2PPOA

Crystal structure of e60a mutant of fkbp12
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWAEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural coupling between FKBP12 and buried water.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords FK506-binding protein 1A
total genus 28
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ppoA00
5HTGA 2RUDA 4MSPA 2M08A 2F4EA 2F21A 3PA7A 3UI6A 2PPNA 3IK8A 1FKDA 1YATA 1FKTA 5HUAA 2N87A 3UQBA 3IKGA 1FKFA 2XP6A 4JFIA 1Q6IA 1FKLA 1F8AB 1PINA 2LKNA 1ZK6A 2OFNA 4DIPA 1FD9A 4DROA 2PV1A 1J4IA 2VN1A 3WH0A 1J4HA 2KFWA 2MPHA 5GPGA 1BKFA 1Q6HA 3EY6A 4DRKA 3TC5A 2KI3A 3JYMA 2KR7A 3O5FA 3OOBA 3O5PA 5HWBA 2M1IA 1Q1CA 1N1AA 1FKJA 4U84A 1FKIA 1Y0OA 2IF4A 4BF8A 3GPKA 2ZQVA 3KAGA 4J4NA 4LAYA 4DZ2A 4FN2A 2MLXA 4MGVA 4DRQA 1ROTA 4DRHA 2XP7A 4U86A 3RFWA 5HKGA 1D7JA 1T11A 4W9PA 2RURA 1D7IA 2PPPA 1JVWA 3JXVA 4J4OA 3UI5A 1HXVA 2KGJA 2M2AA 1L1PA 1FKKA 4ODQA 4QT3A 4TX0A 1R9HA 3H9RB 3B7XA 1NMWA 3IHZA 2L2SA 1ZCNA 2XP5A 3KAFA 4JFMA 4W9OA 4GIVA 1QZ2A 5HT1A 3FAPA 4DRJA 1QPFA 2DG4A 4IQ2A 1FKSA 2Y78A 4JFLA 4LAVA 2DG3A 1A7XA 3CGNA 4ITZA 4QT2A 4LAXA 2PV2A 2XP4A 1FKGA 4TW8A 1J4RA 4DH0A 4DRPA 1EYMA 5HW8A 2PV3A 3NTPA 4JYSA 2PBCA 3O5JA 1NSGA 4DT4A 1F40A 5J6EA 2RSEA 1YW5A 2MLYA 1JNSA 4GGQA 3O5RA 3TDBA 3O5IA 4DRIA 2Q5AA 2ZR5A 3O5MA 3KAIA 3UI4A 4IQCA 2F2DA 1FJDA 3I6CA 4O2TA 2D9FA 1EQ3A 5I98A 2FAPA 2PPOA 4ODOA 4R0XA 3KCEA 5DITA 3JYJA 3TCZA 4LAWA 3NRKA 4DZ3A 2ZQSA 3CGMA 3O5QA 4G2PA 4W9QA 2ITKA 1BL4A 5DIVA 2DG9A 3O5OA 4DRMA 4JFJA 5HW6A 2XPBA 1KT1A 3O5GA 1TCOC 3UQIA 1FKRA 2UZ5A 1NMVA 2MNTA 2LJ4A 3PRDA 1P5QA 2AWGA 3MDYB 5BXJA 1PBKA 3O5EA 4U85A 2ZQTA 3KACA 1U79A 2RQSA 5HW7A 4DRNA 2KO7A 4ODRA 1J6YA 2XP9A 4TNSA 2XP3A 5B8IC 1FKHA 1FKBA 2LPVA 3KAHA 3NI6A 3O5KA 1D6OA 4IPXA 4ODNA 4NNRA 3KADA 4FAPA 1M5YA 5HWCA 3ODKA 1ROUA 4ODMA 4TYOA 1D7HA 2MF9A 2RUQA 2LGOA 2JZVA 3PRBA 1FAPA 4ODLA 2RUCA 1KT0A 2MLZA 2VCDA 1W26A 1JNTA 4JFKA 2XP8A 4TW6A 3UQAA 3LUOA 3O5LA 3UF8A 3KABA 1QPLA 2FKEA 3O5DA 2ZR4A 2ZQUA 2XPAA 1B6CA 2KE0A 4N19A 2ZR6A 2K8IA 3VAWA 4C02B 3KZ7A 4TW7A 5DIUA 1Q6UA 5D75A 4QIBA 3IKDA 4ODPA 4G50A 1C9HA 3RGCA 4ODKA
chains in the Genus database with same CATH superfamily
1EHNA 3ARXA 2M08A 3EIPA 3GU0A 1YATA 5HUAA 3AQUA 2LKNA 1ZK6A 2OFNA 4L3NA 2WK2A 2PV1A 4Q7NA 3WH0A 1J4HA 2KFWA 4KQZA 3ARPA 1BKFA 4DRKA 1UR9A 3TC5A 2DT1A 1JNEA 1RD6A 3OOBA 3O5PA 5HWBA 1N1AA 1FKJA 1IX5A 4MNJA 4DZ2A 4MGVA 4DRQA 1HJXA 1D7IA 2G8ZA 2AOSA 3B9DA 4J4OA 2M2AA 4TX0A 1R9HA 1XRVA 5DF0A 3AS1A 3KAFA 3WL0A 4ML4A 3ARWA 4IQ2A 4JFLA 4Z2HA 1W1TA 2F23A 4DWSB 3PR9A 5DO2A 5HW8A 3WKZA 3NTPA 3WD1A 2PBCA 1VF8A 5J6EA 2RSEA 2Q5AA 3O5MA 2IUZA 3UI4A 2F2DA 1FJDA 2D9FA 1EQ3A 2YBUA 4R0XA 4DZ3A 2ITKA 5DIVA 3CHCA 1FKRA 2DSWA 2MNTA 5BXJA 2AWGA 1PBKA 3O5EA 2ZQTA 3KACA 4DWSD 3CHDA 3WL1A 2XP9A 1XHGA 1LJYA 5B8IC 3KAHA 3KADA 4FAPA 3B9EA 4TYOA 2JZVA 4URIA 2VCDA 1KT0A 1W1YA 1E6RA 3LUOA 3WD0A 3UF8A 4HBOA 4P8XA 1B6CA 1ZB5A 3VAWA 4MNMA 3ALGA 3KZ7A 1NWTA 1TFVA 1W1VA 4ODPA 3CZ8A 5I98A 3GTYX 5HTGA 4MSPA 1HKJA 1X6NA 1W9VA 3UI6A 2A3CA 2XP6A 1Q6IA 1FKLA 1F8AB 3ARVA 2DT0A 4DROA 3WQWA 1J4IA 2VN1A 4IT6A 2MPHA 4DWSC 3JYMA 3O5FA 3ALFA 3BXWA 1EIBA 1Q1CA 2M1IA 4U84A 1FKIA 1Y0OA 4S3KA 2ZQVA 4J4NA 2A3EA 4DRHA 2XP7A 1ZBVA 3WD2A 2PPPA 1HXVA 2KGJA 3FY1A 3H9RB 3B7XA 3RM9A 1E6NA 2XP5A 4R5EA 4JFMA 4Z2IA 4DRJA 1ZL1A 2DG4A 1FKSA 1JCHB 2Y78A 1CTNA 4P8UA 2PV2A 4DH0A 1NH6A 1EDQA 5GPRA 2PV3A 4Z2GA 2PN0A 3O5JA 1WB0A 3WD3A 4DT4A 4P8WA 4WKHA 2EULA 2MLYA 4DRIA 1HKMA 3KAIA 4S3JA 4WIWA 1NWRA 3I6CA 1UR8A 3RM4A 1H0GA 2DPEA 2PPOA 3KCEA 5DITA 3JYJA 3TCZA 1X6LA 2ZQSA 3O5QA 1W9UA 1BL4A 3WIJA 4DRMA 3ARTA 5HW6A 3O5GA 1OWQA 2UZ5A 2LJ4A 1P5QA 2WLZA 3AROA 3AS0A 5HW7A 2KO7A 1J6YA 4TNSA 1FKHA 2FDMA 4ODNA 4MNLA 5HWCA 1M5YA 3ODKA 1ROUA 3ARRA 1D7HA 2RUQA 2LGOA 4Z2LA 2RUCA 2DT3A 1W26A 1HJWA 2G41A 1ZBWA 4W5UA 3O5LA 1GPFA 2ZQUA 2XPAA 2KE0A 5GQBA 2K8IA 1ITXA 5D75A 4QIBA 4Z2JA 1FFQA 4ODKA 5GPGA 5JH8A 1SR0A 1LL4A 2F4EA 2F21A 3PA7A 1FKDA 1KFWA 4WKFA 3UQBA 2DSUA 1FKFA 4JFIA 1PINA 2B31A 4DIPA 1LL7A 1OGGA 1Q6HA 2KR7A 1NWSA 4IT4A 1W9PA 2DSZA 3RMEA 4ZPTR 3GPKA 4Q22A 3KAGA 4FN2A 4LGXA 1W1PA 1ROTA 5HKGA 4U86A 3RFWA 1D7JA 1T11A 1HJVA 1ZBKA 2RURA 4W9PA 3PRAA 1JVWA 3JXVA 1L1PA 1FKKA 4ODQA 1NMWA 3IHZA 4Z2KA 1ZCNA 4GIVA 1QZ2A 5HT1A 3FAPA 2O92A 4LAVA 3ARZA 2DG3A 1A7XA 4ITZA 4QT2A 4LAXA 4DRPA 1FKGA 1NSGA 1F40A 1YW5A 1JNSA 4GGQA 3TDBA 3AS2A 1JNDA 1LG2A 4O2TA 4P8VA 4MAVA 2FAPA 1OGBA 4NZCA 3CGMA 4G2PA 3O5OA 4JFJA 5DEZA 1KT1A 3UQIA 1GOIA 5HBFA 4ZPVR 1U79A 2DSVA 4DRNA 4ODRA 4HBEA 2DT2A 1FFRA 1FKBA 3B9AA 1O6IA 4NNRA 4UDMA 2MF9A 3PRBA 1FAPA 2YBTA 4JFKA 2XP8A 4TW6A 1ZBCA 3UQAA 2OLHA 1GRJA 4DWSA 1QPLA 3O5DA 2ZR4A 4N19A 4TW7A 1Q6UA 1E9LA 3IKDA 3RGCA 3G6LA 2PI6A 2RUDA 1HKKA 2PPNA 3IK8A 3WD4A 1FKTA 3AS3A 2N87A 1HKIA 3IKGA 1LG1A 2A3BA 1FD9A 1E6PA 3BMBA 3EY6A 3ARUA 2KI3A 3B8SA 3QOKA 3ARSA 2IF4A 4BF8A 3CH9A 4L72B 4KR0B 4LAYA 1LL6A 2MLXA 2QF8A 4PTMA 1NWUA 2A3AA 4WJXA 3UI5A 3FXYA 3CHEA 4QT3A 2WLYA 4NSBA 2L2SA 4W9OA 1E6ZA 4MTVA 1QPFA 4HARA 3CGNA 2XP4A 4TW8A 1J4RA 1SYTA 1EYMA 1E15A 4JYSA 2P4VA 1H0IA 3G6MA 4ZPWR 3O5RA 3O5IA 2ZR5A 4IQCA 3CHFA 4ZS6A 1D2KA 4ODOA 4LAWA 3NRKA 4W9QA 2DG9A 2O9OA 2XPBA 1TCOC 1ZU8A 1NMVA 3PRDA 1K9TA 3MDYB 3WQVA 4U85A 2RQSA 2WM0A 2XP3A 2LPVA 3NI6A 3OA5A 4IPXA 1E44A 1D6OA 3O5KA 2ESCA 1LQ0A 4XAKA 4AY1A 1WAWA 4ODMA 3ARQA 3W4RA 4ODLA 2MLZA 1JNTA 4WK9A 1WNOA 2B5UB 3KABA 2FKEA 4C02B 2ETNA 2ZR6A 4WKAA 4MPKA 3ARYA 5DIUA 4G50A 1C9HA 4MNKA 4QZVB 3RM8A 1GUVA
chains in the Genus database with same CATH topology
1EHNA 3ARXA 2M08A 1YATA 5HUAA 3AQUA 2LKNA 1ZK6A 2OFNA 4L3NA 2WK2A 2PV1A 4Q7NA 3WH0A 1J4HA 2KFWA 4KQZA 3ARPA 1BKFA 4DRKA 1UR9A 3TC5A 2DT1A 1JNEA 1RD6A 3OOBA 3O5PA 5HWBA 1N1AA 1FKJA 1IX5A 4MNJA 4DZ2A 4MGVA 4DRQA 1HJXA 1D7IA 2G8ZA 2AOSA 3B9DA 4J4OA 2M2AA 4TX0A 1R9HA 1XRVA 5DF0A 3AS1A 3KAFA 3WL0A 4ML4A 3ARWA 4IQ2A 4JFLA 4Z2HA 1W1TA 4DWSB 3PR9A 5DO2A 5HW8A 3WKZA 3NTPA 3WD1A 2PBCA 1VF8A 5J6EA 2RSEA 2Q5AA 3O5MA 2IUZA 3UI4A 2F2DA 1FJDA 2D9FA 1EQ3A 2YBUA 4R0XA 4DZ3A 2ITKA 5DIVA 3CHCA 1FKRA 2DSWA 2MNTA 5BXJA 2AWGA 1PBKA 3O5EA 2ZQTA 3KACA 4DWSD 3CHDA 3WL1A 2XP9A 1XHGA 1LJYA 5B8IC 3KAHA 3KADA 4FAPA 3B9EA 4TYOA 2JZVA 4URIA 2VCDA 1KT0A 1W1YA 1E6RA 3LUOA 3WD0A 3UF8A 4HBOA 4P8XA 1B6CA 1ZB5A 3VAWA 4MNMA 3ALGA 3KZ7A 1NWTA 1TFVA 1W1VA 4ODPA 3CZ8A 5I98A 5HTGA 4MSPA 1HKJA 1X6NA 1W9VA 3UI6A 2A3CA 2XP6A 1Q6IA 1FKLA 1F8AB 3ARVA 2DT0A 4DROA 3WQWA 1J4IA 2VN1A 4IT6A 2MPHA 4DWSC 3JYMA 3O5FA 3ALFA 3BXWA 1EIBA 1Q1CA 2M1IA 4U84A 1FKIA 1Y0OA 4S3KA 2ZQVA 4J4NA 2A3EA 4DRHA 2XP7A 1ZBVA 3WD2A 2PPPA 1HXVA 2KGJA 3FY1A 3H9RB 3B7XA 3RM9A 1E6NA 2XP5A 4R5EA 4JFMA 4Z2IA 4DRJA 1ZL1A 2DG4A 1FKSA 2Y78A 4P8UA 1CTNA 2PV2A 4DH0A 1NH6A 1EDQA 5GPRA 2PV3A 4Z2GA 3O5JA 1WB0A 3WD3A 4DT4A 4P8WA 4WKHA 2MLYA 4DRIA 1HKMA 3KAIA 4S3JA 4WIWA 1NWRA 3I6CA 1UR8A 3RM4A 1H0GA 2DPEA 2PPOA 3KCEA 5DITA 3JYJA 3TCZA 1X6LA 2ZQSA 3O5QA 1W9UA 1BL4A 3WIJA 4DRMA 3ARTA 5HW6A 3O5GA 1OWQA 2UZ5A 2LJ4A 1P5QA 2WLZA 3AROA 3AS0A 5HW7A 2KO7A 1J6YA 4TNSA 1FKHA 2FDMA 4ODNA 4MNLA 5HWCA 1M5YA 3ODKA 1ROUA 3ARRA 1D7HA 2RUQA 2LGOA 4Z2LA 2RUCA 2DT3A 1W26A 1HJWA 2G41A 1ZBWA 4W5UA 3O5LA 1GPFA 2ZQUA 2XPAA 2KE0A 5GQBA 2K8IA 1ITXA 5D75A 4QIBA 4Z2JA 1FFQA 4ODKA 5GPGA 5JH8A 1SR0A 1LL4A 2F4EA 2F21A 3PA7A 1FKDA 1KFWA 4WKFA 3UQBA 2DSUA 1FKFA 4JFIA 1PINA 2B31A 4DIPA 1LL7A 1OGGA 1Q6HA 2KR7A 1NWSA 4IT4A 1W9PA 2DSZA 3RMEA 4ZPTR 3GPKA 4Q22A 3KAGA 4FN2A 4LGXA 1W1PA 1ROTA 5HKGA 4U86A 3RFWA 1D7JA 1T11A 1HJVA 1ZBKA 2RURA 4W9PA 3PRAA 1JVWA 3JXVA 1L1PA 1FKKA 4ODQA 1NMWA 3IHZA 4Z2KA 1ZCNA 4GIVA 1QZ2A 5HT1A 3FAPA 2O92A 4LAVA 3ARZA 2DG3A 1A7XA 4ITZA 4QT2A 4LAXA 4DRPA 1FKGA 1NSGA 1F40A 1YW5A 1JNSA 4GGQA 3TDBA 3AS2A 1JNDA 1LG2A 4O2TA 4P8VA 4MAVA 2FAPA 1OGBA 4NZCA 3CGMA 4G2PA 3O5OA 4JFJA 5DEZA 1KT1A 3UQIA 1GOIA 5HBFA 4ZPVR 1U79A 2DSVA 4DRNA 4ODRA 4HBEA 2DT2A 1FFRA 1FKBA 3B9AA 1O6IA 4NNRA 2MF9A 3PRBA 1FAPA 2YBTA 4JFKA 2XP8A 4TW6A 1ZBCA 3UQAA 2OLHA 4DWSA 1QPLA 3O5DA 2ZR4A 4N19A 4TW7A 1Q6UA 1E9LA 3IKDA 3RGCA 3G6LA 2PI6A 2RUDA 1HKKA 2PPNA 3IK8A 3WD4A 1FKTA 3AS3A 2N87A 1HKIA 3IKGA 1LG1A 2A3BA 1FD9A 1E6PA 3EY6A 3ARUA 2KI3A 3B8SA 3QOKA 3ARSA 2IF4A 4BF8A 3CH9A 4L72B 4KR0B 4LAYA 1LL6A 2MLXA 2QF8A 4PTMA 1NWUA 2A3AA 4WJXA 3UI5A 3FXYA 3CHEA 4QT3A 2WLYA 4NSBA 2L2SA 4W9OA 1E6ZA 4MTVA 1QPFA 4HARA 3CGNA 2XP4A 4TW8A 1J4RA 1SYTA 1EYMA 1E15A 4JYSA 1H0IA 3G6MA 4ZPWR 3O5RA 3O5IA 2ZR5A 4IQCA 3CHFA 4ZS6A 1D2KA 4ODOA 4LAWA 3NRKA 4W9QA 2DG9A 2O9OA 2XPBA 1TCOC 1ZU8A 1NMVA 3PRDA 1K9TA 3MDYB 3WQVA 4U85A 2RQSA 2WM0A 2XP3A 2LPVA 3NI6A 3OA5A 3O5KA 1D6OA 4IPXA 2ESCA 1LQ0A 4XAKA 4AY1A 1WAWA 4ODMA 3ARQA 3W4RA 4ODLA 2MLZA 1JNTA 4WK9A 1WNOA 3KABA 2FKEA 4C02B 4WKAA 2ZR6A 4MPKA 3ARYA 5DIUA 4G50A 1C9HA 4MNKA 4QZVB 3RM8A 1GUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HTG A;  2RUD A;  4MSP A;  2M08 A;  2F4E A;  2F21 A;  3PA7 A;  3UI6 A;  2PPN A;  3IK8 A;  1FKD A;  1YAT A;  1FKT A;  5HUA A;  2N87 A;  3UQB A;  3IKG A;  1FKF A;  2XP6 A;  4JFI A;  1Q6I A;  1FKL A;  1F8A B;  1PIN A;  2LKN A;  1ZK6 A;  2OFN A;  4DIP A;  1FD9 A;  4DRO A;  2PV1 A;  1J4I A;  2VN1 A;  3WH0 A;  1J4H A;  2KFW A;  2MPH A;  5GPG A;  1BKF A;  1Q6H A;  3EY6 A;  4DRK A;  3TC5 A;  2KI3 A;  3JYM A;  2KR7 A;  3O5F A;  3OOB A;  3O5P A;  5HWB A;  2M1I A;  1Q1C A;  1N1A A;  1FKJ A;  4U84 A;  1FKI A;  1Y0O A;  2IF4 A;  4BF8 A;  3GPK A;  2ZQV A;  3KAG A;  4J4N A;  4LAY A;  4DZ2 A;  4FN2 A;  2MLX A;  4MGV A;  4DRQ A;  1ROT A;  4DRH A;  2XP7 A;  4U86 A;  3RFW A;  5HKG A;  1D7J A;  1T11 A;  4W9P A;  2RUR A;  1D7I A;  2PPP A;  1JVW A;  3JXV A;  4J4O A;  3UI5 A;  1HXV A;  2KGJ A;  2M2A A;  1L1P A;  1FKK A;  4ODQ A;  4QT3 A;  4TX0 A;  1R9H A;  3H9R B;  3B7X A;  1NMW A;  3IHZ A;  2L2S A;  1ZCN A;  2XP5 A;  3KAF A;  4JFM A;  4W9O A;  4GIV A;  1QZ2 A;  5HT1 A;  3FAP A;  4DRJ A;  1QPF A;  2DG4 A;  4IQ2 A;  1FKS A;  2Y78 A;  4JFL A;  4LAV A;  2DG3 A;  1A7X A;  3CGN A;  4ITZ A;  4QT2 A;  4LAX A;  2PV2 A;  2XP4 A;  1FKG A;  4TW8 A;  1J4R A;  4DH0 A;  4DRP A;  1EYM A;  5HW8 A;  2PV3 A;  3NTP A;  4JYS A;  2PBC A;  3O5J A;  1NSG A;  4DT4 A;  1F40 A;  5J6E A;  2RSE A;  1YW5 A;  2MLY A;  1JNS A;  4GGQ A;  3O5R A;  3TDB A;  3O5I A;  4DRI A;  2Q5A A;  2ZR5 A;  3O5M A;  3KAI A;  3UI4 A;  4IQC A;  2F2D A;  1FJD A;  3I6C A;  4O2T A;  2D9F A;  1EQ3 A;  5I98 A;  2FAP A;  2PPO A;  4ODO A;  4R0X A;  3KCE A;  5DIT A;  3JYJ A;  3TCZ A;  4LAW A;  3NRK A;  4DZ3 A;  2ZQS A;  3CGM A;  3O5Q A;  4G2P A;  4W9Q A;  2ITK A;  1BL4 A;  5DIV A;  2DG9 A;  3O5O A;  4DRM A;  4JFJ A;  5HW6 A;  2XPB A;  1KT1 A;  3O5G A;  1TCO C;  3UQI A;  1FKR A;  2UZ5 A;  1NMV A;  2MNT A;  2LJ4 A;  3PRD A;  1P5Q A;  2AWG A;  3MDY B;  5BXJ A;  1PBK A;  3O5E A;  4U85 A;  2ZQT A;  3KAC A;  1U79 A;  2RQS A;  5HW7 A;  4DRN A;  2KO7 A;  4ODR A;  1J6Y A;  2XP9 A;  4TNS A;  2XP3 A;  5B8I C;  1FKH A;  1FKB A;  2LPV A;  3KAH A;  3NI6 A;  3O5K A;  1D6O A;  4IPX A;  4ODN A;  4NNR A;  3KAD A;  4FAP A;  1M5Y A;  5HWC A;  3ODK A;  1ROU A;  4ODM A;  4TYO A;  1D7H A;  2MF9 A;  2RUQ A;  2LGO A;  2JZV A;  3PRB A;  1FAP A;  4ODL A;  2RUC A;  1KT0 A;  2MLZ A;  2VCD A;  1W26 A;  1JNT A;  4JFK A;  2XP8 A;  4TW6 A;  3UQA A;  3LUO A;  3O5L A;  3UF8 A;  3KAB A;  1QPL A;  2FKE A;  3O5D A;  2ZR4 A;  2ZQU A;  2XPA A;  1B6C A;  2KE0 A;  4N19 A;  2ZR6 A;  2K8I A;  3VAW A;  4C02 B;  3KZ7 A;  4TW7 A;  5DIU A;  1Q6U A;  5D75 A;  4QIB A;  3IKD A;  4ODP A;  4G50 A;  1C9H A;  3RGC A;  4ODK A; 
#chains in the Genus database with same CATH topology
 1EHN A;  3ARX A;  2M08 A;  3EIP A;  3GU0 A;  1YAT A;  5HUA A;  3AQU A;  2LKN A;  1ZK6 A;  2OFN A;  4L3N A;  2WK2 A;  2PV1 A;  4Q7N A;  3WH0 A;  1J4H A;  2KFW A;  4KQZ A;  3ARP A;  1BKF A;  4DRK A;  1UR9 A;  3TC5 A;  2DT1 A;  1JNE A;  1RD6 A;  3OOB A;  3O5P A;  5HWB A;  1N1A A;  1FKJ A;  1IX5 A;  4MNJ A;  4DZ2 A;  4MGV A;  4DRQ A;  1HJX A;  1D7I A;  2G8Z A;  2AOS A;  3B9D A;  4J4O A;  2M2A A;  4TX0 A;  1R9H A;  1XRV A;  5DF0 A;  3AS1 A;  3KAF A;  3WL0 A;  4ML4 A;  3ARW A;  4IQ2 A;  4JFL A;  4Z2H A;  1W1T A;  2F23 A;  4DWS B;  3PR9 A;  5DO2 A;  5HW8 A;  3WKZ A;  3NTP A;  3WD1 A;  2PBC A;  1VF8 A;  5J6E A;  2RSE A;  2Q5A A;  3O5M A;  2IUZ A;  3UI4 A;  2F2D A;  1FJD A;  2D9F A;  1EQ3 A;  2YBU A;  4R0X A;  4DZ3 A;  2ITK A;  5DIV A;  3CHC A;  1FKR A;  2DSW A;  2MNT A;  5BXJ A;  2AWG A;  1PBK A;  3O5E A;  2ZQT A;  3KAC A;  4DWS D;  3CHD A;  3WL1 A;  2XP9 A;  1XHG A;  1LJY A;  5B8I C;  3KAH A;  3KAD A;  4FAP A;  3B9E A;  4TYO A;  2JZV A;  4URI A;  2VCD A;  1KT0 A;  1W1Y A;  1E6R A;  3LUO A;  3WD0 A;  3UF8 A;  4HBO A;  4P8X A;  1B6C A;  1ZB5 A;  3VAW A;  4MNM A;  3ALG A;  3KZ7 A;  1NWT A;  1TFV A;  1W1V A;  4ODP A;  3CZ8 A;  5I98 A;  3GTY X;  5HTG A;  4MSP A;  1HKJ A;  1X6N A;  1W9V A;  3UI6 A;  2A3C A;  2XP6 A;  1Q6I A;  1FKL A;  1F8A B;  3ARV A;  2DT0 A;  4DRO A;  3WQW A;  1J4I A;  2VN1 A;  4IT6 A;  2MPH A;  4DWS C;  3JYM A;  3O5F A;  3ALF A;  3BXW A;  1EIB A;  1Q1C A;  2M1I A;  4U84 A;  1FKI A;  1Y0O A;  4S3K A;  2ZQV A;  4J4N A;  2A3E A;  4DRH A;  2XP7 A;  1ZBV A;  3WD2 A;  2PPP A;  1HXV A;  2KGJ A;  3FY1 A;  3H9R B;  3B7X A;  3RM9 A;  1E6N A;  2XP5 A;  4R5E A;  4JFM A;  4Z2I A;  4DRJ A;  1ZL1 A;  2DG4 A;  1FKS A;  1JCH B;  2Y78 A;  1CTN A;  4P8U A;  2PV2 A;  4DH0 A;  1NH6 A;  1EDQ A;  5GPR A;  2PV3 A;  4Z2G A;  2PN0 A;  3O5J A;  1WB0 A;  3WD3 A;  4DT4 A;  4P8W A;  4WKH A;  2EUL A;  2MLY A;  4DRI A;  1HKM A;  3KAI A;  4S3J A;  4WIW A;  1NWR A;  3I6C A;  1UR8 A;  3RM4 A;  1H0G A;  2DPE A;  2PPO A;  3KCE A;  5DIT A;  3JYJ A;  3TCZ A;  1X6L A;  2ZQS A;  3O5Q A;  1W9U A;  1BL4 A;  3WIJ A;  4DRM A;  3ART A;  5HW6 A;  3O5G A;  1OWQ A;  2UZ5 A;  2LJ4 A;  1P5Q A;  2WLZ A;  3ARO A;  3AS0 A;  5HW7 A;  2KO7 A;  1J6Y A;  4TNS A;  1FKH A;  2FDM A;  4ODN A;  4MNL A;  5HWC A;  1M5Y A;  3ODK A;  1ROU A;  3ARR A;  1D7H A;  2RUQ A;  2LGO A;  4Z2L A;  2RUC A;  2DT3 A;  1W26 A;  1HJW A;  2G41 A;  1ZBW A;  4W5U A;  3O5L A;  1GPF A;  2ZQU A;  2XPA A;  2KE0 A;  5GQB A;  2K8I A;  1ITX A;  5D75 A;  4QIB A;  4Z2J A;  1FFQ A;  4ODK A;  5GPG A;  5JH8 A;  1SR0 A;  1LL4 A;  2F4E A;  2F21 A;  3PA7 A;  1FKD A;  1KFW A;  4WKF A;  3UQB A;  2DSU A;  1FKF A;  4JFI A;  1PIN A;  2B31 A;  4DIP A;  1LL7 A;  1OGG A;  1Q6H A;  2KR7 A;  1NWS A;  4IT4 A;  1W9P A;  2DSZ A;  3RME A;  4ZPT R;  3GPK A;  4Q22 A;  3KAG A;  4FN2 A;  4LGX A;  1W1P A;  1ROT A;  5HKG A;  4U86 A;  3RFW A;  1D7J A;  1T11 A;  1HJV A;  1ZBK A;  2RUR A;  4W9P A;  3PRA A;  1JVW A;  3JXV A;  1L1P A;  1FKK A;  4ODQ A;  1NMW A;  3IHZ A;  4Z2K A;  1ZCN A;  4GIV A;  1QZ2 A;  5HT1 A;  3FAP A;  2O92 A;  4LAV A;  3ARZ A;  2DG3 A;  1A7X A;  4ITZ A;  4QT2 A;  4LAX A;  4DRP A;  1FKG A;  1NSG A;  1F40 A;  1YW5 A;  1JNS A;  4GGQ A;  3TDB A;  3AS2 A;  1JND A;  1LG2 A;  4O2T A;  4P8V A;  4MAV A;  2FAP A;  1OGB A;  4NZC A;  3CGM A;  4G2P A;  3O5O A;  4JFJ A;  5DEZ A;  1KT1 A;  3UQI A;  1GOI A;  5HBF A;  4ZPV R;  1U79 A;  2DSV A;  4DRN A;  4ODR A;  4HBE A;  2DT2 A;  1FFR A;  1FKB A;  3B9A A;  1O6I A;  4NNR A;  4UDM A;  2MF9 A;  3PRB A;  1FAP A;  2YBT A;  4JFK A;  2XP8 A;  4TW6 A;  1ZBC A;  3UQA A;  2OLH A;  1GRJ A;  4DWS A;  1QPL A;  3O5D A;  2ZR4 A;  4N19 A;  4TW7 A;  1Q6U A;  1E9L A;  3IKD A;  3RGC A;  3G6L A;  2PI6 A;  2RUD A;  1HKK A;  2PPN A;  3IK8 A;  3WD4 A;  1FKT A;  3AS3 A;  2N87 A;  1HKI A;  3IKG A;  1LG1 A;  2A3B A;  1FD9 A;  1E6P A;  3BMB A;  3EY6 A;  3ARU A;  2KI3 A;  3B8S A;  3QOK A;  3ARS A;  2IF4 A;  4BF8 A;  3CH9 A;  4L72 B;  4KR0 B;  4LAY A;  1LL6 A;  2MLX A;  2QF8 A;  4PTM A;  1NWU A;  2A3A A;  4WJX A;  3UI5 A;  3FXY A;  3CHE A;  4QT3 A;  2WLY A;  4NSB A;  2L2S A;  4W9O A;  1E6Z A;  4MTV A;  1QPF A;  4HAR A;  3CGN A;  2XP4 A;  4TW8 A;  1J4R A;  1SYT A;  1EYM A;  1E15 A;  4JYS A;  2P4V A;  1H0I A;  3G6M A;  4ZPW R;  3O5R A;  3O5I A;  2ZR5 A;  4IQC A;  3CHF A;  4ZS6 A;  1D2K A;  4ODO A;  4LAW A;  3NRK A;  4W9Q A;  2DG9 A;  2O9O A;  2XPB A;  1TCO C;  1ZU8 A;  1NMV A;  3PRD A;  1K9T A;  3MDY B;  3WQV A;  4U85 A;  2RQS A;  2WM0 A;  2XP3 A;  2LPV A;  3NI6 A;  3OA5 A;  4IPX A;  1E44 A;  1D6O A;  3O5K A;  2ESC A;  1LQ0 A;  4XAK A;  4AY1 A;  1WAW A;  4ODM A;  3ARQ A;  3W4R A;  4ODL A;  2MLZ A;  1JNT A;  4WK9 A;  1WNO A;  2B5U B;  3KAB A;  2FKE A;  4C02 B;  2ETN A;  2ZR6 A;  4WKA A;  4MPK A;  3ARY A;  5DIU A;  4G50 A;  1C9H A;  4MNK A;  4QZV B;  3RM8 A;  1GUV A; 
#chains in the Genus database with same CATH homology
 1EHN A;  3ARX A;  2M08 A;  1YAT A;  5HUA A;  3AQU A;  2LKN A;  1ZK6 A;  2OFN A;  4L3N A;  2WK2 A;  2PV1 A;  4Q7N A;  3WH0 A;  1J4H A;  2KFW A;  4KQZ A;  3ARP A;  1BKF A;  4DRK A;  1UR9 A;  3TC5 A;  2DT1 A;  1JNE A;  1RD6 A;  3OOB A;  3O5P A;  5HWB A;  1N1A A;  1FKJ A;  1IX5 A;  4MNJ A;  4DZ2 A;  4MGV A;  4DRQ A;  1HJX A;  1D7I A;  2G8Z A;  2AOS A;  3B9D A;  4J4O A;  2M2A A;  4TX0 A;  1R9H A;  1XRV A;  5DF0 A;  3AS1 A;  3KAF A;  3WL0 A;  4ML4 A;  3ARW A;  4IQ2 A;  4JFL A;  4Z2H A;  1W1T A;  4DWS B;  3PR9 A;  5DO2 A;  5HW8 A;  3WKZ A;  3NTP A;  3WD1 A;  2PBC A;  1VF8 A;  5J6E A;  2RSE A;  2Q5A A;  3O5M A;  2IUZ A;  3UI4 A;  2F2D A;  1FJD A;  2D9F A;  1EQ3 A;  2YBU A;  4R0X A;  4DZ3 A;  2ITK A;  5DIV A;  3CHC A;  1FKR A;  2DSW A;  2MNT A;  5BXJ A;  2AWG A;  1PBK A;  3O5E A;  2ZQT A;  3KAC A;  4DWS D;  3CHD A;  3WL1 A;  2XP9 A;  1XHG A;  1LJY A;  5B8I C;  3KAH A;  3KAD A;  4FAP A;  3B9E A;  4TYO A;  2JZV A;  4URI A;  2VCD A;  1KT0 A;  1W1Y A;  1E6R A;  3LUO A;  3WD0 A;  3UF8 A;  4HBO A;  4P8X A;  1B6C A;  1ZB5 A;  3VAW A;  4MNM A;  3ALG A;  3KZ7 A;  1NWT A;  1TFV A;  1W1V A;  4ODP A;  3CZ8 A;  5I98 A;  5HTG A;  4MSP A;  1HKJ A;  1X6N A;  1W9V A;  3UI6 A;  2A3C A;  2XP6 A;  1Q6I A;  1FKL A;  1F8A B;  3ARV A;  2DT0 A;  4DRO A;  3WQW A;  1J4I A;  2VN1 A;  4IT6 A;  2MPH A;  4DWS C;  3JYM A;  3O5F A;  3ALF A;  3BXW A;  1EIB A;  1Q1C A;  2M1I A;  4U84 A;  1FKI A;  1Y0O A;  4S3K A;  2ZQV A;  4J4N A;  2A3E A;  4DRH A;  2XP7 A;  1ZBV A;  3WD2 A;  2PPP A;  1HXV A;  2KGJ A;  3FY1 A;  3H9R B;  3B7X A;  3RM9 A;  1E6N A;  2XP5 A;  4R5E A;  4JFM A;  4Z2I A;  4DRJ A;  1ZL1 A;  2DG4 A;  1FKS A;  2Y78 A;  4P8U A;  1CTN A;  2PV2 A;  4DH0 A;  1NH6 A;  1EDQ A;  5GPR A;  2PV3 A;  4Z2G A;  3O5J A;  1WB0 A;  3WD3 A;  4DT4 A;  4P8W A;  4WKH A;  2MLY A;  4DRI A;  1HKM A;  3KAI A;  4S3J A;  4WIW A;  1NWR A;  3I6C A;  1UR8 A;  3RM4 A;  1H0G A;  2DPE A;  2PPO A;  3KCE A;  5DIT A;  3JYJ A;  3TCZ A;  1X6L A;  2ZQS A;  3O5Q A;  1W9U A;  1BL4 A;  3WIJ A;  4DRM A;  3ART A;  5HW6 A;  3O5G A;  1OWQ A;  2UZ5 A;  2LJ4 A;  1P5Q A;  2WLZ A;  3ARO A;  3AS0 A;  5HW7 A;  2KO7 A;  1J6Y A;  4TNS A;  1FKH A;  2FDM A;  4ODN A;  4MNL A;  5HWC A;  1M5Y A;  3ODK A;  1ROU A;  3ARR A;  1D7H A;  2RUQ A;  2LGO A;  4Z2L A;  2RUC A;  2DT3 A;  1W26 A;  1HJW A;  2G41 A;  1ZBW A;  4W5U A;  3O5L A;  1GPF A;  2ZQU A;  2XPA A;  2KE0 A;  5GQB A;  2K8I A;  1ITX A;  5D75 A;  4QIB A;  4Z2J A;  1FFQ A;  4ODK A;  5GPG A;  5JH8 A;  1SR0 A;  1LL4 A;  2F4E A;  2F21 A;  3PA7 A;  1FKD A;  1KFW A;  4WKF A;  3UQB A;  2DSU A;  1FKF A;  4JFI A;  1PIN A;  2B31 A;  4DIP A;  1LL7 A;  1OGG A;  1Q6H A;  2KR7 A;  1NWS A;  4IT4 A;  1W9P A;  2DSZ A;  3RME A;  4ZPT R;  3GPK A;  4Q22 A;  3KAG A;  4FN2 A;  4LGX A;  1W1P A;  1ROT A;  5HKG A;  4U86 A;  3RFW A;  1D7J A;  1T11 A;  1HJV A;  1ZBK A;  2RUR A;  4W9P A;  3PRA A;  1JVW A;  3JXV A;  1L1P A;  1FKK A;  4ODQ A;  1NMW A;  3IHZ A;  4Z2K A;  1ZCN A;  4GIV A;  1QZ2 A;  5HT1 A;  3FAP A;  2O92 A;  4LAV A;  3ARZ A;  2DG3 A;  1A7X A;  4ITZ A;  4QT2 A;  4LAX A;  4DRP A;  1FKG A;  1NSG A;  1F40 A;  1YW5 A;  1JNS A;  4GGQ A;  3TDB A;  3AS2 A;  1JND A;  1LG2 A;  4O2T A;  4P8V A;  4MAV A;  2FAP A;  1OGB A;  4NZC A;  3CGM A;  4G2P A;  3O5O A;  4JFJ A;  5DEZ A;  1KT1 A;  3UQI A;  1GOI A;  5HBF A;  4ZPV R;  1U79 A;  2DSV A;  4DRN A;  4ODR A;  4HBE A;  2DT2 A;  1FFR A;  1FKB A;  3B9A A;  1O6I A;  4NNR A;  2MF9 A;  3PRB A;  1FAP A;  2YBT A;  4JFK A;  2XP8 A;  4TW6 A;  1ZBC A;  3UQA A;  2OLH A;  4DWS A;  1QPL A;  3O5D A;  2ZR4 A;  4N19 A;  4TW7 A;  1Q6U A;  1E9L A;  3IKD A;  3RGC A;  3G6L A;  2PI6 A;  2RUD A;  1HKK A;  2PPN A;  3IK8 A;  3WD4 A;  1FKT A;  3AS3 A;  2N87 A;  1HKI A;  3IKG A;  1LG1 A;  2A3B A;  1FD9 A;  1E6P A;  3EY6 A;  3ARU A;  2KI3 A;  3B8S A;  3QOK A;  3ARS A;  2IF4 A;  4BF8 A;  3CH9 A;  4L72 B;  4KR0 B;  4LAY A;  1LL6 A;  2MLX A;  2QF8 A;  4PTM A;  1NWU A;  2A3A A;  4WJX A;  3UI5 A;  3FXY A;  3CHE A;  4QT3 A;  2WLY A;  4NSB A;  2L2S A;  4W9O A;  1E6Z A;  4MTV A;  1QPF A;  4HAR A;  3CGN A;  2XP4 A;  4TW8 A;  1J4R A;  1SYT A;  1EYM A;  1E15 A;  4JYS A;  1H0I A;  3G6M A;  4ZPW R;  3O5R A;  3O5I A;  2ZR5 A;  4IQC A;  3CHF A;  4ZS6 A;  1D2K A;  4ODO A;  4LAW A;  3NRK A;  4W9Q A;  2DG9 A;  2O9O A;  2XPB A;  1TCO C;  1ZU8 A;  1NMV A;  3PRD A;  1K9T A;  3MDY B;  3WQV A;  4U85 A;  2RQS A;  2WM0 A;  2XP3 A;  2LPV A;  3NI6 A;  3OA5 A;  3O5K A;  1D6O A;  4IPX A;  2ESC A;  1LQ0 A;  4XAK A;  4AY1 A;  1WAW A;  4ODM A;  3ARQ A;  3W4R A;  4ODL A;  2MLZ A;  1JNT A;  4WK9 A;  1WNO A;  3KAB A;  2FKE A;  4C02 B;  4WKA A;  2ZR6 A;  4MPK A;  3ARY A;  5DIU A;  4G50 A;  1C9H A;  4MNK A;  4QZV B;  3RM8 A;  1GUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...