2PPOA

Crystal structure of e60a mutant of fkbp12
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWAEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural coupling between FKBP12 and buried water.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords FK506-binding protein 1A
total genus 28
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ppoA00
3KAFA 3UI4A 2DG4A 4ODKA 1NSGA 1NMWA 3KAGA 3PRBA 1NMVA 4IQCA 4TW6A 2PV2A 5HT1A 4DRHA 4DZ2A 1D7JA 2FAPA 1L1PA 2XP6A 3O5FA 4JYSA 2MPHA 2N87A 4DRQA 2ZQTA 3NI6A 1FKFA 2JZVA 4TX0A 2PPPA 5B8IC 1U79A 1YW5A 2XP5A 4FN2A 3UQBA 1J4IA 4GIVA 1FKKA 2M08A 4ODLA 3RFWA 2RUDA 5HW8A 1BKFA 1JVWA 1N1AA 5DIVA 1T11A 2LKNA 3JYMA 2ZR6A 3LUOA 1F40A 3IKDA 1R9HA 2XP9A 4TNSA 1C9HA 3UQIA 1PINA 2AWGA 2KO7A 4DRKA 3H9RB 4DRNA 1ZK6A 1D7HA 3ODKA 3MDYB 2Y78A 3O5IA 3TDBA 2DG3A 1QPLA 3O5MA 4LAXA 5GPGA 1Q6HA 3CGNA 3NTPA 4DZ3A 4LAWA 4BF8A 1Q6IA 4G2PA 1FJDA 1QZ2A 2F2DA 4ODMA 2KGJA 4QT3A 4J4NA 2L2SA 1A7XA 2OFNA 2DG9A 2LJ4A 2MF9A 3KADA 1B6CA 4G50A 4W9QA 3RGCA 2ZQVA 2K8IA 3CGMA 4DRMA 4DRPA 1Q6UA 4ITZA 4JFJA 4ODQA 1JNSA 1J4RA 4J4OA 1D6OA 1ROUA 4DRJA 3O5KA 2RUCA 3UQAA 1FKIA 2VN1A 4R0XA 4DH0A 2UZ5A 3KCEA 4GGQA 3GPKA 4QT2A 4TW7A 4N19A 4U86A 4U85A 4DT4A 5J6EA 1JNTA 1KT1A 3PA7A 3WH0A 4DROA 3UF8A 5HUAA 2ZQSA 3FAPA 1KT0A 2M2AA 3O5DA 1HXVA 1FKRA 4JFIA 1TCOC 2PBCA 2MLZA 2VCDA 4IQ2A 4TW8A 5HKGA 5HWCA 5D75A 4W9OA 3UI6A 2KE0A 2MLXA 5DIUA 4W9PA 1ROTA 2ITKA 2RQSA 4ODOA 4IPXA 5HW6A 4QIBA 1ZCNA 2Q5AA 2D9FA 4JFMA 1Q1CA 3JXVA 2F4EA 1PBKA 4DIPA 3O5LA 2RURA 1EQ3A 3KZ7A 5I98A 3KAHA 3KABA 3OOBA 1Y0OA 4NNRA 1D7IA 1FKGA 2KFWA 2XPAA 2XP4A 1FKJA 3O5GA 4LAYA 3TC5A 3O5OA 2KI3A 4FAPA 2PPNA 2PV3A 3IK8A 2PV1A 2XPBA 3O5JA 5BXJA 1QPFA 1J6YA 5DITA 1FAPA 3O5EA 2ZR5A 2M1IA 4ODPA 2RSEA 2ZR4A 3UI5A 3KAIA 3IKGA 2PPOA 1P5QA 1W26A 2KR7A 1FKTA 4JFKA 5HWBA 1FKSA 1F8AB 1FKLA 1FKBA 2MLYA 3NRKA 3TCZA 2FKEA 2IF4A 2ZQUA 4U84A 5HTGA 1EYMA 3VAWA 1FD9A 4DRIA 1FKDA 3EY6A 2RUQA 3O5QA 4MSPA 4ODNA 4JFLA 4MGVA 1BL4A 5HW7A 3IHZA 1FKHA 1YATA 1M5YA 3PRDA 4LAVA 3JYJA 2F21A 4ODRA 4TYOA 4O2TA 2LPVA 2XP3A 3I6CA 2LGOA 2MNTA 3O5RA 2XP7A 3KACA 3B7XA 4C02B 1J4HA 3O5PA 2XP8A
chains in the Genus database with same CATH superfamily
2DG4A 3PRBA 1NMVA 1L1PA 2XP6A 3O5FA 2MPHA 2ZQTA 1E6RA 5B8IC 2XP5A 4GIVA 4P8WA 2M08A 4UDMA 1KFWA 2QF8A 3GU0A 1T11A 1F40A 4WKHA 3EIPA 1R9HA 4TNSA 3UQIA 2KO7A 1EDQA 4DRKA 4DWSA 4NSBA 2YBUA 3O5IA 2PI6A 4LAXA 1JNDA 1Q6IA 1ITXA 1FJDA 4ODMA 3KADA 2MF9A 2A3AA 4W9QA 4Z2KA 1FFRA 1SR0A 4KQZA 3WD4A 1ZBVA 2ZQVA 3ARSA 3PR9A 4ODQA 1JNSA 3ARRA 1ROUA 4DRJA 2VN1A 4R0XA 3GPKA 4MNKA 2OLHA 4U85A 4DT4A 1JNTA 5HUAA 3PRAA 3W4RA 1LL7A 1FKRA 3WKZA 1HJXA 2PBCA 2MLZA 3WD2A 4W9OA 4WKAA 2ITKA 4IPXA 4QIBA 3RMEA 1ZCNA 3WD1A 1Q1CA 3WD3A 1EQ3A 1NWTA 4NNRA 4TW8A 2XP4A 4LAYA 2KI3A 1ZBWA 4QZVB 2PV1A 1QPFA 1FAPA 1NH6A 2ZR5A 4ZPWR 2ZR4A 3UI5A 1UR8A 1NWSA 3FXYA 2PPOA 1FKBA 3TCZA 1OWQA 1E15A 2IUZA 1WAWA 3G6LA 4WIWA 3EY6A 3O5QA 4ODNA 3ARYA 5HW7A 1FKHA 4LAVA 3JYJA 3O5RA 1HJWA 3KACA 4MNMA 4C02B 2DSVA 1CTNA 1VF8A 2DSUA 1NSGA 4IQCA 3AS3A 2FAPA 3FY1A 4IT6A 4JYSA 1XRVA 3ARXA 3NI6A 1GOIA 4TX0A 4FN2A 1J4IA 1FKKA 3RM8A 2RUDA 5DIVA 2G41A 2F23A 4KR0B 3IKDA 1C9HA 2AWGA 4DRNA 1D7HA 3WL1A 3TDBA 3O5MA 1Q6HA 1OGGA 4ZPTR 4LAWA 4WKFA 4G2PA 2F2DA 4Q22A 2DG9A 4PTMA 2AOSA 3CHFA 4P8XA 4MTVA 4MAVA 3AS2A 2K8IA 4DRMA 4DRPA 4ITZA 4J4OA 1GRJA 3CHEA 4Z2LA 3ARTA 1E9LA 4MNLA 1W1TA 3B9AA 4ZPVR 4DROA 2G8ZA 3UF8A 4L72B 1KT0A 5DEZA 1HXVA 1LQ0A 3BXWA 1E6ZA 2VCDA 1EIBA 3B9EA 1SYTA 1ZL1A 4JFMA 3JXVA 4R5EA 2WLZA 3KZ7A 3KABA 3TC5A 3O5GA 1FKJA 5GQBA 4FAPA 2A3BA 2XPBA 5BXJA 1E44A 1LG1A 3B9DA 4URIA 3KAIA 2KR7A 3RM9A 1FKSA 3NRKA 2MLYA 5HTGA 2IF4A 2DT2A 3VAWA 2RUQA 4MSPA 3IHZA 3PRDA 1W1PA 2WK2A 4O2TA 2LPVA 2LGOA 2MNTA 1GUVA 4DWSD 1LJYA 2XP8A 3NTPA 4W5UA 3KAFA 3CZ8A 5HT1A 2PV2A 4DRHA 1EHNA 4XAKA 2N87A 4DRQA 1ZBCA 3WL0A 2DT3A 2JZVA 3B8SA 2PPPA 1U79A 1YW5A 3UQBA 4ODLA 5HW8A 1JVWA 1N1AA 5DF0A 3JYMA 2ZR6A 2XP9A 5JH8A 3ARWA 4WJXA 1E6PA 3WIJA 5GPRA 3AROA 1E6NA 2DG3A 4QT3A 4J4NA 2L2SA 1A7XA 2OFNA 1HKIA 4L3NA 1JNEA 4NZCA 3RGCA 1K9TA 4DWSB 1Q6UA 4JFJA 1J4RA 4MPKA 3BMBA 4DWSC 3UQAA 3RM4A 3ARPA 4DH0A 3KCEA 4GGQA 4QT2A 4TW7A 4U86A 1LG2A 5J6EA 2DSWA 3WQVA 3ARVA 3O5DA 1D2KA 4LGXA 1W1VA 5HBFA 5HWCA 3UI6A 2KE0A 2MLXA 1W9PA 1ROTA 1XHGA 1X6NA 4MNJA 2A3CA 3CHDA 5I98A 2WM0A 1Y0OA 1D7IA 1FKGA 2KFWA 2XPAA 3O5OA 2DT1A 3IK8A 4HBEA 1J6YA 3ARQA 3O5EA 5DITA 4ODPA 2M1IA 2A3EA 2RSEA 1H0GA 2B31A 2ESCA 1W9VA 1P5QA 4HARA 1FKTA 5HWBA 1F8AB 1FKLA 2FKEA 2ZQUA 4S3KA 4U84A 4DRIA 4S3JA 1W9UA 1TFVA 4JFLA 4ODRA 1ZB5A 2F21A 3WQWA 2DT0A 2ETNA 1RD6A 4ZS6A 3B7XA 1J4HA 1ZBKA 1WB0A 3UI4A 4ODKA 4ML4A 1NMWA 3AQUA 3KAGA 4IT4A 4TW6A 2FDMA 4DZ2A 1D7JA 1O6IA 2WLYA 4HBOA 1FKFA 3GTYX 1NWRA 3RFWA 1BKFA 2LKNA 3LUOA 2B5UB 1PINA 2EULA 3H9RB 1ZK6A 3ODKA 1HKJA 2Y78A 3MDYB 1QPLA 5GPGA 1H0IA 3CGNA 4DZ3A 4BF8A 1QZ2A 2KGJA 2LJ4A 2O9OA 1B6CA 4G50A 1OGBA 4WK9A 2PN0A 3CGMA 1NWUA 3AS1A 4Q7NA 1D6OA 4P8VA 3O5KA 4Z2GA 1LL6A 1LL4A 2RUCA 1FKIA 2UZ5A 5DO2A 4N19A 3CH9A 4AY1A 1FFQA 1KT1A 1GPFA 1W1YA 3PA7A 3WH0A 2ZQSA 3CHCA 3ARUA 3FAPA 2M2AA 1HKMA 4JFIA 1TCOC 4Z2HA 4IQ2A 5HKGA 5D75A 5DIUA 4W9PA 5HW6A 2RQSA 4ODOA 1ZU8A 2Q5AA 2D9FA 2DPEA 2F4EA 1PBKA 4DIPA 3O5LA 2RURA 3KAHA 3OOBA 4Z2IA 2PPNA 1UR9A 2PV3A 3WD0A 3O5JA 1IX5A 1HJVA 1WNOA 3G6MA 1X6LA 4P8UA 3ALFA 3IKGA 1W26A 3OA5A 4JFKA 3ALGA 1EYMA 2YBTA 1FD9A 1FKDA 3QOKA 4MGVA 1BL4A 4Z2JA 2DSZA 1YATA 1M5YA 4TYOA 3ARZA 1HKKA 2XP3A 3I6CA 2P4VA 2XP7A 3AS0A 2O92A 3O5PA 1JCHB
chains in the Genus database with same CATH topology
2DG4A 3PRBA 1NMVA 1L1PA 2XP6A 3O5FA 2MPHA 2ZQTA 1E6RA 5B8IC 2XP5A 4GIVA 4P8WA 2M08A 1KFWA 2QF8A 1T11A 1F40A 4WKHA 1R9HA 4TNSA 3UQIA 2KO7A 1EDQA 4DRKA 4DWSA 4NSBA 2YBUA 3O5IA 2PI6A 4LAXA 1JNDA 1Q6IA 1ITXA 1FJDA 4ODMA 3KADA 2MF9A 2A3AA 4W9QA 4Z2KA 1FFRA 1SR0A 4KQZA 3WD4A 1ZBVA 2ZQVA 3ARSA 3PR9A 4ODQA 1JNSA 3ARRA 1ROUA 4DRJA 2VN1A 4R0XA 3GPKA 4MNKA 2OLHA 4U85A 4DT4A 1JNTA 5HUAA 3PRAA 3W4RA 1LL7A 1FKRA 3WKZA 1HJXA 2PBCA 2MLZA 3WD2A 4W9OA 4WKAA 2ITKA 4IPXA 4QIBA 3RMEA 1ZCNA 3WD1A 1Q1CA 3WD3A 1EQ3A 1NWTA 4NNRA 4TW8A 2XP4A 4LAYA 2KI3A 1ZBWA 4QZVB 2PV1A 1QPFA 1FAPA 1NH6A 2ZR5A 4ZPWR 2ZR4A 3UI5A 1UR8A 1NWSA 3FXYA 2PPOA 1FKBA 3TCZA 1OWQA 1E15A 2IUZA 1WAWA 3G6LA 4WIWA 3EY6A 3O5QA 4ODNA 3ARYA 5HW7A 1FKHA 4LAVA 3JYJA 3O5RA 1HJWA 3KACA 4MNMA 4C02B 2DSVA 1CTNA 1VF8A 2DSUA 1NSGA 4IQCA 3AS3A 2FAPA 3FY1A 4IT6A 4JYSA 1XRVA 3ARXA 3NI6A 1GOIA 4TX0A 4FN2A 1J4IA 1FKKA 3RM8A 2RUDA 5DIVA 2G41A 4KR0B 3IKDA 1C9HA 2AWGA 4DRNA 1D7HA 3WL1A 3TDBA 3O5MA 1Q6HA 1OGGA 4ZPTR 4LAWA 4WKFA 4G2PA 2F2DA 4Q22A 2DG9A 4PTMA 2AOSA 3CHFA 4P8XA 4MTVA 4MAVA 3AS2A 2K8IA 4DRMA 4DRPA 4ITZA 4J4OA 3CHEA 4Z2LA 3ARTA 1E9LA 4MNLA 1W1TA 3B9AA 4ZPVR 4DROA 2G8ZA 3UF8A 4L72B 1KT0A 5DEZA 1HXVA 1LQ0A 3BXWA 1E6ZA 2VCDA 1EIBA 3B9EA 1SYTA 1ZL1A 4JFMA 3JXVA 4R5EA 2WLZA 3KZ7A 3KABA 3TC5A 3O5GA 1FKJA 5GQBA 4FAPA 2A3BA 2XPBA 5BXJA 1LG1A 3B9DA 4URIA 3KAIA 2KR7A 3RM9A 1FKSA 3NRKA 2MLYA 5HTGA 2IF4A 2DT2A 3VAWA 2RUQA 4MSPA 3IHZA 3PRDA 1W1PA 2WK2A 4O2TA 2LPVA 2LGOA 2MNTA 1GUVA 4DWSD 1LJYA 2XP8A 3NTPA 4W5UA 3KAFA 3CZ8A 5HT1A 2PV2A 4DRHA 1EHNA 4XAKA 2N87A 4DRQA 1ZBCA 3WL0A 2DT3A 2JZVA 3B8SA 2PPPA 1U79A 1YW5A 3UQBA 4ODLA 5HW8A 1JVWA 1N1AA 5DF0A 3JYMA 2ZR6A 2XP9A 5JH8A 3ARWA 4WJXA 1E6PA 3WIJA 5GPRA 3AROA 1E6NA 2DG3A 4QT3A 4J4NA 2L2SA 1A7XA 2OFNA 1HKIA 4L3NA 1JNEA 4NZCA 3RGCA 1K9TA 4DWSB 1Q6UA 4JFJA 1J4RA 4MPKA 4DWSC 3UQAA 3RM4A 3ARPA 4DH0A 3KCEA 4GGQA 4QT2A 4TW7A 4U86A 1LG2A 5J6EA 2DSWA 3WQVA 3ARVA 3O5DA 1D2KA 4LGXA 1W1VA 5HBFA 5HWCA 3UI6A 2KE0A 2MLXA 1W9PA 1ROTA 1XHGA 1X6NA 4MNJA 2A3CA 3CHDA 5I98A 2WM0A 1Y0OA 1D7IA 1FKGA 2KFWA 2XPAA 3O5OA 2DT1A 3IK8A 4HBEA 1J6YA 3ARQA 3O5EA 5DITA 4ODPA 2M1IA 2A3EA 2RSEA 1H0GA 2B31A 2ESCA 1W9VA 1P5QA 4HARA 1FKTA 5HWBA 1F8AB 1FKLA 2FKEA 2ZQUA 4S3KA 4U84A 4DRIA 4S3JA 1W9UA 1TFVA 4JFLA 4ODRA 1ZB5A 2F21A 3WQWA 2DT0A 4ZS6A 1RD6A 3B7XA 1J4HA 1ZBKA 1WB0A 3UI4A 4ODKA 4ML4A 1NMWA 3AQUA 3KAGA 4IT4A 4TW6A 2FDMA 4DZ2A 1D7JA 1O6IA 2WLYA 4HBOA 1FKFA 1NWRA 3RFWA 1BKFA 2LKNA 3LUOA 1PINA 3H9RB 1ZK6A 3ODKA 1HKJA 2Y78A 3MDYB 1QPLA 5GPGA 1H0IA 3CGNA 4DZ3A 4BF8A 1QZ2A 2KGJA 2LJ4A 2O9OA 1B6CA 4G50A 1OGBA 4WK9A 3CGMA 1NWUA 3AS1A 4Q7NA 1D6OA 4P8VA 3O5KA 4Z2GA 1LL6A 1LL4A 2RUCA 1FKIA 2UZ5A 5DO2A 4N19A 3CH9A 4AY1A 1FFQA 1KT1A 1GPFA 1W1YA 3PA7A 3WH0A 2ZQSA 3CHCA 3ARUA 3FAPA 2M2AA 1HKMA 4JFIA 1TCOC 4Z2HA 4IQ2A 5HKGA 5D75A 5DIUA 4W9PA 5HW6A 2RQSA 4ODOA 1ZU8A 2Q5AA 2D9FA 2DPEA 2F4EA 1PBKA 4DIPA 3O5LA 2RURA 3KAHA 3OOBA 4Z2IA 2PPNA 1UR9A 2PV3A 3WD0A 3O5JA 1IX5A 1HJVA 1WNOA 3G6MA 1X6LA 4P8UA 3ALFA 3IKGA 1W26A 3OA5A 4JFKA 3ALGA 1EYMA 2YBTA 1FD9A 1FKDA 3QOKA 4MGVA 1BL4A 4Z2JA 2DSZA 1YATA 1M5YA 4TYOA 3ARZA 1HKKA 2XP3A 3I6CA 2XP7A 3AS0A 2O92A 3O5PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KAF A;  3UI4 A;  2DG4 A;  4ODK A;  1NSG A;  1NMW A;  3KAG A;  3PRB A;  1NMV A;  4IQC A;  4TW6 A;  2PV2 A;  5HT1 A;  4DRH A;  4DZ2 A;  1D7J A;  2FAP A;  1L1P A;  2XP6 A;  3O5F A;  4JYS A;  2MPH A;  2N87 A;  4DRQ A;  2ZQT A;  3NI6 A;  1FKF A;  2JZV A;  4TX0 A;  2PPP A;  5B8I C;  1U79 A;  1YW5 A;  2XP5 A;  4FN2 A;  3UQB A;  1J4I A;  4GIV A;  1FKK A;  2M08 A;  4ODL A;  3RFW A;  2RUD A;  5HW8 A;  1BKF A;  1JVW A;  1N1A A;  5DIV A;  1T11 A;  2LKN A;  3JYM A;  2ZR6 A;  3LUO A;  1F40 A;  3IKD A;  1R9H A;  2XP9 A;  4TNS A;  1C9H A;  3UQI A;  1PIN A;  2AWG A;  2KO7 A;  4DRK A;  3H9R B;  4DRN A;  1ZK6 A;  1D7H A;  3ODK A;  3MDY B;  2Y78 A;  3O5I A;  3TDB A;  2DG3 A;  1QPL A;  3O5M A;  4LAX A;  5GPG A;  1Q6H A;  3CGN A;  3NTP A;  4DZ3 A;  4LAW A;  4BF8 A;  1Q6I A;  4G2P A;  1FJD A;  1QZ2 A;  2F2D A;  4ODM A;  2KGJ A;  4QT3 A;  4J4N A;  2L2S A;  1A7X A;  2OFN A;  2DG9 A;  2LJ4 A;  2MF9 A;  3KAD A;  1B6C A;  4G50 A;  4W9Q A;  3RGC A;  2ZQV A;  2K8I A;  3CGM A;  4DRM A;  4DRP A;  1Q6U A;  4ITZ A;  4JFJ A;  4ODQ A;  1JNS A;  1J4R A;  4J4O A;  1D6O A;  1ROU A;  4DRJ A;  3O5K A;  2RUC A;  3UQA A;  1FKI A;  2VN1 A;  4R0X A;  4DH0 A;  2UZ5 A;  3KCE A;  4GGQ A;  3GPK A;  4QT2 A;  4TW7 A;  4N19 A;  4U86 A;  4U85 A;  4DT4 A;  5J6E A;  1JNT A;  1KT1 A;  3PA7 A;  3WH0 A;  4DRO A;  3UF8 A;  5HUA A;  2ZQS A;  3FAP A;  1KT0 A;  2M2A A;  3O5D A;  1HXV A;  1FKR A;  4JFI A;  1TCO C;  2PBC A;  2MLZ A;  2VCD A;  4IQ2 A;  4TW8 A;  5HKG A;  5HWC A;  5D75 A;  4W9O A;  3UI6 A;  2KE0 A;  2MLX A;  5DIU A;  4W9P A;  1ROT A;  2ITK A;  2RQS A;  4ODO A;  4IPX A;  5HW6 A;  4QIB A;  1ZCN A;  2Q5A A;  2D9F A;  4JFM A;  1Q1C A;  3JXV A;  2F4E A;  1PBK A;  4DIP A;  3O5L A;  2RUR A;  1EQ3 A;  3KZ7 A;  5I98 A;  3KAH A;  3KAB A;  3OOB A;  1Y0O A;  4NNR A;  1D7I A;  1FKG A;  2KFW A;  2XPA A;  2XP4 A;  1FKJ A;  3O5G A;  4LAY A;  3TC5 A;  3O5O A;  2KI3 A;  4FAP A;  2PPN A;  2PV3 A;  3IK8 A;  2PV1 A;  2XPB A;  3O5J A;  5BXJ A;  1QPF A;  1J6Y A;  5DIT A;  1FAP A;  3O5E A;  2ZR5 A;  2M1I A;  4ODP A;  2RSE A;  2ZR4 A;  3UI5 A;  3KAI A;  3IKG A;  2PPO A;  1P5Q A;  1W26 A;  2KR7 A;  1FKT A;  4JFK A;  5HWB A;  1FKS A;  1F8A B;  1FKL A;  1FKB A;  2MLY A;  3NRK A;  3TCZ A;  2FKE A;  2IF4 A;  2ZQU A;  4U84 A;  5HTG A;  1EYM A;  3VAW A;  1FD9 A;  4DRI A;  1FKD A;  3EY6 A;  2RUQ A;  3O5Q A;  4MSP A;  4ODN A;  4JFL A;  4MGV A;  1BL4 A;  5HW7 A;  3IHZ A;  1FKH A;  1YAT A;  1M5Y A;  3PRD A;  4LAV A;  3JYJ A;  2F21 A;  4ODR A;  4TYO A;  4O2T A;  2LPV A;  2XP3 A;  3I6C A;  2LGO A;  2MNT A;  3O5R A;  2XP7 A;  3KAC A;  3B7X A;  4C02 B;  1J4H A;  3O5P A;  2XP8 A; 
#chains in the Genus database with same CATH topology
 2DG4 A;  3PRB A;  1NMV A;  1L1P A;  2XP6 A;  3O5F A;  2MPH A;  2ZQT A;  1E6R A;  5B8I C;  2XP5 A;  4GIV A;  4P8W A;  2M08 A;  4UDM A;  1KFW A;  2QF8 A;  3GU0 A;  1T11 A;  1F40 A;  4WKH A;  3EIP A;  1R9H A;  4TNS A;  3UQI A;  2KO7 A;  1EDQ A;  4DRK A;  4DWS A;  4NSB A;  2YBU A;  3O5I A;  2PI6 A;  4LAX A;  1JND A;  1Q6I A;  1ITX A;  1FJD A;  4ODM A;  3KAD A;  2MF9 A;  2A3A A;  4W9Q A;  4Z2K A;  1FFR A;  1SR0 A;  4KQZ A;  3WD4 A;  1ZBV A;  2ZQV A;  3ARS A;  3PR9 A;  4ODQ A;  1JNS A;  3ARR A;  1ROU A;  4DRJ A;  2VN1 A;  4R0X A;  3GPK A;  4MNK A;  2OLH A;  4U85 A;  4DT4 A;  1JNT A;  5HUA A;  3PRA A;  3W4R A;  1LL7 A;  1FKR A;  3WKZ A;  1HJX A;  2PBC A;  2MLZ A;  3WD2 A;  4W9O A;  4WKA A;  2ITK A;  4IPX A;  4QIB A;  3RME A;  1ZCN A;  3WD1 A;  1Q1C A;  3WD3 A;  1EQ3 A;  1NWT A;  4NNR A;  4TW8 A;  2XP4 A;  4LAY A;  2KI3 A;  1ZBW A;  4QZV B;  2PV1 A;  1QPF A;  1FAP A;  1NH6 A;  2ZR5 A;  4ZPW R;  2ZR4 A;  3UI5 A;  1UR8 A;  1NWS A;  3FXY A;  2PPO A;  1FKB A;  3TCZ A;  1OWQ A;  1E15 A;  2IUZ A;  1WAW A;  3G6L A;  4WIW A;  3EY6 A;  3O5Q A;  4ODN A;  3ARY A;  5HW7 A;  1FKH A;  4LAV A;  3JYJ A;  3O5R A;  1HJW A;  3KAC A;  4MNM A;  4C02 B;  2DSV A;  1CTN A;  1VF8 A;  2DSU A;  1NSG A;  4IQC A;  3AS3 A;  2FAP A;  3FY1 A;  4IT6 A;  4JYS A;  1XRV A;  3ARX A;  3NI6 A;  1GOI A;  4TX0 A;  4FN2 A;  1J4I A;  1FKK A;  3RM8 A;  2RUD A;  5DIV A;  2G41 A;  2F23 A;  4KR0 B;  3IKD A;  1C9H A;  2AWG A;  4DRN A;  1D7H A;  3WL1 A;  3TDB A;  3O5M A;  1Q6H A;  1OGG A;  4ZPT R;  4LAW A;  4WKF A;  4G2P A;  2F2D A;  4Q22 A;  2DG9 A;  4PTM A;  2AOS A;  3CHF A;  4P8X A;  4MTV A;  4MAV A;  3AS2 A;  2K8I A;  4DRM A;  4DRP A;  4ITZ A;  4J4O A;  1GRJ A;  3CHE A;  4Z2L A;  3ART A;  1E9L A;  4MNL A;  1W1T A;  3B9A A;  4ZPV R;  4DRO A;  2G8Z A;  3UF8 A;  4L72 B;  1KT0 A;  5DEZ A;  1HXV A;  1LQ0 A;  3BXW A;  1E6Z A;  2VCD A;  1EIB A;  3B9E A;  1SYT A;  1ZL1 A;  4JFM A;  3JXV A;  4R5E A;  2WLZ A;  3KZ7 A;  3KAB A;  3TC5 A;  3O5G A;  1FKJ A;  5GQB A;  4FAP A;  2A3B A;  2XPB A;  5BXJ A;  1E44 A;  1LG1 A;  3B9D A;  4URI A;  3KAI A;  2KR7 A;  3RM9 A;  1FKS A;  3NRK A;  2MLY A;  5HTG A;  2IF4 A;  2DT2 A;  3VAW A;  2RUQ A;  4MSP A;  3IHZ A;  3PRD A;  1W1P A;  2WK2 A;  4O2T A;  2LPV A;  2LGO A;  2MNT A;  1GUV A;  4DWS D;  1LJY A;  2XP8 A;  3NTP A;  4W5U A;  3KAF A;  3CZ8 A;  5HT1 A;  2PV2 A;  4DRH A;  1EHN A;  4XAK A;  2N87 A;  4DRQ A;  1ZBC A;  3WL0 A;  2DT3 A;  2JZV A;  3B8S A;  2PPP A;  1U79 A;  1YW5 A;  3UQB A;  4ODL A;  5HW8 A;  1JVW A;  1N1A A;  5DF0 A;  3JYM A;  2ZR6 A;  2XP9 A;  5JH8 A;  3ARW A;  4WJX A;  1E6P A;  3WIJ A;  5GPR A;  3ARO A;  1E6N A;  2DG3 A;  4QT3 A;  4J4N A;  2L2S A;  1A7X A;  2OFN A;  1HKI A;  4L3N A;  1JNE A;  4NZC A;  3RGC A;  1K9T A;  4DWS B;  1Q6U A;  4JFJ A;  1J4R A;  4MPK A;  3BMB A;  4DWS C;  3UQA A;  3RM4 A;  3ARP A;  4DH0 A;  3KCE A;  4GGQ A;  4QT2 A;  4TW7 A;  4U86 A;  1LG2 A;  5J6E A;  2DSW A;  3WQV A;  3ARV A;  3O5D A;  1D2K A;  4LGX A;  1W1V A;  5HBF A;  5HWC A;  3UI6 A;  2KE0 A;  2MLX A;  1W9P A;  1ROT A;  1XHG A;  1X6N A;  4MNJ A;  2A3C A;  3CHD A;  5I98 A;  2WM0 A;  1Y0O A;  1D7I A;  1FKG A;  2KFW A;  2XPA A;  3O5O A;  2DT1 A;  3IK8 A;  4HBE A;  1J6Y A;  3ARQ A;  3O5E A;  5DIT A;  4ODP A;  2M1I A;  2A3E A;  2RSE A;  1H0G A;  2B31 A;  2ESC A;  1W9V A;  1P5Q A;  4HAR A;  1FKT A;  5HWB A;  1F8A B;  1FKL A;  2FKE A;  2ZQU A;  4S3K A;  4U84 A;  4DRI A;  4S3J A;  1W9U A;  1TFV A;  4JFL A;  4ODR A;  1ZB5 A;  2F21 A;  3WQW A;  2DT0 A;  2ETN A;  1RD6 A;  4ZS6 A;  3B7X A;  1J4H A;  1ZBK A;  1WB0 A;  3UI4 A;  4ODK A;  4ML4 A;  1NMW A;  3AQU A;  3KAG A;  4IT4 A;  4TW6 A;  2FDM A;  4DZ2 A;  1D7J A;  1O6I A;  2WLY A;  4HBO A;  1FKF A;  3GTY X;  1NWR A;  3RFW A;  1BKF A;  2LKN A;  3LUO A;  2B5U B;  1PIN A;  2EUL A;  3H9R B;  1ZK6 A;  3ODK A;  1HKJ A;  2Y78 A;  3MDY B;  1QPL A;  5GPG A;  1H0I A;  3CGN A;  4DZ3 A;  4BF8 A;  1QZ2 A;  2KGJ A;  2LJ4 A;  2O9O A;  1B6C A;  4G50 A;  1OGB A;  4WK9 A;  2PN0 A;  3CGM A;  1NWU A;  3AS1 A;  4Q7N A;  1D6O A;  4P8V A;  3O5K A;  4Z2G A;  1LL6 A;  1LL4 A;  2RUC A;  1FKI A;  2UZ5 A;  5DO2 A;  4N19 A;  3CH9 A;  4AY1 A;  1FFQ A;  1KT1 A;  1GPF A;  1W1Y A;  3PA7 A;  3WH0 A;  2ZQS A;  3CHC A;  3ARU A;  3FAP A;  2M2A A;  1HKM A;  4JFI A;  1TCO C;  4Z2H A;  4IQ2 A;  5HKG A;  5D75 A;  5DIU A;  4W9P A;  5HW6 A;  2RQS A;  4ODO A;  1ZU8 A;  2Q5A A;  2D9F A;  2DPE A;  2F4E A;  1PBK A;  4DIP A;  3O5L A;  2RUR A;  3KAH A;  3OOB A;  4Z2I A;  2PPN A;  1UR9 A;  2PV3 A;  3WD0 A;  3O5J A;  1IX5 A;  1HJV A;  1WNO A;  3G6M A;  1X6L A;  4P8U A;  3ALF A;  3IKG A;  1W26 A;  3OA5 A;  4JFK A;  3ALG A;  1EYM A;  2YBT A;  1FD9 A;  1FKD A;  3QOK A;  4MGV A;  1BL4 A;  4Z2J A;  2DSZ A;  1YAT A;  1M5Y A;  4TYO A;  3ARZ A;  1HKK A;  2XP3 A;  3I6C A;  2P4V A;  2XP7 A;  3AS0 A;  2O92 A;  3O5P A;  1JCH B; 
#chains in the Genus database with same CATH homology
 2DG4 A;  3PRB A;  1NMV A;  1L1P A;  2XP6 A;  3O5F A;  2MPH A;  2ZQT A;  1E6R A;  5B8I C;  2XP5 A;  4GIV A;  4P8W A;  2M08 A;  1KFW A;  2QF8 A;  1T11 A;  1F40 A;  4WKH A;  1R9H A;  4TNS A;  3UQI A;  2KO7 A;  1EDQ A;  4DRK A;  4DWS A;  4NSB A;  2YBU A;  3O5I A;  2PI6 A;  4LAX A;  1JND A;  1Q6I A;  1ITX A;  1FJD A;  4ODM A;  3KAD A;  2MF9 A;  2A3A A;  4W9Q A;  4Z2K A;  1FFR A;  1SR0 A;  4KQZ A;  3WD4 A;  1ZBV A;  2ZQV A;  3ARS A;  3PR9 A;  4ODQ A;  1JNS A;  3ARR A;  1ROU A;  4DRJ A;  2VN1 A;  4R0X A;  3GPK A;  4MNK A;  2OLH A;  4U85 A;  4DT4 A;  1JNT A;  5HUA A;  3PRA A;  3W4R A;  1LL7 A;  1FKR A;  3WKZ A;  1HJX A;  2PBC A;  2MLZ A;  3WD2 A;  4W9O A;  4WKA A;  2ITK A;  4IPX A;  4QIB A;  3RME A;  1ZCN A;  3WD1 A;  1Q1C A;  3WD3 A;  1EQ3 A;  1NWT A;  4NNR A;  4TW8 A;  2XP4 A;  4LAY A;  2KI3 A;  1ZBW A;  4QZV B;  2PV1 A;  1QPF A;  1FAP A;  1NH6 A;  2ZR5 A;  4ZPW R;  2ZR4 A;  3UI5 A;  1UR8 A;  1NWS A;  3FXY A;  2PPO A;  1FKB A;  3TCZ A;  1OWQ A;  1E15 A;  2IUZ A;  1WAW A;  3G6L A;  4WIW A;  3EY6 A;  3O5Q A;  4ODN A;  3ARY A;  5HW7 A;  1FKH A;  4LAV A;  3JYJ A;  3O5R A;  1HJW A;  3KAC A;  4MNM A;  4C02 B;  2DSV A;  1CTN A;  1VF8 A;  2DSU A;  1NSG A;  4IQC A;  3AS3 A;  2FAP A;  3FY1 A;  4IT6 A;  4JYS A;  1XRV A;  3ARX A;  3NI6 A;  1GOI A;  4TX0 A;  4FN2 A;  1J4I A;  1FKK A;  3RM8 A;  2RUD A;  5DIV A;  2G41 A;  4KR0 B;  3IKD A;  1C9H A;  2AWG A;  4DRN A;  1D7H A;  3WL1 A;  3TDB A;  3O5M A;  1Q6H A;  1OGG A;  4ZPT R;  4LAW A;  4WKF A;  4G2P A;  2F2D A;  4Q22 A;  2DG9 A;  4PTM A;  2AOS A;  3CHF A;  4P8X A;  4MTV A;  4MAV A;  3AS2 A;  2K8I A;  4DRM A;  4DRP A;  4ITZ A;  4J4O A;  3CHE A;  4Z2L A;  3ART A;  1E9L A;  4MNL A;  1W1T A;  3B9A A;  4ZPV R;  4DRO A;  2G8Z A;  3UF8 A;  4L72 B;  1KT0 A;  5DEZ A;  1HXV A;  1LQ0 A;  3BXW A;  1E6Z A;  2VCD A;  1EIB A;  3B9E A;  1SYT A;  1ZL1 A;  4JFM A;  3JXV A;  4R5E A;  2WLZ A;  3KZ7 A;  3KAB A;  3TC5 A;  3O5G A;  1FKJ A;  5GQB A;  4FAP A;  2A3B A;  2XPB A;  5BXJ A;  1LG1 A;  3B9D A;  4URI A;  3KAI A;  2KR7 A;  3RM9 A;  1FKS A;  3NRK A;  2MLY A;  5HTG A;  2IF4 A;  2DT2 A;  3VAW A;  2RUQ A;  4MSP A;  3IHZ A;  3PRD A;  1W1P A;  2WK2 A;  4O2T A;  2LPV A;  2LGO A;  2MNT A;  1GUV A;  4DWS D;  1LJY A;  2XP8 A;  3NTP A;  4W5U A;  3KAF A;  3CZ8 A;  5HT1 A;  2PV2 A;  4DRH A;  1EHN A;  4XAK A;  2N87 A;  4DRQ A;  1ZBC A;  3WL0 A;  2DT3 A;  2JZV A;  3B8S A;  2PPP A;  1U79 A;  1YW5 A;  3UQB A;  4ODL A;  5HW8 A;  1JVW A;  1N1A A;  5DF0 A;  3JYM A;  2ZR6 A;  2XP9 A;  5JH8 A;  3ARW A;  4WJX A;  1E6P A;  3WIJ A;  5GPR A;  3ARO A;  1E6N A;  2DG3 A;  4QT3 A;  4J4N A;  2L2S A;  1A7X A;  2OFN A;  1HKI A;  4L3N A;  1JNE A;  4NZC A;  3RGC A;  1K9T A;  4DWS B;  1Q6U A;  4JFJ A;  1J4R A;  4MPK A;  4DWS C;  3UQA A;  3RM4 A;  3ARP A;  4DH0 A;  3KCE A;  4GGQ A;  4QT2 A;  4TW7 A;  4U86 A;  1LG2 A;  5J6E A;  2DSW A;  3WQV A;  3ARV A;  3O5D A;  1D2K A;  4LGX A;  1W1V A;  5HBF A;  5HWC A;  3UI6 A;  2KE0 A;  2MLX A;  1W9P A;  1ROT A;  1XHG A;  1X6N A;  4MNJ A;  2A3C A;  3CHD A;  5I98 A;  2WM0 A;  1Y0O A;  1D7I A;  1FKG A;  2KFW A;  2XPA A;  3O5O A;  2DT1 A;  3IK8 A;  4HBE A;  1J6Y A;  3ARQ A;  3O5E A;  5DIT A;  4ODP A;  2M1I A;  2A3E A;  2RSE A;  1H0G A;  2B31 A;  2ESC A;  1W9V A;  1P5Q A;  4HAR A;  1FKT A;  5HWB A;  1F8A B;  1FKL A;  2FKE A;  2ZQU A;  4S3K A;  4U84 A;  4DRI A;  4S3J A;  1W9U A;  1TFV A;  4JFL A;  4ODR A;  1ZB5 A;  2F21 A;  3WQW A;  2DT0 A;  4ZS6 A;  1RD6 A;  3B7X A;  1J4H A;  1ZBK A;  1WB0 A;  3UI4 A;  4ODK A;  4ML4 A;  1NMW A;  3AQU A;  3KAG A;  4IT4 A;  4TW6 A;  2FDM A;  4DZ2 A;  1D7J A;  1O6I A;  2WLY A;  4HBO A;  1FKF A;  1NWR A;  3RFW A;  1BKF A;  2LKN A;  3LUO A;  1PIN A;  3H9R B;  1ZK6 A;  3ODK A;  1HKJ A;  2Y78 A;  3MDY B;  1QPL A;  5GPG A;  1H0I A;  3CGN A;  4DZ3 A;  4BF8 A;  1QZ2 A;  2KGJ A;  2LJ4 A;  2O9O A;  1B6C A;  4G50 A;  1OGB A;  4WK9 A;  3CGM A;  1NWU A;  3AS1 A;  4Q7N A;  1D6O A;  4P8V A;  3O5K A;  4Z2G A;  1LL6 A;  1LL4 A;  2RUC A;  1FKI A;  2UZ5 A;  5DO2 A;  4N19 A;  3CH9 A;  4AY1 A;  1FFQ A;  1KT1 A;  1GPF A;  1W1Y A;  3PA7 A;  3WH0 A;  2ZQS A;  3CHC A;  3ARU A;  3FAP A;  2M2A A;  1HKM A;  4JFI A;  1TCO C;  4Z2H A;  4IQ2 A;  5HKG A;  5D75 A;  5DIU A;  4W9P A;  5HW6 A;  2RQS A;  4ODO A;  1ZU8 A;  2Q5A A;  2D9F A;  2DPE A;  2F4E A;  1PBK A;  4DIP A;  3O5L A;  2RUR A;  3KAH A;  3OOB A;  4Z2I A;  2PPN A;  1UR9 A;  2PV3 A;  3WD0 A;  3O5J A;  1IX5 A;  1HJV A;  1WNO A;  3G6M A;  1X6L A;  4P8U A;  3ALF A;  3IKG A;  1W26 A;  3OA5 A;  4JFK A;  3ALG A;  1EYM A;  2YBT A;  1FD9 A;  1FKD A;  3QOK A;  4MGV A;  1BL4 A;  4Z2J A;  2DSZ A;  1YAT A;  1M5Y A;  4TYO A;  3ARZ A;  1HKK A;  2XP3 A;  3I6C A;  2XP7 A;  3AS0 A;  2O92 A;  3O5P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...