1EQ3A

Nmr structure of human parvulin hpar14
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
96
structure length
96
Chain Sequence
NAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PEPTIDYL-PROLYL CIS/TRANS ISOMERASE (PPIASE)
publication title NMR solution structure of hPar14 reveals similarity to the peptidyl prolyl cis/trans isomerase domain of the mitotic regulator hPin1 but indicates a different functionality of the protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 96
sequence length 96
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2000-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1eq3A00
3O5LA 4N19A 5HW6A 2XP7A 3O5GA 2KI3A 1QPFA 4DRNA 4ODRA 2N87A 2VCDA 1A7XA 1BL4A 1M5YA 1W26A 2KR7A 1EYMA 2K8IA 3KZ7A 3NRKA 4DT4A 2F4EA 4U84A 4TX0A 1ZK6A 5BXJA 1YW5A 3IKDA 1F8AB 3UQAA 4IQCA 2RSEA 1JNTA 3MDYB 2FKEA 2ITKA 5DITA 3TCZA 5HW8A 2RQSA 3H9RB 3O5DA 2XP3A 3RFWA 1FKGA 2MF9A 2RURA 2XP9A 2UZ5A 3FAPA 4G50A 4U85A 2ZQTA 1JVWA 2KFWA 1FKJA 1FD9A 4DRQA 2KO7A 1C9HA 2ZR5A 2PV1A 3O5IA 2MPHA 2PPOA 2Q5AA 3JYJA 3JYMA 3O5MA 3CGMA 3ODKA 4G2PA 5HW7A 5J6EA 1YATA 3OOBA 3EY6A 1D7HA 1FAPA 1HXVA 3I6CA 5HTGA 4JFKA 4NNRA 2DG9A 4DZ2A 4TW6A 3UQIA 1Q6IA 3KAGA 1QZ2A 4GGQA 5HWCA 4DRMA 3KAHA 1N1AA 2LPVA 4ODQA 4DH0A 1D7JA 5HWBA 1TCOC 2RUQA 3O5PA 2XP8A 3IK8A 4W9QA 1F40A 4ODPA 5B8IC 1B6CA 2PPNA 4J4NA 4DRKA 5HT1A 4DRPA 1D7IA 3UI4A 3UI5A 2LKNA 2ZQSA 4DRHA 2Y78A 3CGNA 1FKKA 5DIVA 2FAPA 2ZQUA 3VAWA 4FN2A 2DG4A 1P5QA 3NTPA 2LJ4A 4JFLA 3PRDA 2D9FA 4LAWA 4QT3A 4C02B 2XP4A 4JFIA 1ZCNA 4DROA 1ROTA 4ITZA 1FKTA 4MSPA 1R9HA 3UI6A 4BF8A 4DIPA 4TW8A 1JNSA 2KGJA 2M08A 2PV3A 3KCEA 2VN1A 1PBKA 3O5KA 1ROUA 1NSGA 2MNTA 2XP5A 3O5OA 3UQBA 3KAIA 2MLXA 1NMVA 3O5JA 4JFMA 2ZR4A 4W9PA 5GPGA 3B7XA 1EQ3A 2L2SA 1J4HA 1PINA 3O5EA 1QPLA 1J4RA 1FKIA 2XPBA 4ODLA 3O5FA 1FKRA 3UF8A 4ODNA 5HKGA 3RGCA 4R0XA 2RUCA 3PA7A 4LAVA 1U79A 1Y0OA 4W9OA 5DIUA 2OFNA 1FKSA 3NI6A 3JXVA 2XPAA 2AWGA 2PPPA 1KT1A 4IPXA 4TW7A 3KADA 4O2TA 2PBCA 1FKFA 3O5RA 1T11A 4J4OA 1Q6UA 4MGVA 2DG3A 2F21A 2ZQVA 4QIBA 3KAFA 2PV2A 4U86A 1KT0A 5HUAA 2XP6A 5D75A 1BKFA 2RUDA 4JYSA 1FKLA 4ODKA 4IQ2A 1FKHA 3TDBA 1J6YA 1NMWA 5I98A 3GPKA 3PRBA 4DRJA 3TC5A 2MLZA 2M1IA 2ZR6A 3LUOA 3WH0A 3KACA 3KABA 1J4IA 3IKGA 1FJDA 1FKBA 2KE0A 4ODOA 1D6OA 1Q1CA 2MLYA 1L1PA 4QT2A 4DRIA 3IHZA 2M2AA 4GIVA 2F2DA 4JFJA 1FKDA 4ODMA 2JZVA 1Q6HA 2LGOA 4FAPA 4LAYA 4TYOA 3O5QA 4DZ3A 4LAXA 4TNSA 2IF4A
chains in the Genus database with same CATH superfamily
4N19A 1TFVA 2KI3A 3B9AA 3QOKA 1ZBKA 2K8IA 4LGXA 1F8AB 1HJVA 2A3AA 4IQCA 3UQAA 3MDYB 2FKEA 1E6ZA 3O5DA 2XP3A 3RFWA 3ALGA 4ML4A 4WKFA 1FD9A 4Z2LA 2MPHA 3JYJA 3ODKA 1YATA 3OOBA 1D7HA 4NNRA 3UQIA 2ESCA 4QZVB 2LPVA 2O9OA 1D7JA 1HJXA 1TCOC 4P8WA 4MNKA 4ODPA 5B8IC 1FFQA 1B6CA 1H0GA 4J4NA 1VF8A 3AS0A 5DEZA 3UI5A 3UI4A 1E15A 1FKKA 4MNJA 3VAWA 4FN2A 2DG4A 4JFLA 2LJ4A 2DT0A 2XP4A 1ZCNA 1ROTA 2DSWA 3WD1A 2PV3A 1HKKA 3UQBA 3KAIA 1LL6A 1EQ3A 2L2SA 2WM0A 1PINA 1HKIA 2DSZA 2P4VA 5HKGA 3RGCA 2A3EA 3AS2A 1W9PA 1ZBWA 2AWGA 4P8UA 2PPPA 1EIBA 1T11A 2DT1A 4MGVA 2F21A 2WLYA 4U86A 1BKFA 2RUDA 2EULA 4ODKA 3TDBA 3G6MA 4Q22A 5I98A 1JCHB 3WH0A 3KACA 1FJDA 4ZPVR 3ARZA 1GOIA 2WLZA 4DRIA 2M2AA 3RM9A 3GTYX 4GIVA 2F2DA 3BXWA 4Z2HA 1ZL1A 4LAYA 4DZ3A 5J6EA 4TNSA 4FAPA 2IF4A 4P8XA 3WD3A 3FXYA 2A3CA 4ODRA 1A7XA 5JH8A 1W26A 2KR7A 4DT4A 1ZK6A 1YW5A 3ARYA 2ITKA 5DITA 5HW8A 1LQ0A 1E44A 3ARRA 1K9TA 1HJWA 2RURA 1KFWA 2UZ5A 3FAPA 4U85A 1FKJA 4DRQA 2ZR5A 3G6LA 3O5IA 2Q5AA 4MPKA 1NH6A 3JYMA 4G2PA 2QF8A 1FAPA 1HXVA 3ARWA 3PR9A 4W5UA 4WK9A 1Q6IA 4UDMA 1QZ2A 5HWCA 1IX5A 4ODQA 1N1AA 1X6LA 4W9QA 3IK8A 1F40A 1SYTA 4Z2GA 1LL7A 4Z2KA 2PPNA 1LL4A 4DRKA 3EIPA 2DPEA 3AS3A 4DRHA 2Y78A 3ARQA 3CHCA 1XRVA 5DIVA 2ZQUA 5GPRA 4URIA 3ARPA 4LAWA 3OA5A 4ITZA 2YBUA 4WIWA 1WNOA 2KGJA 1EDQA 3CZ8A 1PBKA 1NSGA 2MNTA 1UR8A 2XP5A 2MLXA 1NMVA 3O5JA 4JFMA 4W9PA 3RM8A 3BMBA 4DWSD 1J4HA 3O5EA 4HARA 3RMEA 4NZCA 1NWTA 1FKRA 3UF8A 3ARUA 1ZBVA 3GU0A 2RUCA 4LAVA 1U79A 2F23A 4W9OA 3ARVA 3B8SA 2IUZA 1HKJA 1JNEA 2ETNA 4IT6A 4AY1A 3KADA 1FKFA 4ZS6A 1Q6UA 2DG3A 2ZQVA 4Z2IA 1EHNA 3ARXA 1OGGA 4HBOA 3B9EA 3PRBA 4DRJA 2DSUA 3TC5A 2M1IA 2ZR6A 3LUOA 1J4IA 4IT4A 3ARSA 4MTVA 2DT2A 1L1PA 3IHZA 3W4RA 2JZVA 1Q6HA 3O5QA 3O5LA 2XP7A 4PTMA 1M5YA 1EYMA 3NRKA 3WL0A 2F4EA 5BXJA 3IKDA 1ZB5A 2RSEA 1CTNA 2RQSA 3H9RB 1FKGA 4DWSA 4ZPTR 4G50A 2ZQTA 1JVWA 1LJYA 2KFWA 2KO7A 1C9HA 3ALFA 2PPOA 2PI6A 5HW7A 3CGMA 3EY6A 5HTGA 2FDMA 1X6NA 2DG9A 4DZ2A 3KAGA 4GGQA 4DRMA 1GRJA 5HWBA 1ITXA 3ARTA 2XP8A 5GQBA 3FY1A 1XHGA 5HT1A 4DRPA 2LKNA 2ZQSA 2OLHA 2FAPA 1W1YA 1P5QA 4KQZA 1NWUA 4S3JA 2D9FA 4MAVA 4JFIA 2PN0A 4DROA 4MSPA 3UI6A 4L3NA 1SR0A 4TW8A 1JNSA 2DSVA 3WQVA 2M08A 3KCEA 2VN1A 3O5OA 4WJXA 4R5EA 5GPGA 2AOSA 2B5UB 1J4RA 1FKIA 4ODLA 3O5FA 3AS1A 1WAWA 2A3BA 1E6PA 1Y0OA 2G41A 1W1PA 2OFNA 1W1VA 1W1TA 1FKSA 3NI6A 1ZU8A 4IPXA 4J4OA 3O5RA 4QIBA 1O6IA 3KAFA 3WD2A 4S3KA 1KT0A 5D75A 4IQ2A 1LG1A 1JNDA 2MLZA 3KABA 1LG2A 1OWQA 1W9UA 2KE0A 4ODOA 1Q1CA 4MNMA 4QT2A 1GPFA 2LGOA 2WK2A 1D2KA 1H0IA 1NWSA 4XAKA 3O5GA 5HW6A 1QPFA 5DO2A 4DRNA 2N87A 2VCDA 4ZPWR 1BL4A 1ZBCA 3RM4A 3KZ7A 4U84A 3WD4A 4TX0A 4DWSC 2DT3A 3AQUA 1JNTA 5HBFA 3TCZA 1HKMA 4WKHA 2MF9A 2XP9A 1RD6A 4MNLA 2PV1A 1W9VA 3O5MA 4DWSB 3I6CA 4JFKA 4TW6A 1E6NA 3KAHA 4DH0A 2RUQA 3O5PA 4Q7NA 1D7IA 3B9DA 3CGNA 4NSBA 2O92A 3NTPA 3PRDA 4QT3A 4C02B 1FKTA 4BF8A 1R9HA 4DIPA 1UR9A 3CHDA 1FFRA 3O5KA 1OGBA 1ROUA 3AROA 3CHFA 2ZR4A 3B7XA 1QPLA 5DF0A 1E9LA 2XPBA 3CHEA 4L72B 4ODNA 2G8ZA 4R0XA 3PA7A 4Z2JA 3WKZA 5DIUA 1GUVA 4KR0B 3JXVA 2XPAA 4WKAA 3WD0A 1KT1A 4TW7A 2YBTA 4O2TA 2PBCA 1WB0A 2PV2A 5HUAA 4HBEA 2XP6A 4JYSA 1FKLA 1FKHA 1J6YA 3PRAA 1NMWA 3CH9A 3GPKA 3WQWA 3IKGA 4P8VA 1FKBA 1D6OA 1E6RA 2MLYA 3WIJA 2B31A 4JFJA 3WL1A 4ODMA 1FKDA 4TYOA 4LAXA 1NWRA
chains in the Genus database with same CATH topology
4N19A 1TFVA 2KI3A 3B9AA 3QOKA 1ZBKA 2K8IA 4LGXA 1F8AB 1HJVA 2A3AA 4IQCA 3UQAA 3MDYB 2FKEA 1E6ZA 3O5DA 2XP3A 3RFWA 3ALGA 4ML4A 4WKFA 1FD9A 4Z2LA 2MPHA 3JYJA 3ODKA 1YATA 3OOBA 1D7HA 4NNRA 3UQIA 2ESCA 4QZVB 2LPVA 2O9OA 1D7JA 1HJXA 1TCOC 4P8WA 4MNKA 4ODPA 5B8IC 1FFQA 1B6CA 1H0GA 4J4NA 1VF8A 3AS0A 5DEZA 3UI5A 3UI4A 1E15A 1FKKA 4MNJA 3VAWA 4FN2A 2DG4A 4JFLA 2LJ4A 2DT0A 2XP4A 1ZCNA 1ROTA 2DSWA 3WD1A 2PV3A 1HKKA 3UQBA 3KAIA 1LL6A 1EQ3A 2L2SA 2WM0A 1PINA 1HKIA 2DSZA 5HKGA 3RGCA 2A3EA 3AS2A 1W9PA 1ZBWA 2AWGA 4P8UA 2PPPA 1EIBA 1T11A 2DT1A 4MGVA 2F21A 2WLYA 4U86A 1BKFA 2RUDA 4ODKA 3TDBA 3G6MA 4Q22A 5I98A 3WH0A 3KACA 1FJDA 4ZPVR 3ARZA 1GOIA 2WLZA 4DRIA 2M2AA 3RM9A 4GIVA 2F2DA 3BXWA 4Z2HA 1ZL1A 4LAYA 4DZ3A 5J6EA 4TNSA 4FAPA 2IF4A 4P8XA 3WD3A 3FXYA 2A3CA 4ODRA 1A7XA 5JH8A 1W26A 2KR7A 4DT4A 1ZK6A 1YW5A 3ARYA 2ITKA 5DITA 5HW8A 1LQ0A 3ARRA 1K9TA 1HJWA 2RURA 1KFWA 2UZ5A 3FAPA 4U85A 1FKJA 4DRQA 2ZR5A 3G6LA 3O5IA 2Q5AA 4MPKA 1NH6A 3JYMA 4G2PA 2QF8A 1FAPA 1HXVA 3ARWA 3PR9A 4W5UA 4WK9A 1Q6IA 1QZ2A 5HWCA 1IX5A 4ODQA 1N1AA 1X6LA 4W9QA 3IK8A 1F40A 1SYTA 4Z2GA 1LL7A 4Z2KA 2PPNA 1LL4A 4DRKA 2DPEA 3AS3A 4DRHA 2Y78A 3ARQA 3CHCA 1XRVA 5DIVA 2ZQUA 5GPRA 4URIA 3ARPA 4LAWA 3OA5A 4ITZA 2YBUA 4WIWA 1WNOA 2KGJA 1EDQA 3CZ8A 1PBKA 1NSGA 2MNTA 1UR8A 2XP5A 2MLXA 1NMVA 3O5JA 4JFMA 4W9PA 3RM8A 4DWSD 1J4HA 3O5EA 4HARA 3RMEA 4NZCA 1NWTA 1FKRA 3UF8A 3ARUA 1ZBVA 2RUCA 4LAVA 1U79A 4W9OA 3ARVA 3B8SA 2IUZA 1HKJA 1JNEA 4IT6A 4AY1A 3KADA 1FKFA 4ZS6A 1Q6UA 2DG3A 2ZQVA 4Z2IA 1EHNA 3ARXA 1OGGA 4HBOA 3B9EA 3PRBA 4DRJA 2DSUA 3TC5A 2M1IA 2ZR6A 3LUOA 1J4IA 4IT4A 3ARSA 4MTVA 2DT2A 1L1PA 3IHZA 3W4RA 2JZVA 1Q6HA 3O5QA 3O5LA 2XP7A 4PTMA 1M5YA 1EYMA 3NRKA 3WL0A 2F4EA 5BXJA 3IKDA 1ZB5A 2RSEA 1CTNA 2RQSA 3H9RB 1FKGA 4DWSA 4ZPTR 4G50A 2ZQTA 1JVWA 1LJYA 2KFWA 2KO7A 1C9HA 3ALFA 2PPOA 2PI6A 5HW7A 3CGMA 3EY6A 5HTGA 2FDMA 1X6NA 2DG9A 4DZ2A 3KAGA 4GGQA 4DRMA 5HWBA 1ITXA 3ARTA 2XP8A 5GQBA 3FY1A 1XHGA 5HT1A 4DRPA 2LKNA 2ZQSA 2OLHA 2FAPA 1W1YA 1P5QA 4KQZA 1NWUA 4S3JA 2D9FA 4MAVA 4JFIA 4DROA 4MSPA 3UI6A 4L3NA 1SR0A 4TW8A 1JNSA 2DSVA 3WQVA 2M08A 3KCEA 2VN1A 3O5OA 4WJXA 4R5EA 5GPGA 2AOSA 1J4RA 1FKIA 4ODLA 3O5FA 3AS1A 1WAWA 2A3BA 1E6PA 1Y0OA 2G41A 1W1PA 2OFNA 1W1VA 1W1TA 1FKSA 3NI6A 1ZU8A 4IPXA 4J4OA 3O5RA 4QIBA 1O6IA 3KAFA 3WD2A 4S3KA 1KT0A 5D75A 4IQ2A 1LG1A 1JNDA 2MLZA 3KABA 1LG2A 1OWQA 1W9UA 2KE0A 4ODOA 1Q1CA 4MNMA 4QT2A 1GPFA 2LGOA 2WK2A 1D2KA 1H0IA 1NWSA 4XAKA 3O5GA 5HW6A 1QPFA 5DO2A 4DRNA 2N87A 2VCDA 4ZPWR 1BL4A 1ZBCA 3RM4A 3KZ7A 4U84A 3WD4A 4TX0A 4DWSC 2DT3A 3AQUA 1JNTA 5HBFA 3TCZA 1HKMA 4WKHA 2MF9A 2XP9A 1RD6A 4MNLA 2PV1A 1W9VA 3O5MA 4DWSB 3I6CA 4JFKA 4TW6A 1E6NA 3KAHA 4DH0A 2RUQA 3O5PA 4Q7NA 1D7IA 3B9DA 3CGNA 4NSBA 2O92A 3NTPA 3PRDA 4QT3A 4C02B 1FKTA 4BF8A 1R9HA 4DIPA 1UR9A 3CHDA 1FFRA 3O5KA 1OGBA 1ROUA 3AROA 3CHFA 2ZR4A 3B7XA 1QPLA 5DF0A 1E9LA 2XPBA 3CHEA 4L72B 4ODNA 2G8ZA 4R0XA 3PA7A 4Z2JA 3WKZA 5DIUA 1GUVA 4KR0B 3JXVA 2XPAA 4WKAA 3WD0A 1KT1A 4TW7A 2YBTA 4O2TA 2PBCA 1WB0A 2PV2A 5HUAA 4HBEA 2XP6A 4JYSA 1FKLA 1FKHA 1J6YA 3PRAA 1NMWA 3CH9A 3GPKA 3WQWA 3IKGA 4P8VA 1FKBA 1D6OA 1E6RA 2MLYA 3WIJA 2B31A 4JFJA 3WL1A 4ODMA 1FKDA 4TYOA 4LAXA 1NWRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5L A;  4N19 A;  5HW6 A;  2XP7 A;  3O5G A;  2KI3 A;  1QPF A;  4DRN A;  4ODR A;  2N87 A;  2VCD A;  1A7X A;  1BL4 A;  1M5Y A;  1W26 A;  2KR7 A;  1EYM A;  2K8I A;  3KZ7 A;  3NRK A;  4DT4 A;  2F4E A;  4U84 A;  4TX0 A;  1ZK6 A;  5BXJ A;  1YW5 A;  3IKD A;  1F8A B;  3UQA A;  4IQC A;  2RSE A;  1JNT A;  3MDY B;  2FKE A;  2ITK A;  5DIT A;  3TCZ A;  5HW8 A;  2RQS A;  3H9R B;  3O5D A;  2XP3 A;  3RFW A;  1FKG A;  2MF9 A;  2RUR A;  2XP9 A;  2UZ5 A;  3FAP A;  4G50 A;  4U85 A;  2ZQT A;  1JVW A;  2KFW A;  1FKJ A;  1FD9 A;  4DRQ A;  2KO7 A;  1C9H A;  2ZR5 A;  2PV1 A;  3O5I A;  2MPH A;  2PPO A;  2Q5A A;  3JYJ A;  3JYM A;  3O5M A;  3CGM A;  3ODK A;  4G2P A;  5HW7 A;  5J6E A;  1YAT A;  3OOB A;  3EY6 A;  1D7H A;  1FAP A;  1HXV A;  3I6C A;  5HTG A;  4JFK A;  4NNR A;  2DG9 A;  4DZ2 A;  4TW6 A;  3UQI A;  1Q6I A;  3KAG A;  1QZ2 A;  4GGQ A;  5HWC A;  4DRM A;  3KAH A;  1N1A A;  2LPV A;  4ODQ A;  4DH0 A;  1D7J A;  5HWB A;  1TCO C;  2RUQ A;  3O5P A;  2XP8 A;  3IK8 A;  4W9Q A;  1F40 A;  4ODP A;  5B8I C;  1B6C A;  2PPN A;  4J4N A;  4DRK A;  5HT1 A;  4DRP A;  1D7I A;  3UI4 A;  3UI5 A;  2LKN A;  2ZQS A;  4DRH A;  2Y78 A;  3CGN A;  1FKK A;  5DIV A;  2FAP A;  2ZQU A;  3VAW A;  4FN2 A;  2DG4 A;  1P5Q A;  3NTP A;  2LJ4 A;  4JFL A;  3PRD A;  2D9F A;  4LAW A;  4QT3 A;  4C02 B;  2XP4 A;  4JFI A;  1ZCN A;  4DRO A;  1ROT A;  4ITZ A;  1FKT A;  4MSP A;  1R9H A;  3UI6 A;  4BF8 A;  4DIP A;  4TW8 A;  1JNS A;  2KGJ A;  2M08 A;  2PV3 A;  3KCE A;  2VN1 A;  1PBK A;  3O5K A;  1ROU A;  1NSG A;  2MNT A;  2XP5 A;  3O5O A;  3UQB A;  3KAI A;  2MLX A;  1NMV A;  3O5J A;  4JFM A;  2ZR4 A;  4W9P A;  5GPG A;  3B7X A;  1EQ3 A;  2L2S A;  1J4H A;  1PIN A;  3O5E A;  1QPL A;  1J4R A;  1FKI A;  2XPB A;  4ODL A;  3O5F A;  1FKR A;  3UF8 A;  4ODN A;  5HKG A;  3RGC A;  4R0X A;  2RUC A;  3PA7 A;  4LAV A;  1U79 A;  1Y0O A;  4W9O A;  5DIU A;  2OFN A;  1FKS A;  3NI6 A;  3JXV A;  2XPA A;  2AWG A;  2PPP A;  1KT1 A;  4IPX A;  4TW7 A;  3KAD A;  4O2T A;  2PBC A;  1FKF A;  3O5R A;  1T11 A;  4J4O A;  1Q6U A;  4MGV A;  2DG3 A;  2F21 A;  2ZQV A;  4QIB A;  3KAF A;  2PV2 A;  4U86 A;  1KT0 A;  5HUA A;  2XP6 A;  5D75 A;  1BKF A;  2RUD A;  4JYS A;  1FKL A;  4ODK A;  4IQ2 A;  1FKH A;  3TDB A;  1J6Y A;  1NMW A;  5I98 A;  3GPK A;  3PRB A;  4DRJ A;  3TC5 A;  2MLZ A;  2M1I A;  2ZR6 A;  3LUO A;  3WH0 A;  3KAC A;  3KAB A;  1J4I A;  3IKG A;  1FJD A;  1FKB A;  2KE0 A;  4ODO A;  1D6O A;  1Q1C A;  2MLY A;  1L1P A;  4QT2 A;  4DRI A;  3IHZ A;  2M2A A;  4GIV A;  2F2D A;  4JFJ A;  1FKD A;  4ODM A;  2JZV A;  1Q6H A;  2LGO A;  4FAP A;  4LAY A;  4TYO A;  3O5Q A;  4DZ3 A;  4LAX A;  4TNS A;  2IF4 A; 
#chains in the Genus database with same CATH topology
 4N19 A;  1TFV A;  2KI3 A;  3B9A A;  3QOK A;  1ZBK A;  2K8I A;  4LGX A;  1F8A B;  1HJV A;  2A3A A;  4IQC A;  3UQA A;  3MDY B;  2FKE A;  1E6Z A;  3O5D A;  2XP3 A;  3RFW A;  3ALG A;  4ML4 A;  4WKF A;  1FD9 A;  4Z2L A;  2MPH A;  3JYJ A;  3ODK A;  1YAT A;  3OOB A;  1D7H A;  4NNR A;  3UQI A;  2ESC A;  4QZV B;  2LPV A;  2O9O A;  1D7J A;  1HJX A;  1TCO C;  4P8W A;  4MNK A;  4ODP A;  5B8I C;  1FFQ A;  1B6C A;  1H0G A;  4J4N A;  1VF8 A;  3AS0 A;  5DEZ A;  3UI5 A;  3UI4 A;  1E15 A;  1FKK A;  4MNJ A;  3VAW A;  4FN2 A;  2DG4 A;  4JFL A;  2LJ4 A;  2DT0 A;  2XP4 A;  1ZCN A;  1ROT A;  2DSW A;  3WD1 A;  2PV3 A;  1HKK A;  3UQB A;  3KAI A;  1LL6 A;  1EQ3 A;  2L2S A;  2WM0 A;  1PIN A;  1HKI A;  2DSZ A;  2P4V A;  5HKG A;  3RGC A;  2A3E A;  3AS2 A;  1W9P A;  1ZBW A;  2AWG A;  4P8U A;  2PPP A;  1EIB A;  1T11 A;  2DT1 A;  4MGV A;  2F21 A;  2WLY A;  4U86 A;  1BKF A;  2RUD A;  2EUL A;  4ODK A;  3TDB A;  3G6M A;  4Q22 A;  5I98 A;  1JCH B;  3WH0 A;  3KAC A;  1FJD A;  4ZPV R;  3ARZ A;  1GOI A;  2WLZ A;  4DRI A;  2M2A A;  3RM9 A;  3GTY X;  4GIV A;  2F2D A;  3BXW A;  4Z2H A;  1ZL1 A;  4LAY A;  4DZ3 A;  5J6E A;  4TNS A;  4FAP A;  2IF4 A;  4P8X A;  3WD3 A;  3FXY A;  2A3C A;  4ODR A;  1A7X A;  5JH8 A;  1W26 A;  2KR7 A;  4DT4 A;  1ZK6 A;  1YW5 A;  3ARY A;  2ITK A;  5DIT A;  5HW8 A;  1LQ0 A;  1E44 A;  3ARR A;  1K9T A;  1HJW A;  2RUR A;  1KFW A;  2UZ5 A;  3FAP A;  4U85 A;  1FKJ A;  4DRQ A;  2ZR5 A;  3G6L A;  3O5I A;  2Q5A A;  4MPK A;  1NH6 A;  3JYM A;  4G2P A;  2QF8 A;  1FAP A;  1HXV A;  3ARW A;  3PR9 A;  4W5U A;  4WK9 A;  1Q6I A;  4UDM A;  1QZ2 A;  5HWC A;  1IX5 A;  4ODQ A;  1N1A A;  1X6L A;  4W9Q A;  3IK8 A;  1F40 A;  1SYT A;  4Z2G A;  1LL7 A;  4Z2K A;  2PPN A;  1LL4 A;  4DRK A;  3EIP A;  2DPE A;  3AS3 A;  4DRH A;  2Y78 A;  3ARQ A;  3CHC A;  1XRV A;  5DIV A;  2ZQU A;  5GPR A;  4URI A;  3ARP A;  4LAW A;  3OA5 A;  4ITZ A;  2YBU A;  4WIW A;  1WNO A;  2KGJ A;  1EDQ A;  3CZ8 A;  1PBK A;  1NSG A;  2MNT A;  1UR8 A;  2XP5 A;  2MLX A;  1NMV A;  3O5J A;  4JFM A;  4W9P A;  3RM8 A;  3BMB A;  4DWS D;  1J4H A;  3O5E A;  4HAR A;  3RME A;  4NZC A;  1NWT A;  1FKR A;  3UF8 A;  3ARU A;  1ZBV A;  3GU0 A;  2RUC A;  4LAV A;  1U79 A;  2F23 A;  4W9O A;  3ARV A;  3B8S A;  2IUZ A;  1HKJ A;  1JNE A;  2ETN A;  4IT6 A;  4AY1 A;  3KAD A;  1FKF A;  4ZS6 A;  1Q6U A;  2DG3 A;  2ZQV A;  4Z2I A;  1EHN A;  3ARX A;  1OGG A;  4HBO A;  3B9E A;  3PRB A;  4DRJ A;  2DSU A;  3TC5 A;  2M1I A;  2ZR6 A;  3LUO A;  1J4I A;  4IT4 A;  3ARS A;  4MTV A;  2DT2 A;  1L1P A;  3IHZ A;  3W4R A;  2JZV A;  1Q6H A;  3O5Q A;  3O5L A;  2XP7 A;  4PTM A;  1M5Y A;  1EYM A;  3NRK A;  3WL0 A;  2F4E A;  5BXJ A;  3IKD A;  1ZB5 A;  2RSE A;  1CTN A;  2RQS A;  3H9R B;  1FKG A;  4DWS A;  4ZPT R;  4G50 A;  2ZQT A;  1JVW A;  1LJY A;  2KFW A;  2KO7 A;  1C9H A;  3ALF A;  2PPO A;  2PI6 A;  5HW7 A;  3CGM A;  3EY6 A;  5HTG A;  2FDM A;  1X6N A;  2DG9 A;  4DZ2 A;  3KAG A;  4GGQ A;  4DRM A;  1GRJ A;  5HWB A;  1ITX A;  3ART A;  2XP8 A;  5GQB A;  3FY1 A;  1XHG A;  5HT1 A;  4DRP A;  2LKN A;  2ZQS A;  2OLH A;  2FAP A;  1W1Y A;  1P5Q A;  4KQZ A;  1NWU A;  4S3J A;  2D9F A;  4MAV A;  4JFI A;  2PN0 A;  4DRO A;  4MSP A;  3UI6 A;  4L3N A;  1SR0 A;  4TW8 A;  1JNS A;  2DSV A;  3WQV A;  2M08 A;  3KCE A;  2VN1 A;  3O5O A;  4WJX A;  4R5E A;  5GPG A;  2AOS A;  2B5U B;  1J4R A;  1FKI A;  4ODL A;  3O5F A;  3AS1 A;  1WAW A;  2A3B A;  1E6P A;  1Y0O A;  2G41 A;  1W1P A;  2OFN A;  1W1V A;  1W1T A;  1FKS A;  3NI6 A;  1ZU8 A;  4IPX A;  4J4O A;  3O5R A;  4QIB A;  1O6I A;  3KAF A;  3WD2 A;  4S3K A;  1KT0 A;  5D75 A;  4IQ2 A;  1LG1 A;  1JND A;  2MLZ A;  3KAB A;  1LG2 A;  1OWQ A;  1W9U A;  2KE0 A;  4ODO A;  1Q1C A;  4MNM A;  4QT2 A;  1GPF A;  2LGO A;  2WK2 A;  1D2K A;  1H0I A;  1NWS A;  4XAK A;  3O5G A;  5HW6 A;  1QPF A;  5DO2 A;  4DRN A;  2N87 A;  2VCD A;  4ZPW R;  1BL4 A;  1ZBC A;  3RM4 A;  3KZ7 A;  4U84 A;  3WD4 A;  4TX0 A;  4DWS C;  2DT3 A;  3AQU A;  1JNT A;  5HBF A;  3TCZ A;  1HKM A;  4WKH A;  2MF9 A;  2XP9 A;  1RD6 A;  4MNL A;  2PV1 A;  1W9V A;  3O5M A;  4DWS B;  3I6C A;  4JFK A;  4TW6 A;  1E6N A;  3KAH A;  4DH0 A;  2RUQ A;  3O5P A;  4Q7N A;  1D7I A;  3B9D A;  3CGN A;  4NSB A;  2O92 A;  3NTP A;  3PRD A;  4QT3 A;  4C02 B;  1FKT A;  4BF8 A;  1R9H A;  4DIP A;  1UR9 A;  3CHD A;  1FFR A;  3O5K A;  1OGB A;  1ROU A;  3ARO A;  3CHF A;  2ZR4 A;  3B7X A;  1QPL A;  5DF0 A;  1E9L A;  2XPB A;  3CHE A;  4L72 B;  4ODN A;  2G8Z A;  4R0X A;  3PA7 A;  4Z2J A;  3WKZ A;  5DIU A;  1GUV A;  4KR0 B;  3JXV A;  2XPA A;  4WKA A;  3WD0 A;  1KT1 A;  4TW7 A;  2YBT A;  4O2T A;  2PBC A;  1WB0 A;  2PV2 A;  5HUA A;  4HBE A;  2XP6 A;  4JYS A;  1FKL A;  1FKH A;  1J6Y A;  3PRA A;  1NMW A;  3CH9 A;  3GPK A;  3WQW A;  3IKG A;  4P8V A;  1FKB A;  1D6O A;  1E6R A;  2MLY A;  3WIJ A;  2B31 A;  4JFJ A;  3WL1 A;  4ODM A;  1FKD A;  4TYO A;  4LAX A;  1NWR A; 
#chains in the Genus database with same CATH homology
 4N19 A;  1TFV A;  2KI3 A;  3B9A A;  3QOK A;  1ZBK A;  2K8I A;  4LGX A;  1F8A B;  1HJV A;  2A3A A;  4IQC A;  3UQA A;  3MDY B;  2FKE A;  1E6Z A;  3O5D A;  2XP3 A;  3RFW A;  3ALG A;  4ML4 A;  4WKF A;  1FD9 A;  4Z2L A;  2MPH A;  3JYJ A;  3ODK A;  1YAT A;  3OOB A;  1D7H A;  4NNR A;  3UQI A;  2ESC A;  4QZV B;  2LPV A;  2O9O A;  1D7J A;  1HJX A;  1TCO C;  4P8W A;  4MNK A;  4ODP A;  5B8I C;  1FFQ A;  1B6C A;  1H0G A;  4J4N A;  1VF8 A;  3AS0 A;  5DEZ A;  3UI5 A;  3UI4 A;  1E15 A;  1FKK A;  4MNJ A;  3VAW A;  4FN2 A;  2DG4 A;  4JFL A;  2LJ4 A;  2DT0 A;  2XP4 A;  1ZCN A;  1ROT A;  2DSW A;  3WD1 A;  2PV3 A;  1HKK A;  3UQB A;  3KAI A;  1LL6 A;  1EQ3 A;  2L2S A;  2WM0 A;  1PIN A;  1HKI A;  2DSZ A;  5HKG A;  3RGC A;  2A3E A;  3AS2 A;  1W9P A;  1ZBW A;  2AWG A;  4P8U A;  2PPP A;  1EIB A;  1T11 A;  2DT1 A;  4MGV A;  2F21 A;  2WLY A;  4U86 A;  1BKF A;  2RUD A;  4ODK A;  3TDB A;  3G6M A;  4Q22 A;  5I98 A;  3WH0 A;  3KAC A;  1FJD A;  4ZPV R;  3ARZ A;  1GOI A;  2WLZ A;  4DRI A;  2M2A A;  3RM9 A;  4GIV A;  2F2D A;  3BXW A;  4Z2H A;  1ZL1 A;  4LAY A;  4DZ3 A;  5J6E A;  4TNS A;  4FAP A;  2IF4 A;  4P8X A;  3WD3 A;  3FXY A;  2A3C A;  4ODR A;  1A7X A;  5JH8 A;  1W26 A;  2KR7 A;  4DT4 A;  1ZK6 A;  1YW5 A;  3ARY A;  2ITK A;  5DIT A;  5HW8 A;  1LQ0 A;  3ARR A;  1K9T A;  1HJW A;  2RUR A;  1KFW A;  2UZ5 A;  3FAP A;  4U85 A;  1FKJ A;  4DRQ A;  2ZR5 A;  3G6L A;  3O5I A;  2Q5A A;  4MPK A;  1NH6 A;  3JYM A;  4G2P A;  2QF8 A;  1FAP A;  1HXV A;  3ARW A;  3PR9 A;  4W5U A;  4WK9 A;  1Q6I A;  1QZ2 A;  5HWC A;  1IX5 A;  4ODQ A;  1N1A A;  1X6L A;  4W9Q A;  3IK8 A;  1F40 A;  1SYT A;  4Z2G A;  1LL7 A;  4Z2K A;  2PPN A;  1LL4 A;  4DRK A;  2DPE A;  3AS3 A;  4DRH A;  2Y78 A;  3ARQ A;  3CHC A;  1XRV A;  5DIV A;  2ZQU A;  5GPR A;  4URI A;  3ARP A;  4LAW A;  3OA5 A;  4ITZ A;  2YBU A;  4WIW A;  1WNO A;  2KGJ A;  1EDQ A;  3CZ8 A;  1PBK A;  1NSG A;  2MNT A;  1UR8 A;  2XP5 A;  2MLX A;  1NMV A;  3O5J A;  4JFM A;  4W9P A;  3RM8 A;  4DWS D;  1J4H A;  3O5E A;  4HAR A;  3RME A;  4NZC A;  1NWT A;  1FKR A;  3UF8 A;  3ARU A;  1ZBV A;  2RUC A;  4LAV A;  1U79 A;  4W9O A;  3ARV A;  3B8S A;  2IUZ A;  1HKJ A;  1JNE A;  4IT6 A;  4AY1 A;  3KAD A;  1FKF A;  4ZS6 A;  1Q6U A;  2DG3 A;  2ZQV A;  4Z2I A;  1EHN A;  3ARX A;  1OGG A;  4HBO A;  3B9E A;  3PRB A;  4DRJ A;  2DSU A;  3TC5 A;  2M1I A;  2ZR6 A;  3LUO A;  1J4I A;  4IT4 A;  3ARS A;  4MTV A;  2DT2 A;  1L1P A;  3IHZ A;  3W4R A;  2JZV A;  1Q6H A;  3O5Q A;  3O5L A;  2XP7 A;  4PTM A;  1M5Y A;  1EYM A;  3NRK A;  3WL0 A;  2F4E A;  5BXJ A;  3IKD A;  1ZB5 A;  2RSE A;  1CTN A;  2RQS A;  3H9R B;  1FKG A;  4DWS A;  4ZPT R;  4G50 A;  2ZQT A;  1JVW A;  1LJY A;  2KFW A;  2KO7 A;  1C9H A;  3ALF A;  2PPO A;  2PI6 A;  5HW7 A;  3CGM A;  3EY6 A;  5HTG A;  2FDM A;  1X6N A;  2DG9 A;  4DZ2 A;  3KAG A;  4GGQ A;  4DRM A;  5HWB A;  1ITX A;  3ART A;  2XP8 A;  5GQB A;  3FY1 A;  1XHG A;  5HT1 A;  4DRP A;  2LKN A;  2ZQS A;  2OLH A;  2FAP A;  1W1Y A;  1P5Q A;  4KQZ A;  1NWU A;  4S3J A;  2D9F A;  4MAV A;  4JFI A;  4DRO A;  4MSP A;  3UI6 A;  4L3N A;  1SR0 A;  4TW8 A;  1JNS A;  2DSV A;  3WQV A;  2M08 A;  3KCE A;  2VN1 A;  3O5O A;  4WJX A;  4R5E A;  5GPG A;  2AOS A;  1J4R A;  1FKI A;  4ODL A;  3O5F A;  3AS1 A;  1WAW A;  2A3B A;  1E6P A;  1Y0O A;  2G41 A;  1W1P A;  2OFN A;  1W1V A;  1W1T A;  1FKS A;  3NI6 A;  1ZU8 A;  4IPX A;  4J4O A;  3O5R A;  4QIB A;  1O6I A;  3KAF A;  3WD2 A;  4S3K A;  1KT0 A;  5D75 A;  4IQ2 A;  1LG1 A;  1JND A;  2MLZ A;  3KAB A;  1LG2 A;  1OWQ A;  1W9U A;  2KE0 A;  4ODO A;  1Q1C A;  4MNM A;  4QT2 A;  1GPF A;  2LGO A;  2WK2 A;  1D2K A;  1H0I A;  1NWS A;  4XAK A;  3O5G A;  5HW6 A;  1QPF A;  5DO2 A;  4DRN A;  2N87 A;  2VCD A;  4ZPW R;  1BL4 A;  1ZBC A;  3RM4 A;  3KZ7 A;  4U84 A;  3WD4 A;  4TX0 A;  4DWS C;  2DT3 A;  3AQU A;  1JNT A;  5HBF A;  3TCZ A;  1HKM A;  4WKH A;  2MF9 A;  2XP9 A;  1RD6 A;  4MNL A;  2PV1 A;  1W9V A;  3O5M A;  4DWS B;  3I6C A;  4JFK A;  4TW6 A;  1E6N A;  3KAH A;  4DH0 A;  2RUQ A;  3O5P A;  4Q7N A;  1D7I A;  3B9D A;  3CGN A;  4NSB A;  2O92 A;  3NTP A;  3PRD A;  4QT3 A;  4C02 B;  1FKT A;  4BF8 A;  1R9H A;  4DIP A;  1UR9 A;  3CHD A;  1FFR A;  3O5K A;  1OGB A;  1ROU A;  3ARO A;  3CHF A;  2ZR4 A;  3B7X A;  1QPL A;  5DF0 A;  1E9L A;  2XPB A;  3CHE A;  4L72 B;  4ODN A;  2G8Z A;  4R0X A;  3PA7 A;  4Z2J A;  3WKZ A;  5DIU A;  1GUV A;  4KR0 B;  3JXV A;  2XPA A;  4WKA A;  3WD0 A;  1KT1 A;  4TW7 A;  2YBT A;  4O2T A;  2PBC A;  1WB0 A;  2PV2 A;  5HUA A;  4HBE A;  2XP6 A;  4JYS A;  1FKL A;  1FKH A;  1J6Y A;  3PRA A;  1NMW A;  3CH9 A;  3GPK A;  3WQW A;  3IKG A;  4P8V A;  1FKB A;  1D6O A;  1E6R A;  2MLY A;  3WIJ A;  2B31 A;  4JFJ A;  3WL1 A;  4ODM A;  1FKD A;  4TYO A;  4LAX A;  1NWR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...