2PPOA

Crystal structure of e60a mutant of fkbp12
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWAEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 1A
publication title Structural coupling between FKBP12 and buried water.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 28
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ppoA00
5B8IC 1D7HA 1F8AB 1M5YA 2RUDA 1FKLA 3UQAA 2OFNA 5GPGA 2XP4A 4ODKA 4TW7A 3TC5A 3RGCA 4JFMA 3IKDA 2D9FA 2ZR4A 3UI6A 4DIPA 1P5QA 2M08A 3ODKA 3UI4A 1R9HA 3B7XA 3KCEA 2PPNA 2MF9A 5DIVA 4DT4A 5DIUA 1FKFA 2ITKA 1FKTA 1TCOC 1Q1CA 4U85A 4W9OA 2PBCA 4DRPA 4ODRA 1FKRA 1QPFA 2ZQUA 4ITZA 4TX0A 5HWCA 2ZQSA 2XP3A 1PBKA 3KADA 4J4OA 1FKSA 2MLXA 3IKGA 4LAWA 5HW8A 2ZR6A 4LAVA 5HW7A 1J4HA 1Q6HA 2XPAA 2RURA 1J4RA 3I6CA 4ODLA 5HT1A 1PINA 1YW5A 4JFLA 3RFWA 4DRJA 3O5EA 3JYMA 2LPVA 3O5QA 4FN2A 1KT0A 3KACA 4U86A 2N87A 4TNSA 5HTGA 1D7JA 1T11A 1HXVA 4IQCA 5DITA 2L2SA 1F40A 2KFWA 3JXVA 1FAPA 4GGQA 3TDBA 3KZ7A 2IF4A 2KO7A 3OOBA 2RSEA 2F2DA 3IK8A 5D75A 3O5PA 4GIVA 4LAYA 1L1PA 2KGJA 2ZQTA 4MSPA 3KAHA 4ODQA 3O5LA 3CGNA 1FKJA 4JFJA 4DRHA 1FKDA 3UF8A 4JFIA 4ODPA 2KI3A 1JVWA 4LAXA 4DROA 3KAFA 1NMVA 2PV2A 1FKHA 3O5DA 4R0XA 2XP6A 4FAPA 1J6YA 3PRBA 2M1IA 2XP7A 4TW6A 2VCDA 1FJDA 2AWGA 1FD9A 1Q6IA 3O5GA 3NI6A 3CGMA 5HW6A 3NTPA 4G50A 4QT3A 4DRMA 2PPPA 2LJ4A 2MLYA 3O5RA 2Q5AA 4DRQA 1QPLA 4ODNA 1C9HA 3O5JA 4W9PA 1NMWA 3GPKA 4ODOA 5I98A 4JFKA 2FAPA 1KT1A 2PPOA 1JNTA 4QIBA 2DG9A 4DH0A 4DZ3A 1FKBA 1FKGA 3IHZA 1J4IA 5J6EA 4DRKA 1EYMA 1ZK6A 1D7IA 2K8IA 4DRNA 1N1AA 1FKIA 1NSGA 1QZ2A 2DG4A 2VN1A 4C02B 1FKKA 3TCZA 1Q6UA 3O5KA 2XP8A 3O5OA 2XP9A 2M2AA 4G2PA 3FAPA 2F21A 1BL4A 4QT2A 3MDYB 4W9QA 1A7XA 2DG3A 3UI5A 3JYJA 3UQIA 1EQ3A 1U79A 2Y78A 3UQBA 2MLZA 4U84A 2MNTA 2XP5A 4N19A 1BKFA 2MPHA 3VAWA 3O5FA 5HWBA 2LKNA 4JYSA 1W26A 2RQSA 2F4EA 3O5IA 2PV1A 3KABA 2ZR5A 1Y0OA 4DRIA 4J4NA 3PA7A 4TYOA 1D6OA 3KAIA 3O5MA 1ZCNA 1JNSA 2UZ5A 3WH0A 1ROTA 4TW8A 2KR7A 2PV3A 1ROUA 3LUOA 3NRKA 4IPXA 3KAGA 2JZVA 2FKEA 3H9RB 1YATA 5HUAA 2ZQVA 4IQ2A 2XPBA 2RUCA 2KE0A 4ODMA 4NNRA 4DZ2A 1B6CA 4BF8A 5HKGA 3PRDA 2LGOA 5BXJA 2RUQA 3EY6A 4MGVA 4O2TA
chains in the Genus database with same CATH superfamily
5B8IC 1K9TA 1M5YA 3BMBA 4HBEA 4LGXA 5GPGA 4TW7A 3TC5A 1W9PA 2G41A 3UI6A 1P5QA 1R9HA 1FKTA 1E9LA 1TCOC 5DO2A 1ZL1A 1Q1CA 1OGGA 2PBCA 1WAWA 1FKSA 4LAWA 5HW7A 3G6LA 4DZ2A 4Q7NA 1YW5A 3CZ8A 4FN2A 1ZBCA 2LPVA 1KT0A 3CH9A 4L3NA 4DWSA 4IQCA 4P8XA 3JXVA 3KZ7A 2KO7A 3IK8A 3O5PA 4IT4A 1L1PA 4MSPA 3KAHA 1WNOA 3KAFA 4R0XA 1E6PA 2B31A 2XP6A 2G8ZA 3PR9A 2M1IA 1FJDA 2AWGA 1Q6IA 2WM0A 4DRMA 1FFQA 2DSVA 2MLYA 2PPPA 2WLYA 1QPLA 4DWSD 4ODNA 1C9HA 4WJXA 4W9PA 4XAKA 1HKMA 4NZCA 4Z2JA 2PI6A 3WL1A 1KT1A 5DF0A 1JNTA 4URIA 4DZ3A 2DT2A 2A3AA 1FKBA 1ZK6A 1D7IA 4DRNA 3ARQA 1HKIA 3ARZA 2VN1A 4C02B 3FAPA 2F21A 4WKHA 3CHCA 1XRVA 2DG3A 3UI5A 3JYJA 1EQ3A 4HBOA 1GOIA 3WKZA 1IX5A 1TFVA 4P8WA 2PV1A 2ZR5A 1Y0OA 1D6OA 1SYTA 1D2KA 1ZCNA 1JNSA 4TW8A 1ITXA 1ROUA 3LUOA 3RM8A 1GPFA 1YATA 1JCHB 3WD3A 2XPBA 3AS3A 4MNLA 4ODMA 1B6CA 4MGVA 1LG1A 2A3EA 2RUDA 4UDMA 3RGCA 2WK2A 4JFMA 3CHEA 3CHDA 2M08A 3ODKA 3FY1A 3ARVA 3B7XA 2DSZA 3RM4A 4U85A 2WLZA 4ODRA 3ARRA 4TX0A 2XP3A 1PBKA 3KADA 4J4OA 2P4VA 1LJYA 1W9UA 3IKGA 5HW8A 2ZR6A 4LAVA 1J4HA 3I6CA 1FFRA 1J4RA 4KQZA 4ODLA 1PINA 4JFLA 2B5UB 3O5EA 4S3KA 5GQBA 3KACA 2OLHA 4TNSA 1ZBVA 2DSWA 5HTGA 1T11A 1HXVA 3QOKA 2YBTA 2L2SA 4QZVB 4Z2HA 4WIWA 3ALFA 1FAPA 4IT6A 3ARUA 3TDBA 4KR0B 2IF4A 2F2DA 4LAYA 3G6MA 4ODQA 4DRHA 3ARXA 1OGBA 3UF8A 4ODPA 1JVWA 4Z2KA 4DROA 3ARPA 1UR9A 3WQWA 1FKHA 3O5DA 3AQUA 4FAPA 2XP7A 4TW6A 3NTPA 4Z2LA 2Q5AA 3WL0A 2YBUA 3O5JA 2DT1A 5I98A 3GPKA 3WD1A 4JFKA 2FAPA 1NWSA 4QIBA 3ARSA 4DRKA 3ARYA 1EDQA 1QZ2A 1NWTA 4AY1A 4WKAA 3WD2A 3O5OA 4W9QA 1BL4A 1A7XA 1U79A 2Y78A 3UQBA 1NWRA 2MLZA 3FXYA 3GU0A 2MNTA 2XP5A 5JH8A 4P8UA 3O5FA 4P8VA 2RQSA 2F4EA 1O6IA 3PA7A 1W9VA 4MNKA 4TYOA 2FKEA 3H9RB 5HUAA 3CHFA 4Q22A 3EY6A 1D7HA 1F8AB 1FKLA 2XP4A 4ODKA 3ALGA 3GTYX 3RM9A 3IKDA 2ZR4A 4DIPA 3UI4A 4MNMA 5DIVA 5DIUA 2ITKA 1E6NA 3WD0A 1H0IA 3B8SA 1X6NA 1W1PA 3AS1A 1QPFA 4ITZA 2ZQSA 1W1TA 1LL4A 1HJXA 5HBFA 1Q6HA 2XPAA 3RFWA 1VF8A 4DRJA 3O5QA 3AS0A 3JYMA 1ZBWA 1JNDA 3WIJA 4DWSC 3AROA 1JNEA 2A3BA 4GGQA 1WB0A 2RSEA 4ML4A 4GIVA 3WD4A 2KGJA 4Z2IA 4JFJA 1FKDA 2KI3A 3B9DA 4LAXA 1NMVA 2PV2A 1E15A 3PRBA 2VCDA 1FD9A 3NI6A 3ARWA 5HW6A 4MTVA 4W5UA 4QT3A 4G50A 4ZPWR 1HJVA 2LJ4A 1OWQA 5GPRA 1LG2A 4DRQA 1ZU8A 1NMWA 3PRAA 2PPOA 5J6EA 1J4IA 1EYMA 1FKIA 2DG4A 2O92A 2ETNA 4MAVA 3TCZA 1Q6UA 1E6RA 2XP9A 2DPEA 3B9AA 3EIPA 3UQIA 2F23A 1BKFA 4N19A 3ARTA 3RMEA 2LKNA 4JYSA 4DRIA 3O5MA 4ZS6A 2UZ5A 1ROTA 2PV3A 1NH6A 2ZQVA 3OA5A 4NNRA 1W1YA 5DEZA 1CTNA 5HKGA 3PRDA 5BXJA 2RUQA 1HKJA 2DT0A 3AS2A 1NWUA 1E44A 1EIBA 2EULA 1HJWA 3UQAA 2OFNA 2D9FA 3KCEA 4R5EA 2PPNA 2MF9A 4DT4A 1FKFA 1GUVA 4W9OA 1KFWA 4DRPA 1FKRA 2ZQUA 5HWCA 2MLXA 1ZBKA 2RURA 5HT1A 4U86A 2N87A 1D7JA 2DT3A 4L72B 5DITA 1F40A 2KFWA 2IUZA 2QF8A 1RD6A 4MNJA 1SR0A 3OOBA 3B9EA 1UR8A 4WK9A 5D75A 2A3CA 3BXWA 2ZQTA 4PTMA 2DSUA 3O5LA 3CGNA 1FKJA 1LL6A 4Z2GA 4JFIA 1W1VA 1ZB5A 4DWSB 4WKFA 4HARA 4ZPVR 1J6YA 3O5GA 3CGMA 3O5RA 2PN0A 1EHNA 2ESCA 4ODOA 1LL7A 2AOSA 2DG9A 4DH0A 4S3JA 1FKGA 3IHZA 1HKKA 2K8IA 1N1AA 1NSGA 3WQVA 1LQ0A 1FKKA 3W4RA 2O9OA 3O5KA 4G2PA 2XP8A 4QT2A 1GRJA 2M2AA 3MDYB 1XHGA 4U84A 1E6ZA 4MPKA 3VAWA 2MPHA 4NSBA 5HWBA 1W26A 1X6LA 3O5IA 3KABA 4J4NA 3KAIA 3WH0A 2KR7A 3NRKA 1H0GA 4IPXA 3KAGA 2JZVA 2FDMA 4IQ2A 2RUCA 2KE0A 4BF8A 2LGOA 4O2TA 4ZPTR
chains in the Genus database with same CATH topology
5B8IC 1K9TA 1M5YA 4HBEA 4LGXA 5GPGA 4TW7A 3TC5A 1W9PA 2G41A 3UI6A 1P5QA 1R9HA 1FKTA 1E9LA 1TCOC 5DO2A 1ZL1A 1Q1CA 1OGGA 2PBCA 1WAWA 1FKSA 4LAWA 5HW7A 3G6LA 4DZ2A 4Q7NA 1YW5A 3CZ8A 4FN2A 1ZBCA 2LPVA 1KT0A 3CH9A 4L3NA 4DWSA 4IQCA 4P8XA 3JXVA 3KZ7A 2KO7A 3IK8A 3O5PA 4IT4A 1L1PA 4MSPA 3KAHA 1WNOA 3KAFA 4R0XA 1E6PA 2B31A 2XP6A 2G8ZA 3PR9A 2M1IA 1FJDA 2AWGA 1Q6IA 2WM0A 4DRMA 1FFQA 2DSVA 2MLYA 2PPPA 2WLYA 1QPLA 4DWSD 4ODNA 1C9HA 4WJXA 4W9PA 4XAKA 1HKMA 4NZCA 4Z2JA 2PI6A 3WL1A 1KT1A 5DF0A 1JNTA 4URIA 4DZ3A 2DT2A 2A3AA 1FKBA 1ZK6A 1D7IA 4DRNA 3ARQA 1HKIA 3ARZA 2VN1A 4C02B 3FAPA 2F21A 4WKHA 3CHCA 1XRVA 2DG3A 3UI5A 3JYJA 1EQ3A 4HBOA 1GOIA 3WKZA 1IX5A 1TFVA 4P8WA 2PV1A 2ZR5A 1Y0OA 1D6OA 1SYTA 1D2KA 1ZCNA 1JNSA 4TW8A 1ITXA 1ROUA 3LUOA 3RM8A 1GPFA 1YATA 3WD3A 2XPBA 3AS3A 4MNLA 4ODMA 1B6CA 4MGVA 1LG1A 2A3EA 2RUDA 3RGCA 2WK2A 4JFMA 3CHEA 3CHDA 2M08A 3ODKA 3FY1A 3ARVA 3B7XA 2DSZA 3RM4A 4U85A 2WLZA 4ODRA 3ARRA 4TX0A 2XP3A 1PBKA 3KADA 4J4OA 1LJYA 1W9UA 3IKGA 5HW8A 2ZR6A 4LAVA 1J4HA 3I6CA 1FFRA 1J4RA 4KQZA 4ODLA 1PINA 4JFLA 4S3KA 3O5EA 5GQBA 3KACA 2OLHA 4TNSA 1ZBVA 2DSWA 5HTGA 1T11A 1HXVA 3QOKA 2YBTA 2L2SA 4QZVB 4Z2HA 4WIWA 3ALFA 1FAPA 4IT6A 3ARUA 3TDBA 4KR0B 2IF4A 2F2DA 4LAYA 3G6MA 4ODQA 4DRHA 3ARXA 1OGBA 3UF8A 4ODPA 1JVWA 4Z2KA 4DROA 3ARPA 1UR9A 3WQWA 1FKHA 3O5DA 3AQUA 4FAPA 2XP7A 4TW6A 3NTPA 4Z2LA 2Q5AA 3WL0A 2YBUA 3O5JA 2DT1A 5I98A 3GPKA 3WD1A 4JFKA 2FAPA 1NWSA 4QIBA 3ARSA 4DRKA 3ARYA 1EDQA 1QZ2A 1NWTA 4AY1A 4WKAA 3WD2A 3O5OA 4W9QA 1BL4A 1A7XA 1U79A 2Y78A 3UQBA 1NWRA 2MLZA 3FXYA 2MNTA 2XP5A 5JH8A 4P8UA 3O5FA 4P8VA 2RQSA 2F4EA 1O6IA 3PA7A 1W9VA 4MNKA 4TYOA 2FKEA 3H9RB 5HUAA 3CHFA 4Q22A 3EY6A 1D7HA 1F8AB 1FKLA 2XP4A 4ODKA 3ALGA 3RM9A 3IKDA 2ZR4A 4DIPA 3UI4A 4MNMA 5DIVA 5DIUA 2ITKA 1E6NA 3WD0A 1H0IA 3B8SA 1X6NA 1W1PA 3AS1A 1QPFA 4ITZA 2ZQSA 1W1TA 1LL4A 1HJXA 5HBFA 1Q6HA 2XPAA 3RFWA 1VF8A 4DRJA 3O5QA 3AS0A 3JYMA 1ZBWA 1JNDA 3WIJA 4DWSC 3AROA 1JNEA 2A3BA 4GGQA 1WB0A 2RSEA 4ML4A 4GIVA 3WD4A 2KGJA 4Z2IA 4JFJA 1FKDA 2KI3A 3B9DA 4LAXA 1NMVA 2PV2A 1E15A 3PRBA 2VCDA 1FD9A 3NI6A 3ARWA 5HW6A 4MTVA 4W5UA 4QT3A 4G50A 4ZPWR 1HJVA 2LJ4A 1OWQA 5GPRA 1LG2A 4DRQA 1ZU8A 1NMWA 3PRAA 2PPOA 5J6EA 1J4IA 1EYMA 1FKIA 2DG4A 2O92A 4MAVA 3TCZA 1Q6UA 1E6RA 2XP9A 2DPEA 3B9AA 3UQIA 4N19A 1BKFA 3ARTA 3RMEA 2LKNA 4JYSA 4DRIA 3O5MA 4ZS6A 2UZ5A 1ROTA 2PV3A 1NH6A 2ZQVA 3OA5A 4NNRA 1W1YA 5DEZA 1CTNA 5HKGA 3PRDA 5BXJA 2RUQA 1HKJA 2DT0A 3AS2A 1NWUA 1EIBA 1HJWA 3UQAA 2OFNA 2D9FA 3KCEA 4R5EA 2PPNA 2MF9A 4DT4A 1FKFA 1GUVA 4W9OA 1KFWA 4DRPA 1FKRA 2ZQUA 5HWCA 2MLXA 1ZBKA 2RURA 5HT1A 4U86A 2N87A 1D7JA 2DT3A 4L72B 5DITA 1F40A 2KFWA 2IUZA 2QF8A 1RD6A 4MNJA 1SR0A 3OOBA 3B9EA 1UR8A 4WK9A 5D75A 2A3CA 3BXWA 2ZQTA 4PTMA 2DSUA 3O5LA 3CGNA 1FKJA 1LL6A 4Z2GA 4JFIA 1W1VA 1ZB5A 4DWSB 4WKFA 4HARA 4ZPVR 1J6YA 3O5GA 3CGMA 3O5RA 1EHNA 2ESCA 4ODOA 1LL7A 2AOSA 2DG9A 4DH0A 4S3JA 1FKGA 3IHZA 1HKKA 2K8IA 1N1AA 1NSGA 3WQVA 1LQ0A 1FKKA 3W4RA 2O9OA 3O5KA 4G2PA 2XP8A 4QT2A 2M2AA 3MDYB 1XHGA 4U84A 1E6ZA 4MPKA 3VAWA 2MPHA 4NSBA 5HWBA 1W26A 1X6LA 3O5IA 3KABA 4J4NA 3KAIA 3WH0A 2KR7A 3NRKA 1H0GA 4IPXA 3KAGA 2JZVA 2FDMA 4IQ2A 2RUCA 2KE0A 4BF8A 2LGOA 4O2TA 4ZPTR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B8I C;  1D7H A;  1F8A B;  1M5Y A;  2RUD A;  1FKL A;  3UQA A;  2OFN A;  5GPG A;  2XP4 A;  4ODK A;  4TW7 A;  3TC5 A;  3RGC A;  4JFM A;  3IKD A;  2D9F A;  2ZR4 A;  3UI6 A;  4DIP A;  1P5Q A;  2M08 A;  3ODK A;  3UI4 A;  1R9H A;  3B7X A;  3KCE A;  2PPN A;  2MF9 A;  5DIV A;  4DT4 A;  5DIU A;  1FKF A;  2ITK A;  1FKT A;  1TCO C;  1Q1C A;  4U85 A;  4W9O A;  2PBC A;  4DRP A;  4ODR A;  1FKR A;  1QPF A;  2ZQU A;  4ITZ A;  4TX0 A;  5HWC A;  2ZQS A;  2XP3 A;  1PBK A;  3KAD A;  4J4O A;  1FKS A;  2MLX A;  3IKG A;  4LAW A;  5HW8 A;  2ZR6 A;  4LAV A;  5HW7 A;  1J4H A;  1Q6H A;  2XPA A;  2RUR A;  1J4R A;  3I6C A;  4ODL A;  5HT1 A;  1PIN A;  1YW5 A;  4JFL A;  3RFW A;  4DRJ A;  3O5E A;  3JYM A;  2LPV A;  3O5Q A;  4FN2 A;  1KT0 A;  3KAC A;  4U86 A;  2N87 A;  4TNS A;  5HTG A;  1D7J A;  1T11 A;  1HXV A;  4IQC A;  5DIT A;  2L2S A;  1F40 A;  2KFW A;  3JXV A;  1FAP A;  4GGQ A;  3TDB A;  3KZ7 A;  2IF4 A;  2KO7 A;  3OOB A;  2RSE A;  2F2D A;  3IK8 A;  5D75 A;  3O5P A;  4GIV A;  4LAY A;  1L1P A;  2KGJ A;  2ZQT A;  4MSP A;  3KAH A;  4ODQ A;  3O5L A;  3CGN A;  1FKJ A;  4JFJ A;  4DRH A;  1FKD A;  3UF8 A;  4JFI A;  4ODP A;  2KI3 A;  1JVW A;  4LAX A;  4DRO A;  3KAF A;  1NMV A;  2PV2 A;  1FKH A;  3O5D A;  4R0X A;  2XP6 A;  4FAP A;  1J6Y A;  3PRB A;  2M1I A;  2XP7 A;  4TW6 A;  2VCD A;  1FJD A;  2AWG A;  1FD9 A;  1Q6I A;  3O5G A;  3NI6 A;  3CGM A;  5HW6 A;  3NTP A;  4G50 A;  4QT3 A;  4DRM A;  2PPP A;  2LJ4 A;  2MLY A;  3O5R A;  2Q5A A;  4DRQ A;  1QPL A;  4ODN A;  1C9H A;  3O5J A;  4W9P A;  1NMW A;  3GPK A;  4ODO A;  5I98 A;  4JFK A;  2FAP A;  1KT1 A;  2PPO A;  1JNT A;  4QIB A;  2DG9 A;  4DH0 A;  4DZ3 A;  1FKB A;  1FKG A;  3IHZ A;  1J4I A;  5J6E A;  4DRK A;  1EYM A;  1ZK6 A;  1D7I A;  2K8I A;  4DRN A;  1N1A A;  1FKI A;  1NSG A;  1QZ2 A;  2DG4 A;  2VN1 A;  4C02 B;  1FKK A;  3TCZ A;  1Q6U A;  3O5K A;  2XP8 A;  3O5O A;  2XP9 A;  2M2A A;  4G2P A;  3FAP A;  2F21 A;  1BL4 A;  4QT2 A;  3MDY B;  4W9Q A;  1A7X A;  2DG3 A;  3UI5 A;  3JYJ A;  3UQI A;  1EQ3 A;  1U79 A;  2Y78 A;  3UQB A;  2MLZ A;  4U84 A;  2MNT A;  2XP5 A;  4N19 A;  1BKF A;  2MPH A;  3VAW A;  3O5F A;  5HWB A;  2LKN A;  4JYS A;  1W26 A;  2RQS A;  2F4E A;  3O5I A;  2PV1 A;  3KAB A;  2ZR5 A;  1Y0O A;  4DRI A;  4J4N A;  3PA7 A;  4TYO A;  1D6O A;  3KAI A;  3O5M A;  1ZCN A;  1JNS A;  2UZ5 A;  3WH0 A;  1ROT A;  4TW8 A;  2KR7 A;  2PV3 A;  1ROU A;  3LUO A;  3NRK A;  4IPX A;  3KAG A;  2JZV A;  2FKE A;  3H9R B;  1YAT A;  5HUA A;  2ZQV A;  4IQ2 A;  2XPB A;  2RUC A;  2KE0 A;  4ODM A;  4NNR A;  4DZ2 A;  1B6C A;  4BF8 A;  5HKG A;  3PRD A;  2LGO A;  5BXJ A;  2RUQ A;  3EY6 A;  4MGV A;  4O2T A; 
#chains in the Genus database with same CATH topology
 5B8I C;  1K9T A;  1M5Y A;  3BMB A;  4HBE A;  4LGX A;  5GPG A;  4TW7 A;  3TC5 A;  1W9P A;  2G41 A;  3UI6 A;  1P5Q A;  1R9H A;  1FKT A;  1E9L A;  1TCO C;  5DO2 A;  1ZL1 A;  1Q1C A;  1OGG A;  2PBC A;  1WAW A;  1FKS A;  4LAW A;  5HW7 A;  3G6L A;  4DZ2 A;  4Q7N A;  1YW5 A;  3CZ8 A;  4FN2 A;  1ZBC A;  2LPV A;  1KT0 A;  3CH9 A;  4L3N A;  4DWS A;  4IQC A;  4P8X A;  3JXV A;  3KZ7 A;  2KO7 A;  3IK8 A;  3O5P A;  4IT4 A;  1L1P A;  4MSP A;  3KAH A;  1WNO A;  3KAF A;  4R0X A;  1E6P A;  2B31 A;  2XP6 A;  2G8Z A;  3PR9 A;  2M1I A;  1FJD A;  2AWG A;  1Q6I A;  2WM0 A;  4DRM A;  1FFQ A;  2DSV A;  2MLY A;  2PPP A;  2WLY A;  1QPL A;  4DWS D;  4ODN A;  1C9H A;  4WJX A;  4W9P A;  4XAK A;  1HKM A;  4NZC A;  4Z2J A;  2PI6 A;  3WL1 A;  1KT1 A;  5DF0 A;  1JNT A;  4URI A;  4DZ3 A;  2DT2 A;  2A3A A;  1FKB A;  1ZK6 A;  1D7I A;  4DRN A;  3ARQ A;  1HKI A;  3ARZ A;  2VN1 A;  4C02 B;  3FAP A;  2F21 A;  4WKH A;  3CHC A;  1XRV A;  2DG3 A;  3UI5 A;  3JYJ A;  1EQ3 A;  4HBO A;  1GOI A;  3WKZ A;  1IX5 A;  1TFV A;  4P8W A;  2PV1 A;  2ZR5 A;  1Y0O A;  1D6O A;  1SYT A;  1D2K A;  1ZCN A;  1JNS A;  4TW8 A;  1ITX A;  1ROU A;  3LUO A;  3RM8 A;  1GPF A;  1YAT A;  1JCH B;  3WD3 A;  2XPB A;  3AS3 A;  4MNL A;  4ODM A;  1B6C A;  4MGV A;  1LG1 A;  2A3E A;  2RUD A;  4UDM A;  3RGC A;  2WK2 A;  4JFM A;  3CHE A;  3CHD A;  2M08 A;  3ODK A;  3FY1 A;  3ARV A;  3B7X A;  2DSZ A;  3RM4 A;  4U85 A;  2WLZ A;  4ODR A;  3ARR A;  4TX0 A;  2XP3 A;  1PBK A;  3KAD A;  4J4O A;  2P4V A;  1LJY A;  1W9U A;  3IKG A;  5HW8 A;  2ZR6 A;  4LAV A;  1J4H A;  3I6C A;  1FFR A;  1J4R A;  4KQZ A;  4ODL A;  1PIN A;  4JFL A;  2B5U B;  3O5E A;  4S3K A;  5GQB A;  3KAC A;  2OLH A;  4TNS A;  1ZBV A;  2DSW A;  5HTG A;  1T11 A;  1HXV A;  3QOK A;  2YBT A;  2L2S A;  4QZV B;  4Z2H A;  4WIW A;  3ALF A;  1FAP A;  4IT6 A;  3ARU A;  3TDB A;  4KR0 B;  2IF4 A;  2F2D A;  4LAY A;  3G6M A;  4ODQ A;  4DRH A;  3ARX A;  1OGB A;  3UF8 A;  4ODP A;  1JVW A;  4Z2K A;  4DRO A;  3ARP A;  1UR9 A;  3WQW A;  1FKH A;  3O5D A;  3AQU A;  4FAP A;  2XP7 A;  4TW6 A;  3NTP A;  4Z2L A;  2Q5A A;  3WL0 A;  2YBU A;  3O5J A;  2DT1 A;  5I98 A;  3GPK A;  3WD1 A;  4JFK A;  2FAP A;  1NWS A;  4QIB A;  3ARS A;  4DRK A;  3ARY A;  1EDQ A;  1QZ2 A;  1NWT A;  4AY1 A;  4WKA A;  3WD2 A;  3O5O A;  4W9Q A;  1BL4 A;  1A7X A;  1U79 A;  2Y78 A;  3UQB A;  1NWR A;  2MLZ A;  3FXY A;  3GU0 A;  2MNT A;  2XP5 A;  5JH8 A;  4P8U A;  3O5F A;  4P8V A;  2RQS A;  2F4E A;  1O6I A;  3PA7 A;  1W9V A;  4MNK A;  4TYO A;  2FKE A;  3H9R B;  5HUA A;  3CHF A;  4Q22 A;  3EY6 A;  1D7H A;  1F8A B;  1FKL A;  2XP4 A;  4ODK A;  3ALG A;  3GTY X;  3RM9 A;  3IKD A;  2ZR4 A;  4DIP A;  3UI4 A;  4MNM A;  5DIV A;  5DIU A;  2ITK A;  1E6N A;  3WD0 A;  1H0I A;  3B8S A;  1X6N A;  1W1P A;  3AS1 A;  1QPF A;  4ITZ A;  2ZQS A;  1W1T A;  1LL4 A;  1HJX A;  5HBF A;  1Q6H A;  2XPA A;  3RFW A;  1VF8 A;  4DRJ A;  3O5Q A;  3AS0 A;  3JYM A;  1ZBW A;  1JND A;  3WIJ A;  4DWS C;  3ARO A;  1JNE A;  2A3B A;  4GGQ A;  1WB0 A;  2RSE A;  4ML4 A;  4GIV A;  3WD4 A;  2KGJ A;  4Z2I A;  4JFJ A;  1FKD A;  2KI3 A;  3B9D A;  4LAX A;  1NMV A;  2PV2 A;  1E15 A;  3PRB A;  2VCD A;  1FD9 A;  3NI6 A;  3ARW A;  5HW6 A;  4MTV A;  4W5U A;  4QT3 A;  4G50 A;  4ZPW R;  1HJV A;  2LJ4 A;  1OWQ A;  5GPR A;  1LG2 A;  4DRQ A;  1ZU8 A;  1NMW A;  3PRA A;  2PPO A;  5J6E A;  1J4I A;  1EYM A;  1FKI A;  2DG4 A;  2O92 A;  2ETN A;  4MAV A;  3TCZ A;  1Q6U A;  1E6R A;  2XP9 A;  2DPE A;  3B9A A;  3EIP A;  3UQI A;  2F23 A;  1BKF A;  4N19 A;  3ART A;  3RME A;  2LKN A;  4JYS A;  4DRI A;  3O5M A;  4ZS6 A;  2UZ5 A;  1ROT A;  2PV3 A;  1NH6 A;  2ZQV A;  3OA5 A;  4NNR A;  1W1Y A;  5DEZ A;  1CTN A;  5HKG A;  3PRD A;  5BXJ A;  2RUQ A;  1HKJ A;  2DT0 A;  3AS2 A;  1NWU A;  1E44 A;  1EIB A;  2EUL A;  1HJW A;  3UQA A;  2OFN A;  2D9F A;  3KCE A;  4R5E A;  2PPN A;  2MF9 A;  4DT4 A;  1FKF A;  1GUV A;  4W9O A;  1KFW A;  4DRP A;  1FKR A;  2ZQU A;  5HWC A;  2MLX A;  1ZBK A;  2RUR A;  5HT1 A;  4U86 A;  2N87 A;  1D7J A;  2DT3 A;  4L72 B;  5DIT A;  1F40 A;  2KFW A;  2IUZ A;  2QF8 A;  1RD6 A;  4MNJ A;  1SR0 A;  3OOB A;  3B9E A;  1UR8 A;  4WK9 A;  5D75 A;  2A3C A;  3BXW A;  2ZQT A;  4PTM A;  2DSU A;  3O5L A;  3CGN A;  1FKJ A;  1LL6 A;  4Z2G A;  4JFI A;  1W1V A;  1ZB5 A;  4DWS B;  4WKF A;  4HAR A;  4ZPV R;  1J6Y A;  3O5G A;  3CGM A;  3O5R A;  2PN0 A;  1EHN A;  2ESC A;  4ODO A;  1LL7 A;  2AOS A;  2DG9 A;  4DH0 A;  4S3J A;  1FKG A;  3IHZ A;  1HKK A;  2K8I A;  1N1A A;  1NSG A;  3WQV A;  1LQ0 A;  1FKK A;  3W4R A;  2O9O A;  3O5K A;  4G2P A;  2XP8 A;  4QT2 A;  1GRJ A;  2M2A A;  3MDY B;  1XHG A;  4U84 A;  1E6Z A;  4MPK A;  3VAW A;  2MPH A;  4NSB A;  5HWB A;  1W26 A;  1X6L A;  3O5I A;  3KAB A;  4J4N A;  3KAI A;  3WH0 A;  2KR7 A;  3NRK A;  1H0G A;  4IPX A;  3KAG A;  2JZV A;  2FDM A;  4IQ2 A;  2RUC A;  2KE0 A;  4BF8 A;  2LGO A;  4O2T A;  4ZPT R; 
#chains in the Genus database with same CATH homology
 5B8I C;  1K9T A;  1M5Y A;  4HBE A;  4LGX A;  5GPG A;  4TW7 A;  3TC5 A;  1W9P A;  2G41 A;  3UI6 A;  1P5Q A;  1R9H A;  1FKT A;  1E9L A;  1TCO C;  5DO2 A;  1ZL1 A;  1Q1C A;  1OGG A;  2PBC A;  1WAW A;  1FKS A;  4LAW A;  5HW7 A;  3G6L A;  4DZ2 A;  4Q7N A;  1YW5 A;  3CZ8 A;  4FN2 A;  1ZBC A;  2LPV A;  1KT0 A;  3CH9 A;  4L3N A;  4DWS A;  4IQC A;  4P8X A;  3JXV A;  3KZ7 A;  2KO7 A;  3IK8 A;  3O5P A;  4IT4 A;  1L1P A;  4MSP A;  3KAH A;  1WNO A;  3KAF A;  4R0X A;  1E6P A;  2B31 A;  2XP6 A;  2G8Z A;  3PR9 A;  2M1I A;  1FJD A;  2AWG A;  1Q6I A;  2WM0 A;  4DRM A;  1FFQ A;  2DSV A;  2MLY A;  2PPP A;  2WLY A;  1QPL A;  4DWS D;  4ODN A;  1C9H A;  4WJX A;  4W9P A;  4XAK A;  1HKM A;  4NZC A;  4Z2J A;  2PI6 A;  3WL1 A;  1KT1 A;  5DF0 A;  1JNT A;  4URI A;  4DZ3 A;  2DT2 A;  2A3A A;  1FKB A;  1ZK6 A;  1D7I A;  4DRN A;  3ARQ A;  1HKI A;  3ARZ A;  2VN1 A;  4C02 B;  3FAP A;  2F21 A;  4WKH A;  3CHC A;  1XRV A;  2DG3 A;  3UI5 A;  3JYJ A;  1EQ3 A;  4HBO A;  1GOI A;  3WKZ A;  1IX5 A;  1TFV A;  4P8W A;  2PV1 A;  2ZR5 A;  1Y0O A;  1D6O A;  1SYT A;  1D2K A;  1ZCN A;  1JNS A;  4TW8 A;  1ITX A;  1ROU A;  3LUO A;  3RM8 A;  1GPF A;  1YAT A;  3WD3 A;  2XPB A;  3AS3 A;  4MNL A;  4ODM A;  1B6C A;  4MGV A;  1LG1 A;  2A3E A;  2RUD A;  3RGC A;  2WK2 A;  4JFM A;  3CHE A;  3CHD A;  2M08 A;  3ODK A;  3FY1 A;  3ARV A;  3B7X A;  2DSZ A;  3RM4 A;  4U85 A;  2WLZ A;  4ODR A;  3ARR A;  4TX0 A;  2XP3 A;  1PBK A;  3KAD A;  4J4O A;  1LJY A;  1W9U A;  3IKG A;  5HW8 A;  2ZR6 A;  4LAV A;  1J4H A;  3I6C A;  1FFR A;  1J4R A;  4KQZ A;  4ODL A;  1PIN A;  4JFL A;  4S3K A;  3O5E A;  5GQB A;  3KAC A;  2OLH A;  4TNS A;  1ZBV A;  2DSW A;  5HTG A;  1T11 A;  1HXV A;  3QOK A;  2YBT A;  2L2S A;  4QZV B;  4Z2H A;  4WIW A;  3ALF A;  1FAP A;  4IT6 A;  3ARU A;  3TDB A;  4KR0 B;  2IF4 A;  2F2D A;  4LAY A;  3G6M A;  4ODQ A;  4DRH A;  3ARX A;  1OGB A;  3UF8 A;  4ODP A;  1JVW A;  4Z2K A;  4DRO A;  3ARP A;  1UR9 A;  3WQW A;  1FKH A;  3O5D A;  3AQU A;  4FAP A;  2XP7 A;  4TW6 A;  3NTP A;  4Z2L A;  2Q5A A;  3WL0 A;  2YBU A;  3O5J A;  2DT1 A;  5I98 A;  3GPK A;  3WD1 A;  4JFK A;  2FAP A;  1NWS A;  4QIB A;  3ARS A;  4DRK A;  3ARY A;  1EDQ A;  1QZ2 A;  1NWT A;  4AY1 A;  4WKA A;  3WD2 A;  3O5O A;  4W9Q A;  1BL4 A;  1A7X A;  1U79 A;  2Y78 A;  3UQB A;  1NWR A;  2MLZ A;  3FXY A;  2MNT A;  2XP5 A;  5JH8 A;  4P8U A;  3O5F A;  4P8V A;  2RQS A;  2F4E A;  1O6I A;  3PA7 A;  1W9V A;  4MNK A;  4TYO A;  2FKE A;  3H9R B;  5HUA A;  3CHF A;  4Q22 A;  3EY6 A;  1D7H A;  1F8A B;  1FKL A;  2XP4 A;  4ODK A;  3ALG A;  3RM9 A;  3IKD A;  2ZR4 A;  4DIP A;  3UI4 A;  4MNM A;  5DIV A;  5DIU A;  2ITK A;  1E6N A;  3WD0 A;  1H0I A;  3B8S A;  1X6N A;  1W1P A;  3AS1 A;  1QPF A;  4ITZ A;  2ZQS A;  1W1T A;  1LL4 A;  1HJX A;  5HBF A;  1Q6H A;  2XPA A;  3RFW A;  1VF8 A;  4DRJ A;  3O5Q A;  3AS0 A;  3JYM A;  1ZBW A;  1JND A;  3WIJ A;  4DWS C;  3ARO A;  1JNE A;  2A3B A;  4GGQ A;  1WB0 A;  2RSE A;  4ML4 A;  4GIV A;  3WD4 A;  2KGJ A;  4Z2I A;  4JFJ A;  1FKD A;  2KI3 A;  3B9D A;  4LAX A;  1NMV A;  2PV2 A;  1E15 A;  3PRB A;  2VCD A;  1FD9 A;  3NI6 A;  3ARW A;  5HW6 A;  4MTV A;  4W5U A;  4QT3 A;  4G50 A;  4ZPW R;  1HJV A;  2LJ4 A;  1OWQ A;  5GPR A;  1LG2 A;  4DRQ A;  1ZU8 A;  1NMW A;  3PRA A;  2PPO A;  5J6E A;  1J4I A;  1EYM A;  1FKI A;  2DG4 A;  2O92 A;  4MAV A;  3TCZ A;  1Q6U A;  1E6R A;  2XP9 A;  2DPE A;  3B9A A;  3UQI A;  4N19 A;  1BKF A;  3ART A;  3RME A;  2LKN A;  4JYS A;  4DRI A;  3O5M A;  4ZS6 A;  2UZ5 A;  1ROT A;  2PV3 A;  1NH6 A;  2ZQV A;  3OA5 A;  4NNR A;  1W1Y A;  5DEZ A;  1CTN A;  5HKG A;  3PRD A;  5BXJ A;  2RUQ A;  1HKJ A;  2DT0 A;  3AS2 A;  1NWU A;  1EIB A;  1HJW A;  3UQA A;  2OFN A;  2D9F A;  3KCE A;  4R5E A;  2PPN A;  2MF9 A;  4DT4 A;  1FKF A;  1GUV A;  4W9O A;  1KFW A;  4DRP A;  1FKR A;  2ZQU A;  5HWC A;  2MLX A;  1ZBK A;  2RUR A;  5HT1 A;  4U86 A;  2N87 A;  1D7J A;  2DT3 A;  4L72 B;  5DIT A;  1F40 A;  2KFW A;  2IUZ A;  2QF8 A;  1RD6 A;  4MNJ A;  1SR0 A;  3OOB A;  3B9E A;  1UR8 A;  4WK9 A;  5D75 A;  2A3C A;  3BXW A;  2ZQT A;  4PTM A;  2DSU A;  3O5L A;  3CGN A;  1FKJ A;  1LL6 A;  4Z2G A;  4JFI A;  1W1V A;  1ZB5 A;  4DWS B;  4WKF A;  4HAR A;  4ZPV R;  1J6Y A;  3O5G A;  3CGM A;  3O5R A;  1EHN A;  2ESC A;  4ODO A;  1LL7 A;  2AOS A;  2DG9 A;  4DH0 A;  4S3J A;  1FKG A;  3IHZ A;  1HKK A;  2K8I A;  1N1A A;  1NSG A;  3WQV A;  1LQ0 A;  1FKK A;  3W4R A;  2O9O A;  3O5K A;  4G2P A;  2XP8 A;  4QT2 A;  2M2A A;  3MDY B;  1XHG A;  4U84 A;  1E6Z A;  4MPK A;  3VAW A;  2MPH A;  4NSB A;  5HWB A;  1W26 A;  1X6L A;  3O5I A;  3KAB A;  4J4N A;  3KAI A;  3WH0 A;  2KR7 A;  3NRK A;  1H0G A;  4IPX A;  3KAG A;  2JZV A;  2FDM A;  4IQ2 A;  2RUC A;  2KE0 A;  4BF8 A;  2LGO A;  4O2T A;  4ZPT R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...