4MTVA

Crystal structure of the complex of buffalo signalling glycoprotein with pentasaccharide at 2.8a resolution
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the complex of Buffalo Signalling Glycoprotein with pentasaccharide at 2.8A resolution
rcsb
molecule tags Signaling protein
molecule keywords Chitinase-3-like protein 1
total genus 123
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2013-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4mtvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mtvA01
2PF0A 3BLKA 4Z2LA 2DT2A 3OG2A 3OLDA 2V3DA 4D6CA 2XVGA 1NH6A 2A3EA 3N04A 4B3LA 4DWSB 1DWGM 1QNPA 1SFSA 4JFUA 3PHAA 4MDOA 5IFTA 5A94A 2YL8A 3SUTA 1LL6A 5KEZA 1CLVA 1DWFM 4AISA 2WB5A 2QF8A 3K8LA 3VMOA 3N9KA 4LPCA 3MUIA 2XM2A 3VO0A 1R86A 3VINA 3O6AA 4A4AA 2O92A 2WANA 3WY1A 5BRQA 1XRVA 3N18A 1H49A 4Y7EA 1HKKA 3SUSA 1UD5A 4IPNB 3UESA 1V0MA 1KXTA 1GZJA 1CEOA 5LA0A 2CBUA 2VVNA 2ZICA 1WE5A 1FH7A 1FHLA 1HX0A 2WNWA 1LL7A 2O9PA 4CKQA 1EHAA 9CGTA 1KXHA 5GPRA 1VEOA 3CPUA 1DTUA 1XSIA 2WVVB 5C71A 3CMJA 4XZWA 1QW8A 2VNCA 3VDHA 4B9YA 1WP6A 1GQJA 1W9DM 1X1NA 3L4VA 3ZMRA 3WF0A 1E6QM 3L2MA 3DC0A 3VOCA 3CUHA 3VD7A 3SCNA 1UKTA 3FXYA 2GSJA 5EB8A 3BXWA 1MYRA 2ZWYA 2CKSA 2ZXBA 4DUWA 3IJ8A 2ZE0A 2BY0A 1E55A 1E70M 3AMGA 2EBNA 3OLGA 2YIHA 2W63A 1JG9A 1J01A 2A3BA 2G3JA 4PSPA 5AYBA 5A6AA 3VIGA 2GK1B 3DHPA 4GO8A 1MW2A 1UQZA 1MWOA 3AHVA 1UOKA 4JKKA 2J62A 3AFBA 4QFUA 3SEPA 2W4XA 3FNDA 2Y5EA 4CN6A 4TVUA 1V6XA 3WF1A 1JYVA 3KL3A 1B90A 3EYPA 4PTXA 3GM8A 1A3HA 1E6RA 1CIUA 3DYMA 4AZ6A 4DM1A 4AW7A 2XGIA 2WCGA 3POHA 3O2LA 2CESA 4HA1A 2G3IA 5JBDA 1V03A 2VQTA 3KE0A 2YBTA 5A8QA 1TCMA 1RP9A 3CTTA 3AIEA 3K8MA 5M5DA 3FAXA 4GZJA 3WQWA 4QP0A 5BXTA 3PBGA 4F9JA 1JD9A 1JFXA 2YDRA 2VR5A 4X0VA 1BGAA 4YHEA 3M7SA 1E5JA 1E4LA 4P7RA 3VNYA 3WD4A 4M81A 1C90A 3ZOAA 2YJQA 2VC9A 3ARVA 2ZXDA 3L4ZA 2PB1A 1UKOA 3BLPX 3CLWA 1DWAM 4GIAA 2WLZA 1TVNA 5CPTA 3F4VA 3KEHA 2VUYA 3CBWA 3M6DA 4TUFA 5FD0A 3W81A 4EE9A 1KFWA 4HP5A 1JDCA 4UR9A 1AVAA 2WMFA 3VM5A 2Z1KA 3VPLA 2A3AA 4JCLA 1EO5A 4FF5A 1BLIA 5BXSA 2EPMX 5I6SA 1ITCA 3CUIA 1UR9A 1W91A 3AMCA 3MSGA 4UFMA 3N1AA 3NSXA 5F7UA 5D9PA 2DGAA 3QHOA 3S6TA 1BAGA 2VL4A 3LPPA 3QOKA 2OYLA 4ACZA 4JHZA 2X1IA 5D8WA 4PMYA 5BXRA 2BFGA 3PTMA 1GOQA 5CZKA 3L2LA 4TOQA 5BYWA 3KL5A 2WXDM 4H8HA 3ZO9A 2VI0A 2X0YA 1B1YA 4JFWA 3U5YA 5A95A 1B30A 3SUVA 4C7GA 4ZENA 4P7QA 4B9ZA 3RPMA 5LA2A 4PN2A 3EBVA 4D6JA 3WDPP 3ARTA 4PTMA 1PAMA 3AS0A 1NOFA 3GZAA 4J3TA 2D1ZA 3ALFA 2UY3A 3UCQA 4PUEA 1DEDA 1G01A 1E15A 3MSDA 1CYGA 1EDTA 1BYBA 1WNOA 1SYTA 7A3HA 4CD8A 1D7FA 4YHGA 1UWUA 1UWIA 2WM0A 1W1PA 4PEEA 3TTSA 3BAYA 3FW6A 2CHNA 1PEZA 4BQ2A 1JXKA 5A6LA 3AROA 3SIMA 1VEMA 2EPKX 4XV0A 2BHZA 1UD3A 3W38A 2QV4A 3CUGA 1H5VA 1K9TA 2PWDA 1MW0A 1XD1A 1Q6GA 4ATWA 1W2PA 3MV11 5CPQA 3GXFA 1KQZA 2D0FA 2DH2A 2WHJA 4TTUA 1CDGA 1HJUA 3AS3A 2GVYA 4GZEA 2JALA 4CCEA 4M8UA 3WUGA 2BVDA 2O9RA 4U2ZA 5E0CA 1HP4A 4LXFA 1CGXA 4BQ3A 2DSUA 4HZ6A 2BY3A 3IAQA 2F61A 1ODZA 1US2A 1ZS2A 1UWQA 1W9UA 1HVQA 3T2PA 4A3HA 3WQ4A 4DM2A 1HVXA 1CBGA 4DWSC 1K9FA 3WL0A 5JBFA 3N15A 1OT2A 5FOOA 5A8NA 2XG9A 3ZR5A 3NDYA 1KGWA 5HPOA 2X2YA 3QOMA 4P8VA 2WMIA 1W1TA 4UQEA 5HBFA 3BC9A 1QI0A 4JKMA 3RM9A 1J9YA 1O6IA 1FA2A 1ZJAA 3QGVA 1KCKA 1JGIA 1JNEA 2PWFA 4JFSA 4U2YA 4W8AA 1TFVA 1VFMA 2VX4A 2ZUWA 5GNYA 4UTFA 5CGTA 4UZSA 1H0GA 3CUFA 1AQMA 1OIFA 1QI5A 1KWKA 2YA0A 3MKKA 1XH1A 2OYKA 4CD4A 2GUYA 1HF6A 3UG4A 1DWIM 1GPFA 2XSAA 3AIRA 5ABHA 1MXDA 1CXKA 3QR3A 2E9LA 2TAAA 1UD6A 4EAMA 6TAAA 2CERA 1V0NA 2HVMA 1CENA 4RE3A 4AEFA 4KGLA 1XC6A 1VIWA 3NSMA 1VFUA 2E8YA 2ZX9A 4MJ4A 2XSBA 1S46A 4BZYA 2ZX5A 3EDFA 4IM4A 2QMJA 1UR2A 4HA3A 4HU0A 1FFRA 5HXMA 1G1YA 3AI0A 1JAKA 2FDMA 3FY1A 1PIFA 2DEPA 3WF3A 1W9PA 4IISA 3SUWA 1KB3A 2WC4A 3AHTA 4JAWA 1CGYA 4FMVA 3THDA 2ZXQA 4FLOA 1OD0A 1ISXA 3ARYA 2WKGA 2CXGA 1TG7A 1ZBVA 1Y7VA 1V3MA 4W84A 3WNLA 2E40A 5I77A 5I0DA 1SR0A 5D8ZA 3PZIA 4GZIA 3T2QA 1WPCA 2DQXA 2BHYA 4JL1A 3GNPA 2YL6A 3PTQA 1J0HA 1W9BM 2DSWA 3OGSA 2CKRA 1TR1A 1E6ZA 1LJYA 1HJVA 2D23A 5E0FA 1E0VA 3RMEA 2F8QA 3L4YA 5HDRA 3ARZA 2J7FA 5FL0A 1JZ6A 4R5EA 3VIFA 3GYCA 2DSVA 4AZ5A 4YPJA 3WNPA 2J25A 3W37A 5BROA 3ZT5A 1BFNA 3SCTA 3VD4A 3WD3A 1A47A 1I75A 4H7VA 3W25A 2Y24A 1BYCA 1XCWA 3PZTA 3SCOA 2QLYA 1HL9A 2XUCA 3HU7A 2VRKA 4BQ5A 1UZ1A 1ISYA 1GNXA 3WMCA 1UWSA 4KRTA 3U57A 4GI9A 1ECEA 2VQUA 4GO9A 3ARWA 2E8ZA 1E1EA 3VILA 1XSJA 4W7WA 2D3LA 4IPLA 4W86A 1V3LA 1UWTA 4UOQA 1UH4A 1TMQA 5DF0A 3FHAA 1FHDA 4OUEA 3F5KA 4XUYA 2ZUNA 1F4AA 2JEQA 3AIBA 5C70A 3VU2A 1FFQA 3WNMA 4AD0A 4W87A 2WWCA 4UOJA 1H41A 3AQUA 1R8LA 2X09A 1B2YA 4HOWA 5E70A 1ITXA 2BY1A 3VIJA 4MJ2A 3BSGA 3CIVA 3CZ8A 1TA3B 2CIPA 1XYZA 1E3XA 2WHLA 4UFJA 3WEOA 2V5CA 4AY1A 1E0WA 5A6BD 4NZCA 1NWSA 1UYQA 1B0IA 1GOKA 5KZ6A 3VD9A 1HJWA 3WQVA 1E1FA 4H8VA 1ISWA 1F4HA 3GXDA 4AZIA 4QCFA 2E9BA 3RIKA 2UWFA 4LX4A 3TTYA 5A6MA 2ZOXA 3AZTA 4QAWA 1CXHA 4D6EA 2Q8XA 1VBRA 3ZIZA 1CXLA 1OGSA 1W1VA 4LYPA 2VT0A 1W32A 4AD3A 1BYAA 5LYRA 1EO7A 3HN3A 1BPLB 2DDXA 4BF7A 3VDAA 1HP5A 4UOZA 2GDVA 3VDCA 3WUFA 3WH8A 3L4TA 2O9OA 1QHOA 2F2HA 1E6SM 4NF7A 3ZR6A 1JD7A 1ZU8A 2GJXA 4H41A 1NOWA 4HOZA 1HN1A 4CUCA 1VFOA 3CZLA 2O9TA 2FGZA 4ZXOA 1RPKA 3GNOA 4LYRA 2C7FA 3UG3A 3AICA 4PMOA 4MNLA 1G0CA 4E4PA 2WCAA 1XD0A 3CGTA 4EK7A 2CPUA 2WSPA 5BXPA 4U3CA 4J7RA 4MAVA 2J7BA 4XZBA 3GNRA 4CD6A 1KCLA 1UHVA 5FIPA 3OA5A 1E0XA 3AIUA 3ZJ6A 3DHUA 2FHBA 5A2AA 4GI6A 1KBBA 1EIBA 1AMYA 1ISVA 5ABFB 5E6YA 2VRQA 3THCA 4AIOA 3PZ9A 5A6BA 1ZBKA 4FLQA 1QOXA 1E43A 1OBAA 1XGZA 1ZL1A 4AC1X 4HOXA 5A6SA 3RILA 2NSXA 2X0HA 2J8GA 5I3DA 3W28A 1GOIA 4M29A 2X8RA 5HOSA 2XIBA 3AS2A 1EDGA 2XGBA 1Z32X 1GW1A 3AMKA 3VGHA 3UR8A 5AY7A 4ZE5A 3ARSA 1VRXA 2WVUA 3MV01 3J7HA 3ALGA 4GKLA 5A6KA 2J7GA 1E5NA 1C93A 1J18A 1FH8A 2WW5A 3MMDA 4V28A 4HU8A 1HJXA 1HJSA 1UQYA 1QNQA 1UH2A 3WD2A 3AMLA 2QPUA 4QLLA 2A3HA 3AIVA 4W5UA 3W0KA 4N42A 6A3HA 3PZGA 4MB3A 2J7EA 1H2JA 3VD3A 2VRJA 5IHSA 1TA3A 1KR0A 3T0AA 4AEEA 1MVYA 1J0IA 4HTYA 4F8XA 1GHRA 1BQCA 1VEPA 1W9XA 4PMZA 3BSHA 3G6LA 3KZSA 5E9AA 4M82A 5A8MA 1JZ8A 2UY5A 3NSNA 4U5IA 1VJSA 4H2CA 4D6FA 1R7AA 1BVZA 4Z2JA 3BAXA 1PBGA 4WKFA 3W26A 4MNJA 1B3VA 3PTKA 1K9EA 5DEZA 4LGXA 4F79A 1PZ3A 2GJRA 4BA0A 4Z2HA 4UCFA 4OOZA 3L4UA 1E6PA 3CHFA 4MDPA 1V0LA 3MMWA 1M04A 1QBAA 4MB1A 1QW9A 3VX1A 2ESCA 5ABFA 5DFAA 1GVIA 2YA2A 1PJ9A 4AMCA 1DWJM 1YHTA 4Q7NA 1MFVA 1UD4A 4QCEA 2JE8A 1H0IA 3L4XA 1UR1A 1SMDA 1DHKA 3ZSTA 4KGJA 4LYQA 4W89A 2OWCA 1GOOA 1JL8A 1V6YA 2BNJA 3WDQA 1XH0A 4MADA 2FGLA 3B9AA 3AMDA 4MAZA 5CGMA 3WDHA 1E72M 3WKZA 1G94A 4MB5A 2AAAA 3WDRA 3EDDA 3M07A 1JYWA 2V38A 2Y2WA 4TVCA 1CXFA 4D6IA 3T09A 1PX8A 3AYSA 3DYPA 3BMVA 4N0RA 3VIOA 2YOCA 1MQRA 1RH9A 1UKSA 4LQ1A 3QHMA 2W61A 2VX7A 5E6ZA 3VGBA 3BH4A 2YLLA 1WB0A 5I2UA 1LWJA 1V02E 3BAKA 4PMNA 4UQDA 4AZBA 1CGVA 3UR7A 1WZAA 2WVTA 3A3HA 3GBDA 1W3LA 5JIPA 2WLYA 4Z2KA 2YL9A 3FAWA 2D0HA 3WMBA 3GH7A 6CGTA 2OWWA 4ZEPA 1HT6A 4TX8A 1DWHM 4H04A 3WFLA 1Q6DA 2WKLA 2J74A 3OGVA 3W24A 3W6LA 2EXOA 3ZT7A 1LL4A 1KGUA 2EPOA 1OIMA 2J78A 2WPGA 1UH3A 1IV8A 3RJYA 2D3NA 2GJPA 4W93A 1RD6A 4UFHA 4UQCA 3BCFA 4WF7A 2ZXAA 2OWXA 1W3KA 4AZHA 4CU7A 2BXYA 4GQQA 2XTKA 1I1WA 4W88A 4ATDA 5A2BA 2BVTA 1H09A 1PPIA 5EFDA 4YN5A 1X6LA 1QVBA 2VX5A 3SCQA 1J10A 2WHMA 2B31A 4P8UA 4M24A 5FCZA 1R7OA 1GOWA 1UWRA 4V27A 4DWSD 3VNZA 3VIIA 1ZBWA 2XFYA 1OD8A 3BCDA 3NCOA 1NP2A 1HKMA 1OT1A 3AHZA 1UD2A 1JYXA 1NARA 4CD5A 2J7HA 2BV9A 3TONA 3MO4A 2V3EA 3D3AA 5E09A 4J27A 1C92A 1E3ZA 2JEPA 1W1YA 3M46A 8CGTA 1QNSA 1GCYA 4ZXLA 1BVNP 1MXGA 3RM8A 5EMYA 4AD2A 2AMGA 3GH4A 1VFFA 1V3JA 3CZJA 4AZCB 1AQHA 3VIPA 1CGTA 1E56A 3ARRA 1H1NA 3OLIA 4WSKA 1KWGA 4P8WA 2IXUA 2WC3A 3MMUA 5D9OA 4OKDA 4OBRA 2EEXA 2FH6A 1UD8A 4FK9A 4ZFMA 3ARXA 1XCXA 2XFRA 1GQIA 4W85A 3ZM8A 4Q22A 1NM9A 1FOBA 1CXEA 3B9EA 4J3XA 4UQ9A 2PI6A 2VOTA 1MFUA 5I79A 3A6OA 1Q6FA 2OYMA 4P7OA 4TVDA 3IANA 1RP8A 1J12A 1E6XM 3WEZA 3VD5A 3AHXA 3EMZA 5AC5A 5I24A 1QHPA 4CU6A 2PWHA 1QBBA 3OZOA 1CWYA 2Z1SA 1JF6A 4PMXA 4E2OA 1JZ5A 3APGA 3CZEA 2ZX8A 1O7AA 1EA9C 2VR4A 3N12A 3WUEA 3NJ3A 4PMQA 3UETA 2XFFA 4WJXA 2ZIDA 5A6JA 1W3HA 2BY2A 1BF2A 3WH9A 1NOUA 4AD1A 2VJXA 3WF2A 2JIEA 3NYDA 2CCRA 3MS8A 3WQ6A 2WYSA 1IZJA 2G41A 3ARPA 3CHDA 4D71A 4X0NA 2DH3A 1LQ0A 4JL2A 3F5LA 4CGTA 3O9NA 3MUZ1 5ECUA 3UERA 3AHYA 3CH9A 1MW1A 3EDEA 1IZKA 3WH7A 1ODUA 4AWEA 4JIEA 8A3HA 4PBGA 3B8SA 2WHKA 2FH8A 4MNMA 2PWGA 1B3YA 4RE4A 1QPKA 4KMQA 2C8NA 1EQPA 4D1JA 3WENA 5D9MA 2RGMA 3W29A 1VENA 1E73M 5C8BB 3W53A 2YDSA 4CVWA 2YKKA 3U7VA 1UG6A 7CGTA 1GOMA 1AQ0A 2XIIA 1VAHA 4GINA 2OSXA 4QLKA 1M7XA 4U33A 3WH6A 4R27A 1CGWA 4AZ7A 1J0JA 3WL1A 1GJWA 3WMSA 4PMDA 3VIMA 4D6GA 1XH2A 4NSBA 2NT1A 2W91A 3OB8A 3KL0A 3VX0A 4H8UA 2DT1A 1XYFA 2ZWZA 2VCCA 1ZBCA 2FHFA 3MANA 1UA3A 4FLRA 4UFLA 2VCAA 1C91A 3WELA 3VIHA 5CLTA 1HL8A 5AYIA 2J77A 2DIEA 3OGRA 1B3WA 4M80A 2DT3A 2OSWA 1XHGA 1E4IA 1VB9A 1WAWA 3AZRA 1KGXA 4W5ZA 1QI4A 2EQDA 2DPEA 1C3FA 4HMDA 1PX3A 4PRWA 1J11A 1W3JA 2QPSA 2XVLA 3WBEA 4PYSA 2DT0A 2J8FA 5IDIA 4PTVA 4M56A 5ABEA 4GQRA 4L4PA 3SCSA 2GFTA 2WK2A 1HIZA 4J3SA 3ZJKA 5A8PA 2PBGA 1GJUA 2CBJA 1B3ZA 2W67A 1B31A 1V6UA 3BAJA 2BHUA 2WZEA 3KWXA 5A1AA 2IXVA 4NI3A 3ZSSA 3ZJ8A 2FHCA 3AYRA 4L4OA 2PWEA 3CUJA 4OBSA 5HPCA 3N17A 4HMCA 4PMRA 5A3HA 2BXZA 2V3GA 2A3CA 1KR1A 2UY2A 4NRSA 4S3KA 4DWSA 2WMJA 4AD5A 4KWUA 1LLOA 2CEQA 3BGAA 4F66A 3IAPA 1V08A 1HKIA 1I1XA 3GXMA 3WH5A 3NDZA 1OGBA 5FL1A 1JXJA 1EDQA 1D2KA 3B9DA 1EOMA 1E71M 2J47A 1J0YA 1VJZA 1JNDA 4S3JA 1LWHA 3FHQA 4W8LA 3VVGA 3TA9A 3JUGA 1E6NA 1NQ6A 1UZ4A 5M3WA 3BAIA 2XYLA 5CLWA 2GJXB 2VZOA 4JFVA 5D9NA 1WDRA 4C7FA 3AOFA 1UR4A 1QHZA 1EHNA 2J7CA 3AXXA 2GK1A 4CN4A 1UR8A 3VKKA 5TD4A 1UUQA 4CVUA 4HMEA 2YDQA 5DO8A 1QI3A 1QNOA 2XHYA 3T0BA 4OZOA 1NWRA 1WZMA 4P7NA 3VGGA 3G6MA 5JBEA 1JZ3A 1MQQA 1W2VA 3HMCA 3U5UA 3SCPA 4Z2IA 1JAEA 1UKPA 1HNYA 4C7DA 4WLCA 1M01A 3A4AA 5IFPA 1H11A 3IK2A 4AD4A 4U31A 3SURA 4GXPA 4JFTA 2MANA 2ZUUA 3W4RA 3AIQA 3GH5A 5EBAA 2PBOA 2WVVA 5CG0A 1WKYA 1GVYA 2CBIA 1QI2A 1WDPA 4MPKA 3T08A 2GDUA 1ZB5A 3SUUA 3I3BA 4OOUA 1JI2A 3TP4A 4PCTA 4D6DA 1VBUA 1EQCA 3QHNA 2WAGA 3PZOA 2W5FA 1CECA 4AIUA 4XX6A 1BHGA 2XVNA 3CHEA 1BG4A 3WNKA 4HZ7A 3WBAA 3EMQA 3OBAA 1WO2A 3LPFA 4Z2GA 2WSKA 2RGLA 2VVSA 3VMNA 2D24A 3RM4A 3WDJA 1US3A 4W7UA 3LPGA 1H3GA 4OIFA 4EKJA 1EH9A 3POCA 3PN8A 3BMWA 2D2OA 3CHCA 1M03A 3K4AA 1E9LA 4WIWA 5BCAA 3W82A 2ZUSA 1C8QA 4HPHA 1GQLA 1JYNA 1OB0A 5CPSA 4B3KA 4UQAA 1N82A 4CCDA 3PZQA 3WFZA 3LPOA 1OWQA 1JZ7A 1FH9A 3F5JA 4J3WA 4URIA 1KXVA 4PSRA 4BQ4A 5AC4A 1HJQA 3WD0A 4AZGA 2VZUA 4U3AA 1KBKA 1WDQA 3PZMA 2JIWA 4DUVA 1GHSA 3AXHA 2ZX7A 4U5KA 2VMFA 5A2CA 4RL3A 1C8YA 5CQ1A 4WK9A 3SCWA 1JZ4A 4ACYA 3WUBA 2EJ1A 4GI8A 1FP8A 1L8NA 2XJ7A 1MW3A 1UKQA 2XPKA 3IJ9A 3OIHA 4ZE4A 2V5DA 3AIWA 2XVPA 5CSUA 2X05A 4TXEA 2Y4SA 3A4WA 1OINA 2YL5A 1G9HA 3GBEA 4OJYA 3WDIA 3ZJ7A 1PZ2A 5GNZA 4MTVA 4NRRA 3WEMA 1U2YA 1HXJA 3AZSA 1Q6EA 3K46A 3K4DA 3TTQA 4JKLA 3VIKA 3W6MA 4QDMA 4CN1A 1C7SA 3EMCA 1JZ2A 4KRUA 2IUZA 4JCMA 1LG1A 3SCVA 2WMGA 1UR0A 3PZUA 3N13A 4AIEA 5EFFA 2YBUA 2WZHA 5JH8A 4PUDA 5I5RA 5IHRA 3LMYA 2C0HA 2WBKA 4A3YA 3D5HA 3K8KA 1JFHA 3WNOA 1TE1A 3VMPA 2CITA 2WMKA 1L0PA 1Q6CA 3EDKA 4DUXA 1LF1A 3VGEA 3PZNA 4CU8A 2J75A 3SCUA 2XWEA 5LA1A 2DIJA 4UFIA 4P7LA 3AXIA 3RCNA 1NWUA 1CZ1A 2PC8A 1D3CA 2VX6A 7TAAA 1R85A 4ACZB 4XB3A 1SMAA 4E8CA 2YLAA 1JDAA 1UA7A 4UFKA 1V6WA 5I78A 2VURA 3VM7A 3NUKA 3A47A 4J3UA 2NW0A 2D22A 1VF8A 4ML4A 3DYOA 3K1DA 3WQ5A 3VDBA 4M1RA 2OSYA 4ATLA 5DT5A 1OM0A 5D4YA 5A69A 4PTWA 4EANA 5FKYA 1GQKA 3U7BA 4HZ8A 2JF7A 1J0KA 2ZUVA 1FP9A 3ZT6A 1X6NA 4W8BA 2ZUMA 3BAWA 1YQ2A 1OCQA 5BRPA 2V3FA 2WZIA 1BTCA 1V3HA 3HJEA 3N11A 4P8XA 2YA1A 1XV8A 5HNNA 2J79A 1TUXA 3MUY1 3NIYA 3AS1A 1TVPA 2D20A 1CNVA 1OGGA 1E4NA 2JFEX 5CXPA 2J7DA 1JIBA 4B15A 4AYSA 2QHAA 1CPUA 1K9DA 1PX4A 3RJXA 2NT0A 3WNNA 3E1F1 1V0KA 2G3NA 4B16A 1QNRA 1V3IA 2CETA 1C7TA 3I3DA 3ECQA 2VO5A 1JI1A 2DSZA 1ZJBA 3OLEA 5GQBA 1V02A 2VZSA 4JHOA 1Q4NX 3L4WA 1CTNA 1BG9A 2W92A 3WF4A 2Y8VA 1BYDA 3AISA 3SCRA 4GPNA 4QLJA 1E4MM 5M17A 1B3XA 4D1IA 1DP0A 1WZKA 2J4GA 1LG2A 1P6WA 1MQPA 4V2XA 1R87A 3VUPA 1JF5A 1BGGA 4RE2A 2WBGA 3CZKA 4CD7A 4JZ5A 1G5AA 1K6AA 2VCBA 3UEQA 1HKJA 2XWDA 2EO7A 3ARQA 1M53A 5DT7A 3GDBA 4KH2A 1J0ZA 2G3MA 4W7VA 2E9MA 1CXIA 4UNIA 2VZVA 2EPLX 4HA4A 2CYGA 5BWFA 3MUAA 3ZQ9A 3TTOA 5ABGA 4UZUA 1EGZA 4WSJA 2WC7A 1U30A 1KQYA 2XM1A 3FN9A 4TTGA 4AXNA 3GXIA 2ZX6A 2XVKA 4HPGA 3VGFA 1BSIA 1OSEA 5JUVA 2CBVA 2VTFA 4E8DA 2QMKA 2ZUTA 3TOPA 4PMUA 3WIJA 3VGDA 2UY4A 1E40A 1V3KA 3S2CA 3WSUA 4IUGA 1NP0A 2OLHA 4BS0A 1ISZA 4BCEA 3WQ8A 2W62A 3WD1A 1V6VA 1GORA 1XSKA 1KXQA 2WMIB 4TX6A 1TZ7A 1ESWA 1WZLA 2JF6A 4FLSA 3CMGA 5IXEA 1NWTA 1IT0A 5CSYA 1W9VA 1GUVA 2HISA 3WN6A 3OZPA 5DMYA 2E0PA 3MU7A 4K68A 3EDJA 2WCSA 5JIWA 2WWDA 2BVYA 4CCCA 3DECA 2CNCA 3CZGA 2W66A 4WKHA 3A4XA 2G8ZA 1JDDA 3AJ7A 4WKAA 4D6HA 3W27A 1B9ZA 3VTRA 4UQBA 4X9YA 3CO4A 4PMVA 4J3VA 2D0GA 2Y8KA 5M03A 2AOSA 1U33A 2DSKA 1H4PA 5I23A 4F9DA 1EXPA 5CJ5A 2G4FA 1C8XA 2E4TA 1PIGA 2EPNA 4MB4A 2WMHA 2E3ZA 4PCSA 5A8OA 2BS9A 3UG5A 3ARUA 1EOKA 3I3EA 3IJ7A 2VZTA 2WVSA 3II1A 3T0DA 4MNKA 4AZCA 4J28A 1GONA 3RO8A 2CHOA 5GNXA 1CLXA 4D72A 1WDSA 1CGUA 3RDKA 3GTNA 3T2OA 1WCGA 3PZVA
chains in the Genus database with same CATH superfamily
1AW2A 1A4MA 4DO4A 5CC7A 3TOYA 4JIQA 4H6QA 4OWGA 3CV2A 2GJLA 3OLDA 2A3EA 4WXYA 1QNPA 3CAVA 1SFSA 2O7QA 3NOYA 3ZVHA 1LL6A 1XR2A 3E0FA 4K39A 2WB5A 4FNPA 4F2BA 3TYZA 4R9XA 3K8LA 4ADTA 1YW1A 1UCWA 2C0AA 3TQ0A 3N9KA 3EX4A 5T9CE 1FWTA 1I2RA 2VGBA 2V2HA 2GGHA 3CWNA 3B05A 4L6OA 1PCWA 1HKKA 1RCXB 4I9AA 4DRJA 1V0MA 1KXTA 4IIBA 8RUCA 1CEOA 2NVCA 5LA0A 5FJOA 2WJFA 5EU9A 1KV5A 3MQTA 1FKIA 4P61A 3UZZA 2Y7FA 1FH7A 1TZ9A 4CKQA 2O9PA 2RSEA 4JD4A 9CGTA 5GPRA 2D2HA 1XSIA 2WVVB 5C71A 5SWUA 2A6LA 1IR2A 1HG3A 3ZWSA 3DKLA 2C16A 3VOGA 1W31A 1H7OA 3NGFA 3L4VA 4ZO6A 2I9EA 5F2MA 1UOZA 5BWAA 5EBUA 2D9FA 3DC0A 3SCNA 3FXYA 1ZENA 3QC3A 4FOJA 4OQVA 3BXWA 2IKHA 1EFZA 4IP4A 4JTJA 3OZMA 2PDPA 3HGJA 1E55A 1E70M 3WQGA 3H53A 3LM7A 5LIKX 2EBNA 3OLGA 3LXCA 1AJ2A 3MPGA 2Z1WA 4FO4A 3P84A 2V30A 5A6AA 3DHPA 1MW2A 2OVLA 3UP8A 1MWOA 2WZMA 3AHVA 1Q7ZA 3CL7A 4KR0B 4BF5A 3NFUA 5JXQA 4PB4A 3LRKA 4RW3A 3MB9A 4Y9OA 2DVTA 4TVUA 2NUWA 2VGGA 3WF1A 2V5JA 3EYPA 4UTTA 1JPIA 4UR7A 3B0UX 1CT5A 1QASA 3DYMA 3NZGA 4RNHA 4AW7A 3K1GA 2XGIA 3VA8A 3UXLA 3NDOA 4HA1A 2AL2B 3UQAA 1DL3A 1SVDA 5G4WA 2G3IA 3MJYA 3MZ2A 1G6CA 3T07A 1VQTA 3LRMA 2YCKX 4Y8FA 1F61A 3O5JA 2E25A 4GZJA 3WQWA 4LVGA 3H7VA 3NA8A 5BXTA 1HO4A 4JFMA 3TYEA 2ZRWA 2QYGA 5G4HC 3Q58A 3M7SA 1V51A 3WD4A 5BMXA 4J2MA 3YPIA 2PZ0A 3CM4A 3ZOAA 4RKAA 4XD3A 3L4ZA 2PB1A 2YW3A 1UKOA 2AKZA 3L5LA 2XN0A 3G1VA 1JCHB 1E0TA 1T96A 2DY3A 3V1HA 1DJNA 2X7VA 4G2DA 3WFAA 1KFWA 2ZVIA 3EPNA 1XXXA 3UXIA 1RQBA 4LC6A 2Z0IA 3F4DA 2PDGA 1GVOA 1IXPA 3WQDA 3UXAA 4U84A 1ONXA 1OYAA 1I2QA 3AMCA 2XU2A 3MSGA 4F0HA 2QIIA 1K7FA 2DGAA 3PRDA 3GZ3A 3M7WA 3BLLA 1GQNA 1MUCA 4NIRA 4KRZA 4LUSA 2H8XA 2BFGA 3NQ6A 4Z17A 4TOQA 2NWSA 3FCPA 4RV8A 1M5YA 1J6OA 1B1YA 4DJDA 3U5YA 3FJ6A 4C7GA 4ZODA 1EZWA 5LA2A 3EX6A 4JTEA 4PN2A 3QZEA 1NOFA 3TJ4A 2UY3A 1CYGA 1EDTA 1WNOA 1XWYA 3H55A 7A3HA 3P67A 2PV3A 1YXCA 2WM1A 1UWUA 2XP8A 1UWIA 2WM0A 1W1PA 3BAYA 3NQGA 4DBDA 3DHFA 1PEZA 2FPTA 4B2DD 1G4SA 4BQ2A 2Z29A 1JXKA 3EWWA 3PUEA 5A6LA 3OOBA 4A2RA 1UUOA 3TW7A 4XV0A 1R2SA 3P61A 2NXHA 1VFLA 2BHZA 3FV9A 2QV4A 3CUGA 4GJJA 4QIUA 3HTWA 1Q6GA 1I0DA 4ATWA 1TTJA 3HFTA 1UIPA 1IHIA 1KM3A 3GNDA 2D0FA 2VWTA 2PGWA 3PAOA 4TTUA 1HJUA 3UJ2A 2F6UA 1MDRA 4GZEA 2JALA 4IHCA 4CCEA 4M8UA 4HHPA 4R34A 3H22A 1X7IA 3IAQA 4GZ7A 1PDZA 3QR0A 1QATA 3N4EA 4DLFA 3WLRA 1UPPA 5CBBA 3T2PA 1VC4A 2VKZG 2RH9A 3WQ4A 4PFMA 3MO7A 5AYZA 1TJRA 3ATZA 4B5WA 3T42A 4JIPA 5JBFA 5A8NA 3RYSA 3PNUA 3NDYA 1KGWA 2X2YA 2NSOA 3UWYA 1W1TA 3C0JA 5HBFA 2B4GA 3BC9A 3WBXA 3KRBA 4LCRA 1QI0A 4JKMA 1FA2A 3UT0A 1ZJAA 4GJIA 1XYLA 1XLCA 4EP8C 1ZALA 1AJZA 1JGIA 3VNIA 2J88A 4CQ8A 1JNEA 3KLKA 4JFSA 1KFJA 3M0IA 3MY9A 5FF7A 3CUFA 1YTDA 3SY8A 1S2AA 8TIMA 4MZ1A 3MC5A 2YA0A 3MKKA 3QMTA 4CD4A 1HF6A 5AOUA 1DWIM 1QPLA 4HYWA 2XSAA 1TTIA 1LOQA 3M47A 3TTEA 3QR3A 2E9LA 3ZYZA 3SY5A 1VP5A 2CERA 3IARA 5HTGA 1GEQA 3UPMA 1ZNNA 4KGLA 1XC6A 1AA1B 1VIWA 4Y90A 2ZX9A 4V1XA 3R43A 2XSBA 4OFCA 3EDFA 4IM4A 4F40A 1UR2A 3H8AA 5KZMA 4HA3A 5HXMA 1IXQA 1JAKA 2FDMA 3WMLA 3WF3A 1BWLA 3V35A 3DOPA 4BFAA 4LAXA 2I5QA 3WK1A 2V0TA 3KZPA 2AQWA 5D2YA 1BKFA 3Q4DA 3M0MA 5FAGA 4DF2A 3ARYA 4DT4A 4K8EA 2CXGA 3COTA 5CPOA 4W84A 1V3MA 3MUCA 2E40A 5I77A 3WLNA 5D8ZA 3PZIA 1MEHA 2GOKA 2YXXA 1SW7A 3P2VA 2RUDA 3W76A 1J0HA 2GVGA 4M5PA 2W0UA 3CT7A 3DX5A 2C1HA 4KESA 3OGSA 3SGGA 3KHJA 2CKRA 4LWWA 3I4EA 1EF3A 1E0VA 5EY5A 2PPNA 1KCXA 4BWLC 3FKRA 1P43A 1JZ6A 1ADSA 2ZA3A 3WNPA 2PDCA 3TA6A 3RG6A 3CUXA 2ASHA 5DXXA 3UJFA 3SCTA 3VOJA 3VD4A 4ICCX 3WD3A 4TW7A 4E8GA 3L66A 1HXVA 3IEBA 1Z3NA 1UZ1A 4K36A 1K8CA 3C8FA 1W1B1 4M0XA 4P5UA 4GO9A 3ARWA 1XSJA 4RZBA 2D3LA 4IPLA 1O5RA 1TWWA 1UWTA 1S2TA 1UH4A 4EXQA 2SFPA 1GZ1A 3A13A 3HJZA 5HUOA 4CQBA 4D2JA 1OC6A 2PU1A 4OUEA 1RA5A 4XUYA 2ZUNA 2NX1A 2HE5A 3ABSA 2WWCA 4W87A 2QAFA 3MYPA 3KS6A 1OYBA 4LUYA 3BLOA 4HOWA 4LS1A 3W7QA 3LS9A 4XD4A 4XVDA 4DN1A 4G7EB 4AFYA 1KM4A 3BSGA 4MJ2A 5JH1A 4AF0B 1NDWA 5TBOA 1TA3B 2CIPA 3RNDA 1XYZA 4GUFA 4HCHA 1JCTA 4GYJA 2WHLA 4UFJA 3BG3A 3GTIA 5HWCA 1R46A 5A6BD 1NWSA 2FIQA 1KD0A 1E1FA 1B54A 3NQCA 2ACQA 1XRTA 3UI4A 1H51A 1I4NA 4V1YA 2E9BA 3RIKA 3GC5A 1GOXA 3TJIA 3IGSA 3TTYA 3R0UA 1I0BA 4NZJA 4QAWA 4JFLA 4D6EA 2Q8XA 1LRQA 1W1VA 3LGEA 1D6OA 1KA9F 4AD3A 3HN3A 2ZRZA 3UWEA 4KWVA 2CWNA 1XLLA 4QQ3A 4JFIA 5EA9A 1SSDA 2YPIA 1JCJA 3VDAA 1FWGC 2VD9A 3A3XA 2RJGA 5D30A 3WUFA 3H6OA 4XD6A 2QF7A 4Z1DA 3L4TA 4A3QA 1QHOA 3E0WA 2R1MA 4B5VA 1JD7A 1IXOA 3IGHX 1HN1A 2QCDA 4JS3A 4OT7A 2FGZA 3GNOA 4IIHA 4LYRA 2QUVA 4PB3A 4ORIA 4I6KA 1XD0A 4EK7A 3MCNA 2Q3RA 5REQA 5BXPA 1JNSA 1DIKA 4U3CA 1CX9A 3H4WA 1GYMA 2PP0A 4C6PA 4MAVA 3CTLA 2J7BA 1QR7A 3THUA 1SJDA 3IJ6A 3OA5A 3A5VA 3QV8A 1QOPA 1DE5A 3BLFA 3AIUA 4Q8MA 2FHBA 5A2AA 3C0LA 1ISVA 2DZPA 3SRHA 3G8RA 2XP6A 4PODA 3THCA 3TMQA 4AIOA 4LNCA 1SM9A 1XGZA 4AC1X 2X0HA 3KX6A 4M29A 2X8RA 2XGBA 2OT0A 4FNUA 4Z1CA 2DU2A 3W1LA 5AY7A 4FA3A 4ZE5A 4S3CA 1YE4A 5A6KA 4BY3A 4H6RA 3DXIA 2J7GA 2EJAA 3WCZA 3HBLA 4V28A 1J18A 3L23A 1HJXA 1HJSA 1QNQA 1UH2A 3RU6A 1S5WA 4JDBA 4QLLA 1XIGA 4N42A 1H2JA 1J0IA 4LANA 1XIHA 4HTYA 2VCDA 4DAIA 3S5SA 1BQCA 4PMZA 3G6LA 1M1BA 2YCEA 1NFGA 1X8CA 1JZ8A 1SJAA 4H00A 4U5IA 1EC7A 2FKPA 1AD4A 3UD6A 2OZTA 1BVZA 4GE8A 4C6KA 4HJWA 1B3VA 4TIMA 2GL5A 3PTKA 4GGQA 3UY8A 3VI2A 4BA0A 3UJEA 3STPA 4UCFA 4LFYA 4RXFA 1E6PA 3TCZA 1V0LA 3FYPA 1QBAA 4MB1A 2Y89A 1QW9A 3FEMA 2ESCA 1DJWA 1YIXA 3SW6A 1F73A 4AMCA 5GJNA 4U4MA 1YHTA 1RLDA 4Q7NA 2QIWA 2JE8A 4JQ1A 3AC0A 3B8IA 4JYFA 1Y0EA 5HW6A 1SMDA 1OC5A 4KGJA 4LYQA 2BNJA 1JL8A 1V7AA 3WDQA 5KZEA 2PLCA 1E72M 1EX1A 4HA0A 1GJPA 2AAAA 3CQJA 1JYWA 4D8AA 2PTWA 4TVCA 3PK7A 1Q7MA 1PX8A 4OVXA 4V15A 4L72B 4AU0A 3VIOA 1MQRA 1RH9A 1UKSA 3OODA 4LQ1A 1B3OA 4RE0A 4DZAA 1US0A 5E6ZA 3CIXA 3P80A 1Y5WA 1UZHA 3SADA 3I10A 3E02A 1V02E 4ALDA 3BAKA 3M0LA 4PMNA 4AZBA 6REQB 2WVTA 3A3HA 1EJVC 3PG9A 3Q67A 1KBIA 5IDZA 4NJKA 1EJRC 1G7UA 6CGTA 3TQPA 4TX8A 4NNBA 4LAKA 4L65A 4GUJA 5AZ0A 4F48A 3OGVA 2J74A 3W6LA 1VHCA 2E28A 2TODA 2CLOA 1LL4A 4JYDA 2CFFA 4X2PA 1Z41A 2HBVA 2D3NA 4W93A 4JY8A 3UCCA 4GUIA 2FZ8A 4WF7A 1PSCA 2F2KA 1VCFA 4O8RA 4HK5A 4DELA 4GQQA 2XTKA 3PUGA 1MNSA 4W88A 1WDWA 4E2VA 2E6DA 5CJNA 4L7ZA 1H09A 7PTDA 3BOFA 2VX5A 3WJYA 3TROA 5FCZA 1R7OA 5C6MA 1GVQA 3NQDA 3VCRA 1YPIA 1GOWA 3VNZA 3VIIA 1ZBWA 2PDWA 2BOFX 2IPJA 1OD8A 4HHMA 3BCDA 3M64A 3NCOA 1NP2A 1VYSX 4LT9A 5BU9A 2DP3A 1NARA 3UCDA 1B4EA 3TONA 1EEPA 4US5D 4AWTA 1C8VA 2PDYA 1A50A 5E09A 3OVQA 1P4CA 1E3ZA 3W1PA 1JEZA 1RAKA 1W1YA 8CGTA 1AL8A 4ZXLA 4L1XA 2YYUA 2F6XA 1KM5A 4XZLX 2AMGA 5IBXC 3GH4A 5RUBA 1V3JA 1FDJA 3FJLA 4QIBA 1H1NA 3SGZA 1LT8A 2P0IA 1P7TB 4IP5A 2WC3A 1ME8A 3PUOA 1GEHA 1GYNA 2FH6A 1IIGA 3FSUA 3O5MA 3ARXA 1XCXA 2XFRA 4OUIA 3DAQA 1CXEA 3B9EA 4J1OA 3N2OA 1MFUA 1FKSA 2TSYA 4GXWA 2LGOA 3ERPA 4PZVA 1E6XM 3MHGA 3WEZA 2PDLA 3ATYA 3LOTA 2VEPA 4KFNA 1F9CA 4Q8OA 3TYAA 3AHXA 4GIRA 2QJJA 4K6AA 2A0NA 2HK0A 3PA7A 4ZQPA 3OZOA 5EYWA 2E67A 4O0ZA 3ZZ1A 3ZVIA 3APGA 1P1MA 3W1AA 1GW9A 4N6FA 3WUEA 3BO9A 3USZA 1QT1A 3NJ3A 4PMQA 3KWSA 5LNSA 5M2FX 3RGTA 5A6JA 4DJEA 3WH9A 1NOUA 4IQCA 5D04C 4D71A 1VR6A 4X0NA 3N2MA 1H1ZA 3RLVA 4AWSA 1JPMA 3EY6A 4FR6A 1N55A 5ECUA 3UERA 3CH9A 1MW1A 3EDEA 1SO6A 4AWEA 1FKRA 1KTNA 1AFSA 4QTGA 4PBGA 2FH8A 4MNMA 2C71A 3K2GA 2PWGA 1B3YA 1XLEA 3C4UA 3G8EA 2J9XA 3DBPA 1YATA 4D1JA 2RGMA 3GNXA 2XFWA 4QG9A 5C8BB 2YFOA 5CEWA 4JY9A 1GOMA 1XJBA 3NPVA 1AQ0A 3LB0A 4C6EA 1JQVA 3IUIA 5HKGA 1MO0A 2OSXA 1W3TA 3WK0A 4R27A 4MPQA 1FWNA 2Y7DA 2Y1HA 3S9YA 1AG1O 4D6GA 3CASA 4JQ2A 1ITQA 2W91A 2J6VA 3VXGA 4H8UA 2DT1A 1XYFA 2DVXA 4S39A 3TIMA 2VCCA 1ZBCA 3GAKA 1XLKA 4KKXA 1XYMA 1W3IA 2RKXA 1HL8A 2E77A 3IK4A 5T8GA 2J77A 4AHPA 1TMHA 2ZQVA 3QPYA 4GBDA 1AH0A 4UUIA 1KGXA 1LOSA 3W2KA 2EQDA 1MXSA 2DPEA 1FWEC 1C3FA 4HMDA 1KFKA 4GG9A 3HOJA 2PV2A 2ABAA 1W3JA 2QPSA 3WBEA 1NFPA 1QXLA 4M56A 5EL1A 1LTDA 2GFTA 2Q09A 5CBJA 5A8PA 3TV8A 2CBJA 3AYVA 3KWXA 2WZEA 1OHLA 2GUUA 2ZFAA 4DO5A 3ZSSA 2FHCA 3CUJA 4OBSA 4NP7A 3T40A 4LJ3A 3N17A 3W2JA 4PTNA 1UJPA 2YGYA 3EWDA 5CPMA 5F2GA 4UTIA 4AD5A 4FNSA 4I90A 2J24A 1D3GA 3XIMA 3VNKA 1Q8JA 3BGAA 3LV6A 1V08A 1I1XA 1TIWA 4F0RA 1CLKA 3IHZA 4IX2A 5I3GA 2J47A 4N9BA 1VJZA 2XH2A 3VVGA 3TA9A 4UTTC 5KETA 2V9DA 3BAIA 3AUOA 5CLWA 3F2DA 2HVNA 1D7IA 1XG3A 4PUWA 3LXAA 3AOFA 1UR4A 2QCMA 1EHNA 1D7KA 2G4JA 5AVNA 3UFYA 4I8YA 4DZ2A 4A8NA 2REQB 4L80A 4HMEA 2YDQA 1QNOA 1DJGA 4MOZA 4DJFD 3NO5A 1JZ3A 4DZIA 1UUMA 3WBWA 1I2PA 5CC3A 3GSMA 3S5OA 3SCPA 3GS6A 4ONVA 4WLCA 3R58A 1M01A 3IK2A 4PL1A 1J96A 4U31A 3SURA 4JFTA 3E0VA 2PDKA 2ZUUA 1AZ2A 3HB9A 5CZ0A 3AIQA 4PH6A 4DRQA 3I7QA 2Q5AA 5EBAA 2QT3A 3ITCA 5CG0A 1H50A 1WKYA 3OBKA 2CBIA 1PKMA 3R8GA 1ZB5A 2GDUA 4NQ1A 1ROTA 4WXZA 4JTSA 3I3BA 2YDAA 1PDYA 2GOUA 3TP4A 1EQCA 4H83A 3TAOA 3S6DA 3PZOA 3U2EA 3VKDA 3MI2A 1BHGA 2XVNA 1MI3A 4NYUA 3WNKA 2FJUB 3OBAA 1DORA 1WO2A 2J8TA 1VBHA 2VVSA 4ES4A 3WDJA 1US3A 4W7UA 3UYIA 4S3DA 5D2XA 2VDHA 3VDGA 1R9ZA 3U8GA 3S2JA 3CHCA 4S3BA 4GMEA 1JYNA 1GQLA 3GD6A 4O13A 2E7FA 5CPSA 4B3KA 3PZQA 5FEWA 1JZ7A 2GSEA 1I45A 2EHHA 3LERA 3W88A 3LCXA 4DUOA 1HJQA 3H2OA 3D47A 3SRDA 2VZUA 4NASA 1KBKA 4QISA 1TV4A 3GYEA 2HEJA 3WJWA 2P3EA 4RL3A 5CQ1A 2FQIA 2V69A 3CU2A 1ICPA 1H5YA 2EJ1A 4W9OA 1K77A 1NFBA 1VCVA 1IIHA 3GHUA 4GYKA 2P88A 3AIWA 2XVPA 3LXBA 3E0LA 1IX5A 2GVJA 4IQLA 3UNTA 4FOUA 3A4WA 3BG9A 1ZCOA 4I8DA 1G9HA 4N4QA 3U3HA 3WDIA 1QU4A 1GZGA 4NRRA 4NZ1A 1VYRA 1MUWA 3LG3A 3AZSA 4Z08A 3MI6A 5DMMA 2IQ0A 3L5AA 4QDMA 4I9MA 1XLFA 3O3RA 4ODQA 3GUGA 3SCVA 2RJHA 4NNAA 2GZXA 3P74A 3Q45A 4AIEA 3LSCA 1ZFJA 3T1GA 1I2NA 1UZDA 5I5RA 2BB0A 2C0HA 3N2CA 3KAHA 4A3YA 3ITLA 3P3BA 2YZRA 3K8KA 3WNOA 1TE1A 4BEQA 3E6EA 1UP3A 3EOUA 5IRPA 4DUXA 1FWWA 1M7PA 3LI1A 4LB4A 2J75A 3SCUA 2PCEA 2RQSA 5LGZA 2Q71A 3QV6A 5D03A 2VX6A 2YLAA 3PBUA 4UFKA 1V6WA 4Q8VA 1FWJC 1PBKA 4RXGA 4J3UA 2CLFA 2D22A 1VF8A 4ML4A 3VDBA 3FK4A 4M1RA 2OJPA 2CLKA 3KP0A 4ATLA 3VOHA 3JXVA 2I5IA 1RJRA 3N3TA 5FKYA 3RF9A 3OO2A 1J0KA 1H7NA 1X6NA 4W8BA 1YQ2A 1FY6A 2ETNA 2V3FA 1A7XA 1JVWA 4EOUA 3HJEA 2Z27A 3DC8A 4C6LA 1XV8A 4AY7A 1T40A 2JFEX 1H7PA 1PKYA 3QV7A 5C7HA 5FEZA 4B15A 3OU8A 4LSBA 1EGMA 3H26A 1XICA 1LOLA 1V0KA 2G3NA 4XTIA 4B16A 1QNRA 3TAKA 3WYZA 3UF8A 4C5ZA 3I3DA 2VO5A 1BWVA 1JI1A 4S3GA 4OE7A 2PD9A 2R1PA 5LHEA 3IV3A 3TR2A 1PZ0A 3VYLA 3H21A 2C1GA 4Z42C 1CTNA 3L67A 3LTSA 4US6A 2W92A 1J5SA 4FAPA 3QFWA 1J2BA 1KKOA 3SCRA 5LIYX 2RAGA 4QLJA 1AUSL 1GT8A 5M17A 1DP0A 4O1DA 1WZKA 3EX3A 3UZJA 1LG2A 1P6WA 3GHSA 4RE2A 4O16A 1FKFA 3R2GA 3NVDA 4CD7A 4JZ5A 4PEKA 4DPQA 3TC6A 2CC0A 4UDMA 3AAMA 3UEQA 4BR1A 2XWDA 2EO7A 2PLMA 3APTA 3M0YA 1M53A 3GDBA 2V5KA 2G3MA 3DG7A 3CJPA 2RUCA 3H7UA 2CYGA 4LAOA 3OVGA 3MUAA 1EKOA 3DG6A 1U30A 1KQYA 2XM1A 4TTGA 3ABQA 1XBVA 2E68A 1X96A 2ZQTA 5J04A 2Z1BA 2PLKA 2VTFA 4KEVA 4C5YA 2ZUTA 3TOPA 3V16A 1AH3A 4IPJA 2FB3A 1LWIA 3WSUA 4UNKA 1ISZA 3WD1A 1GORA 2R94A 3KZ7A 1KXQA 3N3MA 2WMIB 4TX6A 1TZ7A 1ESWA 1S5VA 3BQ5A 2A1YA 3TJLA 2JF6A 4HJFA 4GQ0A 4JNZA 4DRPA 3W23A 1ZSXA 5CSYA 3U48A 1W9VA 3MDYB 3NZ1A 1GUVA 3BANA 4K37A 3O5KA 1KBLA 3L0GA 1DTNA 1FKTA 2E0PA 3R8RA 3EDJA 4WUIA 3FA3A 1NJJA 3DECA 3CZGA 2W66A 2V63A 4DVOA 4WKHA 1QPFA 4X3ZA 3LCWA 1JDDA 4XKMA 4WKAA 3L0NA 1QAPA 4H9VA 4JDYA 5I07A 3B97A 3KCEA 3ANYA 4X9YA 4PMVA 3EEGA 2AOSA 1U33A 4O0KA 2G4FA 1C8XA 2E4TA 1PIGA 5EKYA 1YBQA 2GDQA 4HTBA 3IJ7A 2VZTA 1FKHA 4AZCA 4J28A 1K02A 3NQMA 3THAA 2RHGA 3IV8A 2DW6A 1AK5A 4PUNA 1JUBA 3HPFA 2VOMA 3T2OA 1JUKA 3PZVA 3UESA 5C9ZA 1S39A 1K03A 4C6BA 4FX6M 3BLKA 1QJWA 5TAOA 1Y0OA 2DT2A 5J6EA 3R25A 3OBEA 3OG2A 3ICJA 4JTQA 2V3DA 3ES7A 3UQNA 2XVGA 4X63A 4DBUA 3PHAA 3PNZA 1JCNA 2Y8UA 3SUTA 1VH7A 5DO2A 4NYYA 4OTKA 3MW7A 3B04A 3QJAA 1DJHA 4PBFA 4DI9A 4D8ZA 4IL2A 1KFLA 2EKCA 5FF2A 4DRHA 5BRQA 1XRVA 3N18A 2ZRUA 4Y7EA 3RFAA 1TIMA 3SUSA 4IPNB 5K3VA 3KRSA 1EPVA 3RR4A 1AJ0A 5JVLA 3O6CA 4WGXA 4IIDA 2CBUA 4JR5A 3E2RA 1FHLA 1LL7A 4LS2A 1EHAA 1VEOA 3W22A 1QW8A 4DXKA 3VDHA 4DROA 1WP6A 3C61A 2OKOA 3PBMA 2Y70A 3D46A 3GR8A 1GWJA 1LQ2A 4IG2A 3LHYA 2CLIA 1X98A 2QV5A 3VOCA 4TMCA 4CNNA 1KFEA 3VD7A 3VOIA 1BRLB 2TRSA 3S1GA 1FTXA 2ZWYA 4WCJA 1W1IE 2BY0A 5BOFA 3BZGA 3STGA 5AECA 4XSLA 1FX6A 4DY1A 4R85A 3UWQA 4PSPA 2XH0A 4GXMA 1SFJA 1RK6A 2O7SA 4QBXA 1UOKA 5HNRA 4G8TA 1YDYA 3MBDA 1FCVA 2B81A 1EIXA 2FLIA 1JCMP 2GVLA 5H2ZA 3KOYA 4ADSA 3LGGA 4ZOEA 1JYVA 5REQB 2HSAA 1B90A 3LY0A 1A5CA 3GM8A 3RAOA 3C86A 3DU0A 4AZ6A 4HYVA 4DM1A 2O0TA 1L6SA 4GI4A 1XLJA 2CESA 3NL2A 5JBDA 4QITA 1QPOA 1V03A 3BDKA 3KE0A 2EF9A 2VR2A 4XZ9A 3CTTA 3AIEA 4MGVA 1ZCCA 2WV8A 5GPGA 1S3HA 4DRSA 1W8SA 3N2XA 3L68A 4LUTB 1JD9A 2VUNA 4HHHA 3RK8A 4XSMA 3LCGA 4X0VA 2GGJA 2WJZA 1E4LA 1A5BA 2OZ8A 2J9ZA 4Q33A 4QGCA 2ZA2A 2ZZ5A 4P7RA 3VNYA 3H54A 2ZTJA 4M81A 1SFTA 2BTMA 1C90A 1V7YA 2YJQA 5B80A 1NDYA 3KM8A 2YW4A 4GGHA 3FGCB 4MIMA 3KBSA 4F3HA 2CLPA 3GTXA 1G4TA 4TUFA 4UC5A 3TYBA 3W81A 1R3WA 5D37A 5G2HA 1DQUA 3GDRA 4XZMX 1GVRA 5AYYA 1CB7B 3VM5A 4O54A 3B40A 2A3AA 4KWWA 4FF5A 2NUXA 2E5BA 2B7QA 5I03A 4UCGA 1XLGA 5I6SA 5CG7A 1UR9A 1J4EA 3NSXA 5F7UA 4Q8QA 2PDIA 5FI8A 1TE6A 3SFWA 3RGCA 1LROA 1RZMA 3LPPA 3E0IA 4RNIA 4JHZA 2X1IA 3HA1A 4PMYA 5CSRA 1GOQA 5CZKA 1WXZA 3ABOA 5BYWA 2LJ4A 2VI0A 2X0YA 1S5MA 4ZENA 4DJDD 1B9BA 3WDPP 1P0BA 1XLMA 1PAMA 4J3TA 1QMLA 2D1ZA 5FF4A 2ALRA 4JTTA 1DEDA 3UCQA 3O16A 1E15A 1EP2A 3MSDA 1YNPA 2V8ZA 1HW6A 1BYBA 2VHLA 1SYTA 4CD8A 4MZYA 1D7FA 4YHGA 1EUAA 3GW3A 4F0MA 3FW6A 2CHNA 3M43A 3PBWA 3E5BA 1OX4A 2K8IA 3WX7A 2OEMA 3SIMA 3F2BA 3V5FA 2J66A 3B3DA 4PB5A 3PR9A 4E6MA 4PC8A 2HV5A 1UD3A 2A7NA 2DZWA 1H5VA 1ZUAX 1K9TA 3KOFA 2C3ZA 3MA8A 5XIAA 2WHJA 1XUUA 4DI8A 2GVYA 4Y2WA 1P48A 4A8LA 2ISDA 3I68A 1ICSA 3TKFA 4DWDA 1RQEA 2PS2A 4U2ZA 5DCBA 3WLPA 2DSUA 4HZ6A 2BY3A 4S23A 3UPBA 2YXOA 1OYCA 1US2A 2W79A 1XYAA 3PPCA 1W9UA 4A3HA 1CBGA 4DWSC 1K9FA 2NQ5A 1X6UA 2OXNA 1GG0A 2Z6JA 3WL0A 3N15A 1OT2A 2XG9A 3P81A 4I3GA 3ZR5A 5HPOA 3EX1A 4O52A 3RM9A 1J9YA 3NURA 1XLHA 2PMQA 1P0KA 1KCKA 1VBJA 1TPVA 3GTHA 4W9PA 5C0QA 2PWFA 4OV4A 4IMFA 1VFMA 2VX4A 4UTFA 5CGTA 4O57A 3HG5A 5C2XA 2ANUA 4H9ZA 2WSYA 1KFBA 1OIFA 1V93A 4JTUA 1WOBA 4J2PA 2BASA 3KAFA 1F5ZA 2GUYA 1O66A 4M7TA 1LLWA 1PUDA 3U2ZA 4REQA 1GPFA 1HGWA 5ABHA 1MXDA 1RV8A 2TAAA 1UD6A 2H8ZA 1NIUA 1ROUA 1RR2A 4TMBA 4ZO8A 3BK0A 5HWMA 4AEFA 4WRHA 1OY0A 3NSMA 1VFUA 3GHTA 4DJDC 5LNVA 5DXYA 1S46A 4G6CA 4HNUA 4NT0A 1TSIA 4LAYA 2QMJA 5HQEA 4HU0A 1DE6A 2PTZA 5I3IA 4AMAA 2IMRA 3FY1A 5MF5A 4K1WA 2OOFA 4GIEA 2WC4A 1QOQA 1ICQA 3DDMA 4C1KA 3THDA 4FLOA 1OD0A 3T7VA 2KX9A 1RBOB 1TMLA 5FEPA 1FCUA 1A5UA 1LM1A 1SR0A 1H1YA 5C2CA 2I16A 1XPGA 1OCNA 4GZIA 3KP1A 4L4MA 1SUXA 1X38A 5CJMA 5FESA 3GNPA 3OTRA 4L4LA 2DSWA 4DXXA 3CYVA 1LJYA 5FF0A 4IXHA 3I6CA 1V77A 5FSDC 2F8QA 4KF1A 3ARZA 4R5EA 2VFHA 4F0SA 1B6CA 3GYCA 3DERA 4LAVA 3C2FA 3GE7A 1TWIA 2Y24A 1BYCA 1XCWA 3KAOA 2QLYA 2VRKA 3M0JA 4IMEA 3OA3A 3WMCA 4WY0A 1YMYA 2YBVA 4OU1A 2VC6A 2GVEA 4K1GA 3VILA 4UTWA 4W7WA 4L9XA 1V3LA 1IF2A 3I6EA 1OG0A 3KDOA 2R1LA 2C79A 5FJRA 5DF0A 3FHAA 1R2TA 4O2TA 3BW3A 3WNMA 4AD0A 2FJKA 3A5FA 5C9XA 3CQIA 1R8LA 2X09A 4W4QA 1B2YA 3TJXA 3KVKA 4KQZA 4K38A 4O4WA 3URQA 2Y85A 3CZ8A 1FKDA 3W3OA 2BDQA 1E3XA 1A49A 3GG8A 4AY1A 4KCTA 1E0WA 3URAA 1B0IA 3TE9A 1M7JA 3VD9A 3WQVA 4Y8EA 1SW0A 1ISWA 3S1UA 2IQDA 4AZIA 2WQPA 3LEPA 1YBQB 2UWFA 3P7YA 3NQ2A 4ZTXA 3DEQA 5LYRA 1EO7A 1F6YA 1POKA 1OFBA 3O5PA 2R8WA 1E51A 2OLAA 2ATMA 4HPNA 1A0DA 2VC5A 2OZ3A 2GDVA 3CHVA 4YTUA 4QJ1A 4NI8A 3WQPA 4E0CA 4HNOA 4MMWA 1F3XA 3ISIX 5DBUA 2O9OA 2F2HA 2F7FA 4NF7A 4JOMA 3ZR6A 4QT3A 1SW3A 1JDFA 4A8IA 2HMCA 3GG1A 4NAEA 2NUYA 3S5ZA 2YFNA 3ABXA 2AL1A 1RPKA 2A21A 5ABTA 4IGNA 1P5QA 3AICA 4MNLA 1S38A 4I5RA 3QPEA 4E4FA 2WSPA 2ALDA 2YYTA 2AMXA 4JTKA 3IJLA 4Q3MA 4XZBA 1KV8A 1KCLA 1VFHA 4NAFB 1DV7A 3P62A 1P0NA 1E0XA 4JX6A 3UG8A 3DHUA 2Z4GA 1KNWA 2PRHA 1EIBA 5ABFB 1KFCA 5E6YA 3QSTA 1ZBKA 3OQEA 1QOXA 1R5YA 2OFNA 5A6SA 2PWVA 3R10A 4M7SA 2OR2A 3W28A 1GOIA 5HOSA 4L9YA 2NQJA 1DOSA 2HXTA 2FB2A 1EDGA 1M6JA 3VFLA 4HBOA 1KW1A 1GW1A 4M3PA 4TYOA 3MBFA 3O0KA 3VGHA 2YB1A 2FAPA 3UR8A 1EGVA 1JCXA 2WVUA 3J7HA 1EJXC 3UZ5A 4MY8A 1C93A 4H6EA 1FH8A 2WW5A 3EOOA 3AMLA 4GX8A 1O1ZA 3WD2A 4YYFA 2A3HA 3AIVA 1FWCC 5IHSA 2JKEA 4GGBA 4G2PA 4NUWA 4R33A 2A5HA 1TWSA 4RDWA 3A9BA 3L7RA 3BSHA 3OOQA 3DGRA 4M82A 9XIAA 2UY5A 4LUJA 1NSGA 5DMNA 3I6TA 5DANA 4D6FA 3TK7A 4Z2JA 1J5TA 3AXMA 5HWNA 1K9EA 2CZFA 4WGHA 5H6HA 4DIAA 1YLVA 3ENLA 3L4UA 3DG3A 4O0QA 3ZVHB 4MDPA 3O07A 4WZHA 5G4EA 1M04A 3NO1A 5ABFA 2FDSA 1W1A1 2Y5JA 1GVIA 6PTDA 3W1XA 4IJRA 2A6NA 1PJ9A 4DRKA 3W7DA 1DWJM 1Q65A 3HGSA 2GPTA 4PE8A 2PFHA 4KBXA 1AMKA 4PL2A 1VPQA 4OV9A 1DHKA 4L56A 4ZGYA 4E38A 3STCA 1ZJHA 3ZSTA 5KINA 4W89A 2OWCA 4IFKA 1XH0A 2FGLA 3AMDA 4MAZA 5CGMA 3WDHA 3BPWA 5HUAA 1G94A 1WDDA 4GYPA 1M41A 1FWSA 4QX4A 3TFXA 3IGUA 3EDDA 3CAQA 3IVSA 4G5DA 1W1ZA 3SIZA 5DCDA 4JX5A 4E2DA 4H7CA 1DJIA 1EB3A 3DYPA 3BMVA 4N0RA 1R47A 3QHMA 3DFOA 4RNJA 3NXLA 4GYFA 4ZOAA 3BH4A 4LU0A 2YLLA 3B4YA 1WB0A 2QCGA 1TUFA 4LS0A 1XBYA 5I3FA 2GSHA 3U6WA 3GBDA 1W3LA 1DXEA 1J4RA 1QW7A 4GY7A 3PB2A 5D2VA 5CZTA 2QR6A 3CB8A 3GH7A 3GDMA 1Q6DA 4MJMA 1TQXA 4N9CA 2FPVA 2WKLA 3VABA 3W24A 1NMVA 2OKTA 1RSCA 4QG6A 3UQBA 4ZSTA 3MTWA 4GNVA 4GD0A 2GJPA 4GIVA 4UFHA 3BCFA 4GNKB 3G1RA 3CC1A 1K70A 2IPGA 2LKNA 4CU7A 2QDHA 4XIAA 1DJQA 1F05A 2GGIA 4LRTA 1G7VA 2BVTA 2PSNA 1PPIA 3S0CA 1R6WA 4OGZA 2B31A 3TSDA 3ABRA 4S2CA 5HMSA 4HARA 1UWRA 4V27A 1EL3A 2IKIA 4UBPC 2XFYA 4RNFA 4GVHA 3DKJA 1TREA 4Q7IA 4LVAA 3MVIA 1HKMA 3AHZA 5LXXA 1OEPA 2CHRA 1XX1A 2FFIA 1K1DA 4CD5A 2J7HA 3OG3A 2BV9A 4TNSA 3M1ZA 3B8UA 1BVNP 3LQLA 1MXGA 3VC5A 4S1FA 3B06A 4AD2A 2C19A 5K9CA 1XIBA 2GWGA 1AQHA 2W6RA 4AG0A 1RVKA 1JUEA 1CGTA 1JJKA 1XLDA 4LVDA 1VYPX 3SR7A 1KWGA 4YCOA 4PBEA 4NJGA 1JQXA 3MMUA 4RDVA 3TCEA 1RCOB 4OBRA 1F76A 3QLDA 3LK6A 5EGRA 3SSZA 4W85A 3B9OA 1OABA 1ECQA 1L6FA 2OU4A 3WH0A 1Q63A 2PI6A 3TDBA 1S2VA 3NNTA 3IANA 4LY4A 4N9DA 2OQHA 5F2LA 4QT2A 2FTYA 3AJXA 3NOEA 3W6YA 3DI1A 4G1KA 4JTFA 2G50A 3RR1A 1QBBA 4PMXA 1JF6A 4I9TA 1OX5A 4NAFA 2PURA 3EOSA 5AZ1A 1G67A 3WLOA 3BZJA 5BZAA 4XTDA 2VR4A 4A29A 2HPMA 1F7BA 3W7IA 3N12A 2C13A 1L6YA 1W3HA 2KZHA 3E49A 2CCRA 2DQWA 3WQ6A 2WYSA 1IZJA 2G41A 2P5NA 3ARPA 3CHDA 1LUCB 2DH3A 1LQ0A 2OELA 4J3ZA 3F5LA 4J4OA 3O5RA 3BLEA 1P6CA 3O9NA 4CGTA 4C6MA 1G4EA 3REQA 4ERGA 3WH7A 2NLYA 4JIIX 2DUXA 2G37A 3K30A 2VD8A 2NQHA 3PR2A 4JIEA 2E09A 1PHWA 3B8SA 2WHKA 2QULA 1U1HA 3C2OA 2OT1A 2C15A 2TPSA 1VENA 4O8AA 4AYGA 4DJED 2YDSA 3U7VA 4QJ5B 7CGTA 1O5XA 3O5EA 3INPA 3SB0A 2PGFA 3S3GA 4BF9A 3N4AA 3RITA 4U33A 3WH6A 1OFPA 2PPPA 1ZY9A 3AO0A 1CGWA 3BUVA 1A5OC 3WL1A 1GJWA 3LTPA 4FHAA 1F3TA 3KL0A 1A5NC 1K8YA 3AU2A 4UNLA 3VX0A 5JU6A 4MSPA 2ZWZA 3H4GA 3MANA 1UA3A 4FLRA 4UFLA 3W1NA 3LTYA 3WQCA 3CAWA 5HA7A 2QKFA 1D3HA 2P4VA 4M80A 3W7HA 2PEVA 3K4WA 2OSWA 1YEYA 1WAWA 3AZRA 4W5ZA 5HWJA 5MKGB 1IR1A 1V4YA 1FKWA 4Q8UA 4MWAB 3O8AA 5F4SA 3PPFA 1J11A 1VLWA 1VFTA 2XVLA 2NQ9A 4HK6A 3FVDA 4XO7A 3W7GA 3D6NA 2J8FA 1WBHA 4F2TA 1LQAA 1BXNA 4GQRA 4L4PA 3VNLA 2WK2A 1HIZA 3ZJKA 2GQ3A 2PBGA 4WR3A 3BAJA 5A1AA 4NI3A 3C0SA 3ZJ8A 2ZR4A 4YMZA 3DHDA 3MWCA 4PMRA 5A3HA 3PB0A 4C6QA 1ITUA 4NRSA 4JTAA 1V79A 3F2CA 1RXOB 1OFEA 2BGSA 1GTEA 3Q94A 2F4EA 1D2KA 1EOMA 1E71M 2B5UB 1LUCA 1JNDA 2OZ0A 3EOLA 5BOOA 2F23A 4S3JA 2IQTA 3FKKA 5H8MA 4QQUA 2HNHA 3JUGA 4C65A 1FXPA 1E6NA 1NQ6A 3M5VA 3QBUA 3PS7A 2XYLA 1TTQA 3P60A 3MUXA 4JFVA 1HL2A 4XZIA 5C7VA 2J7CA 3LCFA 4CN4A 2QPXA 3VKKA 3OW1A 4RLIA 3PAJA 1SJCA 3T0BA 3W2UA 2TYSA 2I57A 4DF0A 3TWAA 4O1CA 3WLLA 1JAEA 4BWLA 1PTDA 2MLXA 4Z1AA 1H11A 3NL3A 4XAGA 1KRAC 3W71A 2NX3A 1TELA 3UGRA 2PBOA 3WK3A 1SGJA 1QI2A 3QF0A 3WJZA 4F4RA 4O1BA 3NVTA 4OOUA 1OZQA 4B90A 4GVFA 1L9WA 3NQ8A 1RD5A 1VBUA 4AQLA 4B2DA 5DCEA 4H9YA 4I7VA 3M9YA 1CECA 2CZVA 2DJLA 1PKLA 3CHEA 3KBVA 1XYBA 4HZ7A 3WBAA 3EMQA 1HFBA 3NQFA 3CH0A 2RGLA 4HIBA 2KE0A 5EMJA 4DZHA 4EKJA 4KQNA 3PN8A 2D2OA 1R30A 1M03A 3K4AA 3UI6A 4NZ4A 2VGFA 4GRSA 2NLIA 3FS2A 3W82A 2ZUSA 2A3LA 4HPHA 3L5MA 4UQAA 1N82A 1YXDA 4CCDA 4LF1A 3WFZA 1YRRA 1FH9A 4XAYA 3F5JA 1KXVA 4PSRA 4BQ4A 2BOGX 3TN5A 1UMLA 3BVJA 4U3AA 3PZMA 4DZ5A 4MZ8A 1U5HA 1OF6A 4DUVA 2J27A 3W01A 4U5KA 3LI0A 3O63A 4UMCA 3T4WA 2VDIA 4WK9A 3OEXA 2J13A 3WUBA 4GI8A 2B0MA 5LGXA 2XJ7A 3SO7A 5U7SA 3IJ9A 3OIHA 4ZE4A 4RDZA 2V5DA 2PGEA 1U5JA 4NNCA 2Y4SA 3U0HA 1PWLA 4HBEA 1OINA 2YL5A 4G9PA 5JH2A 3BL3A 4OJYA 1EPXA 1PZ2A 2Z00A 3SI9A 1CB2A 5I00A 3W1QA 1QFEA 1EF2A 5BRBA 1XBZA 4ODOA 5BU6A 2PA6A 4MY9A 3K4DA 4JKLA 5HW8A 5KMYA 3EMCA 4GYPC 1MMFA 4FEZA 3TC5A 4KRUA 2IUZA 4JCMA 1LG1A 4Q4KA 4DF1A 1UR0A 3N13A 2FFCA 2NWRA 3IJDA 4MG4A 2WZHA 2ZRVA 3WO8A 2PGRA 2WBKA 4IP7A 3OJGA 3RX3A 1BL4A 3VMPA 2FPYA 1D7JA 1HZYA 3A4JA 3O5DA 2ZQ0A 3EDKA 3VGEA 1TKKA 1IZCA 5HANA 2X16A 4QEHA 3FXGA 3CEUA 2DIJA 4HD5A 4R7OA 4UFIA 1FHUA 4EPBC 3EB2A 5A5WA 1D3CA 4B4HA 3RPTA 4XB3A 1JDAA 4ERAA 4GQGA 3IJIA 1LBLA 1CI1A 3W87A 3V4BA 3VOFA 3QTGA 3LGDA 4FXJA 3GW0A 4HSOA 4AHQA 2ZA1A 4NY2A 4QM1A 4JYSA 5DX7A 1OM0A 1ADDA 3GTFA 4ZZ9A 4IICA 4AH7A 4EANA 2KO7A 1XRFA 1GQKA 2L2SA 3QLLA 3U7BA 3LHVA 3IVTA 1FP9A 3ZT6A 2ZUMA 3BV7A 4NJIA 1OCQA 5BRPA 3BQ6A 1BTCA 1V3HA 1GTHA 2NVDA 1SO3A 2BVWA 2J79A 1TUXA 3MUY1 4R7WA 1TVPA 1E9IA 3WQOA 4Q32A 3NZQA 2J7DA 4AB4A 3FOKA 3LLXA 5FJJA 2FGBA 2QHAA 1K9DA 3LM3A 3T8LA 5B7YA 3RJXA 3BJFA 3WNNA 2ZRXA 3E1F1 5AC7A 3EPOA 3HQPA 2CETA 1C7TA 5AHFA 3JRKA 3FLUA 3ECQA 4U10A 4FB7A 3OLEA 5GQBA 4GIYA 5LXEA 2VZSA 2C91A 2Q01A 4TW8A 2F84A 3KAIA 3KLLA 5J8LA 1Q4NX 3L4WA 3TSMA 4JQAA 1BG9A 1ZPTA 2ZZ6A 2Y8VA 3JU2A 3AISA 2TMDA 5C9RA 4GH3A 2BX7A 4GPNA 4JQ3A 6ENLA 1E4MM 2MPHA 4ZR8A 4DBSA 5E5CA 1OVDA 4AVFA 3WJXA 5TQLA 4EWJA 1R87A 2A2IA 3ELFA 1JF5A 2VEMA 1FWFC 3SAZA 1V6TA 4L9ZA 1HKJA 1SSGA 3Q65A 4DJEC 1J0ZA 4WY0F 1Z69A 1FQ0A 1U1UA 2VZVA 5EMMA 4FS9A 4HA4A 5BWFA 2CU0A 1Q2SA 3CV7A 3TTOA 2G97A 4EXAA 4WSJA 2VWSA 4JEJA 4IQDA 4AXNA 3GXIA 2WJEA 3W7PA 2DG4A 1BSIA 1POJA 2WZTA 3FX4A 4J9JA 2QMKA 4MKNA 2UY4A 5B7ZA 1E40A 1V3KA 3S2CA 4JNYA 4IUGA 1XIJA 2FZ9A 1VFSA 2VEFA 1TPUA 2W3ZA 4Z1BA 4LV9A 4JX4A 1FKKA 1WZLA 4FLSA 3CMGA 4NNRA 2YSWA 3WK2A 3W00A 2ABBA 2HCVA 5IXEA 3EX2A 1LBMA 3H2MA 1XL9A 1VGAA 4POCA 2HISA 3B7XA 3WN6A 2O4QA 1W5NA 4QR6A 4BI6A 3OZPA 3MU7A 4K68A 1PCKA 1WX0A 1Q4WA 2WWDA 1QZ2A 5F1VA 3A4XA 1DXFA 3TFCA 3UZWA 3SGUA 1XIDA 3CO4A 2C1IA 2D0GA 4J3VA 3G1XA 5HJXA 4NILA 1TO3A 1H4PA 4F9DA 1E0UA 4WDXA 4PA8A 2H3BA 1R9YA 2EPNA 1BF6A 2GQ9A 4MB4A 2P3ZA 5HINA 4UTWC 1JDEA 2BS9A 2H3DA 3QRHA 3WG6A 3ARUA 3G1FA 1TPDA 3I3EA 3E96A 3IIPA 1KLZA 4L1GA 3O5FA 4DB7A 1L2UA 4YTQA 3B0PA 2BGNE 4L5ZA 5GNXA 4ILSA 1CLXA 4D72A 3R6IA 1WDSA 4R53A 1CGUA 3N25A 3IKDA 4IWWA 3W70A 1NMWA 3E3HA 4B5TA 2XP3A 4Z2LA 1OADA 1DJXA 4BI7A 4IJCA 3CNYA 3K13A 4WY0B 4CQ9A 3SRFA 4Y9NA 4D6CA 2XZ9A 4K2SA 3PY2A 1NH6A 3N04A 4DWSB 1DWGM 2WO5A 3V3WA 4CNSA 4WOQA 3Q37A 5A94A 2R82A 2KR7A 2BG5A 1Z9AA 2Q8LA 4EVZA 3EA1A 3O5OA 4DYJA 4HHLA 3WQFA 4K8HA 3M16A 4LPCA 4A2SA 4IUOA 3ONBA 1L2QA 2NVAA 3FVMA 1RVGA 5DY2A 4A4AA 3N29A 2WANA 2W27A 1H49A 3OHIA 3OPSA 1PWMA 2NV2A 4JICA 1GZJA 2HE8A 3QW4B 3EIPA 3IIZA 1WE5A 4S2BA 2FTPA 3EWUA 3T78A 2WNWA 4QSHA 2OFJA 3GG0A 4ZFCA 1DTUA 3I4KA 2VXNA 2HQAA 2Y6ZA 3CMJA 2M2AA 1WKDA 2RDXA 2VNCA 5AHMA 4B9YA 3GVQA 1GQJA 1W9DM 4MFDA 3ZMRA 3FFSA 4C6DA 3W02A 1HQTA 2FZNA 3FDKA 3WF0A 1P1XA 3L2MA 4JQ4A 1G69A 1UKTA 4O1EA 4CQCA 3UA4A 1MYRA 1TV8A 3EWBX 1KC7A 4HPXA 1SJBA 4DUWA 2ZE0A 3MKCA 3VNJA 1FDYA 2WJDA 1KTCA 3G1AA 1KRCC 3GVWA 4FAMA 3H2EA 4UTJA 2YIHA 5CZSA 1J01A 2A3BA 2G3JA 3P14A 3A23A 3LZ5A 5AYBA 1SZGA 2V82A 3VIGA 3KTCA 3CQ0A 1H7XA 1J6YA 1JRBA 4EACA 3AFBA 4HNCA 3SEPA 2I56A 3QZ6A 5FF3A 4REQB 1K8ZA 2Y5EA 4CN6A 4GQBA 2A79A 4K7YA 3GU2A 3H70A 4PTXA 4GA8A 1A3HA 3LLDA 1ZQ5A 3BW4A 2C14A 2E6YA 4JTGA 3O5IA 3POHA 1GG1A 3SQMA 1TWZA 4ZQCA 1LBFA 1EYEA 2AWGA 1FWBC 4IIFA 2VQTA 4IT1A 1RHCA 2YBTA 3VKAA 1RP9A 3K8MA 3FAXA 2BXVA 2QDDA 4M6PA 3MYOA 3G18A 3VAWA 1BGAA 4LAMA 4TU1A 1DIOA 4IOTA 1R2RA 2DZUA 2OB3A 3UWWA 3XISA 4KIEA 3SJ3A 3ARVA 3O05A 3MCOA 1U5VA 1W5MA 2ISFA 4X22A 2ISSA 3ANVA 3CLWA 1DWAM 3O15A 4F0LA 4R3UA 1J8VA 1TVNA 5CPTA 3F4VA 3KEHA 4HNVA 3CBWA 1KM6A 1SPQA 4GUGA 3C2YA 3UWZA 4WEVX 5FD0A 4Q4MA 1ME7A 1JDCA 4Z1YA 5DRCA 4NU7A 2WMFA 2Z1KA 4KCWA 3QY6A 1OX4B 4DRNA 4A21A 1W5OA 5DRIA 1XYCA 4QSFA 1BLIA 4X60A 2EPMX 5C9WA 3BMXA 3LYEA 4AX6A 1W91A 1VCGA 4IFKB 3BLDA 2NXGA 5D9PA 1O95A 3QHOA 4MHBA 5FJPA 3W7EA 3QOKA 2CW6A 4MLRA 3QQ0A 4ACZA 3S9ZA 2A7RA 4EX4A 3LQGA 1O94A 4HYRA 4YXGA 5BXRA 1L6GA 3KL5A 4DJFC 4H8HA 2WNZA 4JFWA 1B30A 3C52A 4KEUA 2QJMA 4QJ3B 4H6KA 3CPGA 3MP3A 3ALFA 2E1WA 1WYIA 4ZOBA 1KM1A 3QXBA 3K5XA 1IEQA 1XG4A 3W72A 2MNRA 4RPPA 1D9EA 1MRAA 2AKMA 2B7NA 2XH4A 3ME3A 3KW3A 1YPXA 3UA3A 4O4VA 5FA5A 5LHFA 3NQVA 3APYA 1GRJA 3W38A 3CPRA 4QHRA 2PWDA 1XD1A 1UROA 2QXWA 1W2PA 3MV11 4GY1A 1KQZA 2DH2A 3LA4A 1TPWA 1GVEA 3NO3A 4S3EA 1CDGA 5HMEA 3QMSA 3CMFA 3PG8A 2BVDA 3R89A 4N9EA 3L2IA 1HP4A 1CGXA 5JMUA 2M08A 3TH6A 3U4AA 3BWWA 2ON3A 1EC9A 1ZS2A 1TJ0A 3UZYA 1UWQA 1DPMA 5K4ZA 1NVMA 4XZHA 1HVXA 3PRAA 3RN6A 2BWGA 5FOOA 2NV1A 1BKSA 2WMIA 2VM8A 3NL5A 1IEIA 3PC0A 4M19A 1TFVA 2UZ5A 3R0KA 3ES8A 1UR3M 4KWSA 1AQMA 3A22A 4TR9A 3T6CA 1BWKA 4AVOA 4B5SA 4OBTA 1KWKA 4QNEA 4RPQA 4HSHA 4XKYA 1FUYA 1VD6A 2PP3A 3QY8A 4PULA 4ZMGA 1OCJA 3AIRA 4CLMA 2QDEA 1I9CB 1GKPA 5AC8A 3GIQA 3T0CA 2HVMA 1CW2A 2Y61A 3DFHA 1F74A 4ZA0A 3H2AA 4HNLA 4UTKA 3CUZA 4DBEA 2L5HA 2E8YA 2IKGA 2P10A 4MJ4A 1Q6LA 3R13A 2ZX5A 1YTEA 4R7JA 4S3AA 1FFRA 1G1YA 3FJ4A 2Z7GA 1PIFA 2DEPA 1W9PA 3SUWA 1KB3A 4JAWA 2OPJA 9RUBA 3T55A 4LAUA 4FMVA 1YDVA 3WLJA 4YTTA 1XISA 1Q6QA 4K8GA 1ISXA 4UMBA 4IIGA 4ZQOA 1TG7A 1ZBVA 1Y7VA 2IKJA 3WNLA 2ICSA 4IQEA 4C1LA 3VC6A 2PAJA 1KBJA 1EYWA 3T2QA 2MUCA 1WPCA 3QVQA 1Y65A 2FTWA 1QO2A 2BHYA 3T44A 4JL1A 2CWXA 2QVHA 4NG3A 2KI3A 3PTQA 3B0XA 3TYCA 3IWPA 4CEXC 3MWAA 3DZ1A 1HJVA 5E0FA 3RMEA 3KFTA 3OZYA 2J7FA 3TSBA 3NWRA 4GVGA 5H8PA 1W6TA 2XN2A 4XKYB 1AD1A 2J25A 3W37A 3VZYA 3B0YA 4ML9A 5CSSA 3W25A 5U4NA 3V0SA 1HL9A 4YTRA 3HU7A 4HQVA 3PP7A 1IT7A 1JGMA 4OHQA 4KRTA 1VZWA 1ECEA 2VQUA 3SN4A 4LAZA 4H7ZA 1E1EA 5HQMA 2Z2UA 1SO4A 4GX9A 2WSRA 3ITGA 4WJ8A 2QCCA 2FVMA 2VEIA 1EUNA 3LLFA 1FHDA 3F5KA 2JEQA 3AIBA 4LALA 4JXCA 5C70A 3VU2A 2BGQA 3ZR4A 2X0SA 4NX5A 4WQ6A 1H41A 3AQUA 3SJNA 4IFRA 5E70A 1ITXA 2DIKA 1S1RA 4ERIA 3VIJA 3P0WA 1V5XA 2QUTA 2CXEA 4NAEB 2VENA 4AAJA 4RV3A 2DZAA 2EKGA 3WEOA 1Q6HA 1XC4A 4LBUA 4O18A 1BRLA 4NZCA 1R3TA 1UYQA 3G77A 2XPBA 1GOKA 4H8VA 3MJMA 3U2CA 3KRUA 1TJ1A 7XIMA 1F4HA 1KTBA 2DZSA 1OFRA 4ZCWA 4QCFA 4LX4A 3L0KA 4Q8TA 3H9RB 3FEQA 2ZOXA 4PR4A 3QQWA 3BGGA 1M65A 3A64A 1CXLA 1OGSA 4AF0A 4LYPA 4WJEA 3UR2A 3W1UA 3LBMA 3HG2A 2YCLA 2DDXA 4NZ5A 4HBKA 3HURA 4BF7A 1HP5A 4MYXA 2OQYA 4IJBA 3A12A 4O14A 3W1TA 2OLSA 4ICNA 1ZU8A 1FKBA 3UXKA 4JTHA 2X1UA 4HOZA 1TTPA 2I14A 3CZLA 3TW9A 1WXYA 4ZXOA 5CPLA 3HMJG 1YE6A 1DHPA 3UG3A 3W75A 2GJNA 1G0CA 3I6RA 4IQJA 2YX0A 3EZ4A 3N6QA 1P5BA 4H4IA 1PINA 1T0OA 4ZQRA 4GCXA 5FACA 3O7UA 3LMZA 1GVSA 4N19A 3NYZA 3BGJA 4GHRA 3S83A 4CD6A 4XD5A 1XIMA 4JGDA 1Q2RA 1BSLA 1ML1A 3CL6A 4YLWA 4D8LA 1ZAHA 1KBBA 1AMYA 2VRQA 1FAPA 2G0WA 3V5CA 2E5DA 1M5WA 4J40A 5A6BA 1H63A 1E43A 1OBAA 3GU1A 1DIEA 2OGJA 4HOXA 4IZGA 1W0MA 1R9HA 2I5GA 3RILA 5DN1A 1Q6IA 4GBUA 2Y7EA 5I3DA 1K7EA 4Q6XA 2XIBA 3AS2A 3SQLA 3G0SA 3TMLA 1YPFA 1DBTA 1QNVA 1VRXA 3S2LA 1PVNA 2DUZA 4AXKA 3ALGA 1E5NA 1I60A 4CNTA 4XISA 3AWOA 3KTXA 1K4GA 5JQ9A 4CQDA 2OX4A 4W5UA 6A3HA 3PZGA 1OCBA 5D09A 3VD3A 1R3VA 1TA3A 4DYEA 3T0AA 4AEEA 4ZS6A 4F8XA 4HU4A 4MVAA 5BW6A 4N02A 1VEPA 4W9QA 4ROQA 5A8MA 3NSNA 3A24A 1VJSA 3GU0A 4H2CA 1N8FA 4QE5A 3CB3A 3BAXA 2GWNA 4DYKA 3IS4A 2G5WA 4MNJA 4E5TA 5DEZA 4F79A 1PZ3A 1HKVA 3KUMA 4QXIA 2Q02A 4C6IA 1Y5VA 1EJSC 4NL1A 4KEMA 3CHFA 1FKJA 1R3YA 3UBPC 1SZNA 3MMWA 1F8IA 1D8CA 5DFAA 4A6GA 1UC5A 3M0HA 3O0FA 1T11A 3W1MA 3CWOX 3KOXA 4QCEA 3TXZA 4M6UA 1H0IA 3LCIA 1F3EA 3L4XA 1KM2A 1UR1A 1GOOA 1V6YA 5EMUA 4MADA 2KAUC 1Q6OA 4QAIA 3WKZA 3N19B 4HK7A 5H91A 3T9PA 3ZFHA 3B9NA 4MB5A 4DHGA 3WDRA 2OG9A 3M07A