5HW6A

Candida albicans fkbp12 apo protein in c2 space group
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
120
structure length
120
Chain Sequence
b'EELPQIEIVQEGDNTTFAKPGDTVTIHYDGKLTNGKEFDSSRKRGKPFTCTVGVGQVIKGWDISLTNNYGKGGANLPKISKGTKAILTIPPNLAYGPRGIPPIIGPNETLVFEVELLGVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 1
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida albicans (strain sc5314 / atcc mya-2876)
molecule tags Isomerase
total genus 25
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5hw6A00
1ROTA 2KR7A 1J4IA 1FKJA 4FAPA 3UQAA 3RGCA 3H9RB 3O5GA 1Q1CA 1FKKA 1FKLA 3IKDA 4ODOA 4TW7A 2M08A 3EY6A 2Q5AA 1JNTA 3O5RA 3O5OA 1ZCNA 4IPXA 3ODKA 2MPHA 4ODQA 2K8IA 4TX0A 2PBCA 3O5IA 1Q6UA 2VN1A 4DRMA 2VCDA 4JFJA 2OFNA 1J4RA 4ITZA 4JFKA 4ODNA 4DRNA 5HWCA 3KAHA 4G2PA 1FKGA 2L2SA 4TW8A 4ODRA 5HWBA 2XP8A 5HUAA 1BKFA 2ZQUA 1PBKA 4G50A 4W9QA 1FD9A 4NNRA 5DIVA 5I98A 1U79A 2F4EA 2PPOA 1Q6IA 2LJ4A 2ZR5A 3GPKA 4MSPA 2MNTA 2RURA 3TC5A 1D7JA 5D75A 1ROUA 3NRKA 1NMVA 3NTPA 4GIVA 1QPFA 1BL4A 4IQCA 4DH0A 2LPVA 3UI5A 3KCEA 3O5DA 4ODKA 2JZVA 2RQSA 2PV2A 1FKHA 5DIUA 2PV3A 3NI6A 2MLZA 3KAIA 4U86A 4DROA 5BXJA 5HT1A 2D9FA 3MDYB 3O5LA 2N87A 1P5QA 4J4OA 4DRJA 1D7HA 4ODMA 1FKSA 3CGMA 4QIBA 5HW8A 3KACA 1FKTA 1B6CA 1YW5A 2RUDA 4LAXA 4DIPA 2AWGA 1JVWA 2RUQA 2ZQVA 4LAVA 1QPLA 1TCOC 2XP9A 5HTGA 2MF9A 3VAWA 1KT1A 1Q6HA 1N1AA 2XP7A 3CGNA 1C9HA 3KABA 4U84A 1M5YA 2RSEA 3O5KA 4ODPA 4FN2A 1YATA 5HW6A 2ZR4A 3PRBA 3O5FA 1FKDA 1F8AB 2XP3A 2XP4A 3OOBA 1FKRA 1NSGA 3PA7A 3O5PA 3RFWA 5B8IC 3KAGA 3I6CA 4LAYA 1QZ2A 2ZR6A 3UQIA 1R9HA 3FAPA 4QT2A 2KO7A 3O5MA 4DT4A 1EYMA 3JXVA 3KAFA 4DZ2A 5J6EA 4O2TA 2ZQSA 1FKFA 3O5QA 1Y0OA 2M2AA 3B7XA 1HXVA 4MGVA 1A7XA 1PINA 1FJDA 4LAWA 4U85A 1J6YA 1F40A 2XPBA 5DITA 4JFMA 3UI6A 2FAPA 1D6OA 2F21A 2MLYA 2UZ5A 3TDBA 1EQ3A 1T11A 2IF4A 2LKNA 2FKEA 4N19A 2KI3A 2KFWA 2M1IA 2RUCA 2XP5A 3IHZA 3O5JA 4W9PA 5GPGA 4BF8A 4DRHA 5HW7A 2XP6A 4DRQA 4DRPA 2ZQTA 4JFIA 1FAPA 1ZK6A 1FKIA 3IKGA 4TW6A 4QT3A 4R0XA 3UF8A 2KE0A 1J4HA 4DRIA 1KT0A 1W26A 3TCZA 3UI4A 2LGOA 4DZ3A 4JYSA 3O5EA 5HKGA 3KZ7A 3LUOA 4JFLA 2F2DA 2ITKA 3JYJA 4GGQA 4TYOA 1FKBA 4TNSA 2Y78A 2DG9A 2PPNA 2DG3A 2DG4A 2XPAA 4IQ2A 3KADA 1NMWA 3JYMA 4C02B 3WH0A 4W9OA 3UQBA 2PPPA 2PV1A 2KGJA 1JNSA 4J4NA 4DRKA 3PRDA 1L1PA 2MLXA 4ODLA 1D7IA 3IK8A
chains in the Genus database with same CATH superfamily
1ROTA 2A3EA 3WL1A 4ML4A 1Q1CA 1FKKA 1FKLA 2M08A 3UI4A 1JNTA 3O5RA 2K8IA 1EIBA 1NWUA 5HWCA 3B9AA 1FKGA 5HWBA 1BKFA 3WD0A 4W9QA 1LL7A 3WQWA 4MNMA 1U79A 3ARRA 2F4EA 4DWSD 2ZR5A 4MSPA 4IT4A 3ALFA 1D7JA 5D75A 4GIVA 1QPFA 1BL4A 4IQCA 2LPVA 3RMEA 1HJXA 1LG1A 2MLZA 3ARSA 5BXJA 3CHDA 4PTMA 2N87A 4J4OA 1UR8A 4DRJA 2DSWA 1FKTA 3CHFA 1B6CA 3W4RA 5DF0A 1JVWA 4Z2JA 2F23A 1C9HA 3KABA 3O5KA 1YATA 3PRBA 3O5FA 1FKDA 1F8AB 4W5UA 5JH8A 1HKMA 2DT0A 3RFWA 1JNDA 1WAWA 3GU0A 3QOKA 2WLZA 4P8VA 4Z2HA 4WKAA 4O2TA 4ZPWR 3RM4A 1FKFA 2M2AA 4Q22A 4MGVA 4KR0B 1HXVA 1J6YA 3WQVA 2XPBA 5DITA 3UI6A 2MLYA 3ARWA 2UZ5A 5DEZA 4N19A 4DRHA 2XP5A 1X6LA 4DRQA 2ZQTA 4JFIA 1FAPA 4QT3A 3UF8A 2KE0A 3TCZA 2LGOA 1ZU8A 1XRVA 2F2DA 2ITKA 4L72B 1W1PA 4IQ2A 3KADA 1NMWA 1NWSA 2FDMA 3UQBA 2PPPA 1JNSA 2DT1A 4DRKA 1L1PA 2MLXA 1IX5A 3AS2A 4ODLA 3ARQA 4Z2LA 3CH9A 1J4IA 1FKJA 4TW7A 1HKKA 2Q5AA 4S3KA 5DO2A 2MPHA 4ZPTR 3ALGA 2PBCA 3G6MA 4DWSA 3KAHA 4G2PA 2AOSA 3WD1A 2L2SA 3ARUA 2ZQUA 4G50A 4NNRA 4P8UA 5DIVA 1UR9A 1ZBWA 2WK2A 1LQ0A 2RURA 3TC5A 3NRKA 1E15A 1NMVA 3NTPA 4DH0A 3O5DA 4ODKA 4ZS6A 5DIUA 3NI6A 5HT1A 3ARVA 3ARXA 3MDYB 1TFVA 1P5QA 1D7HA 4ODMA 4QIBA 2A3AA 1YW5A 2RUDA 2AWGA 3PR9A 2YBTA 2WLYA 1Q6HA 2G41A 4WKFA 1W9VA 4WIWA 2RSEA 5HW6A 2ZR4A 3OOBA 1FKRA 2IUZA 1GUVA 2A3CA 3PA7A 4URIA 2DSVA 1JCHB 4LAYA 2ZR6A 3AS0A 3FAPA 1W1VA 1EYMA 1OGGA 2O9OA 3WKZA 1LJYA 1K9TA 4U85A 1F40A 4JFMA 2FAPA 1T11A 1ZBKA 4Z2KA 2FKEA 3WD2A 2KFWA 3IHZA 1WNOA 4DRPA 4WJXA 1ZK6A 4TW6A 3IKGA 1W1YA 4MTVA 1J4HA 5HKGA 3O5EA 4KQZA 1FKBA 4TNSA 3BXWA 2WM0A 2G8ZA 2XPAA 3WH0A 1ZBCA 2PV1A 1FFQA 2KGJA 1H0IA 2O92A 1H0GA 3IK8A 1LL4A 2KR7A 4FAPA 4MNLA 3RGCA 2DPEA 3IKDA 3CZ8A 3EY6A 3G6LA 4ODQA 4MPKA 1X6NA 3O5IA 2VN1A 4DRMA 4ITZA 4DRNA 4ODNA 4JFKA 3AS3A 2ETNA 2XP8A 1FFRA 4HARA 3PRAA 1GRJA 1FD9A 1VF8A 1EDQA 2DSZA 3OA5A 1Q6IA 3BMBA 3GPKA 1ROUA 3WL0A 5HBFA 1LL6A 2JZVA 1KFWA 2RQSA 2PV2A 4Q7NA 4DROA 4U86A 1SYTA 4UDMA 1FKSA 3CGMA 5HW8A 4DIPA 2RUQA 2PN0A 2ZQVA 4LAVA 1QPLA 1TCOC 2XP9A 3GTYX 4DWSB 3VAWA 1KT1A 3ARZA 2XP7A 2DT2A 2YBUA 3RM8A 1W1TA 1M5YA 2P4VA 1E6ZA 2PI6A 3O5PA 3WIJA 1XHGA 1OGBA 1R9HA 4NZCA 4QT2A 3O5MA 3RM9A 2A3BA 1SR0A 5J6EA 1HJWA 1Y0OA 1JNEA 3B7XA 1FJDA 4LAWA 1D2KA 1WB0A 1D6OA 2F21A 4DWSC 2B5UB 2LKNA 2QF8A 2KI3A 2RUCA 4W9PA 4BF8A 4HBOA 1CTNA 4R0XA 3ARTA 1KT0A 1W26A 1ITXA 4JYSA 3LUOA 4JFLA 1W9PA 2DG9A 2PPNA 1W9UA 4XAKA 2DG3A 4HBEA 1GOIA 4MNKA 3JYMA 4C02B 1NWTA 4J4NA 3WD4A 3PRDA 4Z2GA 5HUAA 1D7IA 1O6IA 4NSBA 2B31A 3UQAA 3H9RB 3O5GA 4ODOA 3O5OA 1ZCNA 3AROA 3ODKA 4IPXA 4TX0A 1E9LA 1Q6UA 2ESCA 2VCDA 4JFJA 2OFNA 1J4RA 4P8WA 4TW8A 4ODRA 1LG2A 1PBKA 1OWQA 1RD6A 1HKJA 5I98A 2EULA 2PPOA 2LJ4A 2MNTA 3FY1A 3UI5A 3KCEA 3EIPA 1HJVA 4ZPVR 1FKHA 2PV3A 3KAIA 2OLHA 2D9FA 3O5LA 3KACA 4LAXA 5HTGA 1GPFA 2MF9A 4LGXA 3B8SA 1N1AA 1HKIA 3CGNA 1EHNA 4L3NA 4U84A 3B9EA 4ODPA 4FN2A 1E6RA 4R5EA 3FXYA 4WKHA 1E44A 2XP3A 3AQUA 2XP4A 1ZB5A 1ZL1A 4QZVB 1NSGA 1NH6A 5B8IC 3KAGA 3I6CA 3UQIA 1QZ2A 4S3JA 4MNJA 2DSUA 2KO7A 4DT4A 3JXVA 3KAFA 4DZ2A 1E6NA 3B9DA 4AY1A 2ZQSA 3CHCA 3O5QA 1A7XA 1PINA 4P8XA 3TDBA 1EQ3A 3ARPA 2IF4A 5GPRA 2M1IA 3O5JA 5GPGA 5HW7A 2XP6A 1ZBVA 3WD3A 1FKIA 2DT3A 4IT6A 3AS1A 1E6PA 4DRIA 4DZ3A 3KZ7A 3JYJA 4GGQA 4MAVA 4TYOA 2Y78A 2DG4A 3CHEA 5GQBA 4Z2IA 1NWRA 3ARYA 4W9OA 4WK9A
chains in the Genus database with same CATH topology
1ROTA 2A3EA 3WL1A 4ML4A 1Q1CA 1FKKA 1FKLA 2M08A 3UI4A 1JNTA 3O5RA 2K8IA 1EIBA 1NWUA 5HWCA 3B9AA 1FKGA 5HWBA 1BKFA 3WD0A 4W9QA 1LL7A 3WQWA 4MNMA 1U79A 3ARRA 2F4EA 4DWSD 2ZR5A 4MSPA 4IT4A 3ALFA 1D7JA 5D75A 4GIVA 1QPFA 1BL4A 4IQCA 2LPVA 3RMEA 1HJXA 1LG1A 2MLZA 3ARSA 5BXJA 3CHDA 4PTMA 2N87A 4J4OA 1UR8A 4DRJA 2DSWA 1FKTA 3CHFA 1B6CA 3W4RA 5DF0A 1JVWA 4Z2JA 1C9HA 3KABA 3O5KA 1YATA 3PRBA 3O5FA 1FKDA 1F8AB 4W5UA 5JH8A 1HKMA 2DT0A 3RFWA 1JNDA 1WAWA 3QOKA 2WLZA 4P8VA 4Z2HA 4WKAA 4O2TA 4ZPWR 3RM4A 1FKFA 2M2AA 4Q22A 4MGVA 4KR0B 1HXVA 1J6YA 3WQVA 2XPBA 5DITA 3UI6A 2MLYA 3ARWA 2UZ5A 5DEZA 4N19A 4DRHA 2XP5A 1X6LA 4DRQA 2ZQTA 4JFIA 1FAPA 4QT3A 3UF8A 2KE0A 3TCZA 2LGOA 1ZU8A 1XRVA 2F2DA 2ITKA 4L72B 1W1PA 4IQ2A 3KADA 1NMWA 1NWSA 2FDMA 3UQBA 2PPPA 1JNSA 2DT1A 4DRKA 1L1PA 2MLXA 1IX5A 3AS2A 4ODLA 3ARQA 4Z2LA 3CH9A 1J4IA 1FKJA 4TW7A 1HKKA 2Q5AA 4S3KA 5DO2A 2MPHA 4ZPTR 3ALGA 2PBCA 3G6MA 4DWSA 3KAHA 4G2PA 2AOSA 3WD1A 2L2SA 3ARUA 2ZQUA 4G50A 4NNRA 4P8UA 5DIVA 1UR9A 1ZBWA 2WK2A 1LQ0A 2RURA 3TC5A 3NRKA 1E15A 1NMVA 3NTPA 4DH0A 3O5DA 4ODKA 4ZS6A 5DIUA 3NI6A 5HT1A 3ARVA 3ARXA 3MDYB 1TFVA 1P5QA 1D7HA 4ODMA 4QIBA 2A3AA 1YW5A 2RUDA 2AWGA 3PR9A 2YBTA 2WLYA 1Q6HA 2G41A 4WKFA 1W9VA 4WIWA 2RSEA 5HW6A 2ZR4A 3OOBA 1FKRA 2IUZA 1GUVA 2A3CA 3PA7A 4URIA 2DSVA 4LAYA 2ZR6A 3AS0A 3FAPA 1W1VA 1EYMA 1OGGA 2O9OA 3WKZA 1LJYA 1K9TA 4U85A 1F40A 4JFMA 2FAPA 1T11A 1ZBKA 4Z2KA 2FKEA 3WD2A 2KFWA 3IHZA 1WNOA 4DRPA 4WJXA 1ZK6A 4TW6A 3IKGA 1W1YA 4MTVA 1J4HA 5HKGA 3O5EA 4KQZA 1FKBA 4TNSA 3BXWA 2WM0A 2G8ZA 2XPAA 3WH0A 1ZBCA 2PV1A 1FFQA 2KGJA 1H0IA 2O92A 1H0GA 3IK8A 1LL4A 2KR7A 4FAPA 4MNLA 3RGCA 2DPEA 3IKDA 3CZ8A 3EY6A 3G6LA 4ODQA 4MPKA 1X6NA 3O5IA 2VN1A 4DRMA 4ITZA 4DRNA 4ODNA 4JFKA 3AS3A 2XP8A 1FFRA 4HARA 3PRAA 1FD9A 1VF8A 1EDQA 2DSZA 3OA5A 1Q6IA 3GPKA 1ROUA 3WL0A 5HBFA 1LL6A 2JZVA 1KFWA 2RQSA 2PV2A 4Q7NA 4DROA 4U86A 1SYTA 1FKSA 3CGMA 5HW8A 4DIPA 2RUQA 2ZQVA 4LAVA 1QPLA 1TCOC 2XP9A 4DWSB 3VAWA 1KT1A 3ARZA 2XP7A 2DT2A 2YBUA 3RM8A 1W1TA 1M5YA 1E6ZA 2PI6A 3O5PA 3WIJA 1XHGA 1OGBA 1R9HA 4NZCA 4QT2A 3O5MA 3RM9A 2A3BA 1SR0A 5J6EA 1HJWA 1Y0OA 1JNEA 3B7XA 1FJDA 4LAWA 1D2KA 1WB0A 1D6OA 2F21A 4DWSC 2LKNA 2QF8A 2KI3A 2RUCA 4W9PA 4BF8A 4HBOA 1CTNA 4R0XA 3ARTA 1KT0A 1W26A 1ITXA 4JYSA 3LUOA 4JFLA 1W9PA 2DG9A 2PPNA 1W9UA 4XAKA 2DG3A 4HBEA 1GOIA 4MNKA 3JYMA 4C02B 1NWTA 4J4NA 3WD4A 3PRDA 4Z2GA 5HUAA 1D7IA 1O6IA 4NSBA 2B31A 3UQAA 3H9RB 3O5GA 4ODOA 3O5OA 1ZCNA 3AROA 3ODKA 4IPXA 4TX0A 1E9LA 1Q6UA 2ESCA 2VCDA 4JFJA 2OFNA 1J4RA 4P8WA 4TW8A 4ODRA 1LG2A 1PBKA 1OWQA 1RD6A 1HKJA 5I98A 2PPOA 2LJ4A 2MNTA 3FY1A 3UI5A 3KCEA 1HJVA 4ZPVR 1FKHA 2PV3A 3KAIA 2OLHA 2D9FA 3O5LA 3KACA 4LAXA 5HTGA 1GPFA 2MF9A 4LGXA 3B8SA 1N1AA 1HKIA 3CGNA 1EHNA 4L3NA 4U84A 3B9EA 4ODPA 4FN2A 1E6RA 4R5EA 3FXYA 4WKHA 2XP3A 3AQUA 2XP4A 1ZB5A 1ZL1A 4QZVB 1NSGA 1NH6A 5B8IC 3KAGA 3I6CA 3UQIA 1QZ2A 4S3JA 4MNJA 2DSUA 2KO7A 4DT4A 3JXVA 3KAFA 4DZ2A 1E6NA 3B9DA 4AY1A 2ZQSA 3CHCA 3O5QA 1A7XA 1PINA 4P8XA 3TDBA 1EQ3A 3ARPA 2IF4A 5GPRA 2M1IA 3O5JA 5GPGA 5HW7A 2XP6A 1ZBVA 3WD3A 1FKIA 2DT3A 4IT6A 3AS1A 1E6PA 4DRIA 4DZ3A 3KZ7A 3JYJA 4GGQA 4MAVA 4TYOA 2Y78A 2DG4A 3CHEA 5GQBA 4Z2IA 1NWRA 3ARYA 4W9OA 4WK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ROT A;  2KR7 A;  1J4I A;  1FKJ A;  4FAP A;  3UQA A;  3RGC A;  3H9R B;  3O5G A;  1Q1C A;  1FKK A;  1FKL A;  3IKD A;  4ODO A;  4TW7 A;  2M08 A;  3EY6 A;  2Q5A A;  1JNT A;  3O5R A;  3O5O A;  1ZCN A;  4IPX A;  3ODK A;  2MPH A;  4ODQ A;  2K8I A;  4TX0 A;  2PBC A;  3O5I A;  1Q6U A;  2VN1 A;  4DRM A;  2VCD A;  4JFJ A;  2OFN A;  1J4R A;  4ITZ A;  4JFK A;  4ODN A;  4DRN A;  5HWC A;  3KAH A;  4G2P A;  1FKG A;  2L2S A;  4TW8 A;  4ODR A;  5HWB A;  2XP8 A;  5HUA A;  1BKF A;  2ZQU A;  1PBK A;  4G50 A;  4W9Q A;  1FD9 A;  4NNR A;  5DIV A;  5I98 A;  1U79 A;  2F4E A;  2PPO A;  1Q6I A;  2LJ4 A;  2ZR5 A;  3GPK A;  4MSP A;  2MNT A;  2RUR A;  3TC5 A;  1D7J A;  5D75 A;  1ROU A;  3NRK A;  1NMV A;  3NTP A;  4GIV A;  1QPF A;  1BL4 A;  4IQC A;  4DH0 A;  2LPV A;  3UI5 A;  3KCE A;  3O5D A;  4ODK A;  2JZV A;  2RQS A;  2PV2 A;  1FKH A;  5DIU A;  2PV3 A;  3NI6 A;  2MLZ A;  3KAI A;  4U86 A;  4DRO A;  5BXJ A;  5HT1 A;  2D9F A;  3MDY B;  3O5L A;  2N87 A;  1P5Q A;  4J4O A;  4DRJ A;  1D7H A;  4ODM A;  1FKS A;  3CGM A;  4QIB A;  5HW8 A;  3KAC A;  1FKT A;  1B6C A;  1YW5 A;  2RUD A;  4LAX A;  4DIP A;  2AWG A;  1JVW A;  2RUQ A;  2ZQV A;  4LAV A;  1QPL A;  1TCO C;  2XP9 A;  5HTG A;  2MF9 A;  3VAW A;  1KT1 A;  1Q6H A;  1N1A A;  2XP7 A;  3CGN A;  1C9H A;  3KAB A;  4U84 A;  1M5Y A;  2RSE A;  3O5K A;  4ODP A;  4FN2 A;  1YAT A;  5HW6 A;  2ZR4 A;  3PRB A;  3O5F A;  1FKD A;  1F8A B;  2XP3 A;  2XP4 A;  3OOB A;  1FKR A;  1NSG A;  3PA7 A;  3O5P A;  3RFW A;  5B8I C;  3KAG A;  3I6C A;  4LAY A;  1QZ2 A;  2ZR6 A;  3UQI A;  1R9H A;  3FAP A;  4QT2 A;  2KO7 A;  3O5M A;  4DT4 A;  1EYM A;  3JXV A;  3KAF A;  4DZ2 A;  5J6E A;  4O2T A;  2ZQS A;  1FKF A;  3O5Q A;  1Y0O A;  2M2A A;  3B7X A;  1HXV A;  4MGV A;  1A7X A;  1PIN A;  1FJD A;  4LAW A;  4U85 A;  1J6Y A;  1F40 A;  2XPB A;  5DIT A;  4JFM A;  3UI6 A;  2FAP A;  1D6O A;  2F21 A;  2MLY A;  2UZ5 A;  3TDB A;  1EQ3 A;  1T11 A;  2IF4 A;  2LKN A;  2FKE A;  4N19 A;  2KI3 A;  2KFW A;  2M1I A;  2RUC A;  2XP5 A;  3IHZ A;  3O5J A;  4W9P A;  5GPG A;  4BF8 A;  4DRH A;  5HW7 A;  2XP6 A;  4DRQ A;  4DRP A;  2ZQT A;  4JFI A;  1FAP A;  1ZK6 A;  1FKI A;  3IKG A;  4TW6 A;  4QT3 A;  4R0X A;  3UF8 A;  2KE0 A;  1J4H A;  4DRI A;  1KT0 A;  1W26 A;  3TCZ A;  3UI4 A;  2LGO A;  4DZ3 A;  4JYS A;  3O5E A;  5HKG A;  3KZ7 A;  3LUO A;  4JFL A;  2F2D A;  2ITK A;  3JYJ A;  4GGQ A;  4TYO A;  1FKB A;  4TNS A;  2Y78 A;  2DG9 A;  2PPN A;  2DG3 A;  2DG4 A;  2XPA A;  4IQ2 A;  3KAD A;  1NMW A;  3JYM A;  4C02 B;  3WH0 A;  4W9O A;  3UQB A;  2PPP A;  2PV1 A;  2KGJ A;  1JNS A;  4J4N A;  4DRK A;  3PRD A;  1L1P A;  2MLX A;  4ODL A;  1D7I A;  3IK8 A; 
#chains in the Genus database with same CATH topology
 1ROT A;  2A3E A;  3WL1 A;  4ML4 A;  1Q1C A;  1FKK A;  1FKL A;  2M08 A;  3UI4 A;  1JNT A;  3O5R A;  2K8I A;  1EIB A;  1NWU A;  5HWC A;  3B9A A;  1FKG A;  5HWB A;  1BKF A;  3WD0 A;  4W9Q A;  1LL7 A;  3WQW A;  4MNM A;  1U79 A;  3ARR A;  2F4E A;  4DWS D;  2ZR5 A;  4MSP A;  4IT4 A;  3ALF A;  1D7J A;  5D75 A;  4GIV A;  1QPF A;  1BL4 A;  4IQC A;  2LPV A;  3RME A;  1HJX A;  1LG1 A;  2MLZ A;  3ARS A;  5BXJ A;  3CHD A;  4PTM A;  2N87 A;  4J4O A;  1UR8 A;  4DRJ A;  2DSW A;  1FKT A;  3CHF A;  1B6C A;  3W4R A;  5DF0 A;  1JVW A;  4Z2J A;  2F23 A;  1C9H A;  3KAB A;  3O5K A;  1YAT A;  3PRB A;  3O5F A;  1FKD A;  1F8A B;  4W5U A;  5JH8 A;  1HKM A;  2DT0 A;  3RFW A;  1JND A;  1WAW A;  3GU0 A;  3QOK A;  2WLZ A;  4P8V A;  4Z2H A;  4WKA A;  4O2T A;  4ZPW R;  3RM4 A;  1FKF A;  2M2A A;  4Q22 A;  4MGV A;  4KR0 B;  1HXV A;  1J6Y A;  3WQV A;  2XPB A;  5DIT A;  3UI6 A;  2MLY A;  3ARW A;  2UZ5 A;  5DEZ A;  4N19 A;  4DRH A;  2XP5 A;  1X6L A;  4DRQ A;  2ZQT A;  4JFI A;  1FAP A;  4QT3 A;  3UF8 A;  2KE0 A;  3TCZ A;  2LGO A;  1ZU8 A;  1XRV A;  2F2D A;  2ITK A;  4L72 B;  1W1P A;  4IQ2 A;  3KAD A;  1NMW A;  1NWS A;  2FDM A;  3UQB A;  2PPP A;  1JNS A;  2DT1 A;  4DRK A;  1L1P A;  2MLX A;  1IX5 A;  3AS2 A;  4ODL A;  3ARQ A;  4Z2L A;  3CH9 A;  1J4I A;  1FKJ A;  4TW7 A;  1HKK A;  2Q5A A;  4S3K A;  5DO2 A;  2MPH A;  4ZPT R;  3ALG A;  2PBC A;  3G6M A;  4DWS A;  3KAH A;  4G2P A;  2AOS A;  3WD1 A;  2L2S A;  3ARU A;  2ZQU A;  4G50 A;  4NNR A;  4P8U A;  5DIV A;  1UR9 A;  1ZBW A;  2WK2 A;  1LQ0 A;  2RUR A;  3TC5 A;  3NRK A;  1E15 A;  1NMV A;  3NTP A;  4DH0 A;  3O5D A;  4ODK A;  4ZS6 A;  5DIU A;  3NI6 A;  5HT1 A;  3ARV A;  3ARX A;  3MDY B;  1TFV A;  1P5Q A;  1D7H A;  4ODM A;  4QIB A;  2A3A A;  1YW5 A;  2RUD A;  2AWG A;  3PR9 A;  2YBT A;  2WLY A;  1Q6H A;  2G41 A;  4WKF A;  1W9V A;  4WIW A;  2RSE A;  5HW6 A;  2ZR4 A;  3OOB A;  1FKR A;  2IUZ A;  1GUV A;  2A3C A;  3PA7 A;  4URI A;  2DSV A;  1JCH B;  4LAY A;  2ZR6 A;  3AS0 A;  3FAP A;  1W1V A;  1EYM A;  1OGG A;  2O9O A;  3WKZ A;  1LJY A;  1K9T A;  4U85 A;  1F40 A;  4JFM A;  2FAP A;  1T11 A;  1ZBK A;  4Z2K A;  2FKE A;  3WD2 A;  2KFW A;  3IHZ A;  1WNO A;  4DRP A;  4WJX A;  1ZK6 A;  4TW6 A;  3IKG A;  1W1Y A;  4MTV A;  1J4H A;  5HKG A;  3O5E A;  4KQZ A;  1FKB A;  4TNS A;  3BXW A;  2WM0 A;  2G8Z A;  2XPA A;  3WH0 A;  1ZBC A;  2PV1 A;  1FFQ A;  2KGJ A;  1H0I A;  2O92 A;  1H0G A;  3IK8 A;  1LL4 A;  2KR7 A;  4FAP A;  4MNL A;  3RGC A;  2DPE A;  3IKD A;  3CZ8 A;  3EY6 A;  3G6L A;  4ODQ A;  4MPK A;  1X6N A;  3O5I A;  2VN1 A;  4DRM A;  4ITZ A;  4DRN A;  4ODN A;  4JFK A;  3AS3 A;  2ETN A;  2XP8 A;  1FFR A;  4HAR A;  3PRA A;  1GRJ A;  1FD9 A;  1VF8 A;  1EDQ A;  2DSZ A;  3OA5 A;  1Q6I A;  3BMB A;  3GPK A;  1ROU A;  3WL0 A;  5HBF A;  1LL6 A;  2JZV A;  1KFW A;  2RQS A;  2PV2 A;  4Q7N A;  4DRO A;  4U86 A;  1SYT A;  4UDM A;  1FKS A;  3CGM A;  5HW8 A;  4DIP A;  2RUQ A;  2PN0 A;  2ZQV A;  4LAV A;  1QPL A;  1TCO C;  2XP9 A;  3GTY X;  4DWS B;  3VAW A;  1KT1 A;  3ARZ A;  2XP7 A;  2DT2 A;  2YBU A;  3RM8 A;  1W1T A;  1M5Y A;  2P4V A;  1E6Z A;  2PI6 A;  3O5P A;  3WIJ A;  1XHG A;  1OGB A;  1R9H A;  4NZC A;  4QT2 A;  3O5M A;  3RM9 A;  2A3B A;  1SR0 A;  5J6E A;  1HJW A;  1Y0O A;  1JNE A;  3B7X A;  1FJD A;  4LAW A;  1D2K A;  1WB0 A;  1D6O A;  2F21 A;  4DWS C;  2B5U B;  2LKN A;  2QF8 A;  2KI3 A;  2RUC A;  4W9P A;  4BF8 A;  4HBO A;  1CTN A;  4R0X A;  3ART A;  1KT0 A;  1W26 A;  1ITX A;  4JYS A;  3LUO A;  4JFL A;  1W9P A;  2DG9 A;  2PPN A;  1W9U A;  4XAK A;  2DG3 A;  4HBE A;  1GOI A;  4MNK A;  3JYM A;  4C02 B;  1NWT A;  4J4N A;  3WD4 A;  3PRD A;  4Z2G A;  5HUA A;  1D7I A;  1O6I A;  4NSB A;  2B31 A;  3UQA A;  3H9R B;  3O5G A;  4ODO A;  3O5O A;  1ZCN A;  3ARO A;  3ODK A;  4IPX A;  4TX0 A;  1E9L A;  1Q6U A;  2ESC A;  2VCD A;  4JFJ A;  2OFN A;  1J4R A;  4P8W A;  4TW8 A;  4ODR A;  1LG2 A;  1PBK A;  1OWQ A;  1RD6 A;  1HKJ A;  5I98 A;  2EUL A;  2PPO A;  2LJ4 A;  2MNT A;  3FY1 A;  3UI5 A;  3KCE A;  3EIP A;  1HJV A;  4ZPV R;  1FKH A;  2PV3 A;  3KAI A;  2OLH A;  2D9F A;  3O5L A;  3KAC A;  4LAX A;  5HTG A;  1GPF A;  2MF9 A;  4LGX A;  3B8S A;  1N1A A;  1HKI A;  3CGN A;  1EHN A;  4L3N A;  4U84 A;  3B9E A;  4ODP A;  4FN2 A;  1E6R A;  4R5E A;  3FXY A;  4WKH A;  1E44 A;  2XP3 A;  3AQU A;  2XP4 A;  1ZB5 A;  1ZL1 A;  4QZV B;  1NSG A;  1NH6 A;  5B8I C;  3KAG A;  3I6C A;  3UQI A;  1QZ2 A;  4S3J A;  4MNJ A;  2DSU A;  2KO7 A;  4DT4 A;  3JXV A;  3KAF A;  4DZ2 A;  1E6N A;  3B9D A;  4AY1 A;  2ZQS A;  3CHC A;  3O5Q A;  1A7X A;  1PIN A;  4P8X A;  3TDB A;  1EQ3 A;  3ARP A;  2IF4 A;  5GPR A;  2M1I A;  3O5J A;  5GPG A;  5HW7 A;  2XP6 A;  1ZBV A;  3WD3 A;  1FKI A;  2DT3 A;  4IT6 A;  3AS1 A;  1E6P A;  4DRI A;  4DZ3 A;  3KZ7 A;  3JYJ A;  4GGQ A;  4MAV A;  4TYO A;  2Y78 A;  2DG4 A;  3CHE A;  5GQB A;  4Z2I A;  1NWR A;  3ARY A;  4W9O A;  4WK9 A; 
#chains in the Genus database with same CATH homology
 1ROT A;  2A3E A;  3WL1 A;  4ML4 A;  1Q1C A;  1FKK A;  1FKL A;  2M08 A;  3UI4 A;  1JNT A;  3O5R A;  2K8I A;  1EIB A;  1NWU A;  5HWC A;  3B9A A;  1FKG A;  5HWB A;  1BKF A;  3WD0 A;  4W9Q A;  1LL7 A;  3WQW A;  4MNM A;  1U79 A;  3ARR A;  2F4E A;  4DWS D;  2ZR5 A;  4MSP A;  4IT4 A;  3ALF A;  1D7J A;  5D75 A;  4GIV A;  1QPF A;  1BL4 A;  4IQC A;  2LPV A;  3RME A;  1HJX A;  1LG1 A;  2MLZ A;  3ARS A;  5BXJ A;  3CHD A;  4PTM A;  2N87 A;  4J4O A;  1UR8 A;  4DRJ A;  2DSW A;  1FKT A;  3CHF A;  1B6C A;  3W4R A;  5DF0 A;  1JVW A;  4Z2J A;  1C9H A;  3KAB A;  3O5K A;  1YAT A;  3PRB A;  3O5F A;  1FKD A;  1F8A B;  4W5U A;  5JH8 A;  1HKM A;  2DT0 A;  3RFW A;  1JND A;  1WAW A;  3QOK A;  2WLZ A;  4P8V A;  4Z2H A;  4WKA A;  4O2T A;  4ZPW R;  3RM4 A;  1FKF A;  2M2A A;  4Q22 A;  4MGV A;  4KR0 B;  1HXV A;  1J6Y A;  3WQV A;  2XPB A;  5DIT A;  3UI6 A;  2MLY A;  3ARW A;  2UZ5 A;  5DEZ A;  4N19 A;  4DRH A;  2XP5 A;  1X6L A;  4DRQ A;  2ZQT A;  4JFI A;  1FAP A;  4QT3 A;  3UF8 A;  2KE0 A;  3TCZ A;  2LGO A;  1ZU8 A;  1XRV A;  2F2D A;  2ITK A;  4L72 B;  1W1P A;  4IQ2 A;  3KAD A;  1NMW A;  1NWS A;  2FDM A;  3UQB A;  2PPP A;  1JNS A;  2DT1 A;  4DRK A;  1L1P A;  2MLX A;  1IX5 A;  3AS2 A;  4ODL A;  3ARQ A;  4Z2L A;  3CH9 A;  1J4I A;  1FKJ A;  4TW7 A;  1HKK A;  2Q5A A;  4S3K A;  5DO2 A;  2MPH A;  4ZPT R;  3ALG A;  2PBC A;  3G6M A;  4DWS A;  3KAH A;  4G2P A;  2AOS A;  3WD1 A;  2L2S A;  3ARU A;  2ZQU A;  4G50 A;  4NNR A;  4P8U A;  5DIV A;  1UR9 A;  1ZBW A;  2WK2 A;  1LQ0 A;  2RUR A;  3TC5 A;  3NRK A;  1E15 A;  1NMV A;  3NTP A;  4DH0 A;  3O5D A;  4ODK A;  4ZS6 A;  5DIU A;  3NI6 A;  5HT1 A;  3ARV A;  3ARX A;  3MDY B;  1TFV A;  1P5Q A;  1D7H A;  4ODM A;  4QIB A;  2A3A A;  1YW5 A;  2RUD A;  2AWG A;  3PR9 A;  2YBT A;  2WLY A;  1Q6H A;  2G41 A;  4WKF A;  1W9V A;  4WIW A;  2RSE A;  5HW6 A;  2ZR4 A;  3OOB A;  1FKR A;  2IUZ A;  1GUV A;  2A3C A;  3PA7 A;  4URI A;  2DSV A;  4LAY A;  2ZR6 A;  3AS0 A;  3FAP A;  1W1V A;  1EYM A;  1OGG A;  2O9O A;  3WKZ A;  1LJY A;  1K9T A;  4U85 A;  1F40 A;  4JFM A;  2FAP A;  1T11 A;  1ZBK A;  4Z2K A;  2FKE A;  3WD2 A;  2KFW A;  3IHZ A;  1WNO A;  4DRP A;  4WJX A;  1ZK6 A;  4TW6 A;  3IKG A;  1W1Y A;  4MTV A;  1J4H A;  5HKG A;  3O5E A;  4KQZ A;  1FKB A;  4TNS A;  3BXW A;  2WM0 A;  2G8Z A;  2XPA A;  3WH0 A;  1ZBC A;  2PV1 A;  1FFQ A;  2KGJ A;  1H0I A;  2O92 A;  1H0G A;  3IK8 A;  1LL4 A;  2KR7 A;  4FAP A;  4MNL A;  3RGC A;  2DPE A;  3IKD A;  3CZ8 A;  3EY6 A;  3G6L A;  4ODQ A;  4MPK A;  1X6N A;  3O5I A;  2VN1 A;  4DRM A;  4ITZ A;  4DRN A;  4ODN A;  4JFK A;  3AS3 A;  2XP8 A;  1FFR A;  4HAR A;  3PRA A;  1FD9 A;  1VF8 A;  1EDQ A;  2DSZ A;  3OA5 A;  1Q6I A;  3GPK A;  1ROU A;  3WL0 A;  5HBF A;  1LL6 A;  2JZV A;  1KFW A;  2RQS A;  2PV2 A;  4Q7N A;  4DRO A;  4U86 A;  1SYT A;  1FKS A;  3CGM A;  5HW8 A;  4DIP A;  2RUQ A;  2ZQV A;  4LAV A;  1QPL A;  1TCO C;  2XP9 A;  4DWS B;  3VAW A;  1KT1 A;  3ARZ A;  2XP7 A;  2DT2 A;  2YBU A;  3RM8 A;  1W1T A;  1M5Y A;  1E6Z A;  2PI6 A;  3O5P A;  3WIJ A;  1XHG A;  1OGB A;  1R9H A;  4NZC A;  4QT2 A;  3O5M A;  3RM9 A;  2A3B A;  1SR0 A;  5J6E A;  1HJW A;  1Y0O A;  1JNE A;  3B7X A;  1FJD A;  4LAW A;  1D2K A;  1WB0 A;  1D6O A;  2F21 A;  4DWS C;  2LKN A;  2QF8 A;  2KI3 A;  2RUC A;  4W9P A;  4BF8 A;  4HBO A;  1CTN A;  4R0X A;  3ART A;  1KT0 A;  1W26 A;  1ITX A;  4JYS A;  3LUO A;  4JFL A;  1W9P A;  2DG9 A;  2PPN A;  1W9U A;  4XAK A;  2DG3 A;  4HBE A;  1GOI A;  4MNK A;  3JYM A;  4C02 B;  1NWT A;  4J4N A;  3WD4 A;  3PRD A;  4Z2G A;  5HUA A;  1D7I A;  1O6I A;  4NSB A;  2B31 A;  3UQA A;  3H9R B;  3O5G A;  4ODO A;  3O5O A;  1ZCN A;  3ARO A;  3ODK A;  4IPX A;  4TX0 A;  1E9L A;  1Q6U A;  2ESC A;  2VCD A;  4JFJ A;  2OFN A;  1J4R A;  4P8W A;  4TW8 A;  4ODR A;  1LG2 A;  1PBK A;  1OWQ A;  1RD6 A;  1HKJ A;  5I98 A;  2PPO A;  2LJ4 A;  2MNT A;  3FY1 A;  3UI5 A;  3KCE A;  1HJV A;  4ZPV R;  1FKH A;  2PV3 A;  3KAI A;  2OLH A;  2D9F A;  3O5L A;  3KAC A;  4LAX A;  5HTG A;  1GPF A;  2MF9 A;  4LGX A;  3B8S A;  1N1A A;  1HKI A;  3CGN A;  1EHN A;  4L3N A;  4U84 A;  3B9E A;  4ODP A;  4FN2 A;  1E6R A;  4R5E A;  3FXY A;  4WKH A;  2XP3 A;  3AQU A;  2XP4 A;  1ZB5 A;  1ZL1 A;  4QZV B;  1NSG A;  1NH6 A;  5B8I C;  3KAG A;  3I6C A;  3UQI A;  1QZ2 A;  4S3J A;  4MNJ A;  2DSU A;  2KO7 A;  4DT4 A;  3JXV A;  3KAF A;  4DZ2 A;  1E6N A;  3B9D A;  4AY1 A;  2ZQS A;  3CHC A;  3O5Q A;  1A7X A;  1PIN A;  4P8X A;  3TDB A;  1EQ3 A;  3ARP A;  2IF4 A;  5GPR A;  2M1I A;  3O5J A;  5GPG A;  5HW7 A;  2XP6 A;  1ZBV A;  3WD3 A;  1FKI A;  2DT3 A;  4IT6 A;  3AS1 A;  1E6P A;  4DRI A;  4DZ3 A;  3KZ7 A;  3JYJ A;  4GGQ A;  4MAV A;  4TYO A;  2Y78 A;  2DG4 A;  3CHE A;  5GQB A;  4Z2I A;  1NWR A;  3ARY A;  4W9O A;  4WK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...