4MTVA

Crystal structure of the complex of buffalo signalling glycoprotein with pentasaccharide at 2.8a resolution
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Chitinase-3-like protein 1
publication title Crystal structure of the complex of Buffalo Signalling Glycoprotein with pentasaccharide at 2.8A resolution
rcsb
total genus 123
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2013-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4mtvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mtvA01
3SURA 2DSUA 1C90A 1JIBA 5DF0A 1RPKA 5A6BD 3L4VA 8A3HA 1L8NA 3UR7A 5EB8A 2WKLA 3AHVA 4NI3A 3MS8A 3QHNA 4OBSA 1GQLA 2EO7A 3VIFA 3VIGA 2VRJA 2E8ZA 3F5JA 4P7RA 1EHNA 3N17A 2GJXA 2IUZA 1QI4A 1EOMA 2WVVB 2XWDA 4C7FA 3WDHA 3OIHA 1B31A 2G3JA 3KL5A 1UR9A 1DTUA 1V0LA 4LYPA 3LPPA 4MNJA 3UG4A 1VJSA 1QI3A 3EMCA 5I2UA 4AIEA 2WYSA 2J7HA 3ZMRA 4PMDA 3ZT5A 1BYDA 2XM1A 1BYAA 1I75A 4UQDA 2WHMA 3BXWA 1CGXA 2WSPA 1X6NA 5A8QA 3SUVA 2VO5A 1ISYA 2CERA 4ZEPA 4W86A 3ECQA 2YDQA 3S6TA 1OIFA 4AC1X 4CCCA 1KCKA 2XVPA 2J7DA 1OWQA 1XCWA 1HJXA 3THCA 1FH9A 4E2OA 4OOZA 3EDFA 4F8XA 2VZSA 2CYGA 4W84A 1E40A 1D3CA 1V3MA 1BG4A 2WM0A 1B9ZA 2YDRA 5FCZA 2WZIA 4WK9A 2VT0A 3AZSA 2DT0A 1J10A 1KBBA 1JZ5A 1CEOA 3MMUA 4HMCA 3AS0A 4AXNA 3PHAA 4F9DA 3UERA 4UTFA 4W85A 4JKKA 2WMFA 1QI0A 1AQMA 4URIA 2WHJA 3ARUA 1VFOA 5I0DA 2VZOA 1CWYA 3WD3A 1IV8A 3VIPA 3PTMA 4H2CA 2YBUA 4GZJA 2ZIDA 2XPKA 3BGAA 2FHCA 3AYRA 3GZAA 4J7RA 3CO4A 4W89A 4F79A 4KWUA 2D20A 1E1FA 1V0KA 2FH8A 4UFHA 3ARSA 1FH7A 1W3HA 2VQUA 2E9BA 3L4WA 1J0KA 1J0JA 1R86A 1WAWA 1LL6A 1UZ1A 3VNZA 3A4XA 1RP9A 5BWFA 5ABGA 1E73M 3ALFA 5E0CA 3PZTA 5AC4A 1CGTA 3AIBA 1HXJA 1U2YA 3ZM8A 2BFGA 3VOCA 2CESA 1NWSA 3MV01 3BH4A 1ZBVA 3EMZA 1EA9C 2G8ZA 1B2YA 3ZR6A 4PTXA 2A3BA 4Z2JA 2VOTA 2A3AA 2ZXBA 4CN6A 4J3VA 5CGMA 2X09A 1HP5A 1R8LA 2YJQA 1WO2A 4HA1A 1YQ2A 1LWHA 5EFFA 4IUGA 3PZ9A 2J8FA 3N1AA 2WMIB 2ZX5A 4PTWA 2VZTA 1NOFA 2CKSA 3AZRA 1B3WA 4P8UA 3CPUA 1BQCA 1AVAA 4JL2A 2XUCA 7CGTA 1GHRA 1HF6A 3THDA 1B3YA 4W7VA 4MB4A 3RJYA 1UD5A 2XFRA 3ARTA 3WELA 2O9PA 1GZJA 2CKRA 1JGIA 4MADA 3VTRA 1CGVA 1TZ7A 1NH6A 4TVCA 1G9HA 3AMLA 4OOUA 3VDCA 3K4AA 3EYPA 1TG7A 1E6ZA 3UEQA 1VJZA 1TFVA 5CG0A 1E4LA 2ZUMA 2NT0A 2YBTA 3A47A 2G3NA 4P7NA 1GCYA 1UKSA 1ZB5A 3WENA 3EDJA 3BSGA 3MANA 1EHAA 1HN1A 2XIIA 2ZWZA 4AMCA 1OGGA 4ATDA 1E6NA 4AIUA 3W26A 2VQTA 4H04A 1E3XA 1IZJA 1LG1A 4CCEA 1KXTA 3WQ8A 2VCBA 1TMQA 2DPEA 3AZTA 2C8NA 2WMKA 3BSHA 3BLKA 4JAWA 2WVTA 5ABEA 1JFXA 2OYMA 2J79A 4L4PA 3SCNA 1XV8A 4Q7NA 2VL4A 3WD0A 2W63A 2UY2A 2O92A 2QPSA 1HKJA 5HDRA 5I77A 1VBRA 1FH8A 1PX3A 1XH0A 1FFRA 2QLYA 4CKQA 3NSXA 2WCGA 1NP2A 2WHLA 2D0HA 5A3HA 3VVGA 2D2OA 4R5EA 4NRSA 1E6QM 3WUBA 1AMYA 1C3FA 2CCRA 1JG9A 3AXHA 3D5HA 5A8MA 1H4PA 3UG5A 1Q6FA 3ARXA 2DQXA 1E72M 3D3AA 1OB0A 4U5IA 1RH9A 1GJWA 4QLLA 4DM1A 2J75A 4MTVA 2FHFA 1HKMA 2VX6A 1C8QA 3AFBA 1XSIA 1V0MA 3J7HA 2BXYA 1VFUA 1O7AA 3U5YA 2DT3A 2ESCA 1OGBA 2PWDA 2WPGA 3AIEA 2J7BA 1V6VA 4Z2KA 1GOKA 1ODZA 4D6GA 1CGUA 1J0YA 1US3A 4F66A 1W91A 1HVQA 3ARWA 2WZHA 1WE5A 1VF8A 2D24A 1E0VA 4GI9A 2PC8A 1MFVA 1ZS2A 3WNPA 1JYWA 4LPCA 2JE8A 1BG9A 2CITA 1XD0A 3BAXA 1CXIA 1UWIA 4IM4A 3VM7A 3ARRA 4WJXA 3W53A 2Y4SA 4AZIA 3WF3A 4E8CA 1VFMA 3CUIA 5AC5A 3RCNA 1WZKA 4MDPA 3KL0A 2W61A 4MNLA 4H7VA 2WMJA 3IAPA 2PI6A 4C7GA 5A1AA 1VEMA 3CUGA 5I78A 5I24A 5LA0A 1E4MM 3WNNA 1E6RA 4MAVA 2X8RA 1WP6A 1DWFM 1GQJA 4JFVA 3IJ8A 3VGFA 3RM9A 1EOKA 4JHZA 4X0VA 2JF6A 1MQQA 3AS2A 2BHYA 1VAHA 3APGA 2WC7A 3WD2A 4HZ8A 4LX4A 3F5KA 2O9RA 2J74A 2ZOXA 4UOZA 4MDOA 1CIUA 3WFZA 3ALGA 1UD3A 4JL1A 1HP4A 4U2YA 2MANA 3BAIA 3W29A 5DEZA 2VCAA 3BMVA 1EH9A 2JALA 2J7CA 5E70A 5M03A 4NZCA 3HJEA 3ZR5A 1UD4A 1G1YA 5FIPA 1GVIA 1CXKA 4DUVA 2AMGA 3N04A 3ARPA 3N11A 4GIAA 5CLTA 1E71M 1EDGA 3IJ7A 3T0BA 3T2QA 4GINA 3WL0A 3WH7A 1MXGA 2HVMA 5HNNA 2ZXQA 5F7UA 4UR9A 4EE9A 5A2AA 2WC4A 4CCDA 3QHOA 3VMOA 1Y7VA 4FMVA 1WZAA 3CZKA 3W4RA 1TUXA 4QDMA 1KGWA 1KCLA 2WSKA 4PCTA 1FHLA 3CMJA 2XFYA 1SMAA 2NT1A 5D8ZA 1KGUA 3VINA 1YHTA 2JEPA 3HMCA 1B1YA 1ODUA 2FGZA 2W92A 3GH7A 1UD2A 1V6XA 1C7SA 1MXDA 4TXEA 4X0NA 4NSBA 5BRPA 1WDSA 3MSGA 2YL5A 2WMGA 2X2YA 1DWJM 4AZCA 4AY1A 3GM8A 5A6SA 1WPCA 3FW6A 1VEPA 4V28A 5CPSA 1V0NA 4P8XA 1UUQA 5LA2A 3DYMA 2CXGA 2RGMA 3CIVA 5FL1A 3AHYA 3NIYA 2VJXA 1CXFA 1EQPA 3MO4A 4FLRA 1ECEA 2YIHA 2Z1SA 2CEQA 4K68A 3JUGA 1DEDA 3ZJKA 1E70M 1HIZA 2XVKA 4CN4A 1OD8A 2XG9A 1C7TA 5EBAA 5C71A 4OJYA 2CIPA 1KFWA 4JCLA 5BRQA 1OD0A 1HX0A 2QF8A 1ESWA 3VIOA 2DT2A 2A3CA 5KEZA 3AIVA 3WDRA 1JYNA 1R87A 2J77A 1NWTA 2WK2A 4AZCB 1W9UA 2NW0A 3PN8A 3W6MA 4LYQA 4HOXA 1CXLA 2EPNA 5A6KA 1K9DA 4QCFA 4CU7A 1Q6GA 2V38A 1QBAA 2PBGA 2E3ZA 2DH2A 1JAEA 3LMYA 4H8VA 5A8PA 4N0RA 1EDQA 3DECA 5D9NA 1JDAA 3NCOA 4P7OA 2YKKA 4P8VA 3GYCA 3W0KA 3PBGA 1BSIA 3NSMA 1OIMA 1NARA 5BXSA 3KE0A 3U7BA 4UQ9A 3WF2A 3CHEA 3HU7A 2VCCA 4B9ZA 1BLIA 3I3DA 3OA5A 2QV4A 1H5VA 2VUYA 3VX1A 5BXPA 4HMEA 4HA3A 2ZUNA 3L4YA 4UFIA 4E4PA 1LL7A 1ZBCA 1GHSA 2WMHA 1M53A 3RPMA 1KXHA 1V6YA 4Z2LA 3AIRA 4V27A 3VIKA 4LXFA 4Z2GA 4WSKA 2VR4A 4JHOA 3EDDA 4X9YA 1GPFA 4CVUA 1UR2A 1LJYA 3U57A 2D23A 4HZ7A 1UHVA 1QOXA 4DM2A 1GJUA 5JH8A 2PF0A 4M80A 1BFNA 2E9MA 1UKOA 3GXIA 4DWSC 2JF7A 3POCA 1WDPA 2VVSA 2OSWA 1E6PA 1CBGA 1EXPA 4CN1A 1WKYA 1XH2A 1ZBKA 3CUFA 4DUXA 5HOSA 4J3UA 2ZUWA 4MNKA 2XVLA 4S3KA 3RJXA 4AD3A 5M3WA 4GXPA 4XV0A 2HISA 5CSUA 5CLWA 1V02E 1VBUA 6CGTA 4PSPA 1W1PA 1DWAM 1B3VA 4DWSB 2E8YA 4PMQA 2V5CA 3GBDA 1V3IA 2PB1A 3AHXA 4D71A 4RE2A 3WUGA 1MW2A 4XZWA 1R7OA 2XHYA 3B8SA 4AWEA 1K6AA 4GI8A 1NWRA 3G6MA 1AQHA 3AMDA 3W28A 1QPKA 3VDBA 1W1TA 2E4TA 1UKTA 1QI5A 4PEEA 4AZ6A 2D1ZA 3BCFA 5EMYA 1GVYA 1M01A 3OGSA 3WNKA 1BYBA 2ZX8A 3WY1A 2WCAA 2F8QA 1XRVA 3QR3A 2WMIA 1LLOA 1GW1A 3AYSA 1LL4A 5HXMA 4Z2HA 3OLGA 1JF6A 4U3CA 3EMQA 2YA0A 3PZMA 1MVYA 5DT5A 1K9FA 4N42A 5A6MA 3LPOA 1W9BM 1KWKA 5CGTA 1UWSA 4QLKA 4RE4A 3TTSA 3N12A 1E56A 4B15A 5C8BB 5C70A 1MQPA 4LYRA 3CZ8A 3WQ5A 1E4IA 9CGTA 1MW3A 1CGWA 2Y8KA 3SCRA 5ABHA 2J7FA 5I79A 2RGLA 4UOJA 1HKIA 1M7XA 3O2LA 1K9TA 2WCSA 2W91A 2GK1A 2W62A 2V5DA 2YDSA 1JXKA 2XIBA 5E6YA 1VRXA 4HOZA 3NDZA 4ZE4A 2AAAA 1JZ3A 2G3IA 2BV9A 2OSXA 1IZKA 4CD5A 3WBEA 4WF7A 4PSRA 5DFAA 3RM8A 1WB0A 3VIIA 3W37A 1J11A 1WNOA 4ZXOA 1VENA 3ZO9A 1H41A 1W3KA 4GO9A 1OGSA 3VD7A 3CHFA 3VIMA 1IT0A 4TVDA 2VRKA 3CBWA 4CD4A 4RL3A 3G6LA 2GK1B 4PUEA 3MUAA 3WEZA 1WZMA 4ML4A 1JD9A 1V08A 2OWWA 4PMYA 4AD2A 4MJ2A 1ZL1A 1WDRA 4BQ2A 3W25A 1F4HA 3WNLA 3GNPA 3SUTA 2VR5A 4U31A 4HU0A 1OT1A 2W5FA 2WWDA 4ACYA 4D6EA 3F5LA 2TAAA 3L4UA 2FHBA 1HL8A 4DUWA 4PTMA 2YL8A 1UWRA 5D9PA 2YA2A 3ZT6A 3CZJA 3WIJA 4QCEA 4AZGA 1JYVA 2WANA 5I3DA 2DDXA 3PZNA 2BVDA 4UFLA 3A4WA 3L2MA 2VNCA 3AISA 4WLCA 3WH9A 4QLJA 4ZE5A 2Q8XA 3OG2A 4MAZA 5E09A 2GFTA 1LG2A 3WH6A 1DWHM 5BXRA 5AYIA 3W82A 3MKKA 4QP0A 1VB9A 4CVWA 4B16A 1JFHA 1UH2A 2DEPA 1CZ1A 3GNRA 4AISA 1W1YA 3VGGA 2XTKA 4IISA 3SCVA 3VDAA 1CDGA 3VGDA 3T0DA 3VKKA 5JBFA 1XD1A 5I6SA 4PRWA 4FLSA 3PTQA 3M07A 4F9JA 3ZT7A 2CPUA 1GOQA 4U5KA 5DO8A 4PN2A 1H0IA 2ZICA 5AY7A 1N82A 1UWTA 1D7FA 4FLOA 1SMDA 1MFUA 4ACZB 1ITXA 4NRRA 4OIFA 1PIFA 3SCQA 4WKHA 3IANA 3AMKA 2FDMA 6TAAA 1E5JA 1HVXA 1QVBA 1GQKA 3UCQA 4TVUA 3UR8A 2WWCA 4PTVA 1V3JA 1WCGA 2XGBA 5JBEA 1O6IA 1C92A 1Q6DA 2ZXDA 2YL9A 3W24A 3K8MA 4CD7A 4HU8A 1FHDA 2J62A 4OKDA 4MB5A 5A2CA 2C0HA 3ZOAA 1H3GA 2VMFA 2OYKA 1PIGA 1BF2A 3O6AA 3ZSSA 4V2XA 4UZSA 5AYBA 3N15A 4D6FA 3BAYA 1RD6A 1FP9A 5GNYA 3WMCA 1W3LA 1J0HA 3MUZ1 4PMRA 3TP4A 1PZ3A 4W5ZA 4BS0A 1HJUA 3M7SA 5GNZA 3QOKA 2J78A 3T08A 3KEHA 4S3JA 2XM2A 3L2LA 1E6SM 5EFDA 2PWGA 2V3EA 1KXVA 1QNPA 1CXHA 3CGTA 2OSYA 2JIEA 3POHA 1CTNA 3N18A 2FGLA 2XGIA 3A4AA 3AHTA 5A95A 3VX0A 4JKMA 4BQ5A 2WKGA 1GOMA 3AOFA 3KWXA 2CNCA 3CH9A 1E1EA 5D9MA 1GOOA 4UFJA 1NM9A 1B30A 2DH3A 1BGGA 1UD8A 2PWHA 3NUKA 4IPLA 3WEMA 1PZ2A 1Z32X 2WHKA 3VNYA 3CUJA 3BAKA 5FL0A 3WSUA 4AD4A 1EDTA 3M46A 3HN3A 2W67A 1I1WA 3GH5A 3OLEA 4OZOA 4WSJA 3WKZA 1V3HA 1TE1A 4PCSA 4P8WA 4BF7A 1PPIA 2WNWA 1KWGA 2CETA 1V3LA 2C7FA 2V3DA 1KGXA 3F4VA 1QHOA 3WNOA 3N9KA 1V03A 4GI6A 2JIWA 5ECUA 4GKLA 1E6XM 3PZQA 2ZE0A 1V6UA 2X0YA 2CBUA 3ZSTA 4D6CA 3CTTA 3BAWA 1J9YA 4GQQA 7TAAA 2F61A 3AHZA 4PMOA 2BNJA 1QHZA 2XYLA 2ZXAA 1SR0A 3BAJA 4W8LA 1HNYA 1W9VA 2DSVA 3PZOA 2UWFA 1PJ9A 3T0AA 3K4DA 4EKJA 5BCAA 1XSJA 1PX8A 3NDYA 4M1RA 3VPLA 5GQBA 3VGEA 4ZFMA 2BY0A 4AD0A 1QNSA 3K8LA 1QBBA 1BVZA 3U7VA 2EPKX 1KBKA 4TX8A 5FOOA 3T2PA 4ZXLA 3VMNA 3BMWA 3ARQA 1TVPA 2WW5A 1TVNA 1A3HA 4U3AA 4AD1A 3WUFA 4CD8A 1H49A 2D3LA 3MUY1 4UNIA 3NJ3A 2WB5A 1RP8A 5E6ZA 1OCQA 2NSXA 3S2CA 3B9EA 4W93A 2WLYA 5HBFA 2OLHA 4MJ4A 1ITCA 3I3BA 2J25A 3SCWA 1SFSA 4IPNB 1B90A 1JI1A 2FH6A 2XVGA 5E0FA 1JNDA 1GUVA 2W4XA 2AOSA 4YHGA 4PUDA 5HPCA 3OGRA 5LYRA 3WH8A 5A94A 4JFTA 2EPOA 3CHDA 1W9XA 1XH1A 3GXDA 3EDKA 1CYGA 3FHQA 3L4ZA 1E9LA 3WBAA 5CSYA 4MB3A 3WDIA 4OUEA 4M24A 1OT2A 3WL1A 2GUYA 4KGLA 5M17A 4PMNA 5I23A 2GDVA 2XJ7A 1D2KA 3TA9A 3VDHA 3VUPA 1NWUA 1Q6CA 2VX7A 3RM4A 1J18A 4YPJA 2PWEA 1DHKA 4XUYA 5A8OA 1QW8A 2F2HA 4PMZA 5A6LA 3BLPX 2EEXA 2G41A 1JDCA 4JCMA 2QMKA 3WQ6A 1UWUA 2A3EA 3N13A 3EBVA 5D4YA 3W27A 3LPGA 4ATWA 2GJPA 2ZX9A 4DWSA 1NOUA 1KR0A 2WBGA 3VGBA 2VI0A 4UQBA 3MSDA 1JZ6A 4AW7A 3ZQ9A 4WKFA 1GNXA 3NYDA 1XYFA 1MYRA 4AZHA 1JZ7A 4UQEA 4TOQA 1HKKA 3WQ4A 3AI0A 1XYZA 1XSKA 1XHGA 4AIOA 4YHEA 1EQCA 4A3HA 1V02A 3TTQA 1W2VA 3AMGA 1UYQA 3VMPA 2Y8VA 2VVNA 3AMCA 2OYLA 4WIWA 2VX5A 3GH4A 5CQ1A 1UH4A 4XZBA 4YN5A 2GJXB 4M56A 1G94A 5IXEA 2Y2WA 1PAMA 1FP8A 5A6JA 4JFSA 3WMBA 1H11A 1UWQA 2DIJA 4QAWA 3O9NA 1SYTA 2YL6A 4HP5A 4FF5A 3TONA 4W88A 2PBOA 1FOBA 2CHOA 3SCUA 3B9DA 1TA3A 1C93A 3ZJ7A 2E0PA 5JIPA 3AJ7A 1EIBA 2E40A 3A6OA 3UETA 4EAMA 4NF7A 4W5UA 1BYCA 4M82A 4D6JA 2VURA 1E15A 3K46A 2ZX7A 3UG3A 1ISWA 4EANA 4J3WA 4TUFA 4JIEA 1L0PA 2BY1A 2D3NA 4W7UA 5E9AA 4BA0A 5BROA 5A6AA 4GO8A 3RILA 5IHSA 3PTKA 3VILA 2EJ1A 1GQIA 4J3SA 2PWFA 3VD4A 2EPLX 3WF1A 1UR4A 3SEPA 5FKYA 1OSEA 2UY4A 5IHRA 4LQ1A 2VC9A 4J28A 2WBKA 4U2ZA 2O9TA 3M6DA 1NOWA 2X0HA 1TA3B 4HTYA 3WMSA 1QI2A 1E5NA 5IFPA 1G5AA 4JKLA 1BVNP 1HJSA 4UFKA 2EQDA 1V6WA 1A47A 3DYOA 1EGZA 2DSKA 2BVYA 3W38A 1M03A 1PEZA 2Y5EA 2XWEA 3QGVA 3MU7A 1UG6A 5CXPA 2O9OA 1E3ZA 2QMJA 1TR1A 4GPNA 1FFQA 3LPFA 2BHZA 4TTGA 2V3FA 5LA1A 2CBVA 3GTNA 4PMUA 1J12A 1ZJAA 2JEQA 5A2BA 3OLDA 3E1F1 4A3YA 3RIKA 1ZU8A 3K1DA 2ZWYA 5CZKA 3WNMA 2WC3A 3GDBA 1P6WA 1DWIM 1QNRA 2UY5A 6A3HA 3L4XA 1ISVA 1JF5A 1VFFA 2D0GA 4PMXA 4M81A 3DYPA 1HT6A 2EPMX 2BHUA 2QHAA 2QPUA 3WFLA 4AD5A 4GQRA 4TX6A 4Y7EA 1BAGA 3W6LA 1KB3A 1C91A 1NP0A 1UOKA 5ABFA 3ARYA 4J3XA 1PBGA 3GXMA 4AZ5A 3KL3A 5D8WA 1W2PA 4Z2IA 3AXXA 3SUWA 4D6DA 4HA4A 2CBJA 3AXIA 1K9EA 1I1XA 2ZUSA 4D6HA 3MMWA 1CLVA 2GSJA 1BPLB 2BXZA 4ZENA 3VIHA 3CHCA 1J01A 3WH5A 4KRUA 4KRTA 1B3XA 3SUSA 4KH2A 3RO8A 1UQZA 3OGVA 1XCXA 5GPRA 3WDQA 3T09A 3GBEA 1JAKA 1UZ4A 2ZUTA 4W8AA 3FAXA 4E8DA 3TOPA 1X1NA 2Y24A 2YLLA 3PZGA 2ZUUA 2WVSA 3SCTA 3QHMA 3I3EA 3SUUA 5ABFB 1JZ4A 3SCSA 1HJQA 4JFUA 5A6BA 5HPOA 1DWGM 3WQVA 4OBRA 3SCOA 1GOIA 2BVTA 3PZVA 4CU8A 1AQ0A 1M04A 1OBAA 3TTOA 2BY2A 2X1IA 1W1VA 2WXDM 4MB1A 1JZ8A 1H1NA 1WZLA 4D6IA 1UR8A 1U33A 4D1JA 4U33A 2DIEA 2GVYA 4RE3A 5DMYA 1E0WA 4AEFA 1H09A 4HZ6A 1UH3A 1LF1A 1FA2A 4HOWA 4ACZA 4FK9A 3T2OA 4UQAA 4CGTA 1CPUA 3AQUA 3CZLA 1HJWA 3DC0A 5JUVA 2W66A 2VZUA 1CXEA 4ATLA 1EO5A 1KXQA 4UZUA 4B3KA 3U5UA 5CPQA 1X6LA 1E55A 3VD5A 1UKQA 5DT7A 2GDUA 2EXOA 1Q6EA 4JZ5A 5GNXA 2Z1KA 1JD7A 3QOMA 2D0FA 1UA7A 2J47A 4B9YA 3NSNA 3OBAA 3VGHA 1BTCA 2CBIA 1G01A 3ZJ8A 1HL9A 4L4OA 3WDJA 3FNDA 3WF0A 3MV11 2DGAA 3AIQA 5CPTA 2X05A 3CUHA 3PZUA 4J27A 3OLIA 1E4NA 3DHUA 2WLZA 4GZIA 1E43A 4KMQA 1HJVA 1C8XA 2VZVA 2XVNA 1CGYA 4M29A 3II1A 4DWSD 1UR1A 4MPKA 1CLXA 1R85A 4P7QA 4AEEA 2GJRA 1JL8A 1QW9A 4AYSA 3B9AA 3SIMA 3CMGA 4KGJA 2D22A 1GONA 3ARVA 1ZJBA 1JI2A 1OM0A 1BHGA 1JDDA 2ZX6A 4R27A 4BZYA 1C8YA 1H2JA 4P7LA 1KR1A 3RDKA 3VD3A 5KZ6A 4MNMA 3PZIA 4XB3A 1MW1A 2IXUA 3CZEA 1OINA 4B3LA 1CENA 1GORA 3BCDA 4D1IA 2J8GA 1QNOA 4H8HA 3UESA 3A3HA 4A4AA 3TTYA 4C7DA 1B3ZA 5IDIA 2VX4A 2DSZA 3WD4A 2JFEX 2WVUA 1W9PA 3WF4A 5CJ5A 2G4FA 4AZ7A 4FLQA 4UFMA 4EK7A 1JXJA 3MUIA 1UA3A 2XSAA 3GXFA 1S46A 4HPGA 2V3GA 4XX6A 1KQZA 1NQ6A 1WDQA 4CUCA 2WAGA 1JYXA 7A3HA 1GOWA 3K8KA 3WQWA 1QNQA 5TD4A 1MQRA 1ZBWA 3L4TA 1XC6A 2VRQA 5BXTA 1LWJA 2B31A 3VO0A 2BY3A 3FXYA 4WKAA 4W7WA 2IXVA 1TCMA 1V3KA 1H0GA 1UD6A 3RMEA 3FAWA 1QHPA 3FY1A 1W32A 1ISXA 5JIWA 2G3MA 4HPHA 5JBDA 3WD1A 3OB8A 4PBGA 3BC9A 3IAQA 2A3HA 2CHNA 1CNVA 2YOCA 4D72A 1J0IA 2YLAA 2XSBA 5BYWA 3VU2A 4QFUA 1DP0A 4H41A 1E0XA 3AS3A 3WDPP 1Q4NX 2BS9A 3ARZA 1EO7A 5A8NA 2XFFA 1JZ2A 1MWOA 1ISZA 2DSWA 1G0CA 2ZUVA 3CLWA 4BQ3A 4JFWA 2J4GA 3AIUA 8CGTA 4J3TA 3FN9A 3AROA 3ZIZA 2UY3A 1B0IA 3AIWA 2OWXA 2EBNA 5IFTA 1US2A 1J0ZA 1KQYA 2DT1A 4PYSA 1F4AA 4CU6A 5D9OA 3IK2A 2OWCA 4GZEA 3ZJ6A 2YA1A 1XGZA 2J7EA 1PX4A 2J7GA 1VEOA 1UR0A 4M8UA 3GNOA 2WZEA 3W81A 4W87A 4W8BA 1W3JA 3MMDA 3IJ9A 3SCPA 1UQYA 4AZBA 1CECA 4Q22A 3WEOA 1R7AA 1JNEA 1VIWA 4CD6A 5FD0A 5A69A 1LQ0A 3AICA 4UQCA 4UOQA 1U30A 2E9LA 4PMVA 4BQ4A 3CZGA 1BGAA 5I5RA 4HMDA 2VTFA 3VIJA 3VD9A 4BCEA 4TTUA 2WVVA 3AS1A 3EDEA 3DHPA 3OZOA 3OZPA 3KZSA 3VM5A 4UCFA 1MW0A 3WUEA 1UKPA 3FHAA 4H8UA 1W9DM 4LGXA 5M5DA 3WN6A
chains in the Genus database with same CATH superfamily
3SURA 1C90A 1YBQA 4DXVA 3O5MA 3VNIA 1L8NA 1F8MA 4H9UA 3RPDA 3UR7A 4OFCA 5EB8A 4F0MA 4OUIA 4HHHA 4BF8A 3G0SA 4E3TA 3FIGA 1J79A 4ICMA 3H8AA 1XLGA 2E6AA 1GQLA 4MMWA 3VIGA 3SJNA 1I8JA 3KTSA 1EHNA 5C2XA 2IUZA 1EOMA 2WVVB 5LIYX 2P3ZA 4AC7C 1AL7A 3H12A 1DTUA 3UG4A 2VOMA 4LS1A 1E9YB 1IWPA 4AIEA 4C1NB 1YBQB 1KRAC 1BYDA 3SQSA 3TJIA 2NX3A 3LXAA 1I75A 4UQDA 3IGSA 1JCHB 1X6NA 3W1TA 5A8QA 4HJWA 3SUVA 5ENLA 2ZQVA 5LSMA 1D3HA 4HBOA 1KCKA 2XVPA 1XIHA 2J7DA 3UWZA 3KBNA 3CAWA 1XRTA 1XCWA 4O4WA 1HJXA 1XQKA 4E2OA 4OOZA 3T4CA 3LCIA 4YTQA 2CYGA 4DUOA 1E40A 3E9AA 3QF0A 3P81A 3R13A 1EYEA 4LT9A 3UGVA 2PUZA 3NEHA 1JZ5A 2EAWA 1A0EA 1A80A 3PHAA 1QTWA 3C8NA 4HNVA 4JKKA 1FKGA 4URIA 4S2BA 3W1PA 2WZMA 3PAJA 1CWYA 4A8RA 3WD3A 1IV8A 1PO9A 1TJ0A 3PTMA 3SECA 4ZFCA 3U4AA 3GPKA 4GZJA 2P8BA 5I3GA 2FHCA 1CB7B 4J7RA 4HSHA 3CO4A 1TPDA 1LT8A 4DQWA 3LCFA 2KGJA 1M9HA 4DYJA 3HFTA 4FB7A 4DJFC 2VQUA 2X41A 3D3FA 2E9BA 4NVTA 1R86A 3VNZA 3MDWA 3A4XA 3UXAA 5BWFA 1E73M 3IGXA 3ALFA 3PSVA 3EIPA 4OE7A 4U4MA 3C2YA 4NP7A 1DXFA 4AHOA 1XJBA 3VOCA 3NO1A 2A3BA 1IEXA 2VOTA 2TODA 4I9JA 4AIBA 4CN6A 2QIIA 3KWSA 4J3VA 4FXSA 2Z6IA 1R8LA 2YJQA 5I03A 3KLLA 1QATA 2GOUA 4R7WA 3KOXA 1WO2A 4HA1A 2OT0A 3R11A 4NJHA 1TWSA 4ZMGA 4NT0A 4MY1A 3V7PA 3PZ9A 3N1AA 3Q37A 4NX0A 2VZTA 5LGZA 3GDKA 1JCMP 4QIUA 4O1BA 1PXGA 3M5XA 4P8UA 3BVJA 1AVAA 3RMJA 3UZZA 5E1QA 1DJHA 2PDWA 1B3YA 4MSPA 4FR6A 4MB4A 1XYMA 2BWGA 1FKDA 3ARTA 4O17A 4C65A 3DI0A 4JTGA 1FKKA 1QPRA 1F40A 4LNCA 5LNVA 3K1GA 3VNJA 3N2TA 1NH6A 3NA8A 4S3BA 1LOQA 1NJJA 3K4AA 3GE7A 3EYPA 1E6ZA 3EB2A 4H9VA 3UEQA 1W8GA 2QUTA 5CG0A 3AXKA 4HNTA 2ZUMA 3NG3A 4OV4A 3F4WA 3UQNA 1TPVA 1GCYA 2ISSA 3WQPA 4IMCA 3LM3A 2HVNA 4N7QA 4MLRA 4AHPA 1VFHA 1HN1A 5AFDA 2XIIA 1QO5A 4DO4A 2A85A 1OGGA 3M1ZA 1W5QA 1E3XA 4Z0JA 4O1CA 2DZXA 5DBUA 3WQ8A 2VCBA 1RY0A 5CZTA 5CPMA 2DPEA 3BSMA 3CPRA 3ITLA 2VCDA 1JFXA 2OYMA 1XM3A 5DRCA 1RCXB 4GGHA 1XV8A 2PLMA 2VFFA 3LHZA 2QKFA 4ORMA 2FKPA 3UY7A 4KFOA 2O92A 2QPSA 5HDRA 5I77A 3KP1A 3KBMA 1XH0A 4GVHA 3HTWA 1SJBA 2ISWA 2OT1A 3R4IA 4R9XA 2YFOA 1T99A 1GEHA 5LHEA 5G2WA 4PL2A 4NRSA 1C3FA 4PBEA 3AXHA 5A8MA 1H4PA 2PE4A 3UG5A 4ASTA 3QMSA 3UG8A 2DQXA 2WJDA 4E4FA 1E72M 3D3AA 3GYEA 1GJWA 3WLLA 4DM1A 5D30A 1WV2A 1C9HA 2ZRWA 1HKMA 3ID7A 3ITOA 3UJ2A 3EWZA 4LAMA 3EWXA 3J7HA 4CNUA 2BXYA 1O7AA 1DJIA 3OPSA 4Z1YA 2NUWA 3QYSA 1PB0A 4GY7A 2WPGA 2J7BA 1AD1A 4LCRA 3O07A 2E5BA 4HNOA 2G95A 1S38A 3H6OA 4R7JA 3USZA 3UI5A 3IJIA 2KX9A 1ODZA 4KS0A 3TJLA 2A5HA 1US3A 3H2NA 1S1RA 4QM1A 5CKSA 2WZHA 3W88A 1VF8A 3LHTA 2D24A 3N6QA 1HXVA 4GIRA 2CITA 1RK6A 3BAXA 3RHGA 4WJXA 3GDTA 4MDPA 1J4IA 3IAPA 5J5RA 1CCWB 4M0XA 1HFBA 1VEMA 4TW8A 4PC8A 2G37A 3GDLA 3KP0A 5C7VA 1E4MM 3HG2A 3WNNA 3CIWA 1T11A 2NQHA 3JZEA 1WP6A 5BRBA 5EGRA 4L9XA 3RM9A 2OOFA 4JHZA 5U4NA 3WLRA 4E5TA 2VC5A 1GYMA 2JF6A 5I7GA 1RQHA 4OECA 4RDVA 4ZBCA 1VAHA 1F61A 3DESA 1OEPA 4IXXA 3ELFA 4FP1A 3DGBA 2OVLA 3WD2A 4HZ8A 4LX4A 3B0PA 3F5KA 1U5HA 5PTDA 3A21A 5MHBA 4IP4A 4MDOA 1CIUA 1TPH1 3R94A 1UD3A 4JL1A 4FIRA 4K38A 1HP4A 1YADA 1MZRA 2MANA 3BAIA 3W29A 2OEKA 2HE5A 3I7RA 1KLYA 2JALA 2MUCA 4UTMA 2YW4A 5FAJA 3HJEA 5D38A 3ZR5A 4UIOA 4GYPC 1G1YA 1BSLA 1FWRA 1CXKA 4DUVA 2AMGA 5I3KA 3N04A 1RXOB 3N11A 4GA8A 3CAKA 3W07A 3T2QA 1XG3A 3HGRA 4OV9A 4H6EA 2GUUA 3FKKA 2PDIA 4WHBA 4U84A 3QTPA 2ZXQA 3RX3A 3VMOA 1Y7VA 3CZKA 4QDMA 1KCLA 4PCTA 3VKBA 1ELSA 4UNKA 4JTHA 3BLIA 5EMUA 3KVLA 3C2OA 4WY0A 3O5DA 4ZB0A 3I7SA 3E6EA 1U1UA 1YHTA 3HMCA 2C16A 3QH2A 1B1YA 3GH7A 2PTXA 1UD2A 3N73A 4FNQA 5CH9A 3FYOA 3TN5A 3MSGA 4IIGA 2X2YA 1KD0A 4DNMA 5A6SA 1WPCA 4DO6A 1NAL1 1NDZA 3GU9A 1OYBA 3S4TA 2FPVA 3AYTA 1QU4A 5C9XA 2CXGA 3CIVA 5FL1A 3AHYA 3NIYA 2JGQA 4BR1A 2YIHA 5D2WA 1W31A 1DEDA 4EAYA 2AGTA 4GIEA 3ZJKA 2R24A 1DJZA 4ES4A 3UW6A 2XG9A 2PWVA 4JTEA 1A7XA 2HBXA 4WY0B 3W1AA 1X38A 5C71A 4X60A 1QPQA 2CIPA 1KFWA 1ZPTA 4RW3A 1FWFC 3OEXA 2FFCA 3VIOA 1OFBA 2CLFA 5H8PA 1TELA 4MIMA 1PTAA 2FPTA 1NWTA 3H26A 2NW0A 2CLKA 3BQ6A 4W9TA 4HOXA 1A5AA 1C9DA 1CXLA 4XAFA 2LJ4A 1Q6GA 2DG3A 3CYVA 4AB4A 1DPMA 1HW6A 4KFPA 3UZWA 2V69A 5A8PA 4N0RA 3BQ5A 3W1MA 4S3GA 3DECA 1JDAA 4FS9A 2YKKA 3W0KA 1EFZA 1BSIA 3NSMA 3UR2A 2VWSA 3S5OA 3LRLA 5BXSA 4UQ9A 4O15A 5BZAA 2QJJA 3QBUA 2QV4A 2G50A 1JNTA 1UP0A 4HA3A 3WCZA 2ZUNA 1GW9A 1LL7A 1AUSL 1Q3NA 3OOBA 2CLEA 4JS3A 5CCZA 1M53A 3W7IA 3G1DA 1V6YA 4Z2LA 3A9BA 5IDZA 4V27A 4LXFA 4WSKA 3TFCA 2V2HA 4L61A 3W7JA 3W1QA 4JQ4A 4LTSA 4CVUA 3U57A 3PFMA 1T6MA 3TMQA 3M0JA 1S2AA 1P0EA 1VD6A 4DM2A 3KOWA 5TQLA 5JH8A 1IWBA 3NZ1A 5DCBA 2B7OA 1FWEC 3POCA 1LZOA 3UYCA 2VVSA 1CBGA 4Q8PA 3CV2A 4NG3A 4CN1A 1WKYA 3G2GA 3S5ZA 1ZBKA 5AC6A 4B5SA 5HOSA 4LAUA 4J3UA 4MNKA 4AD3A 1VBUA 4IICA 2IMRA 1GG0A 2G0WA 4JDBA 3CAVA 4D71A 1MW2A 4DT4A 4XZWA 4D8ZA 4Q6JA 1SO5A 1RD5A 4A2RA 3DU0A 1GKPA 4JTCA 1EUNA 3N14A 5FF7A 3AMDA 3VDBA 4G1KA 1UKTA 1QI5A 4PEEA 2YB1A 2XP8A 1WKDA 4RXFA 1X8FA 1BYBA 3WY1A 2IQ0A 3PNZA 1POJA 2IS7A 3MB9A 3GX9A 3BZGA 1KV8A 2WNNA 5HXMA 4AQLA 4KRZA 2CZFA 4U3CA 4KEUA 5BOFA 1JUEA 1S2TA 2YA0A 3PZMA 3EX2A 4IZGA 1OABA 1Q4WA 5A6MA 1KFEA 5CGTA 1UWSA 4QLKA 4LUSA 3CIXA 3TTSA 5AHLA 4ZVJA 1AW5A 3CZ8A 4NQ1A 3ITYA 5ABHA 2TYSA 3V4BA 5I79A 3NL2A 4UOJA 4H9ZA 1XR2A 2FZDA 4BI7A 1B3OA 2GK1A 1MUCA 2V5DA 2YDSA 3E0WA 3SM0A 5JH2A 1UB3A 4BF5A 3MSRA 4LANA 2FLIA 5T8GA 4KPLA 2QIWA 4ZE4A 2KR7A 1XI3A 2AAAA 1JZ3A 3W2NA 2OSXA 3A12A 4TNSA 1NY1A 3WBEA 4AWTA 4LOCA 1I60A 1P0DA 2ADAA 3B04A 3VI2A 5GPGA 3W37A 1PKYA 1RBOB 3UZXA 1IT7A 4WX2A 1RZMA 1GTEA 3QLLA 5HATA 2OGJA 3TAOA 2DZPA 4GO9A 3VD7A 1QUMA 3VIMA 1IT0A 2VRKA 4RL3A 3WH0A 4WUIA 2GK1B 2IQDA 3LXBA 2ZR4A 1JD9A 4AMAA 1V08A 3HQ1A 3E5PA 2OWWA 1SZEA 3TAKA 3MZ2A 1JCNA 1YE4A 1WXZA 4K2SA 2GQ3A 4G1NA 4HU0A 4TR9A 1DIKA 4INFA 3RRAA 4D6EA 4RLIA 1YMYA 3L4UA 3CWNA 1KBLA 1DJWA 3SZ8A 3WMLA 4ENLA 3BUVA 1UWRA 3O5LA 3ZT6A 2X42A 4L65A 3GXPA 3N2MA 1L1PA 2CC0A 3PUOA 1D8CA 3H2FA 4M51A 3QY7A 4UFLA 2GUBA 1OF8A 3A4JA 2RUQA 4HZMA 4WLCA 4QLJA 1X7IA 4GRSA 4K37A 5E09A 3WH6A 3MBFA 1DWHM 5BXRA 3KZPA 1NF7A 1VB9A 4Q4MA 3XISA 4XVDA 2NX1A 1IEIA 4GQGA 1RCQA 4HK5A 3VGGA 2XTKA 3SCVA 2RHGA 4LAZA 4N9CA 1I6NA 1EX5A 4WD0A 3T0DA 3MPGA 4ZSTA 5JBFA 3IJ6A 2CW6A 4RKAA 4YNGA 4HJFA 1L6YA 1FKXA 3LMZA 3QW4B 4F9JA 3K4WA 1V79A 4PN2A 2CWXA 1UWTA 5CSRA 4FLOA 2F2DA 3U4FA 3P5ZA 3GDMA 3TVAA 4Q4RA 4ACZB 4NRRA 1CW2A 4WKHA 2PLCA 1D6OA 4ODKA 1XLJA 1HL2A 4XAYA 1HVXA 1DL3A 3E02A 3OODA 2WWCA 1V3JA 1WCGA 4KWSA 3DFQA 3MCNA 4CD7A 1FHDA 3GC5A 4XKYA 4GIYA 2Z0IA 4MB5A 1RAKA 4MJZA 2DW7A 4X2RA 2OYKA 4Q8NA 1AMKA 1PIGA 2H9AA 3W7LA 3ZSSA 2NXGA 1MDRA 3GHTA 1NVMA 1QOPA 2DZAA 4HT3A 1G4SA 3O5KA 3SB0A 4RNHA 4Y6GA 5M2FX 3ZWSA 4W5ZA 3M7SA 1RY8A 1FWWA 2J78A 2PRMA 3KEHA 1U22A 5HQMA 1OG0A 2C3ZA 3L2LA 5EFDA 1F74A 1O95A 3CNYA 3EWDA 2D2HA 3VNLA 2V3EA 1KXVA 1QNPA 1OYCA 2ANUA 3DHDA 2JIEA 5C7HA 4XKYB 2XGIA 3MP3A 4QTGA 5A95A 4X3ZA 1WDDA 1R3YA 2ATMA 5FJJA 2H9AB 3KOFA 2CNCA 1EGMA 3LBMA 3M0KA 2N87A 4JNMA 2C79A 1GOOA 4UFJA 3W7QA 2DH3A 4Y8EA 1E44A 3WEMA 3NUKA 4QHRA 3S5NA 4XWUA 5EYWA 2RSEA 3WFAA 4MWAE 3GHRA 3WSUA 4R85A 3M46A 3HN3A 2DQWA 4WDXA 3OLEA 1W3NA 4WSJA 4GLEA 4CNNA 1AODA 1JGMA 4Z17A 4BF7A 1KCZA 3TQPA 3CL7A 3F4VA 2DVXA 3M43A 5DBTA 1V03A 3VZYA 4RZ5A 3PPHA 1A5SA 2JIWA 5ECUA 4AX6A 2ZE0A 3EXRA 2X0YA 2CBUA 1T5AA 4DAFA 1MXSA 1OFOA 4HSNA 5D05A 4UMAA 2Z1XA 1CX9A 4PMOA 4N4PA 3C0LA 1YPFA 3NQBA 2XPBA 4IIHA 3KCOA 1UUMA 3PBUA 5FF2A 1HZYA 3T42A 1V7YA 2UWFA 1EC9A 1PJ9A 1NDVA 3K4DA 4QT3A 3N2OA 3SR7A 3QPEA 1A3WA 3W7GA 3NQGA 1L9WA 1TRDA 2HQAA 1QNSA 3K8LA 4DI9A 3IPWA 1QBBA 3NL5A 4PUKA 3ZWTA 3U7VA 2PTDA 3PC0A 4Q8WA 4TX8A 3DX5A 3NQ7A 2PDBA 3ARQA 2C1GA 4P61A 4O1AA 1TVPA 1TVNA 1A3HA 2WZTA 4AD1A 1SZRA 2DV0A 4BWLA 1Z8AA 3MUY1 4J35A 5E6ZA 3BZJA 1OCQA 1XKYA 5AOUA 3GO2A 2H3BA 4W93A 2WLYA 2DJLA 3W83A 1ITCA 1DVJA 4PCPA 4Q6XA 1JI1A 4DZ3A 1S3TC 2FH6A 2XVGA 1GUVA 2AOSA 3WK1A 5HPCA 1K8ZA 4JXCA 3HG3A 4JFTA 4LEQA 2EPOA 2FZ9A 1GVSA 4IQLA 3RPTA 1UBPC 3UU0A 3HFYA 5HKGA 3S42A 1QNVA 3UF9A 4NNBA 3EDKA 3L4ZA 3ISIX 3V1PA 5B80A 3BURA 1VHNA 2ZA3A 5DY2A 1MI3A 4OUEA 3E2RA 2Z1VA 1L6SA 2Q02A 4E2BA 1OT2A 1W8SA 2FYMA 3UT0A 1DHPA 2Y89A 2XJ7A 3DFTA 4UCGA 4EP8C 4L5ZA 1NWUA 2R1PA 4JQ1A 2VX7A 4DRMA 5JQ9A 5A8OA 1G67A 5A6LA 3H54A 2E1WA 2QUMA 4LUYA 3C0SA 3GG7A 4JCMA 3V0SA 1UWUA 3FOKA 3N13A 5K3VA 2O7SA 3EBVA 2OMAA 2FVKA 2YCIX 2WBGA 4O14A 3T40A 3PRBA 3TC7A 3NZPA 2VEGA 3QPYA 4HU4A 1JZ6A 4JYEA 4WKFA 3IV3A 4FX8A 4AZHA 1JZ7A 3N19B 4TOQA 1HKKA 3WQ4A 2A21A 2ZKMX 4YHEA 1EQCA 5EPDA 1V02A 4ZTXA 1TTPA 1UYQA 3VMPA 1JVWA 3AMCA 2VEIA 4GKTA 3R8HA 2Y78A 4ZCWA 4WIWA 2VX5A 3P67A 1DJQA 3BOLA 1KM0A 1A5KC 1UH4A 1BF6A 4NZ5A 3CB3A 2X1TA 4M56A 2INFA 1P1MA 2Y1HA 4BY3A 1PAMA 1FP8A 2ALDA 4X2PA 3WMBA 1OC6A 1TB3A 3M47A 5BW6A 1VHCA 4OT7A 1Y5WA 3TONA 4W88A 3B9DA 1C93A 3ZJ7A 5C2CA 5LGXA 5C9WA 2PRLA 4DRPA 3C6CA 1EIBA 3G22A 4JX6A 5F2MA 4FXFA 2FTYA 3GC2A 1BYCA 3K46A 1XFCA 3UNDA 1F3EA 3UZYA 1H1ZA 1R30A 1OFEA 5BROA 4YYCA 5IHSA 4NNRA 3PTKA 3VILA 3DFPA 3MWCA 2XP9A 2VEPA 1UR4A 3SEPA 5FKYA 3UZ5A 2UY4A 2ZR6A 2XINA 5IHRA 4LQ1A 3KS6A 3CM4A 2O9TA 1A5UA 3O1NA 2CZDA 3DBNA 1NOWA 4HTYA 2QCLA 1IE7C 1WA3A 5HT1A 4DO5A 5I06A 4JKLA 2Q5AA 2EQDA 3CXOA 3LEPA 3GSMA 3DYOA 5G2IA 1DJNA 2Y5EA 3FKRA 4R3UA 1IF2A 3MU7A 3TNBA 4G50A 4FNSA 5M1TA 3UI6A 1HKVA 3LPFA 2FZBA 5DANA 2JEQA 3OLDA 3E1F1 3RIKA 4QE5A 5IBXA 1Q45A 4HARA 2GLKA 1Q6RA 1TV5A 2OO0A 2WC3A 1P6WA 1QNRA 6A3HA 3HJZA 1J6OA 4PMXA 4KKXA 4TX0A 1JCJA 3UI4A 4AD5A 4TX6A 3FXGA 3W6LA 1YXCA 4OBTA 4BI6A 3PBYA 5ABFA 1R0MA 5D8WA 1W2PA 4CQBA 3SUWA 4GBUA 3ZLGA 5G1MA 4TW6A 4IIFA 2ZR5A 4JNYA 5AZ1A 3MMWA 2VKZG 1BPLB 4ZENA 4YVVA 3W00A 4LRSA 4UMCA 3KRUA 4IJRA 3JYJA 5SWUA 3CHCA 1Y5XA 4XBSA 4E2VA 3KFTA 4GG9A 3SUSA 2PTZA 3WDQA 3B9NA 1TMLA 3GBEA 4OGZA 4W8AA 3P8IA 4DXKA 4GQ0A 3G3MA 4BEQA 2WVSA 2Y63A 5ABFB 4JTKA 3H2AA 2NZLA 3V0TA 4JFUA 5A6BA 2PRHA 2Q71A 3WQVA 2DP3A 4OBRA 4X9SA 4CU8A 1OBAA 3G0XA 3IRSA 4MB1A 3G1YA 1WZLA 1UR8A 5DMYA 4C6NA 4Z1AA 3R10A 4MKSA 2ZCGA 3MI6A 4ADUA 1VP5A 3DC8A 4HZ6A 3B9OA 1O5XA 1UH3A 2OLSA 1LF1A 3N3TA 1JUBA 3T2OA 4UQAA 1Q66A 1RPXA 2C18A 1CPUA 3AQUA 1GWJA 3CZLA 1HJWA 3DC0A 4DY1A 3GG8A 1SW0A 3S2LA 1H7WA 1U5VA 2ZFAA 4H4IA 3U5UA 1XIDA 3VD5A 4IQJA 1O1HA 1Q6EA 4JZ5A 5GNXA 3QOMA 2D0FA 1UA7A 2J47A 3VGHA 3TN4A 2FKEA 2QVNA 2I9UA 3GR8A 4G56A 4A2SA 1TWIA 1OQFA 3W1RA 3KACA 3TYDA 3UA4A 1E43A 2C71A 1C8XA 1K7EA 1MO0A 1XLCA 4IMEA 3WJYA 5HANA 1BRLB 1CLXA 1A4MA 4GVIA 2QAPA 4Q8MA 1I2PA 3G1HA 5BNKA 1QW9A 1HQTA 5DXXA 3WJSA 4CQ9A 1V4YA 2GVJA 4XTDA 2D22A 5K9XA 4C6CA 1GONA 3ARVA 1JI2A 1OM0A 2GWNA 1JDDA 3LGDA 1OZMA 3GY1A 1EF3A 4JIQA 3BG3A 1C8YA 1H2JA 1SGJA 3FJLA 3M0IA 4IFKA 3I6RA 1XIMA 4MNMA 4XB3A 3GR7A 1MW1A 3TTEA 3VNKA 1XYAA 1GORA 3KAHA 4H8HA 2DW6A 3C2FA 1UZHA 1XYBA 4YJ5A 3TTYA 1CI1A 2FZMA 4C7DA 2C19A 4JX5A 1BTMA 1MNSA 2VX4A 3WD4A 3PJTA 3L0NA 1T96A 1W9PA 4JQAA 5G2HA 4FLQA 5G4HC 3UBPC 2FJKA 4HHLA 4MHBA 1JXJA 1KT0A 1UA3A 3AU6A 1UZDA 5E93A 4EPDC 3GXNA 3TLLA 3GU1A 3MP5A 3NOYA 4XX6A 1LQAA 3PBWA 4F48A 1J96A 2CXEA 1XIGA 4IFKB 3SSZA 1GOWA 1XPYA 3K8KA 1EA0A 2IKJA 5D37A 3SRDA 4QXIA 1XC6A 2YSWA 4EIVA 4PUWA 3LHVA 3GTXA 3PRDA 3FAWA 1QHPA 3FY1A 1ISXA 2I5QA 5GJPA 5HJLA 2AMXA 2OZTA 3IAQA 2HROA 5D2TA 2V81A 4EF9A 2Y8UA 1J0IA 1LBLA 1XLBA 3ABSA 1LT7A 1I0DA 1ICQA 3S1WA 2ZZ4A 3AS3A 1J4RA 3WDPP 2BS9A 3WX7A 3QGKC 5A8NA 4O13A 1MWOA 2PODA 5CC5A 2QUUA 2LPVA 2ZUVA 3CLWA 3K30A 3YPIA 1DORA 3SY8A 3G8RA 3AIUA 8CGTA 2W3ZA 4QE4A 4NUWA 4R33A 3ZIZA 2UY3A 1ME9A 3V5CA 2OWXA 1BKSA 2LGOA 1US2A 1SPQA 2OWCA 4HMNA 1WOAA 2YA1A 3ZJ6A 1P7TB 3T55A 3WLNA 1VYSX 3XINA 5FSDC 3MDUA 3SO7A 4GUHA 3H2CA 1SO6A 3W81A 4MPQA 4DELA 4S3FA 3SCPA 1O5QA 3M0LA 1R7AA 1JNEA 3ANUA 3QR1A 5DELA 5FD0A 1GTHA 3KAGA 3URQA 3GUWA 4JR5A 5XIMA 4DBUA 2QJGA 1R3QA 4C02B 2OU4A 1ADSA 2VTFA 3VIJA 5DQPA 1YIXA 4N6EA 1O94A 2XIOA 4F3HA 3E0IA 3OZPA 3VM5A 3NVTA 1MW0A 1PZ1A 1FKHA 4UUIA 4UTWC 4LGXA 3G1AA 3IACA 4LCQA 3N34A 1JIBA 3SRKA 5DF0A 1Q7ZA 1VBJA 4IL0A 1F6KA 3GNNA 3L4VA 8A3HA 1AW1A 1XXXA 2WKLA 4F4RA 3UYIA 2XP7A 4IF2A 3OA3A 1F6PA 3CGMA 2VRJA 2XIQA 5T9CE 1A5MC 3F5JA 2GJXA 5K9DA 3CUXA 1DIEA 3WJXA 3CPGA 4LYPA 2E5CA 4BF9A 1V51A 1VJSA 1QPLA 3CQKA 4ADSA 4ZB5A 1BYAA 1VYPX 4I90A 3BXWA 2WSPA 4GACA 1YTEA 4ORIA 1FKLA 3QEZA 5DLCA 2DUZA 2VO5A 4KCWA 3VOFA 4ZEPA 2QPXA 4W86A 1HG3A 3LLXA 2GJLA 1OIFA 5D33A 3F1QA 2QCNA 1XBYA 1OWQA 4LV9A 1IXNA 2V5JA 5L9FA 4A05A 2YXXA 3SFWA 1D3CA 2WM0A 3IGUA 1XYLA 1POKA 2YDRA 3KBSA 2WZIA 4IHCA 3EX3A 3AZSA 2DT0A 4TYOA 5J04A 4NL1A 3MMUA 4HMCA 3AS0A 2ACSA 1FWGC 5JXQA 2HMCA 1QI0A 3ARUA 4DJFA 4NZ1A 3VIPA 3NQ6A 2YBUA 5CC3A 3BLLA 3WLQA 4ODMA 3TC3A 3W7OA 3AYRA 3GZAA 4W89A 4WRHA 3ABXA 4REQA 4GY1A 4KWUA 1AA1B 3LHWA 1DKWA 2FH8A 2LKNA 1WQ5A 1W3HA 3MQTA 1LL6A 2HZGA 3HGOA 1RP9A 5ABGA 4H9MA 3MCMA 2YDAA 3NQAA 3AIBA 3RAOA 4IG2A 2BFGA 2FVLA 2CESA 4HVXA 1A3XA 2G8ZA 3ZR6A 4UB9A 4Z2JA 2ZZ3A 1DOSA 1YEYA 2UBPC 2A3AA 4QQ3A 3FSTA 4JYSA 2UV8G 4REQB 7PTDA 2X09A 1HO4A 1TZZA 2FMOA 2I5GA 5EL1A 2QGHA 1X98A 1CT5A 2WMIB 3LQLA 4IT1A 1TUFA 3C56A 4IWWA 3KW3A 2IKHA 5GJNA 3VOJA 1D9EA 3V5FA 1BQCA 4IG2B 2XUCA 1R9HA 7CGTA 1HF6A 3UWVA 4W7VA 2V82A 4DPPA 1KRBC 4NYYA 3RJYA 2XFRA 2RUDA 1JULA 1GZJA 2XIJA 4L6OA 3NOEA 5F4SA 5T9BG 3GVWA 1UR3M 1QWGA 1G9HA 3AMLA 4OOUA 3VDCA 2OQLA 4LAVA 3ZS4A 1DYSA 4RDWA 3T0TA 1S5NA 1TFVA 3GB6A 2NT0A 1PIIA 3S2JA 3TA6A 4HPJA 1OK4A 4V1YA 1UKSA 5E9XA 2QUNA 1EHAA 4WXYA 3BJTA 4FI4A 3VNMA 1V6TA 4L4MA 3W26A 1KFBA 4UTKA 1SVDA 1IZJA 3HIJA 5HQEA 1LG1A 3AALA 5D2VA 2Z1BA 4PODA 3W85A 1TJRA 2ABBA 5TIMA 1TMQA 3AZTA 1XUUA 1QMLA 2C8NA 3BLKA 4JAWA 1I9CB 4RNJA 4C6MA 3W2KA 3S1GA 2XH4A 4H01A 3L5AA 4JOMA 2VL4A 3TK7A 2DZTA 2UY2A 3PULA 1HKJA 1A5BA 1P43A 3DN5A 3NGJA 3BLDA 2K8IA 1FFRA 3P5YA 4JFMA 1VPXA 2WCGA 1VCVA 1NP2A 2PA6A 4J4OA 3KCLA 2QJNA 3U2ZA 3SW6A 4PZVA 4ZS6A 4E38A 2B4GA 2D2OA 3WQOA 2BTMA 1GGOA 3WUBA 5TBOA 3AU2A 4U5IA 4QX4A 1RH9A 3TC5A 2PV3A 3GW0A 1VKFA 1SZNA 1LRQA 4OTKA 2JBMA 1V93A 1H7PA 2ESCA 1OGBA 2PWDA 4GIVA 3QMTA 4GH3A 3PPGA 4XISA 4Z2KA 4QE1A 2DVUA 3RCYA 3GTHA 2E25A 1W91A 2Z7GA 3ARWA 5ECVA 3PF3A 1O68A 4GI9A 1TPUA 3E5BA 1ZS2A 3CV1A 1JYWA 4X22A 5HWNA 1XD0A 5CG7A 1R5YA 4IM4A 2PDFA 3VM7A 1VRDA 5C9RA 3W53A 1PS9A 2OX4A 2Y4SA 4AZIA 3WF3A 1ZUAX 4L7ZA 2F6KA 1WZKA 4MNLA 2R8WA 3SAZA 4C7GA 2VGIA 5A1AA 2HXUA 3PANA 3CUGA 2XIMA 5I24A 3S9YA 1VS1A 2X8RA 1VBHA 3BPWA 4JFVA 4G9PA 3VGFA 4LVDA 2J88A 3APTA 4X0VA 3KAIA 1RQEA 1MQQA 5CAHA 3B03A 3UPWA 5HA7A 4PUMA 4HBKA 2O9RA 1ZZMA 3TJXA 4GYPA 3LTYA 4LVBA 1QZ2A 3S1XA 1R2SA 3WFZA 3ALGA 5CPNA 4M5PA 3LGGA 4JN8A 2VCAA 2QJHA 1EH9A 1F6YA 1AJ0A 3E12A 4NZCA 4DYEA 2W9MA 3NTYA 5KZMA 5K7JA 3GHUA 4YCPA 3ARPA 4GE8A 5LXEA 3QYQA 4QR6A 1GJPA 1EDGA 3T0BA 1IYXA 1TWDA 4NAEB 2QEZA 3B8WA 2YZ5A 1MXGA 2HVMA 4HQVA 5F7UA 4UR9A 4EE9A 5A2AA 4CCDA 1TTIA 3QHOA 4FMVA 3ES7A 1KGWA 3GK0A 3USBA 1FHLA 3BV4A 2Y88A 1JQXA 2M08A 3IKGA 5D8ZA 1FWCC 2QQ6A 4DROA 1PTGA 2JEPA 3MVIA 5LIWX 5J8LA 1EJSC 1ODUA 4UBPC 4M7SA 1MXDA 4NSBA 3TROA 1WDSA 3QY8A 3W1LA 3TYBA 4QNEA 3WLMA 1ALDA 2WMGA 5KZEA 4AZCA 3FYYA 3M0XA 3GG1A 3NFUA 3GM8A 1EJUC 5LIUX 1VEPA 4V28A 1W6TA 4P8XA 5LA2A 1UPMB 4JTIA 3DYMA 4F2TA 1A5OC 2E6FA 1U1HA 2P0IA 2VJXA 3MO4A 1EQPA 4FLRA 1ECEA 4JTJA 3H9RB 1YTDA 3R0KA 3MSYA 4K68A 3TFXA 3JUGA 1WXJA 4DZAA 1DTNA 3UJEA 2FDSA 4TX9A 3S47A 1HIZA 2XVKA 1FHVA 4DYKA 1LRNA 2BGQA 4JTRA 4JCLA 2R1LA 4PUJA 1YW5A 3DH7A 5KEZA 3WDRA 3W72A 4DJDD 4BWLC 2DZUA 2J77A 4XG1A 2QNEA 4AZCB 3LCLA 3W6MA 1JCTA 4U10A 3AJXA 2ISDA 3BDKA 4PL1A 2V38A 2RFGA 4GY0A 4KCTA 1U5JA 3MO7A 2DH2A 3LMYA 4DLFA 2E7FA 1EDQA 4IMDA 4ZB2A 4LRTA 4L64A 3MDYB 3JU2A 3PBGA 5CZ0A 3V1HA 1OIMA 1NARA 4AF0A 3O05A 3KE0A 4N2YA 2E77A 3NPVA 3WF2A 3HU7A 3CO8A 2A3LA 1BLIA 3I3DA 5KTLA 4L1XA 4C6LA 1J2BA 2E67A 3RN6A 3P6LA 4HMEA 2Z29A 3L4YA 4UFIA 4ZOCA 2P50A 3NR0A 4GGBA 1ZBCA 4I5UA 4RE0A 3W73A 4E2DA 2WMHA 3RPMA 4A8IA 3UCCA 1TX0A 3C0JA 3VZZA 2Z7KA 4IPPA 3JXVA 4I7WA 4GABA 4Z2GA 4R0XA 1IEVA 2VR4A 4HCLA 3UWYA 5D75A 2Q01A 1LJYA 1WBJA 2D23A 4HZ7A 1TPB1 3W70A 1GJUA 5IRPA 5TAOA 1BFNA 5HWMA 4Q32A 2EPHA 3U6WA 3O06A 4WDWA 4GX8A 3EX4A 1A49A 2EULA 1BQGA 2XVLA 4S3KA 3OHMB 3RJXA 4NHVA 4AG0A 5CSUA 1O5KA 1V02E 2J9ZA 3OU8A 6CGTA 1W1PA 3PUEA 3UXDA 4PMQA 2XN0A 4CEXC 3C2RA 3GBDA 1V3IA 4RE2A 1UMYA 1XC4A 3OG3A 4B2DA 2QDGA 3B8SA 3OW1A 3KVMA 4U86A 3N6JA 4IFRA 3EOUA 1E9IA 5AHEA 2ICSA 2V5BA 4JTFA 1QPKA 1GVOA 4AZ6A 1KO0A 4JFIA 1BEUA 1VGAA 3BCFA 1U83A 2VDGA 2OXNA 1M01A 3OGSA 3WNKA 2ZX8A 2HCVA 1EQ3A 2Z28A 2EKGA 3U48A 4IQCA 1XRVA 3RX2A 2Y85A 4QG6A 1GW1A 3KRZA 2XP3A 4ZO7A 4F0HA 1JF6A 3HPSA 5AVHA 3QFWA 3BJSA 3Q67A 4I9MA 1MVYA 4CLMA 3QGAC 4CCZA 1K9FA 3KBJA 2PEVA 3LPOA 5D32A 4GMEA 3LI1A 2A79A 3O6CA 2PGRA 3M0ZA 5C8BB 2WSYA 3ZFHA 1Q6OA 1PZ0A 4N4QA 1E4IA 4PUNA 1OG6A 2J8TA 1M7XA 3O2LA 1B9BA 2HWGA 3LRKA 1MSSA 1AG1O 1Y65A 2GYIA 4DHGA 5AHMA 3ODKA 4Q8OA 4CEUC 3OQEA 4DZ2A 4FOKA 4HOZA 3JW7A 4H3DA 5JVLA 1VH7A 3RGTA 2HS8A 4L9YA 3IJDA 4KF1A 1P0NA 2OZ8A 4O8AA 4WF7A 3UJRA 4PSRA 1F3XA 2HDJA 2YPIA 4XBKA 2E6YA 1TMHA 1WNOA 3KRBA 3UJFA 1EB3A 4HHMA 3AUJA 3UJSA 1O4UA 1SQ7A 1UP2A 1RA5A 2BMBA 1RJRA 1Z6KA 3F4DA 3ATYA 3GKAA 4CD4A 3CBWA 4TV5A 4PUEA 3MUAA 3WEZA 3OP2A 1XL9A 2OX1A 4MOZA 1TJ2A 3IIZA 3FAPA 3W2UA 1ZL1A 1WDRA 3GVQA 4BQ2A 4RW5A 4O57A 3T0CA 5I3IA 1EWEA 3R6IA 3GNPA 3UNTA 3B4YA 1TE6A 3PNUA 2VP8A 2XZ9A 3FS2A 3F5LA 2FHBA 1HL8A 4B90A 8XIAA 1TKKA 2YL8A 4ALDA 4DVOA 2QDEA 3WIJA 1A53A 4QCEA 4AZGA 1XBVA 3AXMA 2WANA 5HNRA 3OJGA 1UMLA 3WLHA 3O63A 2E1DA 2BVDA 3PB2A 3L2MA 1UROA 2KAUC 4IPIA 1XPGA 1PKMA 4MF4A 1XLHA 4ZE5A 2Q8XA 4MAZA 1LG2A 3M0HA 4JEQA 5AYIA 1Q6UA 4IQ2A 3O0FA 4B5XA 3NXLA 2CLIA 1JFHA 1UH2A 3IVTA 1CZ1A 3GNRA 5H2ZA 3EOLA 3S2MA 5BXJA 2GJNA 4IP7A 5HR7A 3VKKA 1XD1A 4KEZA 5I6SA 1D8WA 4PRWA 1EWDA 4Z08A 4LBSA 3BLOA 4R7OA 3KRSA 3AWNA 3DKJA 2CPUA 2C0AA 4D8LA 4GHRA 1G7VA 2ZICA 1XLIA 4KWVA 3GDRA 4MYXA 1MFUA 4OIFA 3KBVA 4WXZA 3AMKA 5K2ZA 4ICNA 3T7VA 4AVNA 2GGGA 2NV1A 3UCQA 3RLVA 2V2CA 4RK8A 4TVUA 3FV9A 2Y7FA 2CZVA 1FDJA 3GZ3A 3ENLA 4EWJA 3LS9A 5JBEA 1O1ZA 3W24A 2YL9A 3K8MA 4OKDA 5A2CA 2C0HA 2NVAA 3B0XA 5G4EA 1K8YA 4BFAA 5B7ZA 1Q2RA 3O6AA 4UZSA 3LERA 3JR2A 1WOBA 3BAYA 3DCPA 5FF0A 4XK2A 5ABTA 1P6BA 5GNYA 4PRRA 3JRKA 1KRMA 3TR2A 4WCJA 3TYCA 3MUZ1 4QNWA 4PMRA 1PZ3A 3AAMA 4BS0A 2AWGA 1TTQA 3QOKA 2QCHA 2OEMA 3W1UA 2Z24A 3QLDA 3EWYA 4GCXA 1CXHA 4WVXA 1Q65A 3AUOA 3DFYA 1CTNA 3POHA 1B4EA 2ASHA 4RCXA 3RK8A 1U1JA 1PCWA 4JKMA 3N29A 3TN6A 3HPXA 4WSHA 3WLIA 4XVEA 3LK6A 4DX3A 4LNYA 4C6EA 1RVKA 1UD8A 4LVGA 4IPLA 1DE5A 1YTKA 2QS8A 5EMLA 4QEHA 2J13A 1EDTA 3FSUA 1L2QA 3H7VA 1XFBA 1S5TA 1VIZA 4W9OA 4ZSUA 4ZPWR 4K7YA 4PCSA 4P8WA 3DHFA 1SM9A 1PPIA 2XN1A 4C1LA 4EOUA 1ZJIA 1V3LA 2C7FA 1AJZA 1QHOA 3WNOA 1XICA 3NRKA 4MKVA 2F2KA 5CZSA 1FY6A 3N9KA 3RNDA 3WK0A 3STEA 3KCEA 4GKLA 1E6XM 2VGFA 3MZNA 3W02A 1KW1A 4MZ8A 2Y5SA 3VDGA 3RR1A 7TAAA 5BOOA 4JN6A 3T05A 3NAVA 4GUJA 1QHZA 2XYLA 4LY8A 3GU0A 1W5OA 2WM1A 3CT2A 4H7ZA 2DSVA 2R14A 4EKJA 1ONXA 5F1UA 4M1RA 2DIKA 3PAOA 4GVGA 3EOOA 3EGJA 3M64A 1VR6A 4NYUA 2EPKX 3K13A 2W79A 4WQ6A 3T2PA 2V8ZA 1R2TA 1RJPA 4CD8A 2ZQUA 4DRIA 1H49A 2D3LA 4AVFA 3NJ3A 1DQUA 2WB5A 3HPAA 2NSXA 4WGHA 3BL3A 3O5QA 3CB8A 2J66A 1LCOA 1YLVA 3BOXA 2J25A 2EG8A 1Q5MA 2QJMA 2ATSA 3EA3A 3GW3A 2ZZ5A 5E0FA 3IJLA 4HA0A 4IPXA 3M5ZA 4PUDA 4JTAA 3OGRA 4S39A 5LYRA 3WH8A 3GXTA 3LU2A 3CHDA 5HNTA 1PL9A 1CYGA 1M7PA 1UWAA 3W7RA 2ON3A 2NLIA 4DIAA 1P1XA 5A8GA 4DZIA 2QVHA 3EX1A 5CSYA 4MB3A 4XAZA 2MLYA 3WDIA 5DMNA 3DI1A 1J93A 1R46A 2GUYA 1KTBA 1D2KA 3TA9A 3VDHA 2B5UB 4IUOA 3VUPA 1BD0A 3RM4A 1M41A 4XUYA 3FA3A 2POZA 3WBYA 2EG6A 1PUDA 1RK5A 3BLPX 3KVJA 1JDCA 5JU6A 2V9DA 4TU1A 2ZX9A 4DWSA 4ROQA 1EYMA 4FOUA 2I16A 1P6CA 3MSDA 4ROPA 1GNXA 2I9EA 3L0GA 3NYDA 1MYRA 1W5PA 2HJPA 2DG9A 4AIOA 2XP6A 4GFIA 3AMGA 3R79A 2Y8VA 4FALA 4X63A 4YCOA 4DIPA 1FUYA 3GH4A 4F0LA 3M7WA 3D46A 4NASA 2OQYA 4DO7A 3I6CA 1G94A 1FXQA 4QJ1A 4JFSA 1OC7A 4JDYA 2Q3OA 4CQ8A 3ICJA 3R0UA 1H11A 4Q4OA 2DIJA 5CJNA 4QAWA 3TN3A 1SYTA 2YL6A 1B4KA 2GZXA 4FF5A 1DQWA 2CHOA 5D2YA 2BX7A 1TA3A 2YCKX 4F40A 3B06A 5H8UA 2Z25A 1DIOA 1Q6HA 1SSGA 3UETA 4PULA 2QT3A 4NZFA 5F1VA 5FAGA 3DGRA 4LVFA 4M82A 2BBFA 2VURA 1E15A 2ZX7A 3W2JA 3PPFA 1KFLA 1ISWA 2D9FA 4C6JA 4EANA 4J3WA 4TUFA 2WSRA 5E9AA 4BA0A 5A6AA 4GO8A 1L6FA 6ALDA 1LUCA 4J3SA 3NDOA 4G2PA 3VD4A 4O52A 1XLDA 2MLXA 3GLCA 5FF3A 1YPIA 1UOZA 2OLAA 3FX4A 4HYVA 1TCDA 1H60A 5C0QA 2OZ3A 1B54A 1TA3B 4Q8UA 1QDSA 3WMSA 2XH0A 3P0XA 1IR2A 1SW3A 3STCA 1XS2A 3LI0A 5C9ZA 1BVNP 1SZGA 1RLCL 1V6WA 2WPBA 3RITA 4KWWA 1EGZA 1FVPA 1H5YA 3QGVA 4S2CA 5F4XA 1JPKA 5CXPA 5KITA 4K8GA 4S1FA 2O9OA 1JCXA 1QPFA 1FFQA 1YXDA 2BHZA 4Z1CA 1LUCB 2CBVA 3GTNA 4PMUA 4US5D 1ZJAA 1OC5A 1DBTA 3ZYZA 5A2BA 5LIKX 4A3YA 2G97A 4B5TA 4AY7A 1R6WA 3C2EA 3Q2DA 4Y9PA 3K1DA 4D8AA 1QK0A 2FIQA 3KOZA 4K1GA 4H00A 3DDMA 2HTMA 3C0QA 4OHQA 3L4XA 1TJPA 4M81A 4C5ZA 4ZOEA 2EPMX 1EEPA 4Q3MA 3WFLA 4Y7EA 1NP0A 2HVOA 3ARYA 3PG8A 3TDBA 4N02A 1PBGA 3GXMA 4AZ5A 3ITVA 3W22A 1ONWA 4H9YA 1IT8A 3W86A 3PUGA 3B4UA 3AXIA 2QDDA 3DG6A 4BI5A 4D6HA 1CLVA 3T78A 2X16A 2E6DA 2FMNA 2WV8A 2GVGA 2EF9A 2BXZA 1PKNA 1VPYA 4DN1A 1SR9A 3VC5A 4Q4SA 4DBSA 3RO8A 3OGVA 3O5GA 4ODOA 5GPRA 4FR1A 3T09A 1F8IA 3W71A 4W4QA 1JAKA 1UZ4A 2ZUTA 3KTCA 1QK2A 1W56A 2W6RA 4E8DA 1X1NA 2OPJA 3AWOA 1JPDX 3I65A 3SUUA 3SCSA 1ZHAA 3MHFA 5HPOA 4OU1A 1DWGM 3SCOA 4H6QA 1GOIA 2BVTA 1R9ZA 2BY2A 3T9PA 2CLOA 2CWNA 3TYUA 3W7EA 4DRJA 1N1AA 3NM3A 4D6IA 1MRAA 2DIEA 4FXJA 5G1YA 1GVRA 1E0WA 4IX2A 1G6CA 3CLMA 2NWSA 1OFAA 4Y96A 4HTBA 3TC6A 2INZA 6ENLA 3CQHA 3QMRA 2OZ0A 2G3FA 3CHVA 3TX9A 2PLKA 3WQDA 3W3OA 3LNPA 1EO5A 5E5CA 4AY8A 3BMBA 2WKJA 1ZNNA 2OKOA 1PBKA 4GX9A 1UKQA 2GDUA 2IW0A 2EXOA 4MY8A 1F07A 1REQA 4JYFA 3NSNA 3OBAA 4IJCA 1BTCA 2CBIA 3N25A 3WDJA 4AU0A 2D2GA 5BWAA 1C29A 4LF2A 3W2MA 2BP1A 4NAFA 4E3VA 3CUHA 1FDYA 4GJJA 4JD4A 3OLIA 1QO2A 2SFPA 1LDCA 1ENUA 4GD0A 2I14A 1HJVA 1GZGA 2BDQA 9XIAA 2VZVA 5H91A 1CGYA 4M29A 4O2TA 4Y9MA 2PP3A 3II1A 3SADA 4ZZ9A 4EPKA 4AEEA 3F2BA 3KADA 5DITA 1JL8A 4AYSA 3OOQA 1NFPA 4PB3A 1REQB 4GUIA 5EMKA 1XINA 4KR0B 1X8CA 1AH0A 1AD4A 4NAFB 4K36A 4P7LA 2NUXA 3URAA 5KZ6A 3PZIA 3JZUA 3H4WA 1A5NC 2IXUA 1ZJHA 3CZEA 5HUOA 4ILSA 1JDEA 2VUNA 3BO9A 5FJIA 3A3HA 4A4AA 5FSEC 1TV2A 2BGSA 3RFAA 2R9RA 3QC3A 3JS3A 1GVFA 1VFTA 2HRWA 4YTUA 3OVRA 4O19A 1DQXA 5TF0A 5BOEA 3WF4A 4AZ7A 4UFMA 3MUIA 2XSAA 4L6DA 4E8GA 3EOEA 4R34A 4ONVA 1WDQA 5HWBA 1JYXA 4FZIA 3RR4A 3WQWA 1QNQA 1EC8A 3L4TA 4LS0A 5BXTA 4JTQA 1LWJA 3S5SA 3S0CA 3VO0A 4W7WA 3P3BA 2MPHA 2RQSA 4NILA 1H0GA 4A35A 1M6JA 3S46A 5JIWA 2Z26A 4B91A 3HZ3A 2A3HA 2D73A 1ZENA 4YVPA 2KFWA 1K7FA 1N7KA 4TQTA 3N2CA 4TIMA 5FEZA 1D7HA 3UPMA 3N2BA 3TH6A 4ERGA 5KINA 3QV9A 4Q33A 1I0BA 1Q4NX 4M6QA 3QJAA 2RAGA 1P48A 4B3ZA 1G0CA 3SIZA 3E96A 3NYZA 4LAOA 1JVNA 2J4GA 1J5TA 4J3TA 3FN9A 1WBHA 4MFDA 1JRBA 1P5BA 1XF0A 2ZTKA 1F4AA 3LRMA 3WZ0E 3LY0A 1FRBA 3CV6A 1QT1A 3VKDA 1ITQA 2J7GA 4GUGA 5IOBA 1VEOA 3SY5A 3KCJA 4XZHA 3GNOA 2WZEA 2AQWA 4QIBA 4L1GA 4LSBA 2DZVA 3IJ9A 1CECA 2RKXA 3TQ0A 1IWAA 4JTSA 4HYRA 1FQ0A 3CU2A 4UTWA 4UQCA 4QJ4B 1U30A 1KKRA 2E9LA 4PMVA 4BQ4A 3PR2A 4L4LA 2F21A 2G5WA 4RPPA 4TTUA 2J9YA 1FKSA 3DHPA 1S39A 1PINA 2QCDA 1EKOA 3KHDA 5LIXX 1W9DM 1W1IE 4MKNA 5I00A 2DSUA 4JIIX 1RPKA 3KBWA 3UY8A 2TPSA 4G6CA 3LZ5A 4KETA 4NI3A 3MS8A 1TJ1A 3QHNA 2XDFA 1Q8JA 2NQLA 2FAPA 2EO7A 4YXGA 1I2OA 4A6GA 2E8ZA 4Q8QA 5HW7A 3S3GA 1KC7A 4OVXA 4AHQA 2XWDA 4XZMX 3WDHA 1W54A 3OIHA 1N2VA 2QCDB 4Y8FA 4DJEC 1V0LA 3ONCA 3P93A 3LPPA 3CUZA 1Z42A 1GVQA 2J7HA 4YYFA 5G5IA 3ZT5A 4A3QA 4O0QA 3A9IA 1SUXA 3KAOA 2WHMA 2QULA 1CGXA 4FX6M 2Y70A 3A5FA 1W1ZA 4K7VA 2FFIA 1AZ1A 1ISYA 4NZ3A 3KOYA 3UZJA 3TYZA 5I02A 2GPTA 2IKGA 2YDQA 1H63A 4CCCA 1QAPA 3B05A 4I8DA 4UNLA 1FH9A 3RG6A 1XRFA 3HQNA 3G3DA 4F8XA 2VZSA 4W84A 3PWIA 4Z42C 3CAQA 3VE7A 4XD4A 3ZLHA 1EIXA 2RDXA 4IQDA 1NSJA 2VT0A 4NKCA 1X96A 1J10A 1AK5A 3HG5A 1KBBA 2RJHA 1ICSA 4XUGA 3T44A 2QW5A 1TTJA 4AXNA 4F9DA 1YX1A 2I5IA 2WMFA 1NF0A 5BU6A 2WHJA 5I0DA 2VZOA 4LW7A 1QCWA 1Y0EA 2ZIDA 3TSDA 3S83A 5C6MA 2XPKA 4C6IA 3C52A 3LB0A 4JICA 2BODX 1W5NA 3VCRA 3LGEA 2D20A 5D09A 4C6PA 4IH3A 3ARSA 1FH7A 1ZRQA 1S5MA 4MWAD 2FZNA 3CEUA 1R3VA 1Q8AA 4DI8A 3L4WA 1IXPA 3CC1A 4J4NA 3G1RA 4QDPA 4N9BA 4IMGA 5TNVA 2PWUA 4CQAA 2YCLA 3O5RA 1BVWA 1FBAA 4O1DA 3CWOX 3PZTA 3L7RA 3F2DA 1CGTA 4AUBA 4WDUA 3UGRA 1HXJA 3FYPA 3ZM8A 1TSIA 4LU0A 3MV01 1ZBVA 3EMZA 4DH0A 1ZY9A 3E74A 4PTXA 1RCOB 2CLLA 4PMJA 2ZXBA 3HB9A 5CGMA 2O7QA 4JTLA 3M6YA 1EEXA 3P62A 3HM7A 1YQ2A 5FJTA 2YX0A 4O53A 4FNUA 4IUGA 3UA3A 3G1VA 1NTHA 2NV2A 2ZX5A 4QBXA 1XX1A 3DZ1A 2YCLB 3PUDA 4XZNX 3NTPA 3AZRA 1E1CA 1AH4A 3EWBX 4JL2A 1MEIA 2Z2BA 4Z1BA 3EAUA 5HAOA 4F2UA 1GHRA 4TMBA 4CNTA 1XIEA 4LUSB 4RZ6A 1N8FA 3UWQA 4CNSA 1FJDA 3EWCA 3B0UX 1T40A 3WELA 2O9PA 4MADA 3VTRA 3HG4A 3GTIA 1CGVA 1TZ7A 4TVCA 1TG7A 2ZA2A 1H50A 1ZCOA 4RV8A 4I5RA 1E4LA 2YBTA 4A8LA 3A47A 3KDNA 2G3NA 4P7NA 2OFNA 4E6MA 1E1CB 4NJKA 1H51A 3EDJA 1R3WA 3FVMA 4G7FA 2GWGA 1Q6QA 2R82A 4AMCA 2PMQA 4ATDA 1RBAA 3GFYA 4AIUA 4H04A 1TPEA 4H2HA 3HA1A 3BLEA 1H7RA 3GFXA 4OQVA 4CCEA 4KQZA 2PTYA 3STPA 2Z2AA 2V67A 5I3HA 4FXRA 2KZHA 4NJGA 2WMKA 5HMDA 3R5EA 3BSHA 1S5VA 2WVTA 4AX7A 5ABEA 2J79A 5C5YA 1JPHA 4L4PA 2VD9A 4M6PA 3WD0A 3WK2A 1BXNA 2R91A 4LAKA 4GZ7A 1FH8A 3MKVA 2RDWA 1VCFA 4GQBA 3NSXA 3HOJA 3TCEA 1X1ZA 2YCJA 3LCHA 2WHLA 2D0HA 1L8PA 2Y0FA 3LA4A 4I9TA 1AMYA 2CCRA 1JG9A 1DV7A 3D5HA 4R88A 3T07A 4MTVA 2VX6A 3UPBA 2EHHA 2GDQA 1XSIA 1VFUA 3U5YA 2MF9A 3SJ3A 4LJ3A 1N8WA 1OX4A 1NELA 3P8JA 2ACRA 1G4TA 2YXGA 1GOKA 4D6GA 1CGUA 1EJ7L 1J0YA 4F66A 1QW7A 4DZHA 3TZNA 2PU1A 1WE5A 1YDVA 1E0VA 4EX4A 1MFVA 2JE8A 1CXIA 3ARRA 4XSLA 1J2WA 2NQZA 3RCNA 1XP3A 3R8GA 2W61A 4H7VA 2WMJA 2PI6A 1G4PA 1IR1A 3UXIA 3SFKA 1W1B1 1KBIA 5LA0A 4XZ9A 4MAVA 1DWFM 1GQJA 3W84A 2F38A 1T8QA 2YYUA 1EOKA 1R3TA 4QEEA 2VELA 1WKEA 2PD5A 4X61A 3H7UA 2BHYA 3GIYA 3INPA 2ETNA 2ZBTA 3GWQA 3NQEA 2Z6JA 1QOQA 3GIPA 3S8HA 2VR2A 4UOZA 4K8EA 5F2GA 4HSOA 3BMVA 3B0YA 1Q13A 2NUYA 1TV3A 2VEKA 1ADDA 3A23A 4YLWA 4GNKB 5E70A 5M03A 2P53A 3SGGA 1UD4A 3KX6A 1VYRA 3IUHA 3R8RA 2IQTA 2H8ZA 5CPLA 1ZFJA 4UR8A 5MKGA 2B7QA 1Z7AA 3E2QA 4PFMA 4WOQA 3QKZA 4WJEA 3TYAA 4GIAA 5CLTA 1XQLA 4HBEA 3A22A 1KM2A 2FVMA 4NI8A 3TXZA 4GINA 4Y9NA 1ZP3A 4C6FA 1S2VA 1UC5A 2OODA 1DJYA 3WL0A 3WH7A 3NPXA 3BOFA 2JKEA 1WZAA 1TUXA 3MYOA 2WSKA 3B40A 2OB3A 3CMJA 1LROA 3I68A 4AAJA 1SMAA 3RU8X 2PPGA 3O5PA 2PURA 3EXSA 2UZ9A 2W92A 4FX7A 3M9YA 4TMCA 3Q4DA 1PV8A 1JQVA 4TXEA 4X0NA 2YL5A 5MKGB 4ODNA 1DWJM 2PPPA 3FW6A 1V0NA 3PS7A 2PGEA 2Z4GA 1VFLA 3DFNA 1DXIA 1DE6A 2J9XA 3TUUA 5FJOA 4AWSA 1Y8BA 1YKWA 3CGNA 1OD8A 4V33A 1FCBA 3BANA 6XIMA 5EBAA 4MY9A 5BRQA 1OFPA 1IIGA 3VFLA 1LYXA 2VHLA 3OQ8A 1UC4A 2DT2A 2A3CA 3AIVA 1JYNA 4DRQA 1Q7MA 1LLWA 4XO7A 1R87A 3W7PA 4EPBC 3TWAA 1W9UA 4MSSA 3PN8A 4LYQA 3R7MA 3V18A 1XUZA 2Y7DA 4IIEA 4QCFA 4CU7A 1WDWA 3HBLA 3TCZA 1QBAA 2PBGA 1NMVA 2ZRZA 3QFEA 1JAEA 2RUCA 1TCOC 5T91A 5D9NA 1SFLA 4P8VA 3RX4A 1ONRA 3TKFA 4RR4A 1UJPA 3EPMA 3ONBA 1S3HA 4FSAA 2VCCA 1TR9A 1S1PA 4B9ZA 3OA5A 4IQEA 4RZ4A 2VUYA 3A3XA 3VX1A 4MGGA 5BXPA 4XD6A 1Q6IA 2NWRA 2INEA 3TMLA 4E4PA 2DZBA 2GVLA 2PDGA 1O5RA 1A4LA 2PLJA 4O18A 2CHRA 3K2GA 3NXFA 1KXHA 5BU9A 3VAWA 3KM8A 3VIKA 2Y7EA 4JHOA 4X9YA 1GPFA 5F4WA 4RNFA 5CEWA 3E49A 2ODOA 1UW9A 2JGYA 2OOGA 3ABZA 1QOXA 4GGQA 3CEPA 2PBCA 2PF0A 4M80A 5D2XA 4O1FA 1IIHA 1H7NA 2E9MA 1K8XA 1UKOA 4GWEA 4DWSC 2GGIA 2JF7A 1VZWA 1WDPA 2I1OA 1OFQA 2OSWA 1E6PA 2OGYA 1XH2A 1X1OA 4O1EA 3NZRA 3L5MA 3QSRA 2W27A 4A21A 5M3WA 2HISA 3N3MA 5CLWA 1DWAM 3M0VA 1B3VA 3CQIA 3RU6A 4ODQA 1ZALA 4A22A 1F3WA 3AHXA 3H21A 1WX0A 4O0ZA 6PTDA 4RV3A 5HNUA 2YZRA 4FNTA 1IGSA 5J5DA 1E0TA 4KIEA 4FAMA 1MEWA 4GI8A 3G6MA 4WJ8A 1AQHA 3W28A 3MKCA 5DN1A 3W87A 1AL8A 2ZRXA 3V16A 4BK9A 3MW7A 3TYEA 2G4JA 1YDNA 4O12A 3A13A 4ZQPA 3T4WA 3KLKA 2F8QA 1VJIA 5HMSA 3QR3A 4QJ3B 3FLUA 1LLOA 1XLAA 3AYSA 1EUAA 4Z2HA 3OLGA 3H24A 2QF7A 1IZCA 2VN1A 4ZODA 5AVNA 5DT5A 1NU5A 4N42A 3T8LA 3TOYA 1VLIA 3A5VA 4RE4A 5C70A 5FACA