4MTVA

Crystal structure of the complex of buffalo signalling glycoprotein with pentasaccharide at 2.8a resolution
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
361
structure length
361
Chain Sequence
b'YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3-like protein 1
publication title Crystal structure of the complex of Buffalo Signalling Glycoprotein with pentasaccharide at 2.8A resolution
rcsb
molecule tags Signaling protein
total genus 123
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2013-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4mtvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mtvA01
1V6YA 1Q6GA 1XSIA 4D6EA 5BROA 3L2MA 1W1YA 3WH8A 3VIHA 4Q22A 2CXGA 1RPKA 1JYWA 4MADA 4ZXLA 3SCVA 5BRPA 3TTOA 5DFAA 4B16A 2XFFA 1H49A 3MUY1 3RPMA 1OD8A 1FFQA 3AHYA 3EMZA 2OWXA 1H11A 3RM4A 1J11A 3MMWA 5DMYA 4OOUA 4XB3A 1V6XA 1JD9A 4RL3A 1WDQA 1FHDA 1EDQA 3TONA 4V28A 2CETA 1AQ0A 1GHRA 5A8MA 1GJWA 1CGWA 3PTMA 3ZQ9A 2CYGA 5BYWA 3WDIA 1HVXA 3FW6A 4PTXA 3WNLA 4FLOA 4MB4A 4PMVA 1BG4A 3O2LA 4D1IA 5HDRA 2CBUA 1OM0A 2EJ1A 4LYPA 1CTNA 3IAPA 5A6AA 1HVQA 3W27A 3M07A 4Z2IA 1ZS2A 3OZPA 2OSWA 5JIPA 3RJYA 1FA2A 1OINA 1NARA 3FAXA 1E6NA 1VB9A 5I0DA 1E6ZA 3FN9A 1JI1A 3GNOA 4GZIA 1KXQA 2XVKA 1JFXA 5C70A 1V3LA 4NSBA 2V3DA 4BQ5A 4GI6A 2FHFA 1NWTA 4TUFA 4JKKA 4GKLA 3VD9A 5ABFB 1CNVA 2YBTA 1TVNA 1CXHA 3ZJ7A 1E1EA 3A3HA 1PEZA 3RILA 5A1AA 1W3KA 3AMGA 4IUGA 4PEEA 2G41A 3VMPA 1XC6A 4UOJA 4IPLA 2WVUA 1CXFA 3U7VA 1DWIM 2VX4A 2WSPA 4UOQA 1BTCA 2WNWA 1UR2A 2UWFA 4W7VA 3W38A 3E1F1 1BLIA 2WVTA 3UERA 4UFMA 1XCXA 1CGXA 2CESA 1SR0A 3WMCA 4CUCA 1N82A 3BAYA 5A8OA 3LPPA 1VAHA 3UCQA 3WY1A 4AWEA 3CZ8A 2OWCA 4CCCA 4P7RA 3K46A 4DWSA 4DWSD 1EH9A 4EKJA 1HN1A 1R87A 2J8GA 1MFVA 1NOWA 3F5KA 3B8SA 3VIJA 1NH6A 4UOZA 1X6NA 3L2LA 3BLPX 1WDRA 4FLQA 4W85A 5LYRA 1UR4A 4GIAA 2D1ZA 4UQCA 5ABGA 4OUEA 3ZT6A 3VDCA 2UY4A 2QPUA 3AJ7A 1CDGA 3WD1A 3NCOA 5C8BB 3WEMA 1QI0A 3B9AA 2UY5A 2WPGA 4WLCA 1E56A 5JBFA 1UQZA 5CZKA 2DT3A 1UZ1A 1WP6A 4AEFA 2J77A 1DWFM 1BG9A 2BVDA 4P7OA 1X6LA 5D9OA 3RIKA 2EXOA 1LL6A 1HJVA 3W24A 4ML4A 2Y5EA 4FLSA 1G0CA 3ARWA 2VO5A 5M5DA 3VD5A 2A3CA 5DT5A 3MMDA 3T2OA 4CCEA 4CD5A 2DSUA 5ABFA 1HT6A 1GNXA 1XHGA 4CD6A 3N04A 2WHLA 4JZ5A 4U2YA 3W82A 4HPHA 3OLIA 1ZJAA 3CZKA 4PUEA 4V27A 2PWFA 1VFOA 1UD6A 3RDKA 3WDHA 3TOPA 2VX5A 3WKZA 4WK9A 3SCTA 1XD0A 2W4XA 3CZEA 3VUPA 3WH9A 2QPSA 3OLEA 5BXPA 4QFUA 5JIWA 2CKSA 4Z2LA 4MNMA 1UR0A 2BVTA 5JH8A 2ZUSA 2WZIA 3A47A 3PHAA 3ZR5A 1EO5A 3ARVA 3DC0A 3F5LA 4BA0A 5A8NA 1KWKA 1XD1A 1QOXA 1WPCA 4ACZB 4HTYA 1CLVA 1XCWA 2VR5A 2CEQA 1JNDA 2EQDA 3NIYA 2J7GA 1VBRA 1KFWA 1E1FA 2X8RA 4GZJA 4HZ8A 2XJ7A 2G3JA 4FK9A 1JZ4A 1D2KA 1CENA 1MXGA 5LA0A 2YDQA 1B30A 1GQIA 1MQPA 1EHAA 1E6RA 1EOKA 3DYMA 3CZJA 4R27A 1J18A 5A95A 1PIGA 1IV8A 2WMIA 3RM9A 3DHPA 4B3LA 2V3EA 5IHSA 1CWYA 3I3DA 1ZL1A 3AIEA 1L8NA 3J7HA 5EFDA 4LPCA 2WHJA 3UESA 1GVIA 1GUVA 4AC1X 1E0XA 4W8BA 1W2PA 7TAAA 2VVSA 2DT0A 4M29A 1JXKA 2G3IA 2VT0A 3VIPA 5A2AA 2Y4SA 1XH1A 1G9HA 3AHZA 4PSPA 2WVVB 1UA3A 4CVUA 3LMYA 2QHAA 3NSMA 4J27A 4NZCA 1ITCA 3AXIA 1KR1A 2WSKA 2Y8KA 2BXZA 1KQZA 2VNCA 1OIFA 2EPMX 4YPJA 1M04A 3VX1A 2WMJA 1E6PA 3O9NA 4PTMA 1UD4A 5GPRA 1QNPA 4ACZA 4DM2A 2CITA 2PWGA 1WNOA 3WENA 4C7FA 1I1WA 1WKYA 1WAWA 1Q4NX 1FH8A 3PZVA 3ALGA 1FP9A 1GJUA 4UTFA 4WF7A 1W3HA 2QMKA 4PMOA 2VZOA 3HU7A 2ZE0A 5I6SA 3W29A 1O6IA 1CXEA 1BYCA 1V3HA 2WB5A 1V02E 3CZGA 1K9DA 3WNOA 5FOOA 3S6TA 4MNJA 1DEDA 5CGMA 4OZOA 1WB0A 2WC7A 2FHCA 1M03A 1G5AA 4HOXA 3CBWA 2YBUA 5HNNA 1RH9A 3PZOA 3VILA 2XUCA 1EGZA 1H41A 1W1PA 2RGMA 1HP5A 4DM1A 1PBGA 3L4UA 1QI3A 1W3LA 3TTSA 4AXNA 3PZMA 1JZ5A 4AIUA 4BS0A 4U33A 4D6CA 1QW9A 1E70M 3VM5A 1W1TA 4XUYA 2GJPA 3VDHA 1SFSA 1TZ7A 2DIJA 1VEOA 1LLOA 4AZBA 1O7AA 4LYQA 1ZBVA 4BQ4A 1J0HA 1KBKA 1CXLA 5A6SA 2WVSA 1QI2A 1UKOA 3SUWA 3SCRA 3A4AA 2VRKA 4YN5A 2CKRA 1TUXA 2X09A 4EAMA 3CHCA 3VNZA 2WMFA 3AIRA 1XRVA 4DUXA 4B15A 5TD4A 3T2QA 4X0VA 5AYIA 4F66A 3SEPA 3PZQA 2BHZA 4AZGA 4HOZA 1WZLA 1VBUA 3ARZA 3VDBA 3VIIA 1B1YA 3ARXA 5IDIA 1UKPA 2ZUVA 4RE4A 5CPQA 2Y2WA 1KBBA 1HF6A 2XFRA 4UR9A 3AZSA 1U30A 1IZKA 1OT2A 1QHZA 3MV01 4P7NA 2XVNA 3WH7A 1VF8A 2E8YA 1MWOA 2V5CA 1TCMA 3EDEA 1DHKA 5E0CA 1KQYA 2D0HA 3GTNA 3N15A 4M81A 4AEEA 4H8HA 1HJUA 5IFTA 4AD0A 3CHDA 3QHOA 3TTQA 1HIZA 5DT7A 4CCDA 3VPLA 3ZSSA 4Z2GA 4R5EA 2ZX5A 4QP0A 3MSDA 5EB8A 4C7DA 4E8DA 3CUIA 3BAJA 1J0JA 5AC5A 3WELA 1Q6CA 1VFUA 2YKKA 3PTQA 2DIEA 3W4RA 2CIPA 1KCLA 4JFVA 2CHNA 4AD1A 4BQ2A 2O9RA 1PZ3A 4WIWA 1CGTA 1VENA 3OBAA 1EIBA 1BVZA 5DEZA 1J0KA 1CGYA 1A47A 4GZEA 3VINA 3K4DA 1WZKA 3CH9A 3UR7A 2WK2A 5LA1A 2CBJA 4MTVA 5LA2A 4J3UA 2V3FA 4NRSA 3ARTA 1J9YA 3UG5A 1QPKA 2A3BA 3L4TA 4J3SA 5JBDA 5D8ZA 5AC4A 1HXJA 1NP0A 1B3ZA 3GXFA 2JEQA 5FL0A 1D7FA 1H09A 4JHZA 1JL8A 3CMJA 2PF0A 1OCQA 3T09A 3OGVA 1US3A 3WBAA 3WNNA 4ZFMA 4UFIA 4E4PA 3CGTA 1UG6A 3WUGA 2VMFA 1X1NA 4LQ1A 2JIWA 1W9PA 2NSXA 5BRQA 1R7OA 2OLHA 4KRTA 3AQUA 2QLYA 4JCMA 3CO4A 3VX0A 3EYPA 1ITXA 1PIFA 4W7WA 2J62A 3WDQA 1C7SA 3QOKA 1ZBWA 3PZUA 3N9KA 4DWSB 4GPNA 4TVUA 2EBNA 2X1IA 1GQJA 1OT1A 1I1XA 4WSKA 2BVYA 1GPFA 2PBGA 5FCZA 4MDOA 2V3GA 2BV9A 2G4FA 2D0FA 3N17A 1JDDA 2WWCA 1E4IA 1H3GA 3SCPA 4URIA 5A94A 5DO8A 4AZ7A 4W5ZA 4AZ5A 4JIEA 2WBKA 4HU8A 4CN6A 1BSIA 3KEHA 4M56A 3UETA 4QAWA 3SUUA 3WF2A 1UD8A 4PMZA 2ZUTA 5A8PA 3CTTA 4MNKA 2EPKX 1FH9A 1KXHA 1QBAA 2O9PA 1MQRA 2WXDM 4ZE4A 1J01A 4FLRA 2A3EA 4M80A 4QLJA 2EPOA 1TR1A 2VQTA 1QNRA 2VOTA 4PUDA 4D1JA 2J7DA 2VZTA 1JZ2A 2CCRA 4UFLA 2YIHA 1W9VA 4LX4A 1E6XM 1KXVA 1E5JA 3RM8A 2DGAA 5I78A 2BY2A 2VX6A 2AAAA 1JIBA 1MW2A 4TX8A 4AD4A 4MB3A 4S3KA 1UH3A 2VI0A 4HMEA 2CBVA 2W92A 5E6YA 4AZCB 5GNYA 4UQEA 3WUBA 4AISA 4PN2A 2E0PA 3SURA 1KXTA 4UZUA 3FAWA 3WIJA 2DSWA 3GXIA 1OIMA 2J47A 1PPIA 1K9TA 3BXWA 1CGVA 3CMGA 3W28A 3WMSA 1OGSA 1UQYA 4GINA 1QVBA 1LQ0A 2WC4A 3NYDA 2YJQA 3BSGA 1CPUA 5IFPA 3NDZA 1CGUA 3KL3A 4L4PA 2FH8A 1BF2A 4W84A 2XPKA 1QHPA 3NUKA 1BPLB 4PMYA 1V0MA 4J3XA 5A8QA 3GXMA 2WMIB 3ARPA 3K4AA 1XSJA 1C91A 1MFUA 2OSXA 3APGA 2WLZA 5FD0A 1LG2A 3MUZ1 3ZT7A 3CUHA 2YDSA 3G6MA 4U5IA 3M6DA 1UZ4A 2IXVA 3CUJA 3DYOA 1H2JA 3ZM8A 1I75A 2XHYA 1US2A 1UOKA 1BVNP 3AI0A 4ATWA 2QF8A 3MO4A 2XWEA 4KH2A 5M3WA 3VGEA 1OBAA 1QW8A 3AYSA 1GORA 1EHNA 2XM2A 3W0KA 2WANA 3T0BA 2YA0A 3VIFA 5A6BA 5A6BD 3LPFA 1W9DM 1RP8A 3CHFA 1E5NA 4JKLA 4W89A 4ZEPA 5HPCA 3QHMA 4N0RA 1JYVA 1GOOA 4AZCA 2XTKA 4EANA 2F2HA 1VJSA 4HZ7A 2XVPA 4W87A 5M03A 1B9ZA 2VCAA 1ISZA 3WSUA 3DHUA 1K9EA 3AMCA 2J7BA 2D3NA 2VZVA 2C8NA 1JZ7A 3OLDA 2FDMA 4S3JA 3WF3A 2W63A 2G8ZA 1GOWA 4F79A 3SCOA 1XSKA 1UD5A 2YDRA 3WF1A 3WN6A 3W6MA 2PBOA 1W32A 1R8LA 2ZXAA 3WNPA 2E4TA 5IHRA 3GNPA 1C93A 1E4NA 3OGRA 4OBRA 2WKGA 2X2YA 1GCYA 4PTWA 1NOUA 4KWUA 3AS1A 1JF5A 3FY1A 2DH2A 3VIKA 5CQ1A 2VQUA 1W3JA 1W9BM 9CGTA 1J10A 4K68A 1V03A 4H7VA 5CPTA 3T0AA 4P8UA 4RE3A 5BXRA 3WDPP 1TVPA 2VVNA 3EBVA 4F9JA 4WKAA 2ZIDA 2J78A 3KL5A 4JHOA 4BCEA 3AS3A 3T08A 4H8UA 4CD8A 3EDKA 2BXYA 4OIFA 1TMQA 1QNOA 2NT1A 5A6JA 2UY3A 3KE0A 1SMAA 4GXPA 2J7HA 4CVWA 5BXSA 1V6WA 1E6QM 1H5VA 2PWEA 3FHQA 3U5UA 4DUWA 2W62A 4UFHA 2WWDA 1R7AA 1V0LA 5ABEA 1JYNA 1FFRA 1UD3A 3SUVA 4CGTA 1ZBCA 1V6UA 4U3CA 2C7FA 5D9MA 1B31A 1NOFA 1XH0A 4BF7A 3ZJ8A 2HISA 4HA1A 3SUSA 2DH3A 7CGTA 3MUIA 4LYRA 3WDRA 4P8XA 3ARQA 3IK2A 4OKDA 3GDBA 3GBDA 1KGWA 1P6WA 3AHXA 4ZXOA 3AYRA 5FKYA 3VGFA 4PMXA 1JAEA 2ESCA 5GNXA 1CYGA 1F4HA 1VFMA 1E4MM 6A3HA 2O92A 2YL9A 1JAKA 2OYKA 1E73M 2BY3A 3PZIA 4AYSA 4HMDA 1WZMA 1B3WA 3CLWA 3WH6A 3ECQA 2ZOXA 5HOSA 1UR8A 1GOMA 1DWHM 1MYRA 4TTUA 2VJXA 1ZJBA 2W67A 1E4LA 3AMDA 2VR4A 4EK7A 2YLLA 3ALFA 1TA3A 2Y24A 3S2CA 4Y7EA 2DSKA 2YA1A 2J4GA 3N11A 1EDTA 1DWJM 2ZXQA 4D6DA 2WC3A 1AVAA 2F8QA 2PI6A 1WO2A 2YLAA 4UNIA 3WFLA 3WQ5A 4WKHA 1NQ6A 4OJYA 1QBBA 2CNCA 3G6LA 2GUYA 2O9OA 3NSNA 1HX0A 1MXDA 1Q6DA 1GONA 5CJ5A 1CXKA 1DTUA 3GNRA 2ZUUA 1OGBA 1VEPA 4ACYA 3RO8A 1J0IA 3GH4A 3BH4A 1EO7A 2W91A 3D3AA 5KEZA 4DUVA 1HKJA 2XIBA 2WHMA 1EOMA 3WNKA 2EEXA 1C7TA 4HOWA 1OGGA 2CBIA 8A3HA 1DWAM 3A4WA 1UHVA 3IJ9A 2JIEA 3BSHA 4X9YA 4F8XA 2UY2A 3HN3A 2E9LA 1E3XA 3WD3A 2C0HA 4LGXA 5A6KA 4F9DA 1JFHA 2GFTA 4IISA 4YHEA 1CZ1A 2PB1A 1BYAA 1KR0A 2DPEA 2WW5A 3A4XA 3KZSA 4JL2A 1QNQA 3MANA 1JNEA 3GYCA 4C7GA 4ATLA 1Q6FA 3GZAA 1QI4A 3MSGA 4PMQA 1VEMA 3HMCA 1U33A 3L4WA 1JDAA 3NDYA 2ZX9A 3N12A 3ARRA 1G1YA 1OWQA 2ZXDA 1KGXA 3FXYA 3WQ8A 3K1DA 3I3EA 5E6ZA 1HL9A 1ZBKA 3BCFA 5BCAA 4J3VA 2VX7A 3WUFA 4A4AA 5FL1A 3M7SA 1BYDA 4P7LA 5CGTA 5CSYA 1E40A 4W5UA 3K8LA 3PZ9A 2DEPA 3POCA 1KB3A 3WQ6A 3N1AA 3VO0A 1H0GA 2A3AA 2ZUWA 4GQQA 5EBAA 1KGUA 4PMDA 4UFJA 1V02A 2XVLA 1GW1A 1B3XA 1E0VA 5CPSA 3RMEA 3AZTA 3AIWA 1ISVA 3OB8A 3VGDA 1UH2A 2BY1A 3AXXA 3VD3A 4JAWA 4W88A 4GO8A 5ECUA 3W6LA 3AIUA 4NI3A 1G94A 8CGTA 4E2OA 4Z2KA 1CLXA 2JF6A 4J3TA 4WJXA 1MW3A 3AICA 1CXIA 3OGSA 2DQXA 3TA9A 2AOSA 3MKKA 2XYLA 3EMQA 4CD7A 2ZXBA 3OA5A 5E0FA 1TG7A 2F61A 1HJSA 3VIOA 3VD4A 3BAKA 1E15A 5HPOA 5D8WA 3AS0A 1E55A 3II1A 1KCKA 3MS8A 3UEQA 1WZAA 5JUVA 1CBGA 4UFKA 3VMNA 4M8UA 5I79A 3VGHA 1ISWA 4MB1A 1E71M 4BQ3A 2CERA 3L4ZA 3ARYA 1XV8A 3A6OA 2XGBA 1HJWA 3AHTA 1S46A 2YL6A 2D24A 2HVMA 4L4OA 2YL5A 4J28A 3MMUA 4GI8A 4AZIA 5I77A 4H2CA 5JBEA 5A69A 1OD0A 2DT1A 3VNYA 1UUQA 1W1VA 1Z32X 3UG3A 3UG4A 5I23A 3AROA 3PN8A 2XM1A 1LJYA 3IJ7A 4FMVA 5KZ6A 3EDJA 4D6HA 3ZR6A 1NM9A 3JUGA 3AIVA 3WDJA 1PJ9A 5HXMA 4EE9A 4QLLA 4D6IA 2JE8A 3WQ4A 2YL8A 3AIQA 4ATDA 2TAAA 5EMYA 4M1RA 1JDCA 3ZIZA 4AD5A 4AMCA 4GQRA 3F4VA 1QNSA 2XSBA 3BGAA 2WMHA 1ESWA 4CN4A 2PWDA 2VCBA 1FOBA 1AMYA 3EDDA 2DDXA 1F4AA 1CECA 2XIIA 1NWSA 1LL4A 3AHVA 1XH2A 3WFZA 5CG0A 1LWJA 1VFFA 3VIGA 2EPNA 4JFUA 5BXTA 4UZSA 2EPLX 3LPOA 7A3HA 2Y8VA 1FP8A 4PMUA 5CSUA 1UWSA 3F5JA 2XSAA 2BY0A 4KGJA 1PX4A 4HA3A 2BHUA 2J7EA 5M17A 1JG9A 1ODZA 1HP4A 4J3WA 3WD0A 1J0ZA 2V5DA 4JKMA 1BQCA 5GNZA 5E70A 4B9ZA 1UKSA 1W91A 5A6MA 4MNLA 4A3YA 4W86A 4A3HA 3L4VA 4XX6A 1ISYA 5CLTA 3VMOA 2J75A 2AMGA 1FHLA 1K6AA 3ZJKA 2DSVA 2GJXB 4PCTA 2V38A 2X05A 1V0KA 2D22A 4M24A 3SCQA 1W2VA 1VIWA 1XGZA 5F7UA 3DECA 4D6FA 1MVYA 4CU6A 2JFEX 1V0NA 1GOQA 4MPKA 2WCAA 1JXJA 3ZT5A 4XZWA 2GSJA 5E09A 1GOKA 3POHA 2VZUA 3AIBA 1J12A 1AQMA 2GDVA 4D6JA 5AYBA 1V3MA 1SMDA 5I24A 3ZOAA 2JF7A 1UWIA 3AMLA 1JF6A 3VVGA 2J25A 1R86A 2OYMA 3WNMA 4XV0A 5CLWA 2X0YA 1GQLA 3L4XA 4PBGA 3WD4A 4B3KA 1IZJA 3RCNA 3KWXA 1DP0A 3OG2A 1V6VA 4Z2JA 3IAQA 2VUYA 1UYQA 4PSRA 4QLKA 2OWWA 4JL1A 4AIOA 3THCA 4CKQA 1E3ZA 2WMGA 2FH6A 4JFTA 3BC9A 4D72A 4H8VA 3SCSA 1QI5A 5A2CA 1M01A 2ZICA 3OZOA 4HU0A 2J79A 5ABHA 4PCSA 3U7BA 4W8AA 4XZBA 3ARSA 1EA9C 2QMJA 3VOCA 2FGZA 3W37A 2W5FA 3CUGA 1WDPA 3SIMA 4AIEA 1GZJA 2VRQA 4UQBA 4AY1A 1BAGA 3VM7A 3QGVA 1R85A 3QHNA 3U57A 2WLYA 2GJXA 5C71A 3EMCA 5BWFA 5I3DA 3PZNA 1ZU8A 2E40A 2VZSA 4MB5A 1KWGA 3ZMRA 4B9YA 4TVDA 4BZYA 3AFBA 4QCEA 1HKKA 2D20A 3ZSTA 3THDA 5I5RA 2ZWZA 4DWSC 3PZTA 1CEOA 2A3HA 2IXUA 3GXDA 4D6GA 2CPUA 2J74A 5HBFA 4PTVA 3D5HA 5I2UA 4JCLA 4MAZA 2MANA 1ZB5A 1D3CA 2XWDA 5DF0A 1LF1A 1TFVA 3IJ8A 1OSEA 4WKFA 3O6AA 1ISXA 2WM0A 1GVYA 3B9EA 3GBEA 4CU7A 1HJQA 4TXEA 3AMKA 3AOFA 5FIPA 1LWHA 4U31A 4LXFA 1MQQA 1TA3B 2W61A 3EDFA 1EXPA 2VCCA 2BNJA 2ZWYA 1HJXA 1NWRA 1UKTA 1V3KA 4TX6A 1TE1A 3HJEA 2OSYA 3BLKA 1M7XA 2OYLA 3LPGA 2XGIA 4OBSA 1NWUA 1JI2A 5D9PA 1GOIA 3VD7A 3T0DA 1ODUA 1FH7A 1QHOA 4IPNB 2O9TA 1IT0A 2PC8A 3DYPA 2VC9A 1BHGA 2ZUNA 3NJ3A 1E0WA 1WDSA 1UWUA 1H0IA 4W8LA 3MV11 4W7UA 6TAAA 3WUEA 4GI9A 4JFWA 1B0IA 1VRXA 1L0PA 2B31A 4HMCA 1UD2A 4U5KA 3W81A 4U3AA 1UR9A 1LG1A 2YA2A 2J7FA 1M53A 3WH5A 3BMWA 1OB0A 3BCDA 4IM4A 3N13A 1UWQA 3GM8A 1B3YA 3W25A 2Z1SA 3I3BA 3VDAA 1C92A 1HNYA 3AXHA 1XYZA 3N18A 2JALA 1HKIA 3SCNA 6CGTA 3BMVA 4OOZA 4TVCA 3PZGA 4Z2HA 1NP2A 1V3IA 3T2PA 1ECEA 5D9NA 4GO9A 2E3ZA 1U2YA 4MJ2A 3BAIA 3OIHA 2GJRA 1EQCA 4JFSA 3WBEA 3SCUA 2WHKA 4Q7NA 1UKQA 1MW1A 2WBGA 2ZX6A 1WE5A 3CIVA 3AISA 1GQKA 3CHEA 1GHSA 2WCGA 3UR8A 1BGGA 1HL8A 3SUTA 4FF5A 3TTYA 4V2XA 4UQAA 2GK1B 3VKKA 4PRWA 2CHOA 2E9MA 4KMQA 3WD2A 3B9DA 4PYSA 2J7CA 2E8ZA 5A6LA 1G01A 3W53A 4M82A 2XFYA 1E9LA 2G3NA 3WL0A 3FNDA 2ZX7A 4NRRA 2VURA 4U2ZA 4AD2A 2WMKA 2BS9A 1BGAA 3MUAA 3WEOA 1EDGA 2YOCA 1JD7A 1B2YA 3VGBA 1C8YA 3WQWA 1YQ2A 3VU2A 2VRJA 3VIMA 1RD6A 4TTGA 1V08A 4HP5A 1HKMA 5IXEA 4H41A 2IUZA 1JZ3A 4MJ4A 2NT0A 3VTRA 1AQHA 1XYFA 1C3FA 3TP4A 3CUFA 1J0YA 4UQ9A 3CPUA 2WVVA 3KL0A 4NF7A 2RGLA 4PMRA 1YHTA 2WAGA 5A2BA 2W66A 1PX3A 2QV4A 3WF0A 2WKLA 4N42A 1B3VA 2FHBA 4YHGA 2DT2A 4P8WA 2ZX8A 2WCSA 4X0NA 2XG9A 5E9AA 1BYBA 2WZHA 1Y7VA 4AD3A 3OLGA 4CN1A 4CD4A 5AY7A 3PTKA 2DSZA 3WQVA 1JYXA 3M46A 1UWTA 1H4PA 5A3HA 4RE2A 4P8VA 2NW0A 5EFFA 4PMNA 2D3LA 3IANA 2BHYA 1SYTA 3VGGA 1C90A 3BAXA 2VTFA 3SCWA 4AZHA 2GK1A 3NSXA 3K8MA 1UR1A 2D2OA 1BFNA 2WYSA 4QDMA 4AW7A 3QOMA 4UQDA 3ZJ6A 1W9UA 3ZO9A 2WZEA 1H1NA 5D4YA 1EQPA 1CIUA 1JGIA 3AZRA 4MAVA 1UH4A 1MW0A 1Q6EA 3K8KA 3CZLA 1UWRA 2D0GA 3U5YA 1B90A 4D71A 1PZ2A 4W93A 2X0HA 1V3JA 2Q8XA 1JZ8A 1LL7A 2GVYA 5CXPA 3AS2A 1RP9A 2GDUA 4ZE5A 3PBGA 3BAWA 4QCFA 3L4YA 2PWHA 1DWGM 2J8FA 1C8QA 1PAMA 4E8CA 3ARUA 5GQBA 2D23A 2JEPA 1VJZA 4J7RA 1UA7A 2XVGA 3W26A 1E6SM 4UCFA 4AZ6A 2BFGA 2Z1KA 4KGLA 3WMBA 1E72M 4CU8A 1C8XA 2ZUMA 1E43A 2EO7A 4HPGA 3WL1A 2VL4A 1WCGA 4WSJA 4H04A 3WF4A 2G3MA 1A3HA 3WEZA 1PX8A 3GH7A 1JZ6A 4KRUA 4MDPA 4P7QA 4ZENA 3RJXA 4HA4A 2E9BA 4TOQA 4HZ6A 2FGLA 3FHAA 1W9XA 1K9FA 3GH5A 3QR3A 3MU7A
chains in the Genus database with same CATH superfamily
4FHAA 1VBGA 1W1ZA 1Z7AA 2VC7A 1OFPA 4JNYA 1W1YA 2A7NA 3WH8A 4AUBA 1C9DA 3G0SA 2PDNA 2CXGA 3NNTA 4R7OA 4ADTA 3QY8A 4JGDA 1RPKA 2JGQA 3NXFA 5DIUA 3E0FA 2EJAA 3QQ0A 4MADA 3SCVA 2BZNA 2F6XA 5H6HA 2XFFA 3SFKA 7ODCA 2J9XA 1K8YA 3MUY1 3GIQA 4U10A 4QEEA 3NVDA 1Z9AA 4OOUA 4RL3A 1WDQA 3EXSA 3TONA 3O05A 4V28A 3IHZA 3Q37A 2ZR4A 3FW6A 3M47A 2R1NA 3CU2A 3O2LA 4D1IA 2CBUA 4LYPA 3IAPA 1BF6A 4GI4A 1TMLA 3W27A 3DFTA 3GKFA 2QUMA 4FNUA 3SECA 1OINA 3FAXA 2QCCA 5D32A 4CCZA 4JQAA 4MZ1A 3GNOA 4GZIA 4AY7A 3UT0A 1JFXA 3O63A 4BQ5A 3TFXA 4A8IA 4DX3A 2L5HA 4JKKA 3TXVA 4A3UA 2RURA 1AK5A 1E1EA 1NVMA 3U48A 3APYA 6ALDA 3A3HA 3DN5A 1W3KA 4U85A 4N9CA 2VYOA 2WVUA 3BMXA 1CXFA 8TIMA 1RD5A 4IIEA 3U7VA 5I3GA 3IRDA 1DWIM 3QPYA 2GWNA 1Q6UA 1Q4WA 2WNWA 1A0CA 4H7CA 4W7VA 4Z1BA 4LCRA 1F9CA 3W38A 3E1F1 3BG5A 5A6TC 2C79A 2WVTA 4UFMA 3C2YA 2CESA 1V51A 1MUCA 2WSYA 1FWSA 2ZRVA 2MLXA 3I7QA 2JKAA 3WY1A 1UC5A 4AWEA 3BW4A 2QJNA 4DWSA 5H91A 4OBTA 3EX2A 1MFVA 5LIUX 1ZQ5A 4UOZA 3L2LA 4N9DA 4W85A 1IEXA 2Z1WA 1FXQA 3U3HA 1XBVA 2J8TA 2SFPA 1L2QA 1YW1A 5C8BB 1EC7A 1I0BA 3PVFA 3WEMA 2PDHA 2UY5A 4WLCA 5JBFA 1ZJIA 1DWFM 4KETA 2BVDA 3RIKA 3GFZA 2YCLB 3DG3A 1HJVA 1GJPA 1ZNNA 2A3CA 1K7EA 3DZ1A 1GNXA 1V77A 4CD6A 3IJLA 4U2YA 5D2YA 4HPHA 1VFSA 2E1DA 3TC3A 4JS3A 4HHPA 4NJIA 4YJ5A 2QV5A 3L68A 4RV3A 1FJDA 5HK4A 4RNIA 3IJIA 2YCKX 1S2TA 4XVEA 2VX5A 4DRSA 2OGJA 2QPSA 5BXPA 4MNMA 1UR0A 5JH8A 2ZUSA 2H8ZA 2WZIA 3O06A 2Y0FA 1RCOB 2C14A 1A5UA 3F5LA 5H8UA 4QTGA 3A24A 1F40A 3S2LA 4HTYA 3O5OA 2V5KA 2E5DA 2E67A 4IICA 5HQMA 1XCWA 4IP5A 1JPDX 4REQB 4O1AA 3DOPA 4QIUA 7TIMA 4S23A 1ZK6A 2CEQA 1JNDA 4ZCWA 3LHTA 1ML1A 5CSSA 2EQDA 2P3EA 3MW7A 1VPXA 3N2OA 4WDWA 4IPPA 2NV2A 2YDQA 3EIPA 3CHVA 5A8GA 1VBJA 1E6RA 1EOKA 4EWND 4K8HA 3NQBA 3SR7A 1KTBA 1VIZA 4M3PA 3VE7A 3EGJA 1JCMP 3VYLA 2Y1HA 3MY9A 1QZ2A 1M1BA 1H60A 4YL2A 3ES8A 1RSCA 3RMJA 1CWYA 4GUHA 2VN1A 2HVOA 2Z1BA 4PB5A 2OQYA 2WHJA 3P61A 5U4NA 4DJDA 5EPDA 3UESA 3QRHA 2G5WA 1DBTA 1VR6A 3KCLA 2VVSA 3LBCA 3WJYA 1JXKA 4IMEA 2Y6ZA 5A2AA 3H7UA 2X30A 4KFNA 4C5ZA 1G9HA 3S1XA 4PB4A 4CVUA 2PRHA 2VFHA 3LMYA 3W7QA 3PPFA 5I7GA 2RJGA 1TPUA 1XFBA 1KR1A 4C6KA 3N9SA 1F8AB 1JPIA 1OIFA 1AJ0A 5K4ZA 3NOEA 2DQWA 1J2WA 1JCJA 3OZMA 2IMRA 1UD4A 4BHYA 1JCTA 2HNEA 4XIMA 2VFFA 2CITA 1WNOA 3WENA 3EY6A 3PPGA 5AC8A 4REQA 1WAWA 1XKJA 2ZA1A 3R1ZA 1GJUA 4Q32A 4WF7A 3HFTA 4ENLA 4PMOA 2VD8A 2J6VA 3HU7A 2ZE0A 4XAYA 1PWMA 2OZ8A 1BYCA 1V3HA 2WB5A 1V02E 4AYGA 4GRSA 1DEDA 3QMTA 2WC7A 3KLKA 4HOXA 3DBNA 2V5BA 4WEVX 2BTMA 4UWMA 3GHSA 3CWOX 1H41A 2OPJA 2Y61A 5AOUA 1YATA 1DQUA 2INEA 4ZTXA 3L4UA 1W3LA 3TTSA 3PZMA 3WQEA 4AX6A 3IARA 4AIUA 4BS0A 2F23A 3LGEA 4XUYA 1BWLA 4Y9OA 3GVVA 3CPGA 3VDHA 2FMNA 1SFSA 3MCNA 1TZ7A 1VEOA 1LLOA 1QK0A 2C1HA 1KD0A 1M7OA 1N8FA 2ACSA 2RJHA 4KESA 1KRBC 1V5XA 4Q8NA 1BKSA 3LRKA 1EJVC 4QZVB 1KBKA 1TSIA 2VFEA 5F2GA 1ZCNA 4AHPA 2VRKA 2ACQA 2CKRA 2QCGA 4AQLA 3ONBA 1ZSXA 3FXGA 5HJLA 2QAFA 3GUWA 4B15A 3VZYA 3T2QA 5AYIA 2FZNA 4F66A 3SEPA 4YU1A 3IKGA 1GVRA 4W9OA 1B57A 1WZLA 4QQ3A 1UWAA 1QRQA 4UXDA 2ZQSA 3DGRA 3TIMA 4DYEA 1C8VA 3QC3A 4H9XA 5CPQA 3MYPA 4GUGA 1JNTA 2NQLA 4MZYA 1ROUA 3LUOA 3UXAA 4RZ5A 4TW7A 1HF6A 4DY1A 1EP1A 2V5LA 2VGIA 3RX3A 1OT2A 3QKZA 4H8NA 4OECA 2XVNA 3UZ5A 3QY7A 1L2UA 2Y89A 3COTA 4N9EA 2RUSA 3BARA 3BG3A 2G97A 2D9FA 1DHKA 3GB6A 3GG7A 3GYEA 4XVDA 6TIMA 3UWWA 3LV6A 4CNTA 4AEEA 1OX4A 2GQ8A 4H8HA 3NGFA 3CHDA 3QHOA 3PG8A 1PO9A 1FAPA 1YX1A 2AKMA 2D2GA 4L64A 4R7JA 4YTSA 3H21A 1FVPA 1VFUA 3HGJA 4BJHA 3MDYB 1KCLA 3KS6A 3V16A 1S1PA 1PZ3A 3CYJA 3LB0A 1EIBA 5FJIA 4ZQNA 5DEZA 3UU0A 4GZEA 4XTDA 5HW8A 2WK2A 4MTVA 1G7VA 2WJEA 4ZB5A 2ETNA 1QPKA 3LCIA 4GJIA 2O4QA 4DF2A 3W72A 3EPNA 3CV7A 1B3ZA 2JEQA 5FL0A 3M0HA 3T09A 3QZ6A 3KOYA 3ABRA 3WNNA 1LRQA 4UFIA 4HNLA 4GCAA 2JIWA 1W9PA 4ROPA 1IWAA 4JCMA 4G50A 3CASA 1C7SA 3QOKA 3PBYA 1O5KA 2YFNA 3DGBA 2X1IA 3UNDA 1SW7A 4CQ8A 1XI3A 1K7FA 4LV4A 1DXFA 1J5SA 2IPWA 4MDOA 4TX9A 2BV9A 1FDZA 1VLWA 2ZE3A 1E4IA 5A94A 4H01A 4LRTA 3RLGA 1AODA 1TELA 4NG3A 1MDLA 5CZJA 1UASA 1YTDA 3KBNA 3SRHA 4HU8A 1PWLA 4C6LA 3KEHA 3UCCA 1AQFA 2QJIA 3DUGA 5XINA 3W1QA 4MNKA 1KXHA 2FZDA 4JX4A 3WZ0E 4IIFA 5DX7A 3WBWA 1J01A 4YIWA 3RHGA 4M80A 4HN8A 1TR1A 3JVAA 2VQTA 3C0JA 4D1JA 2J7DA 3V5FA 1JZ2A 4JQ2A 4XK2A 3EWXA 3HF3A 4G7EB 1BSLA 1E6XM 1E5JA 3B0UX 1O4UA 3L66A 3M44A 4KWVA 4XAKA 2QUNA 4G7FA 4HMEA 2CBVA 2G3FA 4X2PA 5E6YA 2P1FA 1RQEA 3VFLA 1Q7QA 1XIDA 3LNMA 3SURA 2BOGX 3V18A 1JPHA 3I6CA 6REQB 4NX5A 3IK8A 2YXGA 3CGMA 1K8XA 3TAKA 4FEZA 3BXWA 1CGVA 4H1ZA 1TRIA 1A50A 1UQYA 2MLZA 1LQ0A 4XZHA 1WQ5A 2PTDA 3TA6A 3BSGA 1LOSA 1CPUA 2OZ3A 3W2LA 4F0MA 1BF2A 3AWOA 5FAJA 1L1PA 1V0MA 3CQ0A 2E28A 1F3WA 1FWDC 2ATMA 4PMJA 1T40A 4RDWA 5MHBA 1Q2RA 3MUZ1 1YBQA 3ZT7A 2ACRA 2I56A 2YDSA 4U5IA 3M6DA 2EPHA 3QZEA 2BG5A 1H2JA 1I75A 1D7JA 1L9WA 1A5CA 3O5GA 3G8RA 5CZ0A 2XWEA 3QV6A 4NJGA 1LUCA 3W3OA 2WANA 3EOLA 4BK9A 3PUEA 3VIFA 4UTTC 4MWAD 2PRLA 3T81A 3I7SA 3S5ZA 1W9DM 4JTCA 3CLMA 3CHFA 1SU5A 1ZTVA 3NL5A 4QSHA 3CAKA 3IIZA 4O18A 3QHMA 2ADAA 1LROA 1JYVA 2XH4A 2ZCGA 3BZGA 3FDGA 3E02A 4W87A 1ISZA 3WSUA 2Y7GA 3DHUA 2DJLA 4IQ2A 3PWAA 5HQEA 4MIMA 4DNHA 3CEPA 4O4WA 3W9ZA 3MDWA 4DLFA 2FGBA 2XN1A 1Y5XA 2AWGA 3SZ8A 5D75A 2FDMA 3TSDA 2G8ZA 1GOWA 4RKAA 3SCOA 1VCGA 1UD5A 3WF1A 3W6MA 3UPWA 1YNYA 1W32A 2KAUC 2ZXAA 2OEJA 3HGOA 1C93A 1BXBA 4J3ZA 1E4NA 1RK6A 3TWBA 2PCQA 5EU9A 3KRZA 4ZGYA 3QN3A 1GCYA 1NOUA 1JPKA 3B0XA 3FY1A 2DH2A 1ZP3A 5CQ1A 1PINA 3CYVA 1J10A 1S5WA 1QR7A 4PTDA 7XIMA 4RE3A 2OVLA 4I7WA 1BWVA 4FN2A 1TVPA 5M2FX 2VVNA 4WKAA 1O5XA 4H8UA 2X7VA 3L2IA 3NFUA 3PUDA 3KE0A 2J7HA 3IGSA 2PWEA 2ZTKA 4UFHA 2GVJA 2Y8UA 1V0LA 5ABEA 3FFSA 1JYNA 2GGHA 1ZBCA 3MYOA 4DYJA 4DLMA 1B31A 1NOFA 4BF7A 4FO4A 2HISA 3SUSA 7CGTA 3CPRA 3GHRA 3TU9A 4LYRA 3WDRA 4CQCA 5DMMA 4DO7A 4QEHA 1JUKA 3R0KA 3P8JA 4GK8A 3GBDA 5I3HA 4QG6A 1QPQA 3AHXA 1YLVA 5FJUA 4PMXA 3WK1A 2ZVIA 3LZ5A 1FX6A 1CYGA 1F4HA 2OYKA 3KS5A 2VCDA 4JIQA 3BK0A 2BY3A 2CZ5A 4IG2B 4AYSA 2PDQA 4HMDA 1TREA 3CLWA 3H7RA 3WH6A 3ECQA 2ZOXA 4IGSA 1DWHM 1Z44A 4R34A 1MYRA 1HGWA 3DFYA 2F4EA 3AU6A 3ME3A 3KAGA 4ZOEA 2YLLA 5AC7A 2Y24A 4TMBA 3S2CA 1W54A 2DSKA 3IIPA 1EDTA 3N4FA 1DWJM 1IYXA 1WX0A 3L21A 2DZUA 4HK6A 4QSFA 2PI6A 1M7PA 1WO2A 1XUUA 3WQ5A 4OJYA 3HQPA 3DFOA 4KCUA 2ZVRA 3TW7A 4AEOA 4ACYA 3RO8A 3PJXA 3GH4A 2PLMA 5IDZA 3HM7A 1OYCA 2BODX 2ZZ7A 4GUIA 2EEXA 2DZWA 4HOWA 1ZP4A 5AN7A 1DWAM 4HD5A 3A4WA 3TZFA 2Q5AA 4FX7A 1FWJC 4HQVA 2YPIA 3BQ6A 4X9YA 1CB7B 2IPFA 2MLYA 4DXKA 3KRUA 3B0YA 2E9LA 2YX0A 4C6IA 3WD3A 1AD4A 5H8PA 5LHEA 3VDGA 1H7OA 5I3KA 4F9DA 1JFHA 3PR9A 2PB1A 4B2DA 4IG2A 2V81A 5RUBA 2FVKA 3A4XA 1U22A 1QNQA 1JEZA 4L6HA 2FIQA 3JRKA 1X98A 4ODKA 1YXDA 4ICCX 1EWEA 5LSMA 3CAWA 3H2AA 3ZWTA 1BRLB 3ARRA 4C6OA 4E2VA 1R9XA 3JYMA 3WQ8A 3I3EA 3BCFA 4J3VA 4A4AA 5HWBA 3M7SA 5CSYA 1E40A 4W5UA 4XG1A 3K8LA 3PZ9A 3ITTA 1ZPTA 1KB3A 3P67A 2PGRA 1H0GA 4ZOCA 5FJPA 1KGUA 1FD9A 3OU8A 5LNRA 3SFWA 4HNCA 2I14A 3G8EA 1MNZA 4O54A 2ALRA 3AXXA 1ZRQA 4JAWA 5ECUA 3AIUA 2PPGA 4TU1A 1W8SA 4Z2KA 2R94A 2W6RA 4C1LA 3P6LA 5HW7A 4J3TA 3OGSA 2J9YA 4H00A 4IXXA 3EWBX 5DY3A 1POJA 3ZLHA 3R8RA 1JCLA 3RRAA 2NZLA 3S8HA 1UP0A 4PB3A 5D8WA 4B91A 3TJLA 1DJIA 4XBKA 3UA3A 2QZRA 1MEHA 3VMNA 2HS8A 2IQ0A 2ZZ3A 3GY1A 1J6PA 4MB1A 1OX5A 4AF0A 1Q13A 4AMAA 4IT6A 1S46A 3WLLA 2HVMA 2YL5A 4UIOA 3N4EA 4NYUA 4GI8A 4NJKA 4O8RA 1D8WA 5JBEA 5M1TA 1OD0A 3VNYA 1DXEA 1UUQA 4BWLA 3LCWA 4QS5A 3KVKA 4LSBA 5I23A 7REQA 3PN8A 3IJ7A 3R2GA 3N73A 3FOKA 4D6HA 3ZR6A 1AL7A 3G0XA 1KV5A 4KWOA 3T42A 4B5VA 1PJ9A 2F6UA 1P1XA 4IMGA 1O66A 3CV6A 4FNSA 3GD6A 3ZLFA 1FTXA 4M1RA 4AD5A 1T99A 3FJ6A 1QNSA 2XSBA 2WMHA 1ESWA 2PWDA 1J93A 3RGTA 5K3VA 1J6OA 1H62A 3A21A 2PPOA 2EPNA 2BOEX 4IJCA 2EPLX 1HGYA 4K2SA 5C9XA 2NX9A 1UWSA 3F5JA 2XSAA 1XS2A 2BY0A 4A3QA 1KFKA 1PX4A 3ID7A 4HA3A 1PSCA 2EG7A 1JG9A 1DKWA 3HFYA 5HR6A 4JKMA 4HNVA 5LNVA 3NL2A 5A6MA 4BR1A 4XX6A 1ISYA 1NSJA 2J75A 3WLPA 2AMGA 1EX1A 3LCLA 2FVLA 4K6AA 4AVNA 2V38A 5EA9A 1ICPA 2HMCA 4M24A 1YPIA 1Z42A 3QY6A 1FWBC 1W2VA 2QUUA 1VIWA 1TPFA 1NEYA 1VHNA 5F7UA 3BLFA 1U5VA 3CXOA 1H7PA 4YXGA 1MVYA 4R0XA 3N19B 4PR4A 4RUBA 5HW6A 2TRSA 2WCAA 3UZYA 5T91A 2GSJA 4QT3A 3W2UA 3V0TA 3SM0A 4TNSA 2VEGA 1EUNA 4E38A 2GDVA 5AYBA 3RG6A 2R91A 1U5HA 3T0TA 3UWUA 5I24A 3LCHA 1DJGA 2QS8A 3DDMA 3NOYA 1Z48A 1R86A 3QGKC 2VUNA 5CLWA 4M5PA 1KLYA 2FZMA 3L0KA 1B6CA 1SW0A 3TWAA 4B3KA 2NQ5A 1XIHA 1XLBA 5FEZA 2XH7A 4CQ9A 3B8IA 4LVAA 4FA3A 3OVQA 1FKBA 3OG2A 4F0RA 1OYAA 2VUYA 2Y7DA 1UYQA 3SQLA 4QLKA 4MMWA 2Y78A 1LM1A 2OWWA 4AIOA 3CH0A 1E3ZA 3UD6A 4KWSA 1R3VA 1M01A 2ZICA 1UIPA 1XYAA 3R8GA 3U7BA 4O19A 3BVJA 4US5A 1POKA 3STGA 4I8YA 1F05A 3VOCA 4HBEA 3CUGA 1I4NA 4NNBA 1GZJA 5DQPA 4UQBA 1BAGA 4KEMA 1S2WA 4Z42C 4MYAA 5C71A 2OELA 1H1ZA 4MB5A 3TN3A 3QMRA 3ZMRA 3AFBA 1HKKA 2XH0A 2E5BA 3HOJA 4S3BA 3DHFA 2QCFA 4DWSC 4AWSA 3GXDA 3DKLA 5LIWX 2J74A 2WNZA 4DN1A 3KDNA 3W1XA 3THAA 3SSJA 5HAOA 1D3CA 1TFVA 4QAIA 4WKFA 2DW7A 1ALDA 3GE7A 4CU7A 1KTCA 1TPEA 4MM1A 3AOFA 2E5CA 1Q8JA 3CQHA 4JTLA 4LXFA 3GVWA 3S5NA 4DO6A 2NX1A 1EXPA 1S39A 3REQB 2BNJA 1NWRA 1UKTA 2QJGA 3B06A 3PUOA 2AKZA 4HGXA 3ANYA 3V0UA 4C60A 4LAMA 1JCNA 2OYLA 1W3NA 4ADSA 4MFEA 2DG9A 3NPVA 4DYKA 1H51A 5AZ1A 2WOQA 3T0DA 2QCDB 2HZGA 4IPNB 2YGYA 4O57A 2RH9A 4AH7A 3M0MA 2HE8A 3HQ1A 4JTEA 2JQXA 2Z7KA 1H0IA 6TAAA 3TJIA 4GIRA 2E09A 1BEUA 2PDXA 5CAHA 4LEFA 4HMCA 4B5SA 2B7PA 3GQYA 1RXOB 1DOSA 3BMWA 1OB0A 2ZRZA 4TYOA 4NT0A 3IKDA 3N13A 3EX3A 4QM1A 2EULA 4ZA0A 1AH0A 2PU1A 4GGQA 1XLCA 2Y7EA 4EF9A 1GYLA 1HNYA 3AXHA 3NQ2A 4UC5A 3BOLA 4NNRA 3W1MA 1Y5WA 3LRLA 2KX9A 1EIXA 1TPH1 3OIHA 3PK7A 2GJRA 4NAEB 4DRNA 4Q7NA 2HV5A 1MW1A 1E9ZB 3SY8A 2ZX6A 4RW5A 1J4IA 3CIVA 1GQKA 3CHEA 3Q45A 4DPPA 3QSTA 5LIKX 1XLGA 1UC4A 3VKKA 3B40A 1PS9A 3WFAA 2IKJA 1TV5A 3REQA 2JKEA 3LYEA 3W23A 3B9DA 2OXNA 4PYSA 1AG1O 1G01A 2VP8A 2G3NA 4DJDC 4PL1A 4U84A 2VURA 1PBKA 3PSWA 3VKAA 3W7RA 4K1WA 2BS9A 1BGAA 4J9JA 2QCDA 1W1IE 3GVGA 1IR2A 3NO1A 4XZ9A 1EDGA 3BSMA 3UZJA 3AXMA 3AYTA 2VDIA 1YQ2A 4J2PA 5HATA 2VRJA 3SQSA 3VIMA 4TTGA 5D38A 5IXEA 3EXRA 4C6FA 1JDFA 3NQVA 4K1GA 1XYFA 5I09A 3TP4A 5DXYA 2PMQA 2V5JA 3KBSA 4NF7A 3C8NA 3NQ6A 3B05A 4XBSA 2RGLA 2CLFA 2Z7GA 2W66A 1AW5A 5FF7A 2QV4A 5ENLA 3TK7A 4LCQA 4IP4A 4UR7A 3LCGA 1TX0A 3LSCA 3E0VA 2PDWA 1Q45A 5MKGB 1K8CA 4B2DD 4AD3A 1O5QA 4HCLA 4E4UA 5AY7A 3WJZA 3PTKA 2DSZA 2BX7A 4NNAA 4LVFA 1H4PA 2FZ8A 1N1AA 4Q8TA 5A3HA 2D3LA 1FWAC 3SAZA 3S46A 1Q6HA 1YADA 1C90A 1S1RA 1M9HA 1ADDA 4L5ZA 3K8MA 4CNUA 1UR1A 2D2OA 3CUZA 3LHVA 2QUTA 1W9UA 4LBUA 4YYCA 2WZEA 1OQFA 1TIWA 1SJAA 1S5VA 3MT1A 1GZGA 2ZRYA 1Q6EA 1O1HA 4O0KA 4IMDA 2TODA 2XIOA 1BKHA 3PJWA 1D7IA 1LL7A 1LBLA 5CXPA 1RP9A 4LUIA 4UBPC 4ZE5A 5IRPA 3TCSA 3L4YA 3VNLA 1VP5A 4JTDA 4E8CA 5C9WA 4ORIA 5GQBA 2D23A 1FKJA 1Q6QA 1VJZA 1S2CA 3V5CA 2LPVA 1UA7A 2FTWA 5KSWA 4F0HA 3W26A 4LWWA 3F2DA 4AZ6A 4GA8A 4KGLA 1ICQA 4IOTA 1AH4A 4LBSA 4CU8A 4HKPA 1E43A 1LORA 3ABSA 3SN0A 4WHBA 4CNPA 3CT2A 4IIBA 5CAKA 4H4IA 1VJIA 4W9TA 4F2BA 1F6PA 3B9OA 4MDPA 5DO2A 4YVXA 1S2UA 2E9BA 3UJFA 3GH5A 4HIBA 1QWKA 3DC8A 3E2VA 4D6EA 1UMYA 4PBFA 2VGBA 3QMSA 3QR0A 4KCVA 3TYUA 1AW2A 3TTOA 3LOTA 1XBZA 4HYWA 1H49A 3RPMA 3ZYZA 1OD8A 5CPMA 4NXKA 3P74A 3BLDA 3O5RA 1J11A 4OTKA 2V9DA 2ZYFA 3CMFA 5K4XA 1V6XA 3IJ6A 1GYMA 5I98A 2QCEA 5CC6A 1GHRA 3FV9A 4XSLA 5A8MA 3Q67A 2CYGA 5BYWA 4PTXA 3OVGA 4FLOA 4PMVA 3OYZA 1BG4A 3R25A 1IXQA 1P43A 3R6IA 3C8FA 4BI6A 1CTNA 3ABZA 5A6AA 1FCQA 4MWAE 3Q4DA 2OSWA 5C9RA 1P7TB 1H7XA 1R3RA 5JH2A 5JIPA 1PV8A 1FA2A 1NARA 1E6NA 1F5ZA 3M64A 1EA0A 2V68A 3GS6A 4LS0A 2XP5A 2XVKA 1AFSA 2ZZ2A 4NSBA 4Q8QA 4ECLA 1VLIA 3ANVA 1NWTA 2QDGA 1CXHA 1OZQA 1T0OA 3WH0A 4FX8A 6XIAA 1JRCA 3UZXA 4AAJA 2Y85A 2BWGA 2G41A 3GAYA 4PEEA 1MZHA 2CLPA 4JN6A 4O11A 1FCVA 4FIQA 2AQOA 3G77A 3AUJA 4GY7A 5AYYA 5F4WA 3UERA 1XCXA 2GYIA 3GLCA 1SR0A 2QGYA 3TH6A 3CIXA 4XWUA 3TJ4A 3T8LA 4CUCA 1EYMA 1N82A 2PDLA 3BAYA 3KHDA 3H23A 1VAHA 4GIVA 3UCQA 5BRBA 3VC6A 1PCKA 2GQ3A 1KCZA 4XAPA 3NZGA 4EKJA 4X60A 1R87A 5BOFA 2J8GA 3A3WA 5BMXA 1NH6A 2FDSA 3M1ZA 4GIAA 1JCHB 1R46A 2P50A 4UQCA 1FKSA 2A21A 4L61A 5C0QA 2UY4A 1THFD 2JBMA 1MEIA 1CDGA 3WD1A 3NQ8A 2OLSA 2C1IA 1QI0A 3B9AA 2DUXA 3RPTA 1UB3A 4ROQA 2J77A 4P7OA 2I5QA 4EACA 3P62A 1LL6A 4A3RA 3B0VC 5HJYA 4ML4A 2Y5EA 4EXQA 3VD5A 4N4PA 3T2OA 4CD5A 4I5XA 2C13A 1DL3A 1XRTA 1XHGA 3N04A 4YLWA 2PURA 3W82A 3OLIA 5DITA 3W88A 4IX2A 1TUFA 3E2RA 5HMFA 3HPAA 1VFOA 8RUCA 1I2QA 4LUTA 3RDKA 3B03A 3S2JA 3WDHA 4H7ZA 2R1PA 4WZHA 4QR6A 5REQB 1TPVA 4WK9A 1TVLA 3SCTA 4A2RA 5LHFA 4LVGA 4NZJA 4YCPA 1XXXA 4AHQA 4WY0F 1WPCA 3M9YA 4ACZB 3TW9A 3M7WA 1FHUA 1O68A 1XICA 3EOEA 2FPYA 3S4TA 3USBA 1IEVA 1DE5A 3NIYA 4GZJA 1U1JA 1PE1A 1XYCA 1MXGA 1OF8A 3NZ1A 4HSOA 4UNKA 3DI0A 3QM3A 1PKYA 1EHAA 3DYMA 4PUJA 3FK4A 4PGLA 4R27A 3N29A 3BANA 2D73A 1G69A 4Q6JA 1I2OA 2B81A 2WMIA 3FGCA 3OA3A 4ODMA 3EX4A 3W02A 1LP6A 3I3DA 1L8NA 1KM6A 3KW3A 1YRRA 1GVIA 4YVVA 1GUVA 1QO5A 4W8BA 1Q85A 1HKWA 2A7PA 5C9ZA 1L6YA 3GR7A 5LKYA 1EF2A 3NWRA 3RAOA 4M29A 2G3IA 3T4WA 4O1FA 2XP9A 3FEMA 1XH1A 3OG3A 3W1PA 4CEUC 2QHAA 4J27A 1F76A 3LHYA 4YYFA 1T11A 2GGIA 3XIMA 5REQA 1W26A 1KQZA 1RVGA 2VNCA 2X1RA 2BBFA 5GJMA 3V7PA 4LC6A 5LNSA 3E12A 4PTMA 3R5EA 1D9EA 5GPRA 4ACZA 2HNHA 2PWGA 1PTAA 1I1WA 3G5EA 2WKJA 4QE4A 1FH8A 4F4RA 2FB2A 1W3HA 4JX5A 3W1AA 4XZMX 3HQOA 2YFOA 2Z2UA 1U1HA 4B4HA 5I6SA 4ODNA 3O07A 1CXEA 4AB4A 3GTYX 1XLEA 1VD6A 5FOOA 4IH3A 3S6TA 4MNJA 1WB0A 3NQMA 2FHCA 1FKLA 1M03A 5EY5A 5C9UA 3VOGA 3DAQA 1TJRA 4H9YA 3TCEA 2QPXA 5HNNA 2XUCA 1L6GA 1Z8AA 1MMFA 1R2SA 4KKXA 3ANUA 2XH2A 3CIWA 3N2TA 4QROA 2OZ0A 1HP5A 4DM1A 5MF5A 3A12A 1OG0A 1R9YA 4AXNA 2I7GA 3LTSA 1XIJA 3H9RB 1NFBA 2ALDA 1JJKA 3VNJA 1E70M 3GTFA 1S2VA 1FWEC 3LM3A 1LLWA 3P81A 2OTDA 1EP3A 4O15A 1RCXB 3TE9A 4AXKA 3TR9A 1CXLA 5D2VA 4CLMA 5A6SA 1QI2A 3H2EA 3SCRA 7PTDA 4ZQMA 3RLUA 1TUXA 4Z0SA 1XRVA 4DUXA 4H19A 4ES4A 1MUWA 3L5AA 4BEUA 1VYPX 2BHZA 4L7ZA 3OVPA 1OJXA 1QCWA 1VBUA 2ZBTA 3FX4A 2B5UB 3VDBA 1FCBA 4N6FA 4NQ1A 1AH3A 1IZCA 3HA1A 1UKPA 3BLIA 2Y2WA 1FWIC 3RX2A 4WXZA 4P2VA 2C1GA 1SM9A 5KITA 3AZSA 1U30A 1A5KC 1IZKA 4J2MA 1DPMA 2FTYA 5HNRA 3H4XA 3LG3A 2ZDSA 1TTIA 2I17A 3EDEA 3BG9A 4ERGA 1KQYA 3OOBA 5KMYA 3NRKA 4C1NB 3N15A 1XF0A 1HJUA 1Y0OA 1QXLA 4LY8A 5JXQA 1GVFA 3R10A 4HA0A 2NWRA 1HIZA 4ZOAA 5DT7A 4CCDA 3ZS4A 3G24A 3MHGA 3JS3A 4S3CA 4R5EA 2YDAA 4QP0A 4C7DA 4E8DA 1FKWA 3BAJA 2GOKA 1J0JA 2W79A 5AC5A 2VHLA 2XDFA 3HG2A 2EGZA 2YKKA 3EX1A 3PTQA 3CL7A 2E6DA 4MJZA 3HPSA 2CIPA 3B8VA 3TC5A 1SR9A 3TYCA 4DUOA 1ME7A 4EXBA 1VGAA 3E5PA 4GHRA 3PAJA 1BVZA 1J0KA 1A47A 3VINA 3CH9A 3UR7A 5LA2A 4NRSA 4FIRA 3UG5A 3GU1A 3L4TA 2ZA3A 2NLYA 5D8ZA 1SJCA 4HNUA 1HXJA 2PTZA 3GXFA 5LXXA 1PDZA 2FQIA 4H6RA 4Q8UA 1D7FA 1H09A 3KXQA 1JL8A 2PF0A 1HO1A 2RHGA 2PTWA 4Y9NA 1FRBA 2Z4GA 3DX5A 3WUGA 1SZGA 2XPBA 1UR3M 4ZVJA 2ZRXA 1BQGA 4LQ1A 3CL8A 3CM4A 4L6OA 1RBOB 3EAUA 2PV3A 4KRTA 5DBTA 2X41A 3AQUA 3CO4A 2LLEA 1PIFA 3LXCA 3T0CA 5AKQA 2R24A 4GPNA 1Q7ZA 4RLIA 3QKEA 4TVUA 2FTPA 1OT1A 3A64A 1JUBA 5C7VA 3OEXA 5DXXA 2BVYA 1GPFA 2PBGA 5FCZA 3T07A 2V3GA 2G4FA 5ABTA 1TWDA 2D0FA 4LAXA 3N17A 2QDDA 4XD5A 4I5UA 3GNXA 3QTPA 5DO8A 5F2MA 2CFFA 2ZZ6A 5LGXA 4W5ZA 1F7BA 3NPUA 4AZ5A 2YZ5A 4DF0A 3KOXA 4FAMA 4WGXA 4CN6A 4M56A 1TWSA 3UETA 2HSAA 4QAWA 4GX9A 3WF2A 1UD8A 4PMZA 5A8PA 3CTTA 4KFOA 2P3ZA 1S3HA 2OO0A 2O9PA 4GNKB 1RA0A 1MQRA 4ZE4A 4QLJA 1XIEA 5KZDA 1AL8A 4EPKA 3QFWA 1IT8A 1RK5A 4PUDA 4RXGA 2VZTA 1XLAA 4DQWA 1LQ2A 3S5SA 3SRFA 4QISA 4XZLX 4X3ZA 4RV8A 2QR6A 2W9MA 5G5IA 2ANUA 1KXVA 1PKLA 3UYCA 3RM8A 3KX6A 5C54A 2DGAA 4NZ5A 5I78A 3IGUA 2Q8LA 4IF2A 1RQHA 3C0SA 2ASHA 1BWKA 4BWLC 4KR0B 4WJ8A 4AZCB 3EOUA 5ECVA 1X1ZA 5GNYA 2Q09A 4DHGA 4UQEA 2PUZA 3DFNA 3WUBA 4EXAA 1R9ZA 3EKZA 2E0PA 4O53A 4IGMA 3WIJA 1AW1A 3GXIA 1VFTA 4LAOA 2F38A 4LS1A 1UUMA 3VOFA 4B5NA 4H6QA 4XZIA 3ITGA 1OGSA 4BFAA 3K30A 1QVBA 4HBOA 3UQIA 4GYFA 3TQPA 2YJQA 1FHVA 1FWNA 5LIXX 3ZLGA 1FWCC 2GQAA 4LB3A 5IFPA 2GJNA 1CGUA 3KL3A 2FH8A 3GW3A 4W84A 3NUKA 5A8QA 3GXMA 3RRXA 3WLKX 3ARPA 3KTSA 1NSGA 2GGEA 4LTSA 2HK1A 2MNTA 2BGNE 3QV7A 2ZZ5A 3CC1A 4AFYA 8XIAA 1VZWA 3C2FA 3G6MA 1VYRA 5E9XA 2NQ9A 5C6MA 3HV8A 3CUJA 2XHYA 1A53A 1T8XA 1US2A 1BVNP 4ATWA 1XQLA 3WLTA 2QF8A 5C2CA 3B3DA 3KRSA 2FAPA 3HTWA 3P5YA 1EHNA 3O6CA 1KKRA 3W0KA 3F03K 5A6BA 5CPLA 1E0TA 3DERA 4OQVA 4ZMGA 4A2SA 4ZEPA 3LBMA 4Y8EA 3CV2A 1GOOA 4PRRA 4AZCA 4Q8OA 2F2HA 1VJSA 3H24A 5I07A 2FZBA 4PL2A 2NVDA 1B9ZA 4ZO8A 2RDXA 1GTEA 1D6OA 1K9EA 4XKYB 2ZRUA 4LALA 4LUYA 1XIBA 1RY8A 2ZQVA 4TV6A 3WF3A 4E2DA 3KBWA 4W4QA 3XINA 1WXZA 1W5PA 4DBWA 3NQAA 1M68A 2H9AA 4GUFA 2Q3OA 5IHRA 1F73A 3QV9A 3LQGA 3OGRA 4JNZA 5D05A 2DZPA 3GR8A 1G4PA 1VFLA 4PTWA 4KWUA 3U4FA 1JF5A 5FJRA 3WLSA 4JTGA 2GGGA 4EP8C 2CLMA 1W3JA 4A8RA 9CGTA 1V7AA 3N25A 3Q2DA 4HU3A 2Z6IA 4MUPA 4AWUA 2EAWA 1W3IA 5BXRA 4K8EA 5CCZA 2P0OA 3EBVA 1Z3NA 3KL5A 4JHOA 1OHLA 4I7UA 1W0MA 4CD8A 1FWRA 1TMQA 1QNOA 4ODPA 4MKNA 2DZAA 4GXPA 3W70A 3U5UA 4ODQA 1Z69A 4YTUA 2WWDA 3JU2A 4CGTA 3W1TA 1R9HA 1D3GA 1GZ1A 2EF9A 1NFPA 4ICNA 3NQFA 2ON3A 3MUIA 3MVTA 4ZR8A 4N19A 4PCNA 3F4DA 3GDBA 1QT1A 4JQ4A 4A35A 3W2NA 3W74A 1A5LC 2DVTA 4ZXOA 1EJRC 1M6JA 4XKYA 3UP8A 1SO5A 4HSHA 2C0AA 1E9IA 1EJUC 3GHTA 1FWTA 2CWNA 1ENUA 4FNPA 4DBSA 2QXWA 1SFTA 3OBKA 3PB2A 3O8AA 1E73M 3F2BA 3IIVA 3NZQA 2FFCA 1YE6A 3PZIA 2J88A 4NXSA 3GG1A 1B3WA 4PUWA 1NF7A 1UR8A 1GOMA 4V33A 4TTUA 2VJXA 4QQUA 1ZJBA 1FKIA 3G2GA 2VR4A 1XR2A 2ZRWA 3ALFA 4Y7EA 2FKEA 5BOEA 3EB2A 3N11A 2EG6A 3RLVA 1W1A1 2NX3A 5I06A 3B8UA 4IQCA 3NYZA 1EQ3A 3UI4A 4H6KA 3M5YA 2IKIA 2YLAA 3WFLA 3ES7A 2BMBA 1YXCA 4WKHA 4IMCA 3G6LA 1Z6KA 2YCJA 5G2IA 2O9OA 1DYSA 1W5QA 2ABAA 3BQ5A 1MXDA 4LF1A 5FF0A 4JN7A 3P7YA 2PRMA 4OGZA 1DTUA 5AHIA 4LC8A 1OGBA 1EEXA 1VEPA 1XLHA 3B8DA 3W01A 4LS2A 4OVXA 4B5WA 1HKJA 3WNKA 3NURA 5F2LA 1EP2A 3E6EA 3OYXA 2AL2A 4R3UA 5F4XA 2FPVA 4F3HA 3LNPA 1QUMA 2CBIA 2BGQA 3M0LA 5IBXA 1UHVA 3IJ9A 4ITZA 2H6RA 1Y8BA 3S3GA 4DZAA 2REQA 2M1IA 4KEVA 4RZ4A 3IVSA 5FESA 5HUAA 4ICMA 5A6KA 4M7TA 2C91A 2GFTA 1YPFA 4IISA 4N2YA 4L3NA 3FSUA 2DPEA 5C2GA 3KZSA 3MSYA 4KEZA 3MANA 4WSHA 4C7GA 2FB3A 4ATLA 4QDPA 1QI4A 4JPGA 1VEMA 3W86A 3SGUA 3HMCA 5T26A 1U33A 3L4WA 1JDAA 1IEWA 1LCOA 1G1YA 2IQTA 2GVLA 5D2XA 5G1MA 3FXYA 4JNMA 1L6FA 5E6ZA 1QOPA 5CJMA 3NTYA 3PR2A 4IZGA 4JX6A 4FOJA 4Z1YA 5D37A 3SO7A 2PN0A 3T1GA 5F1UA 2ZUWA 2POZA 1KT0A 4IQDA 2R1LA 5CG7A 3VCRA 3MJYA 4UFJA 1V02A 4DRPA 3H53A 1TCDA 2OT0A 1P6CA 3OB8A 1O60A 1TR9A 1GVSA 3VD3A 4GO8A 8CGTA 4E2OA 1K8ZA 2CHRA 3GR4A 4A8NA 2JF6A 3WJSA 1CXIA 4MSPA 3TA9A 4WOQA 2ZXBA 2XP8A 4GUJA 1TG7A 2F61A 1SQ7A 3GNDA 1NDWA 5CGQA 3U2CA 3WLRA 3VIOA 1D8CA 3BAKA 2O55A 1DJNA 1JNSA 1UZHA 3BW2A 2WSRA 3FJNA 3AS0A 3GTXA 1XLJA 4MOZA 1WZAA 5JUVA 4XTIA 1JPMA 3MQTA 4Q8WA 3NDOA 3UR2A 4PEKA 3TN5A 2RQSA 3L4ZA 3DFPA 4DT4A 4LOCA 4JICA 3AHTA 1HJWA 3R8HA 3LHZA 1G7UA 3IUIA 2BGSA 4KPLA 4S1FA 4DF1A 4WVXA 4AIBA 4LFYA 4ZQCA 4HNOA 3LBOA 4AWTA 5GJNA 1Z32X 4IJRA 2VR2A 5TIMA 1I2PA 3G1YA 1PYFA 5B7ZA 3VKBA 1X97A 2GDQA 5C55A 1NM9A 2OT1A 2PDYA 1HQTA 1Q7MA 1EKOA 3NO5A 4QLLA 4FPSA 2UZ9A 4AMCA 1XIGA 3ZIZA 3F4VA 4PCFA 3BE7A 3BGAA 1TO3A 4CN4A 3SY1A 4MGGA 4HN4A 2VCBA 3RR4A 1AMYA 3W1UA 1CECA 3P2VA 1AMKA 3AHVA 1XH2A 3WFZA 4XO6A 3ZXWA 3OP2A 1NDVA 1VFFA 2AL1A 4RNFA 4N6EA 4JFUA 3BUVA 3WJWA 2RFGA 2X1TA 4UZSA 3DG6A 5EGRA 3P0WA 4LUSB 2G96A 2Y8VA 3MKVA 3A3XA 4IPJA 4IX0A 1NFGA 5FJOA 4GY0A 1EL3A 5DRIA 1REQB 4KGJA 2VDGA 1XRSA 2BHUA 2B4GA 2Z1XA 2NQZA 5B80A 5GNZA 5E70A 5EYWA 3U4AA 1SZRA 5C7HA 4G2PA 5CLTA 2P0IA 3VMOA 3F4CA 1XL9A 1NY1A 3W71A 3W7HA 1K6AA 2CZEA 3PM6A 4TR9A 2DSVA 2WJDA 2GJXB 3W7LA 4IGHA 2X05A 1PKMA 2XU2A 3LUTA 1E1CB 1B4EA 1XGZA 3AJXA 3M0ZA 1DJHA 4WQ6A 1GOKA 3POHA 3MUXA 5I3IA 5HQLA 3CO8A 2PS2A 3TSMA 1DHPA 3AMLA 2X1UA 3VVGA 1O1ZA 2J25A 1IR1A 5TQLA 3O0FA 2X0YA 1GQLA 1S5TA 4YMZA 3C0QA 1Y0EA 2ZA2A 6XIMA 1F3TA 3TLQA 3ZFHA 4QJ3B 2BASA 1DP0A 1VBHA 3S1WA 3TNOA 4LUSA 4CKQA 3BC9A 2QF7A 2LKNA 2R1KA 1WOAA 1QI5A 2Z25A 5A2CA 1QMLA 3H2NA 4PCSA 2WSQA 3UXDA 3ARSA 2QMJA 1DJQA 1ZHAA 3GSMA 3KABA 2W5FA 3SIMA 2OFNA 4AIEA 3OW1A 2QCLA 3B8WA 4L72B 2R82A 3QGVA 1TYGA 4IWWA 3U57A 2GJXA 1VC4A 3EMCA 1OEPA 4GACA 1KWGA 3MPGA 4TVDA 1QWGA 3O5FA 1EEPA 2D20A 3ZSTA 3PPCA 4YS1A 2BP1A 4H83A 4WGHA 1CEOA 4I7VA 3G22A 4D6GA 2CPUA 3VNKA 4PZVA 3D5HA 3EA1A 5I2UA 1YDNA 2GVEA 4PE8A 2MANA 1ZB5A 2XWDA 1OSEA 3TYZA 3IPWA 1N55A 3AC0A 3FJLA 2WM0A 5HMEA 3B9EA 1YMYA 1UZDA 3NTPA 3D46A 1TQXA 3AMKA 4IQEA 1LWHA 1TV7A 1TA3B 3EDFA 4MKVA 2ZWYA 1V3KA 4TX6A 4C6NA 3EKGA 3HJEA 3BLKA 1M7XA 2CZDA 1YEYA 4MJMA 2F84A 1NWUA 4QJ1A 4K38A 1GOIA 3ENLA 2M2AA 1W56A 2YCLA 2RUCA 3GXPA 4ZB2A 1QHOA 4B92A 3W7CA 1Q1CA 1E0WA 2PPNA 1OK4A 2CW6A 4W7UA 3M0IA 1PB0A 5HUOA 4GI9A 1HW6A 4ONVA 2ITKA 4U5KA 3W81A 2JKPA 3SRDA 2J7FA 4WR3A 1M53A 3WH5A 3W25A 3U2OA 2AGTA 2Z1SA 4GC3A 3I3BA 3VDAA 1FWFC 1VQTA 3VFCA 2GSHA 5AVHA 6CGTA 3BMVA 4TVCA 3W00A 1V3IA 4MZ8A 2DG4A 3LN3A 3ZWSA 5AECA 4GX8A 3KRBA 2E3ZA 1U2YA 4MJ2A 3GAKA 3O5KA 3BAIA 2TPSA 2I16A 2DV0A 4P5UA 4ZO9A 3WBEA 1B54A 3SCUA 1WDWA 2WHKA 3HG4A 4E4FA 4L65A 4GC4A 2J24A 4GLEA 1UKQA 1BKFA 4XQ6A 2HCVA 4UTIA 2V6AA 1J2BA 3KHJA 3QQWA 3D6NA 1BGGA 5CSRA 1AA1B 4UQAA 2GK1B 1UIOA 2E6FA 4KQNA 4KMQA 4TX0A 2KO7A 3G3DA 2J7CA 1KW1A 2YSWA 4LT9A 4M82A 1GVEA 5DMLA 3WL0A 2AQVA 2YXXA 4JIHA 1QO2A 1WV2A 1D7KA 2ISDA 4MPQA 3H2CA 2PP1A 2XIMA 4BI7A 2YOCA 1JD7A 1B2YA 1XBXA 2I1OA 1N2VA 1ONXA 4DJEA 3U2ZA 1UCWA 5J04A 1LYXA 1HKMA 1NDYA 3LXBA 2IUZA 3NEHA 3GDLA 2NT0A 4XIAA 3VTRA 1AQHA 5FJJA 1EZ2A 1P0BA 2X0SA 1JUEA 3NL3A 3HMJG 3KL0A 5DCBA 5F4SA 4PMRA 1YHTA 4GJJA 5JU6A 1PX3A 2TSYA 3E0LA 4PH6A 3DENA 1FWGC 3OZYA 4JTHA 2QJHA 3P3BA 1IX5A 4X0NA 2WZHA 4Q4RA 1IT7A 2ZTJA 4PBEA 3GXNA 1NJJA 3OLGA 4CN1A 4CEXC 4CD4A 3C5QA 4FXJA 1OC5A 5EL1A 3M46A 1FKXA 4L9YA 2NW0A 4P8VA 5EFFA 4ZS6A 3R4IA 1GKQA 3IANA 2BHYA 2OKTA 3C52A 2VWTA 1DIOA 4LUJA 4KW2A 1GW9A 4E8GA 2VTFA 3SCWA 2GK1A 1PVNA 4D2JA 2NXGA 1XFCA 3NXLA 4E5TA 2HTMA 4QDMA 4GMEA 3ZJ6A 5LZLA 3UXKA 1H1NA 4NYYA 4A21A 3S1GA 1JGIA 2RDTA 3AO0A 1QPOA 1EBGA 3U5YA 1B90A 2GLKA 4D71A 1V3JA 4TO8A 1JZ8A 2GDUA 4M6VA 4A6GA 4QCFA 4ADUA 4IFOA 7ENLA 4D8ZA 4YTRA 1SFLA 2PCEA 4FR1A 4F2TA 5D2WA 4Z1DA 4K39A 1EGVA 2XVGA 3BCJA 1EF3A 2QAPA 2Z1KA 4INFA 4UR8A 5XIMA 3WMBA 4AG0A 3E49A 1W8GA 1C8XA 3O5PA 1KBLA 2EO7A 2GVGA 3W83A 3WL1A 3S9ZA 3A9BA 2VL4A 1WCGA 5F1VA 3WF4A 3BOFA 3S2MA 9RUBA 3WEZA 3GH7A 1ZAHA 2Y7FA 1R30A 5AVNA 4P7QA 4AHOA 3UBPC 2NVAA 3RJXA 4POCA 4HA4A 3IGHX 5HR7A 4HZ6A 1X39A 3O6DA 1W9XA 4HMNA 1IGWA 3QPEA 1V6YA 2VENA 1Q6GA 8XIMA 1XLFA 3L2MA 3VIHA 3KCOA 1A5MC 2XN0A 4RW3A 3H4WA 1IF2A 1JYWA 4ZXLA 5BRPA 4FZIA 4DZ3A 4HARA 4B16A 3LSBA 3CQJA 1FFQA 3QF0A 3EMZA 1H11A 3RM4A 1HTIA 4WY0B 4L4MA 2PLCA 3GFYA 5DMYA 2ZR6A 1R3SA 3TR2A 1JD9A 1FHDA 2FJUB 3LTYA 1AQ0A 4S3EA 4Q33A 3EX6A 3PTMA 4LRSA 5HANA 3ZQ9A 1W5MA 3BTNA 3WDIA 2D69A 2V63A 3WNLA 4MB4A 2E6AA 2WNQA 1U83A 2MUCA 4RCXA 1AZ1A 1OM0A 2DZTA 2PLKA 4ILSA 5GPGA 3MUCA 3W7NA 1X8CA 1ZS2A 1MI3A 1H5YA 4Q7IA 3O5MA 5D33A 4GG9A 1VB9A 5I0DA 1E6ZA 1JI1A 3W1NA 1KXQA 5C70A 1Q5MA 4QITA 2V3DA 3R12A 1ZAJA 4QXIA 1XGDA 1FCUA 2FHFA 4LNCA 5HWJA 2NUYA 4IT1A 4TUFA 2ZADA 3S83A 5XIAA 4PUNA 1CNVA 1TVNA 2I9UA 3ZJ7A 1EYEA 1AD1A 3ZVHB 3RILA 5A1AA 5HMDA 4UTLA 4IUGA 1XX1A 3THQA 1XC6A 4UOJA 4IPLA 3KADA 5GVJA 3UFYA 2VX4A 2J27A 2WSPA 4UOQA 2EHHA 1UR2A 1RJRA 3EWWA 1M7JA 2EKCA 1BLIA 2XFWA 3WBXA 4LANA 2YCIX 3WMCA 3H26A 3KBJA 5A8OA 4R7WA 4QG9A 3PNZA 5JMUA 1KA9F 2OWCA 4MUZA 2RDUA 4MGVA 4P7RA 3SRKA 1Z89A 3UA4A 4DWSD 3UI5A 1NOWA 3F5KA 2CLHA 3S6DA 4LAWA 3GIPA 3B8SA 3VIJA 2F9RA 3I7RA 2WZTA 3V3WA 4FLQA 4ERIA 2PD9A 1J8VA 4GNVA 4OUEA 3ZT6A 3VDCA 2KI3A 1XDMA 2QPUA 3AJ7A 3NCOA 5C5YA 3WBYA 2WPGA 3BPWA 1IHIA 5HJXA 2V69A 4US6A 5CZKA 1H61A 3HPXA 1X6LA 5D9OA 3PNUA 3LHWA 1T5AA 1MEWA 5FAGA 1FKDA 4X2RA 1IIGA 3CS2A 2ISSA 3N2MA 3W24A 2V30A 3W75A 3ARWA 5M5DA 4DZ5A 2YB1A 2TYSA 5DT5A 1KM2A 4CCEA 1V8EA 2DSUA 1E0UA 1HT6A 2AAMA 3STFA 3KACA 4LAZA 1KM5A 1ZJAA 1LQAA 3UGVA 4PUEA 3PS7A 4G7EA 5B7YA 2PWFA 1KC7A 2GQ9A 4UTUA 3LD5A 3TOPA 1XC4A 2QVHA 4IFKB 3STEA 3C2EA 5H1WA 1G4SA 2PGEA 4GISA 3VUPA 2W4XA 3CZEA 4FXSA 1OFEA 4IQLA 4WXYA 3T9PA 2ZQ0A 4QFUA 4O2TA 4Z2LA 4HNTA 1KRAC 2BVTA 2O4MA 3TQKA 3A47A 3PHAA 3ZR5A 1KCXA 3EEZA 3ARVA 1TJ1A 4BA0A 1KWKA 4Y6GA 4O14A 1CLVA 3KFTA 6REQA 5AHLA 4Y9AA 4EVZA 1NDZA 2A5HA 3HPFA 2A0NA 4GQGA 2J7GA 3WQGA 4HZ8A 4KBXA 2XJ7A 4XD3A 4XD6A 1JZ4A 4LW7A 2OMAA 2XP7A 3QSRA 3K4WA 1B30A 1XYLA 3QJAA 1MQPA 1X1OA 3WX7A 4JN8A 1M41A 1VPQA 5A95A 4D9PA 1YIXA 3PFRA 1IV8A 1E51A 4AY8A 3E5BA 1RALA 3DHPA 1Q2SA 3H55A 2V3EA 3H6OA 3BZJA 5IHSA 3J7HA 3GKAA 3MI6A 4LPCA 5B8IC 4DJDD 4IFRA 2ZR5A 4AC1X 3FYYA 1M65A 1W2PA 5HWCA 3R0UA 7TAAA 2R6OA 2DT0A 2C19A 3WQFA 4K7YA 1QATA 2Y4SA 1QK2A 4NJHA 3AHZA 1SSGA 2WVVB 1RV8A 2E77A 1EJXC 4DZIA 4YCOA 3GDKA 4NZCA 1ITCA 3AXIA 3H4GA 4N7QA 3R58A 2WSKA 4IFKA 2Y8KA 5HA7A 2O7QA 2BXZA 4X61A 1KKOA 4GKTA 4DNMA 2POTA 1M04A 1WBHA 3VX1A 1E6PA 4CNOA 1A5SA 3IUHA 3UVIA 3RF9A 4M6UA 3F4NA 4DM2A 5E93A 2GWGA 2AMXA 1Q4NX 3PZVA 3ALGA 2Q6ZA 1G4TA 1FP9A 2WJZA 3C3NA 4UTFA 3QLLA 3QW4B 4Q4KA 4L1XA 3BOXA 1RUSA 2VZOA 4K7VA 1NMVA 2NXIA 3OBEA 1U79A 3CZGA 2DP3A 1K9DA 1WDDA 1J4RA 4GVHA 4JYSA 4RR4A 4ZOBA 1G5AA 5E5CA 5HNUA 1I2RA 3G1XA 1LWIA 4KFPA 1XYMA 2YBUA 3O5QA 3PZOA 2HWGA 3VILA 1EGZA 4MLJA 1W1PA 3UQNA 2RGMA 2X42A 2BDQA 3G1HA 2J66A 2OCZA 3MC5A 4RDVA 4OV4A 3CAQA 5D30A 4JYEA 1JZ5A 2PDFA 1AJZA 5FF4A 3WMLA 4V15A 3QV8A 4DAIA 2H8XA 4D6CA 1QW9A 4LVDA 2DORA 1KRMA 1KRCC 2GJPA 1YDVA 3R89A 4ZB0A 4NAFB 3FDKA 1O7AA 3IWPA 4LYQA 2MNRA 2V2CA 1X96A 4Q8MA 1MUMA 3GG0A 3BJTA 4BQ4A 3TTEA 1J0HA 3GRIA 5TAOA 5D02A 3H70A 3TZNA 5CBJA 2PWVA 2WVSA 1KM1A 4PULA 3A4AA 1WUEA 1SZNA 4YN5A 3W1LA 1JCXA 1CI1A 1OF6A 4UTKA 4L9XA 3CHCA 4KT2A 1XLLA 4FXRA 2DG3A 2Y63A 1G67A 5AC6A 3PZQA 4HOZA 1GVQA 4AVOA 4UUIA 1KBIA 3AUOA 1LRNA 3S0CA 2PA6A 4DIAA 2HROA 3VIIA 2QDEA 4HCHA 4IJBA 3ARXA 3NQ7A 4JIPA 2ODOA 3HGRA 2ZUVA 3H12A 4RE4A 1QNVA 1A4LA 3PF3A 2PDIA 2PDKA 3O7UA 1KBBA 5TF0A 4NUWA 5FACA 1QHZA 2QCNA 4OE7A 3WH7A 3LI1A 1TCMA 4MG4A 2XGZA 2XIQA 1R0MA 1D7HA 4R88A 1K02A 4DBDA 3W7KA 4JTTA 3HBLA 3BLEA 4LAKA 4Y9MA 2E68A 3GXTA 3MI2A 5C2XA 3UI6A 3I6RA 1TPWA 4NJJA 4AD0A 2VXNA 2P88A 4NAFA 3ZSSA 2ZX5A 3MSDA 3TYEA 3CUIA 4C6BA 4QS6A 4HHLA 3RLHA 3GFXA 4B3ZA 3RYSA 1HL2A 1Q63A 3QYSA 5IBXC 2Z2BA 2DIEA 2VD9A 3N3MA 3W4RA 1CCWB 3STCA 4JFVA 3S1VA 2CHNA 1TZ9A 4BQ2A 4WIWA 4KCTA 1VENA 3OQEA 3OBAA 1OG6A 1OC6A 4XUGA 3K4DA 1WZKA 1V79A 2CBJA 2V3FA 3ARTA 4J3SA 5AC4A 1NP0A 2WZMA 3C2RA 3CMJA 1OCQA 2O56A 1RJQA 3OGVA 3UWYA 1US3A 4WOZA 3YPIA 4E4PA 3CGTA 1FDJA 3TX9A 4QBXA 2VMFA 1BRLA 1X1NA 1TTJA 3UJSA 1NQKA 1XUZA 1R7OA 4QE1A 2QLYA 3H2OA 3EYPA 1ITXA 1BTMA 4W7WA 2J62A 4NL1A 1ZBWA 3L5MA 3E2SA 3AU2A 1TZZA 4DWSB 4DWDA 4TIMA 5CC3A 4WSKA 1IEQA 4FSAA 2P4VA 4EF8A 5EMUA 3PBVA 1Q6IA 5BZAA 1W17A 2YW4A 1JDDA 4URIA 2PODA 4AZ7A 4WX2A 1OFRA 3XISA 1TJPA 1XIIA 1XBYA 3ABXA 1YPXA 1BSIA 1SW3A 4Z1AA 3SI9A 2CLLA 3VNIA 3SUUA 2ZUTA 3G1VA 4RZ6A 1QAPA 2WXDM 2F2KA 1J5TA 3LTPA 3T8QA 4FLRA 5KINA 3L12A 2EPOA 1QPLA 1QNRA 2VOTA 3GHUA 1H50A 1UMLA 2M08A 4JTRA 3TQVA 4UFLA 2YIHA 4K3ZA 2K8IA 3QW3A 3ERPA 5FSDC 3M0JA 1RQBA 3T4CA 4MWAB 2VX6A 3HB9A 4TX8A 4AD4A 1ONRA 4MB3A 4S3KA 3P14A 1UH3A 4Y8FA 2QJMA 1PTDA 2W92A 3UF8A 2QJJA 4OFCA 1XPGA 5DLCA 3TC7A 3UGRA 1EJTC 1YE4A 4IMFA 1KXTA 3FAWA 2O0TA 4XO7A 2Q3RA 3TYBA 3W2JA 4EIVA 3BICA 4YWIA 4TW6A 3W28A 2E25A 3ODKA 4GINA 1RLCL 4M0XA 1XLDA 2ICSA 2WC4A 3EZ4A 2NWSA 2VKZG 3VA8A 4H6EA 1GG1A 4A29A 3TQ0A 4L4PA 3DIPA 2GOUA 1QHPA 3BGJA 1BPLB 4PMYA 3P84A 3M5VA 3VC5A 1XSJA 3C4UA 1C91A 1MFUA 1A5BA 4FB7A 2BSLA 1LG2A 4Q7BA 2XP4A 4DRIA 5AYZA 1F07A 3GC2A 1UZ4A 1YTKA 3EA2A 5E1QA 2VC6A 3WJXA 4FNTA 3MO4A 3URBA 5M3WA 3LV5A 3ATZA 3VGEA 2ZZ4A 1NELA 4JFJA 1ZFJA 3AYSA 1GORA 2XM2A 1CX9A 3LLDA 3T0BA 1K4GA 5FA5A 4MWAA 3LA4A 3UWQA 4QNEA 3LPFA 4GQBA 4O12A 2I5GA 3FSTA 4HJWA 1E5NA 2Z26A 5CH9A 2QULA 1XISA 3KBVA 4O28A 4N0RA 4EANA