1EQ3A

Nmr structure of human parvulin hpar14
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
96
structure length
96
Chain Sequence
b'NAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-PROLYL CIS/TRANS ISOMERASE (PPIASE)
publication title NMR solution structure of hPar14 reveals similarity to the peptidyl prolyl cis/trans isomerase domain of the mitotic regulator hPin1 but indicates a different functionality of the protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 14
structure length 96
sequence length 96
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2000-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1eq3A00
1FKFA 4QT2A 4FN2A 5HW8A 3KAIA 3ODKA 2ZQUA 3CGNA 4ITZA 5HW6A 1U79A 1FKIA 4J4NA 2FAPA 3RFWA 4IQ2A 1J4IA 3IK8A 3O5PA 1KT1A 3PA7A 4QIBA 5DIVA 2ZR4A 1FKJA 1JNTA 2UZ5A 2KI3A 3CGMA 3KZ7A 2OFNA 1BKFA 1QPFA 3JYJA 4DRNA 4JFJA 4U85A 1FKKA 1TCOC 3UQAA 3NRKA 3O5QA 1B6CA 5B8IC 2XP9A 2PV1A 4TX0A 2K8IA 2RUCA 5BXJA 2VCDA 3UF8A 1F8AB 3PRBA 4TYOA 1YW5A 2RUDA 4G2PA 4ODLA 5HWBA 1HXVA 2LJ4A 3KCEA 1QZ2A 1M5YA 4ODQA 3VAWA 2RUQA 3B7XA 2RQSA 3UI5A 2PPOA 1FD9A 1Q6IA 2PPPA 1JNSA 1N1AA 4DRIA 3TC5A 2PV3A 2KE0A 4IPXA 3UI6A 3IKDA 1D7JA 2LKNA 3IHZA 3JYMA 4ODKA 4DRJA 4C02B 5HWCA 2XP4A 3O5JA 5HKGA 2Q5AA 3GPKA 1A7XA 3KABA 4GIVA 1FKSA 3KADA 4LAYA 1FKTA 1ROTA 2M2AA 4DRMA 2LGOA 2PBCA 2ZQTA 2ZQVA 3O5DA 4LAWA 3H9RB 1ZCNA 4N19A 4ODPA 2DG3A 4BF8A 1W26A 4DIPA 4DT4A 4J4OA 2KGJA 3WH0A 3JXVA 3LUOA 5DIUA 1NSGA 2MF9A 1J4HA 1J4RA 4MGVA 5D75A 1P5QA 4JFLA 3UI4A 2DG4A 5HUAA 4JFKA 5HW7A 1D6OA 1D7HA 1YATA 3KACA 2XPAA 1Q6HA 3KAHA 4G50A 3RGCA 3O5GA 1FKDA 4MSPA 1Y0OA 3TDBA 2ZR5A 2XP6A 3EY6A 4DROA 2LPVA 4LAXA 4TW8A 5DITA 2MPHA 2M08A 2MLZA 2XP7A 2ZR6A 4W9OA 4U86A 1L1PA 1F40A 3MDYB 2Y78A 3NI6A 2RSEA 4ODOA 4R0XA 4W9QA 3I6CA 1NMWA 2IF4A 4O2TA 1EYMA 2XPBA 2MLXA 4IQCA 4DH0A 3UQBA 3TCZA 1PBKA 1R9HA 3O5MA 3O5FA 4DRKA 4GGQA 4TW7A 5GPGA 1ZK6A 2ZQSA 1C9HA 2KR7A 4DRQA 3KAGA 1FKRA 3OOBA 1ROUA 2RURA 3PRDA 1PINA 4W9PA 2PV2A 4DRHA 2ITKA 5I98A 2F2DA 4ODRA 1FKLA 1FKBA 3O5IA 3UQIA 2AWGA 3O5OA 2N87A 4DZ2A 2FKEA 1T11A 2MLYA 1FAPA 2XP5A 3FAPA 3O5LA 4JYSA 1KT0A 4DZ3A 1EQ3A 3IKGA 4FAPA 2JZVA 4QT3A 4TW6A 5HT1A 1Q1CA 2L2SA 2KFWA 2XP8A 2DG9A 3NTPA 3O5EA 4LAVA 5J6EA 1BL4A 1D7IA 1NMVA 2MNTA 2XP3A 1FKHA 2KO7A 4TNSA 1FJDA 2F21A 2M1IA 2D9FA 4U84A 1FKGA 2VN1A 3O5KA 1JVWA 4NNRA 1QPLA 2F4EA 4JFMA 5HTGA 4ODNA 1Q6UA 4ODMA 2PPNA 4JFIA 3O5RA 1J6YA 3KAFA 4DRPA
chains in the Genus database with same CATH superfamily
3ODKA 3BMBA 3RM8A 4IQ2A 4QIBA 2ZR4A 4DWSD 2WM0A 1BKFA 4U85A 3OA5A 2YBUA 1ZBWA 3CHFA 3PR9A 3O5QA 5GQBA 2XP9A 2K8IA 2A3BA 5BXJA 1F8AB 3PRBA 4WJXA 2G8ZA 4G2PA 4ODLA 2ESCA 2LJ4A 1QZ2A 3VAWA 4Z2KA 3ARRA 1Q6IA 4DRIA 3TC5A 2PV3A 3UI6A 1D7JA 2LKNA 3JYMA 1ZBKA 5HWCA 5JH8A 1E6ZA 3GPKA 4DRMA 1ROTA 2LGOA 1W1PA 2PBCA 3FXYA 3O5DA 4LAWA 2DG3A 2G41A 3CHEA 3WH0A 3LUOA 1NSGA 2MF9A 4WKAA 5D75A 3AROA 1D7HA 1W9PA 3WD3A 1Q6HA 3ARYA 4G50A 1FKDA 4MSPA 1Y0OA 4DROA 2O9OA 1ZB5A 3AS3A 2MLZA 1LL6A 1XHGA 2Y78A 4HBEA 4ODOA 1HKMA 3B9DA 4DRKA 3AS0A 1ZK6A 4HBOA 3OOBA 3ARSA 2ITKA 2F2DA 1HJXA 4Z2IA 4DWSC 2FKEA 1NWRA 4ZPVR 1FAPA 1SYTA 3FAPA 3WQVA 1EQ3A 3AS1A 4DWSA 5HT1A 1OGGA 1Q1CA 2XP8A 1NWSA 2DSVA 2A3EA 3ARTA 3ARXA 1BL4A 1W1YA 2MNTA 1FKHA 1FJDA 4TNSA 3AS2A 4U84A 3QOKA 4DRPA 2EULA 2QF8A 4WKHA 5HTGA 1Q6UA 1HJWA 3AQUA 4NZCA 1LQ0A 2DT0A 3CGNA 4ITZA 5HW6A 1W1TA 5HBFA 2DT1A 4Z2LA 3PA7A 4MTVA 1JNTA 2OFNA 1QPFA 3JYJA 4JFJA 1OWQA 3WD0A 3UQAA 3WKZA 1JCHB 3CHDA 4TX0A 2VCDA 1HXVA 1H0IA 2A3CA 4ODQA 4QZVB 1W9UA 1FD9A 4IPXA 4MNMA 3IKDA 1LG1A 3O5JA 5HKGA 3RM4A 1RD6A 1FKSA 1FKTA 1ZCNA 1LL4A 4J4OA 4P8XA 3WD4A 1FFQA 4MNLA 4MGVA 5HUAA 4URIA 3UI4A 4JFKA 5HW7A 1D6OA 4P8VA 2B31A 4P8UA 3TDBA 5DITA 2XP7A 4W9OA 4W9QA 2P4VA 3I6CA 4IT4A 1LG2A 1NMWA 1W1VA 1EYMA 4O2TA 1NH6A 4IQCA 1FFRA 3UQBA 1PBKA 3O5FA 3WIJA 2O92A 3GTYX 5GPRA 2ZQSA 2KR7A 4DRQA 1D2KA 3KAGA 3WD2A 1FKRA 1PINA 4W9PA 2PV2A 5DO2A 2YBTA 1FKBA 1ITXA 3UQIA 2PN0A 2MLYA 4DZ3A 1KT0A 4FAPA 1UR9A 2ETNA 4QT3A 2WK2A 2L2SA 4Z2GA 3ARZA 1EIBA 2XP3A 1LJYA 2M1IA 4ZPWR 4P8WA 1JVWA 2F23A 2PPNA 4JFIA 3O5RA 1J6YA 2B5UB 1GUVA 4QT2A 3KAIA 1KFWA 1GPFA 1FKIA 4J4NA 1W9VA 2FAPA 1KT1A 5DIVA 3KZ7A 1GOIA 3CGMA 4DRNA 1WAWA 1HKJA 1TCOC 1B6CA 2PV1A 2DSWA 5HWBA 3BXWA 1M5YA 2RUQA 3B7XA 4IT6A 4Z2JA 1JNSA 1N1AA 4DWSB 3WL0A 3IHZA 4DRJA 2IUZA 1NWUA 4C02B 1XRVA 1O6IA 1A7XA 3KABA 3G6MA 4ODPA 2ZQTA 2ZQVA 4BF8A 3H9RB 1EHNA 1W26A 4XAKA 1WNOA 3JXVA 4S3JA 4ZPTR 3ARUA 3CH9A 3B9EA 4MNKA 1P5QA 2DG4A 1E44A 2AOSA 1HKKA 2DT2A 1ZBVA 3O5GA 4UDMA 2ZR5A 1E9LA 2XP6A 3EY6A 4KQZA 3ALFA 4LAXA 2MPHA 2FDMA 2ZR6A 1IX5A 4U86A 3ARWA 3MDYB 3NI6A 4S3KA 2IF4A 2XPBA 4WKFA 4DH0A 3O5MA 3ARVA 4GGQA 4TW7A 1E15A 3WL1A 4KR0B 4DRHA 1NWTA 3CHCA 4NSBA 1FKLA 4MNJA 1ZL1A 3O5OA 2N87A 3O5LA 4MAVA 2JZVA 4ML4A 4TW6A 2KFWA 2DG9A 4LAVA 1NMVA 2F21A 2D9FA 2VN1A 1LL7A 3ALGA 2DSZA 4WIWA 1X6NA 1QPLA 2F4EA 4JFMA 4ODMA 3G6LA 4W5UA 3ARQA 3KAFA 1CTNA 1JNDA 1FKFA 4FN2A 5HW8A 2ZQUA 1U79A 3RM9A 4PTMA 3RFWA 4LGXA 1J4IA 3IK8A 3O5PA 1FKJA 2UZ5A 2KI3A 1UR8A 4R5EA 3B9AA 1FKKA 3NRKA 1K9TA 5B8IC 1SR0A 4Q7NA 2RUCA 3UF8A 1ZU8A 4TYOA 1YW5A 2RUDA 3KCEA 2RQSA 3UI5A 3GU0A 2PPOA 3FY1A 2PPPA 2KE0A 3WQWA 4ODKA 2DSUA 1E6NA 2XP4A 2Q5AA 1OGBA 4GIVA 3KADA 4LAYA 5DF0A 2M2AA 4N19A 4DT4A 4DIPA 4Q22A 1JNEA 2KGJA 5DIUA 1J4HA 1TFVA 1J4RA 4JFLA 1X6LA 4WK9A 4Z2HA 3ARPA 1HJVA 1YATA 3KACA 3B8SA 2XPAA 3KAHA 4L3NA 3RMEA 3RGCA 3EIPA 4ZS6A 2LPVA 2DT3A 4TW8A 4L72B 2M08A 1GRJA 1L1PA 1F40A 4R0XA 2RSEA 1H0GA 2MLXA 3W4RA 2WLZA 3PRAA 3TCZA 1R9HA 5GPGA 1C9HA 1ROUA 2RURA 3WD1A 3PRDA 2OLHA 5DEZA 5I98A 4ODRA 3O5IA 2AWGA 4DZ2A 1T11A 2XP5A 4JYSA 1E6PA 2DPEA 2PI6A 3IKGA 1HKIA 3CZ8A 3NTPA 5J6EA 3O5EA 1EDQA 1VF8A 1D7IA 4HARA 2WLYA 2KO7A 2A3AA 1FKGA 3O5KA 4NNRA 4MPKA 4ODNA 1WB0A 1ZBCA 1E6RA 4AY1A
chains in the Genus database with same CATH topology
3ODKA 3RM8A 4IQ2A 4QIBA 2ZR4A 4DWSD 2WM0A 1BKFA 4U85A 3OA5A 2YBUA 1ZBWA 3CHFA 3PR9A 3O5QA 5GQBA 2XP9A 2K8IA 2A3BA 5BXJA 1F8AB 3PRBA 4WJXA 2G8ZA 4G2PA 4ODLA 2ESCA 2LJ4A 1QZ2A 3VAWA 4Z2KA 3ARRA 1Q6IA 4DRIA 3TC5A 2PV3A 3UI6A 1D7JA 2LKNA 3JYMA 1ZBKA 5HWCA 5JH8A 1E6ZA 3GPKA 4DRMA 1ROTA 2LGOA 1W1PA 2PBCA 3FXYA 3O5DA 4LAWA 2DG3A 2G41A 3CHEA 3WH0A 3LUOA 1NSGA 2MF9A 4WKAA 5D75A 3AROA 1D7HA 1W9PA 3WD3A 1Q6HA 3ARYA 4G50A 1FKDA 4MSPA 1Y0OA 4DROA 2O9OA 1ZB5A 3AS3A 2MLZA 1LL6A 1XHGA 2Y78A 4HBEA 4ODOA 1HKMA 3B9DA 4DRKA 3AS0A 1ZK6A 4HBOA 3OOBA 3ARSA 2ITKA 2F2DA 1HJXA 4Z2IA 4DWSC 2FKEA 1NWRA 4ZPVR 1FAPA 1SYTA 3FAPA 3WQVA 1EQ3A 3AS1A 4DWSA 5HT1A 1OGGA 1Q1CA 2XP8A 1NWSA 2DSVA 2A3EA 3ARTA 3ARXA 1BL4A 1W1YA 2MNTA 1FKHA 1FJDA 4TNSA 3AS2A 4U84A 3QOKA 4DRPA 2QF8A 4WKHA 5HTGA 1Q6UA 1HJWA 3AQUA 4NZCA 1LQ0A 2DT0A 3CGNA 4ITZA 5HW6A 1W1TA 5HBFA 2DT1A 4Z2LA 3PA7A 4MTVA 1JNTA 2OFNA 1QPFA 3JYJA 4JFJA 1OWQA 3WD0A 3UQAA 3WKZA 3CHDA 4TX0A 2VCDA 1HXVA 1H0IA 2A3CA 4ODQA 4QZVB 1W9UA 1FD9A 4IPXA 4MNMA 3IKDA 1LG1A 3O5JA 5HKGA 3RM4A 1RD6A 1FKSA 1FKTA 1ZCNA 1LL4A 4J4OA 4P8XA 3WD4A 1FFQA 4MNLA 4MGVA 5HUAA 4URIA 3UI4A 4JFKA 5HW7A 1D6OA 4P8VA 2B31A 4P8UA 3TDBA 5DITA 2XP7A 4W9OA 4W9QA 3I6CA 4IT4A 1LG2A 1NMWA 1W1VA 1EYMA 4O2TA 1NH6A 4IQCA 1FFRA 3UQBA 1PBKA 3O5FA 3WIJA 2O92A 5GPRA 2ZQSA 2KR7A 4DRQA 1D2KA 3KAGA 3WD2A 1FKRA 1PINA 4W9PA 2PV2A 5DO2A 2YBTA 1FKBA 1ITXA 3UQIA 2MLYA 4DZ3A 1KT0A 4FAPA 1UR9A 4QT3A 2WK2A 2L2SA 4Z2GA 3ARZA 1EIBA 2XP3A 1LJYA 2M1IA 4ZPWR 4P8WA 1JVWA 2PPNA 4JFIA 3O5RA 1J6YA 1GUVA 4QT2A 3KAIA 1KFWA 1GPFA 1FKIA 4J4NA 1W9VA 2FAPA 1KT1A 5DIVA 3KZ7A 1GOIA 3CGMA 4DRNA 1WAWA 1HKJA 1TCOC 1B6CA 2PV1A 2DSWA 5HWBA 3BXWA 1M5YA 2RUQA 3B7XA 4IT6A 4Z2JA 1JNSA 1N1AA 4DWSB 3WL0A 3IHZA 4DRJA 2IUZA 1NWUA 4C02B 1XRVA 1O6IA 1A7XA 3KABA 3G6MA 4ODPA 2ZQTA 2ZQVA 4BF8A 3H9RB 1EHNA 1W26A 4XAKA 1WNOA 3JXVA 4S3JA 4ZPTR 3ARUA 3CH9A 3B9EA 4MNKA 1P5QA 2DG4A 2AOSA 1HKKA 2DT2A 1ZBVA 3O5GA 2ZR5A 1E9LA 2XP6A 3EY6A 4KQZA 3ALFA 4LAXA 2MPHA 2FDMA 2ZR6A 1IX5A 4U86A 3ARWA 3MDYB 3NI6A 4S3KA 2IF4A 2XPBA 4WKFA 4DH0A 3O5MA 3ARVA 4GGQA 4TW7A 1E15A 3WL1A 4KR0B 4DRHA 1NWTA 3CHCA 4NSBA 1FKLA 4MNJA 1ZL1A 3O5OA 2N87A 3O5LA 4MAVA 2JZVA 4ML4A 4TW6A 2KFWA 2DG9A 4LAVA 1NMVA 2F21A 2D9FA 2VN1A 1LL7A 3ALGA 2DSZA 4WIWA 1X6NA 1QPLA 2F4EA 4JFMA 4ODMA 3G6LA 4W5UA 3ARQA 3KAFA 1CTNA 1JNDA 1FKFA 4FN2A 5HW8A 2ZQUA 1U79A 3RM9A 4PTMA 3RFWA 4LGXA 1J4IA 3IK8A 3O5PA 1FKJA 2UZ5A 2KI3A 1UR8A 4R5EA 3B9AA 1FKKA 3NRKA 1K9TA 5B8IC 1SR0A 4Q7NA 2RUCA 3UF8A 1ZU8A 4TYOA 1YW5A 2RUDA 3KCEA 2RQSA 3UI5A 2PPOA 3FY1A 2PPPA 2KE0A 3WQWA 4ODKA 2DSUA 1E6NA 2XP4A 2Q5AA 1OGBA 4GIVA 3KADA 4LAYA 5DF0A 2M2AA 4N19A 4DT4A 4DIPA 4Q22A 1JNEA 2KGJA 5DIUA 1J4HA 1TFVA 1J4RA 4JFLA 1X6LA 4WK9A 4Z2HA 3ARPA 1HJVA 1YATA 3KACA 3B8SA 2XPAA 3KAHA 4L3NA 3RMEA 3RGCA 4ZS6A 2LPVA 2DT3A 4TW8A 4L72B 2M08A 1L1PA 1F40A 4R0XA 2RSEA 1H0GA 2MLXA 3W4RA 2WLZA 3PRAA 3TCZA 1R9HA 5GPGA 1C9HA 1ROUA 2RURA 3WD1A 3PRDA 2OLHA 5DEZA 5I98A 4ODRA 3O5IA 2AWGA 4DZ2A 1T11A 2XP5A 4JYSA 1E6PA 2DPEA 2PI6A 3IKGA 1HKIA 3CZ8A 3NTPA 5J6EA 3O5EA 1EDQA 1VF8A 1D7IA 4HARA 2WLYA 2KO7A 2A3AA 1FKGA 3O5KA 4NNRA 4MPKA 4ODNA 1WB0A 1ZBCA 1E6RA 4AY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKF A;  4QT2 A;  4FN2 A;  5HW8 A;  3KAI A;  3ODK A;  2ZQU A;  3CGN A;  4ITZ A;  5HW6 A;  1U79 A;  1FKI A;  4J4N A;  2FAP A;  3RFW A;  4IQ2 A;  1J4I A;  3IK8 A;  3O5P A;  1KT1 A;  3PA7 A;  4QIB A;  5DIV A;  2ZR4 A;  1FKJ A;  1JNT A;  2UZ5 A;  2KI3 A;  3CGM A;  3KZ7 A;  2OFN A;  1BKF A;  1QPF A;  3JYJ A;  4DRN A;  4JFJ A;  4U85 A;  1FKK A;  1TCO C;  3UQA A;  3NRK A;  3O5Q A;  1B6C A;  5B8I C;  2XP9 A;  2PV1 A;  4TX0 A;  2K8I A;  2RUC A;  5BXJ A;  2VCD A;  3UF8 A;  1F8A B;  3PRB A;  4TYO A;  1YW5 A;  2RUD A;  4G2P A;  4ODL A;  5HWB A;  1HXV A;  2LJ4 A;  3KCE A;  1QZ2 A;  1M5Y A;  4ODQ A;  3VAW A;  2RUQ A;  3B7X A;  2RQS A;  3UI5 A;  2PPO A;  1FD9 A;  1Q6I A;  2PPP A;  1JNS A;  1N1A A;  4DRI A;  3TC5 A;  2PV3 A;  2KE0 A;  4IPX A;  3UI6 A;  3IKD A;  1D7J A;  2LKN A;  3IHZ A;  3JYM A;  4ODK A;  4DRJ A;  4C02 B;  5HWC A;  2XP4 A;  3O5J A;  5HKG A;  2Q5A A;  3GPK A;  1A7X A;  3KAB A;  4GIV A;  1FKS A;  3KAD A;  4LAY A;  1FKT A;  1ROT A;  2M2A A;  4DRM A;  2LGO A;  2PBC A;  2ZQT A;  2ZQV A;  3O5D A;  4LAW A;  3H9R B;  1ZCN A;  4N19 A;  4ODP A;  2DG3 A;  4BF8 A;  1W26 A;  4DIP A;  4DT4 A;  4J4O A;  2KGJ A;  3WH0 A;  3JXV A;  3LUO A;  5DIU A;  1NSG A;  2MF9 A;  1J4H A;  1J4R A;  4MGV A;  5D75 A;  1P5Q A;  4JFL A;  3UI4 A;  2DG4 A;  5HUA A;  4JFK A;  5HW7 A;  1D6O A;  1D7H A;  1YAT A;  3KAC A;  2XPA A;  1Q6H A;  3KAH A;  4G50 A;  3RGC A;  3O5G A;  1FKD A;  4MSP A;  1Y0O A;  3TDB A;  2ZR5 A;  2XP6 A;  3EY6 A;  4DRO A;  2LPV A;  4LAX A;  4TW8 A;  5DIT A;  2MPH A;  2M08 A;  2MLZ A;  2XP7 A;  2ZR6 A;  4W9O A;  4U86 A;  1L1P A;  1F40 A;  3MDY B;  2Y78 A;  3NI6 A;  2RSE A;  4ODO A;  4R0X A;  4W9Q A;  3I6C A;  1NMW A;  2IF4 A;  4O2T A;  1EYM A;  2XPB A;  2MLX A;  4IQC A;  4DH0 A;  3UQB A;  3TCZ A;  1PBK A;  1R9H A;  3O5M A;  3O5F A;  4DRK A;  4GGQ A;  4TW7 A;  5GPG A;  1ZK6 A;  2ZQS A;  1C9H A;  2KR7 A;  4DRQ A;  3KAG A;  1FKR A;  3OOB A;  1ROU A;  2RUR A;  3PRD A;  1PIN A;  4W9P A;  2PV2 A;  4DRH A;  2ITK A;  5I98 A;  2F2D A;  4ODR A;  1FKL A;  1FKB A;  3O5I A;  3UQI A;  2AWG A;  3O5O A;  2N87 A;  4DZ2 A;  2FKE A;  1T11 A;  2MLY A;  1FAP A;  2XP5 A;  3FAP A;  3O5L A;  4JYS A;  1KT0 A;  4DZ3 A;  1EQ3 A;  3IKG A;  4FAP A;  2JZV A;  4QT3 A;  4TW6 A;  5HT1 A;  1Q1C A;  2L2S A;  2KFW A;  2XP8 A;  2DG9 A;  3NTP A;  3O5E A;  4LAV A;  5J6E A;  1BL4 A;  1D7I A;  1NMV A;  2MNT A;  2XP3 A;  1FKH A;  2KO7 A;  4TNS A;  1FJD A;  2F21 A;  2M1I A;  2D9F A;  4U84 A;  1FKG A;  2VN1 A;  3O5K A;  1JVW A;  4NNR A;  1QPL A;  2F4E A;  4JFM A;  5HTG A;  4ODN A;  1Q6U A;  4ODM A;  2PPN A;  4JFI A;  3O5R A;  1J6Y A;  3KAF A;  4DRP A; 
#chains in the Genus database with same CATH topology
 3ODK A;  3BMB A;  3RM8 A;  4IQ2 A;  4QIB A;  2ZR4 A;  4DWS D;  2WM0 A;  1BKF A;  4U85 A;  3OA5 A;  2YBU A;  1ZBW A;  3CHF A;  3PR9 A;  3O5Q A;  5GQB A;  2XP9 A;  2K8I A;  2A3B A;  5BXJ A;  1F8A B;  3PRB A;  4WJX A;  2G8Z A;  4G2P A;  4ODL A;  2ESC A;  2LJ4 A;  1QZ2 A;  3VAW A;  4Z2K A;  3ARR A;  1Q6I A;  4DRI A;  3TC5 A;  2PV3 A;  3UI6 A;  1D7J A;  2LKN A;  3JYM A;  1ZBK A;  5HWC A;  5JH8 A;  1E6Z A;  3GPK A;  4DRM A;  1ROT A;  2LGO A;  1W1P A;  2PBC A;  3FXY A;  3O5D A;  4LAW A;  2DG3 A;  2G41 A;  3CHE A;  3WH0 A;  3LUO A;  1NSG A;  2MF9 A;  4WKA A;  5D75 A;  3ARO A;  1D7H A;  1W9P A;  3WD3 A;  1Q6H A;  3ARY A;  4G50 A;  1FKD A;  4MSP A;  1Y0O A;  4DRO A;  2O9O A;  1ZB5 A;  3AS3 A;  2MLZ A;  1LL6 A;  1XHG A;  2Y78 A;  4HBE A;  4ODO A;  1HKM A;  3B9D A;  4DRK A;  3AS0 A;  1ZK6 A;  4HBO A;  3OOB A;  3ARS A;  2ITK A;  2F2D A;  1HJX A;  4Z2I A;  4DWS C;  2FKE A;  1NWR A;  4ZPV R;  1FAP A;  1SYT A;  3FAP A;  3WQV A;  1EQ3 A;  3AS1 A;  4DWS A;  5HT1 A;  1OGG A;  1Q1C A;  2XP8 A;  1NWS A;  2DSV A;  2A3E A;  3ART A;  3ARX A;  1BL4 A;  1W1Y A;  2MNT A;  1FKH A;  1FJD A;  4TNS A;  3AS2 A;  4U84 A;  3QOK A;  4DRP A;  2EUL A;  2QF8 A;  4WKH A;  5HTG A;  1Q6U A;  1HJW A;  3AQU A;  4NZC A;  1LQ0 A;  2DT0 A;  3CGN A;  4ITZ A;  5HW6 A;  1W1T A;  5HBF A;  2DT1 A;  4Z2L A;  3PA7 A;  4MTV A;  1JNT A;  2OFN A;  1QPF A;  3JYJ A;  4JFJ A;  1OWQ A;  3WD0 A;  3UQA A;  3WKZ A;  1JCH B;  3CHD A;  4TX0 A;  2VCD A;  1HXV A;  1H0I A;  2A3C A;  4ODQ A;  4QZV B;  1W9U A;  1FD9 A;  4IPX A;  4MNM A;  3IKD A;  1LG1 A;  3O5J A;  5HKG A;  3RM4 A;  1RD6 A;  1FKS A;  1FKT A;  1ZCN A;  1LL4 A;  4J4O A;  4P8X A;  3WD4 A;  1FFQ A;  4MNL A;  4MGV A;  5HUA A;  4URI A;  3UI4 A;  4JFK A;  5HW7 A;  1D6O A;  4P8V A;  2B31 A;  4P8U A;  3TDB A;  5DIT A;  2XP7 A;  4W9O A;  4W9Q A;  2P4V A;  3I6C A;  4IT4 A;  1LG2 A;  1NMW A;  1W1V A;  1EYM A;  4O2T A;  1NH6 A;  4IQC A;  1FFR A;  3UQB A;  1PBK A;  3O5F A;  3WIJ A;  2O92 A;  3GTY X;  5GPR A;  2ZQS A;  2KR7 A;  4DRQ A;  1D2K A;  3KAG A;  3WD2 A;  1FKR A;  1PIN A;  4W9P A;  2PV2 A;  5DO2 A;  2YBT A;  1FKB A;  1ITX A;  3UQI A;  2PN0 A;  2MLY A;  4DZ3 A;  1KT0 A;  4FAP A;  1UR9 A;  2ETN A;  4QT3 A;  2WK2 A;  2L2S A;  4Z2G A;  3ARZ A;  1EIB A;  2XP3 A;  1LJY A;  2M1I A;  4ZPW R;  4P8W A;  1JVW A;  2F23 A;  2PPN A;  4JFI A;  3O5R A;  1J6Y A;  2B5U B;  1GUV A;  4QT2 A;  3KAI A;  1KFW A;  1GPF A;  1FKI A;  4J4N A;  1W9V A;  2FAP A;  1KT1 A;  5DIV A;  3KZ7 A;  1GOI A;  3CGM A;  4DRN A;  1WAW A;  1HKJ A;  1TCO C;  1B6C A;  2PV1 A;  2DSW A;  5HWB A;  3BXW A;  1M5Y A;  2RUQ A;  3B7X A;  4IT6 A;  4Z2J A;  1JNS A;  1N1A A;  4DWS B;  3WL0 A;  3IHZ A;  4DRJ A;  2IUZ A;  1NWU A;  4C02 B;  1XRV A;  1O6I A;  1A7X A;  3KAB A;  3G6M A;  4ODP A;  2ZQT A;  2ZQV A;  4BF8 A;  3H9R B;  1EHN A;  1W26 A;  4XAK A;  1WNO A;  3JXV A;  4S3J A;  4ZPT R;  3ARU A;  3CH9 A;  3B9E A;  4MNK A;  1P5Q A;  2DG4 A;  1E44 A;  2AOS A;  1HKK A;  2DT2 A;  1ZBV A;  3O5G A;  4UDM A;  2ZR5 A;  1E9L A;  2XP6 A;  3EY6 A;  4KQZ A;  3ALF A;  4LAX A;  2MPH A;  2FDM A;  2ZR6 A;  1IX5 A;  4U86 A;  3ARW A;  3MDY B;  3NI6 A;  4S3K A;  2IF4 A;  2XPB A;  4WKF A;  4DH0 A;  3O5M A;  3ARV A;  4GGQ A;  4TW7 A;  1E15 A;  3WL1 A;  4KR0 B;  4DRH A;  1NWT A;  3CHC A;  4NSB A;  1FKL A;  4MNJ A;  1ZL1 A;  3O5O A;  2N87 A;  3O5L A;  4MAV A;  2JZV A;  4ML4 A;  4TW6 A;  2KFW A;  2DG9 A;  4LAV A;  1NMV A;  2F21 A;  2D9F A;  2VN1 A;  1LL7 A;  3ALG A;  2DSZ A;  4WIW A;  1X6N A;  1QPL A;  2F4E A;  4JFM A;  4ODM A;  3G6L A;  4W5U A;  3ARQ A;  3KAF A;  1CTN A;  1JND A;  1FKF A;  4FN2 A;  5HW8 A;  2ZQU A;  1U79 A;  3RM9 A;  4PTM A;  3RFW A;  4LGX A;  1J4I A;  3IK8 A;  3O5P A;  1FKJ A;  2UZ5 A;  2KI3 A;  1UR8 A;  4R5E A;  3B9A A;  1FKK A;  3NRK A;  1K9T A;  5B8I C;  1SR0 A;  4Q7N A;  2RUC A;  3UF8 A;  1ZU8 A;  4TYO A;  1YW5 A;  2RUD A;  3KCE A;  2RQS A;  3UI5 A;  3GU0 A;  2PPO A;  3FY1 A;  2PPP A;  2KE0 A;  3WQW A;  4ODK A;  2DSU A;  1E6N A;  2XP4 A;  2Q5A A;  1OGB A;  4GIV A;  3KAD A;  4LAY A;  5DF0 A;  2M2A A;  4N19 A;  4DT4 A;  4DIP A;  4Q22 A;  1JNE A;  2KGJ A;  5DIU A;  1J4H A;  1TFV A;  1J4R A;  4JFL A;  1X6L A;  4WK9 A;  4Z2H A;  3ARP A;  1HJV A;  1YAT A;  3KAC A;  3B8S A;  2XPA A;  3KAH A;  4L3N A;  3RME A;  3RGC A;  3EIP A;  4ZS6 A;  2LPV A;  2DT3 A;  4TW8 A;  4L72 B;  2M08 A;  1GRJ A;  1L1P A;  1F40 A;  4R0X A;  2RSE A;  1H0G A;  2MLX A;  3W4R A;  2WLZ A;  3PRA A;  3TCZ A;  1R9H A;  5GPG A;  1C9H A;  1ROU A;  2RUR A;  3WD1 A;  3PRD A;  2OLH A;  5DEZ A;  5I98 A;  4ODR A;  3O5I A;  2AWG A;  4DZ2 A;  1T11 A;  2XP5 A;  4JYS A;  1E6P A;  2DPE A;  2PI6 A;  3IKG A;  1HKI A;  3CZ8 A;  3NTP A;  5J6E A;  3O5E A;  1EDQ A;  1VF8 A;  1D7I A;  4HAR A;  2WLY A;  2KO7 A;  2A3A A;  1FKG A;  3O5K A;  4NNR A;  4MPK A;  4ODN A;  1WB0 A;  1ZBC A;  1E6R A;  4AY1 A; 
#chains in the Genus database with same CATH homology
 3ODK A;  3RM8 A;  4IQ2 A;  4QIB A;  2ZR4 A;  4DWS D;  2WM0 A;  1BKF A;  4U85 A;  3OA5 A;  2YBU A;  1ZBW A;  3CHF A;  3PR9 A;  3O5Q A;  5GQB A;  2XP9 A;  2K8I A;  2A3B A;  5BXJ A;  1F8A B;  3PRB A;  4WJX A;  2G8Z A;  4G2P A;  4ODL A;  2ESC A;  2LJ4 A;  1QZ2 A;  3VAW A;  4Z2K A;  3ARR A;  1Q6I A;  4DRI A;  3TC5 A;  2PV3 A;  3UI6 A;  1D7J A;  2LKN A;  3JYM A;  1ZBK A;  5HWC A;  5JH8 A;  1E6Z A;  3GPK A;  4DRM A;  1ROT A;  2LGO A;  1W1P A;  2PBC A;  3FXY A;  3O5D A;  4LAW A;  2DG3 A;  2G41 A;  3CHE A;  3WH0 A;  3LUO A;  1NSG A;  2MF9 A;  4WKA A;  5D75 A;  3ARO A;  1D7H A;  1W9P A;  3WD3 A;  1Q6H A;  3ARY A;  4G50 A;  1FKD A;  4MSP A;  1Y0O A;  4DRO A;  2O9O A;  1ZB5 A;  3AS3 A;  2MLZ A;  1LL6 A;  1XHG A;  2Y78 A;  4HBE A;  4ODO A;  1HKM A;  3B9D A;  4DRK A;  3AS0 A;  1ZK6 A;  4HBO A;  3OOB A;  3ARS A;  2ITK A;  2F2D A;  1HJX A;  4Z2I A;  4DWS C;  2FKE A;  1NWR A;  4ZPV R;  1FAP A;  1SYT A;  3FAP A;  3WQV A;  1EQ3 A;  3AS1 A;  4DWS A;  5HT1 A;  1OGG A;  1Q1C A;  2XP8 A;  1NWS A;  2DSV A;  2A3E A;  3ART A;  3ARX A;  1BL4 A;  1W1Y A;  2MNT A;  1FKH A;  1FJD A;  4TNS A;  3AS2 A;  4U84 A;  3QOK A;  4DRP A;  2QF8 A;  4WKH A;  5HTG A;  1Q6U A;  1HJW A;  3AQU A;  4NZC A;  1LQ0 A;  2DT0 A;  3CGN A;  4ITZ A;  5HW6 A;  1W1T A;  5HBF A;  2DT1 A;  4Z2L A;  3PA7 A;  4MTV A;  1JNT A;  2OFN A;  1QPF A;  3JYJ A;  4JFJ A;  1OWQ A;  3WD0 A;  3UQA A;  3WKZ A;  3CHD A;  4TX0 A;  2VCD A;  1HXV A;  1H0I A;  2A3C A;  4ODQ A;  4QZV B;  1W9U A;  1FD9 A;  4IPX A;  4MNM A;  3IKD A;  1LG1 A;  3O5J A;  5HKG A;  3RM4 A;  1RD6 A;  1FKS A;  1FKT A;  1ZCN A;  1LL4 A;  4J4O A;  4P8X A;  3WD4 A;  1FFQ A;  4MNL A;  4MGV A;  5HUA A;  4URI A;  3UI4 A;  4JFK A;  5HW7 A;  1D6O A;  4P8V A;  2B31 A;  4P8U A;  3TDB A;  5DIT A;  2XP7 A;  4W9O A;  4W9Q A;  3I6C A;  4IT4 A;  1LG2 A;  1NMW A;  1W1V A;  1EYM A;  4O2T A;  1NH6 A;  4IQC A;  1FFR A;  3UQB A;  1PBK A;  3O5F A;  3WIJ A;  2O92 A;  5GPR A;  2ZQS A;  2KR7 A;  4DRQ A;  1D2K A;  3KAG A;  3WD2 A;  1FKR A;  1PIN A;  4W9P A;  2PV2 A;  5DO2 A;  2YBT A;  1FKB A;  1ITX A;  3UQI A;  2MLY A;  4DZ3 A;  1KT0 A;  4FAP A;  1UR9 A;  4QT3 A;  2WK2 A;  2L2S A;  4Z2G A;  3ARZ A;  1EIB A;  2XP3 A;  1LJY A;  2M1I A;  4ZPW R;  4P8W A;  1JVW A;  2PPN A;  4JFI A;  3O5R A;  1J6Y A;  1GUV A;  4QT2 A;  3KAI A;  1KFW A;  1GPF A;  1FKI A;  4J4N A;  1W9V A;  2FAP A;  1KT1 A;  5DIV A;  3KZ7 A;  1GOI A;  3CGM A;  4DRN A;  1WAW A;  1HKJ A;  1TCO C;  1B6C A;  2PV1 A;  2DSW A;  5HWB A;  3BXW A;  1M5Y A;  2RUQ A;  3B7X A;  4IT6 A;  4Z2J A;  1JNS A;  1N1A A;  4DWS B;  3WL0 A;  3IHZ A;  4DRJ A;  2IUZ A;  1NWU A;  4C02 B;  1XRV A;  1O6I A;  1A7X A;  3KAB A;  3G6M A;  4ODP A;  2ZQT A;  2ZQV A;  4BF8 A;  3H9R B;  1EHN A;  1W26 A;  4XAK A;  1WNO A;  3JXV A;  4S3J A;  4ZPT R;  3ARU A;  3CH9 A;  3B9E A;  4MNK A;  1P5Q A;  2DG4 A;  2AOS A;  1HKK A;  2DT2 A;  1ZBV A;  3O5G A;  2ZR5 A;  1E9L A;  2XP6 A;  3EY6 A;  4KQZ A;  3ALF A;  4LAX A;  2MPH A;  2FDM A;  2ZR6 A;  1IX5 A;  4U86 A;  3ARW A;  3MDY B;  3NI6 A;  4S3K A;  2IF4 A;  2XPB A;  4WKF A;  4DH0 A;  3O5M A;  3ARV A;  4GGQ A;  4TW7 A;  1E15 A;  3WL1 A;  4KR0 B;  4DRH A;  1NWT A;  3CHC A;  4NSB A;  1FKL A;  4MNJ A;  1ZL1 A;  3O5O A;  2N87 A;  3O5L A;  4MAV A;  2JZV A;  4ML4 A;  4TW6 A;  2KFW A;  2DG9 A;  4LAV A;  1NMV A;  2F21 A;  2D9F A;  2VN1 A;  1LL7 A;  3ALG A;  2DSZ A;  4WIW A;  1X6N A;  1QPL A;  2F4E A;  4JFM A;  4ODM A;  3G6L A;  4W5U A;  3ARQ A;  3KAF A;  1CTN A;  1JND A;  1FKF A;  4FN2 A;  5HW8 A;  2ZQU A;  1U79 A;  3RM9 A;  4PTM A;  3RFW A;  4LGX A;  1J4I A;  3IK8 A;  3O5P A;  1FKJ A;  2UZ5 A;  2KI3 A;  1UR8 A;  4R5E A;  3B9A A;  1FKK A;  3NRK A;  1K9T A;  5B8I C;  1SR0 A;  4Q7N A;  2RUC A;  3UF8 A;  1ZU8 A;  4TYO A;  1YW5 A;  2RUD A;  3KCE A;  2RQS A;  3UI5 A;  2PPO A;  3FY1 A;  2PPP A;  2KE0 A;  3WQW A;  4ODK A;  2DSU A;  1E6N A;  2XP4 A;  2Q5A A;  1OGB A;  4GIV A;  3KAD A;  4LAY A;  5DF0 A;  2M2A A;  4N19 A;  4DT4 A;  4DIP A;  4Q22 A;  1JNE A;  2KGJ A;  5DIU A;  1J4H A;  1TFV A;  1J4R A;  4JFL A;  1X6L A;  4WK9 A;  4Z2H A;  3ARP A;  1HJV A;  1YAT A;  3KAC A;  3B8S A;  2XPA A;  3KAH A;  4L3N A;  3RME A;  3RGC A;  4ZS6 A;  2LPV A;  2DT3 A;  4TW8 A;  4L72 B;  2M08 A;  1L1P A;  1F40 A;  4R0X A;  2RSE A;  1H0G A;  2MLX A;  3W4R A;  2WLZ A;  3PRA A;  3TCZ A;  1R9H A;  5GPG A;  1C9H A;  1ROU A;  2RUR A;  3WD1 A;  3PRD A;  2OLH A;  5DEZ A;  5I98 A;  4ODR A;  3O5I A;  2AWG A;  4DZ2 A;  1T11 A;  2XP5 A;  4JYS A;  1E6P A;  2DPE A;  2PI6 A;  3IKG A;  1HKI A;  3CZ8 A;  3NTP A;  5J6E A;  3O5E A;  1EDQ A;  1VF8 A;  1D7I A;  4HAR A;  2WLY A;  2KO7 A;  2A3A A;  1FKG A;  3O5K A;  4NNR A;  4MPK A;  4ODN A;  1WB0 A;  1ZBC A;  1E6R A;  4AY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...