FKEA 4DRPA 1EIBA 4DRIA 2F2DA 3B9AA 1GUVA 4W5UA 3AS3A 2XP5A 1JVWA 1HJWA 2Q5AA 4TW6A 5I98A 1D6OA 2PV2A 3TCZA 3EY6A 1IX5A 4WK9A 2A3AA 3O5GA 4PTMA 5HUAA 1HKJA 3WL1A 5DF0A 3TDBA 4ODOA 1Q6UA 3O5QA 3O5EA 2LPVA 4P8UA 2M2AA 4HBEA 1LL4A 3CZ8A 3FY1A 2LJ4A 4ZPVR 3G6LA 2WLYA 1W1VA 5HKGA 2PV1A 2KO7A 3BMBA 1W9VA 2ZQSA 4GIVA 3UI5A 1E6ZA 4UDMA 2DPEA 1KT1A 4DRMA 1HKMA 1K9TA 1FKFA 1ZBWA 4N19A 1W9PA 1WB0A 5HWBA 2PV3A 1FKLA 5DIUA 1QPLA 1PBKA 2K8IA 3FXYA 2XP4A 2MLXA 1J4HA 1LJYA 5HT1A 3WD4A 3WD3A 1JNSA 2F4EA 2EULA 5HBFA 2XP9A 3RM8A 1D7JA 1W26A 3O5KA 4Z2JA 4AY1A 4Z2GA 4QT2A 4FN2A 4IPXA 1Q6IA 3ARTA 2ZQVA 3O5MA 3RM9A 4URIA 4JFKA 3PRDA 1HXVA 2M08A 3GTYX 4DRKA 1NSGA 1HJVA 3CGNA 2QF8A 4TW8A 1FKKA 3RGCA 2RURA 4Z2LA 2DG4A 5DO2A 1ITXA 4DRHA 1W1TA 4LAWA 1UR8A 5JH8A 2KR7A 3ODKA 1PINA 5HW6A 2PN0A 3CH9A 5HWCA 2KE0A 2B31A 3B9EA 3KADA 4S3KA 2ZQTA 1YATA 3QOKA 2G8ZA 2OLHA 1NMWA 1GPFA 4Q22A 3WIJA 3W4RA 1FKGA 4P8WA 4LGXA 2VN1A 2XPAA 4ZPTR 5HTGA 3ARPA 2ITKA 3LUOA 4QT3A 5D75A 2AWGA 1HKKA 4R0XA 1J4RA 1E6NA 1ZL1A 1F40A 3AROA 5J6EA 1W9UA 3ARQA 2LKNA 4WIWA 1JNEA 3KAFA 3CHCA 2RUQA 4ODNA 3PRAA 3AS1A 1OGBA 5B8IC 4DT4A 1FKHA 4KR0B 4O2TA 1FFRA 3NRKA 1XRVA 1E15A 3O5RA 4KQZA 4J4OA 1JNTA 2PPPA 4W9OA 2Y78A 1E9LA 3RMEA 3WL0A 3OA5A 4P8XA 4ODLA 1M5YA 2AOSA 4U84A 1D7HA 1FKIA 3GPKA 3ARZA 3O5IA 2F21A 4WKAA 4G2PA 1CTNA 3O5FA 4W9QA 2A3EA 1EHNA 3CHFA 3ARWA 2KFWA 5GPGA 3ARRA 3ARVA 4ITZA 4HBOA 1QZ2A 1X6NA 4FAPA 1D2KA 1FFQA 1OGGA 2ZQUA 3KAIA 4TNSA 1NWUA 1C9HA 1EQ3A 4Z2KA 4GGQA 1FKJA 1NWSA 4IT4A 1ZK6A 4MGVA 3JXVA 1E6RA 3NI6A 4XAKA 1LG2A 5GPRA 4DWSD 4C02B 1EDQA 4ODQA 2O92A 2OFNA 2ZR4A 1FJDA 4LAXA 1T11A 1R9HA 3KZ7A 3O5OA 1P5QA 1VF8A 3FAPA 5GQBA 1TFVA 1LL7A 4Z2HA 3IKGA 4WKFA 2A3CA 3ARSA 4IT6A 2YBTA 4MNKA 2DSZA 2RUCA 2M1IA 4JFIA 3KCEA 1NMVA 1B6CA 3JYJA 1ZCNA 3UI4A 2RQSA 1A7XA 2MF9A 2LGOA 2XP8A 1NWTA 3KABA 4S3JA 3B9DA 2KGJA 4TYOA 3UF8A 4NNRA 4QZVB 5DIVA 1FKDA 3WH0A 3I6CA 4BF8A 1SR0A 3UQBA 1H0IA 2L2SA 3O5DA 4Z2IA 2DT1A 1HJXA 1Y0OA 4LAYA 3UI6A 2JZVA 2XP6A 1SYTA 1J6YA 3RM4A 4ODMA 2UZ5A 5DEZA 2WLZA 4L72B 1BL4A 4U85A 2MLYA 3ARYA 3PRBA 1FKBA 4WJXA 4DZ2A 4ML4A 1XHGA 3KAGA 4DRQA 3WD0A 1D7IA 3VAWA 4NSBA 3WD1A 1JCHB 4L3NA 1E6PA 1KFWA 3CGMA 1QPFA 1O6IA 3RFWA 2G41A 1U79A 3AS2A 2XP3A 2PBCA 3UQAA 3O5LA 1ROUA 3O5PA 2IUZA 3B8SA 1FKRA 2XPBA 3NTPA 1E44A 3EIPA 1NH6A 4ODKA 2PI6A 2FAPA 2DG3A 3CHEA 1TCOC 4MNMA 1L1PA 3B7XA 4JFJA 1ZBCA 4IQ2A 2A3BA 3TC5A 3O5JA 1W1YA 3JYMA 1OWQA 2RSEA 3MDYB 3CHDA 4DZ3A 5DITA 2P4VA 1FAPA 2DT3A 1W1PA 3IKDA 3ALFA 4DROA 1ZU8A 2PPOA 1BKFA 4DRNA 3PR9A 1FD9A 5HW7A 4P8VA 1LG1A 1LL6A 4Q7NA 3IHZA 1Q1CA 2KI3A 3AQUA 1ROTA 2ESCA 1GRJA 4MTVA 2VCDA 4G50A 2XP7A 2WK2A 3UQIA 3IK8A 4QIBA 4DWSC 2DT2A 3G6MA 2WM0A 1HKIA 1JNDA 2DG9A 4TW7A 1F8AB 4JFMA 3WKZA 3OOBA 4DWSA 4JYSA 2DT0A 2ZR5A 2MPHA 3H9RB 2IF4A 1N1AA 1ZBVA 2ETNA 2ZR6A 4DH0A 4MAVA 5HW8A 4MPKA 1UR9A 2DSUA 4DRJA 4J4NA 1RD6A 4DIPA 1FKSA 4ZS6A 2DSVA 1ZB5A 4ODRA 1WNOA 4JFLA
chains in the Genus database with same CATH topology
4NZCA 2MNTA 4MSPA 1FKTA 4ODPA 1Q6HA 3BXWA 4ZPWR 2PPNA 4R5EA 4W9PA 1KT0A 1YW5A 4TX0A 1ZBKA 2MLZA 3AS0A 4MNJA 4U86A 4IQCA 2RUDA 3WQWA 1NWRA 3ARUA 3ARXA 4WKHA 2DSWA 4HARA 3WQVA 1H0GA 3KAHA 3PA7A 3ALGA 1GOIA 4DWSB 4LAVA 1J4IA 1WAWA 2D9FA 4MNLA 1LQ0A 3KACA 2YBUA 3WD2A 2N87A 5BXJA 2FDMA 1X6LA 1EYMA 2O9OA 2FKEA 4DRPA 1EIBA 4DRIA 2F2DA 3B9AA 1GUVA 4W5UA 3AS3A 2XP5A 1JVWA 1HJWA 2Q5AA 4TW6A 5I98A 1D6OA 2PV2A 3TCZA 3EY6A 1IX5A 4WK9A 2A3AA 3O5GA 4PTMA 5HUAA 1HKJA 3WL1A 5DF0A 3TDBA 4ODOA 1Q6UA 3O5QA 3O5EA 2LPVA 4P8UA 2M2AA 4HBEA 1LL4A 3CZ8A 3FY1A 2LJ4A 4ZPVR 3G6LA 2WLYA 1W1VA 5HKGA 2PV1A 2KO7A 1W9VA 2ZQSA 4GIVA 3UI5A 1E6ZA 2DPEA 1KT1A 4DRMA 1HKMA 1K9TA 1FKFA 1ZBWA 4N19A 1W9PA 1WB0A 5HWBA 2PV3A 1FKLA 5DIUA 1QPLA 1PBKA 2K8IA 3FXYA 2XP4A 2MLXA 1J4HA 1LJYA 5HT1A 3WD4A 3WD3A 1JNSA 2F4EA 5HBFA 2XP9A 3RM8A 1D7JA 1W26A 3O5KA 4Z2JA 4AY1A 4Z2GA 4QT2A 4FN2A 4IPXA 1Q6IA 3ARTA 2ZQVA 3O5MA 3RM9A 4URIA 4JFKA 3PRDA 1HXVA 2M08A 4DRKA 1NSGA 1HJVA 3CGNA 2QF8A 4TW8A 1FKKA 3RGCA 2RURA 4Z2LA 2DG4A 5DO2A 1ITXA 4DRHA 1W1TA 4LAWA 1UR8A 5JH8A 2KR7A 3ODKA 1PINA 5HW6A 5HWCA 3CH9A 2KE0A 2B31A 3B9EA 3KADA 4S3KA 2ZQTA 1YATA 3QOKA 2G8ZA 2OLHA 1NMWA 1GPFA 4Q22A 3WIJA 3W4RA 1FKGA 4P8WA 4LGXA 2VN1A 2XPAA 4ZPTR 5HTGA 3ARPA 2ITKA 3LUOA 4QT3A 5D75A 2AWGA 1HKKA 4R0XA 1J4RA 1E6NA 1ZL1A 1F40A 3AROA 5J6EA 1W9UA 3ARQA 2LKNA 4WIWA 1JNEA 3KAFA 3CHCA 2RUQA 4ODNA 3PRAA 3AS1A 1OGBA 5B8IC 4DT4A 1FKHA 4KR0B 4O2TA 1FFRA 3NRKA 1XRVA 1E15A 3O5RA 4KQZA 4J4OA 1JNTA 2PPPA 4W9OA 2Y78A 1E9LA 3RMEA 3WL0A 3OA5A 4P8XA 4ODLA 1M5YA 2AOSA 4U84A 1D7HA 1FKIA 3GPKA 3ARZA 3O5IA 2F21A 4WKAA 4G2PA 1CTNA 3O5FA 4W9QA 2A3EA 1EHNA 3CHFA 3ARWA 2KFWA 5GPGA 3ARRA 3ARVA 4ITZA 4HBOA 1QZ2A 1X6NA 4FAPA 1D2KA 1FFQA 1OGGA 2ZQUA 3KAIA 4TNSA 1NWUA 1C9HA 1EQ3A 4Z2KA 4GGQA 1FKJA 1NWSA 4IT4A 1ZK6A 4MGVA 3JXVA 1E6RA 3NI6A 4XAKA 1LG2A 5GPRA 4DWSD 4C02B 1EDQA 4ODQA 2O92A 2OFNA 2ZR4A 1FJDA 4LAXA 1T11A 1R9HA 3KZ7A 3O5OA 1P5QA 1VF8A 3FAPA 5GQBA 1TFVA 1LL7A 4Z2HA 3IKGA 4WKFA 2A3CA 3ARSA 4IT6A 2YBTA 4MNKA 2DSZA 2RUCA 2M1IA 4JFIA 3KCEA 1NMVA 1B6CA 3JYJA 1ZCNA 3UI4A 2RQSA 1A7XA 2MF9A 2LGOA 2XP8A 1NWTA 3KABA 4S3JA 3B9DA 2KGJA 4TYOA 3UF8A 4NNRA 4QZVB 5DIVA 1FKDA 3WH0A 3I6CA 4BF8A 1SR0A 3UQBA 1H0IA 2L2SA 3O5DA 4Z2IA 2DT1A 1HJXA 1Y0OA 4LAYA 3UI6A 2JZVA 2XP6A 1SYTA 1J6YA 3RM4A 4ODMA 2UZ5A 5DEZA 2WLZA 4L72B 1BL4A 4U85A 2MLYA 3ARYA 3PRBA 1FKBA 4WJXA 4DZ2A 4ML4A 1XHGA 3KAGA 4DRQA 3WD0A 1D7IA 3VAWA 4NSBA 3WD1A 4L3NA 1E6PA 1KFWA 3CGMA 1QPFA 1O6IA 3RFWA 2G41A 1U79A 3AS2A 2XP3A 2PBCA 3UQAA 3O5LA 1ROUA 3O5PA 2IUZA 3B8SA 1FKRA 2XPBA 3NTPA 1NH6A 4ODKA 2PI6A 2FAPA 2DG3A 3CHEA 1TCOC 4MNMA 1L1PA 3B7XA 4JFJA 1ZBCA 4IQ2A 2A3BA 3TC5A 3O5JA 1W1YA 3JYMA 1OWQA 2RSEA 3MDYB 3CHDA 4DZ3A 5DITA 1FAPA 2DT3A 1W1PA 3IKDA 3ALFA 4DROA 1ZU8A 2PPOA 1BKFA 4DRNA 3PR9A 1FD9A 5HW7A 4P8VA 1LG1A 1LL6A 4Q7NA 3IHZA 1Q1CA 2KI3A 3AQUA 1ROTA 2ESCA 4MTVA 2VCDA 4G50A 2XP7A 2WK2A 3UQIA 3IK8A 4QIBA 4DWSC 2DT2A 3G6MA 2WM0A 1HKIA 1JNDA 2DG9A 4TW7A 1F8AB 4JFMA 3WKZA 3OOBA 4DWSA 4JYSA 2DT0A 2ZR5A 2MPHA 3H9RB 2IF4A 1N1AA 1ZBVA 2ZR6A 4DH0A 4MAVA 5HW8A 4MPKA 1UR9A 2DSUA 4DRJA 4J4NA 1RD6A 4DIPA 1FKSA 4ZS6A 2DSVA 1ZB5A 4ODRA 1WNOA 4JFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRQ A;  1D7I A;  2F21 A;  3VAW A;  2MNT A;  4MSP A;  2XP9 A;  1FKT A;  4ODP A;  4G2P A;  1Q6H A;  1D7J A;  1W26 A;  3O5F A;  4W9Q A;  3CGM A;  3O5K A;  1QPF A;  2PPN A;  4W9P A;  4QT2 A;  3RFW A;  1U79 A;  2KFW A;  4FN2 A;  5GPG A;  4IPX A;  1KT0 A;  1Q6I A;  4ITZ A;  2ZQV A;  1YW5 A;  2PBC A;  2XP3 A;  2MLZ A;  4TX0 A;  3UQA A;  3O5M A;  1QZ2 A;  3O5L A;  1ROU A;  3O5P A;  4U86 A;  4JFK A;  4FAP A;  3PRD A;  1HXV A;  1FKR A;  2M08 A;  2XPB A;  2ZQU A;  4DRK A;  3NTP A;  4IQC A;  2RUD A;  3KAI A;  4TNS A;  1NSG A;  3CGN A;  4ODK A;  4TW8 A;  1C9H A;  1FKK A;  3RGC A;  1EQ3 A;  2FAP A;  2RUR A;  4GGQ A;  1FKJ A;  2DG3 A;  1ZK6 A;  4MGV A;  1TCO C;  2DG4 A;  3KAH A;  3PA7 A;  1L1P A;  3JXV A;  3B7X A;  4JFJ A;  1J4I A;  2D9F A;  3NI6 A;  4LAV A;  4DRH A;  4LAW A;  4C02 B;  3KAC A;  4IQ2 A;  2KR7 A;  3TC5 A;  3O5J A;  2N87 A;  5BXJ A;  4ODQ A;  3JYM A;  2OFN A;  2ZR4 A;  3ODK A;  1FJD A;  1PIN A;  4LAX A;  1T11 A;  2RSE A;  3MDY B;  1R9H A;  1EYM A;  5HW6 A;  5HWC A;  2KE0 A;  3KZ7 A;  4DZ3 A;  3O5O A;  5DIT A;  1P5Q A;  2FKE A;  3KAD A;  1FAP A;  4DRP A;  2ZQT A;  3IKD A;  1YAT A;  3FAP A;  1NMW A;  4DRI A;  4DRO A;  2F2D A;  2PPO A;  1BKF A;  1FKG A;  4DRN A;  2XP5 A;  1FD9 A;  2VN1 A;  2XPA A;  3IKG A;  5HW7 A;  1JVW A;  2Q5A A;  4TW6 A;  5HTG A;  3IHZ A;  5I98 A;  1D6O A;  2PV2 A;  3TCZ A;  1Q1C A;  2RUC A;  2M1I A;  4JFI A;  3EY6 A;  3KCE A;  2KI3 A;  1NMV A;  2ITK A;  3LUO A;  3KAG A;  1B6C A;  4QT3 A;  5D75 A;  3JYJ A;  2AWG A;  1ROT A;  3O5G A;  5HUA A;  1ZCN A;  3UI4 A;  2RQS A;  1A7X A;  4R0X A;  1J4R A;  4ODO A;  2MF9 A;  1Q6U A;  2LGO A;  2VCD A;  2XP8 A;  3O5E A;  3KAB A;  2LPV A;  2XP7 A;  3O5Q A;  4G50 A;  3IK8 A;  4QIB A;  3UQI A;  5J6E A;  1F40 A;  2M2A A;  2KGJ A;  4TYO A;  3UF8 A;  2LKN A;  4NNR A;  2LJ4 A;  2DG9 A;  4TW7 A;  1F8A B;  5DIV A;  4JFM A;  1FKD A;  3WH0 A;  3I6C A;  4BF8 A;  3KAF A;  3OOB A;  4ODN A;  2RUQ A;  3UQB A;  5HKG A;  2PV1 A;  2KO7 A;  2L2S A;  3TDB A;  3O5D A;  2ZQS A;  4JYS A;  4GIV A;  5B8I C;  4DT4 A;  1FKH A;  3UI5 A;  2ZR5 A;  2MPH A;  3H9R B;  1Y0O A;  2IF4 A;  1N1A A;  4LAY A;  1KT1 A;  3UI6 A;  4DRM A;  2ZR6 A;  4DH0 A;  2JZV A;  2XP6 A;  4O2T A;  5HW8 A;  1J6Y A;  1FKF A;  4N19 A;  3NRK A;  3O5R A;  4DRJ A;  4J4O A;  1JNT A;  2PPP A;  4J4N A;  4ODM A;  4W9O A;  2UZ5 A;  4DIP A;  5HWB A;  2PV3 A;  2Y78 A;  1FKL A;  5DIU A;  1FKS A;  1QPL A;  1BL4 A;  4U85 A;  1PBK A;  2MLY A;  2K8I A;  4ODR A;  2XP4 A;  2MLX A;  3PRB A;  1J4H A;  1FKB A;  4ODL A;  1M5Y A;  5HT1 A;  4DZ2 A;  4U84 A;  1D7H A;  1FKI A;  4JFL A;  3GPK A;  3O5I A;  1JNS A;  2F4E A; 
#chains in the Genus database with same CATH topology
 4NZC A;  2MNT A;  4MSP A;  1FKT A;  4ODP A;  1Q6H A;  2B5U B;  3BXW A;  4ZPW R;  2PPN A;  4R5E A;  4W9P A;  1KT0 A;  1YW5 A;  4TX0 A;  1ZBK A;  2MLZ A;  3AS0 A;  3GU0 A;  4MNJ A;  4U86 A;  4IQC A;  2RUD A;  3WQW A;  1NWR A;  3ARU A;  3ARX A;  4WKH A;  2DSW A;  4HAR A;  3WQV A;  1H0G A;  3KAH A;  3PA7 A;  3ALG A;  1GOI A;  4DWS B;  4LAV A;  1J4I A;  1WAW A;  2D9F A;  4MNL A;  1LQ0 A;  3KAC A;  2YBU A;  3WD2 A;  2N87 A;  5BXJ A;  2FDM A;  2F23 A;  1X6L A;  1EYM A;  2O9O A;  2FKE A;  4DRP A;  1EIB A;  4DRI A;  2F2D A;  3B9A A;  1GUV A;  4W5U A;  3AS3 A;  2XP5 A;  1JVW A;  1HJW A;  2Q5A A;  4TW6 A;  5I98 A;  1D6O A;  2PV2 A;  3TCZ A;  3EY6 A;  1IX5 A;  4WK9 A;  2A3A A;  3O5G A;  4PTM A;  5HUA A;  1HKJ A;  3WL1 A;  5DF0 A;  3TDB A;  4ODO A;  1Q6U A;  3O5Q A;  3O5E A;  2LPV A;  4P8U A;  2M2A A;  4HBE A;  1LL4 A;  3CZ8 A;  3FY1 A;  2LJ4 A;  4ZPV R;  3G6L A;  2WLY A;  1W1V A;  5HKG A;  2PV1 A;  2KO7 A;  3BMB A;  1W9V A;  2ZQS A;  4GIV A;  3UI5 A;  1E6Z A;  4UDM A;  2DPE A;  1KT1 A;  4DRM A;  1HKM A;  1K9T A;  1FKF A;  1ZBW A;  4N19 A;  1W9P A;  1WB0 A;  5HWB A;  2PV3 A;  1FKL A;  5DIU A;  1QPL A;  1PBK A;  2K8I A;  3FXY A;  2XP4 A;  2MLX A;  1J4H A;  1LJY A;  5HT1 A;  3WD4 A;  3WD3 A;  1JNS A;  2F4E A;  2EUL A;  5HBF A;  2XP9 A;  3RM8 A;  1D7J A;  1W26 A;  3O5K A;  4Z2J A;  4AY1 A;  4Z2G A;  4QT2 A;  4FN2 A;  4IPX A;  1Q6I A;  3ART A;  2ZQV A;  3O5M A;  3RM9 A;  4URI A;  4JFK A;  3PRD A;  1HXV A;  2M08 A;  3GTY X;  4DRK A;  1NSG A;  1HJV A;  3CGN A;  2QF8 A;  4TW8 A;  1FKK A;  3RGC A;  2RUR A;  4Z2L A;  2DG4 A;  5DO2 A;  1ITX A;  4DRH A;  1W1T A;  4LAW A;  1UR8 A;  5JH8 A;  2KR7 A;  3ODK A;  1PIN A;  5HW6 A;  2PN0 A;  3CH9 A;  5HWC A;  2KE0 A;  2B31 A;  3B9E A;  3KAD A;  4S3K A;  2ZQT A;  1YAT A;  3QOK A;  2G8Z A;  2OLH A;  1NMW A;  1GPF A;  4Q22 A;  3WIJ A;  3W4R A;  1FKG A;  4P8W A;  4LGX A;  2VN1 A;  2XPA A;  4ZPT R;  5HTG A;  3ARP A;  2ITK A;  3LUO A;  4QT3 A;  5D75 A;  2AWG A;  1HKK A;  4R0X A;  1J4R A;  1E6N A;  1ZL1 A;  1F40 A;  3ARO A;  5J6E A;  1W9U A;  3ARQ A;  2LKN A;  4WIW A;  1JNE A;  3KAF A;  3CHC A;  2RUQ A;  4ODN A;  3PRA A;  3AS1 A;  1OGB A;  5B8I C;  4DT4 A;  1FKH A;  4KR0 B;  4O2T A;  1FFR A;  3NRK A;  1XRV A;  1E15 A;  3O5R A;  4KQZ A;  4J4O A;  1JNT A;  2PPP A;  4W9O A;  2Y78 A;  1E9L A;  3RME A;  3WL0 A;  3OA5 A;  4P8X A;  4ODL A;  1M5Y A;  2AOS A;  4U84 A;  1D7H A;  1FKI A;  3GPK A;  3ARZ A;  3O5I A;  2F21 A;  4WKA A;  4G2P A;  1CTN A;  3O5F A;  4W9Q A;  2A3E A;  1EHN A;  3CHF A;  3ARW A;  2KFW A;  5GPG A;  3ARR A;  3ARV A;  4ITZ A;  4HBO A;  1QZ2 A;  1X6N A;  4FAP A;  1D2K A;  1FFQ A;  1OGG A;  2ZQU A;  3KAI A;  4TNS A;  1NWU A;  1C9H A;  1EQ3 A;  4Z2K A;  4GGQ A;  1FKJ A;  1NWS A;  4IT4 A;  1ZK6 A;  4MGV A;  3JXV A;  1E6R A;  3NI6 A;  4XAK A;  1LG2 A;  5GPR A;  4DWS D;  4C02 B;  1EDQ A;  4ODQ A;  2O92 A;  2OFN A;  2ZR4 A;  1FJD A;  4LAX A;  1T11 A;  1R9H A;  3KZ7 A;  3O5O A;  1P5Q A;  1VF8 A;  3FAP A;  5GQB A;  1TFV A;  1LL7 A;  4Z2H A;  3IKG A;  4WKF A;  2A3C A;  3ARS A;  4IT6 A;  2YBT A;  4MNK A;  2DSZ A;  2RUC A;  2M1I A;  4JFI A;  3KCE A;  1NMV A;  1B6C A;  3JYJ A;  1ZCN A;  3UI4 A;  2RQS A;  1A7X A;  2MF9 A;  2LGO A;  2XP8 A;  1NWT A;  3KAB A;  4S3J A;  3B9D A;  2KGJ A;  4TYO A;  3UF8 A;  4NNR A;  4QZV B;  5DIV A;  1FKD A;  3WH0 A;  3I6C A;  4BF8 A;  1SR0 A;  3UQB A;  1H0I A;  2L2S A;  3O5D A;  4Z2I A;  2DT1 A;  1HJX A;  1Y0O A;  4LAY A;  3UI6 A;  2JZV A;  2XP6 A;  1SYT A;  1J6Y A;  3RM4 A;  4ODM A;  2UZ5 A;  5DEZ A;  2WLZ A;  4L72 B;  1BL4 A;  4U85 A;  2MLY A;  3ARY A;  3PRB A;  1FKB A;  4WJX A;  4DZ2 A;  4ML4 A;  1XHG A;  3KAG A;  4DRQ A;  3WD0 A;  1D7I A;  3VAW A;  4NSB A;  3WD1 A;  1JCH B;  4L3N A;  1E6P A;  1KFW A;  3CGM A;  1QPF A;  1O6I A;  3RFW A;  2G41 A;  1U79 A;  3AS2 A;  2XP3 A;  2PBC A;  3UQA A;  3O5L A;  1ROU A;  3O5P A;  2IUZ A;  3B8S A;  1FKR A;  2XPB A;  3NTP A;  1E44 A;  3EIP A;  1NH6 A;  4ODK A;  2PI6 A;  2FAP A;  2DG3 A;  3CHE A;  1TCO C;  4MNM A;  1L1P A;  3B7X A;  4JFJ A;  1ZBC A;  4IQ2 A;  2A3B A;  3TC5 A;  3O5J A;  1W1Y A;  3JYM A;  1OWQ A;  2RSE A;  3MDY B;  3CHD A;  4DZ3 A;  5DIT A;  2P4V A;  1FAP A;  2DT3 A;  1W1P A;  3IKD A;  3ALF A;  4DRO A;  1ZU8 A;  2PPO A;  1BKF A;  4DRN A;  3PR9 A;  1FD9 A;  5HW7 A;  4P8V A;  1LG1 A;  1LL6 A;  4Q7N A;  3IHZ A;  1Q1C A;  2KI3 A;  3AQU A;  1ROT A;  2ESC A;  1GRJ A;  4MTV A;  2VCD A;  4G50 A;  2XP7 A;  2WK2 A;  3UQI A;  3IK8 A;  4QIB A;  4DWS C;  2DT2 A;  3G6M A;  2WM0 A;  1HKI A;  1JND A;  2DG9 A;  4TW7 A;  1F8A B;  4JFM A;  3WKZ A;  3OOB A;  4DWS A;  4JYS A;  2DT0 A;  2ZR5 A;  2MPH A;  3H9R B;  2IF4 A;  1N1A A;  1ZBV A;  2ETN A;  2ZR6 A;  4DH0 A;  4MAV A;  5HW8 A;  4MPK A;  1UR9 A;  2DSU A;  4DRJ A;  4J4N A;  1RD6 A;  4DIP A;  1FKS A;  4ZS6 A;  2DSV A;  1ZB5 A;  4ODR A;  1WNO A;  4JFL A; 
#chains in the Genus database with same CATH homology
 4NZC A;  2MNT A;  4MSP A;  1FKT A;  4ODP A;  1Q6H A;  3BXW A;  4ZPW R;  2PPN A;  4R5E A;  4W9P A;  1KT0 A;  1YW5 A;  4TX0 A;  1ZBK A;  2MLZ A;  3AS0 A;  4MNJ A;  4U86 A;  4IQC A;  2RUD A;  3WQW A;  1NWR A;  3ARU A;  3ARX A;  4WKH A;  2DSW A;  4HAR A;  3WQV A;  1H0G A;  3KAH A;  3PA7 A;  3ALG A;  1GOI A;  4DWS B;  4LAV A;  1J4I A;  1WAW A;  2D9F A;  4MNL A;  1LQ0 A;  3KAC A;  2YBU A;  3WD2 A;  2N87 A;  5BXJ A;  2FDM A;  1X6L A;  1EYM A;  2O9O A;  2FKE A;  4DRP A;  1EIB A;  4DRI A;  2F2D A;  3B9A A;  1GUV A;  4W5U A;  3AS3 A;  2XP5 A;  1JVW A;  1HJW A;  2Q5A A;  4TW6 A;  5I98 A;  1D6O A;  2PV2 A;  3TCZ A;  3EY6 A;  1IX5 A;  4WK9 A;  2A3A A;  3O5G A;  4PTM A;  5HUA A;  1HKJ A;  3WL1 A;  5DF0 A;  3TDB A;  4ODO A;  1Q6U A;  3O5Q A;  3O5E A;  2LPV A;  4P8U A;  2M2A A;  4HBE A;  1LL4 A;  3CZ8 A;  3FY1 A;  2LJ4 A;  4ZPV R;  3G6L A;  2WLY A;  1W1V A;  5HKG A;  2PV1 A;  2KO7 A;  1W9V A;  2ZQS A;  4GIV A;  3UI5 A;  1E6Z A;  2DPE A;  1KT1 A;  4DRM A;  1HKM A;  1K9T A;  1FKF A;  1ZBW A;  4N19 A;  1W9P A;  1WB0 A;  5HWB A;  2PV3 A;  1FKL A;  5DIU A;  1QPL A;  1PBK A;  2K8I A;  3FXY A;  2XP4 A;  2MLX A;  1J4H A;  1LJY A;  5HT1 A;  3WD4 A;  3WD3 A;  1JNS A;  2F4E A;  5HBF A;  2XP9 A;  3RM8 A;  1D7J A;  1W26 A;  3O5K A;  4Z2J A;  4AY1 A;  4Z2G A;  4QT2 A;  4FN2 A;  4IPX A;  1Q6I A;  3ART A;  2ZQV A;  3O5M A;  3RM9 A;  4URI A;  4JFK A;  3PRD A;  1HXV A;  2M08 A;  4DRK A;  1NSG A;  1HJV A;  3CGN A;  2QF8 A;  4TW8 A;  1FKK A;  3RGC A;  2RUR A;  4Z2L A;  2DG4 A;  5DO2 A;  1ITX A;  4DRH A;  1W1T A;  4LAW A;  1UR8 A;  5JH8 A;  2KR7 A;  3ODK A;  1PIN A;  5HW6 A;  5HWC A;  3CH9 A;  2KE0 A;  2B31 A;  3B9E A;  3KAD A;  4S3K A;  2ZQT A;  1YAT A;  3QOK A;  2G8Z A;  2OLH A;  1NMW A;  1GPF A;  4Q22 A;  3WIJ A;  3W4R A;  1FKG A;  4P8W A;  4LGX A;  2VN1 A;  2XPA A;  4ZPT R;  5HTG A;  3ARP A;  2ITK A;  3LUO A;  4QT3 A;  5D75 A;  2AWG A;  1HKK A;  4R0X A;  1J4R A;  1E6N A;  1ZL1 A;  1F40 A;  3ARO A;  5J6E A;  1W9U A;  3ARQ A;  2LKN A;  4WIW A;  1JNE A;  3KAF A;  3CHC A;  2RUQ A;  4ODN A;  3PRA A;  3AS1 A;  1OGB A;  5B8I C;  4DT4 A;  1FKH A;  4KR0 B;  4O2T A;  1FFR A;  3NRK A;  1XRV A;  1E15 A;  3O5R A;  4KQZ A;  4J4O A;  1JNT A;  2PPP A;  4W9O A;  2Y78 A;  1E9L A;  3RME A;  3WL0 A;  3OA5 A;  4P8X A;  4ODL A;  1M5Y A;  2AOS A;  4U84 A;  1D7H A;  1FKI A;  3GPK A;  3ARZ A;  3O5I A;  2F21 A;  4WKA A;  4G2P A;  1CTN A;  3O5F A;  4W9Q A;  2A3E A;  1EHN A;  3CHF A;  3ARW A;  2KFW A;  5GPG A;  3ARR A;  3ARV A;  4ITZ A;  4HBO A;  1QZ2 A;  1X6N A;  4FAP A;  1D2K A;  1FFQ A;  1OGG A;  2ZQU A;  3KAI A;  4TNS A;  1NWU A;  1C9H A;  1EQ3 A;  4Z2K A;  4GGQ A;  1FKJ A;  1NWS A;  4IT4 A;  1ZK6 A;  4MGV A;  3JXV A;  1E6R A;  3NI6 A;  4XAK A;  1LG2 A;  5GPR A;  4DWS D;  4C02 B;  1EDQ A;  4ODQ A;  2O92 A;  2OFN A;  2ZR4 A;  1FJD A;  4LAX A;  1T11 A;  1R9H A;  3KZ7 A;  3O5O A;  1P5Q A;  1VF8 A;  3FAP A;  5GQB A;  1TFV A;  1LL7 A;  4Z2H A;  3IKG A;  4WKF A;  2A3C A;  3ARS A;  4IT6 A;  2YBT A;  4MNK A;  2DSZ A;  2RUC A;  2M1I A;  4JFI A;  3KCE A;  1NMV A;  1B6C A;  3JYJ A;  1ZCN A;  3UI4 A;  2RQS A;  1A7X A;  2MF9 A;  2LGO A;  2XP8 A;  1NWT A;  3KAB A;  4S3J A;  3B9D A;  2KGJ A;  4TYO A;  3UF8 A;  4NNR A;  4QZV B;  5DIV A;  1FKD A;  3WH0 A;  3I6C A;  4BF8 A;  1SR0 A;  3UQB A;  1H0I A;  2L2S A;  3O5D A;  4Z2I A;  2DT1 A;  1HJX A;  1Y0O A;  4LAY A;  3UI6 A;  2JZV A;  2XP6 A;  1SYT A;  1J6Y A;  3RM4 A;  4ODM A;  2UZ5 A;  5DEZ A;  2WLZ A;  4L72 B;  1BL4 A;  4U85 A;  2MLY A;  3ARY A;  3PRB A;  1FKB A;  4WJX A;  4DZ2 A;  4ML4 A;  1XHG A;  3KAG A;  4DRQ A;  3WD0 A;  1D7I A;  3VAW A;  4NSB A;  3WD1 A;  4L3N A;  1E6P A;  1KFW A;  3CGM A;  1QPF A;  1O6I A;  3RFW A;  2G41 A;  1U79 A;  3AS2 A;  2XP3 A;  2PBC A;  3UQA A;  3O5L A;  1ROU A;  3O5P A;  2IUZ A;  3B8S A;  1FKR A;  2XPB A;  3NTP A;  1NH6 A;  4ODK A;  2PI6 A;  2FAP A;  2DG3 A;  3CHE A;  1TCO C;  4MNM A;  1L1P A;  3B7X A;  4JFJ A;  1ZBC A;  4IQ2 A;  2A3B A;  3TC5 A;  3O5J A;  1W1Y A;  3JYM A;  1OWQ A;  2RSE A;  3MDY B;  3CHD A;  4DZ3 A;  5DIT A;  1FAP A;  2DT3 A;  1W1P A;  3IKD A;  3ALF A;  4DRO A;  1ZU8 A;  2PPO A;  1BKF A;  4DRN A;  3PR9 A;  1FD9 A;  5HW7 A;  4P8V A;  1LG1 A;  1LL6 A;  4Q7N A;  3IHZ A;  1Q1C A;  2KI3 A;  3AQU A;  1ROT A;  2ESC A;  4MTV A;  2VCD A;  4G50 A;  2XP7 A;  2WK2 A;  3UQI A;  3IK8 A;  4QIB A;  4DWS C;  2DT2 A;  3G6M A;  2WM0 A;  1HKI A;  1JND A;  2DG9 A;  4TW7 A;  1F8A B;  4JFM A;  3WKZ A;  3OOB A;  4DWS A;  4JYS A;  2DT0 A;  2ZR5 A;  2MPH A;  3H9R B;  2IF4 A;  1N1A A;  1ZBV A;  2ZR6 A;  4DH0 A;  4MAV A;  5HW8 A;  4MPK A;  1UR9 A;  2DSU A;  4DRJ A;  4J4N A;  1RD6 A;  4DIP A;  1FKS A;  4ZS6 A;  2DSV A;  1ZB5 A;  4ODR A;  1WNO A;  4JFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...