2PPOA

Crystal structure of e60a mutant of fkbp12
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWAEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords FK506-binding protein 1A
publication title Structural coupling between FKBP12 and buried water.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ppoA00
1D7IA 4GIVA 2ZQSA 1FKGA 2VCDA 2L2SA 1Q6HA 4IQCA 4ITZA 3IHZA 3O5EA 2PPOA 3UI6A 1NMWA 1PBKA 2XP6A 2D9FA 1JNTA 1ROTA 3MDYB 3O5PA 4ODQA 1BKFA 1TCOC 1FKLA 1BL4A 1Q6UA 4J4NA 2FKEA 4W9PA 1ROUA 1U79A 1FJDA 2JZVA 2M2AA 2RUDA 2XP3A 4QIBA 1FKIA 1M5YA 2Y78A 2ZR5A 4DRNA 2XP7A 3KAIA 4JFIA 4LAVA 1D6OA 1FKFA 1D7JA 4FN2A 5HW7A 3UQAA 4MGVA 1P5QA 3I6CA 5HTGA 1EQ3A 4N19A 3JYMA 2KGJA 3IK8A 2F21A 2MPHA 3IKGA 4ODOA 5D75A 4DROA 2LPVA 1PINA 4J4OA 1KT1A 4DIPA 3ODKA 4BF8A 4W9QA 3CGMA 3VAWA 4MSPA 3O5KA 3KAGA 4ODPA 1YW5A 2PV3A 2KI3A 3O5MA 4LAXA 4DRJA 5HT1A 4DRPA 1B6CA 4LAYA 5HW8A 3PA7A 1FKKA 3IKDA 3O5DA 4IQ2A 2XP9A 4ODRA 3H9RB 3KZ7A 1W26A 3NRKA 5J6EA 1D7HA 2MLXA 5GPGA 3JXVA 4ODMA 2PV1A 2VN1A 2LKNA 4DH0A 2RUCA 3UI4A 4IPXA 1QPLA 5HW6A 4U84A 1YATA 2IF4A 3B7XA 3JYJA 1L1PA 1J6YA 5I98A 3O5IA 4ODKA 3O5GA 4W9OA 4JFKA 3LUOA 1NSGA 2XP4A 4DRQA 1ZK6A 3KAFA 3GPKA 1ZCNA 3O5FA 5DIUA 1FKBA 1N1AA 2KR7A 2RUQA 2KE0A 2ZQUA 3O5LA 3KABA 2PBCA 1C9HA 3UI5A 4JYSA 4C02B 1F8AB 4JFMA 4TW8A 3OOBA 4GGQA 2KO7A 1Q1CA 2XP8A 5DIVA 5BXJA 5HUAA 4JFJA 2F2DA 1FKRA 2MF9A 2OFNA 1FAPA 4QT2A 2DG3A 1EYMA 2PPPA 4U85A 2ZR6A 2UZ5A 1R9HA 2M1IA 3FAPA 5DITA 3UQBA 1FD9A 4QT3A 1JNSA 1HXVA 4DT4A 3O5QA 3NTPA 1FKTA 2RSEA 3KADA 3O5RA 3TDBA 2M08A 4DRKA 1J4IA 1T11A 4ODLA 4G50A 1J4HA 1Q6IA 1NMVA 3UQIA 4DZ2A 3RFWA 5HWCA 3RGCA 2AWGA 1QZ2A 2LJ4A 3NI6A 3PRBA 4LAWA 4O2TA 3KCEA 4NNRA 1KT0A 4TNSA 2ZR4A 3O5OA 2MLZA 4TW6A 3PRDA 2XP5A 2XPBA 1JVWA 4DZ3A 4TX0A 3UF8A 3CGNA 2ZQTA 1FKJA 4R0XA 4U86A 3TCZA 2DG4A 4DRHA 2Q5AA 1F40A 4TYOA 1Y0OA 2XPAA 1FKHA 2ZQVA 2K8IA 2LGOA 2MLYA 4DRIA 4DRMA 3O5JA 4TW7A 2N87A 2DG9A 4G2PA 4ODNA 4FAPA 5HWBA 1QPFA 3EY6A 2KFWA 2F4EA 3KAHA 5HKGA 2RQSA 3TC5A 1FKSA 3KACA 1J4RA 2PV2A 5B8IC 1A7XA 2ITKA 1FKDA 3WH0A 2MNTA 4JFLA 2FAPA 2RURA 2PPNA
chains in the Genus database with same CATH superfamily
4UDMA 3WD1A 2ZQSA 1FKGA 2VCDA 4R5EA 4ITZA 3IHZA 1WNOA 2G41A 3UI6A 4ODQA 2D9FA 1JNTA 3MDYB 3O5PA 1BKFA 1TCOC 2WLZA 4W9PA 2FKEA 1U79A 3ARSA 2A3CA 4QIBA 2Y78A 2PN0A 2ZR5A 3G6MA 3UQAA 4MGVA 1EQ3A 1HJVA 4N19A 2KGJA 4MNMA 3IK8A 4AY1A 3IKGA 4P8UA 4ODOA 5D75A 4DROA 1KT1A 1GPFA 4W9QA 3VAWA 1NWUA 4MSPA 2KI3A 1KFWA 2DSWA 4IQ2A 2XP9A 5J6EA 3W4RA 4P8VA 3JXVA 1HKJA 1YATA 4ODKA 2A3AA 3WKZA 4JFKA 4P8XA 2XP4A 1W1VA 5DIUA 4KR0B 3CZ8A 5DO2A 1UR8A 4Z2HA 4JYSA 4JFMA 5DEZA 4TW8A 3OOBA 5BXJA 2KO7A 1E9LA 1Q1CA 3ALFA 1FAPA 4QT2A 2PPPA 1HJWA 1ZB5A 1UR9A 2UZ5A 1LG1A 3ARZA 4QT3A 1JNSA 1TFVA 2OLHA 1HKMA 1J4HA 3RFWA 3RMEA 3PRBA 4O2TA 3AS3A 2O9OA 1SYTA 4ZPVR 4MNJA 2MLZA 1JVWA 4TX0A 1L1PA 2ZQTA 3WIJA 2Q5AA 1W1TA 2MLYA 4DRMA 2N87A 2DG9A 3B9DA 4HARA 5HWBA 3EY6A 2F4EA 1HKIA 2B5UB 2DSUA 5B8IC 1E6PA 4NZCA 2FAPA 1LG2A 1D7IA 4DWSC 2L2SA 1LL4A 1Q6HA 1X6NA 1OGGA 2A3EA 2PPOA 1NMWA 1PBKA 2XP6A 1FKLA 3WQWA 1XHGA 1ROUA 1K9TA 3AS0A 4DRNA 1ZL1A 1D6OA 3WL1A 5HW7A 4WIWA 2YBTA 1P5QA 2WLYA 5JH8A 2F21A 2MPHA 4HBEA 1VF8A 1PINA 4IT4A 4J4OA 4BF8A 1LL6A 3O5KA 4S3KA 2DT2A 2PV3A 4DRPA 3O5MA 1FFQA 4DRJA 1E44A 1FKKA 2WK2A 4ML4A 5GQBA 1D7HA 1CTNA 4ODMA 4DH0A 2B31A 3UI4A 1E6ZA 2IF4A 1NWSA 3WQVA 3JYJA 1J6YA 4XAKA 4W9OA 2DT3A 1W9UA 3ARUA 2FDMA 1W1PA 3FY1A 1N1AA 2RUQA 2KE0A 3ARPA 3KABA 2PBCA 4Z2LA 1O6IA 4GGQA 5DIVA 2XP8A 2MF9A 2OFNA 2DG3A 3RM8A 3RM9A 3UQBA 1FD9A 1FKTA 3TDBA 2M08A 4G50A 1JNDA 1Q6IA 1NMVA 4MTVA 3RGCA 2AWGA 1QZ2A 2LJ4A 4LAWA 5HWCA 1KT0A 3RM4A 3WD2A 4TW6A 2IUZA 3GTYX 1D2KA 4QZVB 3CGNA 1H0IA 1Y0OA 1FKHA 4Z2KA 4FAPA 5HKGA 1E6RA 2WM0A 3CHCA 1FKSA 1ZBCA 1J4RA 4PTMA 1A7XA 4Q7NA 3WH0A 4Z2IA 4MNKA 4WKFA 4GIVA 5GPRA 4IT6A 2PI6A 3O5EA 3ARRA 4WK9A 2JZVA 2M2AA 1OGBA 2RUDA 1FKIA 1GOIA 1M5YA 1RD6A 2XP7A 4JFIA 4LAVA 3B8SA 1FKFA 1D7JA 3I6CA 5HTGA 2LPVA 1E15A 4DIPA 3ODKA 3CGMA 3OA5A 3WD3A 3PR9A 4DWSB 1JCHB 2QF8A 1YW5A 4LAXA 1ZBVA 3ARXA 1B6CA 5HW8A 3PA7A 4L72B 3AROA 3ARWA 3H9RB 1W26A 3KZ7A 5GPGA 2PV1A 2LKNA 4IPXA 1QPLA 4U84A 1H0GA 3B7XA 5I98A 1NH6A 3LUOA 1NSGA 3AS1A 4DRQA 2P4VA 4L3NA 1ZCNA 2ZQUA 1C9HA 3CHEA 4C02B 1F8AB 2ESCA 3EIPA 5HUAA 4JFJA 1EIBA 5HBFA 1EYMA 2ZR6A 3FAPA 1R9HA 2M1IA 5DITA 3CHDA 2RSEA 3KADA 3O5RA 4DRKA 1J4IA 4S3JA 4DZ2A 3KCEA 4NNRA 4TNSA 1GRJA 2ZR4A 3PRDA 2XP5A 3WD0A 4DWSA 4ZPWR 4Z2GA 1FKJA 1IX5A 2A3BA 2DG4A 1F40A 2XPAA 4DRIA 3O5JA 2DPEA 4G2PA 2DT0A 3GU0A 3KAHA 2KFWA 3AQUA 1FFRA 2RQSA 1ITXA 3KACA 2PV2A 2DSVA 3ALGA 3ARTA 2ITKA 2RURA 3CH9A 4LGXA 4P8WA 4IQCA 3WD4A 3ARQA 1SR0A 3QOKA 4WKHA 3ARVA 1ROTA 1BL4A 1Q6UA 4J4NA 1FJDA 1W9PA 2XP3A 2F23A 3B9EA 4URIA 3KAIA 2ETNA 1HKKA 4FN2A 4MPKA 3JYMA 1WB0A 3PRAA 4Z2JA 2DT1A 1X6LA 2DSZA 3KAGA 4HBOA 4ODPA 5HT1A 4Q22A 4KQZA 4ZPTR 4LAYA 3G6LA 4ODRA 3IKDA 3O5DA 3NRKA 2MLXA 1GUVA 2VN1A 4ZS6A 2RUCA 5HW6A 3BXWA 4MNLA 3O5IA 2O92A 1HJXA 3O5GA 3ARYA 1LQ0A 1XRVA 1ZK6A 3KAFA 3GPKA 3O5FA 4NSBA 1FKBA 1NWTA 2KR7A 3O5LA 3UI5A 3B9AA 4MAVA 4WJXA 2F2DA 1FKRA 4U85A 1HXVA 1ZBWA 1NWRA 3O5QA 4DT4A 3NTPA 1W9VA 3CHFA 3FXYA 1T11A 4ODLA 1E6NA 2AOSA 3UQIA 3BMBA 1WAWA 3NI6A 1ZU8A 3O5OA 4WKAA 2XPBA 2G8ZA 4DZ3A 3UF8A 1JNEA 4DRHA 4U86A 4R0XA 3TCZA 4TYOA 2ZQVA 2K8IA 2EULA 2LGOA 5DF0A 4TW7A 4DWSD 4ODNA 1LL7A 1QPFA 3WL0A 1ZBKA 4W5UA 1EDQA 3TC5A 1W1YA 2YBUA 1LJYA 1FKDA 2MNTA 4JFLA 1EHNA 2PPNA 1OWQA 3AS2A
chains in the Genus database with same CATH topology
3WD1A 2ZQSA 1FKGA 2VCDA 4R5EA 4ITZA 3IHZA 1WNOA 2G41A 3UI6A 4ODQA 2D9FA 1JNTA 3MDYB 3O5PA 1BKFA 1TCOC 2WLZA 4W9PA 2FKEA 1U79A 3ARSA 2A3CA 4QIBA 2Y78A 2ZR5A 3G6MA 3UQAA 4MGVA 1EQ3A 1HJVA 4N19A 2KGJA 4MNMA 3IK8A 4AY1A 3IKGA 4P8UA 4ODOA 5D75A 4DROA 1KT1A 1GPFA 4W9QA 3VAWA 1NWUA 4MSPA 2KI3A 1KFWA 2DSWA 4IQ2A 2XP9A 5J6EA 3W4RA 4P8VA 3JXVA 1HKJA 1YATA 4ODKA 2A3AA 3WKZA 4JFKA 4P8XA 2XP4A 1W1VA 5DIUA 4KR0B 3CZ8A 5DO2A 1UR8A 4Z2HA 4JYSA 4JFMA 5DEZA 4TW8A 3OOBA 5BXJA 2KO7A 1E9LA 1Q1CA 3ALFA 1FAPA 4QT2A 2PPPA 1HJWA 1ZB5A 1UR9A 2UZ5A 1LG1A 3ARZA 4QT3A 1JNSA 1TFVA 2OLHA 1HKMA 1J4HA 3RFWA 3RMEA 3PRBA 4O2TA 3AS3A 2O9OA 1SYTA 4ZPVR 4MNJA 2MLZA 1JVWA 4TX0A 1L1PA 2ZQTA 3WIJA 2Q5AA 1W1TA 2MLYA 4DRMA 2N87A 2DG9A 3B9DA 4HARA 5HWBA 3EY6A 2F4EA 1HKIA 2DSUA 5B8IC 1E6PA 4NZCA 2FAPA 1LG2A 1D7IA 4DWSC 2L2SA 1LL4A 1Q6HA 1X6NA 1OGGA 2A3EA 2PPOA 1NMWA 1PBKA 2XP6A 1FKLA 3WQWA 1XHGA 1ROUA 1K9TA 3AS0A 4DRNA 1ZL1A 1D6OA 3WL1A 5HW7A 4WIWA 2YBTA 1P5QA 2WLYA 5JH8A 2F21A 2MPHA 4HBEA 1VF8A 1PINA 4IT4A 4J4OA 4BF8A 1LL6A 3O5KA 4S3KA 2DT2A 2PV3A 4DRPA 3O5MA 1FFQA 4DRJA 1FKKA 2WK2A 4ML4A 5GQBA 1D7HA 1CTNA 4ODMA 4DH0A 2B31A 3UI4A 1E6ZA 2IF4A 1NWSA 3WQVA 3JYJA 1J6YA 4XAKA 4W9OA 2DT3A 1W9UA 3ARUA 2FDMA 1W1PA 3FY1A 1N1AA 2RUQA 2KE0A 3ARPA 3KABA 2PBCA 4Z2LA 1O6IA 4GGQA 5DIVA 2XP8A 2MF9A 2OFNA 2DG3A 3RM8A 3RM9A 3UQBA 1FD9A 1FKTA 3TDBA 2M08A 4G50A 1JNDA 1Q6IA 1NMVA 4MTVA 3RGCA 2AWGA 1QZ2A 2LJ4A 4LAWA 5HWCA 1KT0A 3RM4A 3WD2A 4TW6A 2IUZA 1D2KA 4QZVB 3CGNA 1H0IA 1Y0OA 1FKHA 4Z2KA 4FAPA 5HKGA 1E6RA 2WM0A 3CHCA 1FKSA 1ZBCA 1J4RA 4PTMA 1A7XA 4Q7NA 3WH0A 4Z2IA 4MNKA 4WKFA 4GIVA 5GPRA 4IT6A 2PI6A 3O5EA 3ARRA 4WK9A 2JZVA 2M2AA 1OGBA 2RUDA 1FKIA 1GOIA 1M5YA 1RD6A 2XP7A 4JFIA 4LAVA 3B8SA 1FKFA 1D7JA 3I6CA 5HTGA 2LPVA 1E15A 4DIPA 3ODKA 3CGMA 3OA5A 3WD3A 3PR9A 4DWSB 2QF8A 1YW5A 4LAXA 1ZBVA 3ARXA 1B6CA 5HW8A 3PA7A 4L72B 3AROA 3ARWA 3H9RB 1W26A 3KZ7A 5GPGA 2PV1A 2LKNA 4IPXA 1QPLA 4U84A 1H0GA 3B7XA 5I98A 1NH6A 3LUOA 1NSGA 3AS1A 4DRQA 4L3NA 1ZCNA 2ZQUA 1C9HA 3CHEA 4C02B 1F8AB 2ESCA 5HUAA 4JFJA 1EIBA 5HBFA 1EYMA 2ZR6A 3FAPA 1R9HA 2M1IA 5DITA 3CHDA 2RSEA 3KADA 3O5RA 4DRKA 1J4IA 4S3JA 4DZ2A 3KCEA 4NNRA 4TNSA 2ZR4A 3PRDA 2XP5A 3WD0A 4DWSA 4ZPWR 4Z2GA 1FKJA 1IX5A 2A3BA 2DG4A 1F40A 2XPAA 4DRIA 3O5JA 2DPEA 4G2PA 2DT0A 2KFWA 3KAHA 3AQUA 1FFRA 2RQSA 1ITXA 3KACA 2PV2A 2DSVA 3ALGA 3ARTA 2ITKA 2RURA 3CH9A 4LGXA 4P8WA 4IQCA 3WD4A 3ARQA 1SR0A 3QOKA 4WKHA 3ARVA 1ROTA 1BL4A 1Q6UA 4J4NA 1FJDA 1W9PA 2XP3A 4URIA 3B9EA 3KAIA 1HKKA 4FN2A 4MPKA 3JYMA 1WB0A 3PRAA 4Z2JA 2DT1A 1X6LA 2DSZA 3KAGA 4HBOA 4ODPA 5HT1A 4Q22A 4KQZA 4ZPTR 4LAYA 3G6LA 4ODRA 3IKDA 3O5DA 3NRKA 2MLXA 1GUVA 2VN1A 4ZS6A 2RUCA 5HW6A 3BXWA 4MNLA 3O5IA 2O92A 1HJXA 3O5GA 3ARYA 1LQ0A 1XRVA 1ZK6A 3KAFA 3GPKA 3O5FA 4NSBA 1FKBA 1NWTA 2KR7A 3O5LA 3UI5A 3B9AA 4MAVA 4WJXA 2F2DA 1FKRA 4U85A 1HXVA 1ZBWA 1NWRA 3O5QA 4DT4A 3NTPA 1W9VA 3CHFA 3FXYA 1T11A 4ODLA 1E6NA 2AOSA 3UQIA 1WAWA 3NI6A 1ZU8A 3O5OA 4WKAA 2XPBA 2G8ZA 4DZ3A 3UF8A 1JNEA 4DRHA 4U86A 4R0XA 3TCZA 4TYOA 2ZQVA 2K8IA 2LGOA 5DF0A 4TW7A 4DWSD 4ODNA 1LL7A 1QPFA 3WL0A 1ZBKA 4W5UA 1EDQA 3TC5A 1W1YA 2YBUA 1LJYA 1FKDA 2MNTA 4JFLA 1EHNA 2PPNA 1OWQA 3AS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D7I A;  4GIV A;  2ZQS A;  1FKG A;  2VCD A;  2L2S A;  1Q6H A;  4IQC A;  4ITZ A;  3IHZ A;  3O5E A;  2PPO A;  3UI6 A;  1NMW A;  1PBK A;  2XP6 A;  2D9F A;  1JNT A;  1ROT A;  3MDY B;  3O5P A;  4ODQ A;  1BKF A;  1TCO C;  1FKL A;  1BL4 A;  1Q6U A;  4J4N A;  2FKE A;  4W9P A;  1ROU A;  1U79 A;  1FJD A;  2JZV A;  2M2A A;  2RUD A;  2XP3 A;  4QIB A;  1FKI A;  1M5Y A;  2Y78 A;  2ZR5 A;  4DRN A;  2XP7 A;  3KAI A;  4JFI A;  4LAV A;  1D6O A;  1FKF A;  1D7J A;  4FN2 A;  5HW7 A;  3UQA A;  4MGV A;  1P5Q A;  3I6C A;  5HTG A;  1EQ3 A;  4N19 A;  3JYM A;  2KGJ A;  3IK8 A;  2F21 A;  2MPH A;  3IKG A;  4ODO A;  5D75 A;  4DRO A;  2LPV A;  1PIN A;  4J4O A;  1KT1 A;  4DIP A;  3ODK A;  4BF8 A;  4W9Q A;  3CGM A;  3VAW A;  4MSP A;  3O5K A;  3KAG A;  4ODP A;  1YW5 A;  2PV3 A;  2KI3 A;  3O5M A;  4LAX A;  4DRJ A;  5HT1 A;  4DRP A;  1B6C A;  4LAY A;  5HW8 A;  3PA7 A;  1FKK A;  3IKD A;  3O5D A;  4IQ2 A;  2XP9 A;  4ODR A;  3H9R B;  3KZ7 A;  1W26 A;  3NRK A;  5J6E A;  1D7H A;  2MLX A;  5GPG A;  3JXV A;  4ODM A;  2PV1 A;  2VN1 A;  2LKN A;  4DH0 A;  2RUC A;  3UI4 A;  4IPX A;  1QPL A;  5HW6 A;  4U84 A;  1YAT A;  2IF4 A;  3B7X A;  3JYJ A;  1L1P A;  1J6Y A;  5I98 A;  3O5I A;  4ODK A;  3O5G A;  4W9O A;  4JFK A;  3LUO A;  1NSG A;  2XP4 A;  4DRQ A;  1ZK6 A;  3KAF A;  3GPK A;  1ZCN A;  3O5F A;  5DIU A;  1FKB A;  1N1A A;  2KR7 A;  2RUQ A;  2KE0 A;  2ZQU A;  3O5L A;  3KAB A;  2PBC A;  1C9H A;  3UI5 A;  4JYS A;  4C02 B;  1F8A B;  4JFM A;  4TW8 A;  3OOB A;  4GGQ A;  2KO7 A;  1Q1C A;  2XP8 A;  5DIV A;  5BXJ A;  5HUA A;  4JFJ A;  2F2D A;  1FKR A;  2MF9 A;  2OFN A;  1FAP A;  4QT2 A;  2DG3 A;  1EYM A;  2PPP A;  4U85 A;  2ZR6 A;  2UZ5 A;  1R9H A;  2M1I A;  3FAP A;  5DIT A;  3UQB A;  1FD9 A;  4QT3 A;  1JNS A;  1HXV A;  4DT4 A;  3O5Q A;  3NTP A;  1FKT A;  2RSE A;  3KAD A;  3O5R A;  3TDB A;  2M08 A;  4DRK A;  1J4I A;  1T11 A;  4ODL A;  4G50 A;  1J4H A;  1Q6I A;  1NMV A;  3UQI A;  4DZ2 A;  3RFW A;  5HWC A;  3RGC A;  2AWG A;  1QZ2 A;  2LJ4 A;  3NI6 A;  3PRB A;  4LAW A;  4O2T A;  3KCE A;  4NNR A;  1KT0 A;  4TNS A;  2ZR4 A;  3O5O A;  2MLZ A;  4TW6 A;  3PRD A;  2XP5 A;  2XPB A;  1JVW A;  4DZ3 A;  4TX0 A;  3UF8 A;  3CGN A;  2ZQT A;  1FKJ A;  4R0X A;  4U86 A;  3TCZ A;  2DG4 A;  4DRH A;  2Q5A A;  1F40 A;  4TYO A;  1Y0O A;  2XPA A;  1FKH A;  2ZQV A;  2K8I A;  2LGO A;  2MLY A;  4DRI A;  4DRM A;  3O5J A;  4TW7 A;  2N87 A;  2DG9 A;  4G2P A;  4ODN A;  4FAP A;  5HWB A;  1QPF A;  3EY6 A;  2KFW A;  2F4E A;  3KAH A;  5HKG A;  2RQS A;  3TC5 A;  1FKS A;  3KAC A;  1J4R A;  2PV2 A;  5B8I C;  1A7X A;  2ITK A;  1FKD A;  3WH0 A;  2MNT A;  4JFL A;  2FAP A;  2RUR A;  2PPN A; 
#chains in the Genus database with same CATH topology
 4UDM A;  3WD1 A;  2ZQS A;  1FKG A;  2VCD A;  4R5E A;  4ITZ A;  3IHZ A;  1WNO A;  2G41 A;  3UI6 A;  4ODQ A;  2D9F A;  1JNT A;  3MDY B;  3O5P A;  1BKF A;  1TCO C;  2WLZ A;  4W9P A;  2FKE A;  1U79 A;  3ARS A;  2A3C A;  4QIB A;  2Y78 A;  2PN0 A;  2ZR5 A;  3G6M A;  3UQA A;  4MGV A;  1EQ3 A;  1HJV A;  4N19 A;  2KGJ A;  4MNM A;  3IK8 A;  4AY1 A;  3IKG A;  4P8U A;  4ODO A;  5D75 A;  4DRO A;  1KT1 A;  1GPF A;  4W9Q A;  3VAW A;  1NWU A;  4MSP A;  2KI3 A;  1KFW A;  2DSW A;  4IQ2 A;  2XP9 A;  5J6E A;  3W4R A;  4P8V A;  3JXV A;  1HKJ A;  1YAT A;  4ODK A;  2A3A A;  3WKZ A;  4JFK A;  4P8X A;  2XP4 A;  1W1V A;  5DIU A;  4KR0 B;  3CZ8 A;  5DO2 A;  1UR8 A;  4Z2H A;  4JYS A;  4JFM A;  5DEZ A;  4TW8 A;  3OOB A;  5BXJ A;  2KO7 A;  1E9L A;  1Q1C A;  3ALF A;  1FAP A;  4QT2 A;  2PPP A;  1HJW A;  1ZB5 A;  1UR9 A;  2UZ5 A;  1LG1 A;  3ARZ A;  4QT3 A;  1JNS A;  1TFV A;  2OLH A;  1HKM A;  1J4H A;  3RFW A;  3RME A;  3PRB A;  4O2T A;  3AS3 A;  2O9O A;  1SYT A;  4ZPV R;  4MNJ A;  2MLZ A;  1JVW A;  4TX0 A;  1L1P A;  2ZQT A;  3WIJ A;  2Q5A A;  1W1T A;  2MLY A;  4DRM A;  2N87 A;  2DG9 A;  3B9D A;  4HAR A;  5HWB A;  3EY6 A;  2F4E A;  1HKI A;  2B5U B;  2DSU A;  5B8I C;  1E6P A;  4NZC A;  2FAP A;  1LG2 A;  1D7I A;  4DWS C;  2L2S A;  1LL4 A;  1Q6H A;  1X6N A;  1OGG A;  2A3E A;  2PPO A;  1NMW A;  1PBK A;  2XP6 A;  1FKL A;  3WQW A;  1XHG A;  1ROU A;  1K9T A;  3AS0 A;  4DRN A;  1ZL1 A;  1D6O A;  3WL1 A;  5HW7 A;  4WIW A;  2YBT A;  1P5Q A;  2WLY A;  5JH8 A;  2F21 A;  2MPH A;  4HBE A;  1VF8 A;  1PIN A;  4IT4 A;  4J4O A;  4BF8 A;  1LL6 A;  3O5K A;  4S3K A;  2DT2 A;  2PV3 A;  4DRP A;  3O5M A;  1FFQ A;  4DRJ A;  1E44 A;  1FKK A;  2WK2 A;  4ML4 A;  5GQB A;  1D7H A;  1CTN A;  4ODM A;  4DH0 A;  2B31 A;  3UI4 A;  1E6Z A;  2IF4 A;  1NWS A;  3WQV A;  3JYJ A;  1J6Y A;  4XAK A;  4W9O A;  2DT3 A;  1W9U A;  3ARU A;  2FDM A;  1W1P A;  3FY1 A;  1N1A A;  2RUQ A;  2KE0 A;  3ARP A;  3KAB A;  2PBC A;  4Z2L A;  1O6I A;  4GGQ A;  5DIV A;  2XP8 A;  2MF9 A;  2OFN A;  2DG3 A;  3RM8 A;  3RM9 A;  3UQB A;  1FD9 A;  1FKT A;  3TDB A;  2M08 A;  4G50 A;  1JND A;  1Q6I A;  1NMV A;  4MTV A;  3RGC A;  2AWG A;  1QZ2 A;  2LJ4 A;  4LAW A;  5HWC A;  1KT0 A;  3RM4 A;  3WD2 A;  4TW6 A;  2IUZ A;  3GTY X;  1D2K A;  4QZV B;  3CGN A;  1H0I A;  1Y0O A;  1FKH A;  4Z2K A;  4FAP A;  5HKG A;  1E6R A;  2WM0 A;  3CHC A;  1FKS A;  1ZBC A;  1J4R A;  4PTM A;  1A7X A;  4Q7N A;  3WH0 A;  4Z2I A;  4MNK A;  4WKF A;  4GIV A;  5GPR A;  4IT6 A;  2PI6 A;  3O5E A;  3ARR A;  4WK9 A;  2JZV A;  2M2A A;  1OGB A;  2RUD A;  1FKI A;  1GOI A;  1M5Y A;  1RD6 A;  2XP7 A;  4JFI A;  4LAV A;  3B8S A;  1FKF A;  1D7J A;  3I6C A;  5HTG A;  2LPV A;  1E15 A;  4DIP A;  3ODK A;  3CGM A;  3OA5 A;  3WD3 A;  3PR9 A;  4DWS B;  1JCH B;  2QF8 A;  1YW5 A;  4LAX A;  1ZBV A;  3ARX A;  1B6C A;  5HW8 A;  3PA7 A;  4L72 B;  3ARO A;  3ARW A;  3H9R B;  1W26 A;  3KZ7 A;  5GPG A;  2PV1 A;  2LKN A;  4IPX A;  1QPL A;  4U84 A;  1H0G A;  3B7X A;  5I98 A;  1NH6 A;  3LUO A;  1NSG A;  3AS1 A;  4DRQ A;  2P4V A;  4L3N A;  1ZCN A;  2ZQU A;  1C9H A;  3CHE A;  4C02 B;  1F8A B;  2ESC A;  3EIP A;  5HUA A;  4JFJ A;  1EIB A;  5HBF A;  1EYM A;  2ZR6 A;  3FAP A;  1R9H A;  2M1I A;  5DIT A;  3CHD A;  2RSE A;  3KAD A;  3O5R A;  4DRK A;  1J4I A;  4S3J A;  4DZ2 A;  3KCE A;  4NNR A;  4TNS A;  1GRJ A;  2ZR4 A;  3PRD A;  2XP5 A;  3WD0 A;  4DWS A;  4ZPW R;  4Z2G A;  1FKJ A;  1IX5 A;  2A3B A;  2DG4 A;  1F40 A;  2XPA A;  4DRI A;  3O5J A;  2DPE A;  4G2P A;  2DT0 A;  3GU0 A;  3KAH A;  2KFW A;  3AQU A;  1FFR A;  2RQS A;  1ITX A;  3KAC A;  2PV2 A;  2DSV A;  3ALG A;  3ART A;  2ITK A;  2RUR A;  3CH9 A;  4LGX A;  4P8W A;  4IQC A;  3WD4 A;  3ARQ A;  1SR0 A;  3QOK A;  4WKH A;  3ARV A;  1ROT A;  1BL4 A;  1Q6U A;  4J4N A;  1FJD A;  1W9P A;  2XP3 A;  2F23 A;  3B9E A;  4URI A;  3KAI A;  2ETN A;  1HKK A;  4FN2 A;  4MPK A;  3JYM A;  1WB0 A;  3PRA A;  4Z2J A;  2DT1 A;  1X6L A;  2DSZ A;  3KAG A;  4HBO A;  4ODP A;  5HT1 A;  4Q22 A;  4KQZ A;  4ZPT R;  4LAY A;  3G6L A;  4ODR A;  3IKD A;  3O5D A;  3NRK A;  2MLX A;  1GUV A;  2VN1 A;  4ZS6 A;  2RUC A;  5HW6 A;  3BXW A;  4MNL A;  3O5I A;  2O92 A;  1HJX A;  3O5G A;  3ARY A;  1LQ0 A;  1XRV A;  1ZK6 A;  3KAF A;  3GPK A;  3O5F A;  4NSB A;  1FKB A;  1NWT A;  2KR7 A;  3O5L A;  3UI5 A;  3B9A A;  4MAV A;  4WJX A;  2F2D A;  1FKR A;  4U85 A;  1HXV A;  1ZBW A;  1NWR A;  3O5Q A;  4DT4 A;  3NTP A;  1W9V A;  3CHF A;  3FXY A;  1T11 A;  4ODL A;  1E6N A;  2AOS A;  3UQI A;  3BMB A;  1WAW A;  3NI6 A;  1ZU8 A;  3O5O A;  4WKA A;  2XPB A;  2G8Z A;  4DZ3 A;  3UF8 A;  1JNE A;  4DRH A;  4U86 A;  4R0X A;  3TCZ A;  4TYO A;  2ZQV A;  2K8I A;  2EUL A;  2LGO A;  5DF0 A;  4TW7 A;  4DWS D;  4ODN A;  1LL7 A;  1QPF A;  3WL0 A;  1ZBK A;  4W5U A;  1EDQ A;  3TC5 A;  1W1Y A;  2YBU A;  1LJY A;  1FKD A;  2MNT A;  4JFL A;  1EHN A;  2PPN A;  1OWQ A;  3AS2 A; 
#chains in the Genus database with same CATH homology
 3WD1 A;  2ZQS A;  1FKG A;  2VCD A;  4R5E A;  4ITZ A;  3IHZ A;  1WNO A;  2G41 A;  3UI6 A;  4ODQ A;  2D9F A;  1JNT A;  3MDY B;  3O5P A;  1BKF A;  1TCO C;  2WLZ A;  4W9P A;  2FKE A;  1U79 A;  3ARS A;  2A3C A;  4QIB A;  2Y78 A;  2ZR5 A;  3G6M A;  3UQA A;  4MGV A;  1EQ3 A;  1HJV A;  4N19 A;  2KGJ A;  4MNM A;  3IK8 A;  4AY1 A;  3IKG A;  4P8U A;  4ODO A;  5D75 A;  4DRO A;  1KT1 A;  1GPF A;  4W9Q A;  3VAW A;  1NWU A;  4MSP A;  2KI3 A;  1KFW A;  2DSW A;  4IQ2 A;  2XP9 A;  5J6E A;  3W4R A;  4P8V A;  3JXV A;  1HKJ A;  1YAT A;  4ODK A;  2A3A A;  3WKZ A;  4JFK A;  4P8X A;  2XP4 A;  1W1V A;  5DIU A;  4KR0 B;  3CZ8 A;  5DO2 A;  1UR8 A;  4Z2H A;  4JYS A;  4JFM A;  5DEZ A;  4TW8 A;  3OOB A;  5BXJ A;  2KO7 A;  1E9L A;  1Q1C A;  3ALF A;  1FAP A;  4QT2 A;  2PPP A;  1HJW A;  1ZB5 A;  1UR9 A;  2UZ5 A;  1LG1 A;  3ARZ A;  4QT3 A;  1JNS A;  1TFV A;  2OLH A;  1HKM A;  1J4H A;  3RFW A;  3RME A;  3PRB A;  4O2T A;  3AS3 A;  2O9O A;  1SYT A;  4ZPV R;  4MNJ A;  2MLZ A;  1JVW A;  4TX0 A;  1L1P A;  2ZQT A;  3WIJ A;  2Q5A A;  1W1T A;  2MLY A;  4DRM A;  2N87 A;  2DG9 A;  3B9D A;  4HAR A;  5HWB A;  3EY6 A;  2F4E A;  1HKI A;  2DSU A;  5B8I C;  1E6P A;  4NZC A;  2FAP A;  1LG2 A;  1D7I A;  4DWS C;  2L2S A;  1LL4 A;  1Q6H A;  1X6N A;  1OGG A;  2A3E A;  2PPO A;  1NMW A;  1PBK A;  2XP6 A;  1FKL A;  3WQW A;  1XHG A;  1ROU A;  1K9T A;  3AS0 A;  4DRN A;  1ZL1 A;  1D6O A;  3WL1 A;  5HW7 A;  4WIW A;  2YBT A;  1P5Q A;  2WLY A;  5JH8 A;  2F21 A;  2MPH A;  4HBE A;  1VF8 A;  1PIN A;  4IT4 A;  4J4O A;  4BF8 A;  1LL6 A;  3O5K A;  4S3K A;  2DT2 A;  2PV3 A;  4DRP A;  3O5M A;  1FFQ A;  4DRJ A;  1FKK A;  2WK2 A;  4ML4 A;  5GQB A;  1D7H A;  1CTN A;  4ODM A;  4DH0 A;  2B31 A;  3UI4 A;  1E6Z A;  2IF4 A;  1NWS A;  3WQV A;  3JYJ A;  1J6Y A;  4XAK A;  4W9O A;  2DT3 A;  1W9U A;  3ARU A;  2FDM A;  1W1P A;  3FY1 A;  1N1A A;  2RUQ A;  2KE0 A;  3ARP A;  3KAB A;  2PBC A;  4Z2L A;  1O6I A;  4GGQ A;  5DIV A;  2XP8 A;  2MF9 A;  2OFN A;  2DG3 A;  3RM8 A;  3RM9 A;  3UQB A;  1FD9 A;  1FKT A;  3TDB A;  2M08 A;  4G50 A;  1JND A;  1Q6I A;  1NMV A;  4MTV A;  3RGC A;  2AWG A;  1QZ2 A;  2LJ4 A;  4LAW A;  5HWC A;  1KT0 A;  3RM4 A;  3WD2 A;  4TW6 A;  2IUZ A;  1D2K A;  4QZV B;  3CGN A;  1H0I A;  1Y0O A;  1FKH A;  4Z2K A;  4FAP A;  5HKG A;  1E6R A;  2WM0 A;  3CHC A;  1FKS A;  1ZBC A;  1J4R A;  4PTM A;  1A7X A;  4Q7N A;  3WH0 A;  4Z2I A;  4MNK A;  4WKF A;  4GIV A;  5GPR A;  4IT6 A;  2PI6 A;  3O5E A;  3ARR A;  4WK9 A;  2JZV A;  2M2A A;  1OGB A;  2RUD A;  1FKI A;  1GOI A;  1M5Y A;  1RD6 A;  2XP7 A;  4JFI A;  4LAV A;  3B8S A;  1FKF A;  1D7J A;  3I6C A;  5HTG A;  2LPV A;  1E15 A;  4DIP A;  3ODK A;  3CGM A;  3OA5 A;  3WD3 A;  3PR9 A;  4DWS B;  2QF8 A;  1YW5 A;  4LAX A;  1ZBV A;  3ARX A;  1B6C A;  5HW8 A;  3PA7 A;  4L72 B;  3ARO A;  3ARW A;  3H9R B;  1W26 A;  3KZ7 A;  5GPG A;  2PV1 A;  2LKN A;  4IPX A;  1QPL A;  4U84 A;  1H0G A;  3B7X A;  5I98 A;  1NH6 A;  3LUO A;  1NSG A;  3AS1 A;  4DRQ A;  4L3N A;  1ZCN A;  2ZQU A;  1C9H A;  3CHE A;  4C02 B;  1F8A B;  2ESC A;  5HUA A;  4JFJ A;  1EIB A;  5HBF A;  1EYM A;  2ZR6 A;  3FAP A;  1R9H A;  2M1I A;  5DIT A;  3CHD A;  2RSE A;  3KAD A;  3O5R A;  4DRK A;  1J4I A;  4S3J A;  4DZ2 A;  3KCE A;  4NNR A;  4TNS A;  2ZR4 A;  3PRD A;  2XP5 A;  3WD0 A;  4DWS A;  4ZPW R;  4Z2G A;  1FKJ A;  1IX5 A;  2A3B A;  2DG4 A;  1F40 A;  2XPA A;  4DRI A;  3O5J A;  2DPE A;  4G2P A;  2DT0 A;  2KFW A;  3KAH A;  3AQU A;  1FFR A;  2RQS A;  1ITX A;  3KAC A;  2PV2 A;  2DSV A;  3ALG A;  3ART A;  2ITK A;  2RUR A;  3CH9 A;  4LGX A;  4P8W A;  4IQC A;  3WD4 A;  3ARQ A;  1SR0 A;  3QOK A;  4WKH A;  3ARV A;  1ROT A;  1BL4 A;  1Q6U A;  4J4N A;  1FJD A;  1W9P A;  2XP3 A;  4URI A;  3B9E A;  3KAI A;  1HKK A;  4FN2 A;  4MPK A;  3JYM A;  1WB0 A;  3PRA A;  4Z2J A;  2DT1 A;  1X6L A;  2DSZ A;  3KAG A;  4HBO A;  4ODP A;  5HT1 A;  4Q22 A;  4KQZ A;  4ZPT R;  4LAY A;  3G6L A;  4ODR A;  3IKD A;  3O5D A;  3NRK A;  2MLX A;  1GUV A;  2VN1 A;  4ZS6 A;  2RUC A;  5HW6 A;  3BXW A;  4MNL A;  3O5I A;  2O92 A;  1HJX A;  3O5G A;  3ARY A;  1LQ0 A;  1XRV A;  1ZK6 A;  3KAF A;  3GPK A;  3O5F A;  4NSB A;  1FKB A;  1NWT A;  2KR7 A;  3O5L A;  3UI5 A;  3B9A A;  4MAV A;  4WJX A;  2F2D A;  1FKR A;  4U85 A;  1HXV A;  1ZBW A;  1NWR A;  3O5Q A;  4DT4 A;  3NTP A;  1W9V A;  3CHF A;  3FXY A;  1T11 A;  4ODL A;  1E6N A;  2AOS A;  3UQI A;  1WAW A;  3NI6 A;  1ZU8 A;  3O5O A;  4WKA A;  2XPB A;  2G8Z A;  4DZ3 A;  3UF8 A;  1JNE A;  4DRH A;  4U86 A;  4R0X A;  3TCZ A;  4TYO A;  2ZQV A;  2K8I A;  2LGO A;  5DF0 A;  4TW7 A;  4DWS D;  4ODN A;  1LL7 A;  1QPF A;  3WL0 A;  1ZBK A;  4W5U A;  1EDQ A;  3TC5 A;  1W1Y A;  2YBU A;  1LJY A;  1FKD A;  2MNT A;  4JFL A;  1EHN A;  2PPN A;  1OWQ A;  3AS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...