2PPOA

Crystal structure of e60a mutant of fkbp12
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWAEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 1A
publication title Structural coupling between FKBP12 and buried water.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 28
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ppoA00
1EYMA 2MNTA 2XP4A 3UI6A 1M5YA 2PV3A 1PBKA 3JXVA 2AWGA 2XP3A 2XPBA 4MSPA 3UQIA 5HKGA 4TW6A 4DRNA 4QT3A 3ODKA 1FKSA 4IQ2A 4TW7A 5HTGA 2MF9A 1FKBA 3PA7A 4JFMA 1J4RA 1FKFA 1FAPA 3UQBA 1NSGA 1Q6IA 4ODKA 4DIPA 1P5QA 3O5OA 3O5MA 2LKNA 3O5FA 1KT0A 4TX0A 4FN2A 1JNTA 1ROTA 2LPVA 5I98A 1D7IA 2KGJA 2XP9A 4QIBA 4DH0A 5HUAA 3KAHA 2DG4A 4U84A 2RUCA 2UZ5A 5HT1A 4ITZA 2D9FA 2FKEA 5HWBA 3KAFA 3O5PA 4ODNA 3UI4A 2ZR5A 1FKKA 4U86A 4QT2A 3O5KA 4W9QA 4DRHA 1EQ3A 1FKJA 3KADA 4ODRA 1FKHA 1Q6HA 2ZR4A 4DZ2A 3UQAA 1TCOC 2ITKA 4NNRA 1PINA 1B6CA 2ZQUA 2MLXA 1FD9A 2KFWA 4ODQA 4J4NA 2ZQTA 4FAPA 1KT1A 1Q6UA 3O5QA 3VAWA 1J4HA 3NRKA 2ZQSA 4DZ3A 3B7XA 4J4OA 3KZ7A 2IF4A 4TYOA 4ODLA 2PV2A 1T11A 1JNSA 4DRQA 3EY6A 1FKIA 3LUOA 3TCZA 1L1PA 1BKFA 1FKGA 2N87A 3O5LA 3KABA 4JFKA 2XP6A 5DIUA 2Y78A 4IQCA 4TW8A 1JVWA 1Y0OA 3IKGA 2MLZA 3IHZA 4DT4A 2RURA 2OFNA 5J6EA 1NMWA 3KACA 3NTPA 4G50A 3TC5A 1NMVA 2M2AA 1FKLA 1ZCNA 4GGQA 3O5DA 1F40A 5HW6A 2KI3A 3JYJA 3CGMA 2PBCA 4W9OA 3KAGA 4LAXA 5BXJA 2M1IA 2Q5AA 1QPLA 3KAIA 4DRIA 5GPGA 3UF8A 1J6YA 1D7HA 1FJDA 3O5JA 3FAPA 3PRBA 4JFJA 1YW5A 3RGCA 1J4IA 3UI5A 2K8IA 2MLYA 4N19A 3PRDA 3WH0A 4G2PA 5HWCA 2DG9A 3H9RB 3I6CA 4LAYA 5DITA 1FKRA 2M08A 2PV1A 1YATA 2F21A 2PPPA 2RQSA 2VCDA 4LAWA 4ODPA 4DROA 3OOBA 1R9HA 2VN1A 2RSEA 4TNSA 4ODMA 4JFIA 4R0XA 4JYSA 3GPKA 2ZQVA 1C9HA 2JZVA 2XP7A 3RFWA 4DRKA 5HW7A 4IPXA 3MDYB 3NI6A 4O2TA 4W9PA 5B8IC 3O5EA 2MPHA 1QPFA 2PPOA 3CGNA 3IKDA 4U85A 5D75A 4GIVA 1ROUA 2DG3A 1HXVA 1F8AB 1U79A 3JYMA 4JFLA 4DRMA 1Q1CA 2F4EA 4MGVA 1D6OA 2KO7A 4LAVA 1D7JA 3O5GA 2XP5A 2XPAA 1QZ2A 1FKTA 4DRJA 4ODOA 1W26A 3KCEA 1A7XA 2XP8A 2KR7A 3TDBA 1N1AA 2FAPA 2ZR6A 4C02B 2L2SA 2F2DA 5HW8A 1ZK6A 2PPNA 4BF8A 1BL4A 1FKDA 2RUDA 2LGOA 2LJ4A 3IK8A 3O5IA 4DRPA 3O5RA 2KE0A 5DIVA 2RUQA
chains in the Genus database with same CATH superfamily
1EYMA 3UI6A 2AWGA 2XP3A 3ARZA 3BMBA 4TW6A 2EULA 4DRNA 4HBEA 4P8UA 1LJYA 1LQ0A 4TW7A 2MF9A 1FKBA 3PA7A 4JFMA 1ZU8A 1FKFA 1FAPA 2PN0A 3WD4A 3AS2A 1KT0A 4TX0A 1XHGA 2XP9A 3CHDA 4DH0A 4WKFA 2DG4A 5HT1A 4Z2HA 3EIPA 1ITXA 3O5PA 3KADA 3WKZA 2ZQUA 2KFWA 1ZB5A 1HKJA 1KT1A 4L72B 3WD3A 3VAWA 3AQUA 2A3CA 4R5EA 4DZ3A 3KZ7A 3ALGA 1HJVA 1FKIA 3LUOA 1W1PA 1FFRA 1BKFA 4ZPWR 2XP6A 4TW8A 1JVWA 1OWQA 2IUZA 5J6EA 1HKMA 4Z2GA 3KACA 3NTPA 4G50A 3TC5A 2M2AA 1GOIA 2OLHA 5HW6A 3B9AA 3CGMA 1SR0A 4W9OA 2YBTA 3ARRA 4LAXA 2M1IA 4KR0B 5GPGA 3UF8A 1E6RA 4WJXA 1LL4A 1H0IA 1NWTA 4LAWA 2RSEA 4TNSA 3RM9A 5HW7A 4L3NA 2MPHA 4U85A 1ZBKA 1F8AB 4MGVA 1CTNA 4LGXA 2XP5A 1JNDA 4MNKA 3PR9A 4C02B 2L2SA 2F2DA 1FKDA 3KABA 2MNTA 2DT3A 2XP4A 3UQIA 5HKGA 4MNMA 1NWUA 4QT3A 3CHFA 4XAKA 3GU0A 1LL6A 4MPKA 2A3AA 4DWSA 1UR8A 4ODKA 1P5QA 3ARQA 4WK9A 3O5MA 2LKNA 5GPRA 1WNOA 1ROTA 5I98A 1D7IA 1WB0A 2DSUA 2WLZA 4U84A 4Z2IA 2D9FA 3ARSA 3FY1A 1OGGA 2DSZA 4W9QA 4DRHA 1FKHA 2ZR4A 4NZCA 3UQAA 1NWRA 2G8ZA 1JNEA 4J4NA 4FAPA 1Q6UA 3O5QA 3ALFA 1J4HA 4Q7NA 2ZQSA 3B7XA 4J4OA 4WKAA 2PV2A 1JNSA 3CHCA 3WD0A 1LG2A 2A3EA 2N87A 1D2KA 4JFKA 3IKGA 4HBOA 2OFNA 3WL1A 1JCHB 3WD2A 1NMVA 1ZCNA 1E44A 1XRVA 4MNJA 2KI3A 5HBFA 4IT6A 3ARXA 1W1TA 3KAGA 2Q5AA 3KAIA 1FJDA 3FXYA 3FAPA 4MNLA 1YW5A 1J4IA 3UI5A 2MLYA 3PRDA 4G2PA 5HWCA 2DG9A 1FKRA 5DITA 3W4RA 1YATA 2F21A 2O92A 2RQSA 1HJWA 3OOBA 2FDMA 4R0XA 2QF8A 2JZVA 2XP7A 3MDYB 3NI6A 4ZPTR 4Z2KA 4Q22A 3CGNA 3IKDA 1ROUA 1U79A 1K9TA 2F4EA 4NSBA 3BXWA 1EHNA 3O5GA 1FKTA 1E6PA 1WAWA 2XP8A 2KR7A 1N1AA 2FAPA 3RM4A 4Z2LA 2PPNA 4QZVB 3O5IA 1H0GA 3ARTA 2KE0A 1EDQA 5DIVA 2RUQA 4N19A 1VF8A 1FFQA 2PV3A 1TFVA 4MSPA 3CHEA 2ETNA 1FKSA 4IQ2A 1SYTA 5HTGA 3ARUA 1J4RA 1LL7A 4W5UA 1Q6IA 4DIPA 4DWSC 3O5FA 3AS0A 4FN2A 2DPEA 2KGJA 3CH9A 5HUAA 4ITZA 3B8SA 3UI4A 4ODNA 1FKKA 4U86A 3O5KA 1W9PA 4MAVA 4ODRA 4DZ2A 1E15A 4P8WA 1TCOC 2ITKA 4NNRA 1O6IA 1PINA 1B6CA 4ODQA 3WQWA 3GTYX 3NRKA 4AY1A 2B31A 4TYOA 1OGBA 1T11A 1GUVA 3EY6A 1E9LA 3TCZA 1FKGA 1X6LA 3ARWA 5DIUA 2Y78A 4IQCA 3AS1A 4S3KA 3IHZA 4DT4A 2RURA 1NMWA 1NWSA 1FKLA 4GGQA 3AS3A 4ZS6A 5BXJA 1QPLA 5GQBA 3O5JA 3PRBA 3G6MA 4JFJA 1UR9A 3RGCA 2K8IA 2O9OA 2M08A 2PV1A 4ODPA 1R9HA 4ODMA 3G6LA 4DRKA 4W9PA 5B8IC 3O5EA 1QPFA 2G41A 2PPOA 4S3JA 2DG3A 4DRMA 3JYMA 4JFLA 1Q1CA 1D6OA 2KO7A 4LAVA 1D7JA 1GPFA 1W1VA 4DRJA 4UDMA 3WD1A 2ESCA 1ZK6A 5HW8A 1X6NA 3IK8A 1BL4A 1EIBA 2LGOA 4DRPA 1ZL1A 3O5RA 1M5YA 1PBKA 3JXVA 2XPBA 1NH6A 4URIA 2AOSA 2DSVA 3ODKA 4DWSB 1HKKA 3UQBA 1NSGA 5DO2A 3O5OA 1HKIA 3B9DA 1ZBCA 1JNTA 1LG1A 2LPVA 4P8VA 4QIBA 3KAHA 2RUCA 2UZ5A 4WIWA 4KQZA 2DT2A 4HARA 2FKEA 5HWBA 1RD6A 3RMEA 3KAFA 5DF0A 2ZR5A 4QT2A 1EQ3A 1FKJA 2B5UB 1GRJA 1Q6HA 2A3BA 2P4VA 3RM8A 2MLXA 1FD9A 2ZQTA 3PRAA 3B9EA 1W1YA 1W9UA 3CZ8A 4DWSD 2WLYA 3ARYA 2IF4A 4ODLA 4DRQA 3ARVA 1L1PA 1ZBVA 3O5LA 5JH8A 1W9VA 1Y0OA 3WQVA 2MLZA 4IT4A 1E6ZA 5DEZA 4ML4A 1IX5A 3O5DA 1F40A 3JYJA 3QOKA 1E6NA 2PBCA 3WIJA 4DRIA 1KFWA 1J6YA 1D7HA 2WM0A 2YBUA 3WL0A 4Z2JA 3WH0A 3H9RB 4LAYA 3I6CA 2VCDA 2PPPA 4DROA 2VN1A 4JFIA 4JYSA 3GPKA 2ZQVA 1C9HA 4MTVA 4P8XA 3RFWA 4IPXA 4O2TA 2DSWA 5D75A 4WKHA 2DT0A 4GIVA 1HXVA 3ARPA 4PTMA 2PI6A 3AROA 2XPAA 1QZ2A 2DT1A 4ODOA 1W26A 3KCEA 1A7XA 3TDBA 3OA5A 1HJXA 2ZR6A 4BF8A 1ZBWA 2RUDA 2LJ4A 4ZPVR 2F23A 2WK2A
chains in the Genus database with same CATH topology
1EYMA 3UI6A 2AWGA 2XP3A 3ARZA 4TW6A 4DRNA 4HBEA 4P8UA 1LJYA 1LQ0A 4TW7A 2MF9A 1FKBA 3PA7A 4JFMA 1ZU8A 1FKFA 1FAPA 3WD4A 3AS2A 1KT0A 4TX0A 1XHGA 2XP9A 3CHDA 4DH0A 4WKFA 2DG4A 5HT1A 4Z2HA 1ITXA 3O5PA 3KADA 3WKZA 2ZQUA 2KFWA 1ZB5A 1HKJA 1KT1A 4L72B 3WD3A 3VAWA 3AQUA 2A3CA 4R5EA 4DZ3A 3KZ7A 3ALGA 1HJVA 1FKIA 3LUOA 1W1PA 1FFRA 1BKFA 4ZPWR 2XP6A 4TW8A 1JVWA 1OWQA 2IUZA 5J6EA 1HKMA 4Z2GA 3KACA 3NTPA 4G50A 3TC5A 2M2AA 1GOIA 2OLHA 5HW6A 3B9AA 3CGMA 1SR0A 4W9OA 2YBTA 3ARRA 4LAXA 2M1IA 4KR0B 5GPGA 3UF8A 1E6RA 4WJXA 1LL4A 1H0IA 1NWTA 4LAWA 2RSEA 4TNSA 3RM9A 5HW7A 4L3NA 2MPHA 4U85A 1ZBKA 1F8AB 4MGVA 1CTNA 4LGXA 2XP5A 1JNDA 4MNKA 3PR9A 4C02B 2L2SA 2F2DA 1FKDA 3KABA 2MNTA 2DT3A 2XP4A 3UQIA 5HKGA 4MNMA 1NWUA 4QT3A 3CHFA 4XAKA 1LL6A 4MPKA 2A3AA 4DWSA 1UR8A 4ODKA 1P5QA 3ARQA 4WK9A 3O5MA 2LKNA 5GPRA 1WNOA 1ROTA 5I98A 1D7IA 1WB0A 2DSUA 2WLZA 4U84A 4Z2IA 2D9FA 3ARSA 3FY1A 1OGGA 2DSZA 4W9QA 4DRHA 1FKHA 2ZR4A 4NZCA 3UQAA 1NWRA 2G8ZA 1JNEA 4J4NA 4FAPA 1Q6UA 3O5QA 3ALFA 1J4HA 4Q7NA 2ZQSA 3B7XA 4J4OA 4WKAA 2PV2A 1JNSA 3CHCA 3WD0A 1LG2A 2A3EA 2N87A 1D2KA 4JFKA 3IKGA 4HBOA 2OFNA 3WL1A 3WD2A 1NMVA 1ZCNA 1XRVA 4MNJA 2KI3A 5HBFA 4IT6A 3ARXA 1W1TA 3KAGA 2Q5AA 3KAIA 1FJDA 3FXYA 3FAPA 4MNLA 1YW5A 1J4IA 3UI5A 2MLYA 3PRDA 4G2PA 5HWCA 2DG9A 1FKRA 5DITA 3W4RA 1YATA 2F21A 2O92A 2RQSA 1HJWA 3OOBA 2FDMA 4R0XA 2QF8A 2JZVA 2XP7A 3MDYB 3NI6A 4ZPTR 4Z2KA 4Q22A 3CGNA 3IKDA 1ROUA 1U79A 1K9TA 2F4EA 4NSBA 3BXWA 3O5GA 1EHNA 1FKTA 1E6PA 1WAWA 2XP8A 2KR7A 1N1AA 2FAPA 3RM4A 4Z2LA 2PPNA 4QZVB 3O5IA 1H0GA 3ARTA 2KE0A 1EDQA 5DIVA 2RUQA 4N19A 1VF8A 1FFQA 2PV3A 1TFVA 4MSPA 3CHEA 1FKSA 4IQ2A 1SYTA 5HTGA 3ARUA 1J4RA 1LL7A 4W5UA 1Q6IA 4DIPA 4DWSC 3O5FA 3AS0A 4FN2A 2DPEA 2KGJA 3CH9A 5HUAA 4ITZA 3B8SA 3UI4A 4ODNA 1FKKA 4U86A 3O5KA 1W9PA 4MAVA 4ODRA 4DZ2A 1E15A 4P8WA 1TCOC 2ITKA 4NNRA 1O6IA 1PINA 1B6CA 4ODQA 3WQWA 3NRKA 4AY1A 2B31A 4TYOA 1OGBA 1T11A 1GUVA 3EY6A 1E9LA 3TCZA 1FKGA 1X6LA 3ARWA 5DIUA 2Y78A 4IQCA 3AS1A 4S3KA 3IHZA 4DT4A 2RURA 1NMWA 1NWSA 1FKLA 4GGQA 3AS3A 4ZS6A 5BXJA 1QPLA 5GQBA 3O5JA 3PRBA 3G6MA 4JFJA 1UR9A 3RGCA 2K8IA 2O9OA 2M08A 2PV1A 4ODPA 1R9HA 4ODMA 3G6LA 4DRKA 4W9PA 5B8IC 3O5EA 1QPFA 2G41A 2PPOA 4S3JA 2DG3A 4DRMA 3JYMA 4JFLA 1Q1CA 1D6OA 2KO7A 4LAVA 1D7JA 1GPFA 1W1VA 4DRJA 3WD1A 2ESCA 1ZK6A 5HW8A 1X6NA 1BL4A 1EIBA 3IK8A 2LGOA 4DRPA 1ZL1A 3O5RA 1M5YA 1PBKA 3JXVA 2XPBA 1NH6A 4URIA 2AOSA 2DSVA 3ODKA 4DWSB 1HKKA 3UQBA 1NSGA 5DO2A 3O5OA 1HKIA 3B9DA 1ZBCA 1JNTA 1LG1A 2LPVA 4P8VA 4QIBA 3KAHA 2RUCA 2UZ5A 4WIWA 4KQZA 2DT2A 4HARA 2FKEA 5HWBA 1RD6A 3RMEA 3KAFA 5DF0A 2ZR5A 4QT2A 1EQ3A 1FKJA 1Q6HA 2A3BA 3RM8A 2MLXA 1FD9A 2ZQTA 3PRAA 3B9EA 1W1YA 1W9UA 3CZ8A 4DWSD 2WLYA 3ARYA 2IF4A 4ODLA 4DRQA 3ARVA 1L1PA 1ZBVA 3O5LA 5JH8A 1W9VA 1Y0OA 3WQVA 2MLZA 4IT4A 1E6ZA 5DEZA 4ML4A 1IX5A 3O5DA 1F40A 3JYJA 3QOKA 1E6NA 2PBCA 3WIJA 4DRIA 1KFWA 1J6YA 1D7HA 2WM0A 2YBUA 3WL0A 4Z2JA 3WH0A 3H9RB 4LAYA 3I6CA 2VCDA 2PPPA 4DROA 2VN1A 4JFIA 4JYSA 3GPKA 2ZQVA 1C9HA 4MTVA 4P8XA 3RFWA 4IPXA 4O2TA 2DSWA 5D75A 4WKHA 2DT0A 4GIVA 1HXVA 3ARPA 4PTMA 2PI6A 3AROA 2XPAA 1QZ2A 2DT1A 4ODOA 1W26A 3KCEA 1A7XA 3TDBA 3OA5A 1HJXA 2ZR6A 4BF8A 1ZBWA 2RUDA 2LJ4A 4ZPVR 2WK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EYM A;  2MNT A;  2XP4 A;  3UI6 A;  1M5Y A;  2PV3 A;  1PBK A;  3JXV A;  2AWG A;  2XP3 A;  2XPB A;  4MSP A;  3UQI A;  5HKG A;  4TW6 A;  4DRN A;  4QT3 A;  3ODK A;  1FKS A;  4IQ2 A;  4TW7 A;  5HTG A;  2MF9 A;  1FKB A;  3PA7 A;  4JFM A;  1J4R A;  1FKF A;  1FAP A;  3UQB A;  1NSG A;  1Q6I A;  4ODK A;  4DIP A;  1P5Q A;  3O5O A;  3O5M A;  2LKN A;  3O5F A;  1KT0 A;  4TX0 A;  4FN2 A;  1JNT A;  1ROT A;  2LPV A;  5I98 A;  1D7I A;  2KGJ A;  2XP9 A;  4QIB A;  4DH0 A;  5HUA A;  3KAH A;  2DG4 A;  4U84 A;  2RUC A;  2UZ5 A;  5HT1 A;  4ITZ A;  2D9F A;  2FKE A;  5HWB A;  3KAF A;  3O5P A;  4ODN A;  3UI4 A;  2ZR5 A;  1FKK A;  4U86 A;  4QT2 A;  3O5K A;  4W9Q A;  4DRH A;  1EQ3 A;  1FKJ A;  3KAD A;  4ODR A;  1FKH A;  1Q6H A;  2ZR4 A;  4DZ2 A;  3UQA A;  1TCO C;  2ITK A;  4NNR A;  1PIN A;  1B6C A;  2ZQU A;  2MLX A;  1FD9 A;  2KFW A;  4ODQ A;  4J4N A;  2ZQT A;  4FAP A;  1KT1 A;  1Q6U A;  3O5Q A;  3VAW A;  1J4H A;  3NRK A;  2ZQS A;  4DZ3 A;  3B7X A;  4J4O A;  3KZ7 A;  2IF4 A;  4TYO A;  4ODL A;  2PV2 A;  1T11 A;  1JNS A;  4DRQ A;  3EY6 A;  1FKI A;  3LUO A;  3TCZ A;  1L1P A;  1BKF A;  1FKG A;  2N87 A;  3O5L A;  3KAB A;  4JFK A;  2XP6 A;  5DIU A;  2Y78 A;  4IQC A;  4TW8 A;  1JVW A;  1Y0O A;  3IKG A;  2MLZ A;  3IHZ A;  4DT4 A;  2RUR A;  2OFN A;  5J6E A;  1NMW A;  3KAC A;  3NTP A;  4G50 A;  3TC5 A;  1NMV A;  2M2A A;  1FKL A;  1ZCN A;  4GGQ A;  3O5D A;  1F40 A;  5HW6 A;  2KI3 A;  3JYJ A;  3CGM A;  2PBC A;  4W9O A;  3KAG A;  4LAX A;  5BXJ A;  2M1I A;  2Q5A A;  1QPL A;  3KAI A;  4DRI A;  5GPG A;  3UF8 A;  1J6Y A;  1D7H A;  1FJD A;  3O5J A;  3FAP A;  3PRB A;  4JFJ A;  1YW5 A;  3RGC A;  1J4I A;  3UI5 A;  2K8I A;  2MLY A;  4N19 A;  3PRD A;  3WH0 A;  4G2P A;  5HWC A;  2DG9 A;  3H9R B;  3I6C A;  4LAY A;  5DIT A;  1FKR A;  2M08 A;  2PV1 A;  1YAT A;  2F21 A;  2PPP A;  2RQS A;  2VCD A;  4LAW A;  4ODP A;  4DRO A;  3OOB A;  1R9H A;  2VN1 A;  2RSE A;  4TNS A;  4ODM A;  4JFI A;  4R0X A;  4JYS A;  3GPK A;  2ZQV A;  1C9H A;  2JZV A;  2XP7 A;  3RFW A;  4DRK A;  5HW7 A;  4IPX A;  3MDY B;  3NI6 A;  4O2T A;  4W9P A;  5B8I C;  3O5E A;  2MPH A;  1QPF A;  2PPO A;  3CGN A;  3IKD A;  4U85 A;  5D75 A;  4GIV A;  1ROU A;  2DG3 A;  1HXV A;  1F8A B;  1U79 A;  3JYM A;  4JFL A;  4DRM A;  1Q1C A;  2F4E A;  4MGV A;  1D6O A;  2KO7 A;  4LAV A;  1D7J A;  3O5G A;  2XP5 A;  2XPA A;  1QZ2 A;  1FKT A;  4DRJ A;  4ODO A;  1W26 A;  3KCE A;  1A7X A;  2XP8 A;  2KR7 A;  3TDB A;  1N1A A;  2FAP A;  2ZR6 A;  4C02 B;  2L2S A;  2F2D A;  5HW8 A;  1ZK6 A;  2PPN A;  4BF8 A;  1BL4 A;  1FKD A;  2RUD A;  2LGO A;  2LJ4 A;  3IK8 A;  3O5I A;  4DRP A;  3O5R A;  2KE0 A;  5DIV A;  2RUQ A; 
#chains in the Genus database with same CATH topology
 1EYM A;  3UI6 A;  2AWG A;  2XP3 A;  3ARZ A;  3BMB A;  4TW6 A;  2EUL A;  4DRN A;  4HBE A;  4P8U A;  1LJY A;  1LQ0 A;  4TW7 A;  2MF9 A;  1FKB A;  3PA7 A;  4JFM A;  1ZU8 A;  1FKF A;  1FAP A;  2PN0 A;  3WD4 A;  3AS2 A;  1KT0 A;  4TX0 A;  1XHG A;  2XP9 A;  3CHD A;  4DH0 A;  4WKF A;  2DG4 A;  5HT1 A;  4Z2H A;  3EIP A;  1ITX A;  3O5P A;  3KAD A;  3WKZ A;  2ZQU A;  2KFW A;  1ZB5 A;  1HKJ A;  1KT1 A;  4L72 B;  3WD3 A;  3VAW A;  3AQU A;  2A3C A;  4R5E A;  4DZ3 A;  3KZ7 A;  3ALG A;  1HJV A;  1FKI A;  3LUO A;  1W1P A;  1FFR A;  1BKF A;  4ZPW R;  2XP6 A;  4TW8 A;  1JVW A;  1OWQ A;  2IUZ A;  5J6E A;  1HKM A;  4Z2G A;  3KAC A;  3NTP A;  4G50 A;  3TC5 A;  2M2A A;  1GOI A;  2OLH A;  5HW6 A;  3B9A A;  3CGM A;  1SR0 A;  4W9O A;  2YBT A;  3ARR A;  4LAX A;  2M1I A;  4KR0 B;  5GPG A;  3UF8 A;  1E6R A;  4WJX A;  1LL4 A;  1H0I A;  1NWT A;  4LAW A;  2RSE A;  4TNS A;  3RM9 A;  5HW7 A;  4L3N A;  2MPH A;  4U85 A;  1ZBK A;  1F8A B;  4MGV A;  1CTN A;  4LGX A;  2XP5 A;  1JND A;  4MNK A;  3PR9 A;  4C02 B;  2L2S A;  2F2D A;  1FKD A;  3KAB A;  2MNT A;  2DT3 A;  2XP4 A;  3UQI A;  5HKG A;  4MNM A;  1NWU A;  4QT3 A;  3CHF A;  4XAK A;  3GU0 A;  1LL6 A;  4MPK A;  2A3A A;  4DWS A;  1UR8 A;  4ODK A;  1P5Q A;  3ARQ A;  4WK9 A;  3O5M A;  2LKN A;  5GPR A;  1WNO A;  1ROT A;  5I98 A;  1D7I A;  1WB0 A;  2DSU A;  2WLZ A;  4U84 A;  4Z2I A;  2D9F A;  3ARS A;  3FY1 A;  1OGG A;  2DSZ A;  4W9Q A;  4DRH A;  1FKH A;  2ZR4 A;  4NZC A;  3UQA A;  1NWR A;  2G8Z A;  1JNE A;  4J4N A;  4FAP A;  1Q6U A;  3O5Q A;  3ALF A;  1J4H A;  4Q7N A;  2ZQS A;  3B7X A;  4J4O A;  4WKA A;  2PV2 A;  1JNS A;  3CHC A;  3WD0 A;  1LG2 A;  2A3E A;  2N87 A;  1D2K A;  4JFK A;  3IKG A;  4HBO A;  2OFN A;  3WL1 A;  1JCH B;  3WD2 A;  1NMV A;  1ZCN A;  1E44 A;  1XRV A;  4MNJ A;  2KI3 A;  5HBF A;  4IT6 A;  3ARX A;  1W1T A;  3KAG A;  2Q5A A;  3KAI A;  1FJD A;  3FXY A;  3FAP A;  4MNL A;  1YW5 A;  1J4I A;  3UI5 A;  2MLY A;  3PRD A;  4G2P A;  5HWC A;  2DG9 A;  1FKR A;  5DIT A;  3W4R A;  1YAT A;  2F21 A;  2O92 A;  2RQS A;  1HJW A;  3OOB A;  2FDM A;  4R0X A;  2QF8 A;  2JZV A;  2XP7 A;  3MDY B;  3NI6 A;  4ZPT R;  4Z2K A;  4Q22 A;  3CGN A;  3IKD A;  1ROU A;  1U79 A;  1K9T A;  2F4E A;  4NSB A;  3BXW A;  1EHN A;  3O5G A;  1FKT A;  1E6P A;  1WAW A;  2XP8 A;  2KR7 A;  1N1A A;  2FAP A;  3RM4 A;  4Z2L A;  2PPN A;  4QZV B;  3O5I A;  1H0G A;  3ART A;  2KE0 A;  1EDQ A;  5DIV A;  2RUQ A;  4N19 A;  1VF8 A;  1FFQ A;  2PV3 A;  1TFV A;  4MSP A;  3CHE A;  2ETN A;  1FKS A;  4IQ2 A;  1SYT A;  5HTG A;  3ARU A;  1J4R A;  1LL7 A;  4W5U A;  1Q6I A;  4DIP A;  4DWS C;  3O5F A;  3AS0 A;  4FN2 A;  2DPE A;  2KGJ A;  3CH9 A;  5HUA A;  4ITZ A;  3B8S A;  3UI4 A;  4ODN A;  1FKK A;  4U86 A;  3O5K A;  1W9P A;  4MAV A;  4ODR A;  4DZ2 A;  1E15 A;  4P8W A;  1TCO C;  2ITK A;  4NNR A;  1O6I A;  1PIN A;  1B6C A;  4ODQ A;  3WQW A;  3GTY X;  3NRK A;  4AY1 A;  2B31 A;  4TYO A;  1OGB A;  1T11 A;  1GUV A;  3EY6 A;  1E9L A;  3TCZ A;  1FKG A;  1X6L A;  3ARW A;  5DIU A;  2Y78 A;  4IQC A;  3AS1 A;  4S3K A;  3IHZ A;  4DT4 A;  2RUR A;  1NMW A;  1NWS A;  1FKL A;  4GGQ A;  3AS3 A;  4ZS6 A;  5BXJ A;  1QPL A;  5GQB A;  3O5J A;  3PRB A;  3G6M A;  4JFJ A;  1UR9 A;  3RGC A;  2K8I A;  2O9O A;  2M08 A;  2PV1 A;  4ODP A;  1R9H A;  4ODM A;  3G6L A;  4DRK A;  4W9P A;  5B8I C;  3O5E A;  1QPF A;  2G41 A;  2PPO A;  4S3J A;  2DG3 A;  4DRM A;  3JYM A;  4JFL A;  1Q1C A;  1D6O A;  2KO7 A;  4LAV A;  1D7J A;  1GPF A;  1W1V A;  4DRJ A;  4UDM A;  3WD1 A;  2ESC A;  1ZK6 A;  5HW8 A;  1X6N A;  3IK8 A;  1BL4 A;  1EIB A;  2LGO A;  4DRP A;  1ZL1 A;  3O5R A;  1M5Y A;  1PBK A;  3JXV A;  2XPB A;  1NH6 A;  4URI A;  2AOS A;  2DSV A;  3ODK A;  4DWS B;  1HKK A;  3UQB A;  1NSG A;  5DO2 A;  3O5O A;  1HKI A;  3B9D A;  1ZBC A;  1JNT A;  1LG1 A;  2LPV A;  4P8V A;  4QIB A;  3KAH A;  2RUC A;  2UZ5 A;  4WIW A;  4KQZ A;  2DT2 A;  4HAR A;  2FKE A;  5HWB A;  1RD6 A;  3RME A;  3KAF A;  5DF0 A;  2ZR5 A;  4QT2 A;  1EQ3 A;  1FKJ A;  2B5U B;  1GRJ A;  1Q6H A;  2A3B A;  2P4V A;  3RM8 A;  2MLX A;  1FD9 A;  2ZQT A;  3PRA A;  3B9E A;  1W1Y A;  1W9U A;  3CZ8 A;  4DWS D;  2WLY A;  3ARY A;  2IF4 A;  4ODL A;  4DRQ A;  3ARV A;  1L1P A;  1ZBV A;  3O5L A;  5JH8 A;  1W9V A;  1Y0O A;  3WQV A;  2MLZ A;  4IT4 A;  1E6Z A;  5DEZ A;  4ML4 A;  1IX5 A;  3O5D A;  1F40 A;  3JYJ A;  3QOK A;  1E6N A;  2PBC A;  3WIJ A;  4DRI A;  1KFW A;  1J6Y A;  1D7H A;  2WM0 A;  2YBU A;  3WL0 A;  4Z2J A;  3WH0 A;  3H9R B;  4LAY A;  3I6C A;  2VCD A;  2PPP A;  4DRO A;  2VN1 A;  4JFI A;  4JYS A;  3GPK A;  2ZQV A;  1C9H A;  4MTV A;  4P8X A;  3RFW A;  4IPX A;  4O2T A;  2DSW A;  5D75 A;  4WKH A;  2DT0 A;  4GIV A;  1HXV A;  3ARP A;  4PTM A;  2PI6 A;  3ARO A;  2XPA A;  1QZ2 A;  2DT1 A;  4ODO A;  1W26 A;  3KCE A;  1A7X A;  3TDB A;  3OA5 A;  1HJX A;  2ZR6 A;  4BF8 A;  1ZBW A;  2RUD A;  2LJ4 A;  4ZPV R;  2F23 A;  2WK2 A; 
#chains in the Genus database with same CATH homology
 1EYM A;  3UI6 A;  2AWG A;  2XP3 A;  3ARZ A;  4TW6 A;  4DRN A;  4HBE A;  4P8U A;  1LJY A;  1LQ0 A;  4TW7 A;  2MF9 A;  1FKB A;  3PA7 A;  4JFM A;  1ZU8 A;  1FKF A;  1FAP A;  3WD4 A;  3AS2 A;  1KT0 A;  4TX0 A;  1XHG A;  2XP9 A;  3CHD A;  4DH0 A;  4WKF A;  2DG4 A;  5HT1 A;  4Z2H A;  1ITX A;  3O5P A;  3KAD A;  3WKZ A;  2ZQU A;  2KFW A;  1ZB5 A;  1HKJ A;  1KT1 A;  4L72 B;  3WD3 A;  3VAW A;  3AQU A;  2A3C A;  4R5E A;  4DZ3 A;  3KZ7 A;  3ALG A;  1HJV A;  1FKI A;  3LUO A;  1W1P A;  1FFR A;  1BKF A;  4ZPW R;  2XP6 A;  4TW8 A;  1JVW A;  1OWQ A;  2IUZ A;  5J6E A;  1HKM A;  4Z2G A;  3KAC A;  3NTP A;  4G50 A;  3TC5 A;  2M2A A;  1GOI A;  2OLH A;  5HW6 A;  3B9A A;  3CGM A;  1SR0 A;  4W9O A;  2YBT A;  3ARR A;  4LAX A;  2M1I A;  4KR0 B;  5GPG A;  3UF8 A;  1E6R A;  4WJX A;  1LL4 A;  1H0I A;  1NWT A;  4LAW A;  2RSE A;  4TNS A;  3RM9 A;  5HW7 A;  4L3N A;  2MPH A;  4U85 A;  1ZBK A;  1F8A B;  4MGV A;  1CTN A;  4LGX A;  2XP5 A;  1JND A;  4MNK A;  3PR9 A;  4C02 B;  2L2S A;  2F2D A;  1FKD A;  3KAB A;  2MNT A;  2DT3 A;  2XP4 A;  3UQI A;  5HKG A;  4MNM A;  1NWU A;  4QT3 A;  3CHF A;  4XAK A;  1LL6 A;  4MPK A;  2A3A A;  4DWS A;  1UR8 A;  4ODK A;  1P5Q A;  3ARQ A;  4WK9 A;  3O5M A;  2LKN A;  5GPR A;  1WNO A;  1ROT A;  5I98 A;  1D7I A;  1WB0 A;  2DSU A;  2WLZ A;  4U84 A;  4Z2I A;  2D9F A;  3ARS A;  3FY1 A;  1OGG A;  2DSZ A;  4W9Q A;  4DRH A;  1FKH A;  2ZR4 A;  4NZC A;  3UQA A;  1NWR A;  2G8Z A;  1JNE A;  4J4N A;  4FAP A;  1Q6U A;  3O5Q A;  3ALF A;  1J4H A;  4Q7N A;  2ZQS A;  3B7X A;  4J4O A;  4WKA A;  2PV2 A;  1JNS A;  3CHC A;  3WD0 A;  1LG2 A;  2A3E A;  2N87 A;  1D2K A;  4JFK A;  3IKG A;  4HBO A;  2OFN A;  3WL1 A;  3WD2 A;  1NMV A;  1ZCN A;  1XRV A;  4MNJ A;  2KI3 A;  5HBF A;  4IT6 A;  3ARX A;  1W1T A;  3KAG A;  2Q5A A;  3KAI A;  1FJD A;  3FXY A;  3FAP A;  4MNL A;  1YW5 A;  1J4I A;  3UI5 A;  2MLY A;  3PRD A;  4G2P A;  5HWC A;  2DG9 A;  1FKR A;  5DIT A;  3W4R A;  1YAT A;  2F21 A;  2O92 A;  2RQS A;  1HJW A;  3OOB A;  2FDM A;  4R0X A;  2QF8 A;  2JZV A;  2XP7 A;  3MDY B;  3NI6 A;  4ZPT R;  4Z2K A;  4Q22 A;  3CGN A;  3IKD A;  1ROU A;  1U79 A;  1K9T A;  2F4E A;  4NSB A;  3BXW A;  3O5G A;  1EHN A;  1FKT A;  1E6P A;  1WAW A;  2XP8 A;  2KR7 A;  1N1A A;  2FAP A;  3RM4 A;  4Z2L A;  2PPN A;  4QZV B;  3O5I A;  1H0G A;  3ART A;  2KE0 A;  1EDQ A;  5DIV A;  2RUQ A;  4N19 A;  1VF8 A;  1FFQ A;  2PV3 A;  1TFV A;  4MSP A;  3CHE A;  1FKS A;  4IQ2 A;  1SYT A;  5HTG A;  3ARU A;  1J4R A;  1LL7 A;  4W5U A;  1Q6I A;  4DIP A;  4DWS C;  3O5F A;  3AS0 A;  4FN2 A;  2DPE A;  2KGJ A;  3CH9 A;  5HUA A;  4ITZ A;  3B8S A;  3UI4 A;  4ODN A;  1FKK A;  4U86 A;  3O5K A;  1W9P A;  4MAV A;  4ODR A;  4DZ2 A;  1E15 A;  4P8W A;  1TCO C;  2ITK A;  4NNR A;  1O6I A;  1PIN A;  1B6C A;  4ODQ A;  3WQW A;  3NRK A;  4AY1 A;  2B31 A;  4TYO A;  1OGB A;  1T11 A;  1GUV A;  3EY6 A;  1E9L A;  3TCZ A;  1FKG A;  1X6L A;  3ARW A;  5DIU A;  2Y78 A;  4IQC A;  3AS1 A;  4S3K A;  3IHZ A;  4DT4 A;  2RUR A;  1NMW A;  1NWS A;  1FKL A;  4GGQ A;  3AS3 A;  4ZS6 A;  5BXJ A;  1QPL A;  5GQB A;  3O5J A;  3PRB A;  3G6M A;  4JFJ A;  1UR9 A;  3RGC A;  2K8I A;  2O9O A;  2M08 A;  2PV1 A;  4ODP A;  1R9H A;  4ODM A;  3G6L A;  4DRK A;  4W9P A;  5B8I C;  3O5E A;  1QPF A;  2G41 A;  2PPO A;  4S3J A;  2DG3 A;  4DRM A;  3JYM A;  4JFL A;  1Q1C A;  1D6O A;  2KO7 A;  4LAV A;  1D7J A;  1GPF A;  1W1V A;  4DRJ A;  3WD1 A;  2ESC A;  1ZK6 A;  5HW8 A;  1X6N A;  1BL4 A;  1EIB A;  3IK8 A;  2LGO A;  4DRP A;  1ZL1 A;  3O5R A;  1M5Y A;  1PBK A;  3JXV A;  2XPB A;  1NH6 A;  4URI A;  2AOS A;  2DSV A;  3ODK A;  4DWS B;  1HKK A;  3UQB A;  1NSG A;  5DO2 A;  3O5O A;  1HKI A;  3B9D A;  1ZBC A;  1JNT A;  1LG1 A;  2LPV A;  4P8V A;  4QIB A;  3KAH A;  2RUC A;  2UZ5 A;  4WIW A;  4KQZ A;  2DT2 A;  4HAR A;  2FKE A;  5HWB A;  1RD6 A;  3RME A;  3KAF A;  5DF0 A;  2ZR5 A;  4QT2 A;  1EQ3 A;  1FKJ A;  1Q6H A;  2A3B A;  3RM8 A;  2MLX A;  1FD9 A;  2ZQT A;  3PRA A;  3B9E A;  1W1Y A;  1W9U A;  3CZ8 A;  4DWS D;  2WLY A;  3ARY A;  2IF4 A;  4ODL A;  4DRQ A;  3ARV A;  1L1P A;  1ZBV A;  3O5L A;  5JH8 A;  1W9V A;  1Y0O A;  3WQV A;  2MLZ A;  4IT4 A;  1E6Z A;  5DEZ A;  4ML4 A;  1IX5 A;  3O5D A;  1F40 A;  3JYJ A;  3QOK A;  1E6N A;  2PBC A;  3WIJ A;  4DRI A;  1KFW A;  1J6Y A;  1D7H A;  2WM0 A;  2YBU A;  3WL0 A;  4Z2J A;  3WH0 A;  3H9R B;  4LAY A;  3I6C A;  2VCD A;  2PPP A;  4DRO A;  2VN1 A;  4JFI A;  4JYS A;  3GPK A;  2ZQV A;  1C9H A;  4MTV A;  4P8X A;  3RFW A;  4IPX A;  4O2T A;  2DSW A;  5D75 A;  4WKH A;  2DT0 A;  4GIV A;  1HXV A;  3ARP A;  4PTM A;  2PI6 A;  3ARO A;  2XPA A;  1QZ2 A;  2DT1 A;  4ODO A;  1W26 A;  3KCE A;  1A7X A;  3TDB A;  3OA5 A;  1HJX A;  2ZR6 A;  4BF8 A;  1ZBW A;  2RUD A;  2LJ4 A;  4ZPV R;  2WK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...