4MTVA

Crystal structure of the complex of buffalo signalling glycoprotein with pentasaccharide at 2.8a resolution
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3-like protein 1
publication title Crystal structure of the complex of Buffalo Signalling Glycoprotein with pentasaccharide at 2.8A resolution
rcsb
molecule tags Signaling protein
total genus 123
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2013-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4mtvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mtvA01
1MW0A 1V03A 3A47A 1UH2A 1BF2A 4RE3A 2VX6A 2ZX7A 1HNYA 3AYSA 2X1IA 1SMDA 1NWSA 2XHYA 5CPSA 4D6JA 3WUBA 5I2UA 3M6DA 4V28A 1UQZA 1V6XA 1PIGA 2FGZA 3SCWA 1GZJA 5CZKA 5DF0A 2UY4A 4J3UA 1KBKA 1JL8A 3L2LA 3PZUA 1FP9A 2XVNA 5CGTA 4D6CA 3WEOA 4UQBA 3WDQA 1E4MM 3BH4A 3NUKA 3ZMRA 2XVKA 3WN6A 3AMDA 3QHOA 2F61A 4W8BA 5E0CA 5BWFA 1E3XA 1V6YA 3BGAA 1ISZA 2E8YA 5A1AA 1QOXA 3KZSA 2O9TA 3VO0A 5JBEA 3ZT7A 2Y2WA 1A47A 4F8XA 5CQ1A 2DIEA 2W91A 2NT0A 4YPJA 1JZ3A 1G01A 1EQPA 4LYRA 3GH5A 4TX8A 1UD2A 4M81A 3EYPA 3GBDA 3AI0A 3W81A 3UESA 3WH6A 2ZUNA 2ZXQA 1OM0A 5CSUA 5GPRA 1WO2A 2GJXB 4HMDA 4U2ZA 3W26A 3FXYA 4C7DA 2VR5A 1E56A 4NRSA 1UHVA 3N12A 4S3KA 4W88A 5D9PA 3E1F1 4GQRA 1X6LA 1CIUA 1W3HA 1HJWA 3MV01 2CITA 4BQ5A 4AD0A 1Q6DA 3AQUA 3SCUA 3T2OA 1XGZA 1LG1A 4QDMA 2JF7A 4Q7NA 5GNXA 2YBTA 1EDTA 1JZ5A 2F2HA 1XH1A 3SCNA 1KCLA 1FH7A 1CGYA 1UD8A 1GVYA 4AZIA 1QI2A 5A6JA 3AHTA 5HBFA 4JHZA 1CZ1A 3UG5A 3DYMA 5DO8A 3DHUA 2W62A 2XWDA 2WHKA 3GTNA 3PHAA 3LPOA 3T08A 4CD6A 2A3AA 4AXNA 1ZU8A 1DWGM 1I1XA 3G6MA 1W3LA 5A8MA 2OYKA 1EHAA 2V3DA 3VIHA 5A6BD 1BYCA 2FHFA 3ZO9A 2ZX5A 3ZQ9A 5JUVA 4PSRA 3OZOA 2PBGA 1B3ZA 3ARTA 1WDQA 5CG0A 3WH5A 1OB0A 2WB5A 5A2CA 1UH3A 5AYIA 4AZ6A 4UQEA 4BQ2A 5E09A 2VZTA 1E71M 1JFHA 3W29A 2VZOA 2ZUUA 3L4WA 2PWDA 3OB8A 2VRKA 2EQDA 1GJUA 3EBVA 4CCCA 3RJXA 3EDFA 1HF6A 1JIBA 5GQBA 1TG7A 3AHVA 3ZR5A 1PBGA 5FIPA 3W37A 3K46A 4UFJA 2OWCA 3CUJA 3LPFA 1E70M 3MV11 2AAAA 1NWRA 2BHYA 3MU7A 1OT2A 3ZT5A 2OSYA 1WZLA 4C7GA 2JEQA 2EXOA 4PMOA 3ARQA 5BRPA 2CCRA 4WKFA 6A3HA 2HISA 3POCA 4PEEA 1E43A 4FMVA 3CHEA 4M24A 3AFBA 4ATLA 1VJZA 2YA1A 3NSMA 1QHZA 1WZMA 3FN9A 2CBUA 1M04A 1W3KA 1BHGA 4CCEA 4MB1A 1V6VA 4CGTA 5JBFA 3OBAA 1GUVA 4B9YA 2WMJA 5CLWA 4PTMA 1GOQA 3VM5A 1KXTA 1OGBA 1NM9A 1D2KA 1HJVA 1JYNA 1QNSA 2WVSA 1W91A 3SUUA 3AS2A 2D0FA 1BYBA 3K4AA 5GNYA 1AQHA 2X09A 5I23A 4HOZA 2Y8KA 3AS1A 1UYQA 3K1DA 4U2YA 4CD7A 4UOZA 1NWTA 3L4VA 5M17A 1J0KA 1J10A 2CXGA 2CIPA 3EDKA 5C70A 1XD1A 1PJ9A 2PWHA 3WDIA 2DSKA 4W8LA 3VUPA 3ARWA 3VIFA 3AHXA 3SUWA 3U7BA 1V3KA 1LWJA 1LL4A 2WVVA 1D7FA 4NF7A 1JZ7A 5AY7A 2CBVA 2W4XA 3GXMA 1CXHA 1TR1A 2G41A 3AXXA 5HDRA 5C8BB 1TA3B 1ISWA 3WDHA 3CH9A 4A3HA 3T0BA 1V6UA 3THCA 1TCMA 1W9UA 3U7VA 3I3EA 1HP5A 1PX4A 4PUDA 4ZXOA 1EQCA 2J74A 4BCEA 1B3XA 2XM1A 4ATWA 3WBEA 1E0VA 2OLHA 3BAWA 4PMUA 4PMVA 3L4ZA 4HA1A 5BCAA 4HP5A 4CD5A 2YA2A 1CXFA 3VIIA 4J3WA 4ACZA 2MANA 4MDPA 4JL1A 2EPNA 3TTSA 1UZ4A 1FP8A 2DQXA 1UQYA 2YOCA 3IAPA 2W66A 2J7GA 3AZSA 3VILA 4CUCA 2VCCA 5IHRA 1TFVA 1QI0A 1UD5A 1PIFA 1E0XA 4OBSA 3BXWA 1DWJM 3TOPA 3VGGA 3L4YA 3WDPP 1ISYA 2WMGA 3KEHA 1E73M 4CN4A 4DWSC 3WF1A 2GJRA 2WMKA 5CPTA 1KR0A 1WB0A 2G3IA 1CGVA 4P8XA 1E1FA 4URIA 1OIMA 1HKMA 2DSZA 3PZMA 2YDSA 1OSEA 3I3DA 5A6KA 1ESWA 1WKYA 1UR8A 4U3CA 3SCVA 3S2CA 3N13A 1NP0A 4M56A 3TONA 3WNLA 2OSXA 4EK7A 3T0AA 1WZKA 1BSIA 1FFRA 1MW1A 4JFUA 4GZIA 1JI1A 2A3HA 3VX1A 3GXFA 4M80A 4MPKA 1NARA 1O7AA 5FOOA 1QBAA 1R87A 5D9OA 5M3WA 4AZCB 1VEOA 2QF8A 1CENA 4KGJA 5FKYA 1HJUA 2VURA 1WCGA 3D5HA 3WD4A 2VO5A 4FK9A 1NQ6A 5I6SA 3PZOA 1UKQA 4B9ZA 4CU7A 4LX4A 3WBAA 1KXVA 4QFUA 1BVNP 4GI6A 4HMEA 1HVQA 3AIRA 3DC0A 4PRWA 3SUSA 2E9MA 1J12A 1I75A 1FFQA 3HN3A 3VM7A 3MS8A 2JF6A 5EMYA 1HJQA 3VVGA 4W85A 4KRUA 1XHGA 2QMJA 2XFFA 3WQVA 1PZ2A 1WP6A 4M29A 1JDDA 3GDBA 1UWIA 4W86A 4UZSA 2YL9A 4JKMA 4W5UA 4K68A 2IUZA 4W93A 1DWHM 4MB3A 3PTQA 3VKKA 2JALA 4Z2GA 1VEMA 3ECQA 1GW1A 4HPGA 3VD9A 4PTXA 1B90A 3MUAA 5BXTA 5ABFB 3VU2A 1MWOA 3WF2A 4ATDA 3ZJKA 3GYCA 2X8RA 1KXHA 4Q22A 1TUXA 4PTWA 2PI6A 4GPNA 3BAIA 4RE4A 1ECEA 4GXPA 1XYZA 1V3HA 2JEPA 2CYGA 3EDJA 4U33A 2NSXA 2YKKA 1GOKA 4AD4A 4HZ7A 3K8MA 1UG6A 2ZE0A 3IANA 1VF8A 5A2BA 1QW9A 4P7NA 4JFWA 1J0HA 1MXDA 1RH9A 3QHNA 3GXDA 3SUTA 3ARVA 3AZRA 1R7AA 2EPLX 4N0RA 3QGVA 3AHZA 2ZXAA 4JFSA 4LGXA 4HA3A 4A3YA 4E4PA 5CPQA 3CZGA 4QLJA 2QLYA 1QNOA 4AISA 5CJ5A 1QNRA 2X0YA 2XTKA 3BSGA 2NW0A 1EOMA 3IK2A 3UG4A 2Z1SA 5AC4A 1UR4A 3RIKA 1SR0A 1OINA 3SCQA 2D0HA 2VCBA 2WXDM 2ZUSA 4OBRA 4ML4A 2EBNA 5E0FA 2WHMA 3VMPA 3VGBA 1E6ZA 3J7HA 3WMBA 2VUYA 4WKAA 1M7XA 1WDPA 3ARXA 4KMQA 2YA0A 4MB4A 2VRQA 1J0ZA 1Y7VA 4L4OA 4MNKA 1MYRA 1US3A 2E3ZA 3AXIA 1BTCA 1VJSA 5BXPA 3RDKA 1IZKA 1GOIA 1DWAM 3AIBA 4W8AA 1U2YA 4P7LA 2PF0A 1DHKA 3OA5A 1UWTA 3BLKA 3AHYA 1CEOA 1FA2A 4FLRA 3T2PA 4V27A 1W1YA 1WPCA 2FGLA 3MUY1 4J3XA 4TUFA 4W7WA 3VTRA 4B3LA 3ARUA 3CO4A 4UQ9A 4PN2A 2UY2A 3CZEA 4J7RA 3K8LA 2WMFA 4X9YA 4D1IA 3B8SA 5KZ6A 1UWUA 1KQYA 3WH7A 1VFUA 1XC6A 2FHCA 2JIEA 3VD7A 1TE1A 2BXZA 1KGWA 4HPHA 1TMQA 4NI3A 3I3BA 5A6MA 2QV4A 4KGLA 4ZXLA 3QHMA 1JNDA 1PX3A 2C7FA 3KL0A 4CVUA 3GNPA 1UUQA 3F4VA 4U5KA 1DEDA 2XFRA 1JD9A 3UEQA 1KXQA 3TA9A 5A6SA 1K9DA 1E55A 2VQUA 4AZHA 1Q6GA 1E40A 5FL1A 4OIFA 4RE2A 2WAGA 2VMFA 6TAAA 3W0KA 1FHDA 2CEQA 4PMXA 1VRXA 5JIPA 3SCOA 1QBBA 2F8QA 1PZ3A 1JG9A 4JCMA 1UWSA 3AIEA 3EMZA 4JIEA 4MAZA 1W9PA 3VIOA 4JAWA 4GI8A 1GQIA 4UFKA 4HZ6A 3A3HA 2YL8A 1CLXA 4OJYA 2WBKA 1LG2A 4PBGA 1LF1A 3CMGA 4WKHA 2XFYA 1ITXA 1V3IA 4HU0A 4CKQA 3FW6A 2BXYA 3CBWA 3RMEA 5A8OA 1GPFA 3T09A 3W6LA 1CXLA 4D6EA 1UKTA 1LL7A 1UKOA 1V3JA 3VMNA 4MAVA 1C90A 5IFTA 2V3GA 1DWIM 3PTMA 3A4XA 4W5ZA 1V02E 2J7FA 2PC8A 4X0NA 2E40A 3ALGA 2ZWZA 4HZ8A 1F4HA 3VNZA 1AMYA 3BMVA 4AZ7A 1E72M 4MADA 1XCXA 1UA7A 1G5AA 2V38A 1R86A 1E9LA 4QP0A 1VFFA 3F5KA 1BYAA 3VGDA 3JUGA 1JYWA 1GOWA 3WH8A 5KEZA 2D23A 2E8ZA 1KGXA 4OZOA 1ZS2A 5EB8A 4TVUA 3ZSSA 1CWYA 2ZUMA 4J3TA 1KBBA 2BVTA 3UETA 3VDAA 1B30A 3SURA 1JZ2A 1KCKA 1ZBWA 2WWCA 5EBAA 2XSAA 3ZJ6A 1BG4A 3O2LA 4J28A 4J3VA 1GHSA 4W7UA 3MUZ1 1J18A 2OSWA 2FHBA 3OLIA 4H04A 1E6XM 1EHNA 2CHOA 1UD6A 1ZBCA 1SFSA 4CN6A 3AOFA 2VCAA 2WMIA 4UR9A 4E8DA 5A95A 5E6YA 1JZ6A 2CBIA 2WANA 4AD2A 1CXKA 2BY1A 3FY1A 4FLSA 4QAWA 3VNYA 2BHUA 2AOSA 2VOTA 3MKKA 2GUYA 2VX5A 2YIHA 3WUGA 3W4RA 4CVWA 4GI9A 1CGWA 3ARYA 5HNNA 1MQQA 2J77A 5E70A 3HMCA 3WD2A 3ZT6A 4GINA 4W87A 2XM2A 1BGAA 4JL2A 3OLGA 1OGGA 4CCDA 1HVXA 1WDRA 4P7OA 1GQKA 9CGTA 5HXMA 3LPPA 4UQDA 1W1VA 3HJEA 1UZ1A 1VIWA 1VBRA 1JDAA 2W5FA 4MJ2A 2QPSA 4FF5A 5ABEA 5LA1A 3WIJA 2WLZA 4UQCA 1U30A 3N1AA 1IZJA 2D22A 3N15A 5DT5A 3O6AA 1H4PA 1EGZA 1CYGA 1E4LA 3AS0A 1HXJA 4DM2A 3WD3A 1HIZA 1E4NA 3FHAA 1UWQA 1GHRA 2WMIB 4OUEA 4WJXA 1DWFM 4WK9A 4PSPA 2WZHA 4AD5A 3TTYA 2D24A 1UWRA 5IFPA 1CGTA 2VZSA 1G9HA 4UCFA 1QPKA 1AQMA 3U5UA 3WF0A 3A4WA 5HPOA 5EFFA 3WKZA 3KL3A 4J27A 1B3VA 3SCSA 1B0IA 1HJXA 3ZJ7A 3DHPA 3VDBA 1ZBKA 4P8UA 1TZ7A 4P8VA 3OGRA 2VZUA 2W61A 2J7BA 2WKLA 1K9TA 4XZWA 4MNJA 3IJ8A 3GH7A 4RL3A 2V5CA 1JFXA 2GFTA 5JIWA 4C7FA 1H0IA 2FH6A 3ZIZA 1H0GA 2WYSA 2OWWA 1XSIA 3A4AA 2ZOXA 3AROA 2HVMA 1LWHA 2YDQA 1ISXA 3MMUA 4LYPA 3UG3A 2CESA 3BC9A 2W67A 2GK1A 4S3JA 4BA0A 3L4XA 2WVVB 2J8GA 5A6AA 1XYFA 4Z2JA 3A6OA 1H5VA 2CHNA 2G8ZA 2WC3A 1SYTA 5CLTA 4AD1A 2XVLA 4HOWA 2DIJA 3VDCA 3UERA 2WSPA 2BVDA 4IPNB 2QMKA 1C7TA 3W53A 3N11A 1S46A 3W38A 1ZB5A 4J3SA 8CGTA 2YDRA 3N17A 4DUWA 2JE8A 4ACZB 1KGUA 4H7VA 3MSDA 5JBDA 3S6TA 3WNOA 4UTFA 2V5DA 1UR9A 1W2VA 1Q4NX 3VD4A 3OIHA 3F5LA 1QI5A 1RP8A 1I1WA 4PMYA 2RGMA 2G3JA 2GSJA 2VVNA 1E6RA 2XYLA 2J7EA 2ZUWA 2GJPA 1B3YA 1HKKA 4EANA 3AIVA 3BCDA 1X1NA 2G3MA 3KWXA 3WD1A 1RP9A 1FOBA 1MFUA 2A3EA 3TTQA 3SCRA 1V3MA 3WELA 4MNLA 1EIBA 1ITCA 3VGEA 1W2PA 4AY1A 3VD5A 1XSJA 3TP4A 4MTVA 1GONA 2J7CA 4XX6A 5A69A 5CSYA 3NSXA 2WKGA 1E15A 1E6SM 4P7QA 5GNZA 2YJQA 3AICA 1XRVA 4PUEA 4KH2A 2YBUA 2J25A 3FHQA 1JYXA 1CGUA 2VRJA 5HPCA 1VB9A 3II1A 4HU8A 1BGGA 2OWXA 1L8NA 2DGAA 4H2CA 3B9DA 3VX0A 4EAMA 3WNKA 1V0LA 2YLLA 1AVAA 4UZUA 2Y8VA 2XGIA 4UFIA 5BXRA 4XZBA 1O6IA 1H1NA 1WAWA 2PWEA 3POHA 1E6PA 1MQRA 4AEEA 1BPLB 4PMZA 5DT7A 4WSKA 5D9NA 1J0JA 2EPOA 5DEZA 5LYRA 2J79A 3OZPA 5IDIA 4H8UA 5TD4A 4HOXA 5A8QA 1JF5A 3WY1A 3HU7A 2DT1A 4E8CA 1QI3A 1JZ8A 1EO7A 1BAGA 3OG2A 3L2MA 3RM9A 3OLDA 2BY0A 4PCSA 3AS3A 4DWSA 4H8HA 4ZENA 4WSJA 3U5YA 1X6NA 2DSWA 5A2AA 3WQ4A 2CKSA 5CXPA 3M07A 2D20A 3EMQA 1CECA 3PBGA 1P6WA 5BXSA 1VFMA 2WSKA 4PMNA 4WLCA 3PZVA 4Z2HA 3CUGA 3PTKA 1J11A 1AQ0A 4GZJA 1Q6FA 2ZWYA 3SIMA 4PMQA 4OOUA 4GKLA 5M5DA 4KWUA 4B3KA 1G1YA 2IXVA 3CLWA 1HX0A 5HOSA 4FLOA 5D8WA 4ZEPA 2VJXA 4F9DA 3OGSA 2DDXA 5A6LA 2X0HA 1V0NA 2C8NA 2J75A 2J8FA 4X0VA 3GH4A 5FCZA 4W84A 1OCQA 3RM4A 1GCYA 2DH2A 2D0GA 2ZX6A 3DYPA 3LMYA 3PZQA 2TAAA 7A3HA 1KWKA 4DWSB 3VDHA 2ZUVA 2VQTA 5C71A 1NOFA 5LA2A 1OD8A 3VIMA 1PX8A 4D6FA 1KB3A 2DSVA 3AISA 4TVDA 4TVCA 2J47A 2XIBA 3PZ9A 4JHOA 2WVTA 3WENA 3VGHA 1R7OA 2GJXA 3WUFA 4AIUA 1E0WA 3NJ3A 1D3CA 3VIGA 1OBAA 3WEZA 1K9EA 1US2A 5BRQA 3TTOA 3L4TA 2JIWA 1JDCA 2WC4A 1MQPA 2WBGA 1VFOA 1PEZA 3NYDA 2DEPA 3UR7A 3AIUA 1H09A 1C91A 3AMLA 4BF7A 1XV8A 3F5JA 7TAAA 1DTUA 3EDDA 1M53A 1KR1A 1UOKA 1W3JA 2CNCA 5A3HA 2CKRA 2FDMA 3PZGA 2E4TA 1ZJBA 2VTFA 5DMYA 1CDGA 3G6LA 5BYWA 4PCTA 1BYDA 3PN8A 2PB1A 3WL0A 1BG9A 5ABHA 3W24A 5ABGA 4OKDA 1BFNA 1CNVA 1HT6A 1JF6A 4AWEA 4AMCA 2BNJA 2Q8XA 4Z2IA 1QVBA 1WZAA 1W32A 3ARRA 3IJ7A 4AEFA 2Y4SA 4BQ3A 2W92A 1WE5A 3OLEA 3M7SA 4P7RA 2ESCA 1RPKA 4E2OA 1FH8A 3WF4A 1OWQA 1NWUA 4GQQA 1K9FA 1IT0A 4YN5A 1EDQA 1E1EA 4AZGA 1HN1A 4UNIA 1HKIA 2NT1A 1V0MA 3NIYA 4UQAA 2WCAA 4AYSA 1C3FA 2J4GA 1KFWA 1J01A 1KQZA 2BV9A 3AMCA 2XPKA 3MUIA 4JZ5A 2ZXDA 2WK2A 3BAYA 1GOOA 2VVSA 3FNDA 1QHPA 4B15A 1UKSA 3UR8A 4LQ1A 4AZBA 3CZKA 2XVPA 5D4YA 2QPUA 4Z2KA 3SCPA 1CBGA 4D1JA 1PAMA 3CZLA 1E5JA 5E9AA 1CXEA 1NOUA 2E9BA 2UWFA 1EDGA 5IHSA 3N9KA 2V3EA 8A3HA 3WQ5A 4JFTA 3BMWA 1DP0A 1XSKA 3AIWA 4HMCA 4D71A 1GQLA 2Z1KA 3WDJA 3WD0A 1ZJAA 3VINA 1CTNA 1UR1A 2RGLA 1V08A 2WW5A 3NCOA 2WHJA 2B31A 3BAKA 5A8NA 4PYSA 3WMSA 1JNEA 4IPLA 1UR2A 3GXIA 5I79A 2XUCA 4QCFA 2DT2A 3BLPX 4HTYA 3MO4A 5I24A 2BFGA 3CZJA 3WSUA 4TOQA 1R8LA 4PMDA 1VBUA 3WF3A 1H49A 3AMGA 4ZE4A 4TX6A 2EO7A 1SMAA 3ALFA 4NSBA 3AJ7A 4CD8A 5A6BA 1WNOA 4XUYA 3W82A 2GDVA 1RD6A 4M1RA 2WZIA 2XIIA 2D3NA 1H11A 3GNRA 4JKLA 4ZE5A 2BHZA 4WIWA 4MDOA 1A3HA 1BLIA 2G4FA 2WCGA 3WNMA 2A3BA 1JYVA 4QLLA 3W28A 5CGMA 1C93A 4EKJA 1MFVA 1C7SA 1VAHA 1LLOA 1OT1A 2OYLA 1B2YA 3VIKA 2DPEA 2WZEA 4UFMA 4F9JA 3VGFA 1QI4A 2ZXBA 3GNOA 4R27A 1ZBVA 1TA3A 2DT3A 2EPKX 3BAJA 4AW7A 1HL8A 2Y5EA 1FHLA 1B31A 3VIPA 1B9ZA 2WWDA 4UFHA 3N04A 1V6WA 1EO5A 3AIQA 2UY3A 3W27A 4U3AA 5BROA 3BSHA 2E0PA 1UKPA 1MVYA 1BVZA 1QNQA 2XSBA 2YLAA 1HJSA 1MW3A 2XG9A 3WQ8A 4F79A 4JFVA 3WFZA 2WLYA 3AYRA 4U5IA 3U57A 3M46A 2YL6A 4R5EA 1QHOA 4PMRA 3FAWA 3SEPA 4JCLA 5D9MA 1BQCA 1J9YA 1LL6A 2BY2A 3UCQA 3K4DA 4GIAA 1JAKA 1YQ2A 4L4PA 3MMDA 3VD3A 2YL5A 4KRTA 3QOKA 2XGBA 1HKJA 1J0IA 1Z32X 1W1PA 4Z2LA 4LYQA 2GDUA 3EDEA 4BS0A 5EFDA 2O9OA 1JD7A 3THDA 4WF7A 3T2QA 2J62A 2DT0A 3EMCA 3RJYA 1QW8A 1WDSA 1E3ZA 3MSGA 2ZIDA 4OOZA 4TXEA 4GO9A 1CGXA 2VC9A 3WMCA 1OD0A 4JKKA 1YHTA 3PZNA 3WUEA 1ISVA 1EOKA 1CPUA 1C8QA 3WFLA 1V3LA 4UOQA 2OYMA 5M03A 3L4UA 5IXEA 7CGTA 4MJ4A 4AZCA 3GZAA 2PWFA 2PBOA 2WM0A 3QR3A 1TVPA 3O9NA 2BS9A 1E6QM 4ACYA 1LJYA 3B9AA 2VX7A 4DUXA 4W89A 4MB5A 3QOMA 2X2YA 1NP2A 1ODZA 4D6IA 1MW2A 4Y7EA 1UD3A 5I77A 2AMGA 3NDYA 1H2JA 4M82A 1UA3A 2IXUA 2VR4A 2WPGA 3WQWA 2UY5A 4CD4A 2A3CA 4P8WA 2WVUA 1W9DM 1QNPA 4IISA 4CN1A 5ECUA 3AZTA 3KE0A 3CHDA 4DM1A 3WL1A 3DECA 4XB3A 1M03A 4CU8A 2XVGA 1OGSA 5LA0A 4LXFA 2X05A 4MNMA 4F66A 4A4AA 3CHFA 5FD0A 3IAQA 3K8KA 3ZOAA 3T0DA 5E6ZA 1JXKA 3D3AA 2ZX8A 1ODUA 2VX4A 1XD0A 1XCWA 1L0PA 4YHGA 2GK1B 2D3LA 1R85A 1W9VA 3CPUA 3MMWA 4GO8A 4H41A 5ABFA 3ARSA 3RPMA 1W1TA 2WC7A 1JGIA 3CTTA 1EH9A 1UD4A 4D6GA 1B1YA 2D1ZA 3MANA 4NRRA 3N18A 3ZSTA 3ZJ8A 3VPLA 3RO8A 4UOJA 1W9XA 1C8YA 1EXPA 4H8VA 2ZICA 2XJ7A 1CXIA 4PTVA 1V0KA 2ZX9A 3LPGA 4V2XA 5I3DA 2BVYA 1JXJA 4IM4A 2EEXA 2V3FA 4LPCA 4D6HA 4XV0A 1F4AA 2GVYA 5FL0A 2E9LA 4U31A 1GJWA 1GOMA 2C0HA 2CETA 3CUIA 4QCEA 3B9EA 1UR0A 2O92A 5JH8A 5I78A 4YHEA 4ZFMA 3OGVA 4CU6A 5I5RA 1ZL1A 1V02A 2BY3A 2FH8A 3NSNA 4AZ5A 1C92A 3WQ6A 4IUGA 3ARPA 5F7UA 4EE9A 3FAXA 3W25A 2EPMX 4DWSD 1PPIA 5I0DA 3SCTA 3RCNA 2D2OA 1NH6A 1B3WA 1E4IA 1G94A 4TTUA 3CGTA 4AC1X 4DUVA 1LQ0A 2VL4A 3PZTA 2O9RA 2J78A 3BCFA 3CIVA 3CHCA 1K6AA 3VMOA 4FLQA 3APGA 4BZYA 1H41A 5AC5A 6CGTA 2WHLA 5AYBA 3CZ8A 1GQJA 1VENA 3ZM8A 2XWEA 3BAXA 3RM8A 4M8UA 1U33A 3W6MA 1JAEA 4W7VA 5D8ZA 3GBEA 2Y24A 2VNCA 2PWGA 1OIFA 5A8PA 1Q6CA 4D6DA 3NDZA 3AXHA 3IJ9A 3WEMA 2WNWA 1GORA 2VT0A 2VI0A 3CUFA 2CPUA 2DH3A 3WDRA 2WCSA 2G3NA 3WNPA 1W9BM 4QLKA 4N42A 4HA4A 1TVNA 1IV8A 1UH4A 3PZIA 3KL5A 1JI2A 3GM8A 1J0YA 4B16A 3AMKA 1JZ4A 1E5NA 1N82A 4BQ4A 4TTGA 5DFAA 2J7HA 1M01A 1NOWA 1GVIA 2CBJA 3WNNA 2CERA 2QHAA 3VIJA 3SUVA 4AIEA 4NZCA 1GNXA 1HL9A 4D72A 2JFEX 3CUHA 3VOCA 1EA9C 3DYOA 1HP4A 1XH2A 2WMHA 1C8XA 1FH9A 2VZVA 1E6NA 4AIOA 3ARZA 1XH0A 3CMJA 3ZR6A 1Q6EA 2ZUTA 1VEPA 3RILA 2W63A 5A94A 2J7DA 1MXGA 4AD3A 1H3GA 4GZEA 2DSUA 4UFLA 1G0CA 3WH9A 2O9PA 1CLVA 2EJ1A 1KWGA
chains in the Genus database with same CATH superfamily
1MW0A 3K30A 4FX6M 1J4HA 2Z1XA 2GGGA 2HBVA 4QTGA 1U79A 8RUCA 5I3IA 4FNQA 2DZXA 3VYLA 4HYWA 1SMDA 1VS1A 4O0KA 1Q7MA 3WUBA 4JQ1A 1UQZA 3KXQA 3TQ0A 3UWWA 4L4MA 4BK9A 4J3UA 1KBKA 1JL8A 5CC5A 1YTKA 5CGTA 1W31A 1A5LC 4UQBA 4FALA 4V33A 3G8RA 2GUBA 3S1VA 3W7QA 4DWDA 3AXMA 1Z6KA 3EX2A 4HD5A 2G97A 1R30A 3QHOA 2E5BA 4LAOA 3BGAA 3O5OA 2E8YA 5A1AA 1QOXA 4C6KA 3VA8A 3AUOA 3IJDA 3ZT7A 2Y2WA 4DZ2A 4ROQA 4F8XA 3V3WA 4XVEA 2NT0A 2VD8A 4GGHA 3NQVA 1GVEA 3HGOA 5AHNA 4QAIA 3C61A 3C8NA 3VOIA 4DB7A 3W2NA 2I5GA 5HW6A 3GHTA 3WLOA 3UPBA 1SO5A 2GJXB 3DKLA 4HMDA 4U2ZA 3W26A 3FXYA 2DQWA 2VR5A 5K4ZA 4NRSA 5CZTA 3ZZ1A 1X6LA 3WH0A 1W3HA 3MV01 2CITA 3WLPA 1R9XA 3AQUA 2GOUA 3VKCA 1FKRA 4Q7NA 2VM8A 1XLHA 3L65A 1N8IA 3SCNA 2C79A 1TX2A 3C2OA 4KETA 1QI2A 2R9RA 4MKNA 2MPHA 5T9CE 1A80A 5HBFA 2CHRA 2CLFA 5DO8A 3T08A 4GVGA 2A3AA 3KAGA 3EA2A 3OZYA 1W3LA 2LPVA 2OYKA 1EHAA 3VIHA 4HU4A 4HKPA 1BYCA 2FHFA 4WY0B 1LM1A 2ZZ4A 4PSRA 4KEMA 4YMZA 1VHNA 4MZ8A 3WH5A 2WB5A 3FJLA 3ITYA 5A2CA 1GEHA 3TU9A 3L4WA 4R9OA 1GJUA 3LNMA 3RJXA 1Q6OA 2QVHA 2OTDA 1QPLA 3IJLA 5FIPA 3K46A 3U6WA 3TZNA 4Q3MA 1ZCNA 5IM51 3M0IA 1E70M 1ZPTA 3MV11 1JUEA 2RDTA 1OT2A 2RUCA 5DANA 4OUIA 3C5QA 5EU9A 4FS9A 3ARQA 4OFCA 5BRPA 1US0A 4WKFA 5G2WA 3FJ6A 4PEEA 3NSMA 2OGYA 3KAIA 3FN9A 4C6PA 2DU2A 1S1PA 1W3KA 2ZQSA 4DBDA 1V6VA 4CGTA 2EKCA 5JBFA 6REQA 4GC3A 3EGJA 4KFPA 1FKFA 3G18A 1Q85A 2WMJA 1H62A 4GHRA 4JTAA 1TVLA 5CLWA 3VM5A 1KXTA 4ERGA 1JYNA 1W91A 2D2GA 2DVXA 4ZSUA 1BYBA 3TMQA 2JGYA 1AQHA 5I23A 2DG3A 4XISA 4UDMA 4HOZA 1UYQA 4U2YA 1FKBA 4CD7A 4UOZA 4XZNX 3N2BA 2ZDSA 5M17A 2AKMA 3H23A 2KO7A 3S47A 4D2JA 2C13A 3HO8A 4W8LA 3VUPA 2Z24A 2X1TA 4AH7A 3AHXA 3QPZA 5K7JA 1V3KA 4KWSA 4DIPA 3GD6A 2W4XA 1SM9A 3GXMA 4Z1DA 1ITUA 1ITQA 3MVTA 3CH9A 1GJPA 1K3UA 3BLEA 1BKSA 1TCMA 2EGZA 3CWNA 3CB8A 4OQVA 5GJMA 5DXYA 4S39A 4ZXOA 3IUIA 2J74A 1B3XA 5C9WA 5IBXC 3WBEA 4GWEA 2OLHA 5LIUX 4IQDA 4N02A 1OZQA 4HA1A 3V1HA 5MF5A 2QQ6A 2FZNA 3RAOA 3ABRA 3KACA 3M16A 2ZZ7A 3MW7A 2P5NA 3BG3A 4WX2A 3TAOA 4GQGA 3IVUA 1FP8A 2YOCA 2W66A 3CEUA 3WJWA 4CUCA 1SVDA 5D02A 1PIFA 2VFHA 3I7SA 4LBUA 3GVRA 3BXWA 2HWGA 1E9YB 3LCIA 1X38A 1LZOA 3SB0A 3O5QA 1IXPA 4GJJA 4R9XA 4QISA 5CPTA 4Y96A 1DJQA 1KR0A 3C6CA 3WLRA 2G3IA 1T11A 3KRSA 2JK2A 3JYJA 1EB3A 3OODA 1ROUA 1XFBA 3WYZA 4URIA 2Z0IA 3G1RA 3PZMA 4EAYA 2YDSA 3UJ2A 1OSEA 2R24A 1ESWA 4M7TA 2G96A 1EJVC 4NXKA 3L66A 7TIMA 3HQNA 2H6RA 1A3XA 2Q01A 3WNLA 1J4EA 4LBRA 4NZ4A 3SW6A 4EK7A 1Z8AA 2PUZA 4GY1A 2RKXA 1MO0A 1MW1A 4JN7A 3HFYA 3YPIA 1JI1A 3VX1A 2R14A 5HJXA 4HNLA 5I02A 5HNTA 3NQBA 3OA3A 5M3WA 2C6QA 1ZGDA 4AZCB 2QF8A 3P74A 5MKGB 1L2UA 2G5WA 3TWAA 2IPWA 3VOFA 3PZOA 3APTA 1F61A 2QUTA 1UKQA 1EEXA 1H7WA 4CU7A 3GHSA 3F2BA 4LX4A 5CJNA 1KXVA 4QFUA 1A5BA 4GI6A 1TJ2A 4HMEA 4TNSA 3IRSA 1IEIA 4PRWA 1FWTA 2E9MA 4U84A 1I75A 3PPCA 1L6WA 1PXGA 4GG9A 2YGYA 3NZQA 2JBMA 3TW6A 4H9MA 4YL2A 4DNMA 2NV9A 3LLXA 4W85A 1S2TA 1XHGA 4ZB2A 3A23A 3WQVA 4GJIA 4H01A 2N87A 1WP6A 1JDDA 1UWAA 1UWIA 2BASA 4YNGA 1S38A 3VOHA 1D7KA 3DCPA 4W5UA 4DRQA 4WXYA 3UY7A 4K68A 4MB3A 1VEMA 3IVTA 2GVEA 4NYYA 4HPGA 3TXZA 4FX8A 5C9UA 5ABFB 3CAKA 1MWOA 4ATDA 3EWWA 5JMUA 3HBLA 2XSXA 4GBUA 3SR7A 3KBNA 4PTWA 2PI6A 3VKDA 3CYJA 2Q6ZA 4GXPA 4HJWA 4IP5A 1O5KA 2V67A 1FCUA 1X1OA 3OP2A 3IUHA 2ZQVA 5HTGA 1P7TB 3FAPA 2ZE0A 5A2BA 1QW9A 5D03A 2ATSA 2QYGA 2ZRXA 1RH9A 2V63A 3B04A 4IT6A 1POKA 2NLYA 4C6MA 1S2CA 1R7AA 2PDCA 2XIJA 4I5UA 2C18A 3F4DA 4E4PA 4QLJA 5CJ5A 4R7WA 4QEEA 3TNBA 2QCFA 1DJIA 4LYKA 2D9FA 3IK2A 4ORIA 1UR4A 1OINA 3GRIA 3SCQA 2WXDM 2ZUSA 3N6QA 2WHMA 4I5XA 1M6JA 3ABSA 4I9AA 1EP2A 2ZZ6A 4QE5A 2VUYA 4JTFA 4N6FA 5DO2A 4MB4A 2BODX 1U5JA 2B5UB 4IZGA 1MYRA 1US3A 3FA4A 3T40A 1BTCA 5BXPA 2Q3RA 3ELFA 3S1XA 1IZKA 4FNPA 5BXJA 2F4EA 5HQMA 4K39A 2QCDA 4LH8A 1U2YA 1EEPA 4LEQA 4P7LA 1DHKA 3SGZA 2QNEA 1R9ZA 1SJDA 1FA2A 5FF2A 3URBA 1VC4A 4FXSA 1EC9A 4V27A 4LVAA 1W1YA 1WPCA 4TUFA 4B3LA 3O63A 2OQLA 3C0SA 2DG9A 4UQ9A 2CLPA 4PN2A 1TWDA 3CZEA 3K8LA 2YCEA 3B8SA 5KZ6A 1UWUA 4GCAA 3KZ7A 3USZA 1KQYA 1XC6A 1TE1A 1KGWA 5HA7A 5I3HA 1TMQA 4C6IA 4NI3A 1SZNA 4YTSA 3USBA 4CVUA 1P0BA 3NTYA 1YTDA 4RNIA 5G1YA 1CB7B 4X61A 2GJNA 3MSYA 1K9DA 3GDMA 4POCA 4AZHA 4X2PA 4EPEC 3W0KA 1FHDA 4LT9A 4B5WA 3DFSA 4RNHA 1SR9A 4BEUA 2GOKA 3U4FA 1QBBA 4DBSA 1JG9A 3GB6A 3R25A 4ZODA 1MDLA 5DQPA 5KINA 4DRNA 3IS4A 3MDYB 3B8DA 5CCZA 2I56A 1JDEA 3FSUA 2A1YA 3A3HA 4GYFA 4PBGA 1LF1A 3CMGA 2XFYA 3P0WA 1JPDX 1N2VA 2GPTA 4NNRA 3CBWA 4L9XA 3RMEA 4GYKA 4QHRA 5K4XA 1N8WA 3THQA 4FAPA 1UKTA 1LL7A 1DJNA 1V3JA 3E0IA 3R4IA 5B7ZA 3GHUA 1QZ2A 2PC8A 2V81A 2E40A 2L2SA 5EYWA 3ZLFA 4DF1A 2VC6A 2PDYA 3L2IA 4HZ8A 4F0MA 3BGJA 4FNUA 1JCTA 5FESA 4MADA 1G67A 1G5AA 1V77A 2FZMA 3GVQA 1E9LA 3B0UX 5G2HA 2VFGA 3GDRA 3VGDA 2I17A 3JUGA 2ZTKA 3WH8A 5KEZA 4OBTA 2FKPA 3A9BA 5EB8A 4G6CA 2GVJA 4B90A 4TVUA 1SSDA 5AC6A 3PS7A 1WDWA 2BVTA 2ZKMX 3PAOA 4IP4A 1JZ2A 1KCKA 2XSAA 3LHZA 4Z1AA 4AU0A 1BG4A 3T55A 1EQ3A 1J18A 2FHBA 4H04A 4FOKA 1YBQB 2CHOA 2RUQA 2Q3OA 2WMIA 4UR9A 2PDLA 1K77A 5E6YA 4YYFA 3UWZA 3GO2A 3H2NA 1ZENA 3W1UA 4S2BA 3VABA 3D3FA 4PMJA 5HUAA 2VX5A 3WUGA 4CVWA 1NMWA 3U2ZA 1IF2A 4W87A 3TC5A 4PFMA 4X3ZA 1BGAA 1SFTA 1YW5A 3ZXWA 3Q37A 1WDRA 4NJKA 4C6DA 4C60A 4HB7A 4K1WA 1GQKA 8XIAA 1S5MA 1Q13A 3PANA 1W1VA 3T42A 3NM3A 1JDAA 3GTYX 3MA8A 3H7VA 3GNXA 2QPSA 4MJZA 3R7MA 1XIGA 1G7UA 1PTAA 3GUGA 3KBSA 1EBGA 1GW9A 3P6LA 1U30A 1UW9A 1YXCA 1XLBA 1AMKA 1AW5A 1EGZA 4R88A 1CYGA 1E4LA 3WD3A 4RV3A 4AVNA 3FHAA 4UXDA 2OX1A 1FKLA 4AD5A 3TTYA 2QDHA 1H1YA 5AYZA 4LUYA 2Z2UA 1PS9A 4LUJA 4NYUA 5F4XA 3GR8A 3W1RA 4YYCA 4KCTA 1VBJA 2XP7A 4XAPA 1DQWA 3GUWA 4UCFA 3PC0A 6REQB 2MNRA 3WF0A 5HPOA 3WKZA 2LJ4A 4QIBA 3SCSA 3TDBA 1B0IA 5REQB 3ZJ7A 4PTDA 4ZL1A 4M7SA 4A6GA 1ZBKA 3GE7A 1DIDA 2J7BA 4JNYA 1K9TA 1K7FA 1ONWA 2DIKA 4H6QA 4MNJA 3HG2A 3IJ8A 1FKSA 3MHFA 3QR1A 3GH7A 1MUWA 2GFTA 3W1XA 4HN8A 3B03A 1H0IA 3O8AA 3AUJA 3QPEA 1QFEA 2ZQUA 3P5YA 1XSIA 4DO4A 4RJEA 3NNTA 3UG3A 4IGMA 4S3JA 1TTIA 3L0GA 2HNHA 5DXXA 2J8GA 4Z2JA 2EG8A 3N9RA 2FLIA 4K3ZA 2G8ZA 4E3VA 1SYTA 1F8MA 5DY3A 2FMNA 4XZMX 3ITOA 1IWAA 5TNVA 5F2GA 3T81A 3EOSA 3VDCA 4W9TA 4HK7A 3TVAA 2TPSA 1DJWA 1EF2A 2PGWA 1KKRA 3DFOA 1C7TA 3KBWA 4I9JA 2NV1A 3N11A 4DH0A 3TDFA 2KZHA 3W38A 1BWVA 3EB4A 3AO0A 4FNSA 4KT2A 4XWUA 1Q1CA 1K02A 3LTPA 3G1XA 4MG4A 1EUNA 1W2VA 2YCLA 3VD4A 4GIYA 3F5LA 2I1OA 3HGJA 4PMYA 2G3JA 4JPGA 1E6RA 2J7EA 3RX2A 1B3YA 1X1NA 3VI2A 3KWXA 1FOBA 4US5A 2A3EA 3SCRA 1V3MA 4N4PA 4ZQNA 3VGEA 5CAHA 4L6OA 1GONA 1SU5A 4J40A 4LNCA 5F4WA 2ALRA 3NSXA 4A2SA 1E15A 4PUEA 1TIMA 3NDOA 3QJAA 4L72B 1JCJA 1JYXA 2VRJA 3BV7A 2QZRA 3GVGA 3W9ZA 5IBXA 1BGGA 2IKHA 4H2CA 4HU8A 4GQBA 1I9CB 2PCEA 3QQ1A 3WNKA 1JJKA 1AVAA 4HPXA 3LHUA 1P0EA 3L5MA 4DXVA 4JFKA 1BF6A 2XGIA 4GA8A 4UFIA 5BXRA 5GVJA 3UCDA 1Q3NA 1O6IA 1WAWA 4HYRA 2PWEA 1E6PA 5DT7A 1XIDA 3FKRA 1XIIA 4B4FA 2RH9A 1ZFJA 5DEZA 4F0RA 4UTUA 4HOXA 4H8UA 1JF5A 2F84A 3MUXA 3BE7A 1NIUA 2Y7EA 3QXBA 3ITCA 5C9RA 1QI3A 1UJQA 1EO7A 1E44A 1E0UA 1EXBA 2PV3A 3RM9A 5FACA 3OLDA 1H50A 2BY0A 2X16A 3GNDA 5LIXX 4G9PA 3AS3A 3PM6A 4ZOCA 4WSJA 2OLSA 1YNQA 3MHUA 3UXAA 3T1GA 4LF1A 4OV9A 3IIOA 5FJIA 3M07A 1F9CA 4X63A 3QFWA 2OQHA 3JYMA 5BXSA 4L5ZA 3SRFA 4WLCA 1AQ0A 2ZWYA 4PA8A 3SIMA 3AAMA 4NNCA 4OOUA 2KFWA 2WJFA 1XLAA 2IXVA 4DYJA 3HV9A 5D8WA 4FA3A 4BFAA 3ABXA 3OGSA 3FLUA 1V0NA 1DJHA 3AYVA 3IUDA 3I6EA 4X0VA 4M6VA 1GCYA 2G4JA 2ZX6A 3WMLA 4NAFA 3OVPA 2TAAA 1TR9A 2XP5A 2IKJA 3E2RA 3VDHA 3UI4A 2VQTA 5C71A 5JH1A 2WNZA 1FWEC 1OD8A 1AH4A 5JVLA 4D6FA 1KB3A 2DSVA 1F6PA 3AISA 3KCOA 1YX1A 2XIBA 4ZPWR 2NQZA 4H2HA 3VGHA 3LCFA 1R7OA 1RCXB 3NEHA 4AIUA 1D3CA 1M7PA 1BSLA 3UWEA 3VIGA 3P60A 4ODKA 2C1IA 1PVNA 5FF4A 2YYTA 3GFZA 3KRUA 6XIMA 4ICMA 2QCHA 5HMFA 2JIWA 2WC4A 1FAPA 4HNTA 3UR7A 3AIUA 1H09A 4BF7A 5DBTA 3EDDA 3IJQA 1KR1A 1R0MA 1UOKA 4A8IA 2CKRA 5EPDA 3TZFA 2FDMA 1XBVA 5DMYA 1CDGA 2GQ3A 4O8RA 1OCNA 4UR7A 4DYKA 4PCTA 3PN8A 3WL0A 3T0CA 2GSHA 3AWOA 2V2HA 5ABGA 4AWUA 1M68A 3SGGA 2PTDA 1CNVA 4JN8A 2PDNA 4ML9A 3P62A 4EWJA 2X1RA 1TPC1 3TW7A 4K1GA 4JX4A 4BQ3A 3S5OA 2W92A 4P7RA 4QRNA 4ZO7A 4DEFA 4GQQA 2X40A 1EDQA 4ZQPA 2KE0A 2DFAA 1P0KA 1E1EA 3THUA 1CCWB 4UQAA 2J4GA 3EXSA 2PPOA 3HZ3A 3IRDA 3APYA 1DE5A 1JR1A 2VVSA 4JTEA 3HIJA 4B15A 1UKSA 3RRXA 3MKVA 1TWIA 4ICCX 2QPUA 3MMTA 1FWRA 3SCPA 3TCZA 2GWNA 2UBPC 2ON3A 3MI3A 3N9KA 3O06A 2V3EA 8A3HA 4RNFA 1GQNA 5J5DA 3QBUA 1XSKA 1DORA 4LAXA 4HMCA 4D71A 1AH3A 4K8GA 4MSPA 1VBHA 5B80A 3ID7A 3B05A 1KBJA 4GNVA 3BAKA 4IPLA 3PNZA 1UR2A 3CV6A 1WUFA 4LBSA 1VLWA 4QQ3A 4MKVA 3W7IA 2V9DA 4Q8TA 1GT8A 4HTYA 3DC8A 1JQVA 3GXTA 3U48A 1X39A 4TOQA 1LT8A 1R8LA 1UOZA 1H49A 2J88A 3LGEA 4WY0F 2EO7A 4DZIA 4US6A 3AJ7A 4CD8A 5A6BA 1Z3NA 2ZRWA 3NQMA 3IGSA 2D3NA 3KOZA 3CQJA 4MZYA 3VCCA 3DXIA 4WIWA 4B3ZA 5M1TA 4MDOA 2Z00A 4UBPC 2WCGA 1HGYA 4AX7A 1DE6A 1JYVA 3ABOA 4Y9MA 1D9EA 3TYZA 3KS5A 3GG7A 1VAHA 1LLOA 3O5GA 2PLCA 3UXDA 4JDYA 1B2YA 3VIKA 1H63A 4ICNA 2WZEA 2FZ8A 7REQA 4A05A 3VGFA 3TUUA 1PKMA 2DZVA 3RPDA 2DT3A 2D73A 4IT4A 1EP3A 4GUFA 2ZZ2A 3VIPA 4UFHA 2BVWA 3N04A 4D8AA 3AIQA 4OGZA 3TR9A 2G0WA 4H9TA 1TZZA 5HNUA 2PRLA 3H2FA 4QX4A 2P8BA 1H61A 4J9JA 5D2YA 1QNQA 2XG9A 2V5LA 4F79A 3WFZA 1VFHA 2WLYA 3AYRA 5AVNA 3M46A 1QK0A 3BLIA 4PMRA 1GVRA 2ZR6A 4JCLA 3EAUA 4ERAA 1A3WA 3K4DA 1PTGA 4GYJA 1RV8A 1VCGA 4K37A 4L4PA 3UXLA 1NU5A 3VD3A 4GYPC 1Q4WA 3EWDA 2RUDA 3HPZA 4ERIA 3WBXA 4N9BA 2B7NA 3EDEA 4BS0A 1N1AA 2O9OA 3OHMB 3LN3A 1D6OA 2A4AA 3A4JA 5DCEA 4TO8A 2DT0A 2POTA 1BL4A 3TH6A 1KA9F 3RJYA 1TV4A 3IGXA 2WSQA 1QWKA 4GUGA 3N6HA 5HAOA 3QFEA 4GO9A 1CGXA 4DJDA 3WMCA 4NP7A 4JKKA 1YHTA 3PZNA 1EOKA 1FQ0A 4HHLA 4HHMA 1Z41A 2V68A 4XAYA 3AJXA 5M03A 2G95A 5IXEA 4MGVA 1O1HA 3GYEA 2I9EA 4WDXA 1BD0A 2VFEA 4NX0A 3GZAA 2REQA 4DROA 1ZRQA 2PWFA 3NG3A 1Q6RA 1FD9A 2WM0A 1TVPA 3O9NA 3ENLA 3BPWA 1KFLA 2Q8LA 1LJYA 2ZC1A 7XIMA 4Q8UA 3SQLA 5LIYX 1KRMA 1OX4A 4JTDA 1ODZA 1MW2A 3O5LA 2F6KA 4ZPVR 4ZR8A 1P5QA 2AMGA 3NDYA 3M0XA 1UA3A 3KP0A 4CD4A 2A3CA 4QJ1A 3B8VA 2R82A 3AZTA 1KCXA 3KE0A 3L0NA 3WL1A 4XB3A 1M03A 3BW2A 2SFPA 3S1UA 2XVGA 2YZ5A 3S9IA 2PODA 4JQ3A 4ODNA 3Q2DA 2QDDA 5FD0A 4JEJA 3FDGA 2Z6IA 5BOOA 3ZOAA 4GH1A 4MYAA 1O95A 5C0QA 1NDWA 4IMAA 3ORWA 1DIEA 5LNRA 3H53A 3CPUA 4U86A 3MMWA 4H41A 1CX9A 1W1TA 1UR3M 2YB1A 2J66A 3RO8A 2PD9A 3EKZA 4I9TA 2D69A 3LGDA 3PSVA 2Y62A 3VKAA 2GVGA 2ZX9A 3N73A 1JXJA 4IM4A 5EY5A 4YJ5A 3G0UA 3TV8A 1OFEA 3GTFA 1GJWA 4ZO6A 3CUIA 4QCEA 1UB3A 2O92A 4M0XA 4YHEA 2ISVA 4LUSA 4EIVA 1ZL1A 2FH8A 2NVDA 5D09A 3SSJA 3C86A 4EE9A 2YCLB 4O11A 1A53A 4S1FA 3GS6A 3WLIA 2AL2A 3HGSA 2KAUC 3RCNA 2D2OA 1XKJA 4WDUA 4DUVA 3BURA 5FI8A 3C0JA 3H2AA 1OY0A 2J78A 3BCFA 1OYAA 3CIVA 1KNWA 4IIGA 4FLQA 4QG9A 3DG7A 2O0TA 6CGTA 1JPKA 5AYBA 3CZ8A 4G50A 3S5ZA 3HV8A 3NOEA 4ZCWA 1VRDA 3GZ3A 3W6MA 3BV4A 1YW1A 5C5YA 3GBEA 3EX6A 1QPFA 2VNCA 2W0UA 4M6UA 3DKJA 5A8PA 4D6DA 2ZTJA 2ZQ0A 3CUFA 3UU0A 2IKIA 2G3NA 3UFYA 5J6EA 2QJJA 4N42A 1VFSA 1T96A 1UH4A 3TJ4A 1EP1A 1EUAA 4B16A 3MCMA 1RR2A 1D3GA 5DFAA 4MFEA 1YIXA 1M01A 2J8TA 1EGMA 1GVIA 4NQ1A 3P8IA 2CERA 4GIEA 1W5OA 3IVSA 4MKSA 3M5ZA 4CNOA 3VOCA 3DYOA 2AKZA 1GVFA 3C2YA 4NUWA 4O4WA 4FF7A 3ARZA 2OGJA 4O18A 3B8WA 4TW6A 4S38A 1Q6EA 3SECA 2Y8UA 3ZR6A 4E5TA 3OJGA 3I7RA 4NZFA 3M0YA 3CO8A 4DJFC 1G0CA 3WH9A 1CLVA 2EJ1A 1BXNA 4WZHA 1OFDA 4LWWA 1V03A 3A47A 1PV8A 1BF2A 4RE3A 1TTJA 1HNYA 1XUUA 5AHLA 1K8XA 2YSWA 1NWSA 2XHYA 4G7EB 5CPSA 5I2UA 3M6DA 3SIZA 1PIGA 2FGZA 1M5WA 4RV8A 4H3DA 2UY4A 4AWSA 1I2RA 2RURA 1TQJA 4ILSA 2XVNA 4JTQA 4XO7A 4ZSTA 4IG2B 3B0PA 3PJXA 1E4MM 3NUKA 2O7SA 1VKFA 2QJMA 1IWBA 5BWFA 3NPVA 1TMLA 1ISZA 2IW0A 2J9XA 1NDZA 3KZSA 2O9TA 4X22A 4CNNA 4NAFB 1JPMA 1G01A 2PU1A 3W6YA 1RPXA 3TROA 1J2BA 1WUEA 3VCRA 2QCMA 4TYOA 4G2DA 4RDWA 3CQ0A 4IQEA 3GBDA 1ELSA 3W81A 1IE7C 3MSRA 4E4UA 2ZUNA 4NZ1A 4Z17A 4XBJA 3BICA 4H9UA 3N12A 4L61A 4QS6A 2YW3A 5I3GA 4L9YA 4JYDA 5DY2A 4BQ5A 4AD0A 3ITVA 4FXRA 2DG4A 3W74A 3SCUA 2VDHA 3WJSA 4QDMA 2C19A 3GTHA 1GG0A 1ZP4A 3T0TA 2YBTA 1A5AA 4ADUA 4C6FA 4IGSA 1XH1A 3LXBA 1KCLA 1FH7A 4AZIA 3NXLA 3VC5A 2IF4A 4O2TA 3JW7A 1RBAA 4GISA 4JHZA 3LCWA 3UG5A 3NQFA 4Q4SA 3DYMA 3GTNA 2W62A 3PHAA 5EMJA 3IJIA 1ZU8A 1DWGM 6ALDA 2VYOA 4XIMA 2ZX5A 3ZQ9A 3UYCA 3ARTA 5CG0A 2H3BA 3T07A 1UBPC 4IFKA 3UQBA 3CU2A 4JIHA 1UH3A 3WCZA 4AZ6A 1RBLA 4O19A 2XN0A 4BQ2A 1NDVA 5LGZA 4C90A 1E71M 2XU2A 2VZOA 3IPWA 4MF4A 2PWDA 3OB8A 2VRKA 2EQDA 5T8GA 2J27A 3BMXA 1P43A 3EBVA 1K4HA 4OVXA 1HF6A 5A5WA 1JIBA 1Q6UA 4AFYA 3CV7A 3ZR5A 5CEWA 1KM3A 3P93A 5H6HA 3W37A 4LAYA 2OWCA 3G1HA 1I2NA 3DH7A 1ZLPA 3I65A 3QGAC 3H55A 3UGRA 5AOUA 4UIOA 4JX5A 5DBUA 4W9OA 4H4IA 2QCGA 2V82A 4EOUA 1PHQA 4HYVA 4C7GA 2JEQA 4PMOA 2CCRA 3UW6A 3POCA 1E43A 3CHEA 2VGBA 4ATLA 5D30A 1VJZA 2WQPA 2Y7DA 3NR0A 2YX0A 5HMEA 1GYLA 3SO7A 3T05A 3FDKA 2AGKA 4RW5A 4B9YA 4XG1A 4FIQA 1GOQA 4UC5A 1OGBA 1NM9A 1D2KA 3CIXA 5HUOA 1EPXA 1FXPA 3W23A 1ZY9A 4UTLA 1D3HA 3SUUA 2WJDA 3AS2A 3TJIA 3JR2A 1Z9AA 3MP3A 3K4AA 1TE6A 1QASA 4QT3A 3GU2A 4UTWC 3AS1A 4GY7A 3AYTA 3P80A 4XO6A 3H6OA 3NQ2A 2PGEA 1AZ2A 1VJIA 3EWCA 2PDGA 2OXNA 3F2CA 5C70A 5D04C 3KBJA 2PWHA 3O0KA 1AJZA 3WDIA 2DSKA 3E12A 3LCHA 4P2VA 3SUWA 3U7BA 1LWJA 1LL4A 4DPPA 1RY0A 4V15A 7REQB 3BQ5A 3OBKA 3GG8A 1JZ7A 4OHQA 2CBVA 4XBSA 1XIMA 5C8BB 1ISWA 3E5PA 4A3HA 4GXWA 1RK6A 3W85A 2MLZA 3I3EA 3N4AA 1SZGA 3QY6A 1PX4A 3ISIX 3S6OA 2XM1A 1E0VA 1QXLA 1YRRA 3A22A 4F0SA 3L4ZA 1VCFA 3ME3A 4LB4A 5BCAA 4C91A 4XKMA 3B97A 3RLGA 4J3WA 3E0FA 4HN4A 4PFHA 2PV1A 2EPNA 1YPXA 3TTSA 1Q5MA 3DESA 1PDZA 5TBOA 3EPOA 2E5DA 1TFVA 3JXVA 3PR9A 1QI0A 1UD5A 3EWBX 3WO8A 1F3XA 3TOPA 1DWJM 3VGGA 5D2WA 3L4YA 3WDPP 1LBLA 2WMGA 4WHBA 3KEHA 4DWSC 3BL3A 1D7IA 2WMKA 1P0DA 1NF7A 1WB0A 1I2PA 3KZPA 4P8XA 3MTWA 3PPHA 1E1FA 5FSDC 2FFIA 1XIHA 1OG6A 1ZTVA 3V5CA 3MZ2A 1EC8A 1UR8A 1MRQA 4IWWA 4U3CA 3SCVA 3S2CA 3N13A 3IGUA 3DI0A 2VDGA 2PBCA 3W7MA 2OSXA 1Z69A 3LX9A 4E2BA 3M47A 3CEPA 1R5YA 4US5D 3FFSA 4GZIA 5CBJA 4AQLA 1LDCA 4BWLC 1EPVA 4CNTA 1YDOA 5FOOA 1IEQA 3O5EA 3PP7A 2REQB 5FKYA 3WLKX 1FWSA 2VEGA 4J3ZA 3L7RA 1UMLA 4HQVA 1NQ6A 3M0MA 5JU6A 1J5SA 4YTQA 4OECA 4Q8QA 2A5HA 3PNUA 3PWAA 1OX4B 1XM3A 3CWHA 4FNRA 1BVNP 3BOXA 1QUMA 1HVQA 5H8UA 3DC0A 4AF0A 1FFQA 2ONEA 2M08A 4YVPA 5EMYA 2JQXA 2HBXA 3H21A 4XD5A 1R6WA 3VNJA 3GU1A 3CQKA 3HFTA 4LU0A 2YL9A 1Y5WA 5HMSA 4JKMA 2BP1A 1WV2A 3PUOA 5F2MA 3PTQA 3VKKA 4Y90A 3IIVA 4NHVA 3PTDA 3CLMA 3G77A 1B90A 1XGEA 3MUAA 5BXTA 3VU2A 1J8VA 3GDLA 1FWFC 1W5NA 3UJFA 4C5YA 5HR6A 1LOSA 1FDJA 4AY7A 1VIZA 4DLMA 1YADA 3R13A 3NM1A 4GPNA 3BAIA 4RE4A 2JKEA 1XYZA 3Q65A 4HPJA 3H24A 1V3HA 3NXFA 3EB3A 4HZ7A 3K8MA 1UG6A 1UIPA 1EJXC 3BLLA 1JCNA 3GTXA 3OYZA 2YCKX 3ARVA 1O5XA 2E1WA 3AZRA 5TF0A 1FWCC 4N0RA 4LV4A 1JCXA 1QU4A 2ZXAA 3A5VA 2W79A 2QGHA 4EVZA 4BY3A 5G4WA 4YWSA 4LUSB 2QLYA 1KM5A 2QF7A 1QNRA 3LG3A 1CB2A 3JVAA 2XTKA 4ORMA 4O52A 2NW0A 4YWIA 2HROA 5AC4A 3THAA 4Y6GA 2ZA3A 2VCBA 4OBRA 1S5TA 4RZ6A 3W86A 5I06A 4GVIA 3AWNA 4GC4A 3QYSA 2AL2B 5E0FA 5FJRA 1JCLA 1S3TC 5K9DA 1Q6QA 1FWDC 3G1SA 3QYQA 4EACA 4WKAA 3PUEA 3ATZA 1NFPA 4NNBA 3ARXA 4KMQA 2ZVIA 4Q33A 1Y7VA 4MNKA 1FTXA 2E3ZA 1UC4A 3IV3A 1VJSA 3N2OA 1PWMA 3RDKA 2RUSA 4P61A 1J6OA 1DWAM 1XC4A 4LC6A 4Y9PA 3ES8A 3O5PA 3OA5A 4PGLA 3P14A 4O50A 2AL1A 6XIAA 4LCSA 3SY8A 1G4PA 2V6AA 3MUY1 3ARUA 1JULA 3FK4A 4HSNA 1GG1A 1T0OA 5I00A 1SO6A 3CPRA 4DRIA 4FIRA 3VXGA 2JIEA 3VD7A 1HG3A 2BXZA 1OVDA 4PUNA 4JTJA 2C16A 1ZAHA 4HK6A 3ZR4A 4ZXLA 3QHMA 3W71A 1FXQA 2WSYA 3LB0A 3I6CA 1XISA 2C7FA 1H7XA 1WYIA 3LHTA 1UUQA 1REQA 1JD9A 1UPMB 4FPSA 3MPGA 2TMDA 4HCHA 4HCLA 1P6CA 3JS3A 2Q71A 3TA9A 1KFKA 3F2DA 1SGJA 4Z1CA 4PUUA 2WAGA 2VMFA 2CEQA 1VRXA 4ZOAA 5JIPA 3S1WA 4PODA 3CT7A 3FIGA 2ZFAA 4EXBA 3UA4A 1W17A 4MAZA 1W9PA 3CIWA 1YNYA 1AFSA 1VGAA 2YXXA 3TYEA 5CAKA 4QSFA 2QUUA 4E6MA 1GQIA 1QT1A 4J1OA 4HZ6A 3MBDA 2YL8A 4REQA 4LCRA 2WBKA 4MWAA 1ITXA 3WJZA 3FW6A 1OK4A 3GU9A 3E2QA 5EL1A 4C1LA 3DFNA 5AC7A 2ISDA 3W83A 7PTDA 5KZEA 3VMNA 1UUOA 4MAVA 4ROPA 2QKFA 3BK0A 4W5ZA 1O5QA 1IEXA 4QZVB 1D7HA 1LBMA 2YB4A 3H7RA 3TA6A 4DQWA 3SY5A 1F4HA 3O5JA 1UC5A 1Q7QA 4AZ7A 1TB3A 1E72M 4IFOA 1XCXA 1UA7A 2V38A 3QZAA 2IQ0A 1GKQA 1IHIA 5D33A 3F5KA 3HG5A 1JYWA 4GLEA 2DW7A 2A21A 1SZEA 2D23A 1O4UA 4TW8A 1ZS2A 3QVQA 3ZSSA 1CWYA 3LNPA 3R58A 3VDAA 1TTQA 4GMEA 2WWCA 3ZJ6A 5HQLA 3KX6A 4J3VA 1GHSA 3MUZ1 1RA0A 4Q4MA 3O5IA 1UD6A 4B5TA 4HVXA 4C6EA 1XDMA 4L6DA 5CZSA 3LD5A 1YDNA 1H7RA 2CBIA 1SW7A 4AD2A 2BY1A 5I03A 1LUCA 4FLSA 3T8LA 4QAWA 2VOTA 1L6SA 2GUYA 3W4RA 2YXGA 3PB2A 1CGWA 3ARYA 2PP1A 1PWLA 1KM2A 3HMCA 3ZT6A 3SJNA 1LWIA 2JKAA 1HVXA 3ZVIA 4D8ZA 3SN0A 1TPB1 3KADA 4XD4A 3TXVA 3OEXA 4LUTB 3S2NA 3K5XA 4DAFA 4A3QA 1EJ7L 3TC6A 4FSAA 3LCXA 4MJ2A 2O55A 5LA1A 3URQA 2AAMA 3V0SA 2PA6A 3N6JA 3GXNA 1MMFA 3RUBL 2FPTA 1HXJA 3AS0A 4DM2A 1E4NA 3TN5A 2C1HA 1BTMA 4WK9A 2VEKA 4PSPA 2HXTA 1Z44A 2R1PA 2ISSA 3S3GA 3GPKA 3DG3A 1TV7A 1EIXA 4O1DA 4DJDD 5LNWA 3LOTA 3VFCA 1TWWA 1ZCCA 2OMAA 3WQFA 4S3GA 3KL3A 4MLRA 3XINA 1RXOB 4J27A 3LENA 1B3VA 4DXXA 3PUGA 2HDJA 1WBJA 3WX7A 4NJGA 4QG8A 3OGRA 2XP8A 2OEKA 5D05A 1J6YA 2Q09A 3GG1A 4IPIA 1NFGA 1A0EA 1ZNNA 1LCOA 1V79A 4UUIA 1SO3A 4C7FA 2FH6A 1M5YA 3ZIZA 2A2IA 5BZAA 1S2AA 3A4AA 1AJ0A 3BQ6A 1ISXA 4LYPA 3BC9A 1XGDA 2GK1A 4Y2WA 3JU2A 1UP0A 2X7VA 3STFA 3L4XA 2F2KA 5JQ9A 2OZ0A 1XYFA 3NQDA 1H5VA 1U1JA 2OOFA 4ADSA 4Z42C 1S5NA 2BLEA 1YDYA 2E77A 2XVLA 3ANYA 2LKNA 3ZVHB 3L68A 3QZ6A 4L9ZA 4A8RA 3HURA 1LP6A 3HPFA 3S5NA 1FCQA 4U28A 4Q4KA 2I7GA 2WSPA 5HT1A 2ATMA 4I7VA 4IQCA 2BVDA 4K7YA 3CV2A 1K8CA 4IPNB 4AG0A 2WZMA 5LKYA 3EWZA 3KS6A 1FJDA 1PYMA 4N9DA 1S46A 2W9MA 4MSSA 5KSWA 2MLYA 1JPIA 4DUWA 1XLMA 2R1LA 1E1CA 3O6YX 3OIXA 2ACRA 1QOQA 4H7VA 1M7OA 3QRHA 1WA3A 3CM4A 3S6TA 2AMXA 4BKNA 4UTWA 3RPTA 4MVAA 4UTFA 2V5DA 4DO5A 4GI4A 5AB3A 1UR9A 1FKWA 1FDZA 3EKLA 3UD6A 2VVNA 2XYLA 2ZUWA 2V69A 3OHIA 2GQ9A 3ONBA 1WKDA 3AIVA 4PCPA 2XIOA 2G3MA 2YR1A 3NQ6A 3TTQA 4FOJA 1PKYA 3M0LA 1ITCA 3MYOA 4O1BA 1YEYA 3CQIA 1XSJA 2BMBA 1H51A 1R2SA 3UWVA 4XX6A 5A69A 3NVDA 1TPUA 1DBTA 4L65A 3AICA 4TX9A 3H54A 5FJPA 4KBXA 1CGUA 4YS1A 4KCWA 4GVFA 2OWXA 1QPOA 2PZNA 1V0LA 3LHWA 4UZUA 1AD4A 3I6RA 2Y8VA 3RGCA 4PTNA 2ABBA 3EPNA 4WJEA 3POHA 1MQRA 3P61A 2FPYA 1BPLB 1C9HA 2FGBA 4I7UA 3HG4A 5D9NA 2ZA2A 3DFTA 2PDQA 3TEVA 2J79A 5TD4A 1UUMA 5MHBA 9XIMA 4KQNA 3NOYA 4YVXA 5B8IC 3PG8A 3WQGA 4E8CA 1NY1A 1J96A 4HBKA 1V6TA 5XIAA 1JZ8A 3WLJA 3E9AA 1BAGA 3REQA 4AB4A 1W1B1 4Y9OA 4AF0B 3PJTA 4TIMA 4PUMA 4DWSA 4H8HA 5G4EA 3CPGA 1IXOA 3NPXA 4IFRA 4K2SA 5A2AA 3WQ4A 3TC3A 1ICPA 2OZTA 3KVKA 4FN2A 2D20A 3EMQA 1CECA 3PBGA 1P6WA 1W5QA 4JTGA 1VFMA 2WSKA 2FMOA 2BOEX 3PZVA 1J11A 2NX3A 4DI9A 1A5UA 1VP5A 5DIUA 2ZRUA 4GKLA 3H2CA 5M5DA 1RQBA 1W5MA 4KWUA 1RVGA 3G1DA 4BWLA 4I3GA 4BF9A 3FXGA 4QEHA 5CBIA 3CB3A 2FZ9A 4JTUA 4AIBA 2BZNA 1EGVA 1ML1A 2C8NA 2J75A 3GH4A 5FCZA 1VHCA 1OCQA 3VNDA 3KOFA 2F9RA 4IMFA 2ACUA 4JR5A 4KW2A 1CT5A 2X1UA 5FJOA 3VOGA 7A3HA 1KWKA 2Z25A 4LTSA 3KDNA 2HV5A 1NOFA 4WGHA 4AXKA 1VLIA 5C2XA 1P5BA 3BW3A 5CJMA 4F0HA 4R85A 4AEOA 4U10A 1ZSXA 5AN7A 3WUFA 2OFNA 2PDIA 1TO3A 1ICQA 4GGBA 1W3IA 5BRQA 3NQ8A 3L4TA 4H7CA 1JDCA 3KCEA 1TCDA 2WBGA 3TLLA 1VFOA 2BWGA 3NYDA 3N34A 2DEPA 3GR4A 5CPMA 3AMLA 4ZO8A 3F5JA 4UTHA 7TAAA 4JIIX 4V1YA 4MFDA 1XX1A 3SQMA 3PZGA 4JYEA 2E4TA 3RN6A 1QO5A 5SWUA 3G6LA 5BYWA 1TPWA 5KZMA 3V0TA 5E9XA 3DFYA 2KX9A 2XZ7A 3BVJA 1KLZA 1D8CA 4GE8A 2NWSA 4AMCA 4JFLA 5JH2A 4Z2IA 3S4TA 2XIMA 1W32A 1ZAJA 1DJYA 2Y4SA 1XBXA 1RPKA 4DF0A 1FH8A 1OWQA 1BKFA 1IT0A 4YN5A 4JTCA 5K9XA 4AZGA 1HN1A 2VEMA 4UNIA 3M0HA 2NT1A 3VNMA 1F2JA 4AYSA 1C3FA 1KFWA 2CLKA 3EOUA 4HA0A 4B5UA 2WK2A 4MMWA 1OYCA 1QHPA 3TX9A 3TQKA 3UR8A 2Z7GA 2CFFA 4LQ1A 4AZBA 1U83A 2HS6A 2QT3A 2VUNA 4Z2KA 2XIQA 1DQXA 4D1JA 1Z48A 1PAMA 1E5JA 2ADAA 3NAVA 1IQ8A 1T7LA 2E6AA 2RJHA 5IHSA 1L6YA 3SDOA 1NJJA 3CGMA 2EPHA 3WQ5A 4MUZA 4JFTA 1JNTA 3W2MA 1R3VA 3W00A 5D75A 5CC7A 1OABA 3W1LA 1I45A 1SFJA 2Z1KA 3O6CA 3BLDA 2NX1A 5EMKA 5D38A 2RGLA 3BUVA 1V08A 3NCOA 4ZQCA 3P84A 2FTYA 2B31A 5A8NA 6PTDA 2XH2A 3VAWA 4PYSA 4QITA 4X60A 3MWAA 1JNEA 3WMSA 4O57A 3GXIA 2XUCA 2IQTA 3H7UA 1LOLA 2PV2A 3GG0A 3VZXA 1C9WA 1LRQA 3BLPX 2ISWA 3MO4A 5I24A 2BFGA 3WSUA 2CLEA 2WPBA 3GFYA 3OVGA 4RE0A 4ZVJA 1VBUA 4ZE4A 4REQB 3UZXA 3SRHA 4MWAB 4XUYA 2Z2AA 3W82A 4BI7A 2EG7A 3CH0A 1NTHA 3BCJA 3MDUA 4R7OA 1H11A 1U1UA 3GNRA 4ZE5A 1KM1A 4IMCA 1A3HA 3W22A 4GNKB 5CGMA 2ETNA 2DPEA 4UFMA 4KR0B 1QOPA 1K8YA 1W3TA 1R3RA 2J9YA 2DW6A 3GNOA 4IX0A 1QPRA 3F03K 1TA3A 1VPXA 3NL6A 4DO7A 3BAJA 3Q58A 3V35A 3M5VA 3BJTA 1B9ZA 1KFBA 1K70A 1I2OA 4WJ8A 3H4XA 2UY3A 3WBWA 2F2DA 1J4IA 3W27A 3KAHA 4U3AA 1XI3A 2V2CA 3RX3A 3BSHA 3GAKA 3E2SA 1MVYA 3LXAA 3EKGA 2A0NA 2XSBA 1FCVA 1MW3A 4U85A 1J79A 4HARA 4KCUA 1VPQA 4OT7A 1JCHB 2XP4A 2O7QA 4XAKA 2V2DA 1LUCB 3N9SA 3NQCA 2R6OA 4PL1A 1W54A 1X8CA 1EYWA 4F40A 1LL6A 2BY2A 4ONVA 1JAKA 3G1VA 1BWLA 1FWJC 2GQ8A 1BQGA 3WLMA 2YL5A 4KRTA 1HKJA 1J0IA 1Z32X 4E8GA 4DI8A 1N8FA 4LYQA 4NJIA 4Q7IA 4TX0A 1L9WA 3BMBA 3QPYA 2PDHA 3SFWA 4WF7A 4CQBA 3T2QA 5LNVA 2OT1A 3W7OA 3EMCA 4NL1A 4L80A 3PA7A 2ALDA 4IICA 5CC6A 2ZIDA 1FWWA 1YDVA 1XYMA 4DVOA 2VC9A 2PAJA 4X9SA 2WNNA 2BTMA 4NZ5A 1ISVA 1WOBA 5FEXA 3PBYA 1C8QA 5LXXA 3IWPA 1V3LA 3WFLA 2NVAA 4DZAA 3B0XA 2MUCA 4AY8A 2A7PA 2FTWA 7CGTA 1VH7A 1ADSA 1OFRA 3MZNA 3UG8A 3W70A 3QR3A 4PEKA 1V7YA 1OG0A 1FRBA 4NT0A 2J6VA 5F2LA 1E6QM 1QMLA 3B9AA 4MWAE 4O17A 4CEUC 1VYRA 4XSMA 3W84A 3I68A 4MB5A 4WQ6A 2X2YA 1NP2A 4BHYA 4FXFA 4D6IA 3RX4A 3DFPA 2Z29A 1C9DA 3W7RA 8XIMA 5G4HC 2UY5A 4P8WA 3CAVA 3BJSA 3VUSA 4IISA 3BOLA 2FQIA 3DECA 4IL0A 3DIPA 3V75A 3PR2A 3MVIA 2Y70A 4A2RA 5LA0A 2PP0A 3PK7A 4LXFA 4MNMA 4KESA 3O3RA 3UF8A 4S3DA 5HW8A 1B4EA 3NRKA 1JXKA 1RALA 2ZX8A 1IYXA 1EKOA 2VX4A 1XD0A 4QR6A 2GK1B 3OTRA 1I60A 1NDYA 4N9EA 4GO8A 1KRCC 3T8QA 3ARSA 5AHMA 1UD4A 5FF3A 1B1YA 2MNTA 4F0KA 1L2QA 3ZJ8A 3NURA 1W26A 1HKWA 4UOJA 4PCNA 6ENLA 2CZFA 3UBPC 1HTIA 3LPGA 1OC6A 4ENLA 2EEXA 3NPWA 4C6JA 4D6HA 1F4AA 3FYOA 4L6HA 1R38A 2H3DA 3AU6A 5DLCA 2CETA 3KLLA 4DXKA 3AALA 2H8ZA 5JH8A 2XPBA 1T5AA 3G3DA 1HKVA 1E1CB 4ZFMA 1TX0A 4H00A 4QM1A 4MIMA 3QW4B 3NSNA 4LVDA 3IKDA 3ARPA 2ZDRA 4WCJA 3WQPA 1W5PA 4JICA 3B40A 4NNAA 3FAXA 5AZ1A 3UA3A 2BSLA 1XLLA 2VN1A 5EA9A 4I90A 2EPMX 2G50A 5J04A 2QGYA 3QGKC 2ZVRA 1PTDA 1TELA 1NH6A 2QDEA 5ECVA 1T6MA 4IPXA 1LQ0A 3PZTA 2NXIA 4EXAA 3W7EA 1K6AA 1XWYA 3VMOA 4DELA 4BZYA 4UTKA 1GWJA 1H41A 5AC5A 1DV7A 1GQJA 1VENA 3ZM8A 3SN4A 2XWEA 3BAXA 2PU0A 4QGCA 4L1WA 3NQAA 1TJ1A 4L56A 4J35A 4TV6A 3I4EA 5D8ZA 2Y24A 4Q4RA 4XAZA 3ABZA 2PDMA 3DI1A 2Z27A 5KETA 3TN3A 4PULA 1GORA 3CC1A 2DH3A 5C9XA 3WDRA 1W9BM 4QLKA 3SJ3A 5C2CA 1TV2A 3PBVA 1IV8A 5AHEA 3AMKA 1JZ4A 1E5NA 1N82A 2O4QA 4BQ4A 3H12A 2J7HA 4DJEA 3DBNA 2QHAA 1FKIA 4IIHA 1W0MA 4AIEA 1JQXA 4NZCA 4LS0A 2ZBTA 3KAOA 4UTMA 3CS2A 2IQDA 1GGOA 2VFDA 2OEMA 2EULA 4NZJA 1E6NA 4RNJA 2PWUA 1XKYA 1ME9A 3REQB 3LUTA 1PIIA 5CZJA 1F6YA 3H9RB 1P1XA 1VEPA 5FJTA 3RILA 5A94A 4H6KA 3TQPA 4AD3A 4GZEA 4WDTA 4UFLA 4JHMA 3PVFA 4I5RA 3RLHA 4MLJA 4AWTA 1OEPA 1AJ2A 1RY8A 2ZX7A 4RKAA 3AYSA 3LQLA 3PBUA 4D6JA 4V28A 1MUCA 4UTTC 5HKGA 1QW7A 1U22A 5LSMA 3SCWA 4KRZA 1GZJA 1AZ1A 5CZKA 2WSRA 2R1NA 4MJMA 3WQEA 4CCZA 1Y8BA 3R2GA 1FP9A 3WEOA 1X8FA 4LNYA 4HCDA 3UYIA 3W7NA 3IARA 1EL3A 4BEQA 3RR1A 2PTZA 3WN6A 2F61A 1DPMA 4W8BA 1E3XA 5H91A 2C15A 3VO0A 2Z4GA 2QAPA 5DCDA 1Z89A 1EC7A 4RLIA 1A47A 4UNKA 1AG1O 2HK0A 3F1QA 2DIEA 5LHEA 2BGSA 4YVVA 4I8DA 4HK5A 3KAFA 1JZ3A 4W9QA 4MHBA 4MWAD 1PE1A 3GH5A 1UD2A 4WY0A 5DRCA 3C4UA 4G5DA 5BU6A 2I16A 1MNSA 3EYPA 5BOEA 4ADTA 2Q5AA 2XDFA 2H8XA 5EMMA 3WH6A 2ZXQA 4HU3A 4LF2A 1WO2A 2D2HA 1YXYA 1TKKA 5L9FA 3UVAA 3EY6A 4O1EA 3KTSA 2NX9A 1CIUA 1HJWA 4H83A 3ZLHA 2DY3A 1S5VA 1Q2SA 1LG1A 3KVLA 5FJJA 2JF7A 2AQWA 5GNXA 1XXXA 3T6CA 1F07A 1JZ5A 1MSSA 3TAKA 3LCLA 3G1FA 2YDAA 2PD5A 1GVYA 5AECA 2WKJA 3S5SA 2C1GA 1CZ1A 5RUBA 3DHUA 2XWDA 3FEQA 3LPOA 1I8JA 3QMSA 4KFNA 3LBMA 4Z1BA 4CD6A 4AXNA 1I1XA 5A8MA 4ZQOA 1QTWA 3R11A 1IZCA 3LEPA 3A21A 3OZOA 1B3ZA 1WDQA 3VNIA 4QROA 1JCYA 2BX7A 1F8IA 4RUBA 1VYSX 4LSBA 5AYIA 3QLDA 2V5BA 1Q66A 5E09A 2VZTA 1JFHA 3W29A 5BOFA 2ZUUA 4C6QA 4ZQMA 4GUIA 2QCEA 4IQ2A 4CCCA 3UQAA 1OJXA 5GQBA 3AHVA 3H4WA 3RHGA 1PBGA 1HGWA 1Q7ZA 4UFJA 2Z1WA 4WVXA 1ZJIA 2OKOA 3LLDA 1G69A 3CAQA 1NWRA 2BHYA 3MU7A 1ME7A 2QPXA 5B7YA 1XRFA 1V93A 3CTLA 5HNRA 2EXOA 1DIKA 3NL3A 3GLCA 3N3TA 3VNKA 3M5XA 4A35A 3PULA 4FMVA 1F6KA 4RDZA 2FTPA 2YA1A 3P5ZA 3MJMA 4ODRA 1WZMA 3WLQA 3EOLA 2QUNA 2G37A 3VFLA 2IPFA 2FYMA 3VK5A 2DZAA 1GUVA 1KV5A 2VEIA 3ICJA 4DRPA 1HJVA 4E3TA 1QNSA 2PWVA 4PRTA 5GNYA 2X09A 5AKQA 1H7PA 3LRLA 3UI6A 3V7PA 1A50A 2PDJA 2B4GA 2Y8KA 2RFGA 3NI6A 1DIOA 5I7GA 1YPIA 2A6LA 3M0KA 5CG7A 2CXGA 1SW3A 2CIPA 3EDKA 3U3HA 1XD1A 1W1A1 1PJ9A 4FOUA 4FXJA 2FIQA 4Q6XA 3VIFA 4X2RA 4C6OA 3EEGA 1UJPA 4A3UA 1D7FA 4PL2A 4NF7A 4QIUA 4BF8A 4JXCA 4K38A 5AY7A 5F1UA 1TR1A 2G41A 2RQSA 1I2QA 1TA3B 2PRMA 3WDHA 2PFHA 2J9ZA 1PO9A 3QC3A 4LAKA 3THCA 1QJWA 1W9UA 2Y5JA 1OZMA 1HP5A 3CYVA 4I8YA 4PUDA 1NQKA 4BCEA 4Z1YA 4HGXA 4IJBA 3NL5A 1MRAA 4ATWA 4LALA 4PMUA 4UR8A 3B06A 3B8IA 3ATYA 4C1KA 1TTPA 4HP5A 4JNZA 1TPDA 4MDPA 4JL1A 3AXKA 1UZ4A 4JFMA 3IAPA 2J7GA 3RF9A 4PUJA 4KWOA 1AW2A 5MKGA 4IP7A 3RXZA 3VILA 2OG9A 4UMBA 3ZLGA 3TJLA 2ZRVA 4MPQA 3HOJA 3QH2A 2VELA 3GY1A 2HXUA 1ISYA 1W1ZA 2YFOA 1E73M 4CN4A 3WF1A 2EF9A 2GJRA 3B3DA 4UMAA 3E3HA 1CGVA 3RNDA 3PAJA 5DELA 5FEZA 3RG6A 1LYXA 1OIMA 4M6PA 1HKMA 2DSZA 4DYEA 1R3TA 1WXYA 5HATA 3I3DA 5A6KA 3P7YA 2INEA 1WKYA 2TRSA 1ADOA 3BARA 1NP0A 3PG9A 3TONA 3O5FA 1WZKA 4ZOEA 1BSIA 1FFRA 3TKFA 4JFUA 3FKKA 1H7NA 2A3HA 5HANA 4AHQA 3GXFA 4IQLA 4M80A 1NARA 1O7AA 1KTBA 4XKYA 3NPUA 4Q8MA 1QBAA 1T8XA 3DX5A 2FFCA 4YU1A 2GGJA 2O56A 3ZWTA 4M1BA 1DKWA 1CENA 4KGJA 1HJUA 2VURA 3OPSA 2KGJA 1WCGA 1ZCOA 3D5HA 1IX5A 3WD4A 3HMJG 1GZGA 2FJKA 1V5XA 4JEQA 4XTDA 5XIMA 2Q8ZA 2DZUA 3GDTA 4B9ZA 4R3UA 4JD4A 1HFBA 4JOMA 4H9XA 5TAOA 3WBAA 2YBVA 5LHFA 3K13A 5KMYA 2J24A 3AIRA 3O5MA 2GL5A 1M9HA 5IRPA 3RO6A 3MS8A 2JF6A 3MP5A 4GUJA 1HJQA 2Y0FA 1XJBA 1FKDA 4KRUA 3GAYA 3HM7A 1VFTA 3U2OA 1E0TA 3L67A 2NV2A 5CGQA 4DT4A 2ABAA 1X97A 3DEQA 1B5TA 3KRBA 3TFXA 2FZBA 4W93A 1XBYA 4JFJA 3OOQA 3ECQA 4CNPA 1GW1A 3F4WA 1FWNA 3ZYZA 1G6CA 4LJ3A 4PTXA 3G8EA 3FCPA 3GSMA 4QE4A 3ZJKA 3GYCA 3BG9A 3T44A 4MUPA 3LZ3A 4G7FA 1PHWA 2X8RA 1KXHA 4Q22A 1TUXA 3GC4A 3W2JA 4IXHA 1ECEA 1WAUA 4GABA 1XDLA 2CYGA 3EDJA 4U33A 3QY7A 2NSXA 2YKKA 1MEIA 2DVTA 1KW1A 3IANA 3UY8A 3VOJA 4UWMA 1W1IE 1J0HA 1MXDA 1QNVA 3QHNA 5E0KA 5FJUA 3QGVA 3HG3A 4Q8OA 4JFSA 4LGXA 4A3YA 4AMAA 2ZE3A 1F05A 2Z6JA 1RVKA 5C2GA 1TPVA 3VCNA 1A7XA 3CZGA 1TRIA 2X0YA 1X6UA 1QR7A 3BSGA 2QV5A 3W7KA 4HPNA 3UG4A 1SR0A 3E0WA 4ML4A 1GVSA 2EBNA 3VMPA 1F7BA 2NZLA 2W6RA 1EX1A 4O1CA 3U4AA 3VGBA 4YTTA 4HIBA 4TR9A 3J7HA 3RU6A 4XTIA 4B91A 3KWSA 2NUYA 3I7QA 3N2TA 1WDPA 2YA0A 2PP3A 1J0ZA 4H6EA 3UJSA 3CL7A 1ZK6A 4HBEA 3KCJA 2ZYFA 3RMJA 4O28A 3C52A 4DRMA 1AQFA 3AIBA 1NAL1 4W8AA 3LHYA 5CBBA 1RQHA 2VFFA 4CQCA 3BLKA 4LAZA 3QKZA 1CEOA 4OWGA 4FLRA 3I4KA 4L3NA 3CJPA 3VTRA 2FGLA 4J3XA 4W7WA 1PZ1A 1XLJA 3CO4A 3EEZA 4ITZA 5AHIA 3W7GA 5HWNA 4KEUA 4D1IA 3R6IA 3TLQA 2YPIA 2DORA 1IGWA 2OR2A 1A5KC 1ENUA 3C8FA 1VFUA 2PLKA 2FHCA 3EXTA 4D9PA 5M2FX 1P6BA 3PBMA 3KOWA 1PZ0A 1A0CA 3I3BA 5A6MA 2VEFA 4HBOA 4BF5A 5DITA 1JNDA 2WOQA 3N2MA 1PX3A 4I7WA 4IXXA 2AWGA 3R8HA 1FKHA 1W8GA 3F4VA 4U5KA 2CLHA 1TSIA 2TYSA 1I4NA 3LTYA 1KXQA 3U9IA 2Y88A 1A5MC 4J5NA 2QCDB 2CLOA 1E55A 2VQUA 3BZGA 1Q6GA 5FL1A 4OIFA 4RE2A 4GH3A 4KQZA 3RYSA 4Z0SA 4PMXA 2OKTA 3A5FA 2KR7A 2F8QA 1PZ3A 3GTIA 4JCMA 4IX2A 4WOQA 3EMZA 3O1NA 3O05A 4JIEA 3PB0A 3VIOA 2PDFA 4RZBA 5G2IA 5IDZA 3GC2A 5EMUA 1YBQA 5BU9A 1CLXA 1LG2A 4DX3A 1V3IA 4CKQA 3FJNA 3BO9A 2P8CA 1XLEA 3S2LA 5A8OA 3IHZA 3T09A 3W6LA 1CXLA 4D6EA 3EPMA 1UKOA 3B4YA 4LUIA 1EJSC 1IR2A 1C90A 5IFTA 3PTMA 3H22A 1Q6IA 3ALGA 3GWQA 3M5YA 1PYFA 3VNZA 2X7WA 3BMVA 2INZA 4E38A 3UVIA 3GHRA 5EMLA 1BXBA 4QP0A 1VFFA 3H8AA 3UGVA 2EAWA 1OK6A 3DBPA